data_1RB6
# 
_entry.id   1RB6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RB6         
RCSB  RCSB020634   
WWPDB D_1000020634 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RB1 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TRIGONAL AUTOMATIC 
SOLUTION
;
unspecified 
PDB 1RB4 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TETRAGONAL AUTOMATIC 
SOLUTION
;
unspecified 
PDB 1RB5 
;ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A 
TETRAGONAL FORM
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RB6 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Holton, J.' 1 
'Alber, T.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Automated protein crystal structure determination using ELVES.'                               Proc.Natl.Acad.Sci.USA 101 
1537 1542 2004 PNASA6 US 0027-8424 0040 ? 14752198 10.1073/pnas.0306241101 
1       'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization'                            Nat.Struct.Biol.       3   
510  515  1996 NSBIEW US 1072-8368 2024 ? ?        ?                       
2       'Crystal Structure of an Isoleucine-Zipper Trimer'                                             Nature                 371 
80   83   1994 NATUAS UK 0028-0836 0006 ? ?        10.1038/371080a0        
3       'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science                262 
1401 1407 1993 SCIEAS US 0036-8075 0038 ? ?        ?                       
4       'X-Ray Structure of the GCN4 Leucine Zipper, a two-stranded, parallel coiled coil.'            Science                254 
539  544  1991 SCIEAS US 0036-8075 0038 ? ?        ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Holton, J.'       1  
primary 'Alber, T.'        2  
1       'Gonzalez Jr., L.' 3  
1       'Plecs, J.J.'      4  
1       'Alber, T.'        5  
2       'Harbury, P.B.'    6  
2       'Kim, P.S.'        7  
2       'Alber, T.'        8  
3       'Harbury, P.B.'    9  
3       'Zhang, T.'        10 
3       'Kim, P.S.'        11 
3       'Alber, T.'        12 
4       
;O'Shea, E.K.
;
13 
4       'Klemm, J.D.'      14 
4       'Kim, P.S.'        15 
4       'Alber, T.'        16 
# 
_cell.entry_id           1RB6 
_cell.length_a           64.947 
_cell.length_b           64.947 
_cell.length_c           78.012 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RB6 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'General control protein GCN4' 3988.677 3   ? N16A 'LEUCINE-ZIPPER (RESIDUES 249-281)' ? 
2 non-polymer syn 'CHLORIDE ION'                 35.453   8   ? ?    ?                                   ? 
3 non-polymer syn 'POTASSIUM ION'                39.098   2   ? ?    ?                                   ? 
4 water       nat water                          18.015   146 ? ?    ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Amino acid biosynthesis regulatory protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)RMKQLEDKVEELLSKAYHLENEVARLKKLVGER' 
_entity_poly.pdbx_seq_one_letter_code_can   XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  ARG n 
1 3  MET n 
1 4  LYS n 
1 5  GLN n 
1 6  LEU n 
1 7  GLU n 
1 8  ASP n 
1 9  LYS n 
1 10 VAL n 
1 11 GLU n 
1 12 GLU n 
1 13 LEU n 
1 14 LEU n 
1 15 SER n 
1 16 LYS n 
1 17 ALA n 
1 18 TYR n 
1 19 HIS n 
1 20 LEU n 
1 21 GLU n 
1 22 ASN n 
1 23 GLU n 
1 24 VAL n 
1 25 ALA n 
1 26 ARG n 
1 27 LEU n 
1 28 LYS n 
1 29 LYS n 
1 30 LEU n 
1 31 VAL n 
1 32 GLY n 
1 33 GLU n 
1 34 ARG n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'The sequence of the protein is naturally found in Saccharomyces cerevisiae. The protein was chemically synthesized.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RB6 A 2 ? 34 ? P03069 249 ? 281 ? 1 33 
2 1 1RB6 B 2 ? 34 ? P03069 249 ? 281 ? 1 33 
3 1 1RB6 C 2 ? 34 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RB6 ALA A 17 ? UNP P03069 ASN 264 ENGINEERED 16 1 
2 1RB6 ALA B 17 ? UNP P03069 ASN 264 ENGINEERED 16 2 
3 1RB6 ALA C 17 ? UNP P03069 ASN 264 ENGINEERED 16 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RB6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   75. 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.44 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
'25 mM phosphate 400 mM NaCl 15% PEG8000, pH 7.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1998-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0688 1.0 
2 0.9800 1.0 
3 0.9797 1.0 
4 0.9795 1.0 
5 0.9322 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL1-5' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL1-5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '1.0688, 0.9800, 0.9797, 0.9795, 0.9322' 
# 
_reflns.entry_id                     1RB6 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             45 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   19898 
_reflns.number_all                   20031 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.9 
_reflns_shell.percent_possible_all   97.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RB6 
_refine.ls_number_reflns_obs                     13674 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.223 
_refine.ls_R_factor_all                          0.224 
_refine.ls_R_factor_R_work                       0.223 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  809 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        866 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               1031 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RB6 
_struct.title                     'ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TETRAGONAL FORM' 
_struct.pdbx_descriptor           'General control protein GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RB6 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'COILED COIL, LEUCINE ZIPPER, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 2 ? GLY A 32 ? ARG A 1 GLY A 31 1 ? 31 
HELX_P HELX_P2 2 ARG B 2 ? GLU B 33 ? ARG B 1 GLU B 32 1 ? 32 
HELX_P HELX_P3 3 ARG C 2 ? VAL C 31 ? ARG C 1 VAL C 30 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ACE 1  C   ? ? ? 1_555 A ARG 2 N ? ? A ACE 0   A ARG 1   1_555 ? ? ? ? ? ? ? 1.294 ? 
covale2 covale ? ? B ACE 1  C   ? ? ? 1_555 B ARG 2 N ? ? B ACE 0   B ARG 1   1_555 ? ? ? ? ? ? ? 1.336 ? 
covale3 covale ? ? C ACE 1  C   ? ? ? 1_555 C ARG 2 N ? ? C ACE 0   C ARG 1   1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc1 metalc ? ? C GLU 23 OE1 A ? ? 1_555 M K   . K ? ? C GLU 22  C K   801 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc2 metalc ? ? M K   .  K   ? ? ? 1_555 O HOH . O ? ? C K   801 B HOH 922 1_555 ? ? ? ? ? ? ? 2.810 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE K C 801'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K B 802'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 803' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL B 804' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 805' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 806' 
AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 808' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 809' 
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 810' 
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL B 811' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 HOH O .  ? HOH B 922 . ? 1_555 ? 
2  AC1 2 GLU C 23 ? GLU C 22  . ? 1_555 ? 
3  AC2 5 LYS A 9  ? LYS A 8   . ? 1_555 ? 
4  AC2 5 GLU B 11 ? GLU B 10  . ? 1_555 ? 
5  AC2 5 ASN C 22 ? ASN C 21  . ? 3_554 ? 
6  AC2 5 GLU C 23 ? GLU C 22  . ? 3_554 ? 
7  AC2 5 ARG C 26 ? ARG C 25  . ? 3_554 ? 
8  AC3 4 LYS B 16 ? LYS B 15  . ? 1_555 ? 
9  AC3 4 GLU C 12 ? GLU C 11  . ? 1_555 ? 
10 AC3 4 LYS C 16 ? LYS C 15  . ? 1_555 ? 
11 AC3 4 HOH P .  ? HOH C 904 . ? 1_555 ? 
12 AC4 3 LYS A 16 ? LYS A 15  . ? 1_555 ? 
13 AC4 3 GLU B 21 ? GLU B 20  . ? 1_555 ? 
14 AC4 3 HOH O .  ? HOH B 934 . ? 1_555 ? 
15 AC5 4 LYS B 9  ? LYS B 8   . ? 1_555 ? 
16 AC5 4 LYS C 16 ? LYS C 15  . ? 1_555 ? 
17 AC5 4 HOH P .  ? HOH C 908 . ? 1_555 ? 
18 AC5 4 HOH P .  ? HOH C 925 . ? 1_555 ? 
19 AC6 2 ARG A 26 ? ARG A 25  . ? 1_555 ? 
20 AC6 2 LYS B 28 ? LYS B 27  . ? 1_555 ? 
21 AC7 2 GLU A 33 ? GLU A 32  . ? 8_565 ? 
22 AC7 2 ARG A 34 ? ARG A 33  . ? 8_565 ? 
23 AC8 4 HIS B 19 ? HIS B 18  . ? 1_555 ? 
24 AC8 4 ASN B 22 ? ASN B 21  . ? 1_555 ? 
25 AC8 4 ARG B 26 ? ARG B 25  . ? 1_555 ? 
26 AC8 4 HOH O .  ? HOH B 907 . ? 1_555 ? 
27 AC9 2 GLU A 11 ? GLU A 10  . ? 1_555 ? 
28 AC9 2 ASN B 22 ? ASN B 21  . ? 4_455 ? 
29 BC1 2 HOH O .  ? HOH B 917 . ? 1_555 ? 
30 BC1 2 HOH P .  ? HOH C 904 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RB6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RB6 
_atom_sites.fract_transf_matrix[1][1]   0.015397 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015397 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012819 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
K  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    C  C   . ACE A 1 1  ? -16.857 33.740 11.917 1.00 31.37  ? 0   ACE A C   1 
HETATM 2    O  O   . ACE A 1 1  ? -16.668 32.605 12.324 1.00 33.50  ? 0   ACE A O   1 
HETATM 3    C  CH3 . ACE A 1 1  ? -18.243 34.292 11.690 1.00 32.98  ? 0   ACE A CH3 1 
ATOM   4    N  N   . ARG A 1 2  ? -16.294 34.823 11.488 1.00 31.53  ? 1   ARG A N   1 
ATOM   5    C  CA  . ARG A 1 2  ? -15.079 35.434 11.589 1.00 31.80  ? 1   ARG A CA  1 
ATOM   6    C  C   . ARG A 1 2  ? -14.492 35.249 13.027 1.00 29.07  ? 1   ARG A C   1 
ATOM   7    O  O   . ARG A 1 2  ? -13.439 34.589 13.126 1.00 27.56  ? 1   ARG A O   1 
ATOM   8    C  CB  . ARG A 1 2  ? -15.022 36.879 11.164 1.00 33.00  ? 1   ARG A CB  1 
ATOM   9    C  CG  . ARG A 1 2  ? -13.756 37.108 10.368 1.00 33.30  ? 1   ARG A CG  1 
ATOM   10   C  CD  . ARG A 1 2  ? -13.784 38.450 9.648  1.00 33.65  ? 1   ARG A CD  1 
ATOM   11   N  NE  . ARG A 1 2  ? -12.407 38.932 9.600  1.00 34.16  ? 1   ARG A NE  1 
ATOM   12   C  CZ  . ARG A 1 2  ? -12.018 40.194 9.661  1.00 34.14  ? 1   ARG A CZ  1 
ATOM   13   N  NH1 . ARG A 1 2  ? -10.719 40.449 9.579  1.00 32.55  ? 1   ARG A NH1 1 
ATOM   14   N  NH2 . ARG A 1 2  ? -12.922 41.171 9.810  1.00 33.99  ? 1   ARG A NH2 1 
ATOM   15   N  N   . MET A 1 3  ? -15.150 35.716 14.065 1.00 26.12  ? 2   MET A N   1 
ATOM   16   C  CA  . MET A 1 3  ? -14.649 35.512 15.406 1.00 26.92  ? 2   MET A CA  1 
ATOM   17   C  C   . MET A 1 3  ? -14.623 34.035 15.758 1.00 23.53  ? 2   MET A C   1 
ATOM   18   O  O   . MET A 1 3  ? -13.647 33.551 16.335 1.00 23.52  ? 2   MET A O   1 
ATOM   19   C  CB  . MET A 1 3  ? -15.396 36.316 16.492 1.00 26.80  ? 2   MET A CB  1 
ATOM   20   C  CG  A MET A 1 3  ? -14.906 37.711 16.756 0.50 27.69  ? 2   MET A CG  1 
ATOM   21   C  CG  B MET A 1 3  ? -14.843 36.118 17.888 0.50 26.16  ? 2   MET A CG  1 
ATOM   22   S  SD  A MET A 1 3  ? -13.197 37.750 17.291 0.30 29.53  ? 2   MET A SD  1 
ATOM   23   S  SD  B MET A 1 3  ? -13.099 36.327 18.289 0.30 27.15  ? 2   MET A SD  1 
ATOM   24   C  CE  A MET A 1 3  ? -13.291 37.726 19.063 0.50 29.41  ? 2   MET A CE  1 
ATOM   25   C  CE  B MET A 1 3  ? -13.015 38.105 18.494 0.50 25.72  ? 2   MET A CE  1 
ATOM   26   N  N   . LYS A 1 4  ? -15.660 33.251 15.451 1.00 24.58  ? 3   LYS A N   1 
ATOM   27   C  CA  . LYS A 1 4  ? -15.686 31.854 15.824 1.00 23.72  ? 3   LYS A CA  1 
ATOM   28   C  C   . LYS A 1 4  ? -14.605 31.086 15.039 1.00 23.88  ? 3   LYS A C   1 
ATOM   29   O  O   . LYS A 1 4  ? -13.958 30.236 15.640 1.00 21.85  ? 3   LYS A O   1 
ATOM   30   C  CB  . LYS A 1 4  ? -17.050 31.199 15.631 1.00 26.34  ? 3   LYS A CB  1 
ATOM   31   C  CG  . LYS A 1 4  ? -17.149 29.730 16.011 1.00 28.78  ? 3   LYS A CG  1 
ATOM   32   C  CD  A LYS A 1 4  ? -16.665 29.430 17.427 0.50 28.37  ? 3   LYS A CD  1 
ATOM   33   C  CE  A LYS A 1 4  ? -17.178 28.117 17.983 0.50 29.37  ? 3   LYS A CE  1 
ATOM   34   N  NZ  A LYS A 1 4  ? -16.905 26.957 17.081 0.50 28.52  ? 3   LYS A NZ  1 
ATOM   35   N  N   . GLN A 1 5  ? -14.380 31.423 13.787 1.00 23.52  ? 4   GLN A N   1 
ATOM   36   C  CA  . GLN A 1 5  ? -13.326 30.754 13.006 1.00 22.46  ? 4   GLN A CA  1 
ATOM   37   C  C   . GLN A 1 5  ? -11.942 31.135 13.571 1.00 22.15  ? 4   GLN A C   1 
ATOM   38   O  O   . GLN A 1 5  ? -11.107 30.234 13.675 1.00 23.77  ? 4   GLN A O   1 
ATOM   39   C  CB  . GLN A 1 5  ? -13.466 31.133 11.558 1.00 23.22  ? 4   GLN A CB  1 
ATOM   40   C  CG  . GLN A 1 5  ? -14.745 30.424 11.021 1.00 26.37  ? 4   GLN A CG  1 
ATOM   41   C  CD  A GLN A 1 5  ? -14.963 30.749 9.558  0.01 25.80  ? 4   GLN A CD  1 
ATOM   42   O  OE1 A GLN A 1 5  ? -14.739 31.877 9.118  0.01 25.98  ? 4   GLN A OE1 1 
ATOM   43   N  NE2 A GLN A 1 5  ? -15.404 29.758 8.790  0.01 26.00  ? 4   GLN A NE2 1 
ATOM   44   N  N   . LEU A 1 6  ? -11.775 32.344 14.043 1.00 20.67  ? 5   LEU A N   1 
ATOM   45   C  CA  . LEU A 1 6  ? -10.521 32.725 14.705 1.00 20.92  ? 5   LEU A CA  1 
ATOM   46   C  C   . LEU A 1 6  ? -10.308 31.924 15.974 1.00 20.40  ? 5   LEU A C   1 
ATOM   47   O  O   . LEU A 1 6  ? -9.213  31.352 16.206 1.00 18.82  ? 5   LEU A O   1 
ATOM   48   C  CB  . LEU A 1 6  ? -10.395 34.211 14.905 1.00 21.42  ? 5   LEU A CB  1 
ATOM   49   C  CG  . LEU A 1 6  ? -9.223  34.740 15.706 1.00 22.84  ? 5   LEU A CG  1 
ATOM   50   C  CD1 . LEU A 1 6  ? -7.850  34.359 15.117 1.00 21.13  ? 5   LEU A CD1 1 
ATOM   51   C  CD2 . LEU A 1 6  ? -9.302  36.245 15.861 1.00 21.09  ? 5   LEU A CD2 1 
ATOM   52   N  N   A GLU A 1 7  ? -11.314 31.838 16.829 0.50 19.23  ? 6   GLU A N   1 
ATOM   53   N  N   B GLU A 1 7  ? -11.307 31.832 16.837 0.50 19.48  ? 6   GLU A N   1 
ATOM   54   C  CA  A GLU A 1 7  ? -11.242 31.040 18.034 0.50 20.23  ? 6   GLU A CA  1 
ATOM   55   C  CA  B GLU A 1 7  ? -11.219 31.046 18.050 0.50 20.69  ? 6   GLU A CA  1 
ATOM   56   C  C   A GLU A 1 7  ? -10.928 29.583 17.738 0.50 19.57  ? 6   GLU A C   1 
ATOM   57   C  C   B GLU A 1 7  ? -10.978 29.570 17.775 0.50 19.83  ? 6   GLU A C   1 
ATOM   58   O  O   A GLU A 1 7  ? -10.066 29.010 18.404 0.50 19.06  ? 6   GLU A O   1 
ATOM   59   O  O   B GLU A 1 7  ? -10.162 28.968 18.476 0.50 19.35  ? 6   GLU A O   1 
ATOM   60   C  CB  A GLU A 1 7  ? -12.544 31.080 18.856 0.50 20.41  ? 6   GLU A CB  1 
ATOM   61   C  CB  B GLU A 1 7  ? -12.477 31.165 18.933 0.50 21.24  ? 6   GLU A CB  1 
ATOM   62   C  CG  A GLU A 1 7  ? -12.756 32.442 19.483 0.50 19.79  ? 6   GLU A CG  1 
ATOM   63   C  CG  B GLU A 1 7  ? -12.864 32.606 19.186 0.50 21.47  ? 6   GLU A CG  1 
ATOM   64   C  CD  A GLU A 1 7  ? -14.169 32.606 20.048 0.50 22.00  ? 6   GLU A CD  1 
ATOM   65   C  CD  B GLU A 1 7  ? -14.307 32.764 19.667 0.50 23.54  ? 6   GLU A CD  1 
ATOM   66   O  OE1 A GLU A 1 7  ? -15.110 32.809 19.252 0.50 18.79  ? 6   GLU A OE1 1 
ATOM   67   O  OE1 B GLU A 1 7  ? -14.581 33.859 20.198 0.50 23.84  ? 6   GLU A OE1 1 
ATOM   68   O  OE2 A GLU A 1 7  ? -14.292 32.538 21.285 0.50 22.81  ? 6   GLU A OE2 1 
ATOM   69   O  OE2 B GLU A 1 7  ? -15.138 31.845 19.542 0.50 22.26  ? 6   GLU A OE2 1 
ATOM   70   N  N   . ASP A 1 8  ? -11.583 28.979 16.759 1.00 19.56  ? 7   ASP A N   1 
ATOM   71   C  CA  . ASP A 1 8  ? -11.334 27.600 16.406 1.00 19.90  ? 7   ASP A CA  1 
ATOM   72   C  C   . ASP A 1 8  ? -9.851  27.383 16.048 1.00 18.89  ? 7   ASP A C   1 
ATOM   73   O  O   . ASP A 1 8  ? -9.299  26.391 16.492 1.00 19.94  ? 7   ASP A O   1 
ATOM   74   C  CB  . ASP A 1 8  ? -12.157 27.069 15.233 1.00 20.81  ? 7   ASP A CB  1 
ATOM   75   C  CG  . ASP A 1 8  ? -13.635 26.919 15.571 1.00 25.09  ? 7   ASP A CG  1 
ATOM   76   O  OD1 . ASP A 1 8  ? -14.068 27.017 16.727 1.00 24.95  ? 7   ASP A OD1 1 
ATOM   77   O  OD2 . ASP A 1 8  ? -14.423 26.683 14.627 1.00 26.89  ? 7   ASP A OD2 1 
ATOM   78   N  N   . LYS A 1 9  ? -9.280  28.281 15.236 1.00 18.48  ? 8   LYS A N   1 
ATOM   79   C  CA  . LYS A 1 9  ? -7.878  28.184 14.904 1.00 17.78  ? 8   LYS A CA  1 
ATOM   80   C  C   . LYS A 1 9  ? -6.963  28.347 16.114 1.00 17.25  ? 8   LYS A C   1 
ATOM   81   O  O   . LYS A 1 9  ? -5.923  27.677 16.122 1.00 16.76  ? 8   LYS A O   1 
ATOM   82   C  CB  . LYS A 1 9  ? -7.520  29.232 13.828 1.00 17.59  ? 8   LYS A CB  1 
ATOM   83   C  CG  . LYS A 1 9  ? -8.189  28.754 12.503 1.00 18.52  ? 8   LYS A CG  1 
ATOM   84   C  CD  . LYS A 1 9  ? -7.774  29.745 11.420 1.00 23.07  ? 8   LYS A CD  1 
ATOM   85   C  CE  A LYS A 1 9  ? -8.635  29.486 10.171 0.50 21.78  ? 8   LYS A CE  1 
ATOM   86   C  CE  B LYS A 1 9  ? -8.420  29.380 10.081 0.50 23.31  ? 8   LYS A CE  1 
ATOM   87   N  NZ  A LYS A 1 9  ? -10.052 29.834 10.448 0.50 21.15  ? 8   LYS A NZ  1 
ATOM   88   N  NZ  B LYS A 1 9  ? -9.637  30.195 9.854  0.50 24.15  ? 8   LYS A NZ  1 
ATOM   89   N  N   . VAL A 1 10 ? -7.301  29.252 17.017 1.00 15.32  ? 9   VAL A N   1 
ATOM   90   C  CA  . VAL A 1 10 ? -6.464  29.390 18.210 1.00 16.16  ? 9   VAL A CA  1 
ATOM   91   C  C   . VAL A 1 10 ? -6.470  28.149 19.060 1.00 17.80  ? 9   VAL A C   1 
ATOM   92   O  O   . VAL A 1 10 ? -5.408  27.739 19.537 1.00 16.36  ? 9   VAL A O   1 
ATOM   93   C  CB  . VAL A 1 10 ? -6.904  30.593 19.087 1.00 18.64  ? 9   VAL A CB  1 
ATOM   94   C  CG1 . VAL A 1 10 ? -6.021  30.635 20.343 1.00 19.34  ? 9   VAL A CG1 1 
ATOM   95   C  CG2 . VAL A 1 10 ? -6.813  31.825 18.257 1.00 19.18  ? 9   VAL A CG2 1 
ATOM   96   N  N   . GLU A 1 11 ? -7.615  27.517 19.221 1.00 17.69  ? 10  GLU A N   1 
ATOM   97   C  CA  . GLU A 1 11 ? -7.708  26.279 19.980 1.00 18.38  ? 10  GLU A CA  1 
ATOM   98   C  C   . GLU A 1 11 ? -7.023  25.141 19.249 1.00 17.87  ? 10  GLU A C   1 
ATOM   99   O  O   . GLU A 1 11 ? -6.393  24.290 19.912 1.00 17.74  ? 10  GLU A O   1 
ATOM   100  C  CB  . GLU A 1 11 ? -9.187  26.039 20.330 1.00 21.66  ? 10  GLU A CB  1 
ATOM   101  C  CG  . GLU A 1 11 ? -9.773  27.266 21.035 1.00 25.94  ? 10  GLU A CG  1 
ATOM   102  C  CD  . GLU A 1 11 ? -9.095  27.489 22.393 1.00 27.36  ? 10  GLU A CD  1 
ATOM   103  O  OE1 . GLU A 1 11 ? -8.893  26.462 23.045 1.00 28.63  ? 10  GLU A OE1 1 
ATOM   104  O  OE2 . GLU A 1 11 ? -8.714  28.632 22.723 1.00 29.47  ? 10  GLU A OE2 1 
ATOM   105  N  N   . GLU A 1 12 ? -7.011  25.093 17.932 1.00 17.69  ? 11  GLU A N   1 
ATOM   106  C  CA  . GLU A 1 12 ? -6.266  24.122 17.143 1.00 17.64  ? 11  GLU A CA  1 
ATOM   107  C  C   . GLU A 1 12 ? -4.772  24.279 17.434 1.00 16.77  ? 11  GLU A C   1 
ATOM   108  O  O   . GLU A 1 12 ? -3.998  23.353 17.710 1.00 16.20  ? 11  GLU A O   1 
ATOM   109  C  CB  . GLU A 1 12 ? -6.650  24.237 15.646 1.00 16.88  ? 11  GLU A CB  1 
ATOM   110  C  CG  . GLU A 1 12 ? -5.671  23.509 14.718 1.00 19.81  ? 11  GLU A CG  1 
ATOM   111  C  CD  . GLU A 1 12 ? -5.784  23.874 13.255 1.00 21.32  ? 11  GLU A CD  1 
ATOM   112  O  OE1 . GLU A 1 12 ? -6.611  24.730 12.870 1.00 23.31  ? 11  GLU A OE1 1 
ATOM   113  O  OE2 . GLU A 1 12 ? -4.974  23.308 12.457 1.00 24.81  ? 11  GLU A OE2 1 
ATOM   114  N  N   . LEU A 1 13 ? -4.295  25.497 17.389 1.00 16.42  ? 12  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 13 ? -2.929  25.913 17.605 1.00 14.91  ? 12  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 13 ? -2.451  25.489 18.976 1.00 16.27  ? 12  LEU A C   1 
ATOM   117  O  O   . LEU A 1 13 ? -1.391  24.857 19.143 1.00 14.43  ? 12  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 13 ? -2.771  27.410 17.343 1.00 14.86  ? 12  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 13 ? -1.383  27.956 17.796 1.00 14.64  ? 12  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 13 ? -0.238  27.364 16.966 1.00 14.05  ? 12  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 13 ? -1.377  29.458 17.794 1.00 13.61  ? 12  LEU A CD2 1 
ATOM   122  N  N   . LEU A 1 14 ? -3.244  25.808 19.998 1.00 16.96  ? 13  LEU A N   1 
ATOM   123  C  CA  . LEU A 1 14 ? -2.877  25.448 21.355 1.00 15.29  ? 13  LEU A CA  1 
ATOM   124  C  C   . LEU A 1 14 ? -2.792  23.966 21.561 1.00 17.54  ? 13  LEU A C   1 
ATOM   125  O  O   . LEU A 1 14 ? -1.814  23.493 22.143 1.00 16.35  ? 13  LEU A O   1 
ATOM   126  C  CB  . LEU A 1 14 ? -3.907  26.164 22.268 1.00 18.72  ? 13  LEU A CB  1 
ATOM   127  C  CG  . LEU A 1 14 ? -3.577  25.982 23.738 1.00 21.19  ? 13  LEU A CG  1 
ATOM   128  C  CD1 . LEU A 1 14 ? -2.283  26.820 24.019 1.00 19.43  ? 13  LEU A CD1 1 
ATOM   129  C  CD2 . LEU A 1 14 ? -4.702  26.474 24.639 1.00 24.65  ? 13  LEU A CD2 1 
ATOM   130  N  N   . SER A 1 15 ? -3.677  23.149 20.979 1.00 15.96  ? 14  SER A N   1 
ATOM   131  C  CA  . SER A 1 15 ? -3.646  21.711 21.061 1.00 18.26  ? 14  SER A CA  1 
ATOM   132  C  C   . SER A 1 15 ? -2.373  21.203 20.360 1.00 18.71  ? 14  SER A C   1 
ATOM   133  O  O   . SER A 1 15 ? -1.747  20.315 20.930 1.00 17.47  ? 14  SER A O   1 
ATOM   134  C  CB  . SER A 1 15 ? -4.875  21.077 20.419 1.00 17.62  ? 14  SER A CB  1 
ATOM   135  O  OG  A SER A 1 15 ? -4.825  19.665 20.388 0.50 20.89  ? 14  SER A OG  1 
ATOM   136  O  OG  B SER A 1 15 ? -6.027  21.408 21.164 0.50 18.67  ? 14  SER A OG  1 
ATOM   137  N  N   . LYS A 1 16 ? -2.045  21.772 19.215 1.00 18.03  ? 15  LYS A N   1 
ATOM   138  C  CA  . LYS A 1 16 ? -0.799  21.361 18.555 1.00 18.12  ? 15  LYS A CA  1 
ATOM   139  C  C   . LYS A 1 16 ? 0.446   21.707 19.351 1.00 18.81  ? 15  LYS A C   1 
ATOM   140  O  O   . LYS A 1 16 ? 1.400   20.948 19.411 1.00 17.77  ? 15  LYS A O   1 
ATOM   141  C  CB  . LYS A 1 16 ? -0.700  22.034 17.177 1.00 14.49  ? 15  LYS A CB  1 
ATOM   142  C  CG  . LYS A 1 16 ? -1.727  21.368 16.256 1.00 16.12  ? 15  LYS A CG  1 
ATOM   143  C  CD  . LYS A 1 16 ? -1.663  22.147 14.936 1.00 19.40  ? 15  LYS A CD  1 
ATOM   144  C  CE  A LYS A 1 16 ? -2.725  21.614 13.986 0.50 17.42  ? 15  LYS A CE  1 
ATOM   145  C  CE  B LYS A 1 16 ? -1.750  21.211 13.750 0.50 17.01  ? 15  LYS A CE  1 
ATOM   146  N  NZ  A LYS A 1 16 ? -2.346  21.674 12.559 0.50 18.61  ? 15  LYS A NZ  1 
ATOM   147  N  NZ  B LYS A 1 16 ? -3.052  20.513 13.741 0.50 18.76  ? 15  LYS A NZ  1 
ATOM   148  N  N   . ALA A 1 17 ? 0.475   22.889 19.949 1.00 16.55  ? 16  ALA A N   1 
ATOM   149  C  CA  . ALA A 1 17 ? 1.642   23.293 20.734 1.00 16.83  ? 16  ALA A CA  1 
ATOM   150  C  C   . ALA A 1 17 ? 1.812   22.361 21.970 1.00 17.97  ? 16  ALA A C   1 
ATOM   151  O  O   . ALA A 1 17 ? 2.968   22.028 22.309 1.00 17.72  ? 16  ALA A O   1 
ATOM   152  C  CB  . ALA A 1 17 ? 1.458   24.718 21.138 1.00 13.95  ? 16  ALA A CB  1 
ATOM   153  N  N   . TYR A 1 18 ? 0.718   21.964 22.593 1.00 17.06  ? 17  TYR A N   1 
ATOM   154  C  CA  . TYR A 1 18 ? 0.822   21.063 23.746 1.00 18.89  ? 17  TYR A CA  1 
ATOM   155  C  C   . TYR A 1 18 ? 1.273   19.668 23.307 1.00 19.71  ? 17  TYR A C   1 
ATOM   156  O  O   . TYR A 1 18 ? 2.135   19.133 24.004 1.00 20.69  ? 17  TYR A O   1 
ATOM   157  C  CB  . TYR A 1 18 ? -0.449  20.941 24.553 1.00 18.45  ? 17  TYR A CB  1 
ATOM   158  C  CG  . TYR A 1 18 ? -0.771  21.989 25.585 1.00 17.85  ? 17  TYR A CG  1 
ATOM   159  C  CD1 . TYR A 1 18 ? -1.970  22.719 25.516 1.00 18.90  ? 17  TYR A CD1 1 
ATOM   160  C  CD2 . TYR A 1 18 ? 0.108   22.207 26.639 1.00 16.95  ? 17  TYR A CD2 1 
ATOM   161  C  CE1 . TYR A 1 18 ? -2.274  23.667 26.488 1.00 18.73  ? 17  TYR A CE1 1 
ATOM   162  C  CE2 . TYR A 1 18 ? -0.203  23.112 27.644 1.00 18.69  ? 17  TYR A CE2 1 
ATOM   163  C  CZ  . TYR A 1 18 ? -1.384  23.839 27.550 1.00 18.01  ? 17  TYR A CZ  1 
ATOM   164  O  OH  . TYR A 1 18 ? -1.701  24.755 28.502 1.00 20.22  ? 17  TYR A OH  1 
ATOM   165  N  N   . HIS A 1 19 ? 0.798   19.196 22.171 1.00 19.17  ? 18  HIS A N   1 
ATOM   166  C  CA  . HIS A 1 19 ? 1.208   17.913 21.623 1.00 22.16  ? 18  HIS A CA  1 
ATOM   167  C  C   . HIS A 1 19 ? 2.692   17.974 21.268 1.00 21.25  ? 18  HIS A C   1 
ATOM   168  O  O   . HIS A 1 19 ? 3.423   17.020 21.614 1.00 21.94  ? 18  HIS A O   1 
ATOM   169  C  CB  . HIS A 1 19 ? 0.333   17.530 20.432 1.00 23.71  ? 18  HIS A CB  1 
ATOM   170  C  CG  . HIS A 1 19 ? 0.754   16.286 19.709 1.00 28.11  ? 18  HIS A CG  1 
ATOM   171  N  ND1 . HIS A 1 19 ? 0.777   15.051 20.332 1.00 31.73  ? 18  HIS A ND1 1 
ATOM   172  C  CD2 . HIS A 1 19 ? 1.151   16.058 18.443 1.00 30.10  ? 18  HIS A CD2 1 
ATOM   173  C  CE1 . HIS A 1 19 ? 1.153   14.134 19.473 1.00 32.27  ? 18  HIS A CE1 1 
ATOM   174  N  NE2 . HIS A 1 19 ? 1.387   14.707 18.318 1.00 31.25  ? 18  HIS A NE2 1 
ATOM   175  N  N   . LEU A 1 20 ? 3.160   19.066 20.673 1.00 19.07  ? 19  LEU A N   1 
ATOM   176  C  CA  . LEU A 1 20 ? 4.566   19.271 20.411 1.00 19.00  ? 19  LEU A CA  1 
ATOM   177  C  C   . LEU A 1 20 ? 5.412   19.253 21.686 1.00 20.59  ? 19  LEU A C   1 
ATOM   178  O  O   . LEU A 1 20 ? 6.473   18.610 21.778 1.00 20.40  ? 19  LEU A O   1 
ATOM   179  C  CB  . LEU A 1 20 ? 4.863   20.555 19.629 1.00 18.59  ? 19  LEU A CB  1 
ATOM   180  C  CG  . LEU A 1 20 ? 4.560   20.520 18.121 1.00 19.37  ? 19  LEU A CG  1 
ATOM   181  C  CD1 . LEU A 1 20 ? 4.468   21.916 17.539 1.00 17.19  ? 19  LEU A CD1 1 
ATOM   182  C  CD2 . LEU A 1 20 ? 5.683   19.745 17.390 1.00 18.13  ? 19  LEU A CD2 1 
ATOM   183  N  N   . GLU A 1 21 ? 4.948   19.944 22.712 1.00 20.71  ? 20  GLU A N   1 
ATOM   184  C  CA  . GLU A 1 21 ? 5.652   19.969 23.989 1.00 22.24  ? 20  GLU A CA  1 
ATOM   185  C  C   . GLU A 1 21 ? 5.754   18.549 24.531 1.00 23.42  ? 20  GLU A C   1 
ATOM   186  O  O   . GLU A 1 21 ? 6.872   18.171 24.934 1.00 24.40  ? 20  GLU A O   1 
ATOM   187  C  CB  . GLU A 1 21 ? 5.051   20.976 24.934 1.00 23.34  ? 20  GLU A CB  1 
ATOM   188  C  CG  . GLU A 1 21 ? 5.720   21.097 26.293 1.00 31.24  ? 20  GLU A CG  1 
ATOM   189  C  CD  . GLU A 1 21 ? 4.981   22.082 27.181 1.00 34.73  ? 20  GLU A CD  1 
ATOM   190  O  OE1 . GLU A 1 21 ? 3.829   21.831 27.630 1.00 38.01  ? 20  GLU A OE1 1 
ATOM   191  O  OE2 . GLU A 1 21 ? 5.579   23.155 27.388 1.00 39.11  ? 20  GLU A OE2 1 
ATOM   192  N  N   . ASN A 1 22 ? 4.733   17.733 24.497 1.00 22.68  ? 21  ASN A N   1 
ATOM   193  C  CA  . ASN A 1 22 ? 4.780   16.374 24.948 1.00 25.65  ? 21  ASN A CA  1 
ATOM   194  C  C   . ASN A 1 22 ? 5.738   15.529 24.092 1.00 26.58  ? 21  ASN A C   1 
ATOM   195  O  O   . ASN A 1 22 ? 6.435   14.671 24.610 1.00 24.77  ? 21  ASN A O   1 
ATOM   196  C  CB  . ASN A 1 22 ? 3.392   15.749 24.919 1.00 29.60  ? 21  ASN A CB  1 
ATOM   197  C  CG  . ASN A 1 22 ? 2.521   16.306 26.035 1.00 34.52  ? 21  ASN A CG  1 
ATOM   198  O  OD1 . ASN A 1 22 ? 2.981   16.891 27.020 1.00 37.93  ? 21  ASN A OD1 1 
ATOM   199  N  ND2 . ASN A 1 22 ? 1.214   16.174 25.924 1.00 37.55  ? 21  ASN A ND2 1 
ATOM   200  N  N   . GLU A 1 23 ? 5.685   15.690 22.772 1.00 23.07  ? 22  GLU A N   1 
ATOM   201  C  CA  . GLU A 1 23 ? 6.533   14.950 21.880 1.00 24.22  ? 22  GLU A CA  1 
ATOM   202  C  C   . GLU A 1 23 ? 8.011   15.277 22.109 1.00 22.96  ? 22  GLU A C   1 
ATOM   203  O  O   . GLU A 1 23 ? 8.845   14.368 22.185 1.00 25.05  ? 22  GLU A O   1 
ATOM   204  C  CB  . GLU A 1 23 ? 6.158   15.246 20.432 1.00 25.15  ? 22  GLU A CB  1 
ATOM   205  C  CG  . GLU A 1 23 ? 4.844   14.716 19.946 1.00 26.02  ? 22  GLU A CG  1 
ATOM   206  C  CD  . GLU A 1 23 ? 4.658   15.064 18.479 1.00 29.08  ? 22  GLU A CD  1 
ATOM   207  O  OE1 . GLU A 1 23 ? 4.469   14.124 17.681 1.00 31.19  ? 22  GLU A OE1 1 
ATOM   208  O  OE2 . GLU A 1 23 ? 4.684   16.250 18.084 1.00 27.97  ? 22  GLU A OE2 1 
ATOM   209  N  N   . VAL A 1 24 ? 8.381   16.510 22.312 1.00 21.20  ? 23  VAL A N   1 
ATOM   210  C  CA  . VAL A 1 24 ? 9.714   16.967 22.574 1.00 23.35  ? 23  VAL A CA  1 
ATOM   211  C  C   . VAL A 1 24 ? 10.189  16.378 23.912 1.00 24.89  ? 23  VAL A C   1 
ATOM   212  O  O   . VAL A 1 24 ? 11.332  15.914 23.956 1.00 25.23  ? 23  VAL A O   1 
ATOM   213  C  CB  . VAL A 1 24 ? 9.860   18.489 22.595 1.00 23.04  ? 23  VAL A CB  1 
ATOM   214  C  CG1 . VAL A 1 24 ? 11.188  18.964 23.143 1.00 26.74  ? 23  VAL A CG1 1 
ATOM   215  C  CG2 . VAL A 1 24 ? 9.668   18.973 21.154 1.00 24.19  ? 23  VAL A CG2 1 
ATOM   216  N  N   . ALA A 1 25 ? 9.329   16.304 24.910 1.00 23.02  ? 24  ALA A N   1 
ATOM   217  C  CA  . ALA A 1 25 ? 9.755   15.720 26.187 1.00 25.01  ? 24  ALA A CA  1 
ATOM   218  C  C   . ALA A 1 25 ? 10.072  14.245 26.015 1.00 22.85  ? 24  ALA A C   1 
ATOM   219  O  O   . ALA A 1 25 ? 11.066  13.775 26.544 1.00 26.14  ? 24  ALA A O   1 
ATOM   220  C  CB  . ALA A 1 25 ? 8.681   15.965 27.249 1.00 24.80  ? 24  ALA A CB  1 
ATOM   221  N  N   . ARG A 1 26 ? 9.308   13.481 25.269 1.00 24.65  ? 25  ARG A N   1 
ATOM   222  C  CA  . ARG A 1 26 ? 9.527   12.100 24.970 1.00 25.65  ? 25  ARG A CA  1 
ATOM   223  C  C   . ARG A 1 26 ? 10.858  11.901 24.232 1.00 25.39  ? 25  ARG A C   1 
ATOM   224  O  O   . ARG A 1 26 ? 11.631  10.998 24.583 1.00 24.50  ? 25  ARG A O   1 
ATOM   225  C  CB  . ARG A 1 26 ? 8.375   11.463 24.178 1.00 27.98  ? 25  ARG A CB  1 
ATOM   226  C  CG  . ARG A 1 26 ? 7.101   11.436 25.041 1.00 34.07  ? 25  ARG A CG  1 
ATOM   227  C  CD  . ARG A 1 26 ? 5.991   10.576 24.495 1.00 39.00  ? 25  ARG A CD  1 
ATOM   228  N  NE  . ARG A 1 26 ? 5.133   11.102 23.460 1.00 42.79  ? 25  ARG A NE  1 
ATOM   229  C  CZ  . ARG A 1 26 ? 4.171   12.017 23.479 1.00 44.22  ? 25  ARG A CZ  1 
ATOM   230  N  NH1 . ARG A 1 26 ? 3.817   12.681 24.589 1.00 47.67  ? 25  ARG A NH1 1 
ATOM   231  N  NH2 . ARG A 1 26 ? 3.501   12.330 22.382 1.00 43.26  ? 25  ARG A NH2 1 
ATOM   232  N  N   A LEU A 1 27 ? 11.115  12.727 23.238 0.50 23.86  ? 26  LEU A N   1 
ATOM   233  N  N   B LEU A 1 27 ? 11.097  12.716 23.202 0.50 23.59  ? 26  LEU A N   1 
ATOM   234  C  CA  A LEU A 1 27 ? 12.303  12.647 22.411 0.50 23.59  ? 26  LEU A CA  1 
ATOM   235  C  CA  B LEU A 1 27 ? 12.299  12.620 22.405 0.50 23.14  ? 26  LEU A CA  1 
ATOM   236  C  C   A LEU A 1 27 ? 13.556  12.991 23.208 0.50 24.86  ? 26  LEU A C   1 
ATOM   237  C  C   B LEU A 1 27 ? 13.514  12.923 23.285 0.50 24.57  ? 26  LEU A C   1 
ATOM   238  O  O   A LEU A 1 27 ? 14.634  12.402 23.016 0.50 24.28  ? 26  LEU A O   1 
ATOM   239  O  O   B LEU A 1 27 ? 14.385  12.051 23.382 0.50 24.59  ? 26  LEU A O   1 
ATOM   240  C  CB  A LEU A 1 27 ? 12.114  13.594 21.228 0.50 23.67  ? 26  LEU A CB  1 
ATOM   241  C  CB  B LEU A 1 27 ? 12.372  13.550 21.186 0.50 22.36  ? 26  LEU A CB  1 
ATOM   242  C  CG  A LEU A 1 27 ? 13.221  13.830 20.232 0.50 22.93  ? 26  LEU A CG  1 
ATOM   243  C  CG  B LEU A 1 27 ? 11.683  13.088 19.911 0.50 22.50  ? 26  LEU A CG  1 
ATOM   244  C  CD1 A LEU A 1 27 ? 13.658  12.526 19.575 0.50 25.15  ? 26  LEU A CD1 1 
ATOM   245  C  CD1 B LEU A 1 27 ? 11.475  14.245 18.939 0.50 21.72  ? 26  LEU A CD1 1 
ATOM   246  C  CD2 A LEU A 1 27 ? 12.772  14.811 19.147 0.50 23.59  ? 26  LEU A CD2 1 
ATOM   247  C  CD2 B LEU A 1 27 ? 12.465  11.984 19.211 0.50 20.73  ? 26  LEU A CD2 1 
ATOM   248  N  N   . LYS A 1 28 ? 13.425  13.963 24.114 1.00 23.12  ? 27  LYS A N   1 
ATOM   249  C  CA  . LYS A 1 28 ? 14.530  14.358 24.966 1.00 27.78  ? 27  LYS A CA  1 
ATOM   250  C  C   . LYS A 1 28 ? 14.991  13.197 25.876 1.00 28.67  ? 27  LYS A C   1 
ATOM   251  O  O   . LYS A 1 28 ? 16.189  12.941 26.065 1.00 28.20  ? 27  LYS A O   1 
ATOM   252  C  CB  . LYS A 1 28 ? 14.146  15.541 25.819 1.00 30.34  ? 27  LYS A CB  1 
ATOM   253  C  CG  . LYS A 1 28 ? 15.235  16.329 26.479 1.00 35.41  ? 27  LYS A CG  1 
ATOM   254  C  CD  . LYS A 1 28 ? 14.680  17.586 27.128 1.00 39.34  ? 27  LYS A CD  1 
ATOM   255  C  CE  . LYS A 1 28 ? 15.723  18.214 28.052 1.00 43.12  ? 27  LYS A CE  1 
ATOM   256  N  NZ  . LYS A 1 28 ? 15.423  19.666 28.296 1.00 46.05  ? 27  LYS A NZ  1 
ATOM   257  N  N   . LYS A 1 29 ? 14.027  12.432 26.363 1.00 28.85  ? 28  LYS A N   1 
ATOM   258  C  CA  . LYS A 1 29 ? 14.306  11.253 27.157 1.00 31.30  ? 28  LYS A CA  1 
ATOM   259  C  C   . LYS A 1 29 ? 14.959  10.152 26.323 1.00 29.62  ? 28  LYS A C   1 
ATOM   260  O  O   . LYS A 1 29 ? 15.792  9.403  26.838 1.00 30.68  ? 28  LYS A O   1 
ATOM   261  C  CB  . LYS A 1 29 ? 13.025  10.725 27.824 1.00 32.67  ? 28  LYS A CB  1 
ATOM   262  C  CG  A LYS A 1 29 ? 12.601  11.630 28.975 0.50 34.74  ? 28  LYS A CG  1 
ATOM   263  C  CG  B LYS A 1 29 ? 12.601  11.630 28.975 0.50 34.74  ? 28  LYS A CG  1 
ATOM   264  C  CD  A LYS A 1 29 ? 11.359  11.089 29.667 0.01 34.38  ? 28  LYS A CD  1 
ATOM   265  C  CD  B LYS A 1 29 ? 11.359  11.089 29.667 0.01 34.38  ? 28  LYS A CD  1 
ATOM   266  C  CE  A LYS A 1 29 ? 10.944  11.976 30.829 0.01 34.58  ? 28  LYS A CE  1 
ATOM   267  C  CE  B LYS A 1 29 ? 10.944  11.976 30.829 0.01 34.58  ? 28  LYS A CE  1 
ATOM   268  N  NZ  A LYS A 1 29 ? 9.736   11.452 31.524 0.01 34.56  ? 28  LYS A NZ  1 
ATOM   269  N  NZ  B LYS A 1 29 ? 9.736   11.452 31.524 0.01 34.56  ? 28  LYS A NZ  1 
ATOM   270  N  N   . LEU A 1 30 ? 14.520  9.945  25.109 1.00 27.17  ? 29  LEU A N   1 
ATOM   271  C  CA  . LEU A 1 30 ? 15.052  8.969  24.191 1.00 27.32  ? 29  LEU A CA  1 
ATOM   272  C  C   . LEU A 1 30 ? 16.498  9.328  23.841 1.00 27.95  ? 29  LEU A C   1 
ATOM   273  O  O   . LEU A 1 30 ? 17.371  8.472  23.845 1.00 29.32  ? 29  LEU A O   1 
ATOM   274  C  CB  . LEU A 1 30 ? 14.195  8.813  22.981 1.00 27.68  ? 29  LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 30 ? 12.889  8.033  23.057 1.00 29.47  ? 29  LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 30 ? 12.188  7.997  21.713 1.00 29.81  ? 29  LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 30 ? 13.191  6.586  23.472 1.00 31.36  ? 29  LEU A CD2 1 
ATOM   278  N  N   . VAL A 1 31 ? 16.807  10.567 23.606 1.00 27.85  ? 30  VAL A N   1 
ATOM   279  C  CA  . VAL A 1 31 ? 18.126  11.043 23.256 1.00 30.68  ? 30  VAL A CA  1 
ATOM   280  C  C   . VAL A 1 31 ? 19.057  10.946 24.452 1.00 32.16  ? 30  VAL A C   1 
ATOM   281  O  O   . VAL A 1 31 ? 20.216  10.538 24.291 1.00 32.02  ? 30  VAL A O   1 
ATOM   282  C  CB  . VAL A 1 31 ? 18.014  12.443 22.651 1.00 29.51  ? 30  VAL A CB  1 
ATOM   283  C  CG1 . VAL A 1 31 ? 19.351  13.086 22.435 1.00 32.29  ? 30  VAL A CG1 1 
ATOM   284  C  CG2 . VAL A 1 31 ? 17.266  12.282 21.320 1.00 28.89  ? 30  VAL A CG2 1 
ATOM   285  N  N   . GLY A 1 32 ? 18.589  11.337 25.608 1.00 34.44  ? 31  GLY A N   1 
ATOM   286  C  CA  . GLY A 1 32 ? 19.239  11.298 26.881 1.00 36.81  ? 31  GLY A CA  1 
ATOM   287  C  C   . GLY A 1 32 ? 20.140  12.447 27.248 1.00 40.00  ? 31  GLY A C   1 
ATOM   288  O  O   . GLY A 1 32 ? 20.966  12.339 28.177 1.00 39.84  ? 31  GLY A O   1 
ATOM   289  N  N   . GLU A 1 33 ? 20.041  13.559 26.537 1.00 43.10  ? 32  GLU A N   1 
ATOM   290  C  CA  . GLU A 1 33 ? 20.920  14.702 26.811 1.00 46.80  ? 32  GLU A CA  1 
ATOM   291  C  C   . GLU A 1 33 ? 20.276  15.609 27.852 1.00 49.20  ? 32  GLU A C   1 
ATOM   292  O  O   . GLU A 1 33 ? 19.087  15.439 28.141 1.00 50.38  ? 32  GLU A O   1 
ATOM   293  C  CB  . GLU A 1 33 ? 21.249  15.466 25.531 1.00 47.02  ? 32  GLU A CB  1 
ATOM   294  C  CG  A GLU A 1 33 ? 22.305  16.545 25.679 0.01 47.21  ? 32  GLU A CG  1 
ATOM   295  C  CD  A GLU A 1 33 ? 23.695  15.993 25.919 0.01 47.32  ? 32  GLU A CD  1 
ATOM   296  O  OE1 A GLU A 1 33 ? 24.065  14.994 25.268 0.01 47.34  ? 32  GLU A OE1 1 
ATOM   297  O  OE2 A GLU A 1 33 ? 24.424  16.559 26.761 0.01 47.34  ? 32  GLU A OE2 1 
ATOM   298  N  N   . ARG A 1 34 ? 21.069  16.519 28.404 1.00 51.56  ? 33  ARG A N   1 
ATOM   299  C  CA  . ARG A 1 34 ? 20.538  17.461 29.403 1.00 53.12  ? 33  ARG A CA  1 
HETATM 300  C  C   . ACE B 1 1  ? -6.877  44.777 12.900 1.00 26.94  ? 0   ACE B C   1 
HETATM 301  O  O   . ACE B 1 1  ? -6.285  43.903 12.275 1.00 27.96  ? 0   ACE B O   1 
HETATM 302  C  CH3 . ACE B 1 1  ? -7.035  46.159 12.335 1.00 29.55  ? 0   ACE B CH3 1 
ATOM   303  N  N   . ARG B 1 2  ? -7.526  44.972 14.051 1.00 25.45  ? 1   ARG B N   1 
ATOM   304  C  CA  . ARG B 1 2  ? -7.122  44.211 15.169 1.00 24.95  ? 1   ARG B CA  1 
ATOM   305  C  C   . ARG B 1 2  ? -7.453  42.738 14.761 1.00 22.88  ? 1   ARG B C   1 
ATOM   306  O  O   . ARG B 1 2  ? -6.631  41.811 14.881 1.00 22.38  ? 1   ARG B O   1 
ATOM   307  C  CB  . ARG B 1 2  ? -7.696  44.486 16.513 1.00 25.50  ? 1   ARG B CB  1 
ATOM   308  C  CG  . ARG B 1 2  ? -7.186  43.641 17.649 1.00 27.89  ? 1   ARG B CG  1 
ATOM   309  C  CD  . ARG B 1 2  ? -5.671  43.818 17.763 1.00 30.43  ? 1   ARG B CD  1 
ATOM   310  N  NE  . ARG B 1 2  ? -5.194  43.190 18.968 1.00 31.01  ? 1   ARG B NE  1 
ATOM   311  C  CZ  . ARG B 1 2  ? -3.952  42.852 19.238 1.00 32.61  ? 1   ARG B CZ  1 
ATOM   312  N  NH1 . ARG B 1 2  ? -3.004  43.083 18.330 1.00 30.85  ? 1   ARG B NH1 1 
ATOM   313  N  NH2 . ARG B 1 2  ? -3.746  42.331 20.436 1.00 32.40  ? 1   ARG B NH2 1 
ATOM   314  N  N   A MET B 1 3  ? -8.619  42.531 14.178 0.50 21.78  ? 2   MET B N   1 
ATOM   315  N  N   B MET B 1 3  ? -8.638  42.536 14.204 0.50 22.13  ? 2   MET B N   1 
ATOM   316  C  CA  A MET B 1 3  ? -9.118  41.220 13.795 0.50 22.64  ? 2   MET B CA  1 
ATOM   317  C  CA  B MET B 1 3  ? -9.076  41.200 13.834 0.50 23.24  ? 2   MET B CA  1 
ATOM   318  C  C   A MET B 1 3  ? -8.305  40.545 12.697 0.50 23.08  ? 2   MET B C   1 
ATOM   319  C  C   B MET B 1 3  ? -8.148  40.570 12.794 0.50 23.73  ? 2   MET B C   1 
ATOM   320  O  O   A MET B 1 3  ? -8.114  39.311 12.670 0.50 19.91  ? 2   MET B O   1 
ATOM   321  O  O   B MET B 1 3  ? -7.630  39.462 13.026 0.50 22.05  ? 2   MET B O   1 
ATOM   322  C  CB  A MET B 1 3  ? -10.600 41.302 13.488 0.50 25.37  ? 2   MET B CB  1 
ATOM   323  C  CB  B MET B 1 3  ? -10.526 41.149 13.408 0.50 25.70  ? 2   MET B CB  1 
ATOM   324  C  CG  A MET B 1 3  ? -11.301 39.978 13.288 0.50 29.86  ? 2   MET B CG  1 
ATOM   325  C  CG  B MET B 1 3  ? -11.007 39.781 12.948 0.50 29.61  ? 2   MET B CG  1 
ATOM   326  S  SD  A MET B 1 3  ? -13.095 40.058 13.456 0.30 32.68  ? 2   MET B SD  1 
ATOM   327  S  SD  B MET B 1 3  ? -11.749 38.812 14.282 0.30 33.66  ? 2   MET B SD  1 
ATOM   328  C  CE  A MET B 1 3  ? -13.280 40.836 15.047 0.50 32.38  ? 2   MET B CE  1 
ATOM   329  C  CE  B MET B 1 3  ? -13.304 39.685 14.491 0.50 32.40  ? 2   MET B CE  1 
ATOM   330  N  N   . LYS B 1 4  ? -7.775  41.347 11.783 1.00 22.63  ? 3   LYS B N   1 
ATOM   331  C  CA  . LYS B 1 4  ? -6.909  40.823 10.728 1.00 21.19  ? 3   LYS B CA  1 
ATOM   332  C  C   . LYS B 1 4  ? -5.510  40.612 11.316 1.00 21.18  ? 3   LYS B C   1 
ATOM   333  O  O   . LYS B 1 4  ? -4.856  39.665 10.914 1.00 22.38  ? 3   LYS B O   1 
ATOM   334  C  CB  . LYS B 1 4  ? -6.848  41.725 9.516  1.00 24.17  ? 3   LYS B CB  1 
ATOM   335  C  CG  . LYS B 1 4  ? -5.860  41.373 8.413  1.00 24.99  ? 3   LYS B CG  1 
ATOM   336  C  CD  . LYS B 1 4  ? -6.237  40.135 7.641  1.00 29.29  ? 3   LYS B CD  1 
ATOM   337  C  CE  . LYS B 1 4  ? -5.598  40.100 6.233  1.00 32.64  ? 3   LYS B CE  1 
ATOM   338  N  NZ  . LYS B 1 4  ? -4.115  40.296 6.219  1.00 29.22  ? 3   LYS B NZ  1 
ATOM   339  N  N   . GLN B 1 5  ? -4.995  41.394 12.250 1.00 22.10  ? 4   GLN B N   1 
ATOM   340  C  CA  . GLN B 1 5  ? -3.719  41.172 12.878 1.00 21.82  ? 4   GLN B CA  1 
ATOM   341  C  C   . GLN B 1 5  ? -3.698  39.776 13.563 1.00 19.59  ? 4   GLN B C   1 
ATOM   342  O  O   . GLN B 1 5  ? -2.723  39.025 13.464 1.00 19.36  ? 4   GLN B O   1 
ATOM   343  C  CB  . GLN B 1 5  ? -3.413  42.259 13.889 1.00 23.44  ? 4   GLN B CB  1 
ATOM   344  C  CG  . GLN B 1 5  ? -2.062  42.159 14.548 1.00 27.93  ? 4   GLN B CG  1 
ATOM   345  C  CD  A GLN B 1 5  ? -1.681  43.278 15.495 0.50 27.11  ? 4   GLN B CD  1 
ATOM   346  O  OE1 A GLN B 1 5  ? -2.470  44.136 15.873 0.50 23.47  ? 4   GLN B OE1 1 
ATOM   347  N  NE2 A GLN B 1 5  ? -0.413  43.251 15.941 0.50 28.93  ? 4   GLN B NE2 1 
ATOM   348  N  N   . LEU B 1 6  ? -4.792  39.454 14.214 1.00 17.62  ? 5   LEU B N   1 
ATOM   349  C  CA  . LEU B 1 6  ? -4.899  38.200 14.967 1.00 19.09  ? 5   LEU B CA  1 
ATOM   350  C  C   . LEU B 1 6  ? -5.109  37.011 14.064 1.00 17.05  ? 5   LEU B C   1 
ATOM   351  O  O   . LEU B 1 6  ? -4.523  35.925 14.302 1.00 16.90  ? 5   LEU B O   1 
ATOM   352  C  CB  . LEU B 1 6  ? -5.942  38.302 16.064 1.00 17.49  ? 5   LEU B CB  1 
ATOM   353  C  CG  . LEU B 1 6  ? -5.696  39.357 17.129 1.00 19.85  ? 5   LEU B CG  1 
ATOM   354  C  CD1 . LEU B 1 6  ? -6.814  39.267 18.164 1.00 21.95  ? 5   LEU B CD1 1 
ATOM   355  C  CD2 . LEU B 1 6  ? -4.334  39.299 17.814 1.00 19.65  ? 5   LEU B CD2 1 
ATOM   356  N  N   . GLU B 1 7  ? -5.808  37.190 12.933 1.00 18.41  ? 6   GLU B N   1 
ATOM   357  C  CA  . GLU B 1 7  ? -5.979  36.135 11.943 1.00 17.26  ? 6   GLU B CA  1 
ATOM   358  C  C   . GLU B 1 7  ? -4.636  35.819 11.294 1.00 17.02  ? 6   GLU B C   1 
ATOM   359  O  O   . GLU B 1 7  ? -4.255  34.658 11.114 1.00 17.98  ? 6   GLU B O   1 
ATOM   360  C  CB  . GLU B 1 7  ? -7.015  36.507 10.860 1.00 18.43  ? 6   GLU B CB  1 
ATOM   361  C  CG  . GLU B 1 7  ? -8.459  36.468 11.346 1.00 19.70  ? 6   GLU B CG  1 
ATOM   362  C  CD  . GLU B 1 7  ? -9.437  37.238 10.429 1.00 22.94  ? 6   GLU B CD  1 
ATOM   363  O  OE1 . GLU B 1 7  ? -9.007  38.143 9.705  1.00 21.86  ? 6   GLU B OE1 1 
ATOM   364  O  OE2 . GLU B 1 7  ? -10.661 36.953 10.468 1.00 23.34  ? 6   GLU B OE2 1 
ATOM   365  N  N   . ASP B 1 8  ? -3.865  36.843 10.922 1.00 19.16  ? 7   ASP B N   1 
ATOM   366  C  CA  . ASP B 1 8  ? -2.532  36.678 10.374 1.00 19.27  ? 7   ASP B CA  1 
ATOM   367  C  C   . ASP B 1 8  ? -1.637  35.946 11.412 1.00 18.73  ? 7   ASP B C   1 
ATOM   368  O  O   . ASP B 1 8  ? -0.870  35.025 11.100 1.00 14.71  ? 7   ASP B O   1 
ATOM   369  C  CB  . ASP B 1 8  ? -1.852  37.995 10.022 1.00 18.83  ? 7   ASP B CB  1 
ATOM   370  C  CG  . ASP B 1 8  ? -2.489  38.678 8.795  1.00 21.20  ? 7   ASP B CG  1 
ATOM   371  O  OD1 . ASP B 1 8  ? -3.323  38.049 8.164  1.00 20.37  ? 7   ASP B OD1 1 
ATOM   372  O  OD2 . ASP B 1 8  ? -2.131  39.854 8.574  1.00 22.14  ? 7   ASP B OD2 1 
ATOM   373  N  N   . LYS B 1 9  ? -1.704  36.373 12.668 1.00 15.23  ? 8   LYS B N   1 
ATOM   374  C  CA  . LYS B 1 9  ? -0.862  35.721 13.678 1.00 15.11  ? 8   LYS B CA  1 
ATOM   375  C  C   . LYS B 1 9  ? -1.160  34.229 13.849 1.00 15.33  ? 8   LYS B C   1 
ATOM   376  O  O   . LYS B 1 9  ? -0.234  33.434 13.982 1.00 14.63  ? 8   LYS B O   1 
ATOM   377  C  CB  . LYS B 1 9  ? -0.996  36.459 15.000 1.00 14.71  ? 8   LYS B CB  1 
ATOM   378  C  CG  . LYS B 1 9  ? -0.051  35.889 16.093 1.00 18.73  ? 8   LYS B CG  1 
ATOM   379  C  CD  . LYS B 1 9  ? 1.388   36.017 15.714 1.00 16.26  ? 8   LYS B CD  1 
ATOM   380  C  CE  . LYS B 1 9  ? 2.008   37.389 15.665 1.00 20.15  ? 8   LYS B CE  1 
ATOM   381  N  NZ  . LYS B 1 9  ? 3.489   37.260 15.539 1.00 22.15  ? 8   LYS B NZ  1 
ATOM   382  N  N   . VAL B 1 10 ? -2.430  33.837 13.850 1.00 13.34  ? 9   VAL B N   1 
ATOM   383  C  CA  . VAL B 1 10 ? -2.826  32.467 14.030 1.00 15.42  ? 9   VAL B CA  1 
ATOM   384  C  C   . VAL B 1 10 ? -2.321  31.638 12.847 1.00 14.83  ? 9   VAL B C   1 
ATOM   385  O  O   . VAL B 1 10 ? -1.810  30.548 13.073 1.00 14.11  ? 9   VAL B O   1 
ATOM   386  C  CB  . VAL B 1 10 ? -4.277  32.213 14.345 1.00 16.52  ? 9   VAL B CB  1 
ATOM   387  C  CG1 . VAL B 1 10 ? -5.239  32.028 13.157 1.00 13.25  ? 9   VAL B CG1 1 
ATOM   388  C  CG2 . VAL B 1 10 ? -4.422  30.941 15.227 1.00 14.92  ? 9   VAL B CG2 1 
ATOM   389  N  N   . GLU B 1 11 ? -2.399  32.159 11.636 1.00 12.81  ? 10  GLU B N   1 
ATOM   390  C  CA  . GLU B 1 11 ? -1.870  31.449 10.476 1.00 14.38  ? 10  GLU B CA  1 
ATOM   391  C  C   . GLU B 1 11 ? -0.353  31.346 10.527 1.00 12.77  ? 10  GLU B C   1 
ATOM   392  O  O   . GLU B 1 11 ? 0.181   30.262 10.183 1.00 16.73  ? 10  GLU B O   1 
ATOM   393  C  CB  . GLU B 1 11 ? -2.296  32.205 9.205  1.00 16.38  ? 10  GLU B CB  1 
ATOM   394  C  CG  . GLU B 1 11 ? -3.786  32.089 9.036  1.00 18.95  ? 10  GLU B CG  1 
ATOM   395  C  CD  . GLU B 1 11 ? -4.304  33.053 7.964  1.00 23.47  ? 10  GLU B CD  1 
ATOM   396  O  OE1 . GLU B 1 11 ? -3.598  33.964 7.536  1.00 26.36  ? 10  GLU B OE1 1 
ATOM   397  O  OE2 . GLU B 1 11 ? -5.436  32.713 7.592  1.00 30.20  ? 10  GLU B OE2 1 
ATOM   398  N  N   . GLU B 1 12 ? 0.354   32.371 10.996 1.00 14.54  ? 11  GLU B N   1 
ATOM   399  C  CA  . GLU B 1 12 ? 1.804   32.306 11.124 1.00 16.54  ? 11  GLU B CA  1 
ATOM   400  C  C   . GLU B 1 12 ? 2.191   31.167 12.097 1.00 17.58  ? 11  GLU B C   1 
ATOM   401  O  O   . GLU B 1 12 ? 3.079   30.355 11.835 1.00 16.90  ? 11  GLU B O   1 
ATOM   402  C  CB  . GLU B 1 12 ? 2.345   33.644 11.649 1.00 18.22  ? 11  GLU B CB  1 
ATOM   403  C  CG  . GLU B 1 12 ? 3.739   33.588 12.210 1.00 22.56  ? 11  GLU B CG  1 
ATOM   404  C  CD  . GLU B 1 12 ? 4.136   34.808 12.998 1.00 26.77  ? 11  GLU B CD  1 
ATOM   405  O  OE1 . GLU B 1 12 ? 3.552   35.897 13.073 1.00 28.52  ? 11  GLU B OE1 1 
ATOM   406  O  OE2 . GLU B 1 12 ? 5.156   34.601 13.670 1.00 31.65  ? 11  GLU B OE2 1 
ATOM   407  N  N   . LEU B 1 13 ? 1.578   31.175 13.283 1.00 15.73  ? 12  LEU B N   1 
ATOM   408  C  CA  . LEU B 1 13 ? 1.844   30.176 14.314 1.00 15.99  ? 12  LEU B CA  1 
ATOM   409  C  C   . LEU B 1 13 ? 1.363   28.782 13.923 1.00 15.27  ? 12  LEU B C   1 
ATOM   410  O  O   . LEU B 1 13 ? 2.062   27.792 14.229 1.00 15.08  ? 12  LEU B O   1 
ATOM   411  C  CB  . LEU B 1 13 ? 1.275   30.655 15.657 1.00 15.02  ? 12  LEU B CB  1 
ATOM   412  C  CG  . LEU B 1 13 ? 1.841   32.012 16.164 1.00 14.04  ? 12  LEU B CG  1 
ATOM   413  C  CD1 . LEU B 1 13 ? 1.073   32.320 17.476 1.00 14.25  ? 12  LEU B CD1 1 
ATOM   414  C  CD2 . LEU B 1 13 ? 3.325   31.992 16.386 1.00 15.89  ? 12  LEU B CD2 1 
ATOM   415  N  N   . LEU B 1 14 ? 0.287   28.623 13.140 1.00 15.00  ? 13  LEU B N   1 
ATOM   416  C  CA  . LEU B 1 14 ? -0.088  27.294 12.678 1.00 15.52  ? 13  LEU B CA  1 
ATOM   417  C  C   . LEU B 1 14 ? 0.947   26.734 11.728 1.00 15.12  ? 13  LEU B C   1 
ATOM   418  O  O   . LEU B 1 14 ? 1.250   25.525 11.730 1.00 15.74  ? 13  LEU B O   1 
ATOM   419  C  CB  . LEU B 1 14 ? -1.519  27.313 12.113 1.00 14.03  ? 13  LEU B CB  1 
ATOM   420  C  CG  . LEU B 1 14 ? -2.637  27.342 13.126 1.00 13.98  ? 13  LEU B CG  1 
ATOM   421  C  CD1 . LEU B 1 14 ? -3.959  27.735 12.438 1.00 14.54  ? 13  LEU B CD1 1 
ATOM   422  C  CD2 . LEU B 1 14 ? -2.835  25.967 13.832 1.00 13.37  ? 13  LEU B CD2 1 
ATOM   423  N  N   . SER B 1 15 ? 1.473   27.622 10.852 1.00 15.91  ? 14  SER B N   1 
ATOM   424  C  CA  . SER B 1 15 ? 2.529   27.225 9.939  1.00 15.87  ? 14  SER B CA  1 
ATOM   425  C  C   . SER B 1 15 ? 3.789   26.767 10.672 1.00 17.12  ? 14  SER B C   1 
ATOM   426  O  O   . SER B 1 15 ? 4.382   25.720 10.395 1.00 18.59  ? 14  SER B O   1 
ATOM   427  C  CB  . SER B 1 15 ? 2.846   28.407 9.018  1.00 15.26  ? 14  SER B CB  1 
ATOM   428  O  OG  . SER B 1 15 ? 3.885   28.002 8.152  1.00 15.57  ? 14  SER B OG  1 
ATOM   429  N  N   . LYS B 1 16 ? 4.199   27.513 11.683 1.00 16.87  ? 15  LYS B N   1 
ATOM   430  C  CA  . LYS B 1 16 ? 5.339   27.126 12.516 1.00 19.96  ? 15  LYS B CA  1 
ATOM   431  C  C   . LYS B 1 16 ? 5.073   25.799 13.210 1.00 16.85  ? 15  LYS B C   1 
ATOM   432  O  O   . LYS B 1 16 ? 5.986   24.938 13.283 1.00 16.57  ? 15  LYS B O   1 
ATOM   433  C  CB  . LYS B 1 16 ? 5.724   28.245 13.477 1.00 21.42  ? 15  LYS B CB  1 
ATOM   434  C  CG  . LYS B 1 16 ? 6.313   29.386 12.625 1.00 24.09  ? 15  LYS B CG  1 
ATOM   435  C  CD  . LYS B 1 16 ? 6.569   30.574 13.512 1.00 28.54  ? 15  LYS B CD  1 
ATOM   436  C  CE  . LYS B 1 16 ? 7.361   31.624 12.698 1.00 30.53  ? 15  LYS B CE  1 
ATOM   437  N  NZ  . LYS B 1 16 ? 7.620   32.738 13.659 1.00 33.93  ? 15  LYS B NZ  1 
ATOM   438  N  N   . ALA B 1 17 ? 3.865   25.660 13.742 1.00 16.30  ? 16  ALA B N   1 
ATOM   439  C  CA  . ALA B 1 17 ? 3.503   24.410 14.379 1.00 16.32  ? 16  ALA B CA  1 
ATOM   440  C  C   . ALA B 1 17 ? 3.640   23.207 13.415 1.00 17.79  ? 16  ALA B C   1 
ATOM   441  O  O   . ALA B 1 17 ? 4.235   22.188 13.782 1.00 19.73  ? 16  ALA B O   1 
ATOM   442  C  CB  . ALA B 1 17 ? 2.147   24.346 14.968 1.00 15.26  ? 16  ALA B CB  1 
ATOM   443  N  N   . TYR B 1 18 ? 3.117   23.296 12.229 1.00 17.26  ? 17  TYR B N   1 
ATOM   444  C  CA  . TYR B 1 18 ? 3.199   22.250 11.207 1.00 19.10  ? 17  TYR B CA  1 
ATOM   445  C  C   . TYR B 1 18 ? 4.651   21.890 10.866 1.00 18.32  ? 17  TYR B C   1 
ATOM   446  O  O   . TYR B 1 18 ? 4.933   20.680 10.865 1.00 18.18  ? 17  TYR B O   1 
ATOM   447  C  CB  . TYR B 1 18 ? 2.488   22.734 9.952  1.00 18.82  ? 17  TYR B CB  1 
ATOM   448  C  CG  . TYR B 1 18 ? 2.558   21.795 8.753  1.00 22.44  ? 17  TYR B CG  1 
ATOM   449  C  CD1 . TYR B 1 18 ? 1.954   20.540 8.784  1.00 23.27  ? 17  TYR B CD1 1 
ATOM   450  C  CD2 . TYR B 1 18 ? 3.227   22.179 7.612  1.00 23.24  ? 17  TYR B CD2 1 
ATOM   451  C  CE1 . TYR B 1 18 ? 2.019   19.692 7.695  1.00 26.57  ? 17  TYR B CE1 1 
ATOM   452  C  CE2 . TYR B 1 18 ? 3.329   21.330 6.505  1.00 26.81  ? 17  TYR B CE2 1 
ATOM   453  C  CZ  . TYR B 1 18 ? 2.717   20.104 6.566  1.00 28.09  ? 17  TYR B CZ  1 
ATOM   454  O  OH  . TYR B 1 18 ? 2.748   19.270 5.467  1.00 32.26  ? 17  TYR B OH  1 
ATOM   455  N  N   . HIS B 1 19 ? 5.510   22.880 10.638 1.00 16.12  ? 18  HIS B N   1 
ATOM   456  C  CA  . HIS B 1 19 ? 6.914   22.591 10.362 1.00 17.86  ? 18  HIS B CA  1 
ATOM   457  C  C   . HIS B 1 19 ? 7.649   22.015 11.560 1.00 18.96  ? 18  HIS B C   1 
ATOM   458  O  O   . HIS B 1 19 ? 8.501   21.124 11.385 1.00 18.13  ? 18  HIS B O   1 
ATOM   459  C  CB  . HIS B 1 19 ? 7.552   23.869 9.786  1.00 19.11  ? 18  HIS B CB  1 
ATOM   460  C  CG  . HIS B 1 19 ? 6.944   24.178 8.442  1.00 20.98  ? 18  HIS B CG  1 
ATOM   461  N  ND1 . HIS B 1 19 ? 7.437   23.566 7.290  1.00 23.51  ? 18  HIS B ND1 1 
ATOM   462  C  CD2 . HIS B 1 19 ? 5.892   24.944 8.041  1.00 20.74  ? 18  HIS B CD2 1 
ATOM   463  C  CE1 . HIS B 1 19 ? 6.725   23.998 6.241  1.00 20.79  ? 18  HIS B CE1 1 
ATOM   464  N  NE2 . HIS B 1 19 ? 5.787   24.818 6.674  1.00 21.34  ? 18  HIS B NE2 1 
ATOM   465  N  N   . LEU B 1 20 ? 7.285   22.430 12.789 1.00 16.67  ? 19  LEU B N   1 
ATOM   466  C  CA  . LEU B 1 20 ? 7.922   21.819 13.959 1.00 18.07  ? 19  LEU B CA  1 
ATOM   467  C  C   . LEU B 1 20 ? 7.517   20.351 14.068 1.00 17.95  ? 19  LEU B C   1 
ATOM   468  O  O   . LEU B 1 20 ? 8.294   19.480 14.489 1.00 20.10  ? 19  LEU B O   1 
ATOM   469  C  CB  . LEU B 1 20 ? 7.583   22.571 15.254 1.00 16.42  ? 19  LEU B CB  1 
ATOM   470  C  CG  . LEU B 1 20 ? 8.249   23.946 15.328 1.00 18.25  ? 19  LEU B CG  1 
ATOM   471  C  CD1 . LEU B 1 20 ? 7.584   24.787 16.412 1.00 18.56  ? 19  LEU B CD1 1 
ATOM   472  C  CD2 . LEU B 1 20 ? 9.724   23.865 15.639 1.00 16.77  ? 19  LEU B CD2 1 
ATOM   473  N  N   . GLU B 1 21 ? 6.269   20.031 13.793 1.00 18.44  ? 20  GLU B N   1 
ATOM   474  C  CA  . GLU B 1 21 ? 5.742   18.688 13.756 1.00 21.82  ? 20  GLU B CA  1 
ATOM   475  C  C   . GLU B 1 21 ? 6.543   17.833 12.750 1.00 23.62  ? 20  GLU B C   1 
ATOM   476  O  O   . GLU B 1 21 ? 6.949   16.720 13.082 1.00 22.24  ? 20  GLU B O   1 
ATOM   477  C  CB  . GLU B 1 21 ? 4.255   18.691 13.516 1.00 21.68  ? 20  GLU B CB  1 
ATOM   478  C  CG  . GLU B 1 21 ? 3.679   17.347 13.099 1.00 28.87  ? 20  GLU B CG  1 
ATOM   479  C  CD  A GLU B 1 21 ? 2.175   17.380 12.914 0.01 27.50  ? 20  GLU B CD  1 
ATOM   480  O  OE1 A GLU B 1 21 ? 1.464   16.748 13.723 0.01 28.02  ? 20  GLU B OE1 1 
ATOM   481  O  OE2 A GLU B 1 21 ? 1.704   18.034 11.961 0.01 27.98  ? 20  GLU B OE2 1 
ATOM   482  N  N   . ASN B 1 22 ? 6.866   18.389 11.587 1.00 23.28  ? 21  ASN B N   1 
ATOM   483  C  CA  . ASN B 1 22 ? 7.680   17.672 10.602 1.00 23.80  ? 21  ASN B CA  1 
ATOM   484  C  C   . ASN B 1 22 ? 9.069   17.416 11.140 1.00 22.63  ? 21  ASN B C   1 
ATOM   485  O  O   . ASN B 1 22 ? 9.614   16.325 10.885 1.00 23.94  ? 21  ASN B O   1 
ATOM   486  C  CB  . ASN B 1 22 ? 7.761   18.428 9.265  1.00 24.30  ? 21  ASN B CB  1 
ATOM   487  C  CG  . ASN B 1 22 ? 6.426   18.455 8.573  1.00 27.80  ? 21  ASN B CG  1 
ATOM   488  O  OD1 . ASN B 1 22 ? 5.502   17.695 8.878  1.00 29.02  ? 21  ASN B OD1 1 
ATOM   489  N  ND2 . ASN B 1 22 ? 6.311   19.363 7.597  1.00 31.03  ? 21  ASN B ND2 1 
ATOM   490  N  N   A GLU B 1 23 ? 9.675   18.322 11.905 0.50 21.06  ? 22  GLU B N   1 
ATOM   491  N  N   B GLU B 1 23 ? 9.626   18.365 11.872 0.50 21.25  ? 22  GLU B N   1 
ATOM   492  C  CA  A GLU B 1 23 ? 11.000  18.188 12.459 0.50 21.54  ? 22  GLU B CA  1 
ATOM   493  C  CA  B GLU B 1 23 ? 10.940  18.149 12.418 0.50 21.62  ? 22  GLU B CA  1 
ATOM   494  C  C   A GLU B 1 23 ? 11.043  17.145 13.591 0.50 22.66  ? 22  GLU B C   1 
ATOM   495  C  C   B GLU B 1 23 ? 10.895  16.993 13.425 0.50 23.05  ? 22  GLU B C   1 
ATOM   496  O  O   A GLU B 1 23 ? 12.062  16.451 13.689 0.50 17.93  ? 22  GLU B O   1 
ATOM   497  O  O   B GLU B 1 23 ? 11.576  15.988 13.234 0.50 20.39  ? 22  GLU B O   1 
ATOM   498  C  CB  A GLU B 1 23 ? 11.630  19.489 12.927 0.50 22.47  ? 22  GLU B CB  1 
ATOM   499  C  CB  B GLU B 1 23 ? 11.498  19.398 13.074 0.50 21.88  ? 22  GLU B CB  1 
ATOM   500  C  CG  A GLU B 1 23 ? 13.045  19.478 13.447 0.50 24.63  ? 22  GLU B CG  1 
ATOM   501  C  CG  B GLU B 1 23 ? 12.788  19.059 13.803 0.50 23.78  ? 22  GLU B CG  1 
ATOM   502  C  CD  A GLU B 1 23 ? 14.174  19.070 12.533 0.50 27.40  ? 22  GLU B CD  1 
ATOM   503  C  CD  B GLU B 1 23 ? 13.613  20.293 14.057 0.50 25.18  ? 22  GLU B CD  1 
ATOM   504  O  OE1 A GLU B 1 23 ? 14.021  18.892 11.307 0.50 28.51  ? 22  GLU B OE1 1 
ATOM   505  O  OE1 B GLU B 1 23 ? 13.008  21.391 14.118 0.50 26.20  ? 22  GLU B OE1 1 
ATOM   506  O  OE2 A GLU B 1 23 ? 15.317  18.915 13.042 0.50 28.43  ? 22  GLU B OE2 1 
ATOM   507  O  OE2 B GLU B 1 23 ? 14.833  20.089 14.186 0.50 26.96  ? 22  GLU B OE2 1 
ATOM   508  N  N   . VAL B 1 24 ? 9.970   17.099 14.378 1.00 21.18  ? 23  VAL B N   1 
ATOM   509  C  CA  . VAL B 1 24 ? 9.794   16.094 15.394 1.00 23.15  ? 23  VAL B CA  1 
ATOM   510  C  C   . VAL B 1 24 ? 9.748   14.697 14.788 1.00 24.51  ? 23  VAL B C   1 
ATOM   511  O  O   . VAL B 1 24 ? 10.463  13.787 15.214 1.00 25.17  ? 23  VAL B O   1 
ATOM   512  C  CB  . VAL B 1 24 ? 8.511   16.332 16.215 1.00 23.98  ? 23  VAL B CB  1 
ATOM   513  C  CG1 . VAL B 1 24 ? 8.051   15.058 16.939 1.00 26.40  ? 23  VAL B CG1 1 
ATOM   514  C  CG2 . VAL B 1 24 ? 8.818   17.431 17.232 1.00 23.45  ? 23  VAL B CG2 1 
ATOM   515  N  N   . ALA B 1 25 ? 8.921   14.525 13.775 1.00 25.79  ? 24  ALA B N   1 
ATOM   516  C  CA  . ALA B 1 25 ? 8.808   13.243 13.094 1.00 27.30  ? 24  ALA B CA  1 
ATOM   517  C  C   . ALA B 1 25 ? 10.141  12.821 12.462 1.00 27.92  ? 24  ALA B C   1 
ATOM   518  O  O   . ALA B 1 25 ? 10.449  11.626 12.498 1.00 29.11  ? 24  ALA B O   1 
ATOM   519  C  CB  . ALA B 1 25 ? 7.703   13.359 12.061 1.00 27.04  ? 24  ALA B CB  1 
ATOM   520  N  N   . ARG B 1 26 ? 10.963  13.698 11.947 1.00 28.09  ? 25  ARG B N   1 
ATOM   521  C  CA  . ARG B 1 26 ? 12.253  13.409 11.389 1.00 29.96  ? 25  ARG B CA  1 
ATOM   522  C  C   . ARG B 1 26 ? 13.179  12.894 12.503 1.00 30.27  ? 25  ARG B C   1 
ATOM   523  O  O   . ARG B 1 26 ? 13.792  11.824 12.403 1.00 29.55  ? 25  ARG B O   1 
ATOM   524  C  CB  . ARG B 1 26 ? 12.922  14.575 10.674 1.00 32.03  ? 25  ARG B CB  1 
ATOM   525  C  CG  . ARG B 1 26 ? 12.385  14.928 9.306  1.00 35.44  ? 25  ARG B CG  1 
ATOM   526  C  CD  . ARG B 1 26 ? 13.221  15.905 8.505  1.00 36.78  ? 25  ARG B CD  1 
ATOM   527  N  NE  . ARG B 1 26 ? 13.199  17.281 8.932  1.00 39.75  ? 25  ARG B NE  1 
ATOM   528  C  CZ  . ARG B 1 26 ? 12.307  18.256 8.764  1.00 38.05  ? 25  ARG B CZ  1 
ATOM   529  N  NH1 . ARG B 1 26 ? 12.546  19.433 9.311  1.00 37.29  ? 25  ARG B NH1 1 
ATOM   530  N  NH2 . ARG B 1 26 ? 11.196  18.089 8.068  1.00 39.44  ? 25  ARG B NH2 1 
ATOM   531  N  N   . LEU B 1 27 ? 13.234  13.644 13.594 1.00 27.68  ? 26  LEU B N   1 
ATOM   532  C  CA  . LEU B 1 27 ? 14.062  13.290 14.740 1.00 27.18  ? 26  LEU B CA  1 
ATOM   533  C  C   . LEU B 1 27 ? 13.638  11.994 15.400 1.00 27.13  ? 26  LEU B C   1 
ATOM   534  O  O   . LEU B 1 27 ? 14.529  11.198 15.717 1.00 28.74  ? 26  LEU B O   1 
ATOM   535  C  CB  . LEU B 1 27 ? 14.165  14.457 15.705 1.00 27.13  ? 26  LEU B CB  1 
ATOM   536  C  CG  . LEU B 1 27 ? 14.794  15.729 15.136 1.00 28.72  ? 26  LEU B CG  1 
ATOM   537  C  CD1 . LEU B 1 27 ? 15.041  16.790 16.195 1.00 29.62  ? 26  LEU B CD1 1 
ATOM   538  C  CD2 . LEU B 1 27 ? 16.100  15.469 14.400 1.00 31.66  ? 26  LEU B CD2 1 
ATOM   539  N  N   . LYS B 1 28 ? 12.371  11.670 15.485 1.00 26.98  ? 27  LYS B N   1 
ATOM   540  C  CA  . LYS B 1 28 ? 11.889  10.437 16.071 1.00 30.26  ? 27  LYS B CA  1 
ATOM   541  C  C   . LYS B 1 28 ? 12.385  9.244  15.216 1.00 32.74  ? 27  LYS B C   1 
ATOM   542  O  O   . LYS B 1 28 ? 12.829  8.242  15.772 1.00 31.77  ? 27  LYS B O   1 
ATOM   543  C  CB  . LYS B 1 28 ? 10.380  10.307 16.078 1.00 33.25  ? 27  LYS B CB  1 
ATOM   544  C  CG  . LYS B 1 28 ? 9.566   11.109 17.069 1.00 36.13  ? 27  LYS B CG  1 
ATOM   545  C  CD  A LYS B 1 28 ? 8.081   10.948 16.748 0.50 35.72  ? 27  LYS B CD  1 
ATOM   546  C  CE  A LYS B 1 28 ? 7.232   11.722 17.754 0.50 35.63  ? 27  LYS B CE  1 
ATOM   547  N  NZ  A LYS B 1 28 ? 5.786   11.395 17.560 0.50 35.62  ? 27  LYS B NZ  1 
ATOM   548  N  N   . LYS B 1 29 ? 12.285  9.395  13.894 1.00 32.64  ? 28  LYS B N   1 
ATOM   549  C  CA  . LYS B 1 29 ? 12.742  8.299  13.021 1.00 33.69  ? 28  LYS B CA  1 
ATOM   550  C  C   . LYS B 1 29 ? 14.247  8.092  13.181 1.00 32.15  ? 28  LYS B C   1 
ATOM   551  O  O   . LYS B 1 29 ? 14.701  6.956  13.195 1.00 33.24  ? 28  LYS B O   1 
ATOM   552  C  CB  . LYS B 1 29 ? 12.381  8.509  11.570 1.00 33.51  ? 28  LYS B CB  1 
ATOM   553  C  CG  A LYS B 1 29 ? 10.897  8.494  11.248 0.01 33.85  ? 28  LYS B CG  1 
ATOM   554  C  CD  A LYS B 1 29 ? 10.300  7.105  11.410 0.01 33.97  ? 28  LYS B CD  1 
ATOM   555  C  CE  A LYS B 1 29 ? 8.820   7.094  11.068 0.01 34.07  ? 28  LYS B CE  1 
ATOM   556  N  NZ  A LYS B 1 29 ? 8.225   5.738  11.222 0.01 34.09  ? 28  LYS B NZ  1 
ATOM   557  N  N   . LEU B 1 30 ? 15.035  9.138  13.258 1.00 31.22  ? 29  LEU B N   1 
ATOM   558  C  CA  . LEU B 1 30 ? 16.461  9.101  13.440 1.00 30.81  ? 29  LEU B CA  1 
ATOM   559  C  C   . LEU B 1 30 ? 16.935  8.460  14.730 1.00 33.70  ? 29  LEU B C   1 
ATOM   560  O  O   . LEU B 1 30 ? 17.842  7.602  14.771 1.00 34.61  ? 29  LEU B O   1 
ATOM   561  C  CB  . LEU B 1 30 ? 16.939  10.552 13.398 1.00 31.40  ? 29  LEU B CB  1 
ATOM   562  C  CG  A LEU B 1 30 ? 16.961  11.110 11.956 0.50 31.73  ? 29  LEU B CG  1 
ATOM   563  C  CG  B LEU B 1 30 ? 18.346  10.945 13.010 0.50 33.42  ? 29  LEU B CG  1 
ATOM   564  C  CD1 A LEU B 1 30 ? 17.685  12.450 11.928 0.50 32.94  ? 29  LEU B CD1 1 
ATOM   565  C  CD1 B LEU B 1 30 ? 18.591  10.664 11.524 0.50 33.77  ? 29  LEU B CD1 1 
ATOM   566  C  CD2 A LEU B 1 30 ? 17.601  10.146 10.965 0.50 32.68  ? 29  LEU B CD2 1 
ATOM   567  C  CD2 B LEU B 1 30 ? 18.642  12.416 13.304 0.50 33.02  ? 29  LEU B CD2 1 
ATOM   568  N  N   . VAL B 1 31 ? 16.290  8.808  15.840 1.00 32.69  ? 30  VAL B N   1 
ATOM   569  C  CA  . VAL B 1 31 ? 16.716  8.215  17.121 1.00 34.49  ? 30  VAL B CA  1 
ATOM   570  C  C   . VAL B 1 31 ? 16.216  6.790  17.218 1.00 33.58  ? 30  VAL B C   1 
ATOM   571  O  O   . VAL B 1 31 ? 16.728  5.992  18.002 1.00 36.67  ? 30  VAL B O   1 
ATOM   572  C  CB  . VAL B 1 31 ? 16.256  9.131  18.275 1.00 33.55  ? 30  VAL B CB  1 
ATOM   573  C  CG1 . VAL B 1 31 ? 14.776  8.947  18.523 1.00 32.79  ? 30  VAL B CG1 1 
ATOM   574  C  CG2 . VAL B 1 31 ? 17.085  8.885  19.527 1.00 36.27  ? 30  VAL B CG2 1 
ATOM   575  N  N   . GLY B 1 32 ? 15.205  6.421  16.446 1.00 34.57  ? 31  GLY B N   1 
ATOM   576  C  CA  . GLY B 1 32 ? 14.601  5.110  16.440 1.00 36.40  ? 31  GLY B CA  1 
ATOM   577  C  C   . GLY B 1 32 ? 15.524  4.078  15.779 1.00 39.08  ? 31  GLY B C   1 
ATOM   578  O  O   . GLY B 1 32 ? 15.393  2.893  16.075 1.00 39.30  ? 31  GLY B O   1 
ATOM   579  N  N   . GLU B 1 33 ? 16.325  4.508  14.795 1.00 37.73  ? 32  GLU B N   1 
ATOM   580  C  CA  . GLU B 1 33 ? 17.232  3.575  14.144 1.00 39.24  ? 32  GLU B CA  1 
ATOM   581  C  C   . GLU B 1 33 ? 18.274  3.287  15.226 1.00 40.40  ? 32  GLU B C   1 
ATOM   582  O  O   . GLU B 1 33 ? 19.084  4.183  15.560 1.00 37.58  ? 32  GLU B O   1 
ATOM   583  C  CB  . GLU B 1 33 ? 17.932  4.128  12.913 1.00 38.06  ? 32  GLU B CB  1 
ATOM   584  N  N   . ARG B 1 34 ? 18.274  2.084  15.783 1.00 42.15  ? 33  ARG B N   1 
ATOM   585  C  CB  . ARG B 1 34 ? 20.404  1.475  14.602 1.00 46.87  ? 33  ARG B CB  1 
ATOM   586  C  CG  . ARG B 1 34 ? 20.991  0.843  15.853 1.00 49.40  ? 33  ARG B CG  1 
ATOM   587  C  CD  . ARG B 1 34 ? 20.978  1.736  17.054 1.00 50.25  ? 33  ARG B CD  1 
ATOM   588  N  NE  . ARG B 1 34 ? 19.966  1.520  18.080 1.00 51.60  ? 33  ARG B NE  1 
ATOM   589  C  CZ  . ARG B 1 34 ? 19.257  2.493  18.662 1.00 52.99  ? 33  ARG B CZ  1 
ATOM   590  N  NH1 . ARG B 1 34 ? 19.426  3.754  18.254 1.00 53.34  ? 33  ARG B NH1 1 
ATOM   591  N  NH2 . ARG B 1 34 ? 18.351  2.308  19.618 1.00 52.73  ? 33  ARG B NH2 1 
HETATM 592  C  C   . ACE C 1 1  ? 20.794  21.063 17.948 1.00 41.09  ? 0   ACE C C   1 
HETATM 593  O  O   . ACE C 1 1  ? 22.018  21.182 18.186 1.00 45.55  ? 0   ACE C O   1 
HETATM 594  C  CH3 . ACE C 1 1  ? 19.859  21.974 18.649 1.00 40.82  ? 0   ACE C CH3 1 
ATOM   595  N  N   . ARG C 1 2  ? 20.322  20.148 17.110 1.00 39.14  ? 1   ARG C N   1 
ATOM   596  C  CA  . ARG C 1 2  ? 18.988  20.167 16.593 1.00 36.68  ? 1   ARG C CA  1 
ATOM   597  C  C   . ARG C 1 2  ? 18.020  20.040 17.777 1.00 36.04  ? 1   ARG C C   1 
ATOM   598  O  O   . ARG C 1 2  ? 17.016  20.790 17.817 1.00 32.76  ? 1   ARG C O   1 
ATOM   599  C  CB  . ARG C 1 2  ? 18.669  19.091 15.557 1.00 40.07  ? 1   ARG C CB  1 
ATOM   600  C  CG  . ARG C 1 2  ? 19.050  19.354 14.112 1.00 43.82  ? 1   ARG C CG  1 
ATOM   601  C  CD  . ARG C 1 2  ? 18.866  18.185 13.169 1.00 47.00  ? 1   ARG C CD  1 
ATOM   602  N  NE  . ARG C 1 2  ? 17.587  18.037 12.496 1.00 50.47  ? 1   ARG C NE  1 
ATOM   603  C  CZ  . ARG C 1 2  ? 17.211  17.093 11.624 1.00 51.94  ? 1   ARG C CZ  1 
ATOM   604  N  NH1 . ARG C 1 2  ? 18.065  16.115 11.284 1.00 54.23  ? 1   ARG C NH1 1 
ATOM   605  N  NH2 . ARG C 1 2  ? 16.012  17.052 11.049 1.00 50.76  ? 1   ARG C NH2 1 
ATOM   606  N  N   . MET C 1 3  ? 18.368  19.207 18.773 1.00 32.60  ? 2   MET C N   1 
ATOM   607  C  CA  . MET C 1 3  ? 17.494  19.023 19.909 1.00 33.32  ? 2   MET C CA  1 
ATOM   608  C  C   . MET C 1 3  ? 17.266  20.270 20.738 1.00 33.72  ? 2   MET C C   1 
ATOM   609  O  O   . MET C 1 3  ? 16.091  20.581 21.044 1.00 35.58  ? 2   MET C O   1 
ATOM   610  C  CB  . MET C 1 3  ? 17.947  17.807 20.745 1.00 33.54  ? 2   MET C CB  1 
ATOM   611  C  CG  A MET C 1 3  ? 16.773  16.984 21.223 0.50 32.03  ? 2   MET C CG  1 
ATOM   612  C  CG  B MET C 1 3  ? 17.193  16.540 20.403 0.50 32.38  ? 2   MET C CG  1 
ATOM   613  S  SD  A MET C 1 3  ? 15.792  16.164 19.940 0.30 31.28  ? 2   MET C SD  1 
ATOM   614  S  SD  B MET C 1 3  ? 15.687  16.282 21.385 0.30 34.48  ? 2   MET C SD  1 
ATOM   615  C  CE  A MET C 1 3  ? 14.565  15.437 21.035 0.50 32.14  ? 2   MET C CE  1 
ATOM   616  C  CE  B MET C 1 3  ? 14.668  15.644 20.050 0.50 32.32  ? 2   MET C CE  1 
ATOM   617  N  N   . LYS C 1 4  ? 18.257  21.037 21.131 1.00 32.46  ? 3   LYS C N   1 
ATOM   618  C  CA  . LYS C 1 4  ? 18.043  22.241 21.916 1.00 32.44  ? 3   LYS C CA  1 
ATOM   619  C  C   . LYS C 1 4  ? 17.241  23.300 21.138 1.00 33.68  ? 3   LYS C C   1 
ATOM   620  O  O   . LYS C 1 4  ? 16.335  23.914 21.702 1.00 33.90  ? 3   LYS C O   1 
ATOM   621  C  CB  . LYS C 1 4  ? 19.346  22.897 22.346 1.00 32.66  ? 3   LYS C CB  1 
ATOM   622  C  CG  A LYS C 1 4  ? 19.247  24.033 23.344 0.50 33.90  ? 3   LYS C CG  1 
ATOM   623  C  CD  A LYS C 1 4  ? 18.567  23.623 24.632 0.50 35.45  ? 3   LYS C CD  1 
ATOM   624  C  CE  A LYS C 1 4  ? 18.712  24.662 25.733 0.50 36.48  ? 3   LYS C CE  1 
ATOM   625  N  NZ  A LYS C 1 4  ? 17.623  25.681 25.688 0.50 37.35  ? 3   LYS C NZ  1 
ATOM   626  N  N   . GLN C 1 5  ? 17.600  23.561 19.886 1.00 31.17  ? 4   GLN C N   1 
ATOM   627  C  CA  . GLN C 1 5  ? 16.866  24.532 19.096 1.00 32.95  ? 4   GLN C CA  1 
ATOM   628  C  C   . GLN C 1 5  ? 15.384  24.100 18.978 1.00 30.58  ? 4   GLN C C   1 
ATOM   629  O  O   . GLN C 1 5  ? 14.523  24.967 19.130 1.00 30.13  ? 4   GLN C O   1 
ATOM   630  C  CB  . GLN C 1 5  ? 17.491  24.783 17.731 1.00 33.23  ? 4   GLN C CB  1 
ATOM   631  C  CG  A GLN C 1 5  ? 18.945  25.221 17.760 0.01 33.43  ? 4   GLN C CG  1 
ATOM   632  C  CD  A GLN C 1 5  ? 19.537  25.358 16.371 0.01 33.55  ? 4   GLN C CD  1 
ATOM   633  O  OE1 A GLN C 1 5  ? 19.382  24.474 15.529 0.01 33.57  ? 4   GLN C OE1 1 
ATOM   634  N  NE2 A GLN C 1 5  ? 20.220  26.470 16.124 0.01 33.59  ? 4   GLN C NE2 1 
ATOM   635  N  N   . LEU C 1 6  ? 15.093  22.827 18.836 1.00 27.86  ? 5   LEU C N   1 
ATOM   636  C  CA  . LEU C 1 6  ? 13.740  22.308 18.777 1.00 27.88  ? 5   LEU C CA  1 
ATOM   637  C  C   . LEU C 1 6  ? 12.974  22.584 20.069 1.00 27.47  ? 5   LEU C C   1 
ATOM   638  O  O   . LEU C 1 6  ? 11.859  23.159 20.087 1.00 25.07  ? 5   LEU C O   1 
ATOM   639  C  CB  . LEU C 1 6  ? 13.681  20.820 18.458 1.00 25.61  ? 5   LEU C CB  1 
ATOM   640  C  CG  . LEU C 1 6  ? 12.342  20.141 18.474 1.00 26.96  ? 5   LEU C CG  1 
ATOM   641  C  CD1 . LEU C 1 6  ? 11.351  20.820 17.521 1.00 27.64  ? 5   LEU C CD1 1 
ATOM   642  C  CD2 . LEU C 1 6  ? 12.391  18.664 18.048 1.00 29.74  ? 5   LEU C CD2 1 
ATOM   643  N  N   . GLU C 1 7  ? 13.584  22.296 21.211 1.00 27.98  ? 6   GLU C N   1 
ATOM   644  C  CA  . GLU C 1 7  ? 12.942  22.530 22.503 1.00 28.45  ? 6   GLU C CA  1 
ATOM   645  C  C   . GLU C 1 7  ? 12.595  23.997 22.692 1.00 28.57  ? 6   GLU C C   1 
ATOM   646  O  O   . GLU C 1 7  ? 11.568  24.448 23.181 1.00 26.51  ? 6   GLU C O   1 
ATOM   647  C  CB  . GLU C 1 7  ? 13.871  22.126 23.661 1.00 33.75  ? 6   GLU C CB  1 
ATOM   648  C  CG  . GLU C 1 7  ? 14.304  20.688 23.607 1.00 39.33  ? 6   GLU C CG  1 
ATOM   649  C  CD  . GLU C 1 7  ? 15.497  20.304 24.457 1.00 41.78  ? 6   GLU C CD  1 
ATOM   650  O  OE1 . GLU C 1 7  ? 15.889  20.997 25.417 1.00 44.86  ? 6   GLU C OE1 1 
ATOM   651  O  OE2 . GLU C 1 7  ? 16.062  19.232 24.164 1.00 43.97  ? 6   GLU C OE2 1 
ATOM   652  N  N   . ASP C 1 8  ? 13.550  24.851 22.313 1.00 28.71  ? 7   ASP C N   1 
ATOM   653  C  CA  . ASP C 1 8  ? 13.424  26.276 22.443 1.00 27.27  ? 7   ASP C CA  1 
ATOM   654  C  C   . ASP C 1 8  ? 12.282  26.800 21.550 1.00 26.31  ? 7   ASP C C   1 
ATOM   655  O  O   . ASP C 1 8  ? 11.525  27.612 22.039 1.00 25.81  ? 7   ASP C O   1 
ATOM   656  C  CB  . ASP C 1 8  ? 14.740  26.936 22.038 1.00 32.65  ? 7   ASP C CB  1 
ATOM   657  C  CG  . ASP C 1 8  ? 15.835  26.820 23.104 1.00 36.79  ? 7   ASP C CG  1 
ATOM   658  O  OD1 . ASP C 1 8  ? 16.959  27.283 22.766 1.00 37.89  ? 7   ASP C OD1 1 
ATOM   659  O  OD2 . ASP C 1 8  ? 15.556  26.325 24.214 1.00 38.30  ? 7   ASP C OD2 1 
ATOM   660  N  N   . LYS C 1 9  ? 12.191  26.369 20.298 1.00 23.70  ? 8   LYS C N   1 
ATOM   661  C  CA  . LYS C 1 9  ? 11.161  26.835 19.393 1.00 21.76  ? 8   LYS C CA  1 
ATOM   662  C  C   . LYS C 1 9  ? 9.801   26.319 19.866 1.00 20.99  ? 8   LYS C C   1 
ATOM   663  O  O   . LYS C 1 9  ? 8.840   27.087 19.755 1.00 21.05  ? 8   LYS C O   1 
ATOM   664  C  CB  . LYS C 1 9  ? 11.410  26.389 17.955 1.00 21.71  ? 8   LYS C CB  1 
ATOM   665  C  CG  . LYS C 1 9  ? 12.638  27.041 17.345 1.00 25.23  ? 8   LYS C CG  1 
ATOM   666  C  CD  A LYS C 1 9  ? 12.945  26.465 15.971 0.01 24.46  ? 8   LYS C CD  1 
ATOM   667  C  CE  A LYS C 1 9  ? 14.214  27.068 15.390 0.01 24.74  ? 8   LYS C CE  1 
ATOM   668  N  NZ  A LYS C 1 9  ? 14.553  26.475 14.067 0.01 24.66  ? 8   LYS C NZ  1 
ATOM   669  N  N   . VAL C 1 10 ? 9.740   25.115 20.414 1.00 19.99  ? 9   VAL C N   1 
ATOM   670  C  CA  . VAL C 1 10 ? 8.443   24.637 20.920 1.00 20.15  ? 9   VAL C CA  1 
ATOM   671  C  C   . VAL C 1 10 ? 8.004   25.445 22.106 1.00 20.94  ? 9   VAL C C   1 
ATOM   672  O  O   . VAL C 1 10 ? 6.822   25.782 22.217 1.00 20.39  ? 9   VAL C O   1 
ATOM   673  C  CB  . VAL C 1 10 ? 8.419   23.114 21.150 1.00 19.40  ? 9   VAL C CB  1 
ATOM   674  C  CG1 . VAL C 1 10 ? 7.105   22.676 21.745 1.00 21.71  ? 9   VAL C CG1 1 
ATOM   675  C  CG2 . VAL C 1 10 ? 8.702   22.486 19.795 1.00 17.41  ? 9   VAL C CG2 1 
ATOM   676  N  N   . GLU C 1 11 ? 8.907   25.888 22.997 1.00 20.83  ? 10  GLU C N   1 
ATOM   677  C  CA  . GLU C 1 11 ? 8.482   26.641 24.156 1.00 21.71  ? 10  GLU C CA  1 
ATOM   678  C  C   . GLU C 1 11 ? 8.029   28.013 23.706 1.00 21.44  ? 10  GLU C C   1 
ATOM   679  O  O   . GLU C 1 11 ? 7.075   28.561 24.289 1.00 21.63  ? 10  GLU C O   1 
ATOM   680  C  CB  . GLU C 1 11 ? 9.596   26.653 25.243 1.00 27.28  ? 10  GLU C CB  1 
ATOM   681  C  CG  . GLU C 1 11 ? 9.660   25.323 25.983 1.00 34.04  ? 10  GLU C CG  1 
ATOM   682  C  CD  . GLU C 1 11 ? 8.355   24.855 26.609 1.00 37.09  ? 10  GLU C CD  1 
ATOM   683  O  OE1 . GLU C 1 11 ? 7.812   25.599 27.471 1.00 39.35  ? 10  GLU C OE1 1 
ATOM   684  O  OE2 . GLU C 1 11 ? 7.798   23.768 26.259 1.00 39.29  ? 10  GLU C OE2 1 
ATOM   685  N  N   . GLU C 1 12 ? 8.697   28.579 22.717 1.00 19.83  ? 11  GLU C N   1 
ATOM   686  C  CA  . GLU C 1 12 ? 8.335   29.888 22.197 1.00 20.59  ? 11  GLU C CA  1 
ATOM   687  C  C   . GLU C 1 12 ? 6.965   29.822 21.539 1.00 19.55  ? 11  GLU C C   1 
ATOM   688  O  O   . GLU C 1 12 ? 6.188   30.765 21.704 1.00 18.23  ? 11  GLU C O   1 
ATOM   689  C  CB  . GLU C 1 12 ? 9.372   30.345 21.172 1.00 22.28  ? 11  GLU C CB  1 
ATOM   690  C  CG  . GLU C 1 12 ? 9.227   31.721 20.590 1.00 28.67  ? 11  GLU C CG  1 
ATOM   691  C  CD  . GLU C 1 12 ? 10.324  32.126 19.620 1.00 33.89  ? 11  GLU C CD  1 
ATOM   692  O  OE1 . GLU C 1 12 ? 11.286  31.354 19.318 1.00 35.55  ? 11  GLU C OE1 1 
ATOM   693  O  OE2 . GLU C 1 12 ? 10.199  33.252 19.081 1.00 37.02  ? 11  GLU C OE2 1 
ATOM   694  N  N   . LEU C 1 13 ? 6.751   28.749 20.730 1.00 15.11  ? 12  LEU C N   1 
ATOM   695  C  CA  . LEU C 1 13 ? 5.457   28.583 20.111 1.00 16.25  ? 12  LEU C CA  1 
ATOM   696  C  C   . LEU C 1 13 ? 4.332   28.553 21.160 1.00 16.47  ? 12  LEU C C   1 
ATOM   697  O  O   . LEU C 1 13 ? 3.297   29.246 21.020 1.00 16.81  ? 12  LEU C O   1 
ATOM   698  C  CB  . LEU C 1 13 ? 5.422   27.306 19.283 1.00 14.33  ? 12  LEU C CB  1 
ATOM   699  C  CG  . LEU C 1 13 ? 4.095   26.954 18.628 1.00 14.93  ? 12  LEU C CG  1 
ATOM   700  C  CD1 . LEU C 1 13 ? 3.827   27.949 17.506 1.00 14.59  ? 12  LEU C CD1 1 
ATOM   701  C  CD2 . LEU C 1 13 ? 4.005   25.507 18.184 1.00 16.48  ? 12  LEU C CD2 1 
ATOM   702  N  N   . LEU C 1 14 ? 4.537   27.796 22.243 1.00 16.24  ? 13  LEU C N   1 
ATOM   703  C  CA  . LEU C 1 14 ? 3.499   27.706 23.271 1.00 16.21  ? 13  LEU C CA  1 
ATOM   704  C  C   . LEU C 1 14 ? 3.264   29.077 23.883 1.00 17.26  ? 13  LEU C C   1 
ATOM   705  O  O   . LEU C 1 14 ? 2.130   29.442 24.192 1.00 17.04  ? 13  LEU C O   1 
ATOM   706  C  CB  . LEU C 1 14 ? 3.897   26.645 24.289 1.00 16.20  ? 13  LEU C CB  1 
ATOM   707  C  CG  . LEU C 1 14 ? 2.929   26.285 25.414 1.00 18.54  ? 13  LEU C CG  1 
ATOM   708  C  CD1 . LEU C 1 14 ? 1.525   25.924 24.936 1.00 18.05  ? 13  LEU C CD1 1 
ATOM   709  C  CD2 . LEU C 1 14 ? 3.530   25.158 26.272 1.00 19.78  ? 13  LEU C CD2 1 
ATOM   710  N  N   . SER C 1 15 ? 4.345   29.796 24.189 1.00 18.49  ? 14  SER C N   1 
ATOM   711  C  CA  . SER C 1 15 ? 4.128   31.105 24.847 1.00 19.25  ? 14  SER C CA  1 
ATOM   712  C  C   . SER C 1 15 ? 3.489   32.099 23.897 1.00 18.08  ? 14  SER C C   1 
ATOM   713  O  O   . SER C 1 15 ? 2.590   32.875 24.298 1.00 15.07  ? 14  SER C O   1 
ATOM   714  C  CB  . SER C 1 15 ? 5.454   31.432 25.550 1.00 19.82  ? 14  SER C CB  1 
ATOM   715  O  OG  . SER C 1 15 ? 5.677   32.777 25.323 1.00 24.83  ? 14  SER C OG  1 
ATOM   716  N  N   . LYS C 1 16 ? 3.750   32.028 22.607 1.00 17.02  ? 15  LYS C N   1 
ATOM   717  C  CA  . LYS C 1 16 ? 3.071   32.837 21.595 1.00 16.72  ? 15  LYS C CA  1 
ATOM   718  C  C   . LYS C 1 16 ? 1.599   32.494 21.454 1.00 16.52  ? 15  LYS C C   1 
ATOM   719  O  O   . LYS C 1 16 ? 0.749   33.368 21.263 1.00 17.45  ? 15  LYS C O   1 
ATOM   720  C  CB  . LYS C 1 16 ? 3.811   32.804 20.286 1.00 16.47  ? 15  LYS C CB  1 
ATOM   721  C  CG  . LYS C 1 16 ? 5.080   33.646 20.319 1.00 19.08  ? 15  LYS C CG  1 
ATOM   722  C  CD  . LYS C 1 16 ? 5.723   33.646 18.921 1.00 21.51  ? 15  LYS C CD  1 
ATOM   723  C  CE  . LYS C 1 16 ? 6.949   34.579 19.011 1.00 24.24  ? 15  LYS C CE  1 
ATOM   724  N  NZ  . LYS C 1 16 ? 7.731   34.520 17.745 1.00 25.57  ? 15  LYS C NZ  1 
ATOM   725  N  N   . ALA C 1 17 ? 1.288   31.225 21.505 1.00 15.36  ? 16  ALA C N   1 
ATOM   726  C  CA  . ALA C 1 17 ? -0.069  30.714 21.441 1.00 17.05  ? 16  ALA C CA  1 
ATOM   727  C  C   . ALA C 1 17 ? -0.861  31.189 22.690 1.00 15.13  ? 16  ALA C C   1 
ATOM   728  O  O   . ALA C 1 17 ? -2.019  31.637 22.556 1.00 17.69  ? 16  ALA C O   1 
ATOM   729  C  CB  . ALA C 1 17 ? -0.045  29.193 21.375 1.00 14.96  ? 16  ALA C CB  1 
ATOM   730  N  N   . TYR C 1 18 ? -0.284  31.080 23.857 1.00 14.35  ? 17  TYR C N   1 
ATOM   731  C  CA  . TYR C 1 18 ? -0.983  31.632 25.034 1.00 13.85  ? 17  TYR C CA  1 
ATOM   732  C  C   . TYR C 1 18 ? -1.194  33.118 24.904 1.00 14.26  ? 17  TYR C C   1 
ATOM   733  O  O   . TYR C 1 18 ? -2.285  33.562 25.327 1.00 17.06  ? 17  TYR C O   1 
ATOM   734  C  CB  . TYR C 1 18 ? -0.227  31.437 26.326 1.00 12.37  ? 17  TYR C CB  1 
ATOM   735  C  CG  . TYR C 1 18 ? -0.087  30.064 26.864 1.00 14.30  ? 17  TYR C CG  1 
ATOM   736  C  CD1 . TYR C 1 18 ? 1.156   29.680 27.376 1.00 15.63  ? 17  TYR C CD1 1 
ATOM   737  C  CD2 . TYR C 1 18 ? -1.131  29.147 26.922 1.00 14.12  ? 17  TYR C CD2 1 
ATOM   738  C  CE1 . TYR C 1 18 ? 1.364   28.436 27.963 1.00 15.32  ? 17  TYR C CE1 1 
ATOM   739  C  CE2 . TYR C 1 18 ? -0.958  27.908 27.522 1.00 17.02  ? 17  TYR C CE2 1 
ATOM   740  C  CZ  . TYR C 1 18 ? 0.286   27.558 28.014 1.00 16.63  ? 17  TYR C CZ  1 
ATOM   741  O  OH  . TYR C 1 18 ? 0.453   26.326 28.569 1.00 19.81  ? 17  TYR C OH  1 
ATOM   742  N  N   . HIS C 1 19 ? -0.234  33.855 24.380 1.00 16.55  ? 18  HIS C N   1 
ATOM   743  C  CA  . HIS C 1 19 ? -0.396  35.300 24.197 1.00 17.02  ? 18  HIS C CA  1 
ATOM   744  C  C   . HIS C 1 19 ? -1.551  35.568 23.249 1.00 18.79  ? 18  HIS C C   1 
ATOM   745  O  O   . HIS C 1 19 ? -2.499  36.311 23.520 1.00 18.53  ? 18  HIS C O   1 
ATOM   746  C  CB  . HIS C 1 19 ? 0.917   35.940 23.748 1.00 17.45  ? 18  HIS C CB  1 
ATOM   747  C  CG  . HIS C 1 19 ? 0.811   37.424 23.591 1.00 22.79  ? 18  HIS C CG  1 
ATOM   748  N  ND1 . HIS C 1 19 ? 0.428   38.280 24.611 1.00 24.34  ? 18  HIS C ND1 1 
ATOM   749  C  CD2 . HIS C 1 19 ? 0.999   38.227 22.521 1.00 26.44  ? 18  HIS C CD2 1 
ATOM   750  C  CE1 . HIS C 1 19 ? 0.432   39.517 24.196 1.00 24.73  ? 18  HIS C CE1 1 
ATOM   751  N  NE2 . HIS C 1 19 ? 0.748   39.526 22.931 1.00 27.17  ? 18  HIS C NE2 1 
ATOM   752  N  N   . LEU C 1 20 ? -1.523  34.917 22.093 1.00 19.23  ? 19  LEU C N   1 
ATOM   753  C  CA  . LEU C 1 20 ? -2.611  35.022 21.122 1.00 15.33  ? 19  LEU C CA  1 
ATOM   754  C  C   . LEU C 1 20 ? -3.950  34.653 21.758 1.00 17.39  ? 19  LEU C C   1 
ATOM   755  O  O   . LEU C 1 20 ? -4.949  35.362 21.459 1.00 17.55  ? 19  LEU C O   1 
ATOM   756  C  CB  . LEU C 1 20 ? -2.284  34.151 19.923 1.00 16.72  ? 19  LEU C CB  1 
ATOM   757  C  CG  . LEU C 1 20 ? -3.339  34.118 18.805 1.00 17.01  ? 19  LEU C CG  1 
ATOM   758  C  CD1 . LEU C 1 20 ? -3.612  35.531 18.289 1.00 17.21  ? 19  LEU C CD1 1 
ATOM   759  C  CD2 . LEU C 1 20 ? -2.908  33.224 17.639 1.00 16.15  ? 19  LEU C CD2 1 
ATOM   760  N  N   . GLU C 1 21 ? -4.115  33.580 22.526 1.00 17.13  ? 20  GLU C N   1 
ATOM   761  C  CA  . GLU C 1 21 ? -5.381  33.197 23.118 1.00 19.00  ? 20  GLU C CA  1 
ATOM   762  C  C   . GLU C 1 21 ? -5.936  34.335 24.002 1.00 18.99  ? 20  GLU C C   1 
ATOM   763  O  O   . GLU C 1 21 ? -7.153  34.565 23.924 1.00 20.31  ? 20  GLU C O   1 
ATOM   764  C  CB  . GLU C 1 21 ? -5.401  31.900 23.904 1.00 19.69  ? 20  GLU C CB  1 
ATOM   765  C  CG  . GLU C 1 21 ? -6.797  31.347 24.264 1.00 19.99  ? 20  GLU C CG  1 
ATOM   766  C  CD  . GLU C 1 21 ? -6.750  30.033 25.021 1.00 21.78  ? 20  GLU C CD  1 
ATOM   767  O  OE1 . GLU C 1 21 ? -5.992  30.028 25.982 1.00 22.86  ? 20  GLU C OE1 1 
ATOM   768  O  OE2 . GLU C 1 21 ? -7.369  28.957 24.731 1.00 24.43  ? 20  GLU C OE2 1 
ATOM   769  N  N   . ASN C 1 22 ? -5.077  34.984 24.775 1.00 18.47  ? 21  ASN C N   1 
ATOM   770  C  CA  . ASN C 1 22 ? -5.595  36.072 25.602 1.00 18.07  ? 21  ASN C CA  1 
ATOM   771  C  C   . ASN C 1 22 ? -5.927  37.315 24.786 1.00 18.65  ? 21  ASN C C   1 
ATOM   772  O  O   . ASN C 1 22 ? -6.911  37.970 25.104 1.00 18.59  ? 21  ASN C O   1 
ATOM   773  C  CB  . ASN C 1 22 ? -4.633  36.413 26.744 1.00 20.70  ? 21  ASN C CB  1 
ATOM   774  C  CG  . ASN C 1 22 ? -5.517  37.162 27.768 1.00 22.60  ? 21  ASN C CG  1 
ATOM   775  O  OD1 . ASN C 1 22 ? -6.630  36.719 28.131 1.00 23.73  ? 21  ASN C OD1 1 
ATOM   776  N  ND2 . ASN C 1 22 ? -4.963  38.277 28.103 1.00 21.79  ? 21  ASN C ND2 1 
ATOM   777  N  N   . GLU C 1 23 ? -5.209  37.616 23.716 1.00 19.06  ? 22  GLU C N   1 
ATOM   778  C  CA  . GLU C 1 23 ? -5.508  38.732 22.815 1.00 17.91  ? 22  GLU C CA  1 
ATOM   779  C  C   . GLU C 1 23 ? -6.826  38.529 22.120 1.00 17.46  ? 22  GLU C C   1 
ATOM   780  O  O   . GLU C 1 23 ? -7.637  39.468 21.993 1.00 19.78  ? 22  GLU C O   1 
ATOM   781  C  CB  . GLU C 1 23 ? -4.400  38.979 21.794 1.00 20.28  ? 22  GLU C CB  1 
ATOM   782  C  CG  . GLU C 1 23 ? -3.147  39.559 22.505 1.00 25.16  ? 22  GLU C CG  1 
ATOM   783  C  CD  A GLU C 1 23 ? -2.111  39.541 21.409 0.50 27.29  ? 22  GLU C CD  1 
ATOM   784  C  CD  B GLU C 1 23 ? -3.443  40.878 23.200 0.50 28.89  ? 22  GLU C CD  1 
ATOM   785  O  OE1 A GLU C 1 23 ? -1.781  38.325 21.300 0.50 29.52  ? 22  GLU C OE1 1 
ATOM   786  O  OE1 B GLU C 1 23 ? -4.284  41.635 22.680 0.50 30.57  ? 22  GLU C OE1 1 
ATOM   787  O  OE2 A GLU C 1 23 ? -1.760  40.493 20.697 0.50 27.96  ? 22  GLU C OE2 1 
ATOM   788  O  OE2 B GLU C 1 23 ? -2.869  41.189 24.261 0.50 30.75  ? 22  GLU C OE2 1 
ATOM   789  N  N   . VAL C 1 24 ? -7.113  37.314 21.682 1.00 17.89  ? 23  VAL C N   1 
ATOM   790  C  CA  . VAL C 1 24 ? -8.408  36.969 21.110 1.00 15.95  ? 23  VAL C CA  1 
ATOM   791  C  C   . VAL C 1 24 ? -9.504  37.102 22.177 1.00 19.84  ? 23  VAL C C   1 
ATOM   792  O  O   . VAL C 1 24 ? -10.599 37.626 21.875 1.00 19.99  ? 23  VAL C O   1 
ATOM   793  C  CB  . VAL C 1 24 ? -8.415  35.561 20.492 1.00 16.95  ? 23  VAL C CB  1 
ATOM   794  C  CG1 . VAL C 1 24 ? -9.823  35.089 20.109 1.00 18.60  ? 23  VAL C CG1 1 
ATOM   795  C  CG2 . VAL C 1 24 ? -7.532  35.522 19.241 1.00 17.05  ? 23  VAL C CG2 1 
ATOM   796  N  N   . ALA C 1 25 ? -9.258  36.743 23.429 1.00 18.18  ? 24  ALA C N   1 
ATOM   797  C  CA  . ALA C 1 25 ? -10.273 36.888 24.492 1.00 20.10  ? 24  ALA C CA  1 
ATOM   798  C  C   . ALA C 1 25 ? -10.565 38.381 24.745 1.00 19.91  ? 24  ALA C C   1 
ATOM   799  O  O   . ALA C 1 25 ? -11.733 38.745 24.917 1.00 21.17  ? 24  ALA C O   1 
ATOM   800  C  CB  . ALA C 1 25 ? -9.814  36.208 25.762 1.00 17.55  ? 24  ALA C CB  1 
ATOM   801  N  N   . ARG C 1 26 ? -9.537  39.226 24.799 1.00 21.73  ? 25  ARG C N   1 
ATOM   802  C  CA  . ARG C 1 26 ? -9.719  40.658 24.935 1.00 25.97  ? 25  ARG C CA  1 
ATOM   803  C  C   . ARG C 1 26 ? -10.516 41.146 23.717 1.00 26.48  ? 25  ARG C C   1 
ATOM   804  O  O   . ARG C 1 26 ? -11.462 41.925 23.876 1.00 28.92  ? 25  ARG C O   1 
ATOM   805  C  CB  . ARG C 1 26 ? -8.428  41.451 25.141 1.00 23.66  ? 25  ARG C CB  1 
ATOM   806  C  CG  . ARG C 1 26 ? -7.591  41.051 26.326 1.00 25.77  ? 25  ARG C CG  1 
ATOM   807  C  CD  . ARG C 1 26 ? -6.363  41.793 26.744 1.00 27.57  ? 25  ARG C CD  1 
ATOM   808  N  NE  A ARG C 1 26 ? -5.190  41.661 25.903 0.50 24.50  ? 25  ARG C NE  1 
ATOM   809  N  NE  B ARG C 1 26 ? -5.872  42.783 25.813 0.50 31.97  ? 25  ARG C NE  1 
ATOM   810  C  CZ  A ARG C 1 26 ? -4.930  42.398 24.815 0.50 25.18  ? 25  ARG C CZ  1 
ATOM   811  C  CZ  B ARG C 1 26 ? -4.647  42.998 25.364 0.50 33.28  ? 25  ARG C CZ  1 
ATOM   812  N  NH1 A ARG C 1 26 ? -5.753  43.353 24.396 0.50 22.33  ? 25  ARG C NH1 1 
ATOM   813  N  NH1 B ARG C 1 26 ? -3.618  42.240 25.752 0.50 35.19  ? 25  ARG C NH1 1 
ATOM   814  N  NH2 A ARG C 1 26 ? -3.806  42.164 24.131 0.50 23.11  ? 25  ARG C NH2 1 
ATOM   815  N  NH2 B ARG C 1 26 ? -4.431  43.970 24.498 0.50 34.08  ? 25  ARG C NH2 1 
ATOM   816  N  N   . LEU C 1 27 ? -10.212 40.745 22.500 1.00 28.29  ? 26  LEU C N   1 
ATOM   817  C  CA  . LEU C 1 27 ? -10.958 41.182 21.315 1.00 28.02  ? 26  LEU C CA  1 
ATOM   818  C  C   . LEU C 1 27 ? -12.436 40.750 21.409 1.00 29.95  ? 26  LEU C C   1 
ATOM   819  O  O   . LEU C 1 27 ? -13.356 41.502 21.053 1.00 29.86  ? 26  LEU C O   1 
ATOM   820  C  CB  . LEU C 1 27 ? -10.448 40.634 20.016 1.00 28.76  ? 26  LEU C CB  1 
ATOM   821  C  CG  . LEU C 1 27 ? -11.032 41.108 18.700 1.00 29.76  ? 26  LEU C CG  1 
ATOM   822  C  CD1 . LEU C 1 27 ? -10.831 42.612 18.509 1.00 31.19  ? 26  LEU C CD1 1 
ATOM   823  C  CD2 . LEU C 1 27 ? -10.391 40.402 17.513 1.00 31.69  ? 26  LEU C CD2 1 
ATOM   824  N  N   . LYS C 1 28 ? -12.711 39.552 21.887 1.00 28.84  ? 27  LYS C N   1 
ATOM   825  C  CA  . LYS C 1 28 ? -14.062 39.054 22.076 1.00 32.92  ? 27  LYS C CA  1 
ATOM   826  C  C   . LYS C 1 28 ? -14.867 39.945 23.032 1.00 34.30  ? 27  LYS C C   1 
ATOM   827  O  O   . LYS C 1 28 ? -16.090 40.026 22.956 1.00 34.10  ? 27  LYS C O   1 
ATOM   828  C  CB  . LYS C 1 28 ? -14.001 37.593 22.538 1.00 31.42  ? 27  LYS C CB  1 
ATOM   829  C  CG  A LYS C 1 28 ? -15.294 36.825 22.486 0.50 32.82  ? 27  LYS C CG  1 
ATOM   830  C  CD  A LYS C 1 28 ? -15.105 35.411 23.030 0.50 33.23  ? 27  LYS C CD  1 
ATOM   831  C  CE  A LYS C 1 28 ? -16.271 34.508 22.689 0.50 33.89  ? 27  LYS C CE  1 
ATOM   832  N  NZ  A LYS C 1 28 ? -17.579 35.219 22.784 0.50 36.39  ? 27  LYS C NZ  1 
ATOM   833  N  N   . LYS C 1 29 ? -14.237 40.690 23.923 1.00 37.28  ? 28  LYS C N   1 
ATOM   834  C  CA  . LYS C 1 29 ? -14.845 41.638 24.835 1.00 39.61  ? 28  LYS C CA  1 
ATOM   835  C  C   . LYS C 1 29 ? -15.300 42.892 24.100 1.00 40.82  ? 28  LYS C C   1 
ATOM   836  O  O   . LYS C 1 29 ? -16.225 43.596 24.513 1.00 43.49  ? 28  LYS C O   1 
ATOM   837  C  CB  . LYS C 1 29 ? -13.894 42.032 25.968 1.00 40.23  ? 28  LYS C CB  1 
ATOM   838  C  CG  . LYS C 1 29 ? -13.809 40.970 27.056 1.00 39.43  ? 28  LYS C CG  1 
ATOM   839  C  CD  A LYS C 1 29 ? -12.773 41.340 28.106 0.01 39.83  ? 28  LYS C CD  1 
ATOM   840  C  CE  A LYS C 1 29 ? -12.641 40.250 29.158 0.01 39.85  ? 28  LYS C CE  1 
ATOM   841  N  NZ  A LYS C 1 29 ? -11.595 40.575 30.166 0.01 39.92  ? 28  LYS C NZ  1 
ATOM   842  N  N   . LEU C 1 30 ? -14.658 43.198 22.983 1.00 40.95  ? 29  LEU C N   1 
ATOM   843  C  CA  . LEU C 1 30 ? -15.059 44.311 22.145 1.00 40.77  ? 29  LEU C CA  1 
ATOM   844  C  C   . LEU C 1 30 ? -16.069 43.928 21.099 1.00 41.40  ? 29  LEU C C   1 
ATOM   845  O  O   . LEU C 1 30 ? -16.854 44.803 20.696 1.00 43.98  ? 29  LEU C O   1 
ATOM   846  C  CB  . LEU C 1 30 ? -13.819 44.899 21.475 1.00 41.37  ? 29  LEU C CB  1 
ATOM   847  C  CG  . LEU C 1 30 ? -12.912 45.781 22.328 1.00 41.77  ? 29  LEU C CG  1 
ATOM   848  C  CD1 . LEU C 1 30 ? -11.442 45.635 21.944 1.00 42.48  ? 29  LEU C CD1 1 
ATOM   849  C  CD2 . LEU C 1 30 ? -13.317 47.242 22.152 1.00 43.32  ? 29  LEU C CD2 1 
ATOM   850  N  N   A VAL C 1 31 ? -16.079 42.699 20.594 0.50 42.01  ? 30  VAL C N   1 
ATOM   851  N  N   B VAL C 1 31 ? -16.098 42.705 20.562 0.50 41.60  ? 30  VAL C N   1 
ATOM   852  C  CA  A VAL C 1 31 ? -17.016 42.384 19.534 0.50 42.68  ? 30  VAL C CA  1 
ATOM   853  C  CA  B VAL C 1 31 ? -16.993 42.382 19.470 0.50 41.93  ? 30  VAL C CA  1 
ATOM   854  C  C   A VAL C 1 31 ? -18.078 41.358 19.891 0.50 43.81  ? 30  VAL C C   1 
ATOM   855  C  C   B VAL C 1 31 ? -17.967 41.220 19.590 0.50 43.13  ? 30  VAL C C   1 
ATOM   856  O  O   A VAL C 1 31 ? -19.271 41.636 19.727 0.50 44.77  ? 30  VAL C O   1 
ATOM   857  O  O   B VAL C 1 31 ? -18.629 40.959 18.550 0.50 42.61  ? 30  VAL C O   1 
ATOM   858  C  CB  A VAL C 1 31 ? -16.315 41.882 18.257 0.50 43.01  ? 30  VAL C CB  1 
ATOM   859  C  CB  B VAL C 1 31 ? -16.195 42.124 18.165 0.50 42.13  ? 30  VAL C CB  1 
ATOM   860  C  CG1 A VAL C 1 31 ? -17.338 41.685 17.146 0.50 43.59  ? 30  VAL C CG1 1 
ATOM   861  C  CG1 B VAL C 1 31 ? -15.601 43.412 17.624 0.50 42.88  ? 30  VAL C CG1 1 
ATOM   862  C  CG2 A VAL C 1 31 ? -15.209 42.814 17.798 0.50 43.75  ? 30  VAL C CG2 1 
ATOM   863  C  CG2 B VAL C 1 31 ? -15.125 41.067 18.400 0.50 42.31  ? 30  VAL C CG2 1 
ATOM   864  N  N   . GLY C 1 32 ? -17.661 40.210 20.391 1.00 43.83  ? 31  GLY C N   1 
ATOM   865  C  CA  . GLY C 1 32 ? -18.612 39.112 20.618 1.00 45.68  ? 31  GLY C CA  1 
ATOM   866  C  C   . GLY C 1 32 ? -18.499 38.155 19.403 1.00 45.05  ? 31  GLY C C   1 
HETATM 867  CL CL  . CL  D 2 .  ? 5.345   10.941 20.478 1.00 65.90  ? 806 CL  A CL  1 
HETATM 868  CL CL  . CL  E 2 .  ? -16.369 40.775 11.714 1.00 50.13  ? 808 CL  A CL  1 
HETATM 869  CL CL  . CL  F 2 .  ? -12.077 26.014 23.857 1.00 44.74  ? 810 CL  A CL  1 
HETATM 870  K  K   . K   G 3 .  ? -6.879  29.848 6.955  1.00 29.44  ? 802 K   B K   1 
HETATM 871  CL CL  A CL  H 2 .  ? 8.380   31.563 16.721 0.50 22.71  ? 803 CL  B CL  1 
HETATM 872  CL CL  B CL  H 2 .  ? 7.156   31.164 16.886 0.50 27.55  ? 803 CL  B CL  1 
HETATM 873  CL CL  . CL  I 2 .  ? 0.615   19.417 12.285 1.00 28.89  ? 804 CL  B CL  1 
HETATM 874  CL CL  . CL  J 2 .  ? 3.939   36.748 18.679 1.00 40.59  ? 805 CL  B CL  1 
HETATM 875  CL CL  . CL  K 2 .  ? 9.335   21.052 7.196  1.00 45.87  ? 809 CL  B CL  1 
HETATM 876  CL CL  . CL  L 2 .  ? 9.555   27.936 14.678 1.00 30.58  ? 811 CL  B CL  1 
HETATM 877  K  K   . K   M 3 .  ? -0.698  38.164 19.050 1.00 30.96  ? 801 K   C K   1 
HETATM 878  O  O   A HOH N 4 .  ? -1.763  19.947 7.858  0.50 19.66  ? 903 HOH A O   1 
HETATM 879  O  O   B HOH N 4 .  ? -12.991 34.196 25.581 0.50 26.58  ? 903 HOH A O   1 
HETATM 880  O  O   A HOH N 4 .  ? 0.154   14.665 23.534 0.50 17.87  ? 904 HOH A O   1 
HETATM 881  O  O   B HOH N 4 .  ? 0.964   13.317 23.349 0.50 30.38  ? 904 HOH A O   1 
HETATM 882  O  O   A HOH N 4 .  ? -1.004  16.981 24.711 0.50 20.35  ? 905 HOH A O   1 
HETATM 883  O  O   B HOH N 4 .  ? -0.902  15.768 23.250 0.50 38.12  ? 905 HOH A O   1 
HETATM 884  O  O   . HOH N 4 .  ? 4.067   16.766 15.763 1.00 30.51  ? 906 HOH A O   1 
HETATM 885  O  O   A HOH N 4 .  ? -5.360  20.502 16.512 0.50 21.57  ? 907 HOH A O   1 
HETATM 886  O  O   B HOH N 4 .  ? 13.451  29.838 20.222 0.50 24.42  ? 907 HOH A O   1 
HETATM 887  O  O   . HOH N 4 .  ? -10.127 31.002 21.622 1.00 30.12  ? 908 HOH A O   1 
HETATM 888  O  O   . HOH N 4 .  ? -7.465  25.615 10.477 1.00 17.78  ? 909 HOH A O   1 
HETATM 889  O  O   . HOH N 4 .  ? -0.777  23.613 11.668 1.00 19.68  ? 910 HOH A O   1 
HETATM 890  O  O   . HOH N 4 .  ? 21.445  9.530  28.575 1.00 23.32  ? 911 HOH A O   1 
HETATM 891  O  O   . HOH N 4 .  ? -4.875  23.513 9.923  1.00 22.87  ? 912 HOH A O   1 
HETATM 892  O  O   . HOH N 4 .  ? -10.420 24.074 17.224 1.00 24.36  ? 913 HOH A O   1 
HETATM 893  O  O   . HOH N 4 .  ? -2.930  18.474 22.647 1.00 25.50  ? 914 HOH A O   1 
HETATM 894  O  O   . HOH N 4 .  ? -18.513 34.369 14.960 1.00 30.18  ? 915 HOH A O   1 
HETATM 895  O  O   . HOH N 4 .  ? -5.514  22.512 24.445 1.00 18.70  ? 916 HOH A O   1 
HETATM 896  O  O   . HOH N 4 .  ? -7.238  23.854 22.761 1.00 23.88  ? 917 HOH A O   1 
HETATM 897  O  O   . HOH N 4 .  ? -9.474  24.982 13.452 1.00 27.37  ? 918 HOH A O   1 
HETATM 898  O  O   . HOH N 4 .  ? -9.444  32.654 11.202 1.00 25.88  ? 919 HOH A O   1 
HETATM 899  O  O   . HOH N 4 .  ? -17.673 37.220 14.069 1.00 31.89  ? 920 HOH A O   1 
HETATM 900  O  O   . HOH N 4 .  ? -3.360  18.363 18.294 1.00 28.55  ? 921 HOH A O   1 
HETATM 901  O  O   . HOH N 4 .  ? 8.899   19.538 26.147 1.00 33.00  ? 922 HOH A O   1 
HETATM 902  O  O   . HOH N 4 .  ? -4.669  19.916 24.269 1.00 37.49  ? 923 HOH A O   1 
HETATM 903  O  O   . HOH N 4 .  ? 16.967  9.739  29.311 1.00 37.72  ? 924 HOH A O   1 
HETATM 904  O  O   . HOH N 4 .  ? -11.774 27.858 11.215 1.00 30.12  ? 925 HOH A O   1 
HETATM 905  O  O   . HOH N 4 .  ? 10.387  8.601  25.724 1.00 36.80  ? 926 HOH A O   1 
HETATM 906  O  O   . HOH N 4 .  ? -3.193  21.876 29.874 1.00 41.50  ? 927 HOH A O   1 
HETATM 907  O  O   . HOH N 4 .  ? -1.303  17.722 16.909 1.00 38.66  ? 928 HOH A O   1 
HETATM 908  O  O   . HOH N 4 .  ? 11.878  14.602 28.939 1.00 35.30  ? 929 HOH A O   1 
HETATM 909  O  O   . HOH N 4 .  ? 14.612  14.141 30.138 1.00 28.55  ? 930 HOH A O   1 
HETATM 910  O  O   . HOH N 4 .  ? 8.397   9.201  27.795 1.00 49.04  ? 931 HOH A O   1 
HETATM 911  O  O   . HOH N 4 .  ? 8.010   11.948 28.319 1.00 42.39  ? 932 HOH A O   1 
HETATM 912  O  O   . HOH N 4 .  ? 11.303  18.560 26.812 1.00 36.20  ? 933 HOH A O   1 
HETATM 913  O  O   . HOH N 4 .  ? -14.132 26.930 12.101 1.00 35.41  ? 934 HOH A O   1 
HETATM 914  O  O   . HOH N 4 .  ? -12.225 33.756 8.764  1.00 35.77  ? 935 HOH A O   1 
HETATM 915  O  O   . HOH N 4 .  ? -12.540 24.590 19.662 1.00 45.84  ? 936 HOH A O   1 
HETATM 916  O  O   . HOH N 4 .  ? 17.036  5.836  23.570 1.00 41.66  ? 937 HOH A O   1 
HETATM 917  O  O   . HOH N 4 .  ? -13.381 27.410 19.509 1.00 38.99  ? 938 HOH A O   1 
HETATM 918  O  O   . HOH N 4 .  ? 12.924  20.890 26.895 1.00 50.53  ? 939 HOH A O   1 
HETATM 919  O  O   . HOH N 4 .  ? -11.224 23.462 14.538 1.00 48.26  ? 940 HOH A O   1 
HETATM 920  O  O   . HOH N 4 .  ? -3.343  19.770 27.463 1.00 52.74  ? 941 HOH A O   1 
HETATM 921  O  O   . HOH N 4 .  ? -17.787 32.618 19.832 1.00 55.58  ? 942 HOH A O   1 
HETATM 922  O  O   . HOH N 4 .  ? -12.179 33.922 22.929 1.00 42.14  ? 943 HOH A O   1 
HETATM 923  O  O   . HOH N 4 .  ? -0.668  19.083 27.996 1.00 43.01  ? 944 HOH A O   1 
HETATM 924  O  O   . HOH N 4 .  ? -18.510 34.869 18.315 1.00 54.18  ? 945 HOH A O   1 
HETATM 925  O  O   . HOH N 4 .  ? 8.643   7.531  23.744 1.00 70.17  ? 946 HOH A O   1 
HETATM 926  O  O   . HOH N 4 .  ? 8.464   12.075 20.487 1.00 36.34  ? 947 HOH A O   1 
HETATM 927  O  O   . HOH N 4 .  ? -14.868 31.536 8.381  1.00 46.50  ? 948 HOH A O   1 
HETATM 928  O  O   . HOH N 4 .  ? -8.714  21.753 19.080 1.00 44.53  ? 949 HOH A O   1 
HETATM 929  O  O   . HOH N 4 .  ? 4.905   17.518 28.422 1.00 47.06  ? 950 HOH A O   1 
HETATM 930  O  O   . HOH N 4 .  ? -16.476 26.947 9.546  1.00 65.55  ? 951 HOH A O   1 
HETATM 931  O  O   . HOH N 4 .  ? 18.354  15.192 24.900 1.00 48.41  ? 952 HOH A O   1 
HETATM 932  O  O   . HOH N 4 .  ? 2.258   19.268 26.926 1.00 47.68  ? 953 HOH A O   1 
HETATM 933  O  O   . HOH N 4 .  ? 2.220   12.456 16.035 1.00 106.07 ? 954 HOH A O   1 
HETATM 934  O  O   . HOH N 4 .  ? 7.327   19.410 28.920 1.00 53.02  ? 955 HOH A O   1 
HETATM 935  O  O   . HOH N 4 .  ? 11.375  17.442 29.331 1.00 57.91  ? 956 HOH A O   1 
HETATM 936  O  O   . HOH N 4 .  ? -2.992  21.591 9.764  1.00 55.17  ? 957 HOH A O   1 
HETATM 937  O  O   . HOH N 4 .  ? -7.857  20.567 16.553 1.00 60.94  ? 958 HOH A O   1 
HETATM 938  O  O   . HOH N 4 .  ? 5.468   14.475 28.138 1.00 80.75  ? 959 HOH A O   1 
HETATM 939  O  O   A HOH O 4 .  ? 0.321   35.888 8.709  0.50 10.10  ? 901 HOH B O   1 
HETATM 940  O  O   A HOH O 4 .  ? 6.202   35.769 15.654 0.50 18.77  ? 902 HOH B O   1 
HETATM 941  O  O   B HOH O 4 .  ? 6.141   34.197 15.618 0.50 25.79  ? 902 HOH B O   1 
HETATM 942  O  O   A HOH O 4 .  ? 2.628   17.265 10.159 0.50 33.11  ? 903 HOH B O   1 
HETATM 943  O  O   A HOH O 4 .  ? -6.785  33.232 10.625 0.50 248.55 ? 904 HOH B O   1 
HETATM 944  O  O   B HOH O 4 .  ? -6.930  33.211 10.446 0.50 24.96  ? 904 HOH B O   1 
HETATM 945  O  O   . HOH O 4 .  ? 10.913  24.349 11.976 1.00 32.00  ? 905 HOH B O   1 
HETATM 946  O  O   . HOH O 4 .  ? 10.089  25.936 7.753  1.00 40.57  ? 906 HOH B O   1 
HETATM 947  O  O   . HOH O 4 .  ? 10.657  21.544 9.656  1.00 33.81  ? 907 HOH B O   1 
HETATM 948  O  O   . HOH O 4 .  ? 6.544   28.297 8.967  1.00 20.89  ? 908 HOH B O   1 
HETATM 949  O  O   . HOH O 4 .  ? -0.794  28.676 8.126  1.00 18.21  ? 909 HOH B O   1 
HETATM 950  O  O   . HOH O 4 .  ? -11.436 34.477 11.106 1.00 22.72  ? 910 HOH B O   1 
HETATM 951  O  O   . HOH O 4 .  ? 1.661   37.609 11.574 1.00 24.17  ? 911 HOH B O   1 
HETATM 952  O  O   . HOH O 4 .  ? 8.675   27.147 9.933  1.00 24.36  ? 912 HOH B O   1 
HETATM 953  O  O   . HOH O 4 .  ? -8.373  45.064 8.437  1.00 37.11  ? 913 HOH B O   1 
HETATM 954  O  O   . HOH O 4 .  ? 9.006   14.743 8.558  1.00 31.62  ? 914 HOH B O   1 
HETATM 955  O  O   . HOH O 4 .  ? 0.028   39.445 12.946 1.00 28.84  ? 915 HOH B O   1 
HETATM 956  O  O   . HOH O 4 .  ? -4.534  44.639 10.459 1.00 29.39  ? 916 HOH B O   1 
HETATM 957  O  O   . HOH O 4 .  ? 8.703   26.092 12.458 1.00 24.95  ? 917 HOH B O   1 
HETATM 958  O  O   . HOH O 4 .  ? 15.914  4.743  20.640 1.00 41.81  ? 918 HOH B O   1 
HETATM 959  O  O   . HOH O 4 .  ? -5.174  36.374 7.076  1.00 28.96  ? 919 HOH B O   1 
HETATM 960  O  O   . HOH O 4 .  ? 13.097  4.862  19.782 1.00 35.55  ? 920 HOH B O   1 
HETATM 961  O  O   . HOH O 4 .  ? 13.783  23.626 15.248 1.00 38.23  ? 921 HOH B O   1 
HETATM 962  O  O   . HOH O 4 .  ? -0.537  39.926 16.867 1.00 37.95  ? 922 HOH B O   1 
HETATM 963  O  O   . HOH O 4 .  ? 16.013  21.840 15.478 1.00 35.60  ? 923 HOH B O   1 
HETATM 964  O  O   . HOH O 4 .  ? 1.771   18.641 16.680 1.00 40.18  ? 924 HOH B O   1 
HETATM 965  O  O   . HOH O 4 .  ? 10.054  12.060 8.779  1.00 40.30  ? 925 HOH B O   1 
HETATM 966  O  O   . HOH O 4 .  ? -2.325  42.556 10.244 1.00 40.65  ? 926 HOH B O   1 
HETATM 967  O  O   . HOH O 4 .  ? 22.202  6.680  8.586  1.00 41.38  ? 927 HOH B O   1 
HETATM 968  O  O   . HOH O 4 .  ? 14.463  11.209 9.647  1.00 40.13  ? 928 HOH B O   1 
HETATM 969  O  O   . HOH O 4 .  ? -0.065  40.852 9.753  1.00 50.21  ? 929 HOH B O   1 
HETATM 970  O  O   . HOH O 4 .  ? 1.169   40.811 14.984 1.00 44.21  ? 930 HOH B O   1 
HETATM 971  O  O   . HOH O 4 .  ? 11.852  6.830  17.953 1.00 50.97  ? 931 HOH B O   1 
HETATM 972  O  O   . HOH O 4 .  ? 19.898  6.490  18.051 1.00 53.18  ? 932 HOH B O   1 
HETATM 973  O  O   . HOH O 4 .  ? 9.227   6.852  13.511 1.00 52.30  ? 933 HOH B O   1 
HETATM 974  O  O   . HOH O 4 .  ? 1.749   20.460 14.866 1.00 43.25  ? 934 HOH B O   1 
HETATM 975  O  O   . HOH O 4 .  ? 4.004   39.930 15.270 1.00 61.94  ? 935 HOH B O   1 
HETATM 976  O  O   . HOH O 4 .  ? 2.592   20.387 2.888  1.00 37.72  ? 936 HOH B O   1 
HETATM 977  O  O   . HOH O 4 .  ? 9.083   7.947  19.003 1.00 55.63  ? 937 HOH B O   1 
HETATM 978  O  O   . HOH O 4 .  ? 10.131  9.792  20.711 1.00 44.26  ? 938 HOH B O   1 
HETATM 979  O  O   . HOH O 4 .  ? 10.843  5.285  15.770 1.00 80.73  ? 939 HOH B O   1 
HETATM 980  O  O   . HOH O 4 .  ? 21.555  8.955  10.199 1.00 56.53  ? 940 HOH B O   1 
HETATM 981  O  O   . HOH O 4 .  ? 4.740   14.856 14.283 1.00 46.52  ? 941 HOH B O   1 
HETATM 982  O  O   . HOH O 4 .  ? 7.916   9.017  21.395 1.00 45.11  ? 942 HOH B O   1 
HETATM 983  O  O   . HOH O 4 .  ? -5.858  45.672 8.329  1.00 45.74  ? 943 HOH B O   1 
HETATM 984  O  O   . HOH O 4 .  ? 21.216  10.379 13.166 1.00 51.72  ? 944 HOH B O   1 
HETATM 985  O  O   . HOH O 4 .  ? 5.931   12.529 15.094 1.00 52.49  ? 945 HOH B O   1 
HETATM 986  O  O   . HOH O 4 .  ? -9.847  43.166 7.061  1.00 64.29  ? 946 HOH B O   1 
HETATM 987  O  O   . HOH O 4 .  ? 13.949  22.341 11.125 1.00 99.48  ? 947 HOH B O   1 
HETATM 988  O  O   . HOH O 4 .  ? 8.384   9.821  12.746 1.00 57.70  ? 948 HOH B O   1 
HETATM 989  O  O   . HOH O 4 .  ? -3.902  46.000 14.934 1.00 43.84  ? 949 HOH B O   1 
HETATM 990  O  O   . HOH O 4 .  ? 18.931  6.784  11.241 1.00 55.53  ? 950 HOH B O   1 
HETATM 991  O  O   . HOH O 4 .  ? -8.110  33.161 8.196  1.00 48.89  ? 951 HOH B O   1 
HETATM 992  O  O   . HOH O 4 .  ? 20.331  4.388  11.082 1.00 55.33  ? 952 HOH B O   1 
HETATM 993  O  O   A HOH P 4 .  ? 3.263   34.273 26.441 0.50 12.26  ? 902 HOH C O   1 
HETATM 994  O  O   B HOH P 4 .  ? 2.824   33.100 27.441 0.50 17.70  ? 902 HOH C O   1 
HETATM 995  O  O   A HOH P 4 .  ? 8.122   34.042 23.329 0.50 9.94   ? 903 HOH C O   1 
HETATM 996  O  O   B HOH P 4 .  ? -2.758  39.707 3.651  0.50 15.61  ? 903 HOH C O   1 
HETATM 997  O  O   . HOH P 4 .  ? 8.349   28.585 17.181 1.00 27.31  ? 904 HOH C O   1 
HETATM 998  O  O   . HOH P 4 .  ? 20.993  19.717 21.527 1.00 26.62  ? 905 HOH C O   1 
HETATM 999  O  O   . HOH P 4 .  ? -8.281  34.068 28.485 1.00 26.04  ? 906 HOH C O   1 
HETATM 1000 O  O   . HOH P 4 .  ? -9.544  33.036 23.407 1.00 28.78  ? 907 HOH C O   1 
HETATM 1001 O  O   . HOH P 4 .  ? 1.465   35.793 19.747 1.00 22.34  ? 908 HOH C O   1 
HETATM 1002 O  O   . HOH P 4 .  ? 6.516   28.288 26.887 1.00 27.27  ? 909 HOH C O   1 
HETATM 1003 O  O   . HOH P 4 .  ? -6.248  32.434 27.395 1.00 21.41  ? 910 HOH C O   1 
HETATM 1004 O  O   . HOH P 4 .  ? -6.621  42.070 21.524 1.00 26.36  ? 911 HOH C O   1 
HETATM 1005 O  O   . HOH P 4 .  ? 5.063   30.309 28.526 1.00 26.72  ? 912 HOH C O   1 
HETATM 1006 O  O   . HOH P 4 .  ? -8.608  44.247 21.601 1.00 28.94  ? 913 HOH C O   1 
HETATM 1007 O  O   . HOH P 4 .  ? 9.724   36.497 18.406 1.00 36.12  ? 914 HOH C O   1 
HETATM 1008 O  O   . HOH P 4 .  ? 4.502   35.820 24.152 1.00 30.11  ? 915 HOH C O   1 
HETATM 1009 O  O   . HOH P 4 .  ? -13.548 37.290 26.228 1.00 32.74  ? 916 HOH C O   1 
HETATM 1010 O  O   . HOH P 4 .  ? -16.439 37.674 26.117 1.00 33.98  ? 917 HOH C O   1 
HETATM 1011 O  O   . HOH P 4 .  ? 3.909   36.913 21.919 1.00 33.95  ? 918 HOH C O   1 
HETATM 1012 O  O   . HOH P 4 .  ? 2.510   25.264 30.007 1.00 38.35  ? 919 HOH C O   1 
HETATM 1013 O  O   . HOH P 4 .  ? 12.018  29.400 24.043 1.00 44.72  ? 920 HOH C O   1 
HETATM 1014 O  O   . HOH P 4 .  ? 0.975   41.929 21.081 1.00 44.10  ? 921 HOH C O   1 
HETATM 1015 O  O   . HOH P 4 .  ? -10.070 32.735 26.101 1.00 50.78  ? 922 HOH C O   1 
HETATM 1016 O  O   . HOH P 4 .  ? 4.723   27.117 29.642 1.00 53.27  ? 923 HOH C O   1 
HETATM 1017 O  O   . HOH P 4 .  ? -10.432 40.076 28.705 1.00 24.43  ? 924 HOH C O   1 
HETATM 1018 O  O   . HOH P 4 .  ? 6.522   38.378 18.388 1.00 59.94  ? 925 HOH C O   1 
HETATM 1019 O  O   . HOH P 4 .  ? 8.604   32.932 25.753 1.00 43.44  ? 926 HOH C O   1 
HETATM 1020 O  O   . HOH P 4 .  ? 21.000  18.232 23.819 1.00 55.60  ? 927 HOH C O   1 
HETATM 1021 O  O   . HOH P 4 .  ? 8.304   30.320 27.463 1.00 55.66  ? 928 HOH C O   1 
HETATM 1022 O  O   . HOH P 4 .  ? 10.152  30.831 25.289 1.00 47.13  ? 929 HOH C O   1 
HETATM 1023 O  O   . HOH P 4 .  ? 22.718  18.535 16.162 1.00 52.13  ? 930 HOH C O   1 
HETATM 1024 O  O   . HOH P 4 .  ? 16.830  14.264 9.116  1.00 48.77  ? 931 HOH C O   1 
HETATM 1025 O  O   . HOH P 4 .  ? 9.529   22.077 24.944 1.00 51.17  ? 932 HOH C O   1 
HETATM 1026 O  O   . HOH P 4 .  ? 18.401  17.762 24.737 1.00 56.50  ? 933 HOH C O   1 
HETATM 1027 O  O   . HOH P 4 .  ? -2.331  43.899 27.310 1.00 35.62  ? 934 HOH C O   1 
HETATM 1028 O  O   . HOH P 4 .  ? -7.583  44.734 25.724 1.00 68.59  ? 935 HOH C O   1 
HETATM 1029 O  O   . HOH P 4 .  ? -11.361 40.274 32.085 1.00 76.42  ? 936 HOH C O   1 
HETATM 1030 O  O   . HOH P 4 .  ? 12.670  26.448 14.413 1.00 66.76  ? 937 HOH C O   1 
HETATM 1031 O  O   . HOH P 4 .  ? -20.370 37.793 16.584 1.00 138.08 ? 938 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  0  1  ACE ARG A . n 
A 1 2  ARG 2  1  1  ARG ARG A . n 
A 1 3  MET 3  2  2  MET MET A . n 
A 1 4  LYS 4  3  3  LYS LYS A . n 
A 1 5  GLN 5  4  4  GLN GLN A . n 
A 1 6  LEU 6  5  5  LEU LEU A . n 
A 1 7  GLU 7  6  6  GLU GLU A . n 
A 1 8  ASP 8  7  7  ASP ASP A . n 
A 1 9  LYS 9  8  8  LYS LYS A . n 
A 1 10 VAL 10 9  9  VAL VAL A . n 
A 1 11 GLU 11 10 10 GLU GLU A . n 
A 1 12 GLU 12 11 11 GLU GLU A . n 
A 1 13 LEU 13 12 12 LEU LEU A . n 
A 1 14 LEU 14 13 13 LEU LEU A . n 
A 1 15 SER 15 14 14 SER SER A . n 
A 1 16 LYS 16 15 15 LYS LYS A . n 
A 1 17 ALA 17 16 16 ALA ALA A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 HIS 19 18 18 HIS HIS A . n 
A 1 20 LEU 20 19 19 LEU LEU A . n 
A 1 21 GLU 21 20 20 GLU GLU A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 GLU 23 22 22 GLU GLU A . n 
A 1 24 VAL 24 23 23 VAL VAL A . n 
A 1 25 ALA 25 24 24 ALA ALA A . n 
A 1 26 ARG 26 25 25 ARG ARG A . n 
A 1 27 LEU 27 26 26 LEU LEU A . n 
A 1 28 LYS 28 27 27 LYS LYS A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LEU 30 29 29 LEU LEU A . n 
A 1 31 VAL 31 30 30 VAL VAL A . n 
A 1 32 GLY 32 31 31 GLY GLY A . n 
A 1 33 GLU 33 32 32 GLU GLU A . n 
A 1 34 ARG 34 33 33 ARG ARG A . n 
B 1 1  ACE 1  0  1  ACE ARG B . n 
B 1 2  ARG 2  1  1  ARG ARG B . n 
B 1 3  MET 3  2  2  MET MET B . n 
B 1 4  LYS 4  3  3  LYS LYS B . n 
B 1 5  GLN 5  4  4  GLN GLN B . n 
B 1 6  LEU 6  5  5  LEU LEU B . n 
B 1 7  GLU 7  6  6  GLU GLU B . n 
B 1 8  ASP 8  7  7  ASP ASP B . n 
B 1 9  LYS 9  8  8  LYS LYS B . n 
B 1 10 VAL 10 9  9  VAL VAL B . n 
B 1 11 GLU 11 10 10 GLU GLU B . n 
B 1 12 GLU 12 11 11 GLU GLU B . n 
B 1 13 LEU 13 12 12 LEU LEU B . n 
B 1 14 LEU 14 13 13 LEU LEU B . n 
B 1 15 SER 15 14 14 SER SER B . n 
B 1 16 LYS 16 15 15 LYS LYS B . n 
B 1 17 ALA 17 16 16 ALA ALA B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 HIS 19 18 18 HIS HIS B . n 
B 1 20 LEU 20 19 19 LEU LEU B . n 
B 1 21 GLU 21 20 20 GLU GLU B . n 
B 1 22 ASN 22 21 21 ASN ASN B . n 
B 1 23 GLU 23 22 22 GLU GLU B . n 
B 1 24 VAL 24 23 23 VAL VAL B . n 
B 1 25 ALA 25 24 24 ALA ALA B . n 
B 1 26 ARG 26 25 25 ARG ARG B . n 
B 1 27 LEU 27 26 26 LEU LEU B . n 
B 1 28 LYS 28 27 27 LYS LYS B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LEU 30 29 29 LEU LEU B . n 
B 1 31 VAL 31 30 30 VAL VAL B . n 
B 1 32 GLY 32 31 31 GLY GLY B . n 
B 1 33 GLU 33 32 32 GLU GLU B . n 
B 1 34 ARG 34 33 33 ARG ARG B . n 
C 1 1  ACE 1  0  1  ACE ARG C . n 
C 1 2  ARG 2  1  1  ARG ARG C . n 
C 1 3  MET 3  2  2  MET MET C . n 
C 1 4  LYS 4  3  3  LYS LYS C . n 
C 1 5  GLN 5  4  4  GLN GLN C . n 
C 1 6  LEU 6  5  5  LEU LEU C . n 
C 1 7  GLU 7  6  6  GLU GLU C . n 
C 1 8  ASP 8  7  7  ASP ASP C . n 
C 1 9  LYS 9  8  8  LYS LYS C . n 
C 1 10 VAL 10 9  9  VAL VAL C . n 
C 1 11 GLU 11 10 10 GLU GLU C . n 
C 1 12 GLU 12 11 11 GLU GLU C . n 
C 1 13 LEU 13 12 12 LEU LEU C . n 
C 1 14 LEU 14 13 13 LEU LEU C . n 
C 1 15 SER 15 14 14 SER SER C . n 
C 1 16 LYS 16 15 15 LYS LYS C . n 
C 1 17 ALA 17 16 16 ALA ALA C . n 
C 1 18 TYR 18 17 17 TYR TYR C . n 
C 1 19 HIS 19 18 18 HIS HIS C . n 
C 1 20 LEU 20 19 19 LEU LEU C . n 
C 1 21 GLU 21 20 20 GLU GLU C . n 
C 1 22 ASN 22 21 21 ASN ASN C . n 
C 1 23 GLU 23 22 22 GLU GLU C . n 
C 1 24 VAL 24 23 23 VAL VAL C . n 
C 1 25 ALA 25 24 24 ALA ALA C . n 
C 1 26 ARG 26 25 25 ARG ARG C . n 
C 1 27 LEU 27 26 26 LEU LEU C . n 
C 1 28 LYS 28 27 27 LYS LYS C . n 
C 1 29 LYS 29 28 28 LYS LYS C . n 
C 1 30 LEU 30 29 29 LEU LEU C . n 
C 1 31 VAL 31 30 30 VAL VAL C . n 
C 1 32 GLY 32 31 31 GLY GLY C . n 
C 1 33 GLU 33 32 ?  ?   ?   C . n 
C 1 34 ARG 34 33 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 CL  1  806 6   CL  IUM A . 
E 2 CL  1  808 8   CL  IUM A . 
F 2 CL  1  810 10  CL  IUM A . 
G 3 K   1  802 2   K   IUM B . 
H 2 CL  1  803 3   CL  IUM B . 
I 2 CL  1  804 4   CL  IUM B . 
J 2 CL  1  805 5   CL  IUM B . 
K 2 CL  1  809 9   CL  IUM B . 
L 2 CL  1  811 11  CL  IUM B . 
M 3 K   1  801 1   K   IUM C . 
N 4 HOH 1  903 903 HOH WAT A . 
N 4 HOH 2  904 905 HOH WAT A . 
N 4 HOH 3  905 907 HOH WAT A . 
N 4 HOH 4  906 916 HOH WAT A . 
N 4 HOH 5  907 917 HOH WAT A . 
N 4 HOH 6  908 8   HOH WAT A . 
N 4 HOH 7  909 13  HOH WAT A . 
N 4 HOH 8  910 14  HOH WAT A . 
N 4 HOH 9  911 16  HOH WAT A . 
N 4 HOH 10 912 17  HOH WAT A . 
N 4 HOH 11 913 21  HOH WAT A . 
N 4 HOH 12 914 22  HOH WAT A . 
N 4 HOH 13 915 23  HOH WAT A . 
N 4 HOH 14 916 25  HOH WAT A . 
N 4 HOH 15 917 29  HOH WAT A . 
N 4 HOH 16 918 30  HOH WAT A . 
N 4 HOH 17 919 32  HOH WAT A . 
N 4 HOH 18 920 33  HOH WAT A . 
N 4 HOH 19 921 37  HOH WAT A . 
N 4 HOH 20 922 39  HOH WAT A . 
N 4 HOH 21 923 43  HOH WAT A . 
N 4 HOH 22 924 48  HOH WAT A . 
N 4 HOH 23 925 50  HOH WAT A . 
N 4 HOH 24 926 51  HOH WAT A . 
N 4 HOH 25 927 52  HOH WAT A . 
N 4 HOH 26 928 55  HOH WAT A . 
N 4 HOH 27 929 59  HOH WAT A . 
N 4 HOH 28 930 61  HOH WAT A . 
N 4 HOH 29 931 62  HOH WAT A . 
N 4 HOH 30 932 63  HOH WAT A . 
N 4 HOH 31 933 64  HOH WAT A . 
N 4 HOH 32 934 65  HOH WAT A . 
N 4 HOH 33 935 66  HOH WAT A . 
N 4 HOH 34 936 68  HOH WAT A . 
N 4 HOH 35 937 70  HOH WAT A . 
N 4 HOH 36 938 72  HOH WAT A . 
N 4 HOH 37 939 75  HOH WAT A . 
N 4 HOH 38 940 77  HOH WAT A . 
N 4 HOH 39 941 78  HOH WAT A . 
N 4 HOH 40 942 80  HOH WAT A . 
N 4 HOH 41 943 81  HOH WAT A . 
N 4 HOH 42 944 82  HOH WAT A . 
N 4 HOH 43 945 84  HOH WAT A . 
N 4 HOH 44 946 94  HOH WAT A . 
N 4 HOH 45 947 96  HOH WAT A . 
N 4 HOH 46 948 98  HOH WAT A . 
N 4 HOH 47 949 99  HOH WAT A . 
N 4 HOH 48 950 101 HOH WAT A . 
N 4 HOH 49 951 106 HOH WAT A . 
N 4 HOH 50 952 108 HOH WAT A . 
N 4 HOH 51 953 113 HOH WAT A . 
N 4 HOH 52 954 122 HOH WAT A . 
N 4 HOH 53 955 123 HOH WAT A . 
N 4 HOH 54 956 131 HOH WAT A . 
N 4 HOH 55 957 133 HOH WAT A . 
N 4 HOH 56 958 134 HOH WAT A . 
N 4 HOH 57 959 137 HOH WAT A . 
O 4 HOH 1  901 901 HOH WAT B . 
O 4 HOH 2  902 909 HOH WAT B . 
O 4 HOH 3  903 911 HOH WAT B . 
O 4 HOH 4  904 913 HOH WAT B . 
O 4 HOH 5  905 7   HOH WAT B . 
O 4 HOH 6  906 9   HOH WAT B . 
O 4 HOH 7  907 10  HOH WAT B . 
O 4 HOH 8  908 12  HOH WAT B . 
O 4 HOH 9  909 15  HOH WAT B . 
O 4 HOH 10 910 18  HOH WAT B . 
O 4 HOH 11 911 20  HOH WAT B . 
O 4 HOH 12 912 27  HOH WAT B . 
O 4 HOH 13 913 34  HOH WAT B . 
O 4 HOH 14 914 35  HOH WAT B . 
O 4 HOH 15 915 36  HOH WAT B . 
O 4 HOH 16 916 38  HOH WAT B . 
O 4 HOH 17 917 40  HOH WAT B . 
O 4 HOH 18 918 41  HOH WAT B . 
O 4 HOH 19 919 44  HOH WAT B . 
O 4 HOH 20 920 45  HOH WAT B . 
O 4 HOH 21 921 49  HOH WAT B . 
O 4 HOH 22 922 54  HOH WAT B . 
O 4 HOH 23 923 57  HOH WAT B . 
O 4 HOH 24 924 58  HOH WAT B . 
O 4 HOH 25 925 60  HOH WAT B . 
O 4 HOH 26 926 67  HOH WAT B . 
O 4 HOH 27 927 69  HOH WAT B . 
O 4 HOH 28 928 73  HOH WAT B . 
O 4 HOH 29 929 83  HOH WAT B . 
O 4 HOH 30 930 85  HOH WAT B . 
O 4 HOH 31 931 87  HOH WAT B . 
O 4 HOH 32 932 89  HOH WAT B . 
O 4 HOH 33 933 91  HOH WAT B . 
O 4 HOH 34 934 92  HOH WAT B . 
O 4 HOH 35 935 93  HOH WAT B . 
O 4 HOH 36 936 95  HOH WAT B . 
O 4 HOH 37 937 104 HOH WAT B . 
O 4 HOH 38 938 105 HOH WAT B . 
O 4 HOH 39 939 109 HOH WAT B . 
O 4 HOH 40 940 110 HOH WAT B . 
O 4 HOH 41 941 111 HOH WAT B . 
O 4 HOH 42 942 112 HOH WAT B . 
O 4 HOH 43 943 114 HOH WAT B . 
O 4 HOH 44 944 115 HOH WAT B . 
O 4 HOH 45 945 118 HOH WAT B . 
O 4 HOH 46 946 119 HOH WAT B . 
O 4 HOH 47 947 121 HOH WAT B . 
O 4 HOH 48 948 125 HOH WAT B . 
O 4 HOH 49 949 126 HOH WAT B . 
O 4 HOH 50 950 130 HOH WAT B . 
O 4 HOH 51 951 132 HOH WAT B . 
O 4 HOH 52 952 135 HOH WAT B . 
P 4 HOH 1  902 902 HOH WAT C . 
P 4 HOH 2  903 915 HOH WAT C . 
P 4 HOH 3  904 3   HOH WAT C . 
P 4 HOH 4  905 4   HOH WAT C . 
P 4 HOH 5  906 5   HOH WAT C . 
P 4 HOH 6  907 6   HOH WAT C . 
P 4 HOH 7  908 11  HOH WAT C . 
P 4 HOH 8  909 19  HOH WAT C . 
P 4 HOH 9  910 24  HOH WAT C . 
P 4 HOH 10 911 26  HOH WAT C . 
P 4 HOH 11 912 28  HOH WAT C . 
P 4 HOH 12 913 31  HOH WAT C . 
P 4 HOH 13 914 42  HOH WAT C . 
P 4 HOH 14 915 46  HOH WAT C . 
P 4 HOH 15 916 47  HOH WAT C . 
P 4 HOH 16 917 53  HOH WAT C . 
P 4 HOH 17 918 56  HOH WAT C . 
P 4 HOH 18 919 71  HOH WAT C . 
P 4 HOH 19 920 74  HOH WAT C . 
P 4 HOH 20 921 76  HOH WAT C . 
P 4 HOH 21 922 79  HOH WAT C . 
P 4 HOH 22 923 86  HOH WAT C . 
P 4 HOH 23 924 88  HOH WAT C . 
P 4 HOH 24 925 90  HOH WAT C . 
P 4 HOH 25 926 97  HOH WAT C . 
P 4 HOH 26 927 100 HOH WAT C . 
P 4 HOH 27 928 102 HOH WAT C . 
P 4 HOH 28 929 103 HOH WAT C . 
P 4 HOH 29 930 107 HOH WAT C . 
P 4 HOH 30 931 116 HOH WAT C . 
P 4 HOH 31 932 117 HOH WAT C . 
P 4 HOH 32 933 120 HOH WAT C . 
P 4 HOH 33 934 124 HOH WAT C . 
P 4 HOH 34 935 127 HOH WAT C . 
P 4 HOH 35 936 128 HOH WAT C . 
P 4 HOH 36 937 129 HOH WAT C . 
P 4 HOH 37 938 136 HOH WAT C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5850 ? 
1 MORE         -120 ? 
1 'SSA (A^2)'  6460 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   OE1 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    A 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   GLU 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    23 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    C 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    GLU 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     22 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   K 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   M 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   K 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    C 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    K 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     801 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   O 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   HOH 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    B 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    HOH 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     922 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 133.1 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
REFMAC refinement       26/11/99  ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
CCP4   phasing          .         ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLN 4  ? A O  A HOH 948 ? ? 0.82 
2 1 CD  A GLN 4  ? A O  A HOH 948 ? ? 1.42 
3 1 CD  C LYS 8  ? A O  C HOH 937 ? ? 1.58 
4 1 OE2 B GLU 20 ? A CL B CL  804 ? ? 1.79 
5 1 NE2 A GLN 4  ? A O  A HOH 948 ? ? 1.90 
6 1 NZ  C LYS 8  ? A O  C HOH 937 ? ? 1.91 
7 1 CE  C LYS 8  ? A O  C HOH 937 ? ? 1.93 
8 1 NZ  C LYS 28 ? A O  C HOH 924 ? ? 1.93 
9 1 NZ  C LYS 28 ? A O  C HOH 936 ? ? 1.96 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE2 A GLU 32 ? A 1_555 CL  A CL  808 ? ? 8_655 0.62 
2 1 CD  A GLU 32 ? A 1_555 CL  A CL  808 ? ? 8_655 1.50 
3 1 O   B GLU 32 ? ? 1_555 NH2 C ARG 25  ? B 8_655 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  A ACE 0  ? ? C  A ACE 0  ? ? N   A ARG 1  ? ? 145.25 122.70 22.55  1.60 Y 
2 1 C  A ACE 0  ? ? N  A ARG 1  ? ? CA  A ARG 1  ? ? 137.58 121.70 15.88  2.50 Y 
3 1 CD A ARG 25 ? ? NE A ARG 25 ? ? CZ  A ARG 25 ? ? 132.18 123.60 8.58   1.40 N 
4 1 O  B ACE 0  ? ? C  B ACE 0  ? ? N   B ARG 1  ? ? 141.03 122.70 18.33  1.60 Y 
5 1 NE B ARG 1  ? ? CZ B ARG 1  ? ? NH2 B ARG 1  ? ? 115.74 120.30 -4.56  0.50 N 
6 1 CD B ARG 25 ? ? NE B ARG 25 ? ? CZ  B ARG 25 ? ? 132.21 123.60 8.61   1.40 N 
7 1 NE B ARG 33 ? ? CZ B ARG 33 ? ? NH2 B ARG 33 ? ? 124.95 120.30 4.65   0.50 N 
8 1 NE C ARG 1  ? ? CZ C ARG 1  ? ? NH2 C ARG 1  ? ? 123.80 120.30 3.50   0.50 N 
9 1 CG C GLU 22 ? ? CD C GLU 22 ? A OE1 C GLU 22 ? A 104.68 118.30 -13.62 2.00 N 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             VAL 
_pdbx_validate_main_chain_plane.auth_asym_id             C 
_pdbx_validate_main_chain_plane.auth_seq_id              30 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             B 
_pdbx_validate_main_chain_plane.improper_torsion_angle   18.38 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 33 ? C   ? A ARG 34 C   
2  1 Y 1 A ARG 33 ? O   ? A ARG 34 O   
3  1 Y 1 A ARG 33 ? CB  ? A ARG 34 CB  
4  1 Y 1 A ARG 33 ? CG  ? A ARG 34 CG  
5  1 Y 1 A ARG 33 ? CD  ? A ARG 34 CD  
6  1 Y 1 A ARG 33 ? NE  ? A ARG 34 NE  
7  1 Y 1 A ARG 33 ? CZ  ? A ARG 34 CZ  
8  1 Y 1 A ARG 33 ? NH1 ? A ARG 34 NH1 
9  1 Y 1 A ARG 33 ? NH2 ? A ARG 34 NH2 
10 1 Y 1 B GLU 32 ? CG  ? B GLU 33 CG  
11 1 Y 1 B GLU 32 ? CD  ? B GLU 33 CD  
12 1 Y 1 B GLU 32 ? OE1 ? B GLU 33 OE1 
13 1 Y 1 B GLU 32 ? OE2 ? B GLU 33 OE2 
14 1 Y 1 B ARG 33 ? CA  ? B ARG 34 CA  
15 1 Y 1 B ARG 33 ? C   ? B ARG 34 C   
16 1 Y 1 B ARG 33 ? O   ? B ARG 34 O   
17 1 Y 1 C GLY 31 ? O   ? C GLY 32 O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 C GLU 32 ? C GLU 33 
2 1 Y 1 C ARG 33 ? C ARG 34 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'  CL  
3 'POTASSIUM ION' K   
4 water           HOH 
#