data_1RFV
# 
_entry.id   1RFV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RFV         
RCSB  RCSB020711   
WWPDB D_1000020711 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1LHP 'The same protein without ligand binding'                  unspecified 
PDB 1LHR 'The same protein complexed with ATP'                      unspecified 
PDB 1RFT 'The same protein complexed with AMP-PCP and pyridoxamine' unspecified 
PDB 1RFU 'The same protein complexed with ADP and PLP'              unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RFV 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liang, D.-C.' 1 
'Jiang, T.'    2 
'Li, M.-H.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Conformational changes in the reaction of pyridoxal kinase'                                    J.BIOL.CHEM.               
279 17459 17465 2004 JBCHA3 US 0021-9258 0071 ? 14722069 10.1074/jbc.M312380200    
1       'Crystal Structure of Brain Pyridoxal Kinase, a Novel Member of the Ribokinase Superfamily'     J.Biol.Chem.               
277 46385 46390 2002 JBCHA3 US 0021-9258 0071 ? 12235162 10.1074/jbc.M208600200    
2       'Crystallization and preliminary crystallographic studies of pyridoxal kinase from sheep brain' 'Acta Crystallogr.,Sect.D' 
58  1479  1481  2002 ABCRE6 DK 0907-4449 0766 ? 12198308 10.1107/S0907444902011034 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, M.-H.'    1  
primary 'Kwok, F.'     2  
primary 'Chang, W.-R.' 3  
primary 'Liu, S.-Q.'   4  
primary 'Lo, S.C.L.'   5  
primary 'Zhang, J.-P.' 6  
primary 'Jiang, T.'    7  
primary 'Liang, D.-C.' 8  
1       'Li, M.-H.'    9  
1       'Kwok, F.'     10 
1       'Chang, W.-R.' 11 
1       'Lau, C.-K.'   12 
1       'Zhang, J.-P.' 13 
1       'Lo, S.C.L.'   14 
1       'Jiang, T.'    15 
1       'Liang, D.-C.' 16 
2       'Li, M.-H.'    17 
2       'Kwok, F.'     18 
2       'An, X.-M.'    19 
2       'Chang, W.-R.' 20 
2       'Lau, C.-K.'   21 
2       'Zhang, J.-P.' 22 
2       'Liu, S.-Q.'   23 
2       'Leung, Y.-C.' 24 
2       'Jiang, T.'    25 
2       'Liang, D.-C.' 26 
# 
_cell.entry_id           1RFV 
_cell.length_a           59.066 
_cell.length_b           93.942 
_cell.length_c           128.743 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RFV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'pyridoxal kinase'         34860.879 2   2.7.1.35 ? ? ? 
2 non-polymer syn 'ZINC ION'                 65.409    2   ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   2   ?        ? ? ? 
4 water       nat water                      18.015    138 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pyridoxine kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEEECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGR
KIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEEECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGR
KIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   GLU n 
1 4   GLU n 
1 5   CYS n 
1 6   ARG n 
1 7   VAL n 
1 8   LEU n 
1 9   SER n 
1 10  ILE n 
1 11  GLN n 
1 12  SER n 
1 13  HIS n 
1 14  VAL n 
1 15  VAL n 
1 16  ARG n 
1 17  GLY n 
1 18  TYR n 
1 19  VAL n 
1 20  GLY n 
1 21  ASN n 
1 22  ARG n 
1 23  ALA n 
1 24  ALA n 
1 25  THR n 
1 26  PHE n 
1 27  PRO n 
1 28  LEU n 
1 29  GLN n 
1 30  VAL n 
1 31  LEU n 
1 32  GLY n 
1 33  PHE n 
1 34  GLU n 
1 35  VAL n 
1 36  ASP n 
1 37  ALA n 
1 38  VAL n 
1 39  ASN n 
1 40  SER n 
1 41  VAL n 
1 42  GLN n 
1 43  PHE n 
1 44  SER n 
1 45  ASN n 
1 46  HIS n 
1 47  THR n 
1 48  GLY n 
1 49  TYR n 
1 50  SER n 
1 51  HIS n 
1 52  TRP n 
1 53  LYS n 
1 54  GLY n 
1 55  GLN n 
1 56  VAL n 
1 57  LEU n 
1 58  ASN n 
1 59  SER n 
1 60  ASP n 
1 61  GLU n 
1 62  LEU n 
1 63  GLN n 
1 64  GLU n 
1 65  LEU n 
1 66  TYR n 
1 67  ASP n 
1 68  GLY n 
1 69  LEU n 
1 70  LYS n 
1 71  LEU n 
1 72  ASN n 
1 73  HIS n 
1 74  VAL n 
1 75  ASN n 
1 76  GLN n 
1 77  TYR n 
1 78  ASP n 
1 79  TYR n 
1 80  VAL n 
1 81  LEU n 
1 82  THR n 
1 83  GLY n 
1 84  TYR n 
1 85  THR n 
1 86  ARG n 
1 87  ASP n 
1 88  LYS n 
1 89  SER n 
1 90  PHE n 
1 91  LEU n 
1 92  ALA n 
1 93  MET n 
1 94  VAL n 
1 95  VAL n 
1 96  ASP n 
1 97  ILE n 
1 98  VAL n 
1 99  GLN n 
1 100 GLU n 
1 101 LEU n 
1 102 LYS n 
1 103 GLN n 
1 104 GLN n 
1 105 ASN n 
1 106 PRO n 
1 107 ARG n 
1 108 LEU n 
1 109 VAL n 
1 110 TYR n 
1 111 VAL n 
1 112 CYS n 
1 113 ASP n 
1 114 PRO n 
1 115 VAL n 
1 116 MET n 
1 117 GLY n 
1 118 ASP n 
1 119 GLN n 
1 120 ARG n 
1 121 ASN n 
1 122 GLY n 
1 123 GLU n 
1 124 GLY n 
1 125 ALA n 
1 126 MET n 
1 127 TYR n 
1 128 VAL n 
1 129 PRO n 
1 130 ASP n 
1 131 ASP n 
1 132 LEU n 
1 133 LEU n 
1 134 PRO n 
1 135 VAL n 
1 136 TYR n 
1 137 ARG n 
1 138 GLU n 
1 139 LYS n 
1 140 VAL n 
1 141 VAL n 
1 142 PRO n 
1 143 VAL n 
1 144 ALA n 
1 145 ASP n 
1 146 ILE n 
1 147 ILE n 
1 148 THR n 
1 149 PRO n 
1 150 ASN n 
1 151 GLN n 
1 152 PHE n 
1 153 GLU n 
1 154 ALA n 
1 155 GLU n 
1 156 LEU n 
1 157 LEU n 
1 158 THR n 
1 159 GLY n 
1 160 ARG n 
1 161 LYS n 
1 162 ILE n 
1 163 HIS n 
1 164 SER n 
1 165 GLN n 
1 166 GLU n 
1 167 GLU n 
1 168 ALA n 
1 169 LEU n 
1 170 GLU n 
1 171 VAL n 
1 172 MET n 
1 173 ASP n 
1 174 MET n 
1 175 LEU n 
1 176 HIS n 
1 177 SER n 
1 178 MET n 
1 179 GLY n 
1 180 PRO n 
1 181 ASP n 
1 182 THR n 
1 183 VAL n 
1 184 VAL n 
1 185 ILE n 
1 186 THR n 
1 187 SER n 
1 188 SER n 
1 189 ASN n 
1 190 LEU n 
1 191 LEU n 
1 192 SER n 
1 193 PRO n 
1 194 ARG n 
1 195 GLY n 
1 196 SER n 
1 197 ASP n 
1 198 TYR n 
1 199 LEU n 
1 200 MET n 
1 201 ALA n 
1 202 LEU n 
1 203 GLY n 
1 204 SER n 
1 205 GLN n 
1 206 ARG n 
1 207 THR n 
1 208 ARG n 
1 209 ALA n 
1 210 PRO n 
1 211 ASP n 
1 212 GLY n 
1 213 SER n 
1 214 VAL n 
1 215 VAL n 
1 216 THR n 
1 217 GLN n 
1 218 ARG n 
1 219 ILE n 
1 220 ARG n 
1 221 MET n 
1 222 GLU n 
1 223 MET n 
1 224 HIS n 
1 225 LYS n 
1 226 VAL n 
1 227 ASP n 
1 228 ALA n 
1 229 VAL n 
1 230 PHE n 
1 231 VAL n 
1 232 GLY n 
1 233 THR n 
1 234 GLY n 
1 235 ASP n 
1 236 LEU n 
1 237 PHE n 
1 238 ALA n 
1 239 ALA n 
1 240 MET n 
1 241 LEU n 
1 242 LEU n 
1 243 ALA n 
1 244 TRP n 
1 245 THR n 
1 246 HIS n 
1 247 LYS n 
1 248 HIS n 
1 249 PRO n 
1 250 ASN n 
1 251 ASN n 
1 252 LEU n 
1 253 LYS n 
1 254 VAL n 
1 255 ALA n 
1 256 CYS n 
1 257 GLU n 
1 258 LYS n 
1 259 THR n 
1 260 VAL n 
1 261 SER n 
1 262 ALA n 
1 263 MET n 
1 264 HIS n 
1 265 HIS n 
1 266 VAL n 
1 267 LEU n 
1 268 GLN n 
1 269 ARG n 
1 270 THR n 
1 271 ILE n 
1 272 LYS n 
1 273 CYS n 
1 274 ALA n 
1 275 LYS n 
1 276 ALA n 
1 277 LYS n 
1 278 SER n 
1 279 GLY n 
1 280 GLU n 
1 281 GLY n 
1 282 VAL n 
1 283 LYS n 
1 284 PRO n 
1 285 SER n 
1 286 PRO n 
1 287 ALA n 
1 288 GLN n 
1 289 LEU n 
1 290 GLU n 
1 291 LEU n 
1 292 ARG n 
1 293 MET n 
1 294 VAL n 
1 295 GLN n 
1 296 SER n 
1 297 LYS n 
1 298 LYS n 
1 299 ASP n 
1 300 ILE n 
1 301 GLU n 
1 302 SER n 
1 303 PRO n 
1 304 GLU n 
1 305 ILE n 
1 306 VAL n 
1 307 VAL n 
1 308 GLN n 
1 309 ALA n 
1 310 THR n 
1 311 VAL n 
1 312 LEU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                sheep 
_entity_src_nat.pdbx_organism_scientific   'Ovis aries' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9940 
_entity_src_nat.genus                      Ovis 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDXK_SHEEP 
_struct_ref.pdbx_db_accession          P82197 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEEECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGR
KIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RFV A 1 ? 312 ? P82197 1 ? 312 ? 1 312 
2 1 1RFV B 1 ? 312 ? P82197 1 ? 312 ? 1 312 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                 ? 'Zn 2'              65.409  
# 
_exptl.entry_id          1RFV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   52.83 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    'sodium citrate, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           290 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-03-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'SEALED TUBE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1RFV 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.8 
_reflns.d_resolution_low             20 
_reflns.number_all                   18190 
_reflns.number_obs                   18118 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.136 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.86 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.599 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1187 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RFV 
_refine.ls_d_res_high                            2.8 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          -3 
_refine.ls_number_reflns_all                     18190 
_refine.ls_number_reflns_obs                     18118 
_refine.ls_number_reflns_R_free                  1690 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_all                          0.193 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1LHP' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4798 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             138 
_refine_hist.number_atoms_total               4992 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RFV 
_struct.title                     'Crystal structure of pyridoxal kinase complexed with ADP' 
_struct.pdbx_descriptor           'Pyridoxal kinase (E.C.2.7.1.35)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RFV 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a dimer formed by the two monomers in the asymmetric unit' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 20  ? LEU A 31  ? GLY A 20  LEU A 31  1 ? 12 
HELX_P HELX_P2  2  ASN A 58  ? ASN A 72  ? ASN A 58  ASN A 72  1 ? 15 
HELX_P HELX_P3  3  ASP A 87  ? ASN A 105 ? ASP A 87  ASN A 105 1 ? 19 
HELX_P HELX_P4  4  PRO A 129 ? ASP A 131 ? PRO A 129 ASP A 131 5 ? 3  
HELX_P HELX_P5  5  LEU A 132 ? LYS A 139 ? LEU A 132 LYS A 139 1 ? 8  
HELX_P HELX_P6  6  VAL A 140 ? ALA A 144 ? VAL A 140 ALA A 144 5 ? 5  
HELX_P HELX_P7  7  ASN A 150 ? GLY A 159 ? ASN A 150 GLY A 159 1 ? 10 
HELX_P HELX_P8  8  SER A 164 ? GLY A 179 ? SER A 164 GLY A 179 1 ? 16 
HELX_P HELX_P9  9  GLY A 232 ? HIS A 248 ? GLY A 232 HIS A 248 1 ? 17 
HELX_P HELX_P10 10 ASN A 251 ? SER A 278 ? ASN A 251 SER A 278 1 ? 28 
HELX_P HELX_P11 11 MET A 293 ? GLN A 295 ? MET A 293 GLN A 295 5 ? 3  
HELX_P HELX_P12 12 SER A 296 ? SER A 302 ? SER A 296 SER A 302 1 ? 7  
HELX_P HELX_P13 13 GLY B 20  ? LEU B 31  ? GLY B 20  LEU B 31  1 ? 12 
HELX_P HELX_P14 14 ASN B 58  ? ASN B 72  ? ASN B 58  ASN B 72  1 ? 15 
HELX_P HELX_P15 15 ASP B 87  ? ASN B 105 ? ASP B 87  ASN B 105 1 ? 19 
HELX_P HELX_P16 16 PRO B 129 ? ASP B 131 ? PRO B 129 ASP B 131 5 ? 3  
HELX_P HELX_P17 17 LEU B 132 ? LYS B 139 ? LEU B 132 LYS B 139 1 ? 8  
HELX_P HELX_P18 18 VAL B 140 ? ALA B 144 ? VAL B 140 ALA B 144 5 ? 5  
HELX_P HELX_P19 19 ASN B 150 ? GLY B 159 ? ASN B 150 GLY B 159 1 ? 10 
HELX_P HELX_P20 20 SER B 164 ? GLY B 179 ? SER B 164 GLY B 179 1 ? 16 
HELX_P HELX_P21 21 GLY B 232 ? HIS B 248 ? GLY B 232 HIS B 248 1 ? 17 
HELX_P HELX_P22 22 ASN B 251 ? GLY B 279 ? ASN B 251 GLY B 279 1 ? 29 
HELX_P HELX_P23 23 MET B 293 ? GLN B 295 ? MET B 293 GLN B 295 5 ? 3  
HELX_P HELX_P24 24 SER B 296 ? SER B 302 ? SER B 296 SER B 302 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D ADP . O2B ? ? ? 1_555 C ZN . ZN ? ? A ADP 401  A ZN 402  1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc2 metalc ? ? F ADP . O2B ? ? ? 1_555 E ZN . ZN ? ? B ADP 1401 B ZN 1402 1_555 ? ? ? ? ? ? ? 2.026 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 10 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? parallel      
B 3 4  ? parallel      
B 4 5  ? parallel      
B 5 6  ? parallel      
B 6 7  ? parallel      
B 7 8  ? anti-parallel 
B 8 9  ? anti-parallel 
B 9 10 ? anti-parallel 
C 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLY A 54  ? VAL A 56  ? GLY A 54  VAL A 56  
A 2  GLU A 34  ? PHE A 43  ? GLU A 34  PHE A 43  
A 3  ARG A 6   ? VAL A 14  ? ARG A 6   VAL A 14  
A 4  TYR A 79  ? THR A 82  ? TYR A 79  THR A 82  
A 5  VAL A 109 ? CYS A 112 ? VAL A 109 CYS A 112 
A 6  ILE A 146 ? ILE A 147 ? ILE A 146 ILE A 147 
A 7  THR A 182 ? SER A 188 ? THR A 182 SER A 188 
A 8  TYR A 198 ? THR A 207 ? TYR A 198 THR A 207 
A 9  VAL A 215 ? HIS A 224 ? VAL A 215 HIS A 224 
A 10 THR A 310 ? VAL A 311 ? THR A 310 VAL A 311 
B 1  GLY B 54  ? VAL B 56  ? GLY B 54  VAL B 56  
B 2  GLU B 34  ? PHE B 43  ? GLU B 34  PHE B 43  
B 3  ARG B 6   ? VAL B 14  ? ARG B 6   VAL B 14  
B 4  TYR B 79  ? THR B 82  ? TYR B 79  THR B 82  
B 5  VAL B 109 ? CYS B 112 ? VAL B 109 CYS B 112 
B 6  ILE B 146 ? ILE B 147 ? ILE B 146 ILE B 147 
B 7  THR B 182 ? ILE B 185 ? THR B 182 ILE B 185 
B 8  TYR B 198 ? ARG B 208 ? TYR B 198 ARG B 208 
B 9  VAL B 214 ? HIS B 224 ? VAL B 214 HIS B 224 
B 10 THR B 310 ? VAL B 311 ? THR B 310 VAL B 311 
C 1  GLY B 117 ? ASP B 118 ? GLY B 117 ASP B 118 
C 2  ALA B 125 ? MET B 126 ? ALA B 125 MET B 126 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O GLN A 55  ? O GLN A 55  N GLN A 42  ? N GLN A 42  
A 2 3  O ASP A 36  ? O ASP A 36  N VAL A 7   ? N VAL A 7   
A 3 4  N LEU A 8   ? N LEU A 8   O LEU A 81  ? O LEU A 81  
A 4 5  N VAL A 80  ? N VAL A 80  O VAL A 111 ? O VAL A 111 
A 5 6  N CYS A 112 ? N CYS A 112 O ILE A 146 ? O ILE A 146 
A 6 7  N ILE A 147 ? N ILE A 147 O VAL A 184 ? O VAL A 184 
A 7 8  N VAL A 183 ? N VAL A 183 O SER A 204 ? O SER A 204 
A 8 9  N LEU A 199 ? N LEU A 199 O MET A 223 ? O MET A 223 
A 9 10 N ARG A 220 ? N ARG A 220 O THR A 310 ? O THR A 310 
B 1 2  O GLN B 55  ? O GLN B 55  N GLN B 42  ? N GLN B 42  
B 2 3  O ASP B 36  ? O ASP B 36  N VAL B 7   ? N VAL B 7   
B 3 4  N LEU B 8   ? N LEU B 8   O LEU B 81  ? O LEU B 81  
B 4 5  N VAL B 80  ? N VAL B 80  O VAL B 111 ? O VAL B 111 
B 5 6  N CYS B 112 ? N CYS B 112 O ILE B 146 ? O ILE B 146 
B 6 7  N ILE B 147 ? N ILE B 147 O VAL B 184 ? O VAL B 184 
B 7 8  N VAL B 183 ? N VAL B 183 O SER B 204 ? O SER B 204 
B 8 9  N LEU B 199 ? N LEU B 199 O MET B 223 ? O MET B 223 
B 9 10 N ARG B 220 ? N ARG B 220 O THR B 310 ? O THR B 310 
C 1 2  N ASP B 118 ? N ASP B 118 O ALA B 125 ? O ALA B 125 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ZN A 402'   
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE ZN B 1402'  
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A 401'  
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE ADP B 1401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  GLN A 119 ? GLN A 119  . ? 1_555 ? 
2  AC1 2  ADP D .   ? ADP A 401  . ? 1_555 ? 
3  AC2 1  ADP F .   ? ADP B 1401 . ? 1_555 ? 
4  AC3 15 GLN A 119 ? GLN A 119  . ? 1_555 ? 
5  AC3 15 ASN A 150 ? ASN A 150  . ? 1_555 ? 
6  AC3 15 THR A 186 ? THR A 186  . ? 1_555 ? 
7  AC3 15 SER A 187 ? SER A 187  . ? 1_555 ? 
8  AC3 15 MET A 223 ? MET A 223  . ? 1_555 ? 
9  AC3 15 HIS A 224 ? HIS A 224  . ? 1_555 ? 
10 AC3 15 LYS A 225 ? LYS A 225  . ? 1_555 ? 
11 AC3 15 VAL A 226 ? VAL A 226  . ? 1_555 ? 
12 AC3 15 ALA A 228 ? ALA A 228  . ? 1_555 ? 
13 AC3 15 THR A 233 ? THR A 233  . ? 1_555 ? 
14 AC3 15 PHE A 237 ? PHE A 237  . ? 1_555 ? 
15 AC3 15 LEU A 267 ? LEU A 267  . ? 1_555 ? 
16 AC3 15 ZN  C .   ? ZN  A 402  . ? 1_555 ? 
17 AC3 15 HOH G .   ? HOH A 404  . ? 1_555 ? 
18 AC3 15 HOH G .   ? HOH A 434  . ? 1_555 ? 
19 AC4 18 ASP B 118 ? ASP B 118  . ? 1_555 ? 
20 AC4 18 ASN B 150 ? ASN B 150  . ? 1_555 ? 
21 AC4 18 THR B 186 ? THR B 186  . ? 1_555 ? 
22 AC4 18 SER B 187 ? SER B 187  . ? 1_555 ? 
23 AC4 18 MET B 223 ? MET B 223  . ? 1_555 ? 
24 AC4 18 HIS B 224 ? HIS B 224  . ? 1_555 ? 
25 AC4 18 LYS B 225 ? LYS B 225  . ? 1_555 ? 
26 AC4 18 VAL B 226 ? VAL B 226  . ? 1_555 ? 
27 AC4 18 ALA B 228 ? ALA B 228  . ? 1_555 ? 
28 AC4 18 THR B 233 ? THR B 233  . ? 1_555 ? 
29 AC4 18 PHE B 237 ? PHE B 237  . ? 1_555 ? 
30 AC4 18 MET B 263 ? MET B 263  . ? 1_555 ? 
31 AC4 18 LEU B 267 ? LEU B 267  . ? 1_555 ? 
32 AC4 18 ZN  E .   ? ZN  B 1402 . ? 1_555 ? 
33 AC4 18 HOH H .   ? HOH B 1403 . ? 1_555 ? 
34 AC4 18 HOH H .   ? HOH B 1414 . ? 1_555 ? 
35 AC4 18 HOH H .   ? HOH B 1421 . ? 1_555 ? 
36 AC4 18 HOH H .   ? HOH B 1440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RFV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RFV 
_atom_sites.fract_transf_matrix[1][1]   0.016930 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010645 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007767 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 4   ? 52.614 13.106  61.134 1.00 38.97 ? 4    GLU A N     1 
ATOM   2    C  CA    . GLU A 1 4   ? 51.549 12.852  60.119 1.00 40.05 ? 4    GLU A CA    1 
ATOM   3    C  C     . GLU A 1 4   ? 51.306 11.356  59.850 1.00 38.07 ? 4    GLU A C     1 
ATOM   4    O  O     . GLU A 1 4   ? 52.236 10.611  59.533 1.00 38.80 ? 4    GLU A O     1 
ATOM   5    C  CB    . GLU A 1 4   ? 51.911 13.574  58.813 1.00 41.47 ? 4    GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 4   ? 53.396 13.531  58.485 1.00 47.14 ? 4    GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 4   ? 53.722 14.109  57.115 1.00 51.49 ? 4    GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 4   ? 54.301 15.218  57.053 1.00 54.37 ? 4    GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 4   ? 53.394 13.450  56.099 1.00 53.41 ? 4    GLU A OE2   1 
ATOM   10   N  N     . CYS A 1 5   ? 50.059 10.914  59.994 1.00 34.81 ? 5    CYS A N     1 
ATOM   11   C  CA    . CYS A 1 5   ? 49.715 9.516   59.742 1.00 32.90 ? 5    CYS A CA    1 
ATOM   12   C  C     . CYS A 1 5   ? 48.991 9.391   58.399 1.00 29.80 ? 5    CYS A C     1 
ATOM   13   O  O     . CYS A 1 5   ? 48.036 10.115  58.131 1.00 29.95 ? 5    CYS A O     1 
ATOM   14   C  CB    . CYS A 1 5   ? 48.841 8.958   60.876 1.00 32.75 ? 5    CYS A CB    1 
ATOM   15   S  SG    . CYS A 1 5   ? 49.758 8.046   62.150 1.00 37.43 ? 5    CYS A SG    1 
ATOM   16   N  N     . ARG A 1 6   ? 49.448 8.477   57.550 1.00 26.80 ? 6    ARG A N     1 
ATOM   17   C  CA    . ARG A 1 6   ? 48.833 8.308   56.241 1.00 24.22 ? 6    ARG A CA    1 
ATOM   18   C  C     . ARG A 1 6   ? 48.025 7.016   56.112 1.00 21.75 ? 6    ARG A C     1 
ATOM   19   O  O     . ARG A 1 6   ? 48.525 5.926   56.373 1.00 22.83 ? 6    ARG A O     1 
ATOM   20   C  CB    . ARG A 1 6   ? 49.912 8.366   55.162 1.00 23.28 ? 6    ARG A CB    1 
ATOM   21   C  CG    . ARG A 1 6   ? 49.386 8.417   53.740 1.00 23.19 ? 6    ARG A CG    1 
ATOM   22   C  CD    . ARG A 1 6   ? 50.543 8.492   52.763 1.00 23.05 ? 6    ARG A CD    1 
ATOM   23   N  NE    . ARG A 1 6   ? 51.185 9.802   52.755 1.00 20.32 ? 6    ARG A NE    1 
ATOM   24   C  CZ    . ARG A 1 6   ? 50.749 10.835  52.044 1.00 20.93 ? 6    ARG A CZ    1 
ATOM   25   N  NH1   . ARG A 1 6   ? 49.670 10.702  51.284 1.00 19.70 ? 6    ARG A NH1   1 
ATOM   26   N  NH2   . ARG A 1 6   ? 51.391 11.998  52.088 1.00 21.62 ? 6    ARG A NH2   1 
ATOM   27   N  N     . VAL A 1 7   ? 46.771 7.161   55.693 1.00 19.19 ? 7    VAL A N     1 
ATOM   28   C  CA    . VAL A 1 7   ? 45.854 6.040   55.520 1.00 17.12 ? 7    VAL A CA    1 
ATOM   29   C  C     . VAL A 1 7   ? 45.547 5.717   54.049 1.00 17.27 ? 7    VAL A C     1 
ATOM   30   O  O     . VAL A 1 7   ? 45.262 6.612   53.251 1.00 16.25 ? 7    VAL A O     1 
ATOM   31   C  CB    . VAL A 1 7   ? 44.505 6.325   56.215 1.00 15.61 ? 7    VAL A CB    1 
ATOM   32   C  CG1   . VAL A 1 7   ? 43.572 5.143   56.045 1.00 14.06 ? 7    VAL A CG1   1 
ATOM   33   C  CG2   . VAL A 1 7   ? 44.727 6.640   57.680 1.00 15.86 ? 7    VAL A CG2   1 
ATOM   34   N  N     . LEU A 1 8   ? 45.614 4.438   53.696 1.00 16.97 ? 8    LEU A N     1 
ATOM   35   C  CA    . LEU A 1 8   ? 45.281 4.007   52.345 1.00 15.75 ? 8    LEU A CA    1 
ATOM   36   C  C     . LEU A 1 8   ? 43.925 3.355   52.501 1.00 15.56 ? 8    LEU A C     1 
ATOM   37   O  O     . LEU A 1 8   ? 43.812 2.264   53.053 1.00 15.23 ? 8    LEU A O     1 
ATOM   38   C  CB    . LEU A 1 8   ? 46.286 2.983   51.807 1.00 16.95 ? 8    LEU A CB    1 
ATOM   39   C  CG    . LEU A 1 8   ? 45.965 2.387   50.429 1.00 17.22 ? 8    LEU A CG    1 
ATOM   40   C  CD1   . LEU A 1 8   ? 45.727 3.502   49.412 1.00 17.76 ? 8    LEU A CD1   1 
ATOM   41   C  CD2   . LEU A 1 8   ? 47.111 1.497   49.982 1.00 18.81 ? 8    LEU A CD2   1 
ATOM   42   N  N     . SER A 1 9   ? 42.891 4.041   52.042 1.00 14.69 ? 9    SER A N     1 
ATOM   43   C  CA    . SER A 1 9   ? 41.544 3.521   52.150 1.00 14.98 ? 9    SER A CA    1 
ATOM   44   C  C     . SER A 1 9   ? 41.052 3.068   50.787 1.00 15.52 ? 9    SER A C     1 
ATOM   45   O  O     . SER A 1 9   ? 41.026 3.855   49.838 1.00 16.04 ? 9    SER A O     1 
ATOM   46   C  CB    . SER A 1 9   ? 40.616 4.600   52.710 1.00 15.93 ? 9    SER A CB    1 
ATOM   47   O  OG    . SER A 1 9   ? 39.276 4.144   52.740 1.00 15.40 ? 9    SER A OG    1 
ATOM   48   N  N     . ILE A 1 10  ? 40.664 1.800   50.696 1.00 14.51 ? 10   ILE A N     1 
ATOM   49   C  CA    . ILE A 1 10  ? 40.179 1.235   49.445 1.00 13.94 ? 10   ILE A CA    1 
ATOM   50   C  C     . ILE A 1 10  ? 38.735 0.796   49.624 1.00 13.91 ? 10   ILE A C     1 
ATOM   51   O  O     . ILE A 1 10  ? 38.471 -0.273  50.151 1.00 14.44 ? 10   ILE A O     1 
ATOM   52   C  CB    . ILE A 1 10  ? 41.034 0.028   49.029 1.00 14.74 ? 10   ILE A CB    1 
ATOM   53   C  CG1   . ILE A 1 10  ? 42.509 0.431   49.011 1.00 13.98 ? 10   ILE A CG1   1 
ATOM   54   C  CG2   . ILE A 1 10  ? 40.621 -0.459  47.651 1.00 14.98 ? 10   ILE A CG2   1 
ATOM   55   C  CD1   . ILE A 1 10  ? 43.456 -0.715  48.790 1.00 12.63 ? 10   ILE A CD1   1 
ATOM   56   N  N     . GLN A 1 11  ? 37.807 1.644   49.194 1.00 14.03 ? 11   GLN A N     1 
ATOM   57   C  CA    . GLN A 1 11  ? 36.381 1.367   49.309 1.00 13.17 ? 11   GLN A CA    1 
ATOM   58   C  C     . GLN A 1 11  ? 35.610 2.079   48.199 1.00 13.99 ? 11   GLN A C     1 
ATOM   59   O  O     . GLN A 1 11  ? 36.173 2.866   47.429 1.00 12.24 ? 11   GLN A O     1 
ATOM   60   C  CB    . GLN A 1 11  ? 35.853 1.844   50.662 1.00 13.58 ? 11   GLN A CB    1 
ATOM   61   C  CG    . GLN A 1 11  ? 36.589 1.291   51.853 1.00 12.69 ? 11   GLN A CG    1 
ATOM   62   C  CD    . GLN A 1 11  ? 36.107 1.888   53.147 1.00 12.37 ? 11   GLN A CD    1 
ATOM   63   O  OE1   . GLN A 1 11  ? 34.962 1.689   53.548 1.00 14.33 ? 11   GLN A OE1   1 
ATOM   64   N  NE2   . GLN A 1 11  ? 36.978 2.633   53.809 1.00 12.09 ? 11   GLN A NE2   1 
ATOM   65   N  N     . SER A 1 12  ? 34.310 1.817   48.149 1.00 14.62 ? 12   SER A N     1 
ATOM   66   C  CA    . SER A 1 12  ? 33.435 2.388   47.134 1.00 15.73 ? 12   SER A CA    1 
ATOM   67   C  C     . SER A 1 12  ? 33.285 3.894   47.226 1.00 16.29 ? 12   SER A C     1 
ATOM   68   O  O     . SER A 1 12  ? 33.540 4.501   48.264 1.00 17.04 ? 12   SER A O     1 
ATOM   69   C  CB    . SER A 1 12  ? 32.046 1.768   47.233 1.00 15.99 ? 12   SER A CB    1 
ATOM   70   O  OG    . SER A 1 12  ? 31.353 2.304   48.350 1.00 19.73 ? 12   SER A OG    1 
ATOM   71   N  N     . HIS A 1 13  ? 32.845 4.485   46.120 1.00 16.39 ? 13   HIS A N     1 
ATOM   72   C  CA    . HIS A 1 13  ? 32.608 5.914   46.042 1.00 16.51 ? 13   HIS A CA    1 
ATOM   73   C  C     . HIS A 1 13  ? 31.236 6.163   45.434 1.00 16.88 ? 13   HIS A C     1 
ATOM   74   O  O     . HIS A 1 13  ? 30.863 5.532   44.448 1.00 16.65 ? 13   HIS A O     1 
ATOM   75   C  CB    . HIS A 1 13  ? 33.650 6.606   45.160 1.00 18.05 ? 13   HIS A CB    1 
ATOM   76   C  CG    . HIS A 1 13  ? 33.379 8.065   44.952 1.00 21.19 ? 13   HIS A CG    1 
ATOM   77   N  ND1   . HIS A 1 13  ? 33.659 9.020   45.906 1.00 22.72 ? 13   HIS A ND1   1 
ATOM   78   C  CD2   . HIS A 1 13  ? 32.791 8.726   43.926 1.00 22.23 ? 13   HIS A CD2   1 
ATOM   79   C  CE1   . HIS A 1 13  ? 33.257 10.205  45.478 1.00 22.81 ? 13   HIS A CE1   1 
ATOM   80   N  NE2   . HIS A 1 13  ? 32.726 10.054  44.279 1.00 21.65 ? 13   HIS A NE2   1 
ATOM   81   N  N     . VAL A 1 14  ? 30.476 7.072   46.032 1.00 16.23 ? 14   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 14  ? 29.175 7.427   45.486 1.00 15.86 ? 14   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 14  ? 29.171 8.938   45.254 1.00 17.23 ? 14   VAL A C     1 
ATOM   84   O  O     . VAL A 1 14  ? 29.748 9.707   46.030 1.00 16.34 ? 14   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 14  ? 27.999 7.030   46.423 1.00 15.53 ? 14   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 14  ? 27.775 5.523   46.349 1.00 12.44 ? 14   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 14  ? 28.278 7.494   47.865 1.00 15.22 ? 14   VAL A CG2   1 
ATOM   88   N  N     . VAL A 1 15  ? 28.552 9.356   44.159 1.00 16.57 ? 15   VAL A N     1 
ATOM   89   C  CA    . VAL A 1 15  ? 28.476 10.772  43.828 1.00 14.35 ? 15   VAL A CA    1 
ATOM   90   C  C     . VAL A 1 15  ? 27.767 11.512  44.953 1.00 13.91 ? 15   VAL A C     1 
ATOM   91   O  O     . VAL A 1 15  ? 28.275 12.493  45.485 1.00 11.08 ? 15   VAL A O     1 
ATOM   92   C  CB    . VAL A 1 15  ? 27.704 10.959  42.512 1.00 15.19 ? 15   VAL A CB    1 
ATOM   93   C  CG1   . VAL A 1 15  ? 27.555 12.430  42.181 1.00 13.33 ? 15   VAL A CG1   1 
ATOM   94   C  CG2   . VAL A 1 15  ? 28.431 10.208  41.402 1.00 14.82 ? 15   VAL A CG2   1 
ATOM   95   N  N     . ARG A 1 16  ? 26.593 11.004  45.307 1.00 14.10 ? 16   ARG A N     1 
ATOM   96   C  CA    . ARG A 1 16  ? 25.752 11.563  46.361 1.00 15.09 ? 16   ARG A CA    1 
ATOM   97   C  C     . ARG A 1 16  ? 25.676 10.631  47.577 1.00 15.14 ? 16   ARG A C     1 
ATOM   98   O  O     . ARG A 1 16  ? 25.747 9.411   47.441 1.00 14.88 ? 16   ARG A O     1 
ATOM   99   C  CB    . ARG A 1 16  ? 24.338 11.782  45.820 1.00 15.98 ? 16   ARG A CB    1 
ATOM   100  C  CG    . ARG A 1 16  ? 23.345 12.200  46.871 1.00 17.44 ? 16   ARG A CG    1 
ATOM   101  C  CD    . ARG A 1 16  ? 21.960 11.720  46.517 1.00 20.35 ? 16   ARG A CD    1 
ATOM   102  N  NE    . ARG A 1 16  ? 21.053 11.870  47.649 1.00 22.44 ? 16   ARG A NE    1 
ATOM   103  C  CZ    . ARG A 1 16  ? 20.526 13.025  48.035 1.00 23.83 ? 16   ARG A CZ    1 
ATOM   104  N  NH1   . ARG A 1 16  ? 20.806 14.141  47.375 1.00 23.80 ? 16   ARG A NH1   1 
ATOM   105  N  NH2   . ARG A 1 16  ? 19.731 13.066  49.096 1.00 24.30 ? 16   ARG A NH2   1 
ATOM   106  N  N     . GLY A 1 17  ? 25.530 11.208  48.765 1.00 14.73 ? 17   GLY A N     1 
ATOM   107  C  CA    . GLY A 1 17  ? 25.417 10.396  49.966 1.00 14.18 ? 17   GLY A CA    1 
ATOM   108  C  C     . GLY A 1 17  ? 26.721 9.963   50.606 1.00 14.41 ? 17   GLY A C     1 
ATOM   109  O  O     . GLY A 1 17  ? 27.812 10.338  50.160 1.00 14.88 ? 17   GLY A O     1 
ATOM   110  N  N     . TYR A 1 18  ? 26.611 9.160   51.658 1.00 13.40 ? 18   TYR A N     1 
ATOM   111  C  CA    . TYR A 1 18  ? 27.797 8.694   52.358 1.00 13.83 ? 18   TYR A CA    1 
ATOM   112  C  C     . TYR A 1 18  ? 27.831 7.193   52.646 1.00 14.12 ? 18   TYR A C     1 
ATOM   113  O  O     . TYR A 1 18  ? 27.044 6.659   53.433 1.00 15.06 ? 18   TYR A O     1 
ATOM   114  C  CB    . TYR A 1 18  ? 27.977 9.482   53.661 1.00 12.99 ? 18   TYR A CB    1 
ATOM   115  C  CG    . TYR A 1 18  ? 28.103 10.970  53.432 1.00 13.08 ? 18   TYR A CG    1 
ATOM   116  C  CD1   . TYR A 1 18  ? 26.969 11.777  53.295 1.00 12.97 ? 18   TYR A CD1   1 
ATOM   117  C  CD2   . TYR A 1 18  ? 29.355 11.562  53.273 1.00 11.81 ? 18   TYR A CD2   1 
ATOM   118  C  CE1   . TYR A 1 18  ? 27.080 13.134  53.000 1.00 11.78 ? 18   TYR A CE1   1 
ATOM   119  C  CE2   . TYR A 1 18  ? 29.475 12.914  52.975 1.00 11.26 ? 18   TYR A CE2   1 
ATOM   120  C  CZ    . TYR A 1 18  ? 28.337 13.690  52.839 1.00 11.78 ? 18   TYR A CZ    1 
ATOM   121  O  OH    . TYR A 1 18  ? 28.465 15.017  52.529 1.00 12.65 ? 18   TYR A OH    1 
ATOM   122  N  N     . VAL A 1 19  ? 28.761 6.520   51.983 1.00 13.29 ? 19   VAL A N     1 
ATOM   123  C  CA    . VAL A 1 19  ? 28.964 5.097   52.161 1.00 12.37 ? 19   VAL A CA    1 
ATOM   124  C  C     . VAL A 1 19  ? 30.395 4.840   51.712 1.00 12.78 ? 19   VAL A C     1 
ATOM   125  O  O     . VAL A 1 19  ? 30.977 5.659   51.006 1.00 12.82 ? 19   VAL A O     1 
ATOM   126  C  CB    . VAL A 1 19  ? 27.959 4.267   51.320 1.00 12.46 ? 19   VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 19  ? 28.226 4.449   49.837 1.00 11.57 ? 19   VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 19  ? 28.041 2.802   51.720 1.00 10.78 ? 19   VAL A CG2   1 
ATOM   129  N  N     . GLY A 1 20  ? 30.981 3.731   52.140 1.00 11.99 ? 20   GLY A N     1 
ATOM   130  C  CA    . GLY A 1 20  ? 32.344 3.453   51.734 1.00 12.52 ? 20   GLY A CA    1 
ATOM   131  C  C     . GLY A 1 20  ? 33.289 4.620   51.962 1.00 13.81 ? 20   GLY A C     1 
ATOM   132  O  O     . GLY A 1 20  ? 33.290 5.240   53.030 1.00 14.45 ? 20   GLY A O     1 
ATOM   133  N  N     . ASN A 1 21  ? 34.098 4.926   50.951 1.00 14.73 ? 21   ASN A N     1 
ATOM   134  C  CA    . ASN A 1 21  ? 35.081 6.004   51.055 1.00 14.96 ? 21   ASN A CA    1 
ATOM   135  C  C     . ASN A 1 21  ? 34.508 7.368   51.352 1.00 14.67 ? 21   ASN A C     1 
ATOM   136  O  O     . ASN A 1 21  ? 35.204 8.226   51.883 1.00 15.56 ? 21   ASN A O     1 
ATOM   137  C  CB    . ASN A 1 21  ? 35.929 6.077   49.792 1.00 14.28 ? 21   ASN A CB    1 
ATOM   138  C  CG    . ASN A 1 21  ? 37.282 5.470   49.990 1.00 16.14 ? 21   ASN A CG    1 
ATOM   139  O  OD1   . ASN A 1 21  ? 38.045 5.293   49.049 1.00 19.80 ? 21   ASN A OD1   1 
ATOM   140  N  ND2   . ASN A 1 21  ? 37.598 5.150   51.230 1.00 18.65 ? 21   ASN A ND2   1 
ATOM   141  N  N     . ARG A 1 22  ? 33.241 7.564   51.016 1.00 13.78 ? 22   ARG A N     1 
ATOM   142  C  CA    . ARG A 1 22  ? 32.577 8.838   51.257 1.00 14.43 ? 22   ARG A CA    1 
ATOM   143  C  C     . ARG A 1 22  ? 32.265 9.040   52.743 1.00 15.30 ? 22   ARG A C     1 
ATOM   144  O  O     . ARG A 1 22  ? 32.218 10.169  53.232 1.00 15.72 ? 22   ARG A O     1 
ATOM   145  C  CB    . ARG A 1 22  ? 31.293 8.911   50.421 1.00 14.59 ? 22   ARG A CB    1 
ATOM   146  C  CG    . ARG A 1 22  ? 31.551 9.238   48.961 1.00 13.18 ? 22   ARG A CG    1 
ATOM   147  C  CD    . ARG A 1 22  ? 31.702 10.732  48.761 1.00 11.69 ? 22   ARG A CD    1 
ATOM   148  N  NE    . ARG A 1 22  ? 30.445 11.394  49.091 1.00 14.09 ? 22   ARG A NE    1 
ATOM   149  C  CZ    . ARG A 1 22  ? 30.130 12.634  48.737 1.00 14.65 ? 22   ARG A CZ    1 
ATOM   150  N  NH1   . ARG A 1 22  ? 30.989 13.363  48.034 1.00 13.71 ? 22   ARG A NH1   1 
ATOM   151  N  NH2   . ARG A 1 22  ? 28.949 13.142  49.076 1.00 14.13 ? 22   ARG A NH2   1 
ATOM   152  N  N     . ALA A 1 23  ? 32.067 7.934   53.449 1.00 15.27 ? 23   ALA A N     1 
ATOM   153  C  CA    . ALA A 1 23  ? 31.762 7.952   54.869 1.00 14.46 ? 23   ALA A CA    1 
ATOM   154  C  C     . ALA A 1 23  ? 33.043 7.886   55.693 1.00 16.44 ? 23   ALA A C     1 
ATOM   155  O  O     . ALA A 1 23  ? 33.057 8.231   56.875 1.00 17.66 ? 23   ALA A O     1 
ATOM   156  C  CB    . ALA A 1 23  ? 30.862 6.776   55.214 1.00 11.28 ? 23   ALA A CB    1 
ATOM   157  N  N     . ALA A 1 24  ? 34.130 7.460   55.069 1.00 17.23 ? 24   ALA A N     1 
ATOM   158  C  CA    . ALA A 1 24  ? 35.381 7.330   55.798 1.00 16.92 ? 24   ALA A CA    1 
ATOM   159  C  C     . ALA A 1 24  ? 36.388 8.463   55.605 1.00 16.44 ? 24   ALA A C     1 
ATOM   160  O  O     . ALA A 1 24  ? 37.187 8.733   56.495 1.00 15.68 ? 24   ALA A O     1 
ATOM   161  C  CB    . ALA A 1 24  ? 36.037 5.978   55.445 1.00 15.55 ? 24   ALA A CB    1 
ATOM   162  N  N     . THR A 1 25  ? 36.354 9.141   54.463 1.00 15.82 ? 25   THR A N     1 
ATOM   163  C  CA    . THR A 1 25  ? 37.350 10.181  54.224 1.00 16.19 ? 25   THR A CA    1 
ATOM   164  C  C     . THR A 1 25  ? 37.211 11.470  55.029 1.00 17.08 ? 25   THR A C     1 
ATOM   165  O  O     . THR A 1 25  ? 38.171 11.891  55.685 1.00 15.63 ? 25   THR A O     1 
ATOM   166  C  CB    . THR A 1 25  ? 37.452 10.541  52.719 1.00 16.34 ? 25   THR A CB    1 
ATOM   167  O  OG1   . THR A 1 25  ? 37.674 9.350   51.954 1.00 18.60 ? 25   THR A OG1   1 
ATOM   168  C  CG2   . THR A 1 25  ? 38.631 11.483  52.480 1.00 16.28 ? 25   THR A CG2   1 
ATOM   169  N  N     . PHE A 1 26  ? 36.036 12.097  54.982 1.00 16.63 ? 26   PHE A N     1 
ATOM   170  C  CA    . PHE A 1 26  ? 35.828 13.348  55.715 1.00 15.78 ? 26   PHE A CA    1 
ATOM   171  C  C     . PHE A 1 26  ? 36.129 13.206  57.221 1.00 16.35 ? 26   PHE A C     1 
ATOM   172  O  O     . PHE A 1 26  ? 36.763 14.079  57.822 1.00 16.29 ? 26   PHE A O     1 
ATOM   173  C  CB    . PHE A 1 26  ? 34.401 13.865  55.504 1.00 14.96 ? 26   PHE A CB    1 
ATOM   174  C  CG    . PHE A 1 26  ? 34.135 15.185  56.163 1.00 14.36 ? 26   PHE A CG    1 
ATOM   175  C  CD1   . PHE A 1 26  ? 34.750 16.350  55.700 1.00 15.70 ? 26   PHE A CD1   1 
ATOM   176  C  CD2   . PHE A 1 26  ? 33.300 15.264  57.276 1.00 14.34 ? 26   PHE A CD2   1 
ATOM   177  C  CE1   . PHE A 1 26  ? 34.539 17.578  56.343 1.00 14.24 ? 26   PHE A CE1   1 
ATOM   178  C  CE2   . PHE A 1 26  ? 33.082 16.483  57.926 1.00 13.41 ? 26   PHE A CE2   1 
ATOM   179  C  CZ    . PHE A 1 26  ? 33.703 17.641  57.458 1.00 14.36 ? 26   PHE A CZ    1 
ATOM   180  N  N     . PRO A 1 27  ? 35.673 12.109  57.853 1.00 16.62 ? 27   PRO A N     1 
ATOM   181  C  CA    . PRO A 1 27  ? 35.947 11.930  59.285 1.00 14.92 ? 27   PRO A CA    1 
ATOM   182  C  C     . PRO A 1 27  ? 37.448 11.875  59.585 1.00 14.55 ? 27   PRO A C     1 
ATOM   183  O  O     . PRO A 1 27  ? 37.938 12.575  60.467 1.00 15.00 ? 27   PRO A O     1 
ATOM   184  C  CB    . PRO A 1 27  ? 35.241 10.614  59.604 1.00 14.54 ? 27   PRO A CB    1 
ATOM   185  C  CG    . PRO A 1 27  ? 34.041 10.678  58.706 1.00 16.09 ? 27   PRO A CG    1 
ATOM   186  C  CD    . PRO A 1 27  ? 34.661 11.138  57.396 1.00 15.92 ? 27   PRO A CD    1 
ATOM   187  N  N     . LEU A 1 28  ? 38.171 11.042  58.847 1.00 12.97 ? 28   LEU A N     1 
ATOM   188  C  CA    . LEU A 1 28  ? 39.604 10.915  59.042 1.00 13.58 ? 28   LEU A CA    1 
ATOM   189  C  C     . LEU A 1 28  ? 40.345 12.224  58.743 1.00 15.32 ? 28   LEU A C     1 
ATOM   190  O  O     . LEU A 1 28  ? 41.324 12.581  59.423 1.00 13.51 ? 28   LEU A O     1 
ATOM   191  C  CB    . LEU A 1 28  ? 40.139 9.778   58.168 1.00 13.06 ? 28   LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 28  ? 39.818 8.396   58.737 1.00 13.56 ? 28   LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 28  ? 40.236 7.287   57.774 1.00 14.85 ? 28   LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 28  ? 40.547 8.253   60.062 1.00 13.45 ? 28   LEU A CD2   1 
ATOM   195  N  N     . GLN A 1 29  ? 39.875 12.948  57.731 1.00 16.20 ? 29   GLN A N     1 
ATOM   196  C  CA    . GLN A 1 29  ? 40.505 14.209  57.374 1.00 15.37 ? 29   GLN A CA    1 
ATOM   197  C  C     . GLN A 1 29  ? 40.365 15.238  58.494 1.00 15.36 ? 29   GLN A C     1 
ATOM   198  O  O     . GLN A 1 29  ? 41.374 15.812  58.920 1.00 13.89 ? 29   GLN A O     1 
ATOM   199  C  CB    . GLN A 1 29  ? 39.926 14.743  56.061 1.00 15.90 ? 29   GLN A CB    1 
ATOM   200  C  CG    . GLN A 1 29  ? 40.322 13.906  54.848 1.00 16.49 ? 29   GLN A CG    1 
ATOM   201  C  CD    . GLN A 1 29  ? 39.805 14.469  53.524 1.00 15.75 ? 29   GLN A CD    1 
ATOM   202  O  OE1   . GLN A 1 29  ? 38.615 14.752  53.376 1.00 13.47 ? 29   GLN A OE1   1 
ATOM   203  N  NE2   . GLN A 1 29  ? 40.701 14.616  52.555 1.00 12.54 ? 29   GLN A NE2   1 
ATOM   204  N  N     . VAL A 1 30  ? 39.142 15.461  58.989 1.00 14.33 ? 30   VAL A N     1 
ATOM   205  C  CA    . VAL A 1 30  ? 38.954 16.435  60.070 1.00 15.47 ? 30   VAL A CA    1 
ATOM   206  C  C     . VAL A 1 30  ? 39.687 16.000  61.339 1.00 14.67 ? 30   VAL A C     1 
ATOM   207  O  O     . VAL A 1 30  ? 40.056 16.838  62.161 1.00 15.37 ? 30   VAL A O     1 
ATOM   208  C  CB    . VAL A 1 30  ? 37.447 16.690  60.425 1.00 14.71 ? 30   VAL A CB    1 
ATOM   209  C  CG1   . VAL A 1 30  ? 36.674 17.067  59.176 1.00 14.22 ? 30   VAL A CG1   1 
ATOM   210  C  CG2   . VAL A 1 30  ? 36.840 15.480  61.102 1.00 16.51 ? 30   VAL A CG2   1 
ATOM   211  N  N     . LEU A 1 31  ? 39.907 14.696  61.493 1.00 13.61 ? 31   LEU A N     1 
ATOM   212  C  CA    . LEU A 1 31  ? 40.616 14.194  62.660 1.00 14.81 ? 31   LEU A CA    1 
ATOM   213  C  C     . LEU A 1 31  ? 42.138 14.292  62.497 1.00 16.20 ? 31   LEU A C     1 
ATOM   214  O  O     . LEU A 1 31  ? 42.890 13.892  63.384 1.00 18.20 ? 31   LEU A O     1 
ATOM   215  C  CB    . LEU A 1 31  ? 40.183 12.755  62.976 1.00 13.98 ? 31   LEU A CB    1 
ATOM   216  C  CG    . LEU A 1 31  ? 38.817 12.617  63.676 1.00 14.01 ? 31   LEU A CG    1 
ATOM   217  C  CD1   . LEU A 1 31  ? 38.401 11.162  63.745 1.00 15.00 ? 31   LEU A CD1   1 
ATOM   218  C  CD2   . LEU A 1 31  ? 38.885 13.200  65.072 1.00 10.63 ? 31   LEU A CD2   1 
ATOM   219  N  N     . GLY A 1 32  ? 42.590 14.823  61.361 1.00 16.10 ? 32   GLY A N     1 
ATOM   220  C  CA    . GLY A 1 32  ? 44.013 15.004  61.144 1.00 14.16 ? 32   GLY A CA    1 
ATOM   221  C  C     . GLY A 1 32  ? 44.758 13.972  60.332 1.00 15.67 ? 32   GLY A C     1 
ATOM   222  O  O     . GLY A 1 32  ? 45.979 14.046  60.224 1.00 17.11 ? 32   GLY A O     1 
ATOM   223  N  N     . PHE A 1 33  ? 44.051 13.014  59.747 1.00 16.13 ? 33   PHE A N     1 
ATOM   224  C  CA    . PHE A 1 33  ? 44.727 11.986  58.966 1.00 15.19 ? 33   PHE A CA    1 
ATOM   225  C  C     . PHE A 1 33  ? 44.859 12.307  57.485 1.00 14.79 ? 33   PHE A C     1 
ATOM   226  O  O     . PHE A 1 33  ? 43.958 12.861  56.869 1.00 14.18 ? 33   PHE A O     1 
ATOM   227  C  CB    . PHE A 1 33  ? 44.014 10.638  59.127 1.00 16.52 ? 33   PHE A CB    1 
ATOM   228  C  CG    . PHE A 1 33  ? 44.104 10.069  60.512 1.00 17.01 ? 33   PHE A CG    1 
ATOM   229  C  CD1   . PHE A 1 33  ? 43.338 10.597  61.545 1.00 18.16 ? 33   PHE A CD1   1 
ATOM   230  C  CD2   . PHE A 1 33  ? 44.990 9.032   60.796 1.00 17.12 ? 33   PHE A CD2   1 
ATOM   231  C  CE1   . PHE A 1 33  ? 43.450 10.104  62.849 1.00 18.52 ? 33   PHE A CE1   1 
ATOM   232  C  CE2   . PHE A 1 33  ? 45.113 8.531   62.094 1.00 17.80 ? 33   PHE A CE2   1 
ATOM   233  C  CZ    . PHE A 1 33  ? 44.341 9.069   63.123 1.00 18.64 ? 33   PHE A CZ    1 
ATOM   234  N  N     . GLU A 1 34  ? 46.009 11.958  56.927 1.00 15.30 ? 34   GLU A N     1 
ATOM   235  C  CA    . GLU A 1 34  ? 46.274 12.149  55.509 1.00 14.54 ? 34   GLU A CA    1 
ATOM   236  C  C     . GLU A 1 34  ? 45.648 10.902  54.873 1.00 14.54 ? 34   GLU A C     1 
ATOM   237  O  O     . GLU A 1 34  ? 46.132 9.792   55.084 1.00 14.13 ? 34   GLU A O     1 
ATOM   238  C  CB    . GLU A 1 34  ? 47.786 12.173  55.282 1.00 14.60 ? 34   GLU A CB    1 
ATOM   239  C  CG    . GLU A 1 34  ? 48.229 12.545  53.891 1.00 17.23 ? 34   GLU A CG    1 
ATOM   240  C  CD    . GLU A 1 34  ? 47.911 13.985  53.540 1.00 19.96 ? 34   GLU A CD    1 
ATOM   241  O  OE1   . GLU A 1 34  ? 47.100 14.193  52.613 1.00 22.05 ? 34   GLU A OE1   1 
ATOM   242  O  OE2   . GLU A 1 34  ? 48.470 14.904  54.184 1.00 18.13 ? 34   GLU A OE2   1 
ATOM   243  N  N     . VAL A 1 35  ? 44.562 11.076  54.122 1.00 14.09 ? 35   VAL A N     1 
ATOM   244  C  CA    . VAL A 1 35  ? 43.878 9.941   53.494 1.00 13.89 ? 35   VAL A CA    1 
ATOM   245  C  C     . VAL A 1 35  ? 44.077 9.792   51.974 1.00 15.36 ? 35   VAL A C     1 
ATOM   246  O  O     . VAL A 1 35  ? 43.738 10.696  51.204 1.00 16.48 ? 35   VAL A O     1 
ATOM   247  C  CB    . VAL A 1 35  ? 42.365 10.021  53.739 1.00 12.59 ? 35   VAL A CB    1 
ATOM   248  C  CG1   . VAL A 1 35  ? 41.701 8.752   53.260 1.00 11.95 ? 35   VAL A CG1   1 
ATOM   249  C  CG2   . VAL A 1 35  ? 42.084 10.279  55.198 1.00 12.90 ? 35   VAL A CG2   1 
ATOM   250  N  N     . ASP A 1 36  ? 44.629 8.655   51.549 1.00 15.39 ? 36   ASP A N     1 
ATOM   251  C  CA    . ASP A 1 36  ? 44.822 8.372   50.126 1.00 16.79 ? 36   ASP A CA    1 
ATOM   252  C  C     . ASP A 1 36  ? 43.650 7.456   49.804 1.00 17.63 ? 36   ASP A C     1 
ATOM   253  O  O     . ASP A 1 36  ? 43.510 6.389   50.400 1.00 19.16 ? 36   ASP A O     1 
ATOM   254  C  CB    . ASP A 1 36  ? 46.159 7.662   49.875 1.00 16.09 ? 36   ASP A CB    1 
ATOM   255  C  CG    . ASP A 1 36  ? 47.341 8.621   49.906 1.00 18.86 ? 36   ASP A CG    1 
ATOM   256  O  OD1   . ASP A 1 36  ? 47.145 9.766   50.352 1.00 21.68 ? 36   ASP A OD1   1 
ATOM   257  O  OD2   . ASP A 1 36  ? 48.464 8.245   49.498 1.00 18.75 ? 36   ASP A OD2   1 
ATOM   258  N  N     . ALA A 1 37  ? 42.796 7.875   48.879 1.00 18.13 ? 37   ALA A N     1 
ATOM   259  C  CA    . ALA A 1 37  ? 41.613 7.088   48.557 1.00 18.74 ? 37   ALA A CA    1 
ATOM   260  C  C     . ALA A 1 37  ? 41.562 6.414   47.188 1.00 19.90 ? 37   ALA A C     1 
ATOM   261  O  O     . ALA A 1 37  ? 41.644 7.066   46.142 1.00 21.38 ? 37   ALA A O     1 
ATOM   262  C  CB    . ALA A 1 37  ? 40.372 7.950   48.743 1.00 16.10 ? 37   ALA A CB    1 
ATOM   263  N  N     . VAL A 1 38  ? 41.418 5.094   47.215 1.00 18.94 ? 38   VAL A N     1 
ATOM   264  C  CA    . VAL A 1 38  ? 41.298 4.305   46.002 1.00 18.30 ? 38   VAL A CA    1 
ATOM   265  C  C     . VAL A 1 38  ? 39.823 3.947   45.952 1.00 19.54 ? 38   VAL A C     1 
ATOM   266  O  O     . VAL A 1 38  ? 39.327 3.236   46.829 1.00 19.16 ? 38   VAL A O     1 
ATOM   267  C  CB    . VAL A 1 38  ? 42.110 2.989   46.074 1.00 16.88 ? 38   VAL A CB    1 
ATOM   268  C  CG1   . VAL A 1 38  ? 41.843 2.158   44.834 1.00 15.29 ? 38   VAL A CG1   1 
ATOM   269  C  CG2   . VAL A 1 38  ? 43.600 3.288   46.210 1.00 16.41 ? 38   VAL A CG2   1 
ATOM   270  N  N     . ASN A 1 39  ? 39.108 4.453   44.954 1.00 19.90 ? 39   ASN A N     1 
ATOM   271  C  CA    . ASN A 1 39  ? 37.690 4.143   44.853 1.00 19.79 ? 39   ASN A CA    1 
ATOM   272  C  C     . ASN A 1 39  ? 37.512 2.849   44.079 1.00 19.07 ? 39   ASN A C     1 
ATOM   273  O  O     . ASN A 1 39  ? 37.817 2.780   42.887 1.00 18.73 ? 39   ASN A O     1 
ATOM   274  C  CB    . ASN A 1 39  ? 36.939 5.279   44.163 1.00 20.96 ? 39   ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 39  ? 37.080 6.599   44.896 1.00 20.67 ? 39   ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 39  ? 36.959 6.654   46.118 1.00 21.91 ? 39   ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 39  ? 37.327 7.672   44.152 1.00 20.67 ? 39   ASN A ND2   1 
ATOM   278  N  N     . SER A 1 40  ? 37.025 1.823   44.770 1.00 17.34 ? 40   SER A N     1 
ATOM   279  C  CA    . SER A 1 40  ? 36.817 0.522   44.160 1.00 18.67 ? 40   SER A CA    1 
ATOM   280  C  C     . SER A 1 40  ? 35.689 0.536   43.134 1.00 17.77 ? 40   SER A C     1 
ATOM   281  O  O     . SER A 1 40  ? 35.636 -0.307  42.243 1.00 18.45 ? 40   SER A O     1 
ATOM   282  C  CB    . SER A 1 40  ? 36.527 -0.512  45.237 1.00 19.08 ? 40   SER A CB    1 
ATOM   283  O  OG    . SER A 1 40  ? 35.320 -0.205  45.905 1.00 22.94 ? 40   SER A OG    1 
ATOM   284  N  N     . VAL A 1 41  ? 34.783 1.492   43.264 1.00 17.30 ? 41   VAL A N     1 
ATOM   285  C  CA    . VAL A 1 41  ? 33.677 1.618   42.325 1.00 17.74 ? 41   VAL A CA    1 
ATOM   286  C  C     . VAL A 1 41  ? 33.221 3.066   42.378 1.00 18.85 ? 41   VAL A C     1 
ATOM   287  O  O     . VAL A 1 41  ? 33.621 3.810   43.277 1.00 20.60 ? 41   VAL A O     1 
ATOM   288  C  CB    . VAL A 1 41  ? 32.468 0.730   42.730 1.00 17.57 ? 41   VAL A CB    1 
ATOM   289  C  CG1   . VAL A 1 41  ? 32.915 -0.692  42.970 1.00 17.53 ? 41   VAL A CG1   1 
ATOM   290  C  CG2   . VAL A 1 41  ? 31.807 1.279   43.989 1.00 16.07 ? 41   VAL A CG2   1 
ATOM   291  N  N     . GLN A 1 42  ? 32.417 3.479   41.403 1.00 18.54 ? 42   GLN A N     1 
ATOM   292  C  CA    . GLN A 1 42  ? 31.859 4.823   41.421 1.00 18.31 ? 42   GLN A CA    1 
ATOM   293  C  C     . GLN A 1 42  ? 30.412 4.738   40.981 1.00 18.61 ? 42   GLN A C     1 
ATOM   294  O  O     . GLN A 1 42  ? 30.128 4.531   39.807 1.00 18.74 ? 42   GLN A O     1 
ATOM   295  C  CB    . GLN A 1 42  ? 32.613 5.801   40.512 1.00 18.25 ? 42   GLN A CB    1 
ATOM   296  C  CG    . GLN A 1 42  ? 31.905 7.166   40.444 1.00 18.92 ? 42   GLN A CG    1 
ATOM   297  C  CD    . GLN A 1 42  ? 32.728 8.261   39.798 1.00 18.88 ? 42   GLN A CD    1 
ATOM   298  O  OE1   . GLN A 1 42  ? 33.265 8.079   38.712 1.00 20.52 ? 42   GLN A OE1   1 
ATOM   299  N  NE2   . GLN A 1 42  ? 32.813 9.416   40.458 1.00 16.06 ? 42   GLN A NE2   1 
ATOM   300  N  N     . PHE A 1 43  ? 29.497 4.870   41.934 1.00 19.40 ? 43   PHE A N     1 
ATOM   301  C  CA    . PHE A 1 43  ? 28.080 4.833   41.621 1.00 20.13 ? 43   PHE A CA    1 
ATOM   302  C  C     . PHE A 1 43  ? 27.452 6.176   41.929 1.00 19.84 ? 43   PHE A C     1 
ATOM   303  O  O     . PHE A 1 43  ? 28.061 7.018   42.593 1.00 19.87 ? 43   PHE A O     1 
ATOM   304  C  CB    . PHE A 1 43  ? 27.375 3.723   42.397 1.00 23.23 ? 43   PHE A CB    1 
ATOM   305  C  CG    . PHE A 1 43  ? 27.603 2.360   41.820 1.00 25.05 ? 43   PHE A CG    1 
ATOM   306  C  CD1   . PHE A 1 43  ? 28.537 1.506   42.368 1.00 27.29 ? 43   PHE A CD1   1 
ATOM   307  C  CD2   . PHE A 1 43  ? 26.913 1.951   40.690 1.00 26.92 ? 43   PHE A CD2   1 
ATOM   308  C  CE1   . PHE A 1 43  ? 28.785 0.263   41.794 1.00 29.18 ? 43   PHE A CE1   1 
ATOM   309  C  CE2   . PHE A 1 43  ? 27.155 0.711   40.111 1.00 27.44 ? 43   PHE A CE2   1 
ATOM   310  C  CZ    . PHE A 1 43  ? 28.093 -0.133  40.664 1.00 27.39 ? 43   PHE A CZ    1 
ATOM   311  N  N     . SER A 1 44  ? 26.239 6.377   41.428 1.00 19.52 ? 44   SER A N     1 
ATOM   312  C  CA    . SER A 1 44  ? 25.529 7.628   41.630 1.00 19.85 ? 44   SER A CA    1 
ATOM   313  C  C     . SER A 1 44  ? 25.072 7.775   43.083 1.00 21.35 ? 44   SER A C     1 
ATOM   314  O  O     . SER A 1 44  ? 24.973 8.885   43.610 1.00 22.52 ? 44   SER A O     1 
ATOM   315  C  CB    . SER A 1 44  ? 24.324 7.688   40.697 1.00 17.80 ? 44   SER A CB    1 
ATOM   316  O  OG    . SER A 1 44  ? 23.429 6.631   40.980 1.00 16.74 ? 44   SER A OG    1 
ATOM   317  N  N     . ASN A 1 45  ? 24.813 6.647   43.730 1.00 21.02 ? 45   ASN A N     1 
ATOM   318  C  CA    . ASN A 1 45  ? 24.355 6.648   45.104 1.00 20.66 ? 45   ASN A CA    1 
ATOM   319  C  C     . ASN A 1 45  ? 24.404 5.208   45.576 1.00 20.95 ? 45   ASN A C     1 
ATOM   320  O  O     . ASN A 1 45  ? 24.857 4.349   44.835 1.00 21.64 ? 45   ASN A O     1 
ATOM   321  C  CB    . ASN A 1 45  ? 22.939 7.194   45.140 1.00 19.92 ? 45   ASN A CB    1 
ATOM   322  C  CG    . ASN A 1 45  ? 22.085 6.616   44.047 1.00 21.28 ? 45   ASN A CG    1 
ATOM   323  O  OD1   . ASN A 1 45  ? 21.655 5.465   44.131 1.00 26.29 ? 45   ASN A OD1   1 
ATOM   324  N  ND2   . ASN A 1 45  ? 21.848 7.399   42.996 1.00 18.67 ? 45   ASN A ND2   1 
ATOM   325  N  N     . HIS A 1 46  ? 23.952 4.934   46.797 1.00 21.08 ? 46   HIS A N     1 
ATOM   326  C  CA    . HIS A 1 46  ? 23.990 3.569   47.302 1.00 20.24 ? 46   HIS A CA    1 
ATOM   327  C  C     . HIS A 1 46  ? 22.752 2.783   46.912 1.00 21.76 ? 46   HIS A C     1 
ATOM   328  O  O     . HIS A 1 46  ? 21.757 3.356   46.467 1.00 21.05 ? 46   HIS A O     1 
ATOM   329  C  CB    . HIS A 1 46  ? 24.211 3.547   48.827 1.00 20.80 ? 46   HIS A CB    1 
ATOM   330  C  CG    . HIS A 1 46  ? 23.080 4.106   49.632 1.00 19.19 ? 46   HIS A CG    1 
ATOM   331  N  ND1   . HIS A 1 46  ? 21.852 3.490   49.720 1.00 19.24 ? 46   HIS A ND1   1 
ATOM   332  C  CD2   . HIS A 1 46  ? 23.006 5.204   50.423 1.00 19.50 ? 46   HIS A CD2   1 
ATOM   333  C  CE1   . HIS A 1 46  ? 21.070 4.181   50.530 1.00 20.30 ? 46   HIS A CE1   1 
ATOM   334  N  NE2   . HIS A 1 46  ? 21.748 5.226   50.970 1.00 19.63 ? 46   HIS A NE2   1 
ATOM   335  N  N     . THR A 1 47  ? 22.831 1.465   47.077 1.00 23.26 ? 47   THR A N     1 
ATOM   336  C  CA    . THR A 1 47  ? 21.754 0.543   46.710 1.00 23.80 ? 47   THR A CA    1 
ATOM   337  C  C     . THR A 1 47  ? 20.475 0.611   47.541 1.00 24.08 ? 47   THR A C     1 
ATOM   338  O  O     . THR A 1 47  ? 19.571 -0.208  47.362 1.00 24.84 ? 47   THR A O     1 
ATOM   339  C  CB    . THR A 1 47  ? 22.259 -0.905  46.737 1.00 24.46 ? 47   THR A CB    1 
ATOM   340  O  OG1   . THR A 1 47  ? 22.727 -1.206  48.054 1.00 23.29 ? 47   THR A OG1   1 
ATOM   341  C  CG2   . THR A 1 47  ? 23.407 -1.094  45.742 1.00 24.24 ? 47   THR A CG2   1 
ATOM   342  N  N     . GLY A 1 48  ? 20.396 1.577   48.447 1.00 23.53 ? 48   GLY A N     1 
ATOM   343  C  CA    . GLY A 1 48  ? 19.203 1.719   49.260 1.00 23.09 ? 48   GLY A CA    1 
ATOM   344  C  C     . GLY A 1 48  ? 18.149 2.473   48.476 1.00 23.67 ? 48   GLY A C     1 
ATOM   345  O  O     . GLY A 1 48  ? 16.972 2.501   48.851 1.00 24.57 ? 48   GLY A O     1 
ATOM   346  N  N     . TYR A 1 49  ? 18.587 3.096   47.387 1.00 23.50 ? 49   TYR A N     1 
ATOM   347  C  CA    . TYR A 1 49  ? 17.712 3.854   46.503 1.00 24.78 ? 49   TYR A CA    1 
ATOM   348  C  C     . TYR A 1 49  ? 17.051 2.883   45.512 1.00 26.22 ? 49   TYR A C     1 
ATOM   349  O  O     . TYR A 1 49  ? 17.489 1.738   45.378 1.00 27.95 ? 49   TYR A O     1 
ATOM   350  C  CB    . TYR A 1 49  ? 18.535 4.903   45.749 1.00 24.09 ? 49   TYR A CB    1 
ATOM   351  C  CG    . TYR A 1 49  ? 19.027 6.064   46.594 1.00 24.02 ? 49   TYR A CG    1 
ATOM   352  C  CD1   . TYR A 1 49  ? 18.406 7.318   46.520 1.00 22.41 ? 49   TYR A CD1   1 
ATOM   353  C  CD2   . TYR A 1 49  ? 20.114 5.919   47.459 1.00 23.54 ? 49   TYR A CD2   1 
ATOM   354  C  CE1   . TYR A 1 49  ? 18.854 8.399   47.283 1.00 21.71 ? 49   TYR A CE1   1 
ATOM   355  C  CE2   . TYR A 1 49  ? 20.572 7.001   48.230 1.00 24.19 ? 49   TYR A CE2   1 
ATOM   356  C  CZ    . TYR A 1 49  ? 19.931 8.240   48.134 1.00 23.04 ? 49   TYR A CZ    1 
ATOM   357  O  OH    . TYR A 1 49  ? 20.350 9.315   48.891 1.00 21.86 ? 49   TYR A OH    1 
ATOM   358  N  N     . SER A 1 50  ? 16.009 3.331   44.812 1.00 27.33 ? 50   SER A N     1 
ATOM   359  C  CA    . SER A 1 50  ? 15.306 2.469   43.856 1.00 27.86 ? 50   SER A CA    1 
ATOM   360  C  C     . SER A 1 50  ? 16.126 2.262   42.597 1.00 27.66 ? 50   SER A C     1 
ATOM   361  O  O     . SER A 1 50  ? 15.947 1.273   41.885 1.00 28.59 ? 50   SER A O     1 
ATOM   362  C  CB    . SER A 1 50  ? 13.963 3.075   43.433 1.00 27.58 ? 50   SER A CB    1 
ATOM   363  O  OG    . SER A 1 50  ? 13.408 3.915   44.425 1.00 31.72 ? 50   SER A OG    1 
ATOM   364  N  N     . HIS A 1 51  ? 17.000 3.218   42.310 1.00 26.86 ? 51   HIS A N     1 
ATOM   365  C  CA    . HIS A 1 51  ? 17.843 3.163   41.126 1.00 26.04 ? 51   HIS A CA    1 
ATOM   366  C  C     . HIS A 1 51  ? 19.290 3.440   41.487 1.00 24.54 ? 51   HIS A C     1 
ATOM   367  O  O     . HIS A 1 51  ? 19.588 3.987   42.545 1.00 25.45 ? 51   HIS A O     1 
ATOM   368  C  CB    . HIS A 1 51  ? 17.391 4.216   40.112 1.00 28.97 ? 51   HIS A CB    1 
ATOM   369  C  CG    . HIS A 1 51  ? 15.992 4.027   39.621 1.00 31.76 ? 51   HIS A CG    1 
ATOM   370  N  ND1   . HIS A 1 51  ? 15.654 3.077   38.683 1.00 35.37 ? 51   HIS A ND1   1 
ATOM   371  C  CD2   . HIS A 1 51  ? 14.839 4.651   39.955 1.00 34.03 ? 51   HIS A CD2   1 
ATOM   372  C  CE1   . HIS A 1 51  ? 14.352 3.122   38.462 1.00 36.54 ? 51   HIS A CE1   1 
ATOM   373  N  NE2   . HIS A 1 51  ? 13.834 4.069   39.222 1.00 34.76 ? 51   HIS A NE2   1 
ATOM   374  N  N     . TRP A 1 52  ? 20.190 3.049   40.603 1.00 22.35 ? 52   TRP A N     1 
ATOM   375  C  CA    . TRP A 1 52  ? 21.597 3.318   40.804 1.00 21.83 ? 52   TRP A CA    1 
ATOM   376  C  C     . TRP A 1 52  ? 22.348 2.927   39.541 1.00 22.48 ? 52   TRP A C     1 
ATOM   377  O  O     . TRP A 1 52  ? 22.013 1.943   38.879 1.00 22.58 ? 52   TRP A O     1 
ATOM   378  C  CB    . TRP A 1 52  ? 22.138 2.591   42.048 1.00 21.14 ? 52   TRP A CB    1 
ATOM   379  C  CG    . TRP A 1 52  ? 22.263 1.098   41.948 1.00 22.23 ? 52   TRP A CG    1 
ATOM   380  C  CD1   . TRP A 1 52  ? 23.221 0.393   41.272 1.00 20.63 ? 52   TRP A CD1   1 
ATOM   381  C  CD2   . TRP A 1 52  ? 21.425 0.128   42.584 1.00 23.06 ? 52   TRP A CD2   1 
ATOM   382  N  NE1   . TRP A 1 52  ? 23.032 -0.953  41.452 1.00 20.31 ? 52   TRP A NE1   1 
ATOM   383  C  CE2   . TRP A 1 52  ? 21.937 -1.146  42.253 1.00 22.09 ? 52   TRP A CE2   1 
ATOM   384  C  CE3   . TRP A 1 52  ? 20.291 0.212   43.408 1.00 22.73 ? 52   TRP A CE3   1 
ATOM   385  C  CZ2   . TRP A 1 52  ? 21.356 -2.330  42.716 1.00 23.12 ? 52   TRP A CZ2   1 
ATOM   386  C  CZ3   . TRP A 1 52  ? 19.714 -0.962  43.869 1.00 23.82 ? 52   TRP A CZ3   1 
ATOM   387  C  CH2   . TRP A 1 52  ? 20.249 -2.219  43.520 1.00 23.60 ? 52   TRP A CH2   1 
ATOM   388  N  N     . LYS A 1 53  ? 23.336 3.736   39.190 1.00 21.61 ? 53   LYS A N     1 
ATOM   389  C  CA    . LYS A 1 53  ? 24.142 3.503   38.008 1.00 20.08 ? 53   LYS A CA    1 
ATOM   390  C  C     . LYS A 1 53  ? 25.575 3.851   38.341 1.00 19.46 ? 53   LYS A C     1 
ATOM   391  O  O     . LYS A 1 53  ? 25.817 4.701   39.191 1.00 19.49 ? 53   LYS A O     1 
ATOM   392  C  CB    . LYS A 1 53  ? 23.648 4.373   36.858 1.00 21.79 ? 53   LYS A CB    1 
ATOM   393  C  CG    . LYS A 1 53  ? 22.309 3.935   36.301 1.00 23.94 ? 53   LYS A CG    1 
ATOM   394  C  CD    . LYS A 1 53  ? 21.946 4.728   35.054 1.00 26.92 ? 53   LYS A CD    1 
ATOM   395  C  CE    . LYS A 1 53  ? 20.753 4.120   34.337 1.00 28.00 ? 53   LYS A CE    1 
ATOM   396  N  NZ    . LYS A 1 53  ? 21.080 2.738   33.879 1.00 30.54 ? 53   LYS A NZ    1 
ATOM   397  N  N     . GLY A 1 54  ? 26.522 3.196   37.681 1.00 17.52 ? 54   GLY A N     1 
ATOM   398  C  CA    . GLY A 1 54  ? 27.917 3.473   37.953 1.00 15.99 ? 54   GLY A CA    1 
ATOM   399  C  C     . GLY A 1 54  ? 28.801 2.428   37.324 1.00 16.19 ? 54   GLY A C     1 
ATOM   400  O  O     . GLY A 1 54  ? 28.312 1.568   36.611 1.00 17.62 ? 54   GLY A O     1 
ATOM   401  N  N     . GLN A 1 55  ? 30.098 2.498   37.589 1.00 17.37 ? 55   GLN A N     1 
ATOM   402  C  CA    . GLN A 1 55  ? 31.049 1.550   37.024 1.00 18.64 ? 55   GLN A CA    1 
ATOM   403  C  C     . GLN A 1 55  ? 31.916 0.927   38.121 1.00 20.15 ? 55   GLN A C     1 
ATOM   404  O  O     . GLN A 1 55  ? 32.125 1.526   39.173 1.00 21.72 ? 55   GLN A O     1 
ATOM   405  C  CB    . GLN A 1 55  ? 31.923 2.257   35.980 1.00 17.24 ? 55   GLN A CB    1 
ATOM   406  N  N     . VAL A 1 56  ? 32.422 -0.275  37.869 1.00 21.53 ? 56   VAL A N     1 
ATOM   407  C  CA    . VAL A 1 56  ? 33.250 -0.980  38.842 1.00 23.47 ? 56   VAL A CA    1 
ATOM   408  C  C     . VAL A 1 56  ? 34.713 -1.075  38.417 1.00 23.80 ? 56   VAL A C     1 
ATOM   409  O  O     . VAL A 1 56  ? 35.029 -1.043  37.234 1.00 25.56 ? 56   VAL A O     1 
ATOM   410  C  CB    . VAL A 1 56  ? 32.726 -2.407  39.061 1.00 24.64 ? 56   VAL A CB    1 
ATOM   411  C  CG1   . VAL A 1 56  ? 32.364 -2.612  40.501 1.00 25.80 ? 56   VAL A CG1   1 
ATOM   412  C  CG2   . VAL A 1 56  ? 31.516 -2.645  38.189 1.00 27.45 ? 56   VAL A CG2   1 
ATOM   413  N  N     . LEU A 1 57  ? 35.604 -1.200  39.388 1.00 24.29 ? 57   LEU A N     1 
ATOM   414  C  CA    . LEU A 1 57  ? 37.026 -1.312  39.106 1.00 26.09 ? 57   LEU A CA    1 
ATOM   415  C  C     . LEU A 1 57  ? 37.396 -2.778  39.287 1.00 27.26 ? 57   LEU A C     1 
ATOM   416  O  O     . LEU A 1 57  ? 36.999 -3.390  40.279 1.00 27.58 ? 57   LEU A O     1 
ATOM   417  C  CB    . LEU A 1 57  ? 37.823 -0.476  40.103 1.00 27.52 ? 57   LEU A CB    1 
ATOM   418  C  CG    . LEU A 1 57  ? 39.038 0.288   39.574 1.00 29.33 ? 57   LEU A CG    1 
ATOM   419  C  CD1   . LEU A 1 57  ? 38.553 1.535   38.827 1.00 28.38 ? 57   LEU A CD1   1 
ATOM   420  C  CD2   . LEU A 1 57  ? 39.954 0.674   40.737 1.00 28.23 ? 57   LEU A CD2   1 
ATOM   421  N  N     . ASN A 1 58  ? 38.134 -3.353  38.339 1.00 28.51 ? 58   ASN A N     1 
ATOM   422  C  CA    . ASN A 1 58  ? 38.529 -4.750  38.475 1.00 30.01 ? 58   ASN A CA    1 
ATOM   423  C  C     . ASN A 1 58  ? 39.899 -4.826  39.137 1.00 30.69 ? 58   ASN A C     1 
ATOM   424  O  O     . ASN A 1 58  ? 40.596 -3.814  39.261 1.00 28.90 ? 58   ASN A O     1 
ATOM   425  C  CB    . ASN A 1 58  ? 38.541 -5.467  37.118 1.00 31.57 ? 58   ASN A CB    1 
ATOM   426  C  CG    . ASN A 1 58  ? 39.437 -4.788  36.098 1.00 34.61 ? 58   ASN A CG    1 
ATOM   427  O  OD1   . ASN A 1 58  ? 40.611 -4.509  36.364 1.00 36.32 ? 58   ASN A OD1   1 
ATOM   428  N  ND2   . ASN A 1 58  ? 38.890 -4.534  34.913 1.00 34.02 ? 58   ASN A ND2   1 
ATOM   429  N  N     . SER A 1 59  ? 40.273 -6.023  39.574 1.00 31.80 ? 59   SER A N     1 
ATOM   430  C  CA    . SER A 1 59  ? 41.539 -6.213  40.260 1.00 32.70 ? 59   SER A CA    1 
ATOM   431  C  C     . SER A 1 59  ? 42.737 -5.698  39.484 1.00 32.35 ? 59   SER A C     1 
ATOM   432  O  O     . SER A 1 59  ? 43.729 -5.295  40.091 1.00 32.85 ? 59   SER A O     1 
ATOM   433  C  CB    . SER A 1 59  ? 41.728 -7.689  40.614 1.00 33.81 ? 59   SER A CB    1 
ATOM   434  O  OG    . SER A 1 59  ? 41.460 -8.517  39.499 1.00 38.20 ? 59   SER A OG    1 
ATOM   435  N  N     . ASP A 1 60  ? 42.650 -5.700  38.154 1.00 32.53 ? 60   ASP A N     1 
ATOM   436  C  CA    . ASP A 1 60  ? 43.757 -5.214  37.322 1.00 32.17 ? 60   ASP A CA    1 
ATOM   437  C  C     . ASP A 1 60  ? 43.928 -3.714  37.440 1.00 30.83 ? 60   ASP A C     1 
ATOM   438  O  O     . ASP A 1 60  ? 45.047 -3.211  37.475 1.00 30.59 ? 60   ASP A O     1 
ATOM   439  C  CB    . ASP A 1 60  ? 43.541 -5.541  35.846 1.00 36.14 ? 60   ASP A CB    1 
ATOM   440  C  CG    . ASP A 1 60  ? 43.644 -7.016  35.552 1.00 41.19 ? 60   ASP A CG    1 
ATOM   441  O  OD1   . ASP A 1 60  ? 44.548 -7.676  36.122 1.00 43.73 ? 60   ASP A OD1   1 
ATOM   442  O  OD2   . ASP A 1 60  ? 42.829 -7.512  34.738 1.00 43.63 ? 60   ASP A OD2   1 
ATOM   443  N  N     . GLU A 1 61  ? 42.808 -3.003  37.472 1.00 29.23 ? 61   GLU A N     1 
ATOM   444  C  CA    . GLU A 1 61  ? 42.831 -1.559  37.587 1.00 27.48 ? 61   GLU A CA    1 
ATOM   445  C  C     . GLU A 1 61  ? 43.326 -1.164  38.971 1.00 26.93 ? 61   GLU A C     1 
ATOM   446  O  O     . GLU A 1 61  ? 44.068 -0.190  39.116 1.00 25.63 ? 61   GLU A O     1 
ATOM   447  C  CB    . GLU A 1 61  ? 41.435 -1.012  37.292 1.00 29.26 ? 61   GLU A CB    1 
ATOM   448  C  CG    . GLU A 1 61  ? 41.055 -1.255  35.833 1.00 30.68 ? 61   GLU A CG    1 
ATOM   449  C  CD    . GLU A 1 61  ? 39.613 -0.940  35.493 1.00 30.83 ? 61   GLU A CD    1 
ATOM   450  O  OE1   . GLU A 1 61  ? 39.404 -0.310  34.431 1.00 31.56 ? 61   GLU A OE1   1 
ATOM   451  O  OE2   . GLU A 1 61  ? 38.700 -1.335  36.259 1.00 30.34 ? 61   GLU A OE2   1 
ATOM   452  N  N     . LEU A 1 62  ? 42.938 -1.930  39.986 1.00 26.22 ? 62   LEU A N     1 
ATOM   453  C  CA    . LEU A 1 62  ? 43.397 -1.647  41.337 1.00 26.86 ? 62   LEU A CA    1 
ATOM   454  C  C     . LEU A 1 62  ? 44.918 -1.737  41.340 1.00 27.28 ? 62   LEU A C     1 
ATOM   455  O  O     . LEU A 1 62  ? 45.606 -0.888  41.900 1.00 28.42 ? 62   LEU A O     1 
ATOM   456  C  CB    . LEU A 1 62  ? 42.828 -2.659  42.332 1.00 26.38 ? 62   LEU A CB    1 
ATOM   457  C  CG    . LEU A 1 62  ? 43.462 -2.610  43.732 1.00 26.70 ? 62   LEU A CG    1 
ATOM   458  C  CD1   . LEU A 1 62  ? 43.203 -1.256  44.380 1.00 24.92 ? 62   LEU A CD1   1 
ATOM   459  C  CD2   . LEU A 1 62  ? 42.904 -3.733  44.594 1.00 26.58 ? 62   LEU A CD2   1 
ATOM   460  N  N     . GLN A 1 63  ? 45.435 -2.776  40.698 1.00 28.66 ? 63   GLN A N     1 
ATOM   461  C  CA    . GLN A 1 63  ? 46.873 -3.006  40.603 1.00 30.64 ? 63   GLN A CA    1 
ATOM   462  C  C     . GLN A 1 63  ? 47.617 -1.864  39.896 1.00 29.58 ? 63   GLN A C     1 
ATOM   463  O  O     . GLN A 1 63  ? 48.716 -1.475  40.298 1.00 27.62 ? 63   GLN A O     1 
ATOM   464  C  CB    . GLN A 1 63  ? 47.116 -4.313  39.858 1.00 32.85 ? 63   GLN A CB    1 
ATOM   465  C  CG    . GLN A 1 63  ? 48.557 -4.564  39.518 1.00 40.35 ? 63   GLN A CG    1 
ATOM   466  C  CD    . GLN A 1 63  ? 49.204 -5.527  40.473 1.00 43.91 ? 63   GLN A CD    1 
ATOM   467  O  OE1   . GLN A 1 63  ? 48.773 -6.679  40.592 1.00 46.81 ? 63   GLN A OE1   1 
ATOM   468  N  NE2   . GLN A 1 63  ? 50.248 -5.071  41.162 1.00 44.80 ? 63   GLN A NE2   1 
ATOM   469  N  N     . GLU A 1 64  ? 47.019 -1.349  38.827 1.00 30.19 ? 64   GLU A N     1 
ATOM   470  C  CA    . GLU A 1 64  ? 47.606 -0.254  38.068 1.00 30.97 ? 64   GLU A CA    1 
ATOM   471  C  C     . GLU A 1 64  ? 47.823 0.952   38.964 1.00 29.22 ? 64   GLU A C     1 
ATOM   472  O  O     . GLU A 1 64  ? 48.894 1.562   38.950 1.00 28.61 ? 64   GLU A O     1 
ATOM   473  C  CB    . GLU A 1 64  ? 46.684 0.160   36.930 1.00 35.68 ? 64   GLU A CB    1 
ATOM   474  C  CG    . GLU A 1 64  ? 46.835 -0.613  35.637 1.00 42.14 ? 64   GLU A CG    1 
ATOM   475  C  CD    . GLU A 1 64  ? 45.766 -0.205  34.623 1.00 46.10 ? 64   GLU A CD    1 
ATOM   476  O  OE1   . GLU A 1 64  ? 45.667 1.008   34.311 1.00 46.14 ? 64   GLU A OE1   1 
ATOM   477  O  OE2   . GLU A 1 64  ? 45.020 -1.097  34.149 1.00 48.32 ? 64   GLU A OE2   1 
ATOM   478  N  N     . LEU A 1 65  ? 46.789 1.301   39.726 1.00 27.02 ? 65   LEU A N     1 
ATOM   479  C  CA    . LEU A 1 65  ? 46.854 2.438   40.630 1.00 24.90 ? 65   LEU A CA    1 
ATOM   480  C  C     . LEU A 1 65  ? 47.972 2.243   41.645 1.00 25.19 ? 65   LEU A C     1 
ATOM   481  O  O     . LEU A 1 65  ? 48.845 3.103   41.789 1.00 25.70 ? 65   LEU A O     1 
ATOM   482  C  CB    . LEU A 1 65  ? 45.505 2.630   41.330 1.00 22.47 ? 65   LEU A CB    1 
ATOM   483  C  CG    . LEU A 1 65  ? 44.361 3.028   40.387 1.00 21.32 ? 65   LEU A CG    1 
ATOM   484  C  CD1   . LEU A 1 65  ? 43.024 3.004   41.108 1.00 19.39 ? 65   LEU A CD1   1 
ATOM   485  C  CD2   . LEU A 1 65  ? 44.645 4.410   39.823 1.00 20.19 ? 65   LEU A CD2   1 
ATOM   486  N  N     . TYR A 1 66  ? 47.965 1.104   42.329 1.00 25.42 ? 66   TYR A N     1 
ATOM   487  C  CA    . TYR A 1 66  ? 48.993 0.824   43.323 1.00 26.92 ? 66   TYR A CA    1 
ATOM   488  C  C     . TYR A 1 66  ? 50.382 0.904   42.697 1.00 28.25 ? 66   TYR A C     1 
ATOM   489  O  O     . TYR A 1 66  ? 51.325 1.413   43.311 1.00 28.97 ? 66   TYR A O     1 
ATOM   490  C  CB    . TYR A 1 66  ? 48.783 -0.559  43.936 1.00 26.31 ? 66   TYR A CB    1 
ATOM   491  C  CG    . TYR A 1 66  ? 49.863 -0.932  44.917 1.00 26.94 ? 66   TYR A CG    1 
ATOM   492  C  CD1   . TYR A 1 66  ? 49.974 -0.279  46.144 1.00 28.50 ? 66   TYR A CD1   1 
ATOM   493  C  CD2   . TYR A 1 66  ? 50.810 -1.904  44.600 1.00 27.18 ? 66   TYR A CD2   1 
ATOM   494  C  CE1   . TYR A 1 66  ? 51.013 -0.586  47.034 1.00 29.64 ? 66   TYR A CE1   1 
ATOM   495  C  CE2   . TYR A 1 66  ? 51.853 -2.217  45.478 1.00 28.23 ? 66   TYR A CE2   1 
ATOM   496  C  CZ    . TYR A 1 66  ? 51.950 -1.555  46.690 1.00 29.11 ? 66   TYR A CZ    1 
ATOM   497  O  OH    . TYR A 1 66  ? 52.989 -1.848  47.546 1.00 29.29 ? 66   TYR A OH    1 
ATOM   498  N  N     . ASP A 1 67  ? 50.504 0.405   41.473 1.00 29.47 ? 67   ASP A N     1 
ATOM   499  C  CA    . ASP A 1 67  ? 51.770 0.420   40.756 1.00 30.34 ? 67   ASP A CA    1 
ATOM   500  C  C     . ASP A 1 67  ? 52.275 1.844   40.549 1.00 29.18 ? 67   ASP A C     1 
ATOM   501  O  O     . ASP A 1 67  ? 53.480 2.101   40.591 1.00 28.42 ? 67   ASP A O     1 
ATOM   502  C  CB    . ASP A 1 67  ? 51.606 -0.242  39.395 1.00 35.21 ? 67   ASP A CB    1 
ATOM   503  C  CG    . ASP A 1 67  ? 52.595 -1.350  39.174 1.00 38.67 ? 67   ASP A CG    1 
ATOM   504  O  OD1   . ASP A 1 67  ? 53.633 -1.358  39.871 1.00 41.50 ? 67   ASP A OD1   1 
ATOM   505  O  OD2   . ASP A 1 67  ? 52.338 -2.205  38.300 1.00 41.47 ? 67   ASP A OD2   1 
ATOM   506  N  N     . GLY A 1 68  ? 51.343 2.761   40.308 1.00 26.75 ? 68   GLY A N     1 
ATOM   507  C  CA    . GLY A 1 68  ? 51.714 4.144   40.108 1.00 24.96 ? 68   GLY A CA    1 
ATOM   508  C  C     . GLY A 1 68  ? 52.364 4.706   41.357 1.00 24.80 ? 68   GLY A C     1 
ATOM   509  O  O     . GLY A 1 68  ? 53.383 5.390   41.280 1.00 25.09 ? 68   GLY A O     1 
ATOM   510  N  N     . LEU A 1 69  ? 51.776 4.412   42.513 1.00 24.19 ? 69   LEU A N     1 
ATOM   511  C  CA    . LEU A 1 69  ? 52.302 4.892   43.789 1.00 23.25 ? 69   LEU A CA    1 
ATOM   512  C  C     . LEU A 1 69  ? 53.672 4.281   44.034 1.00 24.62 ? 69   LEU A C     1 
ATOM   513  O  O     . LEU A 1 69  ? 54.594 4.945   44.528 1.00 24.06 ? 69   LEU A O     1 
ATOM   514  C  CB    . LEU A 1 69  ? 51.365 4.489   44.927 1.00 21.71 ? 69   LEU A CB    1 
ATOM   515  C  CG    . LEU A 1 69  ? 49.914 4.948   44.839 1.00 19.01 ? 69   LEU A CG    1 
ATOM   516  C  CD1   . LEU A 1 69  ? 49.091 4.235   45.889 1.00 17.88 ? 69   LEU A CD1   1 
ATOM   517  C  CD2   . LEU A 1 69  ? 49.854 6.448   45.028 1.00 19.18 ? 69   LEU A CD2   1 
ATOM   518  N  N     . LYS A 1 70  ? 53.790 3.003   43.682 1.00 25.48 ? 70   LYS A N     1 
ATOM   519  C  CA    . LYS A 1 70  ? 55.030 2.260   43.854 1.00 26.18 ? 70   LYS A CA    1 
ATOM   520  C  C     . LYS A 1 70  ? 56.130 2.825   42.959 1.00 25.51 ? 70   LYS A C     1 
ATOM   521  O  O     . LYS A 1 70  ? 57.253 3.045   43.406 1.00 24.34 ? 70   LYS A O     1 
ATOM   522  C  CB    . LYS A 1 70  ? 54.796 0.781   43.537 1.00 28.46 ? 70   LYS A CB    1 
ATOM   523  C  CG    . LYS A 1 70  ? 56.036 -0.089  43.692 1.00 31.98 ? 70   LYS A CG    1 
ATOM   524  C  CD    . LYS A 1 70  ? 55.814 -1.490  43.132 1.00 34.84 ? 70   LYS A CD    1 
ATOM   525  C  CE    . LYS A 1 70  ? 55.466 -2.498  44.212 1.00 34.58 ? 70   LYS A CE    1 
ATOM   526  N  NZ    . LYS A 1 70  ? 56.606 -3.419  44.518 1.00 36.87 ? 70   LYS A NZ    1 
ATOM   527  N  N     . LEU A 1 71  ? 55.801 3.066   41.694 1.00 25.20 ? 71   LEU A N     1 
ATOM   528  C  CA    . LEU A 1 71  ? 56.772 3.612   40.755 1.00 26.32 ? 71   LEU A CA    1 
ATOM   529  C  C     . LEU A 1 71  ? 57.327 4.951   41.240 1.00 27.59 ? 71   LEU A C     1 
ATOM   530  O  O     . LEU A 1 71  ? 58.484 5.282   40.983 1.00 29.21 ? 71   LEU A O     1 
ATOM   531  C  CB    . LEU A 1 71  ? 56.127 3.802   39.379 1.00 25.86 ? 71   LEU A CB    1 
ATOM   532  C  CG    . LEU A 1 71  ? 55.816 2.538   38.570 1.00 25.00 ? 71   LEU A CG    1 
ATOM   533  C  CD1   . LEU A 1 71  ? 54.961 2.897   37.364 1.00 23.40 ? 71   LEU A CD1   1 
ATOM   534  C  CD2   . LEU A 1 71  ? 57.112 1.879   38.137 1.00 22.52 ? 71   LEU A CD2   1 
ATOM   535  N  N     . ASN A 1 72  ? 56.495 5.715   41.943 1.00 27.39 ? 72   ASN A N     1 
ATOM   536  C  CA    . ASN A 1 72  ? 56.889 7.024   42.445 1.00 26.21 ? 72   ASN A CA    1 
ATOM   537  C  C     . ASN A 1 72  ? 57.487 6.982   43.846 1.00 27.67 ? 72   ASN A C     1 
ATOM   538  O  O     . ASN A 1 72  ? 57.838 8.013   44.420 1.00 25.86 ? 72   ASN A O     1 
ATOM   539  C  CB    . ASN A 1 72  ? 55.686 7.963   42.410 1.00 26.01 ? 72   ASN A CB    1 
ATOM   540  C  CG    . ASN A 1 72  ? 55.324 8.387   41.000 1.00 26.15 ? 72   ASN A CG    1 
ATOM   541  O  OD1   . ASN A 1 72  ? 56.172 8.876   40.254 1.00 27.65 ? 72   ASN A OD1   1 
ATOM   542  N  ND2   . ASN A 1 72  ? 54.064 8.210   40.629 1.00 25.36 ? 72   ASN A ND2   1 
ATOM   543  N  N     . HIS A 1 73  ? 57.600 5.777   44.393 1.00 30.14 ? 73   HIS A N     1 
ATOM   544  C  CA    . HIS A 1 73  ? 58.176 5.584   45.718 1.00 30.89 ? 73   HIS A CA    1 
ATOM   545  C  C     . HIS A 1 73  ? 57.371 6.278   46.800 1.00 30.28 ? 73   HIS A C     1 
ATOM   546  O  O     . HIS A 1 73  ? 57.928 6.736   47.801 1.00 28.76 ? 73   HIS A O     1 
ATOM   547  C  CB    . HIS A 1 73  ? 59.612 6.110   45.748 1.00 34.08 ? 73   HIS A CB    1 
ATOM   548  C  CG    . HIS A 1 73  ? 60.488 5.532   44.681 1.00 37.76 ? 73   HIS A CG    1 
ATOM   549  N  ND1   . HIS A 1 73  ? 60.796 4.189   44.620 1.00 39.86 ? 73   HIS A ND1   1 
ATOM   550  C  CD2   . HIS A 1 73  ? 61.099 6.108   43.620 1.00 38.39 ? 73   HIS A CD2   1 
ATOM   551  C  CE1   . HIS A 1 73  ? 61.558 3.965   43.564 1.00 40.51 ? 73   HIS A CE1   1 
ATOM   552  N  NE2   . HIS A 1 73  ? 61.757 5.112   42.941 1.00 39.97 ? 73   HIS A NE2   1 
ATOM   553  N  N     . VAL A 1 74  ? 56.062 6.370   46.604 1.00 28.89 ? 74   VAL A N     1 
ATOM   554  C  CA    . VAL A 1 74  ? 55.228 7.009   47.608 1.00 28.50 ? 74   VAL A CA    1 
ATOM   555  C  C     . VAL A 1 74  ? 54.224 6.025   48.185 1.00 30.42 ? 74   VAL A C     1 
ATOM   556  O  O     . VAL A 1 74  ? 53.133 6.406   48.604 1.00 32.06 ? 74   VAL A O     1 
ATOM   557  C  CB    . VAL A 1 74  ? 54.489 8.241   47.037 1.00 25.99 ? 74   VAL A CB    1 
ATOM   558  C  CG1   . VAL A 1 74  ? 55.493 9.310   46.673 1.00 25.52 ? 74   VAL A CG1   1 
ATOM   559  C  CG2   . VAL A 1 74  ? 53.671 7.855   45.831 1.00 25.61 ? 74   VAL A CG2   1 
ATOM   560  N  N     . ASN A 1 75  ? 54.611 4.754   48.214 1.00 30.95 ? 75   ASN A N     1 
ATOM   561  C  CA    . ASN A 1 75  ? 53.753 3.708   48.742 1.00 30.69 ? 75   ASN A CA    1 
ATOM   562  C  C     . ASN A 1 75  ? 54.127 3.382   50.187 1.00 31.42 ? 75   ASN A C     1 
ATOM   563  O  O     . ASN A 1 75  ? 54.302 2.217   50.546 1.00 31.00 ? 75   ASN A O     1 
ATOM   564  C  CB    . ASN A 1 75  ? 53.851 2.456   47.866 1.00 31.52 ? 75   ASN A CB    1 
ATOM   565  C  CG    . ASN A 1 75  ? 55.232 1.836   47.891 1.00 33.66 ? 75   ASN A CG    1 
ATOM   566  O  OD1   . ASN A 1 75  ? 56.246 2.544   47.873 1.00 32.61 ? 75   ASN A OD1   1 
ATOM   567  N  ND2   . ASN A 1 75  ? 55.285 0.502   47.924 1.00 34.21 ? 75   ASN A ND2   1 
ATOM   568  N  N     . GLN A 1 76  ? 54.267 4.428   51.001 1.00 31.71 ? 76   GLN A N     1 
ATOM   569  C  CA    . GLN A 1 76  ? 54.572 4.286   52.427 1.00 32.19 ? 76   GLN A CA    1 
ATOM   570  C  C     . GLN A 1 76  ? 53.306 4.644   53.206 1.00 31.08 ? 76   GLN A C     1 
ATOM   571  O  O     . GLN A 1 76  ? 52.863 5.792   53.174 1.00 31.74 ? 76   GLN A O     1 
ATOM   572  C  CB    . GLN A 1 76  ? 55.684 5.244   52.861 1.00 34.62 ? 76   GLN A CB    1 
ATOM   573  C  CG    . GLN A 1 76  ? 57.107 4.833   52.504 1.00 41.02 ? 76   GLN A CG    1 
ATOM   574  C  CD    . GLN A 1 76  ? 57.700 5.666   51.376 1.00 44.75 ? 76   GLN A CD    1 
ATOM   575  O  OE1   . GLN A 1 76  ? 57.738 5.232   50.219 1.00 48.15 ? 76   GLN A OE1   1 
ATOM   576  N  NE2   . GLN A 1 76  ? 58.161 6.875   51.705 1.00 45.53 ? 76   GLN A NE2   1 
ATOM   577  N  N     . TYR A 1 77  ? 52.716 3.675   53.896 1.00 28.84 ? 77   TYR A N     1 
ATOM   578  C  CA    . TYR A 1 77  ? 51.510 3.955   54.666 1.00 26.65 ? 77   TYR A CA    1 
ATOM   579  C  C     . TYR A 1 77  ? 51.623 3.509   56.110 1.00 25.27 ? 77   TYR A C     1 
ATOM   580  O  O     . TYR A 1 77  ? 52.479 2.695   56.456 1.00 25.58 ? 77   TYR A O     1 
ATOM   581  C  CB    . TYR A 1 77  ? 50.286 3.294   54.021 1.00 27.56 ? 77   TYR A CB    1 
ATOM   582  C  CG    . TYR A 1 77  ? 49.942 3.892   52.683 1.00 27.98 ? 77   TYR A CG    1 
ATOM   583  C  CD1   . TYR A 1 77  ? 50.524 3.410   51.509 1.00 27.94 ? 77   TYR A CD1   1 
ATOM   584  C  CD2   . TYR A 1 77  ? 49.099 5.000   52.596 1.00 27.85 ? 77   TYR A CD2   1 
ATOM   585  C  CE1   . TYR A 1 77  ? 50.279 4.020   50.281 1.00 27.20 ? 77   TYR A CE1   1 
ATOM   586  C  CE2   . TYR A 1 77  ? 48.852 5.620   51.376 1.00 27.16 ? 77   TYR A CE2   1 
ATOM   587  C  CZ    . TYR A 1 77  ? 49.447 5.126   50.226 1.00 28.24 ? 77   TYR A CZ    1 
ATOM   588  O  OH    . TYR A 1 77  ? 49.231 5.755   49.026 1.00 29.85 ? 77   TYR A OH    1 
ATOM   589  N  N     . ASP A 1 78  ? 50.750 4.057   56.948 1.00 23.11 ? 78   ASP A N     1 
ATOM   590  C  CA    . ASP A 1 78  ? 50.718 3.732   58.369 1.00 20.64 ? 78   ASP A CA    1 
ATOM   591  C  C     . ASP A 1 78  ? 49.487 2.883   58.647 1.00 20.16 ? 78   ASP A C     1 
ATOM   592  O  O     . ASP A 1 78  ? 49.473 2.065   59.569 1.00 19.84 ? 78   ASP A O     1 
ATOM   593  C  CB    . ASP A 1 78  ? 50.667 5.016   59.194 1.00 19.73 ? 78   ASP A CB    1 
ATOM   594  C  CG    . ASP A 1 78  ? 51.868 5.892   58.959 1.00 21.34 ? 78   ASP A CG    1 
ATOM   595  O  OD1   . ASP A 1 78  ? 52.995 5.425   59.248 1.00 21.04 ? 78   ASP A OD1   1 
ATOM   596  O  OD2   . ASP A 1 78  ? 51.694 7.036   58.478 1.00 21.06 ? 78   ASP A OD2   1 
ATOM   597  N  N     . TYR A 1 79  ? 48.456 3.086   57.834 1.00 18.17 ? 79   TYR A N     1 
ATOM   598  C  CA    . TYR A 1 79  ? 47.209 2.351   57.966 1.00 18.48 ? 79   TYR A CA    1 
ATOM   599  C  C     . TYR A 1 79  ? 46.643 2.035   56.580 1.00 18.62 ? 79   TYR A C     1 
ATOM   600  O  O     . TYR A 1 79  ? 46.857 2.780   55.616 1.00 19.33 ? 79   TYR A O     1 
ATOM   601  C  CB    . TYR A 1 79  ? 46.142 3.184   58.692 1.00 19.31 ? 79   TYR A CB    1 
ATOM   602  C  CG    . TYR A 1 79  ? 46.367 3.401   60.182 1.00 20.48 ? 79   TYR A CG    1 
ATOM   603  C  CD1   . TYR A 1 79  ? 47.185 4.447   60.621 1.00 20.54 ? 79   TYR A CD1   1 
ATOM   604  C  CD2   . TYR A 1 79  ? 45.733 2.566   61.104 1.00 20.12 ? 79   TYR A CD2   1 
ATOM   605  C  CE1   . TYR A 1 79  ? 47.371 4.656   61.991 1.00 21.14 ? 79   TYR A CE1   1 
ATOM   606  C  CE2   . TYR A 1 79  ? 45.918 2.774   62.473 1.00 19.66 ? 79   TYR A CE2   1 
ATOM   607  C  CZ    . TYR A 1 79  ? 46.737 3.819   62.917 1.00 21.76 ? 79   TYR A CZ    1 
ATOM   608  O  OH    . TYR A 1 79  ? 46.915 4.019   64.249 1.00 24.63 ? 79   TYR A OH    1 
ATOM   609  N  N     . VAL A 1 80  ? 45.955 0.924   56.532 1.00 15.98 ? 80   VAL A N     1 
ATOM   610  C  CA    . VAL A 1 80  ? 45.201 0.486   55.354 1.00 14.83 ? 80   VAL A CA    1 
ATOM   611  C  C     . VAL A 1 80  ? 43.808 0.209   55.872 1.00 16.27 ? 80   VAL A C     1 
ATOM   612  O  O     . VAL A 1 80  ? 43.640 -0.375  56.948 1.00 17.18 ? 80   VAL A O     1 
ATOM   613  C  CB    . VAL A 1 80  ? 45.813 -0.775  54.733 1.00 13.43 ? 80   VAL A CB    1 
ATOM   614  C  CG1   . VAL A 1 80  ? 44.949 -1.367  53.611 1.00 10.35 ? 80   VAL A CG1   1 
ATOM   615  C  CG2   . VAL A 1 80  ? 47.188 -0.540  54.106 1.00 11.79 ? 80   VAL A CG2   1 
ATOM   616  N  N     . LEU A 1 81  ? 42.819 0.632   55.140 1.00 15.32 ? 81   LEU A N     1 
ATOM   617  C  CA    . LEU A 1 81  ? 41.442 0.470   55.601 1.00 14.75 ? 81   LEU A CA    1 
ATOM   618  C  C     . LEU A 1 81  ? 40.554 -0.013  54.461 1.00 15.45 ? 81   LEU A C     1 
ATOM   619  O  O     . LEU A 1 81  ? 40.456 0.642   53.429 1.00 16.70 ? 81   LEU A O     1 
ATOM   620  C  CB    . LEU A 1 81  ? 40.959 1.828   56.145 1.00 13.50 ? 81   LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 81  ? 39.446 1.943   56.363 1.00 13.16 ? 81   LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 81  ? 38.939 1.097   57.533 1.00 11.64 ? 81   LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 81  ? 39.009 3.383   56.673 1.00 13.33 ? 81   LEU A CD2   1 
ATOM   624  N  N     . THR A 1 82  ? 39.914 -1.164  54.645 1.00 15.54 ? 82   THR A N     1 
ATOM   625  C  CA    . THR A 1 82  ? 39.025 -1.712  53.622 1.00 15.98 ? 82   THR A CA    1 
ATOM   626  C  C     . THR A 1 82  ? 37.679 -2.083  54.239 1.00 17.60 ? 82   THR A C     1 
ATOM   627  O  O     . THR A 1 82  ? 37.554 -2.228  55.455 1.00 18.51 ? 82   THR A O     1 
ATOM   628  C  CB    . THR A 1 82  ? 39.624 -2.981  52.939 1.00 14.33 ? 82   THR A CB    1 
ATOM   629  O  OG1   . THR A 1 82  ? 39.757 -4.031  53.898 1.00 14.97 ? 82   THR A OG1   1 
ATOM   630  C  CG2   . THR A 1 82  ? 40.994 -2.691  52.361 1.00 13.95 ? 82   THR A CG2   1 
ATOM   631  N  N     . GLY A 1 83  ? 36.673 -2.236  53.389 1.00 19.08 ? 83   GLY A N     1 
ATOM   632  C  CA    . GLY A 1 83  ? 35.348 -2.588  53.853 1.00 20.76 ? 83   GLY A CA    1 
ATOM   633  C  C     . GLY A 1 83  ? 34.648 -3.474  52.841 1.00 23.50 ? 83   GLY A C     1 
ATOM   634  O  O     . GLY A 1 83  ? 35.201 -4.478  52.403 1.00 24.15 ? 83   GLY A O     1 
ATOM   635  N  N     . TYR A 1 84  ? 33.432 -3.103  52.463 1.00 25.20 ? 84   TYR A N     1 
ATOM   636  C  CA    . TYR A 1 84  ? 32.660 -3.876  51.503 1.00 27.71 ? 84   TYR A CA    1 
ATOM   637  C  C     . TYR A 1 84  ? 33.416 -4.129  50.200 1.00 29.42 ? 84   TYR A C     1 
ATOM   638  O  O     . TYR A 1 84  ? 34.101 -3.243  49.678 1.00 29.35 ? 84   TYR A O     1 
ATOM   639  C  CB    . TYR A 1 84  ? 31.359 -3.150  51.183 1.00 29.21 ? 84   TYR A CB    1 
ATOM   640  C  CG    . TYR A 1 84  ? 30.395 -3.958  50.352 1.00 31.91 ? 84   TYR A CG    1 
ATOM   641  C  CD1   . TYR A 1 84  ? 29.411 -4.733  50.960 1.00 34.58 ? 84   TYR A CD1   1 
ATOM   642  C  CD2   . TYR A 1 84  ? 30.470 -3.963  48.961 1.00 32.13 ? 84   TYR A CD2   1 
ATOM   643  C  CE1   . TYR A 1 84  ? 28.525 -5.495  50.209 1.00 35.20 ? 84   TYR A CE1   1 
ATOM   644  C  CE2   . TYR A 1 84  ? 29.586 -4.724  48.197 1.00 34.49 ? 84   TYR A CE2   1 
ATOM   645  C  CZ    . TYR A 1 84  ? 28.614 -5.486  48.832 1.00 34.85 ? 84   TYR A CZ    1 
ATOM   646  O  OH    . TYR A 1 84  ? 27.713 -6.229  48.106 1.00 35.87 ? 84   TYR A OH    1 
ATOM   647  N  N     . THR A 1 85  ? 33.273 -5.353  49.693 1.00 31.45 ? 85   THR A N     1 
ATOM   648  C  CA    . THR A 1 85  ? 33.878 -5.823  48.442 1.00 33.49 ? 85   THR A CA    1 
ATOM   649  C  C     . THR A 1 85  ? 33.015 -7.003  48.026 1.00 34.54 ? 85   THR A C     1 
ATOM   650  O  O     . THR A 1 85  ? 32.626 -7.796  48.878 1.00 35.55 ? 85   THR A O     1 
ATOM   651  C  CB    . THR A 1 85  ? 35.301 -6.393  48.635 1.00 33.06 ? 85   THR A CB    1 
ATOM   652  O  OG1   . THR A 1 85  ? 36.113 -5.474  49.371 1.00 35.76 ? 85   THR A OG1   1 
ATOM   653  C  CG2   . THR A 1 85  ? 35.945 -6.639  47.294 1.00 32.90 ? 85   THR A CG2   1 
ATOM   654  N  N     . ARG A 1 86  ? 32.687 -7.142  46.748 1.00 37.28 ? 86   ARG A N     1 
ATOM   655  C  CA    . ARG A 1 86  ? 31.885 -8.307  46.365 1.00 40.33 ? 86   ARG A CA    1 
ATOM   656  C  C     . ARG A 1 86  ? 32.553 -9.146  45.279 1.00 38.71 ? 86   ARG A C     1 
ATOM   657  O  O     . ARG A 1 86  ? 31.927 -9.996  44.654 1.00 40.03 ? 86   ARG A O     1 
ATOM   658  C  CB    . ARG A 1 86  ? 30.453 -7.901  45.951 1.00 43.62 ? 86   ARG A CB    1 
ATOM   659  C  CG    . ARG A 1 86  ? 30.319 -6.962  44.769 1.00 47.97 ? 86   ARG A CG    1 
ATOM   660  C  CD    . ARG A 1 86  ? 29.307 -7.509  43.768 1.00 51.61 ? 86   ARG A CD    1 
ATOM   661  N  NE    . ARG A 1 86  ? 29.971 -7.781  42.501 1.00 56.00 ? 86   ARG A NE    1 
ATOM   662  C  CZ    . ARG A 1 86  ? 29.844 -8.901  41.798 1.00 57.02 ? 86   ARG A CZ    1 
ATOM   663  N  NH1   . ARG A 1 86  ? 29.062 -9.885  42.229 1.00 56.20 ? 86   ARG A NH1   1 
ATOM   664  N  NH2   . ARG A 1 86  ? 30.527 -9.040  40.669 1.00 58.88 ? 86   ARG A NH2   1 
ATOM   665  N  N     . ASP A 1 87  ? 33.846 -8.918  45.102 1.00 37.23 ? 87   ASP A N     1 
ATOM   666  C  CA    . ASP A 1 87  ? 34.650 -9.607  44.108 1.00 37.22 ? 87   ASP A CA    1 
ATOM   667  C  C     . ASP A 1 87  ? 35.864 -10.218 44.817 1.00 36.89 ? 87   ASP A C     1 
ATOM   668  O  O     . ASP A 1 87  ? 36.746 -9.497  45.282 1.00 37.36 ? 87   ASP A O     1 
ATOM   669  C  CB    . ASP A 1 87  ? 35.074 -8.580  43.047 1.00 39.40 ? 87   ASP A CB    1 
ATOM   670  C  CG    . ASP A 1 87  ? 36.195 -9.066  42.160 1.00 41.82 ? 87   ASP A CG    1 
ATOM   671  O  OD1   . ASP A 1 87  ? 36.745 -8.231  41.398 1.00 42.73 ? 87   ASP A OD1   1 
ATOM   672  O  OD2   . ASP A 1 87  ? 36.524 -10.272 42.219 1.00 44.26 ? 87   ASP A OD2   1 
ATOM   673  N  N     . LYS A 1 88  ? 35.915 -11.545 44.897 1.00 36.59 ? 88   LYS A N     1 
ATOM   674  C  CA    . LYS A 1 88  ? 37.019 -12.225 45.576 1.00 36.99 ? 88   LYS A CA    1 
ATOM   675  C  C     . LYS A 1 88  ? 38.389 -11.954 44.970 1.00 35.97 ? 88   LYS A C     1 
ATOM   676  O  O     . LYS A 1 88  ? 39.408 -11.998 45.662 1.00 35.60 ? 88   LYS A O     1 
ATOM   677  C  CB    . LYS A 1 88  ? 36.785 -13.736 45.600 1.00 40.55 ? 88   LYS A CB    1 
ATOM   678  C  CG    . LYS A 1 88  ? 36.800 -14.403 44.231 1.00 43.83 ? 88   LYS A CG    1 
ATOM   679  C  CD    . LYS A 1 88  ? 36.740 -15.929 44.360 1.00 47.07 ? 88   LYS A CD    1 
ATOM   680  C  CE    . LYS A 1 88  ? 36.659 -16.617 42.992 1.00 48.21 ? 88   LYS A CE    1 
ATOM   681  N  NZ    . LYS A 1 88  ? 37.606 -17.772 42.866 1.00 48.96 ? 88   LYS A NZ    1 
ATOM   682  N  N     . SER A 1 89  ? 38.406 -11.686 43.669 1.00 34.72 ? 89   SER A N     1 
ATOM   683  C  CA    . SER A 1 89  ? 39.640 -11.411 42.947 1.00 33.38 ? 89   SER A CA    1 
ATOM   684  C  C     . SER A 1 89  ? 40.223 -10.071 43.411 1.00 32.57 ? 89   SER A C     1 
ATOM   685  O  O     . SER A 1 89  ? 41.441 -9.910  43.550 1.00 30.91 ? 89   SER A O     1 
ATOM   686  C  CB    . SER A 1 89  ? 39.336 -11.383 41.446 1.00 34.07 ? 89   SER A CB    1 
ATOM   687  O  OG    . SER A 1 89  ? 40.515 -11.327 40.665 1.00 38.72 ? 89   SER A OG    1 
ATOM   688  N  N     . PHE A 1 90  ? 39.331 -9.116  43.657 1.00 31.54 ? 90   PHE A N     1 
ATOM   689  C  CA    . PHE A 1 90  ? 39.710 -7.785  44.111 1.00 30.48 ? 90   PHE A CA    1 
ATOM   690  C  C     . PHE A 1 90  ? 40.259 -7.891  45.532 1.00 29.80 ? 90   PHE A C     1 
ATOM   691  O  O     . PHE A 1 90  ? 41.304 -7.325  45.863 1.00 30.79 ? 90   PHE A O     1 
ATOM   692  C  CB    . PHE A 1 90  ? 38.477 -6.880  44.102 1.00 29.97 ? 90   PHE A CB    1 
ATOM   693  C  CG    . PHE A 1 90  ? 38.787 -5.421  44.260 1.00 30.15 ? 90   PHE A CG    1 
ATOM   694  C  CD1   . PHE A 1 90  ? 39.069 -4.631  43.144 1.00 28.70 ? 90   PHE A CD1   1 
ATOM   695  C  CD2   . PHE A 1 90  ? 38.783 -4.827  45.524 1.00 29.78 ? 90   PHE A CD2   1 
ATOM   696  C  CE1   . PHE A 1 90  ? 39.341 -3.268  43.285 1.00 28.24 ? 90   PHE A CE1   1 
ATOM   697  C  CE2   . PHE A 1 90  ? 39.055 -3.463  45.677 1.00 29.54 ? 90   PHE A CE2   1 
ATOM   698  C  CZ    . PHE A 1 90  ? 39.332 -2.682  44.554 1.00 28.73 ? 90   PHE A CZ    1 
ATOM   699  N  N     . LEU A 1 91  ? 39.535 -8.635  46.361 1.00 28.49 ? 91   LEU A N     1 
ATOM   700  C  CA    . LEU A 1 91  ? 39.895 -8.843  47.755 1.00 27.84 ? 91   LEU A CA    1 
ATOM   701  C  C     . LEU A 1 91  ? 41.266 -9.494  47.891 1.00 28.53 ? 91   LEU A C     1 
ATOM   702  O  O     . LEU A 1 91  ? 42.057 -9.126  48.763 1.00 29.27 ? 91   LEU A O     1 
ATOM   703  C  CB    . LEU A 1 91  ? 38.830 -9.714  48.420 1.00 27.30 ? 91   LEU A CB    1 
ATOM   704  C  CG    . LEU A 1 91  ? 38.838 -9.834  49.939 1.00 26.00 ? 91   LEU A CG    1 
ATOM   705  C  CD1   . LEU A 1 91  ? 38.814 -8.455  50.581 1.00 24.84 ? 91   LEU A CD1   1 
ATOM   706  C  CD2   . LEU A 1 91  ? 37.630 -10.640 50.357 1.00 24.55 ? 91   LEU A CD2   1 
ATOM   707  N  N     . ALA A 1 92  ? 41.539 -10.465 47.026 1.00 29.12 ? 92   ALA A N     1 
ATOM   708  C  CA    . ALA A 1 92  ? 42.816 -11.167 47.036 1.00 28.36 ? 92   ALA A CA    1 
ATOM   709  C  C     . ALA A 1 92  ? 43.928 -10.186 46.671 1.00 29.32 ? 92   ALA A C     1 
ATOM   710  O  O     . ALA A 1 92  ? 45.045 -10.262 47.195 1.00 28.99 ? 92   ALA A O     1 
ATOM   711  C  CB    . ALA A 1 92  ? 42.781 -12.311 46.045 1.00 26.88 ? 92   ALA A CB    1 
ATOM   712  N  N     . MET A 1 93  ? 43.614 -9.257  45.773 1.00 29.81 ? 93   MET A N     1 
ATOM   713  C  CA    . MET A 1 93  ? 44.590 -8.265  45.350 1.00 29.78 ? 93   MET A CA    1 
ATOM   714  C  C     . MET A 1 93  ? 44.927 -7.364  46.527 1.00 29.19 ? 93   MET A C     1 
ATOM   715  O  O     . MET A 1 93  ? 46.080 -6.954  46.698 1.00 28.18 ? 93   MET A O     1 
ATOM   716  C  CB    . MET A 1 93  ? 44.035 -7.429  44.196 1.00 33.65 ? 93   MET A CB    1 
ATOM   717  C  CG    . MET A 1 93  ? 45.003 -6.373  43.668 1.00 37.49 ? 93   MET A CG    1 
ATOM   718  S  SD    . MET A 1 93  ? 46.567 -7.071  43.058 1.00 43.13 ? 93   MET A SD    1 
ATOM   719  C  CE    . MET A 1 93  ? 46.022 -7.700  41.447 1.00 41.07 ? 93   MET A CE    1 
ATOM   720  N  N     . VAL A 1 94  ? 43.914 -7.064  47.338 1.00 27.34 ? 94   VAL A N     1 
ATOM   721  C  CA    . VAL A 1 94  ? 44.095 -6.216  48.504 1.00 25.94 ? 94   VAL A CA    1 
ATOM   722  C  C     . VAL A 1 94  ? 45.079 -6.858  49.479 1.00 26.83 ? 94   VAL A C     1 
ATOM   723  O  O     . VAL A 1 94  ? 45.985 -6.192  49.991 1.00 28.09 ? 94   VAL A O     1 
ATOM   724  C  CB    . VAL A 1 94  ? 42.752 -5.962  49.219 1.00 23.91 ? 94   VAL A CB    1 
ATOM   725  C  CG1   . VAL A 1 94  ? 42.987 -5.283  50.553 1.00 23.33 ? 94   VAL A CG1   1 
ATOM   726  C  CG2   . VAL A 1 94  ? 41.863 -5.093  48.349 1.00 23.70 ? 94   VAL A CG2   1 
ATOM   727  N  N     . VAL A 1 95  ? 44.915 -8.152  49.730 1.00 26.02 ? 95   VAL A N     1 
ATOM   728  C  CA    . VAL A 1 95  ? 45.812 -8.838  50.651 1.00 25.47 ? 95   VAL A CA    1 
ATOM   729  C  C     . VAL A 1 95  ? 47.265 -8.774  50.178 1.00 25.96 ? 95   VAL A C     1 
ATOM   730  O  O     . VAL A 1 95  ? 48.180 -8.605  50.987 1.00 24.81 ? 95   VAL A O     1 
ATOM   731  C  CB    . VAL A 1 95  ? 45.404 -10.315 50.837 1.00 25.67 ? 95   VAL A CB    1 
ATOM   732  C  CG1   . VAL A 1 95  ? 46.359 -11.004 51.806 1.00 22.50 ? 95   VAL A CG1   1 
ATOM   733  C  CG2   . VAL A 1 95  ? 43.978 -10.395 51.357 1.00 25.64 ? 95   VAL A CG2   1 
ATOM   734  N  N     . ASP A 1 96  ? 47.485 -8.912  48.874 1.00 26.43 ? 96   ASP A N     1 
ATOM   735  C  CA    . ASP A 1 96  ? 48.845 -8.851  48.346 1.00 27.30 ? 96   ASP A CA    1 
ATOM   736  C  C     . ASP A 1 96  ? 49.435 -7.490  48.661 1.00 26.67 ? 96   ASP A C     1 
ATOM   737  O  O     . ASP A 1 96  ? 50.569 -7.388  49.128 1.00 26.72 ? 96   ASP A O     1 
ATOM   738  C  CB    . ASP A 1 96  ? 48.853 -9.061  46.833 1.00 29.60 ? 96   ASP A CB    1 
ATOM   739  C  CG    . ASP A 1 96  ? 48.510 -10.475 46.444 1.00 33.32 ? 96   ASP A CG    1 
ATOM   740  O  OD1   . ASP A 1 96  ? 48.203 -10.696 45.253 1.00 36.51 ? 96   ASP A OD1   1 
ATOM   741  O  OD2   . ASP A 1 96  ? 48.555 -11.368 47.321 1.00 35.21 ? 96   ASP A OD2   1 
ATOM   742  N  N     . ILE A 1 97  ? 48.647 -6.449  48.401 1.00 26.26 ? 97   ILE A N     1 
ATOM   743  C  CA    . ILE A 1 97  ? 49.068 -5.079  48.640 1.00 24.84 ? 97   ILE A CA    1 
ATOM   744  C  C     . ILE A 1 97  ? 49.406 -4.835  50.112 1.00 25.36 ? 97   ILE A C     1 
ATOM   745  O  O     . ILE A 1 97  ? 50.430 -4.224  50.421 1.00 24.84 ? 97   ILE A O     1 
ATOM   746  C  CB    . ILE A 1 97  ? 47.980 -4.076  48.175 1.00 23.93 ? 97   ILE A CB    1 
ATOM   747  C  CG1   . ILE A 1 97  ? 47.797 -4.190  46.662 1.00 22.32 ? 97   ILE A CG1   1 
ATOM   748  C  CG2   . ILE A 1 97  ? 48.375 -2.653  48.559 1.00 23.52 ? 97   ILE A CG2   1 
ATOM   749  C  CD1   . ILE A 1 97  ? 46.783 -3.233  46.087 1.00 21.83 ? 97   ILE A CD1   1 
ATOM   750  N  N     . VAL A 1 98  ? 48.556 -5.316  51.015 1.00 25.67 ? 98   VAL A N     1 
ATOM   751  C  CA    . VAL A 1 98  ? 48.799 -5.138  52.441 1.00 26.88 ? 98   VAL A CA    1 
ATOM   752  C  C     . VAL A 1 98  ? 50.083 -5.846  52.874 1.00 28.82 ? 98   VAL A C     1 
ATOM   753  O  O     . VAL A 1 98  ? 50.896 -5.288  53.617 1.00 28.17 ? 98   VAL A O     1 
ATOM   754  C  CB    . VAL A 1 98  ? 47.646 -5.693  53.289 1.00 26.62 ? 98   VAL A CB    1 
ATOM   755  C  CG1   . VAL A 1 98  ? 47.982 -5.528  54.766 1.00 25.55 ? 98   VAL A CG1   1 
ATOM   756  C  CG2   . VAL A 1 98  ? 46.344 -4.977  52.944 1.00 25.07 ? 98   VAL A CG2   1 
ATOM   757  N  N     . GLN A 1 99  ? 50.258 -7.081  52.416 1.00 31.06 ? 99   GLN A N     1 
ATOM   758  C  CA    . GLN A 1 99  ? 51.450 -7.842  52.762 1.00 33.45 ? 99   GLN A CA    1 
ATOM   759  C  C     . GLN A 1 99  ? 52.706 -7.101  52.335 1.00 33.15 ? 99   GLN A C     1 
ATOM   760  O  O     . GLN A 1 99  ? 53.640 -6.940  53.125 1.00 33.38 ? 99   GLN A O     1 
ATOM   761  C  CB    . GLN A 1 99  ? 51.414 -9.218  52.105 1.00 35.59 ? 99   GLN A CB    1 
ATOM   762  C  CG    . GLN A 1 99  ? 50.353 -10.123 52.684 1.00 40.84 ? 99   GLN A CG    1 
ATOM   763  C  CD    . GLN A 1 99  ? 50.371 -11.511 52.078 1.00 44.38 ? 99   GLN A CD    1 
ATOM   764  O  OE1   . GLN A 1 99  ? 50.743 -11.688 50.915 1.00 47.24 ? 99   GLN A OE1   1 
ATOM   765  N  NE2   . GLN A 1 99  ? 49.954 -12.508 52.857 1.00 46.09 ? 99   GLN A NE2   1 
ATOM   766  N  N     . GLU A 1 100 ? 52.719 -6.651  51.084 1.00 32.55 ? 100  GLU A N     1 
ATOM   767  C  CA    . GLU A 1 100 ? 53.853 -5.922  50.543 1.00 32.18 ? 100  GLU A CA    1 
ATOM   768  C  C     . GLU A 1 100 ? 54.129 -4.654  51.342 1.00 31.06 ? 100  GLU A C     1 
ATOM   769  O  O     . GLU A 1 100 ? 55.287 -4.318  51.583 1.00 31.07 ? 100  GLU A O     1 
ATOM   770  C  CB    . GLU A 1 100 ? 53.593 -5.567  49.085 1.00 34.15 ? 100  GLU A CB    1 
ATOM   771  C  CG    . GLU A 1 100 ? 54.780 -4.945  48.386 1.00 38.31 ? 100  GLU A CG    1 
ATOM   772  C  CD    . GLU A 1 100 ? 54.500 -4.669  46.924 1.00 40.36 ? 100  GLU A CD    1 
ATOM   773  O  OE1   . GLU A 1 100 ? 54.199 -5.624  46.170 1.00 40.57 ? 100  GLU A OE1   1 
ATOM   774  O  OE2   . GLU A 1 100 ? 54.578 -3.489  46.532 1.00 42.90 ? 100  GLU A OE2   1 
ATOM   775  N  N     . LEU A 1 101 ? 53.068 -3.957  51.751 1.00 29.51 ? 101  LEU A N     1 
ATOM   776  C  CA    . LEU A 1 101 ? 53.214 -2.729  52.530 1.00 29.07 ? 101  LEU A CA    1 
ATOM   777  C  C     . LEU A 1 101 ? 53.744 -3.007  53.930 1.00 30.26 ? 101  LEU A C     1 
ATOM   778  O  O     . LEU A 1 101 ? 54.588 -2.262  54.437 1.00 29.71 ? 101  LEU A O     1 
ATOM   779  C  CB    . LEU A 1 101 ? 51.879 -1.980  52.622 1.00 26.26 ? 101  LEU A CB    1 
ATOM   780  C  CG    . LEU A 1 101 ? 51.410 -1.268  51.348 1.00 23.98 ? 101  LEU A CG    1 
ATOM   781  C  CD1   . LEU A 1 101 ? 50.038 -0.668  51.572 1.00 22.34 ? 101  LEU A CD1   1 
ATOM   782  C  CD2   . LEU A 1 101 ? 52.410 -0.188  50.961 1.00 22.92 ? 101  LEU A CD2   1 
ATOM   783  N  N     . LYS A 1 102 ? 53.258 -4.078  54.554 1.00 32.17 ? 102  LYS A N     1 
ATOM   784  C  CA    . LYS A 1 102 ? 53.716 -4.433  55.892 1.00 34.23 ? 102  LYS A CA    1 
ATOM   785  C  C     . LYS A 1 102 ? 55.177 -4.826  55.860 1.00 37.54 ? 102  LYS A C     1 
ATOM   786  O  O     . LYS A 1 102 ? 55.821 -4.943  56.902 1.00 39.27 ? 102  LYS A O     1 
ATOM   787  C  CB    . LYS A 1 102 ? 52.885 -5.571  56.468 1.00 31.60 ? 102  LYS A CB    1 
ATOM   788  C  CG    . LYS A 1 102 ? 51.583 -5.093  57.077 1.00 30.27 ? 102  LYS A CG    1 
ATOM   789  C  CD    . LYS A 1 102 ? 50.879 -6.191  57.846 1.00 27.91 ? 102  LYS A CD    1 
ATOM   790  C  CE    . LYS A 1 102 ? 49.789 -5.614  58.730 1.00 27.56 ? 102  LYS A CE    1 
ATOM   791  N  NZ    . LYS A 1 102 ? 49.067 -6.657  59.504 1.00 25.73 ? 102  LYS A NZ    1 
ATOM   792  N  N     . GLN A 1 103 ? 55.699 -5.030  54.656 1.00 41.72 ? 103  GLN A N     1 
ATOM   793  C  CA    . GLN A 1 103 ? 57.101 -5.377  54.484 1.00 44.99 ? 103  GLN A CA    1 
ATOM   794  C  C     . GLN A 1 103 ? 57.988 -4.149  54.707 1.00 45.05 ? 103  GLN A C     1 
ATOM   795  O  O     . GLN A 1 103 ? 59.000 -4.233  55.404 1.00 44.71 ? 103  GLN A O     1 
ATOM   796  C  CB    . GLN A 1 103 ? 57.338 -5.949  53.086 1.00 48.73 ? 103  GLN A CB    1 
ATOM   797  C  CG    . GLN A 1 103 ? 57.398 -7.466  53.052 1.00 53.99 ? 103  GLN A CG    1 
ATOM   798  C  CD    . GLN A 1 103 ? 58.702 -7.966  52.460 1.00 58.01 ? 103  GLN A CD    1 
ATOM   799  O  OE1   . GLN A 1 103 ? 59.757 -7.345  52.640 1.00 60.05 ? 103  GLN A OE1   1 
ATOM   800  N  NE2   . GLN A 1 103 ? 58.648 -9.098  51.759 1.00 59.81 ? 103  GLN A NE2   1 
ATOM   801  N  N     . GLN A 1 104 ? 57.611 -3.010  54.129 1.00 45.09 ? 104  GLN A N     1 
ATOM   802  C  CA    . GLN A 1 104 ? 58.397 -1.790  54.305 1.00 46.69 ? 104  GLN A CA    1 
ATOM   803  C  C     . GLN A 1 104 ? 58.116 -1.167  55.657 1.00 45.76 ? 104  GLN A C     1 
ATOM   804  O  O     . GLN A 1 104 ? 58.946 -0.440  56.206 1.00 46.70 ? 104  GLN A O     1 
ATOM   805  C  CB    . GLN A 1 104 ? 58.047 -0.732  53.275 1.00 49.23 ? 104  GLN A CB    1 
ATOM   806  C  CG    . GLN A 1 104 ? 57.956 -1.186  51.852 1.00 53.98 ? 104  GLN A CG    1 
ATOM   807  C  CD    . GLN A 1 104 ? 57.809 0.003   50.922 1.00 55.45 ? 104  GLN A CD    1 
ATOM   808  O  OE1   . GLN A 1 104 ? 57.137 0.985   51.259 1.00 56.65 ? 104  GLN A OE1   1 
ATOM   809  N  NE2   . GLN A 1 104 ? 58.431 -0.075  49.751 1.00 56.02 ? 104  GLN A NE2   1 
ATOM   810  N  N     . ASN A 1 105 ? 56.923 -1.418  56.176 1.00 43.49 ? 105  ASN A N     1 
ATOM   811  C  CA    . ASN A 1 105 ? 56.549 -0.863  57.458 1.00 41.17 ? 105  ASN A CA    1 
ATOM   812  C  C     . ASN A 1 105 ? 55.850 -1.911  58.306 1.00 40.01 ? 105  ASN A C     1 
ATOM   813  O  O     . ASN A 1 105 ? 54.624 -2.020  58.305 1.00 39.21 ? 105  ASN A O     1 
ATOM   814  C  CB    . ASN A 1 105 ? 55.651 0.350   57.251 1.00 40.41 ? 105  ASN A CB    1 
ATOM   815  C  CG    . ASN A 1 105 ? 55.314 1.049   58.545 1.00 40.35 ? 105  ASN A CG    1 
ATOM   816  O  OD1   . ASN A 1 105 ? 56.057 0.962   59.520 1.00 41.73 ? 105  ASN A OD1   1 
ATOM   817  N  ND2   . ASN A 1 105 ? 54.199 1.764   58.558 1.00 39.76 ? 105  ASN A ND2   1 
ATOM   818  N  N     . PRO A 1 106 ? 56.638 -2.709  59.043 1.00 40.68 ? 106  PRO A N     1 
ATOM   819  C  CA    . PRO A 1 106 ? 56.112 -3.766  59.910 1.00 39.94 ? 106  PRO A CA    1 
ATOM   820  C  C     . PRO A 1 106 ? 55.140 -3.203  60.934 1.00 38.84 ? 106  PRO A C     1 
ATOM   821  O  O     . PRO A 1 106 ? 54.371 -3.933  61.559 1.00 39.82 ? 106  PRO A O     1 
ATOM   822  C  CB    . PRO A 1 106 ? 57.373 -4.352  60.547 1.00 40.67 ? 106  PRO A CB    1 
ATOM   823  C  CG    . PRO A 1 106 ? 58.358 -3.210  60.508 1.00 40.38 ? 106  PRO A CG    1 
ATOM   824  C  CD    . PRO A 1 106 ? 58.105 -2.616  59.153 1.00 40.28 ? 106  PRO A CD    1 
ATOM   825  N  N     . ARG A 1 107 ? 55.173 -1.887  61.077 1.00 38.04 ? 107  ARG A N     1 
ATOM   826  C  CA    . ARG A 1 107 ? 54.324 -1.181  62.018 1.00 37.65 ? 107  ARG A CA    1 
ATOM   827  C  C     . ARG A 1 107 ? 52.962 -0.766  61.459 1.00 34.83 ? 107  ARG A C     1 
ATOM   828  O  O     . ARG A 1 107 ? 52.119 -0.237  62.190 1.00 34.39 ? 107  ARG A O     1 
ATOM   829  C  CB    . ARG A 1 107 ? 55.046 0.061   62.483 1.00 42.11 ? 107  ARG A CB    1 
ATOM   830  C  CG    . ARG A 1 107 ? 55.946 -0.089  63.670 1.00 47.44 ? 107  ARG A CG    1 
ATOM   831  C  CD    . ARG A 1 107 ? 55.477 1.019   64.570 1.00 53.83 ? 107  ARG A CD    1 
ATOM   832  N  NE    . ARG A 1 107 ? 56.423 1.554   65.546 1.00 59.84 ? 107  ARG A NE    1 
ATOM   833  C  CZ    . ARG A 1 107 ? 57.449 2.358   65.268 1.00 61.62 ? 107  ARG A CZ    1 
ATOM   834  N  NH1   . ARG A 1 107 ? 57.713 2.730   64.018 1.00 63.72 ? 107  ARG A NH1   1 
ATOM   835  N  NH2   . ARG A 1 107 ? 58.171 2.858   66.262 1.00 61.61 ? 107  ARG A NH2   1 
ATOM   836  N  N     . LEU A 1 108 ? 52.760 -0.982  60.164 1.00 30.77 ? 108  LEU A N     1 
ATOM   837  C  CA    . LEU A 1 108 ? 51.503 -0.629  59.522 1.00 27.51 ? 108  LEU A CA    1 
ATOM   838  C  C     . LEU A 1 108 ? 50.350 -1.393  60.166 1.00 25.37 ? 108  LEU A C     1 
ATOM   839  O  O     . LEU A 1 108 ? 50.473 -2.573  60.475 1.00 25.90 ? 108  LEU A O     1 
ATOM   840  C  CB    . LEU A 1 108 ? 51.587 -0.946  58.028 1.00 28.00 ? 108  LEU A CB    1 
ATOM   841  C  CG    . LEU A 1 108 ? 50.377 -0.686  57.138 1.00 26.61 ? 108  LEU A CG    1 
ATOM   842  C  CD1   . LEU A 1 108 ? 50.851 -0.330  55.746 1.00 27.43 ? 108  LEU A CD1   1 
ATOM   843  C  CD2   . LEU A 1 108 ? 49.483 -1.904  57.111 1.00 26.65 ? 108  LEU A CD2   1 
ATOM   844  N  N     . VAL A 1 109 ? 49.233 -0.708  60.375 1.00 22.42 ? 109  VAL A N     1 
ATOM   845  C  CA    . VAL A 1 109 ? 48.061 -1.322  60.980 1.00 19.87 ? 109  VAL A CA    1 
ATOM   846  C  C     . VAL A 1 109 ? 46.984 -1.462  59.921 1.00 19.08 ? 109  VAL A C     1 
ATOM   847  O  O     . VAL A 1 109 ? 46.652 -0.505  59.223 1.00 18.76 ? 109  VAL A O     1 
ATOM   848  C  CB    . VAL A 1 109 ? 47.515 -0.463  62.141 1.00 19.48 ? 109  VAL A CB    1 
ATOM   849  C  CG1   . VAL A 1 109 ? 46.245 -1.079  62.705 1.00 18.60 ? 109  VAL A CG1   1 
ATOM   850  C  CG2   . VAL A 1 109 ? 48.567 -0.337  63.222 1.00 17.96 ? 109  VAL A CG2   1 
ATOM   851  N  N     . TYR A 1 110 ? 46.448 -2.667  59.795 1.00 18.02 ? 110  TYR A N     1 
ATOM   852  C  CA    . TYR A 1 110 ? 45.417 -2.924  58.815 1.00 17.85 ? 110  TYR A CA    1 
ATOM   853  C  C     . TYR A 1 110 ? 44.072 -3.056  59.519 1.00 18.72 ? 110  TYR A C     1 
ATOM   854  O  O     . TYR A 1 110 ? 43.861 -3.981  60.308 1.00 18.83 ? 110  TYR A O     1 
ATOM   855  C  CB    . TYR A 1 110 ? 45.750 -4.204  58.035 1.00 16.76 ? 110  TYR A CB    1 
ATOM   856  C  CG    . TYR A 1 110 ? 44.683 -4.651  57.060 1.00 16.42 ? 110  TYR A CG    1 
ATOM   857  C  CD1   . TYR A 1 110 ? 44.615 -5.981  56.650 1.00 14.18 ? 110  TYR A CD1   1 
ATOM   858  C  CD2   . TYR A 1 110 ? 43.727 -3.752  56.560 1.00 16.28 ? 110  TYR A CD2   1 
ATOM   859  C  CE1   . TYR A 1 110 ? 43.623 -6.417  55.770 1.00 15.16 ? 110  TYR A CE1   1 
ATOM   860  C  CE2   . TYR A 1 110 ? 42.722 -4.176  55.679 1.00 16.64 ? 110  TYR A CE2   1 
ATOM   861  C  CZ    . TYR A 1 110 ? 42.677 -5.516  55.292 1.00 16.51 ? 110  TYR A CZ    1 
ATOM   862  O  OH    . TYR A 1 110 ? 41.669 -5.972  54.472 1.00 13.25 ? 110  TYR A OH    1 
ATOM   863  N  N     . VAL A 1 111 ? 43.170 -2.116  59.240 1.00 18.53 ? 111  VAL A N     1 
ATOM   864  C  CA    . VAL A 1 111 ? 41.831 -2.139  59.821 1.00 18.42 ? 111  VAL A CA    1 
ATOM   865  C  C     . VAL A 1 111 ? 40.870 -2.724  58.783 1.00 20.42 ? 111  VAL A C     1 
ATOM   866  O  O     . VAL A 1 111 ? 40.725 -2.180  57.686 1.00 20.78 ? 111  VAL A O     1 
ATOM   867  C  CB    . VAL A 1 111 ? 41.354 -0.715  60.209 1.00 17.31 ? 111  VAL A CB    1 
ATOM   868  C  CG1   . VAL A 1 111 ? 39.959 -0.780  60.818 1.00 13.05 ? 111  VAL A CG1   1 
ATOM   869  C  CG2   . VAL A 1 111 ? 42.341 -0.073  61.188 1.00 14.79 ? 111  VAL A CG2   1 
ATOM   870  N  N     . CYS A 1 112 ? 40.226 -3.840  59.120 1.00 21.57 ? 112  CYS A N     1 
ATOM   871  C  CA    . CYS A 1 112 ? 39.295 -4.471  58.194 1.00 22.53 ? 112  CYS A CA    1 
ATOM   872  C  C     . CYS A 1 112 ? 37.894 -4.715  58.735 1.00 23.08 ? 112  CYS A C     1 
ATOM   873  O  O     . CYS A 1 112 ? 37.712 -5.250  59.831 1.00 20.54 ? 112  CYS A O     1 
ATOM   874  C  CB    . CYS A 1 112 ? 39.844 -5.810  57.681 1.00 22.86 ? 112  CYS A CB    1 
ATOM   875  S  SG    . CYS A 1 112 ? 38.618 -6.758  56.672 1.00 25.70 ? 112  CYS A SG    1 
ATOM   876  N  N     . ASP A 1 113 ? 36.908 -4.316  57.936 1.00 24.03 ? 113  ASP A N     1 
ATOM   877  C  CA    . ASP A 1 113 ? 35.506 -4.512  58.248 1.00 25.09 ? 113  ASP A CA    1 
ATOM   878  C  C     . ASP A 1 113 ? 35.082 -5.534  57.199 1.00 26.74 ? 113  ASP A C     1 
ATOM   879  O  O     . ASP A 1 113 ? 34.829 -5.180  56.045 1.00 28.50 ? 113  ASP A O     1 
ATOM   880  C  CB    . ASP A 1 113 ? 34.737 -3.205  58.075 1.00 25.15 ? 113  ASP A CB    1 
ATOM   881  C  CG    . ASP A 1 113 ? 33.244 -3.391  58.210 1.00 28.24 ? 113  ASP A CG    1 
ATOM   882  O  OD1   . ASP A 1 113 ? 32.822 -4.391  58.827 1.00 29.49 ? 113  ASP A OD1   1 
ATOM   883  O  OD2   . ASP A 1 113 ? 32.485 -2.536  57.709 1.00 30.14 ? 113  ASP A OD2   1 
ATOM   884  N  N     . PRO A 1 114 ? 35.016 -6.823  57.583 1.00 27.08 ? 114  PRO A N     1 
ATOM   885  C  CA    . PRO A 1 114 ? 34.641 -7.942  56.705 1.00 27.45 ? 114  PRO A CA    1 
ATOM   886  C  C     . PRO A 1 114 ? 33.158 -8.021  56.364 1.00 28.29 ? 114  PRO A C     1 
ATOM   887  O  O     . PRO A 1 114 ? 32.441 -8.876  56.879 1.00 30.17 ? 114  PRO A O     1 
ATOM   888  C  CB    . PRO A 1 114 ? 35.109 -9.153  57.498 1.00 27.08 ? 114  PRO A CB    1 
ATOM   889  C  CG    . PRO A 1 114 ? 34.768 -8.740  58.906 1.00 26.06 ? 114  PRO A CG    1 
ATOM   890  C  CD    . PRO A 1 114 ? 35.231 -7.293  58.966 1.00 25.90 ? 114  PRO A CD    1 
ATOM   891  N  N     . VAL A 1 115 ? 32.700 -7.158  55.469 1.00 29.32 ? 115  VAL A N     1 
ATOM   892  C  CA    . VAL A 1 115 ? 31.282 -7.139  55.120 1.00 30.14 ? 115  VAL A CA    1 
ATOM   893  C  C     . VAL A 1 115 ? 30.791 -8.340  54.317 1.00 31.62 ? 115  VAL A C     1 
ATOM   894  O  O     . VAL A 1 115 ? 31.371 -8.694  53.295 1.00 29.69 ? 115  VAL A O     1 
ATOM   895  C  CB    . VAL A 1 115 ? 30.920 -5.842  54.354 1.00 29.96 ? 115  VAL A CB    1 
ATOM   896  C  CG1   . VAL A 1 115 ? 29.440 -5.824  54.032 1.00 26.09 ? 115  VAL A CG1   1 
ATOM   897  C  CG2   . VAL A 1 115 ? 31.300 -4.623  55.191 1.00 28.60 ? 115  VAL A CG2   1 
ATOM   898  N  N     . MET A 1 116 ? 29.719 -8.962  54.807 1.00 34.68 ? 116  MET A N     1 
ATOM   899  C  CA    . MET A 1 116 ? 29.093 -10.116 54.160 1.00 37.93 ? 116  MET A CA    1 
ATOM   900  C  C     . MET A 1 116 ? 27.580 -10.049 54.401 1.00 40.52 ? 116  MET A C     1 
ATOM   901  O  O     . MET A 1 116 ? 27.133 -9.464  55.387 1.00 40.28 ? 116  MET A O     1 
ATOM   902  C  CB    . MET A 1 116 ? 29.673 -11.424 54.718 1.00 37.27 ? 116  MET A CB    1 
ATOM   903  C  CG    . MET A 1 116 ? 31.193 -11.503 54.576 1.00 38.71 ? 116  MET A CG    1 
ATOM   904  S  SD    . MET A 1 116 ? 31.970 -13.074 55.014 1.00 37.86 ? 116  MET A SD    1 
ATOM   905  C  CE    . MET A 1 116 ? 32.133 -12.910 56.802 1.00 41.07 ? 116  MET A CE    1 
ATOM   906  N  N     . GLY A 1 117 ? 26.795 -10.621 53.491 1.00 43.70 ? 117  GLY A N     1 
ATOM   907  C  CA    . GLY A 1 117 ? 25.348 -10.595 53.646 1.00 47.85 ? 117  GLY A CA    1 
ATOM   908  C  C     . GLY A 1 117 ? 24.604 -9.727  52.637 1.00 51.00 ? 117  GLY A C     1 
ATOM   909  O  O     . GLY A 1 117 ? 25.193 -9.244  51.666 1.00 51.55 ? 117  GLY A O     1 
ATOM   910  N  N     . ASP A 1 118 ? 23.308 -9.521  52.879 1.00 53.31 ? 118  ASP A N     1 
ATOM   911  C  CA    . ASP A 1 118 ? 22.445 -8.728  51.991 1.00 55.28 ? 118  ASP A CA    1 
ATOM   912  C  C     . ASP A 1 118 ? 22.456 -7.218  52.266 1.00 55.49 ? 118  ASP A C     1 
ATOM   913  O  O     . ASP A 1 118 ? 21.490 -6.513  51.953 1.00 55.78 ? 118  ASP A O     1 
ATOM   914  C  CB    . ASP A 1 118 ? 21.001 -9.231  52.089 1.00 56.47 ? 118  ASP A CB    1 
ATOM   915  C  CG    . ASP A 1 118 ? 20.424 -9.071  53.489 1.00 59.30 ? 118  ASP A CG    1 
ATOM   916  O  OD1   . ASP A 1 118 ? 19.187 -9.192  53.644 1.00 60.66 ? 118  ASP A OD1   1 
ATOM   917  O  OD2   . ASP A 1 118 ? 21.209 -8.828  54.437 1.00 60.05 ? 118  ASP A OD2   1 
ATOM   918  N  N     . GLN A 1 119 ? 23.547 -6.723  52.839 1.00 55.33 ? 119  GLN A N     1 
ATOM   919  C  CA    . GLN A 1 119 ? 23.670 -5.305  53.163 1.00 55.13 ? 119  GLN A CA    1 
ATOM   920  C  C     . GLN A 1 119 ? 23.577 -4.336  51.995 1.00 53.62 ? 119  GLN A C     1 
ATOM   921  O  O     . GLN A 1 119 ? 23.913 -4.670  50.858 1.00 53.54 ? 119  GLN A O     1 
ATOM   922  C  CB    . GLN A 1 119 ? 24.989 -5.058  53.883 1.00 56.39 ? 119  GLN A CB    1 
ATOM   923  C  CG    . GLN A 1 119 ? 24.842 -4.930  55.370 1.00 60.66 ? 119  GLN A CG    1 
ATOM   924  C  CD    . GLN A 1 119 ? 26.093 -5.350  56.092 1.00 63.42 ? 119  GLN A CD    1 
ATOM   925  O  OE1   . GLN A 1 119 ? 27.189 -4.906  55.756 1.00 65.55 ? 119  GLN A OE1   1 
ATOM   926  N  NE2   . GLN A 1 119 ? 25.943 -6.214  57.094 1.00 65.35 ? 119  GLN A NE2   1 
ATOM   927  N  N     . ARG A 1 120 ? 23.110 -3.129  52.291 1.00 51.74 ? 120  ARG A N     1 
ATOM   928  C  CA    . ARG A 1 120 ? 23.021 -2.089  51.282 1.00 50.28 ? 120  ARG A CA    1 
ATOM   929  C  C     . ARG A 1 120 ? 24.412 -1.493  51.231 1.00 48.99 ? 120  ARG A C     1 
ATOM   930  O  O     . ARG A 1 120 ? 25.021 -1.225  52.267 1.00 49.19 ? 120  ARG A O     1 
ATOM   931  C  CB    . ARG A 1 120 ? 21.981 -1.049  51.676 1.00 50.85 ? 120  ARG A CB    1 
ATOM   932  C  CG    . ARG A 1 120 ? 20.590 -1.492  51.308 1.00 52.03 ? 120  ARG A CG    1 
ATOM   933  C  CD    . ARG A 1 120 ? 19.559 -0.946  52.256 1.00 55.52 ? 120  ARG A CD    1 
ATOM   934  N  NE    . ARG A 1 120 ? 18.229 -1.435  51.902 1.00 58.57 ? 120  ARG A NE    1 
ATOM   935  C  CZ    . ARG A 1 120 ? 17.154 -1.307  52.674 1.00 59.98 ? 120  ARG A CZ    1 
ATOM   936  N  NH1   . ARG A 1 120 ? 17.247 -0.703  53.852 1.00 60.02 ? 120  ARG A NH1   1 
ATOM   937  N  NH2   . ARG A 1 120 ? 15.985 -1.789  52.271 1.00 60.78 ? 120  ARG A NH2   1 
ATOM   938  N  N     . ASN A 1 121 ? 24.916 -1.296  50.021 1.00 47.56 ? 121  ASN A N     1 
ATOM   939  C  CA    . ASN A 1 121 ? 26.270 -0.795  49.826 1.00 45.06 ? 121  ASN A CA    1 
ATOM   940  C  C     . ASN A 1 121 ? 26.337 0.243   48.715 1.00 43.10 ? 121  ASN A C     1 
ATOM   941  O  O     . ASN A 1 121 ? 25.312 0.712   48.225 1.00 42.65 ? 121  ASN A O     1 
ATOM   942  C  CB    . ASN A 1 121 ? 27.160 -1.981  49.468 1.00 45.00 ? 121  ASN A CB    1 
ATOM   943  C  CG    . ASN A 1 121 ? 26.594 -2.789  48.302 1.00 44.59 ? 121  ASN A CG    1 
ATOM   944  O  OD1   . ASN A 1 121 ? 26.711 -2.393  47.143 1.00 41.96 ? 121  ASN A OD1   1 
ATOM   945  N  ND2   . ASN A 1 121 ? 25.950 -3.910  48.612 1.00 45.43 ? 121  ASN A ND2   1 
ATOM   946  N  N     . GLY A 1 122 ? 27.557 0.588   48.321 1.00 41.12 ? 122  GLY A N     1 
ATOM   947  C  CA    . GLY A 1 122 ? 27.740 1.554   47.258 1.00 41.44 ? 122  GLY A CA    1 
ATOM   948  C  C     . GLY A 1 122 ? 28.407 0.942   46.038 1.00 41.39 ? 122  GLY A C     1 
ATOM   949  O  O     . GLY A 1 122 ? 29.048 1.648   45.263 1.00 41.13 ? 122  GLY A O     1 
ATOM   950  N  N     . GLU A 1 123 ? 28.261 -0.371  45.868 1.00 41.64 ? 123  GLU A N     1 
ATOM   951  C  CA    . GLU A 1 123 ? 28.856 -1.076  44.736 1.00 41.33 ? 123  GLU A CA    1 
ATOM   952  C  C     . GLU A 1 123 ? 27.815 -1.757  43.851 1.00 40.41 ? 123  GLU A C     1 
ATOM   953  O  O     . GLU A 1 123 ? 28.072 -2.827  43.302 1.00 41.22 ? 123  GLU A O     1 
ATOM   954  C  CB    . GLU A 1 123 ? 29.860 -2.127  45.220 1.00 42.74 ? 123  GLU A CB    1 
ATOM   955  C  CG    . GLU A 1 123 ? 31.018 -1.582  46.045 1.00 46.32 ? 123  GLU A CG    1 
ATOM   956  C  CD    . GLU A 1 123 ? 32.163 -2.577  46.147 1.00 48.79 ? 123  GLU A CD    1 
ATOM   957  O  OE1   . GLU A 1 123 ? 31.982 -3.718  45.668 1.00 51.91 ? 123  GLU A OE1   1 
ATOM   958  O  OE2   . GLU A 1 123 ? 33.235 -2.225  46.698 1.00 48.64 ? 123  GLU A OE2   1 
ATOM   959  N  N     . GLY A 1 124 ? 26.646 -1.134  43.717 1.00 40.27 ? 124  GLY A N     1 
ATOM   960  C  CA    . GLY A 1 124 ? 25.574 -1.675  42.890 1.00 41.95 ? 124  GLY A CA    1 
ATOM   961  C  C     . GLY A 1 124 ? 25.179 -3.137  43.086 1.00 43.22 ? 124  GLY A C     1 
ATOM   962  O  O     . GLY A 1 124 ? 24.401 -3.685  42.294 1.00 42.62 ? 124  GLY A O     1 
ATOM   963  N  N     . ALA A 1 125 ? 25.692 -3.761  44.145 1.00 43.65 ? 125  ALA A N     1 
ATOM   964  C  CA    . ALA A 1 125 ? 25.424 -5.167  44.441 1.00 43.54 ? 125  ALA A CA    1 
ATOM   965  C  C     . ALA A 1 125 ? 24.258 -5.422  45.394 1.00 44.76 ? 125  ALA A C     1 
ATOM   966  O  O     . ALA A 1 125 ? 24.015 -4.660  46.331 1.00 45.65 ? 125  ALA A O     1 
ATOM   967  C  CB    . ALA A 1 125 ? 26.681 -5.809  44.999 1.00 42.73 ? 125  ALA A CB    1 
ATOM   968  N  N     . MET A 1 126 ? 23.545 -6.518  45.161 1.00 45.68 ? 126  MET A N     1 
ATOM   969  C  CA    . MET A 1 126 ? 22.422 -6.878  46.014 1.00 46.49 ? 126  MET A CA    1 
ATOM   970  C  C     . MET A 1 126 ? 22.815 -7.862  47.122 1.00 46.59 ? 126  MET A C     1 
ATOM   971  O  O     . MET A 1 126 ? 22.034 -8.104  48.045 1.00 46.66 ? 126  MET A O     1 
ATOM   972  C  CB    . MET A 1 126 ? 21.296 -7.476  45.170 1.00 46.74 ? 126  MET A CB    1 
ATOM   973  C  CG    . MET A 1 126 ? 20.509 -6.451  44.381 1.00 47.43 ? 126  MET A CG    1 
ATOM   974  S  SD    . MET A 1 126 ? 19.596 -5.339  45.453 1.00 47.90 ? 126  MET A SD    1 
ATOM   975  C  CE    . MET A 1 126 ? 18.109 -6.307  45.763 1.00 47.50 ? 126  MET A CE    1 
ATOM   976  N  N     . TYR A 1 127 ? 24.022 -8.420  47.031 1.00 46.64 ? 127  TYR A N     1 
ATOM   977  C  CA    . TYR A 1 127 ? 24.508 -9.388  48.023 1.00 46.43 ? 127  TYR A CA    1 
ATOM   978  C  C     . TYR A 1 127 ? 25.999 -9.692  47.829 1.00 45.26 ? 127  TYR A C     1 
ATOM   979  O  O     . TYR A 1 127 ? 26.590 -9.321  46.816 1.00 45.17 ? 127  TYR A O     1 
ATOM   980  C  CB    . TYR A 1 127 ? 23.708 -10.698 47.911 1.00 47.31 ? 127  TYR A CB    1 
ATOM   981  C  CG    . TYR A 1 127 ? 23.880 -11.381 46.569 1.00 48.91 ? 127  TYR A CG    1 
ATOM   982  C  CD1   . TYR A 1 127 ? 25.071 -12.039 46.251 1.00 49.96 ? 127  TYR A CD1   1 
ATOM   983  C  CD2   . TYR A 1 127 ? 22.903 -11.272 45.576 1.00 49.28 ? 127  TYR A CD2   1 
ATOM   984  C  CE1   . TYR A 1 127 ? 25.296 -12.557 44.973 1.00 51.35 ? 127  TYR A CE1   1 
ATOM   985  C  CE2   . TYR A 1 127 ? 23.114 -11.789 44.291 1.00 50.43 ? 127  TYR A CE2   1 
ATOM   986  C  CZ    . TYR A 1 127 ? 24.319 -12.424 43.996 1.00 51.49 ? 127  TYR A CZ    1 
ATOM   987  O  OH    . TYR A 1 127 ? 24.579 -12.872 42.716 1.00 50.55 ? 127  TYR A OH    1 
ATOM   988  N  N     . VAL A 1 128 ? 26.595 -10.375 48.804 1.00 44.31 ? 128  VAL A N     1 
ATOM   989  C  CA    . VAL A 1 128 ? 28.006 -10.756 48.731 1.00 44.47 ? 128  VAL A CA    1 
ATOM   990  C  C     . VAL A 1 128 ? 28.116 -12.269 48.484 1.00 45.96 ? 128  VAL A C     1 
ATOM   991  O  O     . VAL A 1 128 ? 27.640 -13.081 49.284 1.00 46.58 ? 128  VAL A O     1 
ATOM   992  C  CB    . VAL A 1 128 ? 28.758 -10.391 50.035 1.00 43.11 ? 128  VAL A CB    1 
ATOM   993  C  CG1   . VAL A 1 128 ? 30.206 -10.839 49.948 1.00 41.02 ? 128  VAL A CG1   1 
ATOM   994  C  CG2   . VAL A 1 128 ? 28.696 -8.895  50.262 1.00 42.58 ? 128  VAL A CG2   1 
ATOM   995  N  N     . PRO A 1 129 ? 28.752 -12.663 47.367 1.00 46.56 ? 129  PRO A N     1 
ATOM   996  C  CA    . PRO A 1 129 ? 28.931 -14.071 46.993 1.00 46.93 ? 129  PRO A CA    1 
ATOM   997  C  C     . PRO A 1 129 ? 29.522 -14.902 48.130 1.00 47.28 ? 129  PRO A C     1 
ATOM   998  O  O     . PRO A 1 129 ? 30.456 -14.466 48.803 1.00 47.86 ? 129  PRO A O     1 
ATOM   999  C  CB    . PRO A 1 129 ? 29.880 -13.998 45.799 1.00 47.34 ? 129  PRO A CB    1 
ATOM   1000 C  CG    . PRO A 1 129 ? 29.639 -12.633 45.235 1.00 46.84 ? 129  PRO A CG    1 
ATOM   1001 C  CD    . PRO A 1 129 ? 29.492 -11.778 46.452 1.00 46.06 ? 129  PRO A CD    1 
ATOM   1002 N  N     . ASP A 1 130 ? 28.991 -16.103 48.330 1.00 46.67 ? 130  ASP A N     1 
ATOM   1003 C  CA    . ASP A 1 130 ? 29.482 -16.970 49.385 1.00 46.15 ? 130  ASP A CA    1 
ATOM   1004 C  C     . ASP A 1 130 ? 30.959 -17.316 49.210 1.00 45.88 ? 130  ASP A C     1 
ATOM   1005 O  O     . ASP A 1 130 ? 31.650 -17.562 50.195 1.00 47.09 ? 130  ASP A O     1 
ATOM   1006 C  CB    . ASP A 1 130 ? 28.658 -18.255 49.436 1.00 47.79 ? 130  ASP A CB    1 
ATOM   1007 C  CG    . ASP A 1 130 ? 27.167 -17.999 49.308 1.00 49.55 ? 130  ASP A CG    1 
ATOM   1008 O  OD1   . ASP A 1 130 ? 26.627 -17.177 50.080 1.00 49.24 ? 130  ASP A OD1   1 
ATOM   1009 O  OD2   . ASP A 1 130 ? 26.532 -18.625 48.431 1.00 51.83 ? 130  ASP A OD2   1 
ATOM   1010 N  N     . ASP A 1 131 ? 31.453 -17.328 47.972 1.00 45.36 ? 131  ASP A N     1 
ATOM   1011 C  CA    . ASP A 1 131 ? 32.858 -17.664 47.739 1.00 45.34 ? 131  ASP A CA    1 
ATOM   1012 C  C     . ASP A 1 131 ? 33.858 -16.651 48.312 1.00 44.24 ? 131  ASP A C     1 
ATOM   1013 O  O     . ASP A 1 131 ? 35.060 -16.746 48.054 1.00 44.59 ? 131  ASP A O     1 
ATOM   1014 C  CB    . ASP A 1 131 ? 33.138 -17.890 46.237 1.00 47.88 ? 131  ASP A CB    1 
ATOM   1015 C  CG    . ASP A 1 131 ? 32.856 -16.661 45.384 1.00 49.92 ? 131  ASP A CG    1 
ATOM   1016 O  OD1   . ASP A 1 131 ? 33.683 -16.344 44.494 1.00 49.43 ? 131  ASP A OD1   1 
ATOM   1017 O  OD2   . ASP A 1 131 ? 31.803 -16.023 45.593 1.00 50.80 ? 131  ASP A OD2   1 
ATOM   1018 N  N     . LEU A 1 132 ? 33.373 -15.683 49.086 1.00 42.40 ? 132  LEU A N     1 
ATOM   1019 C  CA    . LEU A 1 132 ? 34.265 -14.699 49.696 1.00 40.53 ? 132  LEU A CA    1 
ATOM   1020 C  C     . LEU A 1 132 ? 34.679 -15.134 51.096 1.00 38.60 ? 132  LEU A C     1 
ATOM   1021 O  O     . LEU A 1 132 ? 35.808 -14.897 51.520 1.00 39.13 ? 132  LEU A O     1 
ATOM   1022 C  CB    . LEU A 1 132 ? 33.609 -13.317 49.771 1.00 40.36 ? 132  LEU A CB    1 
ATOM   1023 C  CG    . LEU A 1 132 ? 34.195 -12.314 48.769 1.00 40.64 ? 132  LEU A CG    1 
ATOM   1024 C  CD1   . LEU A 1 132 ? 33.674 -12.628 47.378 1.00 41.16 ? 132  LEU A CD1   1 
ATOM   1025 C  CD2   . LEU A 1 132 ? 33.820 -10.904 49.155 1.00 40.70 ? 132  LEU A CD2   1 
ATOM   1026 N  N     . LEU A 1 133 ? 33.764 -15.780 51.808 1.00 36.79 ? 133  LEU A N     1 
ATOM   1027 C  CA    . LEU A 1 133 ? 34.038 -16.244 53.162 1.00 36.20 ? 133  LEU A CA    1 
ATOM   1028 C  C     . LEU A 1 133 ? 35.398 -16.925 53.293 1.00 35.66 ? 133  LEU A C     1 
ATOM   1029 O  O     . LEU A 1 133 ? 36.164 -16.615 54.206 1.00 36.72 ? 133  LEU A O     1 
ATOM   1030 C  CB    . LEU A 1 133 ? 32.937 -17.197 53.625 1.00 35.93 ? 133  LEU A CB    1 
ATOM   1031 C  CG    . LEU A 1 133 ? 33.070 -17.773 55.039 1.00 36.30 ? 133  LEU A CG    1 
ATOM   1032 C  CD1   . LEU A 1 133 ? 33.236 -16.646 56.052 1.00 35.93 ? 133  LEU A CD1   1 
ATOM   1033 C  CD2   . LEU A 1 133 ? 31.829 -18.600 55.362 1.00 36.08 ? 133  LEU A CD2   1 
ATOM   1034 N  N     . PRO A 1 134 ? 35.710 -17.882 52.401 1.00 35.23 ? 134  PRO A N     1 
ATOM   1035 C  CA    . PRO A 1 134 ? 37.020 -18.528 52.530 1.00 34.09 ? 134  PRO A CA    1 
ATOM   1036 C  C     . PRO A 1 134 ? 38.217 -17.592 52.329 1.00 33.89 ? 134  PRO A C     1 
ATOM   1037 O  O     . PRO A 1 134 ? 39.287 -17.826 52.902 1.00 35.62 ? 134  PRO A O     1 
ATOM   1038 C  CB    . PRO A 1 134 ? 36.965 -19.663 51.504 1.00 34.09 ? 134  PRO A CB    1 
ATOM   1039 C  CG    . PRO A 1 134 ? 35.801 -19.305 50.591 1.00 35.18 ? 134  PRO A CG    1 
ATOM   1040 C  CD    . PRO A 1 134 ? 34.824 -18.647 51.505 1.00 34.67 ? 134  PRO A CD    1 
ATOM   1041 N  N     . VAL A 1 135 ? 38.045 -16.533 51.536 1.00 32.11 ? 135  VAL A N     1 
ATOM   1042 C  CA    . VAL A 1 135 ? 39.137 -15.576 51.304 1.00 30.46 ? 135  VAL A CA    1 
ATOM   1043 C  C     . VAL A 1 135 ? 39.364 -14.734 52.560 1.00 30.72 ? 135  VAL A C     1 
ATOM   1044 O  O     . VAL A 1 135 ? 40.506 -14.473 52.956 1.00 30.23 ? 135  VAL A O     1 
ATOM   1045 C  CB    . VAL A 1 135 ? 38.836 -14.613 50.124 1.00 29.76 ? 135  VAL A CB    1 
ATOM   1046 C  CG1   . VAL A 1 135 ? 40.030 -13.681 49.893 1.00 28.17 ? 135  VAL A CG1   1 
ATOM   1047 C  CG2   . VAL A 1 135 ? 38.520 -15.402 48.861 1.00 28.21 ? 135  VAL A CG2   1 
ATOM   1048 N  N     . TYR A 1 136 ? 38.265 -14.307 53.174 1.00 30.22 ? 136  TYR A N     1 
ATOM   1049 C  CA    . TYR A 1 136 ? 38.318 -13.513 54.394 1.00 30.91 ? 136  TYR A CA    1 
ATOM   1050 C  C     . TYR A 1 136 ? 38.943 -14.329 55.509 1.00 32.49 ? 136  TYR A C     1 
ATOM   1051 O  O     . TYR A 1 136 ? 39.846 -13.878 56.217 1.00 32.76 ? 136  TYR A O     1 
ATOM   1052 C  CB    . TYR A 1 136 ? 36.905 -13.105 54.819 1.00 29.41 ? 136  TYR A CB    1 
ATOM   1053 C  CG    . TYR A 1 136 ? 36.494 -11.746 54.325 1.00 27.08 ? 136  TYR A CG    1 
ATOM   1054 C  CD1   . TYR A 1 136 ? 35.217 -11.523 53.814 1.00 25.65 ? 136  TYR A CD1   1 
ATOM   1055 C  CD2   . TYR A 1 136 ? 37.395 -10.682 54.345 1.00 27.11 ? 136  TYR A CD2   1 
ATOM   1056 C  CE1   . TYR A 1 136 ? 34.848 -10.276 53.326 1.00 25.46 ? 136  TYR A CE1   1 
ATOM   1057 C  CE2   . TYR A 1 136 ? 37.038 -9.429  53.862 1.00 27.16 ? 136  TYR A CE2   1 
ATOM   1058 C  CZ    . TYR A 1 136 ? 35.763 -9.233  53.352 1.00 25.84 ? 136  TYR A CZ    1 
ATOM   1059 O  OH    . TYR A 1 136 ? 35.412 -7.998  52.866 1.00 24.30 ? 136  TYR A OH    1 
ATOM   1060 N  N     . ARG A 1 137 ? 38.440 -15.546 55.641 1.00 33.73 ? 137  ARG A N     1 
ATOM   1061 C  CA    . ARG A 1 137 ? 38.872 -16.463 56.664 1.00 36.06 ? 137  ARG A CA    1 
ATOM   1062 C  C     . ARG A 1 137 ? 40.340 -16.864 56.582 1.00 36.94 ? 137  ARG A C     1 
ATOM   1063 O  O     . ARG A 1 137 ? 41.050 -16.824 57.586 1.00 38.00 ? 137  ARG A O     1 
ATOM   1064 C  CB    . ARG A 1 137 ? 37.973 -17.693 56.614 1.00 37.65 ? 137  ARG A CB    1 
ATOM   1065 C  CG    . ARG A 1 137 ? 37.955 -18.501 57.885 1.00 41.31 ? 137  ARG A CG    1 
ATOM   1066 C  CD    . ARG A 1 137 ? 36.614 -19.210 58.101 1.00 44.88 ? 137  ARG A CD    1 
ATOM   1067 N  NE    . ARG A 1 137 ? 36.114 -19.937 56.935 1.00 48.34 ? 137  ARG A NE    1 
ATOM   1068 C  CZ    . ARG A 1 137 ? 35.114 -20.813 56.982 1.00 48.97 ? 137  ARG A CZ    1 
ATOM   1069 N  NH1   . ARG A 1 137 ? 34.518 -21.070 58.140 1.00 49.11 ? 137  ARG A NH1   1 
ATOM   1070 N  NH2   . ARG A 1 137 ? 34.701 -21.416 55.872 1.00 49.47 ? 137  ARG A NH2   1 
ATOM   1071 N  N     . GLU A 1 138 ? 40.811 -17.220 55.393 1.00 37.54 ? 138  GLU A N     1 
ATOM   1072 C  CA    . GLU A 1 138 ? 42.192 -17.665 55.256 1.00 39.57 ? 138  GLU A CA    1 
ATOM   1073 C  C     . GLU A 1 138 ? 43.247 -16.669 54.788 1.00 38.79 ? 138  GLU A C     1 
ATOM   1074 O  O     . GLU A 1 138 ? 44.437 -16.855 55.057 1.00 39.19 ? 138  GLU A O     1 
ATOM   1075 C  CB    . GLU A 1 138 ? 42.207 -18.908 54.377 1.00 41.98 ? 138  GLU A CB    1 
ATOM   1076 C  CG    . GLU A 1 138 ? 41.512 -20.072 55.058 1.00 46.80 ? 138  GLU A CG    1 
ATOM   1077 C  CD    . GLU A 1 138 ? 40.989 -21.104 54.085 1.00 49.94 ? 138  GLU A CD    1 
ATOM   1078 O  OE1   . GLU A 1 138 ? 41.686 -21.404 53.088 1.00 50.64 ? 138  GLU A OE1   1 
ATOM   1079 O  OE2   . GLU A 1 138 ? 39.879 -21.622 54.330 1.00 52.38 ? 138  GLU A OE2   1 
ATOM   1080 N  N     . LYS A 1 139 ? 42.834 -15.608 54.107 1.00 37.76 ? 139  LYS A N     1 
ATOM   1081 C  CA    . LYS A 1 139 ? 43.807 -14.633 53.649 1.00 36.57 ? 139  LYS A CA    1 
ATOM   1082 C  C     . LYS A 1 139 ? 43.695 -13.248 54.290 1.00 35.64 ? 139  LYS A C     1 
ATOM   1083 O  O     . LYS A 1 139 ? 44.708 -12.665 54.668 1.00 35.90 ? 139  LYS A O     1 
ATOM   1084 C  CB    . LYS A 1 139 ? 43.741 -14.527 52.131 1.00 38.06 ? 139  LYS A CB    1 
ATOM   1085 C  CG    . LYS A 1 139 ? 43.883 -15.877 51.458 1.00 39.92 ? 139  LYS A CG    1 
ATOM   1086 C  CD    . LYS A 1 139 ? 44.006 -15.743 49.954 1.00 43.99 ? 139  LYS A CD    1 
ATOM   1087 C  CE    . LYS A 1 139 ? 45.464 -15.657 49.513 1.00 46.50 ? 139  LYS A CE    1 
ATOM   1088 N  NZ    . LYS A 1 139 ? 45.584 -15.449 48.037 1.00 47.65 ? 139  LYS A NZ    1 
ATOM   1089 N  N     . VAL A 1 140 ? 42.481 -12.731 54.442 1.00 33.65 ? 140  VAL A N     1 
ATOM   1090 C  CA    . VAL A 1 140 ? 42.296 -11.397 55.015 1.00 31.65 ? 140  VAL A CA    1 
ATOM   1091 C  C     . VAL A 1 140 ? 42.523 -11.299 56.530 1.00 30.84 ? 140  VAL A C     1 
ATOM   1092 O  O     . VAL A 1 140 ? 43.450 -10.615 56.989 1.00 30.00 ? 140  VAL A O     1 
ATOM   1093 C  CB    . VAL A 1 140 ? 40.886 -10.854 54.680 1.00 31.62 ? 140  VAL A CB    1 
ATOM   1094 C  CG1   . VAL A 1 140 ? 40.757 -9.407  55.126 1.00 30.82 ? 140  VAL A CG1   1 
ATOM   1095 C  CG2   . VAL A 1 140 ? 40.636 -10.969 53.184 1.00 30.96 ? 140  VAL A CG2   1 
ATOM   1096 N  N     . VAL A 1 141 ? 41.676 -11.979 57.299 1.00 29.62 ? 141  VAL A N     1 
ATOM   1097 C  CA    . VAL A 1 141 ? 41.765 -11.965 58.757 1.00 28.38 ? 141  VAL A CA    1 
ATOM   1098 C  C     . VAL A 1 141 ? 43.182 -12.199 59.301 1.00 28.61 ? 141  VAL A C     1 
ATOM   1099 O  O     . VAL A 1 141 ? 43.604 -11.537 60.252 1.00 28.82 ? 141  VAL A O     1 
ATOM   1100 C  CB    . VAL A 1 141 ? 40.804 -13.007 59.376 1.00 28.07 ? 141  VAL A CB    1 
ATOM   1101 C  CG1   . VAL A 1 141 ? 40.923 -12.988 60.879 1.00 28.34 ? 141  VAL A CG1   1 
ATOM   1102 C  CG2   . VAL A 1 141 ? 39.373 -12.709 58.961 1.00 26.44 ? 141  VAL A CG2   1 
ATOM   1103 N  N     . PRO A 1 142 ? 43.924 -13.161 58.721 1.00 29.38 ? 142  PRO A N     1 
ATOM   1104 C  CA    . PRO A 1 142 ? 45.290 -13.450 59.171 1.00 28.46 ? 142  PRO A CA    1 
ATOM   1105 C  C     . PRO A 1 142 ? 46.253 -12.266 59.128 1.00 28.77 ? 142  PRO A C     1 
ATOM   1106 O  O     . PRO A 1 142 ? 47.219 -12.230 59.891 1.00 31.11 ? 142  PRO A O     1 
ATOM   1107 C  CB    . PRO A 1 142 ? 45.720 -14.570 58.241 1.00 27.88 ? 142  PRO A CB    1 
ATOM   1108 C  CG    . PRO A 1 142 ? 44.447 -15.344 58.082 1.00 28.49 ? 142  PRO A CG    1 
ATOM   1109 C  CD    . PRO A 1 142 ? 43.433 -14.244 57.845 1.00 28.23 ? 142  PRO A CD    1 
ATOM   1110 N  N     . VAL A 1 143 ? 46.004 -11.298 58.247 1.00 29.23 ? 143  VAL A N     1 
ATOM   1111 C  CA    . VAL A 1 143 ? 46.888 -10.130 58.145 1.00 28.78 ? 143  VAL A CA    1 
ATOM   1112 C  C     . VAL A 1 143 ? 46.248 -8.844  58.693 1.00 27.01 ? 143  VAL A C     1 
ATOM   1113 O  O     . VAL A 1 143 ? 46.866 -7.771  58.700 1.00 28.12 ? 143  VAL A O     1 
ATOM   1114 C  CB    . VAL A 1 143 ? 47.408 -9.934  56.656 1.00 29.54 ? 143  VAL A CB    1 
ATOM   1115 C  CG1   . VAL A 1 143 ? 46.686 -10.868 55.720 1.00 30.90 ? 143  VAL A CG1   1 
ATOM   1116 C  CG2   . VAL A 1 143 ? 47.220 -8.511  56.183 1.00 28.70 ? 143  VAL A CG2   1 
ATOM   1117 N  N     . ALA A 1 144 ? 45.022 -8.968  59.188 1.00 25.45 ? 144  ALA A N     1 
ATOM   1118 C  CA    . ALA A 1 144 ? 44.302 -7.833  59.752 1.00 25.37 ? 144  ALA A CA    1 
ATOM   1119 C  C     . ALA A 1 144 ? 44.659 -7.589  61.226 1.00 25.33 ? 144  ALA A C     1 
ATOM   1120 O  O     . ALA A 1 144 ? 44.816 -8.533  62.004 1.00 26.45 ? 144  ALA A O     1 
ATOM   1121 C  CB    . ALA A 1 144 ? 42.812 -8.058  59.608 1.00 25.95 ? 144  ALA A CB    1 
ATOM   1122 N  N     . ASP A 1 145 ? 44.774 -6.318  61.605 1.00 25.07 ? 145  ASP A N     1 
ATOM   1123 C  CA    . ASP A 1 145 ? 45.120 -5.947  62.975 1.00 24.31 ? 145  ASP A CA    1 
ATOM   1124 C  C     . ASP A 1 145 ? 43.910 -5.540  63.812 1.00 23.88 ? 145  ASP A C     1 
ATOM   1125 O  O     . ASP A 1 145 ? 43.886 -5.754  65.023 1.00 23.88 ? 145  ASP A O     1 
ATOM   1126 C  CB    . ASP A 1 145 ? 46.148 -4.824  62.945 1.00 24.84 ? 145  ASP A CB    1 
ATOM   1127 C  CG    . ASP A 1 145 ? 47.386 -5.218  62.182 1.00 27.71 ? 145  ASP A CG    1 
ATOM   1128 O  OD1   . ASP A 1 145 ? 48.088 -6.136  62.651 1.00 31.51 ? 145  ASP A OD1   1 
ATOM   1129 O  OD2   . ASP A 1 145 ? 47.653 -4.634  61.109 1.00 28.17 ? 145  ASP A OD2   1 
ATOM   1130 N  N     . ILE A 1 146 ? 42.916 -4.944  63.162 1.00 22.80 ? 146  ILE A N     1 
ATOM   1131 C  CA    . ILE A 1 146 ? 41.684 -4.531  63.828 1.00 20.34 ? 146  ILE A CA    1 
ATOM   1132 C  C     . ILE A 1 146 ? 40.552 -4.938  62.907 1.00 21.40 ? 146  ILE A C     1 
ATOM   1133 O  O     . ILE A 1 146 ? 40.568 -4.591  61.727 1.00 22.04 ? 146  ILE A O     1 
ATOM   1134 C  CB    . ILE A 1 146 ? 41.599 -3.004  64.012 1.00 18.91 ? 146  ILE A CB    1 
ATOM   1135 C  CG1   . ILE A 1 146 ? 42.762 -2.508  64.871 1.00 17.97 ? 146  ILE A CG1   1 
ATOM   1136 C  CG2   . ILE A 1 146 ? 40.259 -2.636  64.640 1.00 17.54 ? 146  ILE A CG2   1 
ATOM   1137 C  CD1   . ILE A 1 146 ? 42.825 -0.996  65.013 1.00 15.60 ? 146  ILE A CD1   1 
ATOM   1138 N  N     . ILE A 1 147 ? 39.589 -5.694  63.422 1.00 20.72 ? 147  ILE A N     1 
ATOM   1139 C  CA    . ILE A 1 147 ? 38.460 -6.105  62.596 1.00 20.74 ? 147  ILE A CA    1 
ATOM   1140 C  C     . ILE A 1 147 ? 37.169 -5.696  63.284 1.00 21.12 ? 147  ILE A C     1 
ATOM   1141 O  O     . ILE A 1 147 ? 37.082 -5.715  64.508 1.00 22.03 ? 147  ILE A O     1 
ATOM   1142 C  CB    . ILE A 1 147 ? 38.453 -7.630  62.325 1.00 21.24 ? 147  ILE A CB    1 
ATOM   1143 C  CG1   . ILE A 1 147 ? 38.556 -8.405  63.636 1.00 20.97 ? 147  ILE A CG1   1 
ATOM   1144 C  CG2   . ILE A 1 147 ? 39.588 -7.988  61.373 1.00 18.96 ? 147  ILE A CG2   1 
ATOM   1145 C  CD1   . ILE A 1 147 ? 38.413 -9.897  63.459 1.00 22.37 ? 147  ILE A CD1   1 
ATOM   1146 N  N     . THR A 1 148 ? 36.168 -5.323  62.494 1.00 20.56 ? 148  THR A N     1 
ATOM   1147 C  CA    . THR A 1 148 ? 34.900 -4.869  63.047 1.00 20.83 ? 148  THR A CA    1 
ATOM   1148 C  C     . THR A 1 148 ? 33.707 -5.625  62.483 1.00 22.03 ? 148  THR A C     1 
ATOM   1149 O  O     . THR A 1 148 ? 32.840 -5.042  61.850 1.00 23.29 ? 148  THR A O     1 
ATOM   1150 C  CB    . THR A 1 148 ? 34.705 -3.347  62.779 1.00 19.94 ? 148  THR A CB    1 
ATOM   1151 O  OG1   . THR A 1 148 ? 34.682 -3.097  61.366 1.00 19.23 ? 148  THR A OG1   1 
ATOM   1152 C  CG2   . THR A 1 148 ? 35.842 -2.548  63.398 1.00 18.25 ? 148  THR A CG2   1 
ATOM   1153 N  N     . PRO A 1 149 ? 33.635 -6.939  62.720 1.00 23.63 ? 149  PRO A N     1 
ATOM   1154 C  CA    . PRO A 1 149 ? 32.508 -7.719  62.196 1.00 25.08 ? 149  PRO A CA    1 
ATOM   1155 C  C     . PRO A 1 149 ? 31.254 -7.545  63.039 1.00 26.30 ? 149  PRO A C     1 
ATOM   1156 O  O     . PRO A 1 149 ? 31.340 -7.144  64.200 1.00 25.94 ? 149  PRO A O     1 
ATOM   1157 C  CB    . PRO A 1 149 ? 33.029 -9.140  62.272 1.00 24.45 ? 149  PRO A CB    1 
ATOM   1158 C  CG    . PRO A 1 149 ? 33.788 -9.110  63.576 1.00 24.99 ? 149  PRO A CG    1 
ATOM   1159 C  CD    . PRO A 1 149 ? 34.546 -7.791  63.509 1.00 24.90 ? 149  PRO A CD    1 
ATOM   1160 N  N     . ASN A 1 150 ? 30.089 -7.806  62.452 1.00 27.75 ? 150  ASN A N     1 
ATOM   1161 C  CA    . ASN A 1 150 ? 28.857 -7.736  63.225 1.00 29.78 ? 150  ASN A CA    1 
ATOM   1162 C  C     . ASN A 1 150 ? 28.705 -9.179  63.707 1.00 31.47 ? 150  ASN A C     1 
ATOM   1163 O  O     . ASN A 1 150 ? 29.526 -10.030 63.356 1.00 31.30 ? 150  ASN A O     1 
ATOM   1164 C  CB    . ASN A 1 150 ? 27.663 -7.324  62.360 1.00 28.91 ? 150  ASN A CB    1 
ATOM   1165 C  CG    . ASN A 1 150 ? 27.542 -8.138  61.098 1.00 30.52 ? 150  ASN A CG    1 
ATOM   1166 O  OD1   . ASN A 1 150 ? 27.964 -9.290  61.046 1.00 33.08 ? 150  ASN A OD1   1 
ATOM   1167 N  ND2   . ASN A 1 150 ? 26.942 -7.550  60.071 1.00 32.61 ? 150  ASN A ND2   1 
ATOM   1168 N  N     . GLN A 1 151 ? 27.682 -9.472  64.502 1.00 32.44 ? 151  GLN A N     1 
ATOM   1169 C  CA    . GLN A 1 151 ? 27.514 -10.836 64.983 1.00 33.57 ? 151  GLN A CA    1 
ATOM   1170 C  C     . GLN A 1 151 ? 27.479 -11.853 63.841 1.00 33.69 ? 151  GLN A C     1 
ATOM   1171 O  O     . GLN A 1 151 ? 28.194 -12.853 63.890 1.00 33.69 ? 151  GLN A O     1 
ATOM   1172 C  CB    . GLN A 1 151 ? 26.239 -10.970 65.812 1.00 35.80 ? 151  GLN A CB    1 
ATOM   1173 C  CG    . GLN A 1 151 ? 26.191 -12.249 66.633 1.00 38.69 ? 151  GLN A CG    1 
ATOM   1174 C  CD    . GLN A 1 151 ? 24.831 -12.494 67.256 1.00 39.81 ? 151  GLN A CD    1 
ATOM   1175 O  OE1   . GLN A 1 151 ? 24.247 -11.596 67.861 1.00 39.52 ? 151  GLN A OE1   1 
ATOM   1176 N  NE2   . GLN A 1 151 ? 24.323 -13.718 67.115 1.00 40.15 ? 151  GLN A NE2   1 
ATOM   1177 N  N     . PHE A 1 152 ? 26.659 -11.599 62.819 1.00 33.43 ? 152  PHE A N     1 
ATOM   1178 C  CA    . PHE A 1 152 ? 26.540 -12.510 61.678 1.00 33.43 ? 152  PHE A CA    1 
ATOM   1179 C  C     . PHE A 1 152 ? 27.882 -12.830 61.019 1.00 33.61 ? 152  PHE A C     1 
ATOM   1180 O  O     . PHE A 1 152 ? 28.159 -13.986 60.683 1.00 34.38 ? 152  PHE A O     1 
ATOM   1181 C  CB    . PHE A 1 152 ? 25.588 -11.930 60.628 1.00 35.03 ? 152  PHE A CB    1 
ATOM   1182 C  CG    . PHE A 1 152 ? 25.433 -12.797 59.406 1.00 38.61 ? 152  PHE A CG    1 
ATOM   1183 C  CD1   . PHE A 1 152 ? 24.863 -14.067 59.502 1.00 39.54 ? 152  PHE A CD1   1 
ATOM   1184 C  CD2   . PHE A 1 152 ? 25.895 -12.364 58.164 1.00 39.49 ? 152  PHE A CD2   1 
ATOM   1185 C  CE1   . PHE A 1 152 ? 24.756 -14.894 58.383 1.00 38.77 ? 152  PHE A CE1   1 
ATOM   1186 C  CE2   . PHE A 1 152 ? 25.794 -13.184 57.036 1.00 40.14 ? 152  PHE A CE2   1 
ATOM   1187 C  CZ    . PHE A 1 152 ? 25.225 -14.452 57.149 1.00 40.03 ? 152  PHE A CZ    1 
ATOM   1188 N  N     . GLU A 1 153 ? 28.711 -11.806 60.834 1.00 33.80 ? 153  GLU A N     1 
ATOM   1189 C  CA    . GLU A 1 153 ? 30.023 -11.977 60.215 1.00 34.52 ? 153  GLU A CA    1 
ATOM   1190 C  C     . GLU A 1 153 ? 30.999 -12.716 61.128 1.00 34.55 ? 153  GLU A C     1 
ATOM   1191 O  O     . GLU A 1 153 ? 31.782 -13.552 60.668 1.00 34.85 ? 153  GLU A O     1 
ATOM   1192 C  CB    . GLU A 1 153 ? 30.582 -10.609 59.808 1.00 35.53 ? 153  GLU A CB    1 
ATOM   1193 C  CG    . GLU A 1 153 ? 29.778 -9.977  58.681 1.00 37.20 ? 153  GLU A CG    1 
ATOM   1194 C  CD    . GLU A 1 153 ? 29.872 -8.470  58.650 1.00 37.55 ? 153  GLU A CD    1 
ATOM   1195 O  OE1   . GLU A 1 153 ? 30.362 -7.881  59.637 1.00 37.93 ? 153  GLU A OE1   1 
ATOM   1196 O  OE2   . GLU A 1 153 ? 29.436 -7.874  57.642 1.00 38.46 ? 153  GLU A OE2   1 
ATOM   1197 N  N     . ALA A 1 154 ? 30.948 -12.410 62.420 1.00 34.74 ? 154  ALA A N     1 
ATOM   1198 C  CA    . ALA A 1 154 ? 31.810 -13.072 63.390 1.00 35.71 ? 154  ALA A CA    1 
ATOM   1199 C  C     . ALA A 1 154 ? 31.523 -14.587 63.388 1.00 37.05 ? 154  ALA A C     1 
ATOM   1200 O  O     . ALA A 1 154 ? 32.444 -15.405 63.496 1.00 37.54 ? 154  ALA A O     1 
ATOM   1201 C  CB    . ALA A 1 154 ? 31.576 -12.492 64.776 1.00 32.76 ? 154  ALA A CB    1 
ATOM   1202 N  N     . GLU A 1 155 ? 30.248 -14.956 63.253 1.00 37.58 ? 155  GLU A N     1 
ATOM   1203 C  CA    . GLU A 1 155 ? 29.858 -16.365 63.232 1.00 37.70 ? 155  GLU A CA    1 
ATOM   1204 C  C     . GLU A 1 155 ? 30.396 -17.088 61.994 1.00 38.64 ? 155  GLU A C     1 
ATOM   1205 O  O     . GLU A 1 155 ? 30.963 -18.177 62.110 1.00 38.86 ? 155  GLU A O     1 
ATOM   1206 C  CB    . GLU A 1 155 ? 28.333 -16.509 63.287 1.00 35.61 ? 155  GLU A CB    1 
ATOM   1207 C  CG    . GLU A 1 155 ? 27.702 -15.926 64.537 1.00 36.63 ? 155  GLU A CG    1 
ATOM   1208 C  CD    . GLU A 1 155 ? 26.208 -16.170 64.606 1.00 37.24 ? 155  GLU A CD    1 
ATOM   1209 O  OE1   . GLU A 1 155 ? 25.567 -16.223 63.536 1.00 38.30 ? 155  GLU A OE1   1 
ATOM   1210 O  OE2   . GLU A 1 155 ? 25.671 -16.292 65.728 1.00 37.96 ? 155  GLU A OE2   1 
ATOM   1211 N  N     . LEU A 1 156 ? 30.225 -16.490 60.816 1.00 38.44 ? 156  LEU A N     1 
ATOM   1212 C  CA    . LEU A 1 156 ? 30.715 -17.110 59.584 1.00 37.72 ? 156  LEU A CA    1 
ATOM   1213 C  C     . LEU A 1 156 ? 32.226 -17.330 59.627 1.00 37.12 ? 156  LEU A C     1 
ATOM   1214 O  O     . LEU A 1 156 ? 32.721 -18.393 59.252 1.00 37.50 ? 156  LEU A O     1 
ATOM   1215 C  CB    . LEU A 1 156 ? 30.371 -16.241 58.375 1.00 37.48 ? 156  LEU A CB    1 
ATOM   1216 C  CG    . LEU A 1 156 ? 28.886 -15.993 58.121 1.00 37.13 ? 156  LEU A CG    1 
ATOM   1217 C  CD1   . LEU A 1 156 ? 28.729 -15.050 56.943 1.00 37.94 ? 156  LEU A CD1   1 
ATOM   1218 C  CD2   . LEU A 1 156 ? 28.189 -17.306 57.849 1.00 35.53 ? 156  LEU A CD2   1 
ATOM   1219 N  N     . LEU A 1 157 ? 32.955 -16.321 60.089 1.00 36.13 ? 157  LEU A N     1 
ATOM   1220 C  CA    . LEU A 1 157 ? 34.407 -16.405 60.165 1.00 36.47 ? 157  LEU A CA    1 
ATOM   1221 C  C     . LEU A 1 157 ? 34.928 -17.511 61.083 1.00 37.35 ? 157  LEU A C     1 
ATOM   1222 O  O     . LEU A 1 157 ? 35.992 -18.076 60.841 1.00 38.11 ? 157  LEU A O     1 
ATOM   1223 C  CB    . LEU A 1 157 ? 34.985 -15.062 60.622 1.00 35.14 ? 157  LEU A CB    1 
ATOM   1224 C  CG    . LEU A 1 157 ? 34.899 -13.859 59.678 1.00 32.88 ? 157  LEU A CG    1 
ATOM   1225 C  CD1   . LEU A 1 157 ? 35.287 -12.611 60.451 1.00 32.17 ? 157  LEU A CD1   1 
ATOM   1226 C  CD2   . LEU A 1 157 ? 35.817 -14.050 58.472 1.00 32.28 ? 157  LEU A CD2   1 
ATOM   1227 N  N     . THR A 1 158 ? 34.182 -17.823 62.134 1.00 37.94 ? 158  THR A N     1 
ATOM   1228 C  CA    . THR A 1 158 ? 34.612 -18.841 63.089 1.00 37.21 ? 158  THR A CA    1 
ATOM   1229 C  C     . THR A 1 158 ? 33.797 -20.130 63.017 1.00 38.88 ? 158  THR A C     1 
ATOM   1230 O  O     . THR A 1 158 ? 34.094 -21.105 63.713 1.00 39.01 ? 158  THR A O     1 
ATOM   1231 C  CB    . THR A 1 158 ? 34.542 -18.293 64.519 1.00 36.21 ? 158  THR A CB    1 
ATOM   1232 O  OG1   . THR A 1 158 ? 33.205 -17.842 64.787 1.00 34.42 ? 158  THR A OG1   1 
ATOM   1233 C  CG2   . THR A 1 158 ? 35.524 -17.138 64.688 1.00 33.02 ? 158  THR A CG2   1 
ATOM   1234 N  N     . GLY A 1 159 ? 32.769 -20.127 62.177 1.00 39.99 ? 159  GLY A N     1 
ATOM   1235 C  CA    . GLY A 1 159 ? 31.928 -21.300 62.024 1.00 40.88 ? 159  GLY A CA    1 
ATOM   1236 C  C     . GLY A 1 159 ? 31.152 -21.638 63.279 1.00 42.24 ? 159  GLY A C     1 
ATOM   1237 O  O     . GLY A 1 159 ? 30.614 -22.739 63.405 1.00 43.30 ? 159  GLY A O     1 
ATOM   1238 N  N     . ARG A 1 160 ? 31.083 -20.692 64.209 1.00 42.95 ? 160  ARG A N     1 
ATOM   1239 C  CA    . ARG A 1 160 ? 30.370 -20.912 65.458 1.00 43.53 ? 160  ARG A CA    1 
ATOM   1240 C  C     . ARG A 1 160 ? 29.184 -19.963 65.608 1.00 43.90 ? 160  ARG A C     1 
ATOM   1241 O  O     . ARG A 1 160 ? 29.179 -18.873 65.045 1.00 44.82 ? 160  ARG A O     1 
ATOM   1242 C  CB    . ARG A 1 160 ? 31.327 -20.729 66.637 1.00 43.54 ? 160  ARG A CB    1 
ATOM   1243 C  CG    . ARG A 1 160 ? 31.382 -21.920 67.561 1.00 45.00 ? 160  ARG A CG    1 
ATOM   1244 C  CD    . ARG A 1 160 ? 32.119 -21.592 68.840 1.00 47.32 ? 160  ARG A CD    1 
ATOM   1245 N  NE    . ARG A 1 160 ? 31.226 -21.621 69.996 1.00 49.71 ? 160  ARG A NE    1 
ATOM   1246 C  CZ    . ARG A 1 160 ? 31.610 -21.343 71.236 1.00 51.31 ? 160  ARG A CZ    1 
ATOM   1247 N  NH1   . ARG A 1 160 ? 32.878 -21.011 71.473 1.00 52.33 ? 160  ARG A NH1   1 
ATOM   1248 N  NH2   . ARG A 1 160 ? 30.731 -21.396 72.235 1.00 51.21 ? 160  ARG A NH2   1 
ATOM   1249 N  N     . LYS A 1 161 ? 28.169 -20.376 66.358 1.00 44.59 ? 161  LYS A N     1 
ATOM   1250 C  CA    . LYS A 1 161 ? 27.024 -19.510 66.561 1.00 45.51 ? 161  LYS A CA    1 
ATOM   1251 C  C     . LYS A 1 161 ? 27.090 -18.915 67.949 1.00 46.07 ? 161  LYS A C     1 
ATOM   1252 O  O     . LYS A 1 161 ? 27.641 -19.515 68.874 1.00 47.07 ? 161  LYS A O     1 
ATOM   1253 C  CB    . LYS A 1 161 ? 25.719 -20.271 66.376 1.00 47.21 ? 161  LYS A CB    1 
ATOM   1254 C  CG    . LYS A 1 161 ? 25.617 -20.922 65.020 1.00 50.84 ? 161  LYS A CG    1 
ATOM   1255 C  CD    . LYS A 1 161 ? 24.201 -20.912 64.477 1.00 54.32 ? 161  LYS A CD    1 
ATOM   1256 C  CE    . LYS A 1 161 ? 23.926 -19.640 63.687 1.00 56.08 ? 161  LYS A CE    1 
ATOM   1257 N  NZ    . LYS A 1 161 ? 23.116 -19.946 62.465 1.00 58.32 ? 161  LYS A NZ    1 
ATOM   1258 N  N     . ILE A 1 162 ? 26.530 -17.719 68.077 1.00 45.97 ? 162  ILE A N     1 
ATOM   1259 C  CA    . ILE A 1 162 ? 26.527 -16.999 69.333 1.00 45.47 ? 162  ILE A CA    1 
ATOM   1260 C  C     . ILE A 1 162 ? 25.119 -16.947 69.899 1.00 45.83 ? 162  ILE A C     1 
ATOM   1261 O  O     . ILE A 1 162 ? 24.201 -16.447 69.250 1.00 45.52 ? 162  ILE A O     1 
ATOM   1262 C  CB    . ILE A 1 162 ? 27.066 -15.571 69.125 1.00 45.58 ? 162  ILE A CB    1 
ATOM   1263 C  CG1   . ILE A 1 162 ? 28.485 -15.650 68.552 1.00 45.30 ? 162  ILE A CG1   1 
ATOM   1264 C  CG2   . ILE A 1 162 ? 27.061 -14.806 70.440 1.00 45.21 ? 162  ILE A CG2   1 
ATOM   1265 C  CD1   . ILE A 1 162 ? 29.169 -14.312 68.388 1.00 45.26 ? 162  ILE A CD1   1 
ATOM   1266 N  N     . HIS A 1 163 ? 24.964 -17.476 71.113 1.00 46.84 ? 163  HIS A N     1 
ATOM   1267 C  CA    . HIS A 1 163 ? 23.675 -17.513 71.804 1.00 46.47 ? 163  HIS A CA    1 
ATOM   1268 C  C     . HIS A 1 163 ? 23.719 -16.694 73.091 1.00 45.87 ? 163  HIS A C     1 
ATOM   1269 O  O     . HIS A 1 163 ? 22.681 -16.417 73.690 1.00 46.07 ? 163  HIS A O     1 
ATOM   1270 C  CB    . HIS A 1 163 ? 23.299 -18.953 72.172 1.00 47.68 ? 163  HIS A CB    1 
ATOM   1271 C  CG    . HIS A 1 163 ? 23.338 -19.910 71.022 1.00 50.24 ? 163  HIS A CG    1 
ATOM   1272 N  ND1   . HIS A 1 163 ? 24.462 -20.092 70.243 1.00 52.44 ? 163  HIS A ND1   1 
ATOM   1273 C  CD2   . HIS A 1 163 ? 22.407 -20.771 70.546 1.00 51.83 ? 163  HIS A CD2   1 
ATOM   1274 C  CE1   . HIS A 1 163 ? 24.220 -21.024 69.337 1.00 53.03 ? 163  HIS A CE1   1 
ATOM   1275 N  NE2   . HIS A 1 163 ? 22.981 -21.452 69.499 1.00 52.89 ? 163  HIS A NE2   1 
ATOM   1276 N  N     . SER A 1 164 ? 24.916 -16.310 73.523 1.00 45.06 ? 164  SER A N     1 
ATOM   1277 C  CA    . SER A 1 164 ? 25.046 -15.548 74.760 1.00 44.45 ? 164  SER A CA    1 
ATOM   1278 C  C     . SER A 1 164 ? 26.306 -14.703 74.812 1.00 44.33 ? 164  SER A C     1 
ATOM   1279 O  O     . SER A 1 164 ? 27.194 -14.834 73.969 1.00 45.04 ? 164  SER A O     1 
ATOM   1280 C  CB    . SER A 1 164 ? 25.053 -16.497 75.951 1.00 45.12 ? 164  SER A CB    1 
ATOM   1281 O  OG    . SER A 1 164 ? 26.195 -17.338 75.910 1.00 44.06 ? 164  SER A OG    1 
ATOM   1282 N  N     . GLN A 1 165 ? 26.385 -13.849 75.823 1.00 43.19 ? 165  GLN A N     1 
ATOM   1283 C  CA    . GLN A 1 165 ? 27.535 -12.975 75.972 1.00 43.00 ? 165  GLN A CA    1 
ATOM   1284 C  C     . GLN A 1 165 ? 28.813 -13.776 76.099 1.00 43.36 ? 165  GLN A C     1 
ATOM   1285 O  O     . GLN A 1 165 ? 29.852 -13.387 75.565 1.00 43.48 ? 165  GLN A O     1 
ATOM   1286 C  CB    . GLN A 1 165 ? 27.383 -12.083 77.206 1.00 42.36 ? 165  GLN A CB    1 
ATOM   1287 C  CG    . GLN A 1 165 ? 28.370 -10.917 77.237 1.00 42.71 ? 165  GLN A CG    1 
ATOM   1288 C  CD    . GLN A 1 165 ? 28.290 -10.103 78.518 1.00 43.11 ? 165  GLN A CD    1 
ATOM   1289 O  OE1   . GLN A 1 165 ? 28.979 -10.394 79.495 1.00 46.49 ? 165  GLN A OE1   1 
ATOM   1290 N  NE2   . GLN A 1 165 ? 27.439 -9.086  78.523 1.00 41.78 ? 165  GLN A NE2   1 
ATOM   1291 N  N     . GLU A 1 166 ? 28.729 -14.901 76.803 1.00 44.22 ? 166  GLU A N     1 
ATOM   1292 C  CA    . GLU A 1 166 ? 29.897 -15.751 77.032 1.00 45.18 ? 166  GLU A CA    1 
ATOM   1293 C  C     . GLU A 1 166 ? 30.399 -16.411 75.762 1.00 43.99 ? 166  GLU A C     1 
ATOM   1294 O  O     . GLU A 1 166 ? 31.601 -16.614 75.595 1.00 43.61 ? 166  GLU A O     1 
ATOM   1295 C  CB    . GLU A 1 166 ? 29.590 -16.834 78.070 1.00 47.45 ? 166  GLU A CB    1 
ATOM   1296 C  CG    . GLU A 1 166 ? 29.019 -16.321 79.387 1.00 51.84 ? 166  GLU A CG    1 
ATOM   1297 C  CD    . GLU A 1 166 ? 27.563 -15.897 79.268 1.00 54.80 ? 166  GLU A CD    1 
ATOM   1298 O  OE1   . GLU A 1 166 ? 26.737 -16.729 78.820 1.00 55.77 ? 166  GLU A OE1   1 
ATOM   1299 O  OE2   . GLU A 1 166 ? 27.247 -14.737 79.625 1.00 56.94 ? 166  GLU A OE2   1 
ATOM   1300 N  N     . GLU A 1 167 ? 29.478 -16.759 74.871 1.00 43.28 ? 167  GLU A N     1 
ATOM   1301 C  CA    . GLU A 1 167 ? 29.861 -17.384 73.613 1.00 43.22 ? 167  GLU A CA    1 
ATOM   1302 C  C     . GLU A 1 167 ? 30.534 -16.357 72.701 1.00 42.22 ? 167  GLU A C     1 
ATOM   1303 O  O     . GLU A 1 167 ? 31.468 -16.682 71.966 1.00 41.66 ? 167  GLU A O     1 
ATOM   1304 C  CB    . GLU A 1 167 ? 28.632 -17.985 72.924 1.00 44.19 ? 167  GLU A CB    1 
ATOM   1305 C  CG    . GLU A 1 167 ? 28.085 -19.217 73.630 1.00 46.54 ? 167  GLU A CG    1 
ATOM   1306 C  CD    . GLU A 1 167 ? 26.929 -19.863 72.891 1.00 47.42 ? 167  GLU A CD    1 
ATOM   1307 O  OE1   . GLU A 1 167 ? 26.394 -20.873 73.385 1.00 49.96 ? 167  GLU A OE1   1 
ATOM   1308 O  OE2   . GLU A 1 167 ? 26.551 -19.366 71.815 1.00 48.40 ? 167  GLU A OE2   1 
ATOM   1309 N  N     . ALA A 1 168 ? 30.058 -15.116 72.761 1.00 40.85 ? 168  ALA A N     1 
ATOM   1310 C  CA    . ALA A 1 168 ? 30.617 -14.044 71.955 1.00 39.40 ? 168  ALA A CA    1 
ATOM   1311 C  C     . ALA A 1 168 ? 32.086 -13.869 72.316 1.00 38.11 ? 168  ALA A C     1 
ATOM   1312 O  O     . ALA A 1 168 ? 32.957 -13.806 71.445 1.00 36.49 ? 168  ALA A O     1 
ATOM   1313 C  CB    . ALA A 1 168 ? 29.856 -12.752 72.209 1.00 40.80 ? 168  ALA A CB    1 
ATOM   1314 N  N     . LEU A 1 169 ? 32.356 -13.792 73.612 1.00 37.09 ? 169  LEU A N     1 
ATOM   1315 C  CA    . LEU A 1 169 ? 33.723 -13.639 74.088 1.00 37.35 ? 169  LEU A CA    1 
ATOM   1316 C  C     . LEU A 1 169 ? 34.598 -14.792 73.594 1.00 37.43 ? 169  LEU A C     1 
ATOM   1317 O  O     . LEU A 1 169 ? 35.791 -14.614 73.340 1.00 37.34 ? 169  LEU A O     1 
ATOM   1318 C  CB    . LEU A 1 169 ? 33.743 -13.604 75.616 1.00 37.51 ? 169  LEU A CB    1 
ATOM   1319 C  CG    . LEU A 1 169 ? 32.945 -12.476 76.263 1.00 38.82 ? 169  LEU A CG    1 
ATOM   1320 C  CD1   . LEU A 1 169 ? 32.929 -12.672 77.766 1.00 39.66 ? 169  LEU A CD1   1 
ATOM   1321 C  CD2   . LEU A 1 169 ? 33.561 -11.130 75.900 1.00 39.26 ? 169  LEU A CD2   1 
ATOM   1322 N  N     . GLU A 1 170 ? 34.005 -15.976 73.468 1.00 37.79 ? 170  GLU A N     1 
ATOM   1323 C  CA    . GLU A 1 170 ? 34.748 -17.143 73.004 1.00 38.38 ? 170  GLU A CA    1 
ATOM   1324 C  C     . GLU A 1 170 ? 35.055 -17.007 71.516 1.00 38.10 ? 170  GLU A C     1 
ATOM   1325 O  O     . GLU A 1 170 ? 36.148 -17.351 71.057 1.00 37.00 ? 170  GLU A O     1 
ATOM   1326 C  CB    . GLU A 1 170 ? 33.955 -18.432 73.268 1.00 40.13 ? 170  GLU A CB    1 
ATOM   1327 C  CG    . GLU A 1 170 ? 33.942 -18.868 74.738 1.00 43.84 ? 170  GLU A CG    1 
ATOM   1328 C  CD    . GLU A 1 170 ? 33.194 -20.186 74.981 1.00 45.79 ? 170  GLU A CD    1 
ATOM   1329 O  OE1   . GLU A 1 170 ? 33.093 -20.614 76.154 1.00 46.69 ? 170  GLU A OE1   1 
ATOM   1330 O  OE2   . GLU A 1 170 ? 32.708 -20.798 74.005 1.00 45.83 ? 170  GLU A OE2   1 
ATOM   1331 N  N     . VAL A 1 171 ? 34.086 -16.499 70.762 1.00 37.32 ? 171  VAL A N     1 
ATOM   1332 C  CA    . VAL A 1 171 ? 34.276 -16.310 69.335 1.00 34.70 ? 171  VAL A CA    1 
ATOM   1333 C  C     . VAL A 1 171 ? 35.321 -15.226 69.117 1.00 34.49 ? 171  VAL A C     1 
ATOM   1334 O  O     . VAL A 1 171 ? 36.143 -15.330 68.210 1.00 33.93 ? 171  VAL A O     1 
ATOM   1335 C  CB    . VAL A 1 171 ? 32.960 -15.909 68.641 1.00 35.51 ? 171  VAL A CB    1 
ATOM   1336 C  CG1   . VAL A 1 171 ? 33.235 -15.482 67.209 1.00 34.93 ? 171  VAL A CG1   1 
ATOM   1337 C  CG2   . VAL A 1 171 ? 31.988 -17.089 68.654 1.00 34.42 ? 171  VAL A CG2   1 
ATOM   1338 N  N     . MET A 1 172 ? 35.303 -14.192 69.953 1.00 33.82 ? 172  MET A N     1 
ATOM   1339 C  CA    . MET A 1 172 ? 36.278 -13.115 69.819 1.00 34.71 ? 172  MET A CA    1 
ATOM   1340 C  C     . MET A 1 172 ? 37.689 -13.626 70.082 1.00 34.87 ? 172  MET A C     1 
ATOM   1341 O  O     . MET A 1 172 ? 38.658 -13.143 69.482 1.00 35.84 ? 172  MET A O     1 
ATOM   1342 C  CB    . MET A 1 172 ? 35.961 -11.963 70.774 1.00 36.03 ? 172  MET A CB    1 
ATOM   1343 C  CG    . MET A 1 172 ? 34.679 -11.202 70.440 1.00 38.11 ? 172  MET A CG    1 
ATOM   1344 S  SD    . MET A 1 172 ? 34.593 -9.580  71.264 1.00 41.08 ? 172  MET A SD    1 
ATOM   1345 C  CE    . MET A 1 172 ? 33.767 -10.011 72.753 1.00 39.28 ? 172  MET A CE    1 
ATOM   1346 N  N     . ASP A 1 173 ? 37.806 -14.599 70.982 1.00 34.40 ? 173  ASP A N     1 
ATOM   1347 C  CA    . ASP A 1 173 ? 39.107 -15.186 71.299 1.00 33.84 ? 173  ASP A CA    1 
ATOM   1348 C  C     . ASP A 1 173 ? 39.596 -15.996 70.100 1.00 32.94 ? 173  ASP A C     1 
ATOM   1349 O  O     . ASP A 1 173 ? 40.787 -16.003 69.779 1.00 31.05 ? 173  ASP A O     1 
ATOM   1350 C  CB    . ASP A 1 173 ? 38.996 -16.086 72.528 1.00 34.75 ? 173  ASP A CB    1 
ATOM   1351 C  CG    . ASP A 1 173 ? 39.164 -15.325 73.821 1.00 36.54 ? 173  ASP A CG    1 
ATOM   1352 O  OD1   . ASP A 1 173 ? 38.795 -15.876 74.879 1.00 38.58 ? 173  ASP A OD1   1 
ATOM   1353 O  OD2   . ASP A 1 173 ? 39.676 -14.185 73.784 1.00 38.10 ? 173  ASP A OD2   1 
ATOM   1354 N  N     . MET A 1 174 ? 38.660 -16.674 69.441 1.00 32.32 ? 174  MET A N     1 
ATOM   1355 C  CA    . MET A 1 174 ? 38.983 -17.473 68.269 1.00 33.11 ? 174  MET A CA    1 
ATOM   1356 C  C     . MET A 1 174 ? 39.514 -16.558 67.167 1.00 33.32 ? 174  MET A C     1 
ATOM   1357 O  O     . MET A 1 174 ? 40.438 -16.923 66.435 1.00 33.24 ? 174  MET A O     1 
ATOM   1358 C  CB    . MET A 1 174 ? 37.740 -18.230 67.788 1.00 33.30 ? 174  MET A CB    1 
ATOM   1359 C  CG    . MET A 1 174 ? 37.376 -19.426 68.659 1.00 35.65 ? 174  MET A CG    1 
ATOM   1360 S  SD    . MET A 1 174 ? 35.817 -20.211 68.208 1.00 41.17 ? 174  MET A SD    1 
ATOM   1361 C  CE    . MET A 1 174 ? 36.304 -21.082 66.694 1.00 40.61 ? 174  MET A CE    1 
ATOM   1362 N  N     . LEU A 1 175 ? 38.931 -15.364 67.060 1.00 32.45 ? 175  LEU A N     1 
ATOM   1363 C  CA    . LEU A 1 175 ? 39.354 -14.396 66.058 1.00 30.29 ? 175  LEU A CA    1 
ATOM   1364 C  C     . LEU A 1 175 ? 40.744 -13.888 66.403 1.00 30.05 ? 175  LEU A C     1 
ATOM   1365 O  O     . LEU A 1 175 ? 41.574 -13.698 65.519 1.00 28.55 ? 175  LEU A O     1 
ATOM   1366 C  CB    . LEU A 1 175 ? 38.354 -13.244 65.982 1.00 29.35 ? 175  LEU A CB    1 
ATOM   1367 C  CG    . LEU A 1 175 ? 37.014 -13.657 65.363 1.00 29.19 ? 175  LEU A CG    1 
ATOM   1368 C  CD1   . LEU A 1 175 ? 35.985 -12.567 65.547 1.00 29.42 ? 175  LEU A CD1   1 
ATOM   1369 C  CD2   . LEU A 1 175 ? 37.211 -13.967 63.887 1.00 28.94 ? 175  LEU A CD2   1 
ATOM   1370 N  N     . HIS A 1 176 ? 41.005 -13.676 67.689 1.00 30.72 ? 176  HIS A N     1 
ATOM   1371 C  CA    . HIS A 1 176 ? 42.327 -13.217 68.100 1.00 32.90 ? 176  HIS A CA    1 
ATOM   1372 C  C     . HIS A 1 176 ? 43.392 -14.208 67.645 1.00 34.46 ? 176  HIS A C     1 
ATOM   1373 O  O     . HIS A 1 176 ? 44.429 -13.808 67.124 1.00 35.12 ? 176  HIS A O     1 
ATOM   1374 C  CB    . HIS A 1 176 ? 42.413 -13.073 69.618 1.00 32.86 ? 176  HIS A CB    1 
ATOM   1375 C  CG    . HIS A 1 176 ? 41.799 -11.816 70.146 1.00 34.06 ? 176  HIS A CG    1 
ATOM   1376 N  ND1   . HIS A 1 176 ? 42.268 -10.561 69.819 1.00 34.32 ? 176  HIS A ND1   1 
ATOM   1377 C  CD2   . HIS A 1 176 ? 40.770 -11.620 71.004 1.00 34.39 ? 176  HIS A CD2   1 
ATOM   1378 C  CE1   . HIS A 1 176 ? 41.555 -9.647  70.453 1.00 33.51 ? 176  HIS A CE1   1 
ATOM   1379 N  NE2   . HIS A 1 176 ? 40.640 -10.264 71.179 1.00 34.89 ? 176  HIS A NE2   1 
ATOM   1380 N  N     . SER A 1 177 ? 43.139 -15.500 67.848 1.00 35.57 ? 177  SER A N     1 
ATOM   1381 C  CA    . SER A 1 177 ? 44.103 -16.521 67.450 1.00 36.39 ? 177  SER A CA    1 
ATOM   1382 C  C     . SER A 1 177 ? 44.287 -16.578 65.940 1.00 35.67 ? 177  SER A C     1 
ATOM   1383 O  O     . SER A 1 177 ? 45.311 -17.063 65.461 1.00 37.03 ? 177  SER A O     1 
ATOM   1384 C  CB    . SER A 1 177 ? 43.693 -17.896 67.991 1.00 37.09 ? 177  SER A CB    1 
ATOM   1385 O  OG    . SER A 1 177 ? 42.293 -18.083 67.909 1.00 41.75 ? 177  SER A OG    1 
ATOM   1386 N  N     . MET A 1 178 ? 43.304 -16.083 65.190 1.00 33.89 ? 178  MET A N     1 
ATOM   1387 C  CA    . MET A 1 178 ? 43.408 -16.061 63.737 1.00 31.05 ? 178  MET A CA    1 
ATOM   1388 C  C     . MET A 1 178 ? 44.278 -14.890 63.283 1.00 30.26 ? 178  MET A C     1 
ATOM   1389 O  O     . MET A 1 178 ? 44.722 -14.854 62.138 1.00 30.26 ? 178  MET A O     1 
ATOM   1390 C  CB    . MET A 1 178 ? 42.027 -15.964 63.103 1.00 31.43 ? 178  MET A CB    1 
ATOM   1391 C  CG    . MET A 1 178 ? 41.228 -17.232 63.233 1.00 32.78 ? 178  MET A CG    1 
ATOM   1392 S  SD    . MET A 1 178 ? 39.518 -17.002 62.760 1.00 38.94 ? 178  MET A SD    1 
ATOM   1393 C  CE    . MET A 1 178 ? 39.663 -16.917 60.949 1.00 35.27 ? 178  MET A CE    1 
ATOM   1394 N  N     . GLY A 1 179 ? 44.523 -13.929 64.172 1.00 28.80 ? 179  GLY A N     1 
ATOM   1395 C  CA    . GLY A 1 179 ? 45.368 -12.812 63.787 1.00 28.48 ? 179  GLY A CA    1 
ATOM   1396 C  C     . GLY A 1 179 ? 45.207 -11.454 64.457 1.00 27.57 ? 179  GLY A C     1 
ATOM   1397 O  O     . GLY A 1 179 ? 46.115 -11.001 65.150 1.00 28.11 ? 179  GLY A O     1 
ATOM   1398 N  N     . PRO A 1 180 ? 44.070 -10.772 64.259 1.00 26.65 ? 180  PRO A N     1 
ATOM   1399 C  CA    . PRO A 1 180 ? 43.821 -9.451  64.853 1.00 26.25 ? 180  PRO A CA    1 
ATOM   1400 C  C     . PRO A 1 180 ? 43.904 -9.304  66.373 1.00 26.34 ? 180  PRO A C     1 
ATOM   1401 O  O     . PRO A 1 180 ? 43.218 -10.013 67.108 1.00 27.11 ? 180  PRO A O     1 
ATOM   1402 C  CB    . PRO A 1 180 ? 42.431 -9.085  64.313 1.00 25.73 ? 180  PRO A CB    1 
ATOM   1403 C  CG    . PRO A 1 180 ? 41.792 -10.419 64.030 1.00 24.18 ? 180  PRO A CG    1 
ATOM   1404 C  CD    . PRO A 1 180 ? 42.927 -11.204 63.432 1.00 24.43 ? 180  PRO A CD    1 
ATOM   1405 N  N     . ASP A 1 181 ? 44.736 -8.368  66.835 1.00 26.75 ? 181  ASP A N     1 
ATOM   1406 C  CA    . ASP A 1 181 ? 44.888 -8.095  68.269 1.00 26.62 ? 181  ASP A CA    1 
ATOM   1407 C  C     . ASP A 1 181 ? 43.688 -7.326  68.826 1.00 26.85 ? 181  ASP A C     1 
ATOM   1408 O  O     . ASP A 1 181 ? 43.514 -7.234  70.042 1.00 27.51 ? 181  ASP A O     1 
ATOM   1409 C  CB    . ASP A 1 181 ? 46.147 -7.272  68.553 1.00 28.07 ? 181  ASP A CB    1 
ATOM   1410 C  CG    . ASP A 1 181 ? 47.412 -8.102  68.525 1.00 31.02 ? 181  ASP A CG    1 
ATOM   1411 O  OD1   . ASP A 1 181 ? 47.343 -9.312  68.830 1.00 33.04 ? 181  ASP A OD1   1 
ATOM   1412 O  OD2   . ASP A 1 181 ? 48.485 -7.537  68.218 1.00 33.18 ? 181  ASP A OD2   1 
ATOM   1413 N  N     . THR A 1 182 ? 42.880 -6.750  67.940 1.00 25.00 ? 182  THR A N     1 
ATOM   1414 C  CA    . THR A 1 182 ? 41.700 -6.006  68.360 1.00 22.30 ? 182  THR A CA    1 
ATOM   1415 C  C     . THR A 1 182 ? 40.491 -6.501  67.581 1.00 22.55 ? 182  THR A C     1 
ATOM   1416 O  O     . THR A 1 182 ? 40.533 -6.613  66.354 1.00 23.59 ? 182  THR A O     1 
ATOM   1417 C  CB    . THR A 1 182 ? 41.869 -4.491  68.117 1.00 21.09 ? 182  THR A CB    1 
ATOM   1418 O  OG1   . THR A 1 182 ? 43.009 -4.011  68.837 1.00 21.46 ? 182  THR A OG1   1 
ATOM   1419 C  CG2   . THR A 1 182 ? 40.644 -3.740  68.590 1.00 20.00 ? 182  THR A CG2   1 
ATOM   1420 N  N     . VAL A 1 183 ? 39.418 -6.815  68.298 1.00 21.67 ? 183  VAL A N     1 
ATOM   1421 C  CA    . VAL A 1 183 ? 38.195 -7.284  67.667 1.00 20.40 ? 183  VAL A CA    1 
ATOM   1422 C  C     . VAL A 1 183 ? 37.016 -6.549  68.280 1.00 20.58 ? 183  VAL A C     1 
ATOM   1423 O  O     . VAL A 1 183 ? 36.897 -6.454  69.500 1.00 20.09 ? 183  VAL A O     1 
ATOM   1424 C  CB    . VAL A 1 183 ? 37.985 -8.808  67.872 1.00 20.12 ? 183  VAL A CB    1 
ATOM   1425 C  CG1   . VAL A 1 183 ? 36.700 -9.257  67.199 1.00 18.91 ? 183  VAL A CG1   1 
ATOM   1426 C  CG2   . VAL A 1 183 ? 39.162 -9.580  67.310 1.00 19.69 ? 183  VAL A CG2   1 
ATOM   1427 N  N     . VAL A 1 184 ? 36.154 -6.014  67.427 1.00 20.94 ? 184  VAL A N     1 
ATOM   1428 C  CA    . VAL A 1 184 ? 34.981 -5.313  67.904 1.00 22.10 ? 184  VAL A CA    1 
ATOM   1429 C  C     . VAL A 1 184 ? 33.752 -5.795  67.152 1.00 24.00 ? 184  VAL A C     1 
ATOM   1430 O  O     . VAL A 1 184 ? 33.659 -5.656  65.931 1.00 25.57 ? 184  VAL A O     1 
ATOM   1431 C  CB    . VAL A 1 184 ? 35.105 -3.790  67.715 1.00 20.45 ? 184  VAL A CB    1 
ATOM   1432 C  CG1   . VAL A 1 184 ? 33.840 -3.117  68.188 1.00 21.47 ? 184  VAL A CG1   1 
ATOM   1433 C  CG2   . VAL A 1 184 ? 36.288 -3.261  68.491 1.00 19.66 ? 184  VAL A CG2   1 
ATOM   1434 N  N     . ILE A 1 185 ? 32.824 -6.393  67.888 1.00 24.80 ? 185  ILE A N     1 
ATOM   1435 C  CA    . ILE A 1 185 ? 31.581 -6.857  67.301 1.00 25.57 ? 185  ILE A CA    1 
ATOM   1436 C  C     . ILE A 1 185 ? 30.651 -5.662  67.421 1.00 26.19 ? 185  ILE A C     1 
ATOM   1437 O  O     . ILE A 1 185 ? 30.094 -5.403  68.481 1.00 27.44 ? 185  ILE A O     1 
ATOM   1438 C  CB    . ILE A 1 185 ? 31.020 -8.069  68.069 1.00 26.20 ? 185  ILE A CB    1 
ATOM   1439 C  CG1   . ILE A 1 185 ? 31.941 -9.275  67.835 1.00 26.40 ? 185  ILE A CG1   1 
ATOM   1440 C  CG2   . ILE A 1 185 ? 29.592 -8.359  67.622 1.00 26.37 ? 185  ILE A CG2   1 
ATOM   1441 C  CD1   . ILE A 1 185 ? 31.437 -10.570 68.422 1.00 26.64 ? 185  ILE A CD1   1 
ATOM   1442 N  N     . THR A 1 186 ? 30.517 -4.935  66.316 1.00 27.38 ? 186  THR A N     1 
ATOM   1443 C  CA    . THR A 1 186 ? 29.718 -3.713  66.226 1.00 27.36 ? 186  THR A CA    1 
ATOM   1444 C  C     . THR A 1 186 ? 28.217 -3.758  66.533 1.00 29.29 ? 186  THR A C     1 
ATOM   1445 O  O     . THR A 1 186 ? 27.639 -2.743  66.904 1.00 31.68 ? 186  THR A O     1 
ATOM   1446 C  CB    . THR A 1 186 ? 29.916 -3.053  64.843 1.00 26.34 ? 186  THR A CB    1 
ATOM   1447 O  OG1   . THR A 1 186 ? 29.439 -3.927  63.811 1.00 23.56 ? 186  THR A OG1   1 
ATOM   1448 C  CG2   . THR A 1 186 ? 31.395 -2.755  64.612 1.00 23.65 ? 186  THR A CG2   1 
ATOM   1449 N  N     . SER A 1 187 ? 27.576 -4.905  66.369 1.00 31.56 ? 187  SER A N     1 
ATOM   1450 C  CA    . SER A 1 187 ? 26.149 -5.016  66.676 1.00 33.66 ? 187  SER A CA    1 
ATOM   1451 C  C     . SER A 1 187 ? 25.790 -6.485  66.781 1.00 35.50 ? 187  SER A C     1 
ATOM   1452 O  O     . SER A 1 187 ? 26.364 -7.328  66.087 1.00 35.24 ? 187  SER A O     1 
ATOM   1453 C  CB    . SER A 1 187 ? 25.285 -4.353  65.599 1.00 32.74 ? 187  SER A CB    1 
ATOM   1454 O  OG    . SER A 1 187 ? 25.186 -5.163  64.442 1.00 33.97 ? 187  SER A OG    1 
ATOM   1455 N  N     . SER A 1 188 ? 24.833 -6.790  67.646 1.00 38.20 ? 188  SER A N     1 
ATOM   1456 C  CA    . SER A 1 188 ? 24.431 -8.173  67.859 1.00 40.53 ? 188  SER A CA    1 
ATOM   1457 C  C     . SER A 1 188 ? 22.961 -8.309  68.210 1.00 42.21 ? 188  SER A C     1 
ATOM   1458 O  O     . SER A 1 188 ? 22.274 -7.323  68.480 1.00 43.18 ? 188  SER A O     1 
ATOM   1459 C  CB    . SER A 1 188 ? 25.250 -8.768  68.995 1.00 39.60 ? 188  SER A CB    1 
ATOM   1460 O  OG    . SER A 1 188 ? 24.927 -8.107  70.206 1.00 38.74 ? 188  SER A OG    1 
ATOM   1461 N  N     . ASN A 1 189 ? 22.502 -9.553  68.229 1.00 43.84 ? 189  ASN A N     1 
ATOM   1462 C  CA    . ASN A 1 189 ? 21.125 -9.883  68.552 1.00 45.62 ? 189  ASN A CA    1 
ATOM   1463 C  C     . ASN A 1 189 ? 20.967 -10.147 70.043 1.00 46.06 ? 189  ASN A C     1 
ATOM   1464 O  O     . ASN A 1 189 ? 19.851 -10.340 70.524 1.00 45.96 ? 189  ASN A O     1 
ATOM   1465 C  CB    . ASN A 1 189 ? 20.703 -11.122 67.773 1.00 48.42 ? 189  ASN A CB    1 
ATOM   1466 C  CG    . ASN A 1 189 ? 20.719 -10.896 66.279 1.00 52.10 ? 189  ASN A CG    1 
ATOM   1467 O  OD1   . ASN A 1 189 ? 19.665 -10.805 65.648 1.00 55.72 ? 189  ASN A OD1   1 
ATOM   1468 N  ND2   . ASN A 1 189 ? 21.915 -10.789 65.701 1.00 52.73 ? 189  ASN A ND2   1 
ATOM   1469 N  N     . LEU A 1 190 ? 22.083 -10.165 70.770 1.00 45.96 ? 190  LEU A N     1 
ATOM   1470 C  CA    . LEU A 1 190 ? 22.040 -10.412 72.204 1.00 46.98 ? 190  LEU A CA    1 
ATOM   1471 C  C     . LEU A 1 190 ? 21.219 -9.366  72.933 1.00 48.66 ? 190  LEU A C     1 
ATOM   1472 O  O     . LEU A 1 190 ? 21.359 -8.165  72.691 1.00 49.06 ? 190  LEU A O     1 
ATOM   1473 C  CB    . LEU A 1 190 ? 23.447 -10.454 72.796 1.00 46.46 ? 190  LEU A CB    1 
ATOM   1474 C  CG    . LEU A 1 190 ? 24.269 -11.677 72.399 1.00 47.53 ? 190  LEU A CG    1 
ATOM   1475 C  CD1   . LEU A 1 190 ? 25.277 -11.309 71.327 1.00 47.94 ? 190  LEU A CD1   1 
ATOM   1476 C  CD2   . LEU A 1 190 ? 24.982 -12.202 73.618 1.00 47.04 ? 190  LEU A CD2   1 
ATOM   1477 N  N     . LEU A 1 191 ? 20.352 -9.831  73.823 1.00 50.60 ? 191  LEU A N     1 
ATOM   1478 C  CA    . LEU A 1 191 ? 19.504 -8.945  74.603 1.00 52.42 ? 191  LEU A CA    1 
ATOM   1479 C  C     . LEU A 1 191 ? 20.381 -8.251  75.639 1.00 53.69 ? 191  LEU A C     1 
ATOM   1480 O  O     . LEU A 1 191 ? 21.094 -8.910  76.402 1.00 53.49 ? 191  LEU A O     1 
ATOM   1481 C  CB    . LEU A 1 191 ? 18.410 -9.750  75.306 1.00 52.38 ? 191  LEU A CB    1 
ATOM   1482 C  CG    . LEU A 1 191 ? 16.985 -9.222  75.151 1.00 53.18 ? 191  LEU A CG    1 
ATOM   1483 C  CD1   . LEU A 1 191 ? 16.172 -10.215 74.330 1.00 53.51 ? 191  LEU A CD1   1 
ATOM   1484 C  CD2   . LEU A 1 191 ? 16.354 -9.020  76.517 1.00 53.55 ? 191  LEU A CD2   1 
ATOM   1485 N  N     . SER A 1 192 ? 20.342 -6.923  75.660 1.00 54.42 ? 192  SER A N     1 
ATOM   1486 C  CA    . SER A 1 192 ? 21.147 -6.174  76.617 1.00 55.62 ? 192  SER A CA    1 
ATOM   1487 C  C     . SER A 1 192 ? 20.429 -6.106  77.956 1.00 55.96 ? 192  SER A C     1 
ATOM   1488 O  O     . SER A 1 192 ? 19.199 -6.017  78.010 1.00 56.40 ? 192  SER A O     1 
ATOM   1489 C  CB    . SER A 1 192 ? 21.386 -4.750  76.122 1.00 54.80 ? 192  SER A CB    1 
ATOM   1490 O  OG    . SER A 1 192 ? 21.234 -4.679  74.721 1.00 57.50 ? 192  SER A OG    1 
ATOM   1491 N  N     . PRO A 1 193 ? 21.188 -6.170  79.060 1.00 56.07 ? 193  PRO A N     1 
ATOM   1492 C  CA    . PRO A 1 193 ? 20.583 -6.101  80.392 1.00 56.06 ? 193  PRO A CA    1 
ATOM   1493 C  C     . PRO A 1 193 ? 19.829 -4.781  80.602 1.00 56.04 ? 193  PRO A C     1 
ATOM   1494 O  O     . PRO A 1 193 ? 18.904 -4.710  81.414 1.00 56.63 ? 193  PRO A O     1 
ATOM   1495 C  CB    . PRO A 1 193 ? 21.786 -6.256  81.336 1.00 55.79 ? 193  PRO A CB    1 
ATOM   1496 C  CG    . PRO A 1 193 ? 22.995 -5.914  80.473 1.00 55.69 ? 193  PRO A CG    1 
ATOM   1497 C  CD    . PRO A 1 193 ? 22.620 -6.505  79.146 1.00 56.14 ? 193  PRO A CD    1 
ATOM   1498 N  N     . ARG A 1 194 ? 20.220 -3.749  79.852 1.00 55.14 ? 194  ARG A N     1 
ATOM   1499 C  CA    . ARG A 1 194 ? 19.593 -2.432  79.956 1.00 54.36 ? 194  ARG A CA    1 
ATOM   1500 C  C     . ARG A 1 194 ? 18.170 -2.390  79.391 1.00 53.67 ? 194  ARG A C     1 
ATOM   1501 O  O     . ARG A 1 194 ? 17.328 -1.630  79.877 1.00 55.04 ? 194  ARG A O     1 
ATOM   1502 C  CB    . ARG A 1 194 ? 20.463 -1.378  79.254 1.00 53.67 ? 194  ARG A CB    1 
ATOM   1503 N  N     . GLY A 1 195 ? 17.906 -3.203  78.371 1.00 52.34 ? 195  GLY A N     1 
ATOM   1504 C  CA    . GLY A 1 195 ? 16.586 -3.227  77.760 1.00 51.40 ? 195  GLY A CA    1 
ATOM   1505 C  C     . GLY A 1 195 ? 16.591 -3.704  76.314 1.00 50.69 ? 195  GLY A C     1 
ATOM   1506 O  O     . GLY A 1 195 ? 17.628 -3.707  75.650 1.00 51.74 ? 195  GLY A O     1 
ATOM   1507 N  N     . SER A 1 196 ? 15.425 -4.096  75.813 1.00 48.54 ? 196  SER A N     1 
ATOM   1508 C  CA    . SER A 1 196 ? 15.303 -4.590  74.445 1.00 46.63 ? 196  SER A CA    1 
ATOM   1509 C  C     . SER A 1 196 ? 15.509 -3.530  73.361 1.00 45.97 ? 196  SER A C     1 
ATOM   1510 O  O     . SER A 1 196 ? 15.586 -3.852  72.177 1.00 45.39 ? 196  SER A O     1 
ATOM   1511 C  CB    . SER A 1 196 ? 13.927 -5.229  74.254 1.00 46.83 ? 196  SER A CB    1 
ATOM   1512 O  OG    . SER A 1 196 ? 12.893 -4.269  74.402 1.00 46.61 ? 196  SER A OG    1 
ATOM   1513 N  N     . ASP A 1 197 ? 15.591 -2.268  73.765 1.00 45.28 ? 197  ASP A N     1 
ATOM   1514 C  CA    . ASP A 1 197 ? 15.768 -1.170  72.821 1.00 43.66 ? 197  ASP A CA    1 
ATOM   1515 C  C     . ASP A 1 197 ? 17.219 -0.764  72.659 1.00 42.13 ? 197  ASP A C     1 
ATOM   1516 O  O     . ASP A 1 197 ? 17.536 0.147   71.891 1.00 41.71 ? 197  ASP A O     1 
ATOM   1517 C  CB    . ASP A 1 197 ? 14.959 0.036   73.283 1.00 45.65 ? 197  ASP A CB    1 
ATOM   1518 C  CG    . ASP A 1 197 ? 13.480 -0.176  73.131 1.00 46.46 ? 197  ASP A CG    1 
ATOM   1519 O  OD1   . ASP A 1 197 ? 12.711 0.447   73.893 1.00 48.69 ? 197  ASP A OD1   1 
ATOM   1520 O  OD2   . ASP A 1 197 ? 13.090 -0.958  72.241 1.00 47.85 ? 197  ASP A OD2   1 
ATOM   1521 N  N     . TYR A 1 198 ? 18.101 -1.429  73.392 1.00 40.17 ? 198  TYR A N     1 
ATOM   1522 C  CA    . TYR A 1 198 ? 19.510 -1.111  73.305 1.00 38.89 ? 198  TYR A CA    1 
ATOM   1523 C  C     . TYR A 1 198 ? 20.235 -2.097  72.419 1.00 38.99 ? 198  TYR A C     1 
ATOM   1524 O  O     . TYR A 1 198 ? 19.918 -3.281  72.403 1.00 39.45 ? 198  TYR A O     1 
ATOM   1525 C  CB    . TYR A 1 198 ? 20.145 -1.101  74.695 1.00 37.44 ? 198  TYR A CB    1 
ATOM   1526 C  CG    . TYR A 1 198 ? 19.688 0.055   75.547 1.00 37.29 ? 198  TYR A CG    1 
ATOM   1527 C  CD1   . TYR A 1 198 ? 18.511 -0.022  76.290 1.00 36.91 ? 198  TYR A CD1   1 
ATOM   1528 C  CD2   . TYR A 1 198 ? 20.413 1.245   75.579 1.00 36.57 ? 198  TYR A CD2   1 
ATOM   1529 C  CE1   . TYR A 1 198 ? 18.067 1.060   77.042 1.00 36.91 ? 198  TYR A CE1   1 
ATOM   1530 C  CE2   . TYR A 1 198 ? 19.977 2.331   76.320 1.00 37.02 ? 198  TYR A CE2   1 
ATOM   1531 C  CZ    . TYR A 1 198 ? 18.804 2.232   77.052 1.00 37.07 ? 198  TYR A CZ    1 
ATOM   1532 O  OH    . TYR A 1 198 ? 18.368 3.306   77.792 1.00 39.43 ? 198  TYR A OH    1 
ATOM   1533 N  N     . LEU A 1 199 ? 21.195 -1.591  71.657 1.00 39.28 ? 199  LEU A N     1 
ATOM   1534 C  CA    . LEU A 1 199 ? 21.999 -2.422  70.780 1.00 37.96 ? 199  LEU A CA    1 
ATOM   1535 C  C     . LEU A 1 199 ? 23.256 -2.751  71.566 1.00 37.01 ? 199  LEU A C     1 
ATOM   1536 O  O     . LEU A 1 199 ? 23.828 -1.887  72.242 1.00 36.15 ? 199  LEU A O     1 
ATOM   1537 C  CB    . LEU A 1 199 ? 22.397 -1.658  69.526 1.00 40.31 ? 199  LEU A CB    1 
ATOM   1538 C  CG    . LEU A 1 199 ? 21.678 -2.090  68.257 1.00 41.60 ? 199  LEU A CG    1 
ATOM   1539 C  CD1   . LEU A 1 199 ? 21.953 -1.138  67.086 1.00 43.57 ? 199  LEU A CD1   1 
ATOM   1540 C  CD2   . LEU A 1 199 ? 22.100 -3.479  67.785 1.00 42.39 ? 199  LEU A CD2   1 
ATOM   1541 N  N     . MET A 1 200 ? 23.676 -3.979  71.489 1.00 36.71 ? 200  MET A N     1 
ATOM   1542 C  CA    . MET A 1 200 ? 24.847 -4.415  72.245 1.00 37.66 ? 200  MET A CA    1 
ATOM   1543 C  C     . MET A 1 200 ? 26.042 -4.636  71.322 1.00 36.99 ? 200  MET A C     1 
ATOM   1544 O  O     . MET A 1 200 ? 25.936 -5.309  70.290 1.00 36.07 ? 200  MET A O     1 
ATOM   1545 C  CB    . MET A 1 200 ? 24.519 -5.710  72.966 1.00 39.97 ? 200  MET A CB    1 
ATOM   1546 C  CG    . MET A 1 200 ? 25.580 -6.129  73.973 1.00 45.51 ? 200  MET A CG    1 
ATOM   1547 S  SD    . MET A 1 200 ? 25.210 -7.704  74.704 1.00 53.72 ? 200  MET A SD    1 
ATOM   1548 C  CE    . MET A 1 200 ? 26.184 -7.939  76.168 1.00 52.13 ? 200  MET A CE    1 
ATOM   1549 N  N     . ALA A 1 201 ? 27.150 -4.054  71.733 1.00 36.39 ? 201  ALA A N     1 
ATOM   1550 C  CA    . ALA A 1 201 ? 28.429 -4.168  71.021 1.00 35.37 ? 201  ALA A CA    1 
ATOM   1551 C  C     . ALA A 1 201 ? 29.477 -4.684  72.000 1.00 35.05 ? 201  ALA A C     1 
ATOM   1552 O  O     . ALA A 1 201 ? 29.463 -4.331  73.183 1.00 33.87 ? 201  ALA A O     1 
ATOM   1553 C  CB    . ALA A 1 201 ? 28.850 -2.801  70.479 1.00 34.24 ? 201  ALA A CB    1 
ATOM   1554 N  N     . LEU A 1 202 ? 30.379 -5.523  71.510 1.00 34.29 ? 202  LEU A N     1 
ATOM   1555 C  CA    . LEU A 1 202 ? 31.415 -6.093  72.359 1.00 33.06 ? 202  LEU A CA    1 
ATOM   1556 C  C     . LEU A 1 202 ? 32.790 -5.787  71.800 1.00 32.35 ? 202  LEU A C     1 
ATOM   1557 O  O     . LEU A 1 202 ? 32.972 -5.714  70.585 1.00 33.04 ? 202  LEU A O     1 
ATOM   1558 C  CB    . LEU A 1 202 ? 31.211 -7.609  72.472 1.00 32.27 ? 202  LEU A CB    1 
ATOM   1559 C  CG    . LEU A 1 202 ? 29.954 -8.024  73.248 1.00 32.11 ? 202  LEU A CG    1 
ATOM   1560 C  CD1   . LEU A 1 202 ? 29.526 -9.424  72.877 1.00 33.36 ? 202  LEU A CD1   1 
ATOM   1561 C  CD2   . LEU A 1 202 ? 30.233 -7.926  74.735 1.00 33.34 ? 202  LEU A CD2   1 
ATOM   1562 N  N     . GLY A 1 203 ? 33.755 -5.599  72.690 1.00 30.71 ? 203  GLY A N     1 
ATOM   1563 C  CA    . GLY A 1 203 ? 35.100 -5.307  72.243 1.00 31.61 ? 203  GLY A CA    1 
ATOM   1564 C  C     . GLY A 1 203 ? 36.151 -6.098  72.995 1.00 32.48 ? 203  GLY A C     1 
ATOM   1565 O  O     . GLY A 1 203 ? 36.003 -6.366  74.181 1.00 32.47 ? 203  GLY A O     1 
ATOM   1566 N  N     . SER A 1 204 ? 37.221 -6.474  72.304 1.00 33.39 ? 204  SER A N     1 
ATOM   1567 C  CA    . SER A 1 204 ? 38.299 -7.230  72.923 1.00 33.37 ? 204  SER A CA    1 
ATOM   1568 C  C     . SER A 1 204 ? 39.627 -6.850  72.298 1.00 33.41 ? 204  SER A C     1 
ATOM   1569 O  O     . SER A 1 204 ? 39.744 -6.760  71.075 1.00 31.97 ? 204  SER A O     1 
ATOM   1570 C  CB    . SER A 1 204 ? 38.070 -8.729  72.747 1.00 33.25 ? 204  SER A CB    1 
ATOM   1571 O  OG    . SER A 1 204 ? 39.165 -9.462  73.272 1.00 34.25 ? 204  SER A OG    1 
ATOM   1572 N  N     . GLN A 1 205 ? 40.626 -6.628  73.145 1.00 34.98 ? 205  GLN A N     1 
ATOM   1573 C  CA    . GLN A 1 205 ? 41.950 -6.255  72.672 1.00 38.28 ? 205  GLN A CA    1 
ATOM   1574 C  C     . GLN A 1 205 ? 43.059 -6.997  73.393 1.00 40.86 ? 205  GLN A C     1 
ATOM   1575 O  O     . GLN A 1 205 ? 43.173 -6.915  74.611 1.00 42.18 ? 205  GLN A O     1 
ATOM   1576 C  CB    . GLN A 1 205 ? 42.175 -4.751  72.837 1.00 36.83 ? 205  GLN A CB    1 
ATOM   1577 C  CG    . GLN A 1 205 ? 43.610 -4.319  72.591 1.00 37.38 ? 205  GLN A CG    1 
ATOM   1578 C  CD    . GLN A 1 205 ? 43.774 -2.813  72.581 1.00 39.43 ? 205  GLN A CD    1 
ATOM   1579 O  OE1   . GLN A 1 205 ? 43.327 -2.123  73.497 1.00 43.42 ? 205  GLN A OE1   1 
ATOM   1580 N  NE2   . GLN A 1 205 ? 44.424 -2.294  71.549 1.00 40.67 ? 205  GLN A NE2   1 
ATOM   1581 N  N     . ARG A 1 206 ? 43.882 -7.715  72.636 1.00 44.28 ? 206  ARG A N     1 
ATOM   1582 C  CA    . ARG A 1 206 ? 45.002 -8.444  73.211 1.00 47.35 ? 206  ARG A CA    1 
ATOM   1583 C  C     . ARG A 1 206 ? 46.244 -7.571  73.192 1.00 49.80 ? 206  ARG A C     1 
ATOM   1584 O  O     . ARG A 1 206 ? 46.812 -7.320  72.134 1.00 50.24 ? 206  ARG A O     1 
ATOM   1585 C  CB    . ARG A 1 206 ? 45.267 -9.731  72.433 1.00 47.03 ? 206  ARG A CB    1 
ATOM   1586 C  CG    . ARG A 1 206 ? 44.942 -10.954 73.253 1.00 49.94 ? 206  ARG A CG    1 
ATOM   1587 C  CD    . ARG A 1 206 ? 45.008 -12.242 72.480 1.00 52.54 ? 206  ARG A CD    1 
ATOM   1588 N  NE    . ARG A 1 206 ? 43.941 -13.130 72.925 1.00 55.44 ? 206  ARG A NE    1 
ATOM   1589 C  CZ    . ARG A 1 206 ? 43.805 -14.402 72.561 1.00 56.96 ? 206  ARG A CZ    1 
ATOM   1590 N  NH1   . ARG A 1 206 ? 44.679 -14.969 71.734 1.00 57.12 ? 206  ARG A NH1   1 
ATOM   1591 N  NH2   . ARG A 1 206 ? 42.777 -15.102 73.021 1.00 58.40 ? 206  ARG A NH2   1 
ATOM   1592 N  N     . THR A 1 207 ? 46.654 -7.093  74.364 1.00 53.76 ? 207  THR A N     1 
ATOM   1593 C  CA    . THR A 1 207 ? 47.845 -6.248  74.474 1.00 57.88 ? 207  THR A CA    1 
ATOM   1594 C  C     . THR A 1 207 ? 49.028 -7.114  74.899 1.00 59.64 ? 207  THR A C     1 
ATOM   1595 O  O     . THR A 1 207 ? 49.185 -7.449  76.075 1.00 60.83 ? 207  THR A O     1 
ATOM   1596 C  CB    . THR A 1 207 ? 47.661 -5.115  75.519 1.00 58.83 ? 207  THR A CB    1 
ATOM   1597 O  OG1   . THR A 1 207 ? 46.480 -4.359  75.212 1.00 60.14 ? 207  THR A OG1   1 
ATOM   1598 C  CG2   . THR A 1 207 ? 48.872 -4.180  75.507 1.00 58.76 ? 207  THR A CG2   1 
ATOM   1599 N  N     . ARG A 1 208 ? 49.858 -7.469  73.929 1.00 61.58 ? 208  ARG A N     1 
ATOM   1600 C  CA    . ARG A 1 208 ? 51.021 -8.315  74.164 1.00 63.78 ? 208  ARG A CA    1 
ATOM   1601 C  C     . ARG A 1 208 ? 52.205 -7.527  74.736 1.00 64.29 ? 208  ARG A C     1 
ATOM   1602 O  O     . ARG A 1 208 ? 52.369 -7.419  75.957 1.00 64.64 ? 208  ARG A O     1 
ATOM   1603 C  CB    . ARG A 1 208 ? 51.409 -8.988  72.845 1.00 64.76 ? 208  ARG A CB    1 
ATOM   1604 C  CG    . ARG A 1 208 ? 50.322 -8.839  71.774 1.00 66.62 ? 208  ARG A CG    1 
ATOM   1605 C  CD    . ARG A 1 208 ? 50.625 -9.621  70.508 1.00 68.10 ? 208  ARG A CD    1 
ATOM   1606 N  NE    . ARG A 1 208 ? 50.489 -11.062 70.701 1.00 70.07 ? 208  ARG A NE    1 
ATOM   1607 C  CZ    . ARG A 1 208 ? 49.334 -11.682 70.931 1.00 70.97 ? 208  ARG A CZ    1 
ATOM   1608 N  NH1   . ARG A 1 208 ? 48.205 -10.985 70.995 1.00 71.38 ? 208  ARG A NH1   1 
ATOM   1609 N  NH2   . ARG A 1 208 ? 49.307 -13.000 71.100 1.00 70.22 ? 208  ARG A NH2   1 
ATOM   1610 N  N     . GLY A 1 212 ? 56.189 -10.817 78.928 1.00 70.18 ? 212  GLY A N     1 
ATOM   1611 C  CA    . GLY A 1 212 ? 54.966 -10.429 78.249 1.00 70.38 ? 212  GLY A CA    1 
ATOM   1612 C  C     . GLY A 1 212 ? 53.957 -11.549 78.048 1.00 70.52 ? 212  GLY A C     1 
ATOM   1613 O  O     . GLY A 1 212 ? 54.154 -12.444 77.219 1.00 71.08 ? 212  GLY A O     1 
ATOM   1614 N  N     . SER A 1 213 ? 52.882 -11.499 78.831 1.00 69.90 ? 213  SER A N     1 
ATOM   1615 C  CA    . SER A 1 213 ? 51.784 -12.464 78.749 1.00 68.83 ? 213  SER A CA    1 
ATOM   1616 C  C     . SER A 1 213 ? 50.699 -11.675 78.006 1.00 67.36 ? 213  SER A C     1 
ATOM   1617 O  O     . SER A 1 213 ? 50.898 -10.488 77.722 1.00 67.49 ? 213  SER A O     1 
ATOM   1618 C  CB    . SER A 1 213 ? 51.321 -12.847 80.164 1.00 68.45 ? 213  SER A CB    1 
ATOM   1619 O  OG    . SER A 1 213 ? 50.117 -13.597 80.150 1.00 69.27 ? 213  SER A OG    1 
ATOM   1620 N  N     . VAL A 1 214 ? 49.574 -12.299 77.665 1.00 65.27 ? 214  VAL A N     1 
ATOM   1621 C  CA    . VAL A 1 214 ? 48.540 -11.535 76.969 1.00 63.25 ? 214  VAL A CA    1 
ATOM   1622 C  C     . VAL A 1 214 ? 47.487 -10.967 77.902 1.00 61.00 ? 214  VAL A C     1 
ATOM   1623 O  O     . VAL A 1 214 ? 46.595 -11.673 78.385 1.00 61.47 ? 214  VAL A O     1 
ATOM   1624 C  CB    . VAL A 1 214 ? 47.819 -12.348 75.857 1.00 64.07 ? 214  VAL A CB    1 
ATOM   1625 C  CG1   . VAL A 1 214 ? 48.802 -12.705 74.756 1.00 63.64 ? 214  VAL A CG1   1 
ATOM   1626 C  CG2   . VAL A 1 214 ? 47.157 -13.586 76.438 1.00 63.57 ? 214  VAL A CG2   1 
ATOM   1627 N  N     . VAL A 1 215 ? 47.616 -9.676  78.167 1.00 57.45 ? 215  VAL A N     1 
ATOM   1628 C  CA    . VAL A 1 215 ? 46.665 -8.974  79.004 1.00 54.28 ? 215  VAL A CA    1 
ATOM   1629 C  C     . VAL A 1 215 ? 45.519 -8.615  78.046 1.00 51.75 ? 215  VAL A C     1 
ATOM   1630 O  O     . VAL A 1 215 ? 45.675 -7.775  77.161 1.00 53.09 ? 215  VAL A O     1 
ATOM   1631 C  CB    . VAL A 1 215 ? 47.348 -7.718  79.637 1.00 53.69 ? 215  VAL A CB    1 
ATOM   1632 C  CG1   . VAL A 1 215 ? 48.427 -7.191  78.703 1.00 52.05 ? 215  VAL A CG1   1 
ATOM   1633 C  CG2   . VAL A 1 215 ? 46.317 -6.634  79.943 1.00 54.92 ? 215  VAL A CG2   1 
ATOM   1634 N  N     . THR A 1 216 ? 44.379 -9.280  78.201 1.00 47.62 ? 216  THR A N     1 
ATOM   1635 C  CA    . THR A 1 216 ? 43.236 -9.037  77.324 1.00 43.74 ? 216  THR A CA    1 
ATOM   1636 C  C     . THR A 1 216 ? 42.171 -8.118  77.924 1.00 42.05 ? 216  THR A C     1 
ATOM   1637 O  O     . THR A 1 216 ? 41.584 -8.442  78.952 1.00 42.20 ? 216  THR A O     1 
ATOM   1638 C  CB    . THR A 1 216 ? 42.559 -10.375 76.938 1.00 43.49 ? 216  THR A CB    1 
ATOM   1639 O  OG1   . THR A 1 216 ? 43.518 -11.224 76.295 1.00 42.37 ? 216  THR A OG1   1 
ATOM   1640 C  CG2   . THR A 1 216 ? 41.375 -10.140 75.998 1.00 42.54 ? 216  THR A CG2   1 
ATOM   1641 N  N     . GLN A 1 217 ? 41.920 -6.975  77.286 1.00 40.19 ? 217  GLN A N     1 
ATOM   1642 C  CA    . GLN A 1 217 ? 40.886 -6.057  77.764 1.00 39.33 ? 217  GLN A CA    1 
ATOM   1643 C  C     . GLN A 1 217 ? 39.587 -6.333  76.996 1.00 38.01 ? 217  GLN A C     1 
ATOM   1644 O  O     . GLN A 1 217 ? 39.572 -6.339  75.767 1.00 38.11 ? 217  GLN A O     1 
ATOM   1645 C  CB    . GLN A 1 217 ? 41.293 -4.589  77.556 1.00 41.60 ? 217  GLN A CB    1 
ATOM   1646 C  CG    . GLN A 1 217 ? 40.499 -3.607  78.448 1.00 44.73 ? 217  GLN A CG    1 
ATOM   1647 C  CD    . GLN A 1 217 ? 40.555 -2.132  78.000 1.00 47.45 ? 217  GLN A CD    1 
ATOM   1648 O  OE1   . GLN A 1 217 ? 41.470 -1.708  77.276 1.00 47.64 ? 217  GLN A OE1   1 
ATOM   1649 N  NE2   . GLN A 1 217 ? 39.576 -1.346  78.452 1.00 47.01 ? 217  GLN A NE2   1 
ATOM   1650 N  N     . ARG A 1 218 ? 38.503 -6.581  77.724 1.00 37.34 ? 218  ARG A N     1 
ATOM   1651 C  CA    . ARG A 1 218 ? 37.206 -6.845  77.110 1.00 37.27 ? 218  ARG A CA    1 
ATOM   1652 C  C     . ARG A 1 218 ? 36.205 -5.820  77.617 1.00 36.30 ? 218  ARG A C     1 
ATOM   1653 O  O     . ARG A 1 218 ? 36.246 -5.430  78.783 1.00 37.41 ? 218  ARG A O     1 
ATOM   1654 C  CB    . ARG A 1 218 ? 36.719 -8.259  77.452 1.00 38.58 ? 218  ARG A CB    1 
ATOM   1655 C  CG    . ARG A 1 218 ? 37.573 -9.363  76.860 1.00 41.04 ? 218  ARG A CG    1 
ATOM   1656 C  CD    . ARG A 1 218 ? 37.001 -10.736 77.167 1.00 44.73 ? 218  ARG A CD    1 
ATOM   1657 N  NE    . ARG A 1 218 ? 37.846 -11.789 76.615 1.00 49.09 ? 218  ARG A NE    1 
ATOM   1658 C  CZ    . ARG A 1 218 ? 38.575 -12.635 77.338 1.00 50.49 ? 218  ARG A CZ    1 
ATOM   1659 N  NH1   . ARG A 1 218 ? 38.559 -12.559 78.664 1.00 51.64 ? 218  ARG A NH1   1 
ATOM   1660 N  NH2   . ARG A 1 218 ? 39.332 -13.547 76.737 1.00 51.43 ? 218  ARG A NH2   1 
ATOM   1661 N  N     . ILE A 1 219 ? 35.309 -5.378  76.743 1.00 34.93 ? 219  ILE A N     1 
ATOM   1662 C  CA    . ILE A 1 219 ? 34.316 -4.392  77.128 1.00 33.91 ? 219  ILE A CA    1 
ATOM   1663 C  C     . ILE A 1 219 ? 32.979 -4.638  76.460 1.00 35.01 ? 219  ILE A C     1 
ATOM   1664 O  O     . ILE A 1 219 ? 32.885 -5.330  75.444 1.00 35.59 ? 219  ILE A O     1 
ATOM   1665 C  CB    . ILE A 1 219 ? 34.769 -2.978  76.753 1.00 32.27 ? 219  ILE A CB    1 
ATOM   1666 C  CG1   . ILE A 1 219 ? 34.926 -2.873  75.234 1.00 30.67 ? 219  ILE A CG1   1 
ATOM   1667 C  CG2   . ILE A 1 219 ? 36.074 -2.652  77.460 1.00 31.51 ? 219  ILE A CG2   1 
ATOM   1668 C  CD1   . ILE A 1 219 ? 35.238 -1.475  74.733 1.00 29.54 ? 219  ILE A CD1   1 
ATOM   1669 N  N     . ARG A 1 220 ? 31.940 -4.060  77.045 1.00 36.12 ? 220  ARG A N     1 
ATOM   1670 C  CA    . ARG A 1 220 ? 30.606 -4.179  76.495 1.00 38.02 ? 220  ARG A CA    1 
ATOM   1671 C  C     . ARG A 1 220 ? 30.029 -2.778  76.420 1.00 39.03 ? 220  ARG A C     1 
ATOM   1672 O  O     . ARG A 1 220 ? 30.295 -1.941  77.284 1.00 39.16 ? 220  ARG A O     1 
ATOM   1673 C  CB    . ARG A 1 220 ? 29.724 -5.048  77.383 1.00 38.66 ? 220  ARG A CB    1 
ATOM   1674 C  CG    . ARG A 1 220 ? 28.319 -5.208  76.845 1.00 41.33 ? 220  ARG A CG    1 
ATOM   1675 C  CD    . ARG A 1 220 ? 27.461 -5.930  77.835 1.00 42.85 ? 220  ARG A CD    1 
ATOM   1676 N  NE    . ARG A 1 220 ? 27.416 -5.224  79.103 1.00 47.39 ? 220  ARG A NE    1 
ATOM   1677 C  CZ    . ARG A 1 220 ? 27.178 -5.813  80.268 1.00 49.56 ? 220  ARG A CZ    1 
ATOM   1678 N  NH1   . ARG A 1 220 ? 26.965 -7.123  80.316 1.00 50.35 ? 220  ARG A NH1   1 
ATOM   1679 N  NH2   . ARG A 1 220 ? 27.160 -5.094  81.384 1.00 51.08 ? 220  ARG A NH2   1 
ATOM   1680 N  N     . MET A 1 221 ? 29.250 -2.526  75.377 1.00 40.72 ? 221  MET A N     1 
ATOM   1681 C  CA    . MET A 1 221 ? 28.631 -1.225  75.180 1.00 42.07 ? 221  MET A CA    1 
ATOM   1682 C  C     . MET A 1 221 ? 27.202 -1.398  74.736 1.00 41.94 ? 221  MET A C     1 
ATOM   1683 O  O     . MET A 1 221 ? 26.875 -2.315  73.976 1.00 41.99 ? 221  MET A O     1 
ATOM   1684 C  CB    . MET A 1 221 ? 29.385 -0.422  74.124 1.00 44.56 ? 221  MET A CB    1 
ATOM   1685 C  CG    . MET A 1 221 ? 30.762 0.013   74.556 1.00 47.68 ? 221  MET A CG    1 
ATOM   1686 S  SD    . MET A 1 221 ? 31.680 0.701   73.188 1.00 53.70 ? 221  MET A SD    1 
ATOM   1687 C  CE    . MET A 1 221 ? 32.136 -0.821  72.283 1.00 52.26 ? 221  MET A CE    1 
ATOM   1688 N  N     . GLU A 1 222 ? 26.352 -0.504  75.210 1.00 41.78 ? 222  GLU A N     1 
ATOM   1689 C  CA    . GLU A 1 222 ? 24.950 -0.550  74.866 1.00 42.71 ? 222  GLU A CA    1 
ATOM   1690 C  C     . GLU A 1 222 ? 24.561 0.829   74.367 1.00 42.04 ? 222  GLU A C     1 
ATOM   1691 O  O     . GLU A 1 222 ? 24.830 1.842   75.022 1.00 42.59 ? 222  GLU A O     1 
ATOM   1692 C  CB    . GLU A 1 222 ? 24.143 -0.955  76.100 1.00 44.76 ? 222  GLU A CB    1 
ATOM   1693 C  CG    . GLU A 1 222 ? 24.809 -2.101  76.855 1.00 49.21 ? 222  GLU A CG    1 
ATOM   1694 C  CD    . GLU A 1 222 ? 23.901 -2.779  77.855 1.00 52.14 ? 222  GLU A CD    1 
ATOM   1695 O  OE1   . GLU A 1 222 ? 23.481 -2.125  78.836 1.00 53.99 ? 222  GLU A OE1   1 
ATOM   1696 O  OE2   . GLU A 1 222 ? 23.609 -3.976  77.652 1.00 55.17 ? 222  GLU A OE2   1 
ATOM   1697 N  N     . MET A 1 223 ? 23.952 0.864   73.189 1.00 40.25 ? 223  MET A N     1 
ATOM   1698 C  CA    . MET A 1 223 ? 23.530 2.117   72.592 1.00 38.71 ? 223  MET A CA    1 
ATOM   1699 C  C     . MET A 1 223 ? 22.046 2.015   72.297 1.00 36.17 ? 223  MET A C     1 
ATOM   1700 O  O     . MET A 1 223 ? 21.578 0.975   71.851 1.00 35.32 ? 223  MET A O     1 
ATOM   1701 C  CB    . MET A 1 223 ? 24.303 2.353   71.297 1.00 42.28 ? 223  MET A CB    1 
ATOM   1702 C  CG    . MET A 1 223 ? 25.752 1.899   71.359 1.00 46.54 ? 223  MET A CG    1 
ATOM   1703 S  SD    . MET A 1 223 ? 26.020 0.370   70.425 1.00 51.33 ? 223  MET A SD    1 
ATOM   1704 C  CE    . MET A 1 223 ? 27.507 0.757   69.545 1.00 48.99 ? 223  MET A CE    1 
ATOM   1705 N  N     . HIS A 1 224 ? 21.291 3.075   72.548 1.00 33.47 ? 224  HIS A N     1 
ATOM   1706 C  CA    . HIS A 1 224 ? 19.868 2.995   72.269 1.00 32.32 ? 224  HIS A CA    1 
ATOM   1707 C  C     . HIS A 1 224 ? 19.647 3.016   70.760 1.00 32.07 ? 224  HIS A C     1 
ATOM   1708 O  O     . HIS A 1 224 ? 20.215 3.843   70.052 1.00 33.07 ? 224  HIS A O     1 
ATOM   1709 C  CB    . HIS A 1 224 ? 19.123 4.147   72.940 1.00 31.31 ? 224  HIS A CB    1 
ATOM   1710 C  CG    . HIS A 1 224 ? 17.634 4.036   72.837 1.00 30.49 ? 224  HIS A CG    1 
ATOM   1711 N  ND1   . HIS A 1 224 ? 16.939 4.385   71.701 1.00 31.19 ? 224  HIS A ND1   1 
ATOM   1712 C  CD2   . HIS A 1 224 ? 16.711 3.586   73.719 1.00 31.29 ? 224  HIS A CD2   1 
ATOM   1713 C  CE1   . HIS A 1 224 ? 15.650 4.155   71.886 1.00 31.50 ? 224  HIS A CE1   1 
ATOM   1714 N  NE2   . HIS A 1 224 ? 15.485 3.670   73.103 1.00 31.06 ? 224  HIS A NE2   1 
ATOM   1715 N  N     . LYS A 1 225 ? 18.839 2.091   70.261 1.00 31.87 ? 225  LYS A N     1 
ATOM   1716 C  CA    . LYS A 1 225 ? 18.571 2.035   68.830 1.00 32.30 ? 225  LYS A CA    1 
ATOM   1717 C  C     . LYS A 1 225 ? 17.816 3.276   68.366 1.00 31.84 ? 225  LYS A C     1 
ATOM   1718 O  O     . LYS A 1 225 ? 16.967 3.816   69.084 1.00 32.98 ? 225  LYS A O     1 
ATOM   1719 C  CB    . LYS A 1 225 ? 17.695 0.828   68.476 1.00 34.54 ? 225  LYS A CB    1 
ATOM   1720 C  CG    . LYS A 1 225 ? 18.298 -0.536  68.810 1.00 38.63 ? 225  LYS A CG    1 
ATOM   1721 C  CD    . LYS A 1 225 ? 17.457 -1.698  68.253 1.00 38.75 ? 225  LYS A CD    1 
ATOM   1722 C  CE    . LYS A 1 225 ? 16.611 -2.402  69.321 1.00 39.65 ? 225  LYS A CE    1 
ATOM   1723 N  NZ    . LYS A 1 225 ? 15.609 -3.320  68.754 1.00 39.04 ? 225  LYS A NZ    1 
ATOM   1724 N  N     . VAL A 1 226 ? 18.165 3.707   67.172 1.00 30.83 ? 226  VAL A N     1 
ATOM   1725 C  CA    . VAL A 1 226 ? 17.453 4.795   66.499 1.00 30.48 ? 226  VAL A CA    1 
ATOM   1726 C  C     . VAL A 1 226 ? 16.470 4.106   65.574 1.00 32.26 ? 226  VAL A C     1 
ATOM   1727 O  O     . VAL A 1 226 ? 16.815 3.136   64.893 1.00 32.64 ? 226  VAL A O     1 
ATOM   1728 C  CB    . VAL A 1 226 ? 18.423 5.684   65.721 1.00 29.42 ? 226  VAL A CB    1 
ATOM   1729 C  CG1   . VAL A 1 226 ? 17.728 6.870   65.044 1.00 29.97 ? 226  VAL A CG1   1 
ATOM   1730 C  CG2   . VAL A 1 226 ? 19.520 6.292   66.596 1.00 28.48 ? 226  VAL A CG2   1 
ATOM   1731 N  N     . ASP A 1 227 ? 15.262 4.586   65.555 1.00 33.86 ? 227  ASP A N     1 
ATOM   1732 C  CA    . ASP A 1 227 ? 14.205 3.928   64.786 1.00 35.33 ? 227  ASP A CA    1 
ATOM   1733 C  C     . ASP A 1 227 ? 14.247 4.265   63.296 1.00 34.01 ? 227  ASP A C     1 
ATOM   1734 O  O     . ASP A 1 227 ? 13.402 4.997   62.782 1.00 34.95 ? 227  ASP A O     1 
ATOM   1735 C  CB    . ASP A 1 227 ? 12.847 4.329   65.356 1.00 40.19 ? 227  ASP A CB    1 
ATOM   1736 C  CG    . ASP A 1 227 ? 11.674 3.674   64.636 1.00 44.11 ? 227  ASP A CG    1 
ATOM   1737 O  OD1   . ASP A 1 227 ? 11.714 2.422   64.337 1.00 46.36 ? 227  ASP A OD1   1 
ATOM   1738 O  OD2   . ASP A 1 227 ? 10.647 4.386   64.326 1.00 47.05 ? 227  ASP A OD2   1 
ATOM   1739 N  N     . ALA A 1 228 ? 15.239 3.717   62.607 1.00 31.30 ? 228  ALA A N     1 
ATOM   1740 C  CA    . ALA A 1 228 ? 15.399 3.943   61.178 1.00 29.23 ? 228  ALA A CA    1 
ATOM   1741 C  C     . ALA A 1 228 ? 16.527 3.072   60.651 1.00 28.11 ? 228  ALA A C     1 
ATOM   1742 O  O     . ALA A 1 228 ? 17.332 2.551   61.424 1.00 28.47 ? 228  ALA A O     1 
ATOM   1743 C  CB    . ALA A 1 228 ? 15.708 5.404   60.914 1.00 28.75 ? 228  ALA A CB    1 
ATOM   1744 N  N     . VAL A 1 229 ? 16.577 2.913   59.333 1.00 26.78 ? 229  VAL A N     1 
ATOM   1745 C  CA    . VAL A 1 229 ? 17.619 2.113   58.705 1.00 26.34 ? 229  VAL A CA    1 
ATOM   1746 C  C     . VAL A 1 229 ? 18.629 3.036   58.031 1.00 25.05 ? 229  VAL A C     1 
ATOM   1747 O  O     . VAL A 1 229 ? 18.277 3.794   57.133 1.00 26.30 ? 229  VAL A O     1 
ATOM   1748 C  CB    . VAL A 1 229 ? 17.030 1.157   57.639 1.00 26.40 ? 229  VAL A CB    1 
ATOM   1749 C  CG1   . VAL A 1 229 ? 18.158 0.422   56.910 1.00 25.54 ? 229  VAL A CG1   1 
ATOM   1750 C  CG2   . VAL A 1 229 ? 16.081 0.168   58.302 1.00 24.80 ? 229  VAL A CG2   1 
ATOM   1751 N  N     . PHE A 1 230 ? 19.882 2.974   58.466 1.00 24.40 ? 230  PHE A N     1 
ATOM   1752 C  CA    . PHE A 1 230 ? 20.924 3.814   57.884 1.00 23.62 ? 230  PHE A CA    1 
ATOM   1753 C  C     . PHE A 1 230 ? 21.887 3.007   57.022 1.00 23.12 ? 230  PHE A C     1 
ATOM   1754 O  O     . PHE A 1 230 ? 21.978 1.784   57.136 1.00 24.47 ? 230  PHE A O     1 
ATOM   1755 C  CB    . PHE A 1 230 ? 21.718 4.528   58.986 1.00 22.99 ? 230  PHE A CB    1 
ATOM   1756 C  CG    . PHE A 1 230 ? 20.885 5.422   59.845 1.00 23.29 ? 230  PHE A CG    1 
ATOM   1757 C  CD1   . PHE A 1 230 ? 20.461 5.006   61.102 1.00 23.31 ? 230  PHE A CD1   1 
ATOM   1758 C  CD2   . PHE A 1 230 ? 20.505 6.678   59.387 1.00 22.90 ? 230  PHE A CD2   1 
ATOM   1759 C  CE1   . PHE A 1 230 ? 19.671 5.829   61.890 1.00 24.79 ? 230  PHE A CE1   1 
ATOM   1760 C  CE2   . PHE A 1 230 ? 19.716 7.509   60.165 1.00 23.92 ? 230  PHE A CE2   1 
ATOM   1761 C  CZ    . PHE A 1 230 ? 19.296 7.085   61.422 1.00 24.94 ? 230  PHE A CZ    1 
ATOM   1762 N  N     . VAL A 1 231 ? 22.604 3.703   56.152 1.00 21.47 ? 231  VAL A N     1 
ATOM   1763 C  CA    . VAL A 1 231 ? 23.587 3.062   55.292 1.00 18.52 ? 231  VAL A CA    1 
ATOM   1764 C  C     . VAL A 1 231 ? 24.903 3.810   55.468 1.00 18.47 ? 231  VAL A C     1 
ATOM   1765 O  O     . VAL A 1 231 ? 24.914 5.038   55.555 1.00 20.62 ? 231  VAL A O     1 
ATOM   1766 C  CB    . VAL A 1 231 ? 23.183 3.130   53.803 1.00 17.10 ? 231  VAL A CB    1 
ATOM   1767 C  CG1   . VAL A 1 231 ? 24.250 2.473   52.959 1.00 16.34 ? 231  VAL A CG1   1 
ATOM   1768 C  CG2   . VAL A 1 231 ? 21.853 2.445   53.582 1.00 16.03 ? 231  VAL A CG2   1 
ATOM   1769 N  N     . GLY A 1 232 ? 26.004 3.067   55.529 1.00 16.83 ? 232  GLY A N     1 
ATOM   1770 C  CA    . GLY A 1 232 ? 27.313 3.679   55.684 1.00 14.94 ? 232  GLY A CA    1 
ATOM   1771 C  C     . GLY A 1 232 ? 27.766 3.804   57.126 1.00 13.86 ? 232  GLY A C     1 
ATOM   1772 O  O     . GLY A 1 232 ? 28.897 4.200   57.412 1.00 11.77 ? 232  GLY A O     1 
ATOM   1773 N  N     . THR A 1 233 ? 26.881 3.459   58.047 1.00 14.69 ? 233  THR A N     1 
ATOM   1774 C  CA    . THR A 1 233 ? 27.207 3.558   59.460 1.00 15.01 ? 233  THR A CA    1 
ATOM   1775 C  C     . THR A 1 233 ? 28.380 2.662   59.831 1.00 16.14 ? 233  THR A C     1 
ATOM   1776 O  O     . THR A 1 233 ? 29.234 3.043   60.637 1.00 16.52 ? 233  THR A O     1 
ATOM   1777 C  CB    . THR A 1 233 ? 25.985 3.223   60.313 1.00 13.01 ? 233  THR A CB    1 
ATOM   1778 O  OG1   . THR A 1 233 ? 25.308 2.100   59.739 1.00 15.26 ? 233  THR A OG1   1 
ATOM   1779 C  CG2   . THR A 1 233 ? 25.040 4.414   60.354 1.00 11.97 ? 233  THR A CG2   1 
ATOM   1780 N  N     . GLY A 1 234 ? 28.437 1.480   59.232 1.00 16.13 ? 234  GLY A N     1 
ATOM   1781 C  CA    . GLY A 1 234 ? 29.534 0.581   59.527 1.00 15.84 ? 234  GLY A CA    1 
ATOM   1782 C  C     . GLY A 1 234 ? 30.854 1.147   59.040 1.00 15.99 ? 234  GLY A C     1 
ATOM   1783 O  O     . GLY A 1 234 ? 31.882 1.005   59.704 1.00 16.19 ? 234  GLY A O     1 
ATOM   1784 N  N     . ASP A 1 235 ? 30.835 1.785   57.873 1.00 16.18 ? 235  ASP A N     1 
ATOM   1785 C  CA    . ASP A 1 235 ? 32.051 2.372   57.317 1.00 16.20 ? 235  ASP A CA    1 
ATOM   1786 C  C     . ASP A 1 235 ? 32.509 3.535   58.213 1.00 16.61 ? 235  ASP A C     1 
ATOM   1787 O  O     . ASP A 1 235 ? 33.708 3.671   58.513 1.00 15.01 ? 235  ASP A O     1 
ATOM   1788 C  CB    . ASP A 1 235 ? 31.806 2.882   55.886 1.00 18.81 ? 235  ASP A CB    1 
ATOM   1789 C  CG    . ASP A 1 235 ? 31.271 1.799   54.945 1.00 20.85 ? 235  ASP A CG    1 
ATOM   1790 O  OD1   . ASP A 1 235 ? 31.874 0.701   54.865 1.00 22.26 ? 235  ASP A OD1   1 
ATOM   1791 O  OD2   . ASP A 1 235 ? 30.247 2.059   54.273 1.00 19.22 ? 235  ASP A OD2   1 
ATOM   1792 N  N     . LEU A 1 236 ? 31.551 4.368   58.633 1.00 14.74 ? 236  LEU A N     1 
ATOM   1793 C  CA    . LEU A 1 236 ? 31.850 5.497   59.504 1.00 13.38 ? 236  LEU A CA    1 
ATOM   1794 C  C     . LEU A 1 236 ? 32.444 4.980   60.818 1.00 14.20 ? 236  LEU A C     1 
ATOM   1795 O  O     . LEU A 1 236 ? 33.424 5.531   61.324 1.00 14.98 ? 236  LEU A O     1 
ATOM   1796 C  CB    . LEU A 1 236 ? 30.584 6.317   59.783 1.00 13.16 ? 236  LEU A CB    1 
ATOM   1797 C  CG    . LEU A 1 236 ? 30.717 7.469   60.795 1.00 11.00 ? 236  LEU A CG    1 
ATOM   1798 C  CD1   . LEU A 1 236 ? 31.723 8.483   60.295 1.00 7.28  ? 236  LEU A CD1   1 
ATOM   1799 C  CD2   . LEU A 1 236 ? 29.365 8.126   61.017 1.00 11.56 ? 236  LEU A CD2   1 
ATOM   1800 N  N     . PHE A 1 237 ? 31.856 3.918   61.362 1.00 13.70 ? 237  PHE A N     1 
ATOM   1801 C  CA    . PHE A 1 237 ? 32.345 3.323   62.601 1.00 13.60 ? 237  PHE A CA    1 
ATOM   1802 C  C     . PHE A 1 237 ? 33.830 2.949   62.495 1.00 13.40 ? 237  PHE A C     1 
ATOM   1803 O  O     . PHE A 1 237 ? 34.667 3.433   63.262 1.00 12.79 ? 237  PHE A O     1 
ATOM   1804 C  CB    . PHE A 1 237 ? 31.544 2.066   62.938 1.00 13.55 ? 237  PHE A CB    1 
ATOM   1805 C  CG    . PHE A 1 237 ? 31.871 1.484   64.291 1.00 17.21 ? 237  PHE A CG    1 
ATOM   1806 C  CD1   . PHE A 1 237 ? 31.166 1.884   65.425 1.00 17.49 ? 237  PHE A CD1   1 
ATOM   1807 C  CD2   . PHE A 1 237 ? 32.914 0.571   64.441 1.00 17.35 ? 237  PHE A CD2   1 
ATOM   1808 C  CE1   . PHE A 1 237 ? 31.495 1.389   66.683 1.00 17.26 ? 237  PHE A CE1   1 
ATOM   1809 C  CE2   . PHE A 1 237 ? 33.252 0.069   65.706 1.00 18.28 ? 237  PHE A CE2   1 
ATOM   1810 C  CZ    . PHE A 1 237 ? 32.542 0.479   66.825 1.00 16.35 ? 237  PHE A CZ    1 
ATOM   1811 N  N     . ALA A 1 238 ? 34.145 2.084   61.533 1.00 13.05 ? 238  ALA A N     1 
ATOM   1812 C  CA    . ALA A 1 238 ? 35.509 1.616   61.318 1.00 12.84 ? 238  ALA A CA    1 
ATOM   1813 C  C     . ALA A 1 238 ? 36.524 2.737   61.117 1.00 13.99 ? 238  ALA A C     1 
ATOM   1814 O  O     . ALA A 1 238 ? 37.658 2.647   61.599 1.00 15.69 ? 238  ALA A O     1 
ATOM   1815 C  CB    . ALA A 1 238 ? 35.540 0.671   60.137 1.00 10.28 ? 238  ALA A CB    1 
ATOM   1816 N  N     . ALA A 1 239 ? 36.121 3.787   60.402 1.00 14.94 ? 239  ALA A N     1 
ATOM   1817 C  CA    . ALA A 1 239 ? 37.009 4.924   60.142 1.00 14.77 ? 239  ALA A CA    1 
ATOM   1818 C  C     . ALA A 1 239 ? 37.331 5.699   61.418 1.00 14.71 ? 239  ALA A C     1 
ATOM   1819 O  O     . ALA A 1 239 ? 38.479 6.090   61.644 1.00 12.81 ? 239  ALA A O     1 
ATOM   1820 C  CB    . ALA A 1 239 ? 36.381 5.858   59.123 1.00 15.60 ? 239  ALA A CB    1 
ATOM   1821 N  N     . MET A 1 240 ? 36.318 5.924   62.250 1.00 13.95 ? 240  MET A N     1 
ATOM   1822 C  CA    . MET A 1 240 ? 36.531 6.647   63.488 1.00 14.98 ? 240  MET A CA    1 
ATOM   1823 C  C     . MET A 1 240 ? 37.279 5.803   64.519 1.00 15.68 ? 240  MET A C     1 
ATOM   1824 O  O     . MET A 1 240 ? 38.100 6.333   65.279 1.00 16.15 ? 240  MET A O     1 
ATOM   1825 C  CB    . MET A 1 240 ? 35.199 7.131   64.053 1.00 14.45 ? 240  MET A CB    1 
ATOM   1826 C  CG    . MET A 1 240 ? 34.563 8.222   63.219 1.00 14.29 ? 240  MET A CG    1 
ATOM   1827 S  SD    . MET A 1 240 ? 33.226 9.048   64.101 1.00 13.51 ? 240  MET A SD    1 
ATOM   1828 C  CE    . MET A 1 240 ? 31.919 7.845   64.008 1.00 12.46 ? 240  MET A CE    1 
ATOM   1829 N  N     . LEU A 1 241 ? 37.008 4.496   64.547 1.00 14.90 ? 241  LEU A N     1 
ATOM   1830 C  CA    . LEU A 1 241 ? 37.689 3.608   65.488 1.00 14.90 ? 241  LEU A CA    1 
ATOM   1831 C  C     . LEU A 1 241 ? 39.176 3.641   65.160 1.00 15.97 ? 241  LEU A C     1 
ATOM   1832 O  O     . LEU A 1 241 ? 40.029 3.579   66.047 1.00 15.64 ? 241  LEU A O     1 
ATOM   1833 C  CB    . LEU A 1 241 ? 37.158 2.174   65.374 1.00 14.54 ? 241  LEU A CB    1 
ATOM   1834 C  CG    . LEU A 1 241 ? 37.762 1.102   66.301 1.00 15.59 ? 241  LEU A CG    1 
ATOM   1835 C  CD1   . LEU A 1 241 ? 37.583 1.508   67.756 1.00 16.66 ? 241  LEU A CD1   1 
ATOM   1836 C  CD2   . LEU A 1 241 ? 37.096 -0.250  66.056 1.00 14.84 ? 241  LEU A CD2   1 
ATOM   1837 N  N     . LEU A 1 242 ? 39.483 3.752   63.875 1.00 16.00 ? 242  LEU A N     1 
ATOM   1838 C  CA    . LEU A 1 242 ? 40.873 3.802   63.456 1.00 15.95 ? 242  LEU A CA    1 
ATOM   1839 C  C     . LEU A 1 242 ? 41.539 5.014   64.105 1.00 16.66 ? 242  LEU A C     1 
ATOM   1840 O  O     . LEU A 1 242 ? 42.603 4.902   64.716 1.00 16.27 ? 242  LEU A O     1 
ATOM   1841 C  CB    . LEU A 1 242 ? 40.954 3.893   61.926 1.00 14.73 ? 242  LEU A CB    1 
ATOM   1842 C  CG    . LEU A 1 242 ? 42.329 3.793   61.257 1.00 13.90 ? 242  LEU A CG    1 
ATOM   1843 C  CD1   . LEU A 1 242 ? 42.113 3.627   59.776 1.00 16.21 ? 242  LEU A CD1   1 
ATOM   1844 C  CD2   . LEU A 1 242 ? 43.184 5.023   61.524 1.00 12.29 ? 242  LEU A CD2   1 
ATOM   1845 N  N     . ALA A 1 243 ? 40.896 6.168   63.979 1.00 16.86 ? 243  ALA A N     1 
ATOM   1846 C  CA    . ALA A 1 243 ? 41.432 7.407   64.527 1.00 18.11 ? 243  ALA A CA    1 
ATOM   1847 C  C     . ALA A 1 243 ? 41.613 7.369   66.038 1.00 19.22 ? 243  ALA A C     1 
ATOM   1848 O  O     . ALA A 1 243 ? 42.686 7.697   66.554 1.00 17.17 ? 243  ALA A O     1 
ATOM   1849 C  CB    . ALA A 1 243 ? 40.529 8.571   64.152 1.00 18.53 ? 243  ALA A CB    1 
ATOM   1850 N  N     . TRP A 1 244 ? 40.560 6.967   66.740 1.00 20.20 ? 244  TRP A N     1 
ATOM   1851 C  CA    . TRP A 1 244 ? 40.594 6.915   68.192 1.00 20.99 ? 244  TRP A CA    1 
ATOM   1852 C  C     . TRP A 1 244 ? 41.493 5.831   68.790 1.00 21.55 ? 244  TRP A C     1 
ATOM   1853 O  O     . TRP A 1 244 ? 42.016 6.001   69.892 1.00 21.73 ? 244  TRP A O     1 
ATOM   1854 C  CB    . TRP A 1 244 ? 39.166 6.819   68.724 1.00 21.01 ? 244  TRP A CB    1 
ATOM   1855 C  CG    . TRP A 1 244 ? 38.366 8.068   68.422 1.00 20.61 ? 244  TRP A CG    1 
ATOM   1856 C  CD1   . TRP A 1 244 ? 37.175 8.142   67.746 1.00 21.05 ? 244  TRP A CD1   1 
ATOM   1857 C  CD2   . TRP A 1 244 ? 38.701 9.418   68.789 1.00 19.27 ? 244  TRP A CD2   1 
ATOM   1858 N  NE1   . TRP A 1 244 ? 36.753 9.453   67.671 1.00 20.02 ? 244  TRP A NE1   1 
ATOM   1859 C  CE2   . TRP A 1 244 ? 37.671 10.254  68.299 1.00 19.23 ? 244  TRP A CE2   1 
ATOM   1860 C  CE3   . TRP A 1 244 ? 39.776 10.001  69.474 1.00 19.55 ? 244  TRP A CE3   1 
ATOM   1861 C  CZ2   . TRP A 1 244 ? 37.681 11.642  68.486 1.00 18.38 ? 244  TRP A CZ2   1 
ATOM   1862 C  CZ3   . TRP A 1 244 ? 39.782 11.384  69.657 1.00 18.27 ? 244  TRP A CZ3   1 
ATOM   1863 C  CH2   . TRP A 1 244 ? 38.742 12.185  69.160 1.00 16.54 ? 244  TRP A CH2   1 
ATOM   1864 N  N     . THR A 1 245 ? 41.693 4.725   68.086 1.00 21.08 ? 245  THR A N     1 
ATOM   1865 C  CA    . THR A 1 245 ? 42.581 3.706   68.625 1.00 21.27 ? 245  THR A CA    1 
ATOM   1866 C  C     . THR A 1 245 ? 44.017 4.200   68.460 1.00 22.51 ? 245  THR A C     1 
ATOM   1867 O  O     . THR A 1 245 ? 44.907 3.823   69.220 1.00 23.62 ? 245  THR A O     1 
ATOM   1868 C  CB    . THR A 1 245 ? 42.418 2.344   67.913 1.00 21.49 ? 245  THR A CB    1 
ATOM   1869 O  OG1   . THR A 1 245 ? 42.608 2.504   66.504 1.00 21.50 ? 245  THR A OG1   1 
ATOM   1870 C  CG2   . THR A 1 245 ? 41.034 1.768   68.183 1.00 21.02 ? 245  THR A CG2   1 
ATOM   1871 N  N     . HIS A 1 246 ? 44.237 5.056   67.469 1.00 23.06 ? 246  HIS A N     1 
ATOM   1872 C  CA    . HIS A 1 246 ? 45.564 5.595   67.229 1.00 24.40 ? 246  HIS A CA    1 
ATOM   1873 C  C     . HIS A 1 246 ? 45.952 6.519   68.387 1.00 26.20 ? 246  HIS A C     1 
ATOM   1874 O  O     . HIS A 1 246 ? 47.100 6.542   68.826 1.00 25.38 ? 246  HIS A O     1 
ATOM   1875 C  CB    . HIS A 1 246 ? 45.591 6.372   65.903 1.00 23.08 ? 246  HIS A CB    1 
ATOM   1876 C  CG    . HIS A 1 246 ? 46.849 7.157   65.693 1.00 21.15 ? 246  HIS A CG    1 
ATOM   1877 N  ND1   . HIS A 1 246 ? 48.032 6.574   65.295 1.00 19.72 ? 246  HIS A ND1   1 
ATOM   1878 C  CD2   . HIS A 1 246 ? 47.134 8.459   65.929 1.00 20.32 ? 246  HIS A CD2   1 
ATOM   1879 C  CE1   . HIS A 1 246 ? 48.993 7.480   65.303 1.00 20.50 ? 246  HIS A CE1   1 
ATOM   1880 N  NE2   . HIS A 1 246 ? 48.475 8.633   65.685 1.00 21.49 ? 246  HIS A NE2   1 
ATOM   1881 N  N     . LYS A 1 247 ? 44.985 7.278   68.883 1.00 29.48 ? 247  LYS A N     1 
ATOM   1882 C  CA    . LYS A 1 247 ? 45.244 8.201   69.979 1.00 33.88 ? 247  LYS A CA    1 
ATOM   1883 C  C     . LYS A 1 247 ? 45.332 7.463   71.318 1.00 34.90 ? 247  LYS A C     1 
ATOM   1884 O  O     . LYS A 1 247 ? 46.113 7.828   72.196 1.00 34.12 ? 247  LYS A O     1 
ATOM   1885 C  CB    . LYS A 1 247 ? 44.138 9.252   70.051 1.00 36.34 ? 247  LYS A CB    1 
ATOM   1886 C  CG    . LYS A 1 247 ? 44.645 10.624  70.450 1.00 42.00 ? 247  LYS A CG    1 
ATOM   1887 C  CD    . LYS A 1 247 ? 43.512 11.517  70.930 1.00 46.78 ? 247  LYS A CD    1 
ATOM   1888 C  CE    . LYS A 1 247 ? 43.926 12.984  70.986 1.00 48.22 ? 247  LYS A CE    1 
ATOM   1889 N  NZ    . LYS A 1 247 ? 42.801 13.836  71.476 1.00 49.68 ? 247  LYS A NZ    1 
ATOM   1890 N  N     . HIS A 1 248 ? 44.521 6.425   71.465 1.00 35.01 ? 248  HIS A N     1 
ATOM   1891 C  CA    . HIS A 1 248 ? 44.506 5.644   72.682 1.00 35.86 ? 248  HIS A CA    1 
ATOM   1892 C  C     . HIS A 1 248 ? 44.868 4.222   72.287 1.00 37.53 ? 248  HIS A C     1 
ATOM   1893 O  O     . HIS A 1 248 ? 44.046 3.312   72.360 1.00 37.26 ? 248  HIS A O     1 
ATOM   1894 C  CB    . HIS A 1 248 ? 43.111 5.707   73.300 1.00 37.37 ? 248  HIS A CB    1 
ATOM   1895 C  CG    . HIS A 1 248 ? 42.612 7.103   73.508 1.00 38.47 ? 248  HIS A CG    1 
ATOM   1896 N  ND1   . HIS A 1 248 ? 43.194 7.977   74.402 1.00 40.67 ? 248  HIS A ND1   1 
ATOM   1897 C  CD2   . HIS A 1 248 ? 41.602 7.790   72.919 1.00 39.29 ? 248  HIS A CD2   1 
ATOM   1898 C  CE1   . HIS A 1 248 ? 42.566 9.140   74.355 1.00 40.25 ? 248  HIS A CE1   1 
ATOM   1899 N  NE2   . HIS A 1 248 ? 41.595 9.052   73.462 1.00 40.18 ? 248  HIS A NE2   1 
ATOM   1900 N  N     . PRO A 1 249 ? 46.123 4.016   71.862 1.00 38.58 ? 249  PRO A N     1 
ATOM   1901 C  CA    . PRO A 1 249 ? 46.650 2.717   71.431 1.00 39.33 ? 249  PRO A CA    1 
ATOM   1902 C  C     . PRO A 1 249 ? 46.460 1.543   72.387 1.00 40.07 ? 249  PRO A C     1 
ATOM   1903 O  O     . PRO A 1 249 ? 46.290 0.401   71.948 1.00 40.56 ? 249  PRO A O     1 
ATOM   1904 C  CB    . PRO A 1 249 ? 48.125 3.017   71.157 1.00 38.97 ? 249  PRO A CB    1 
ATOM   1905 C  CG    . PRO A 1 249 ? 48.424 4.162   72.082 1.00 37.92 ? 249  PRO A CG    1 
ATOM   1906 C  CD    . PRO A 1 249 ? 47.200 5.020   71.913 1.00 38.79 ? 249  PRO A CD    1 
ATOM   1907 N  N     . ASN A 1 250 ? 46.479 1.811   73.688 1.00 39.97 ? 250  ASN A N     1 
ATOM   1908 C  CA    . ASN A 1 250 ? 46.321 0.725   74.650 1.00 41.16 ? 250  ASN A CA    1 
ATOM   1909 C  C     . ASN A 1 250 ? 45.045 0.786   75.457 1.00 40.32 ? 250  ASN A C     1 
ATOM   1910 O  O     . ASN A 1 250 ? 44.869 0.019   76.397 1.00 41.65 ? 250  ASN A O     1 
ATOM   1911 C  CB    . ASN A 1 250 ? 47.514 0.690   75.603 1.00 42.98 ? 250  ASN A CB    1 
ATOM   1912 C  CG    . ASN A 1 250 ? 48.792 0.271   74.911 1.00 45.21 ? 250  ASN A CG    1 
ATOM   1913 O  OD1   . ASN A 1 250 ? 48.890 -0.842  74.385 1.00 44.93 ? 250  ASN A OD1   1 
ATOM   1914 N  ND2   . ASN A 1 250 ? 49.781 1.163   74.899 1.00 46.35 ? 250  ASN A ND2   1 
ATOM   1915 N  N     . ASN A 1 251 ? 44.144 1.685   75.094 1.00 38.95 ? 251  ASN A N     1 
ATOM   1916 C  CA    . ASN A 1 251 ? 42.903 1.802   75.837 1.00 36.30 ? 251  ASN A CA    1 
ATOM   1917 C  C     . ASN A 1 251 ? 41.674 1.640   74.951 1.00 35.56 ? 251  ASN A C     1 
ATOM   1918 O  O     . ASN A 1 251 ? 41.081 2.625   74.514 1.00 35.87 ? 251  ASN A O     1 
ATOM   1919 C  CB    . ASN A 1 251 ? 42.855 3.151   76.532 1.00 35.08 ? 251  ASN A CB    1 
ATOM   1920 C  CG    . ASN A 1 251 ? 41.898 3.156   77.688 1.00 35.52 ? 251  ASN A CG    1 
ATOM   1921 O  OD1   . ASN A 1 251 ? 40.889 2.449   77.674 1.00 36.52 ? 251  ASN A OD1   1 
ATOM   1922 N  ND2   . ASN A 1 251 ? 42.198 3.960   78.700 1.00 35.70 ? 251  ASN A ND2   1 
ATOM   1923 N  N     . LEU A 1 252 ? 41.286 0.395   74.697 1.00 33.91 ? 252  LEU A N     1 
ATOM   1924 C  CA    . LEU A 1 252 ? 40.133 0.127   73.851 1.00 31.40 ? 252  LEU A CA    1 
ATOM   1925 C  C     . LEU A 1 252 ? 38.870 0.744   74.433 1.00 31.49 ? 252  LEU A C     1 
ATOM   1926 O  O     . LEU A 1 252 ? 37.960 1.112   73.690 1.00 31.47 ? 252  LEU A O     1 
ATOM   1927 C  CB    . LEU A 1 252 ? 39.928 -1.381  73.681 1.00 29.13 ? 252  LEU A CB    1 
ATOM   1928 C  CG    . LEU A 1 252 ? 38.780 -1.790  72.752 1.00 27.70 ? 252  LEU A CG    1 
ATOM   1929 C  CD1   . LEU A 1 252 ? 39.097 -1.349  71.334 1.00 27.69 ? 252  LEU A CD1   1 
ATOM   1930 C  CD2   . LEU A 1 252 ? 38.567 -3.289  72.806 1.00 25.30 ? 252  LEU A CD2   1 
ATOM   1931 N  N     . LYS A 1 253 ? 38.816 0.857   75.760 1.00 31.47 ? 253  LYS A N     1 
ATOM   1932 C  CA    . LYS A 1 253 ? 37.643 1.422   76.429 1.00 30.14 ? 253  LYS A CA    1 
ATOM   1933 C  C     . LYS A 1 253 ? 37.345 2.849   75.974 1.00 28.43 ? 253  LYS A C     1 
ATOM   1934 O  O     . LYS A 1 253 ? 36.228 3.158   75.554 1.00 26.20 ? 253  LYS A O     1 
ATOM   1935 C  CB    . LYS A 1 253 ? 37.824 1.405   77.952 1.00 29.98 ? 253  LYS A CB    1 
ATOM   1936 C  CG    . LYS A 1 253 ? 36.619 1.964   78.705 1.00 30.85 ? 253  LYS A CG    1 
ATOM   1937 C  CD    . LYS A 1 253 ? 36.722 1.772   80.212 1.00 31.36 ? 253  LYS A CD    1 
ATOM   1938 C  CE    . LYS A 1 253 ? 35.516 2.369   80.935 1.00 31.46 ? 253  LYS A CE    1 
ATOM   1939 N  NZ    . LYS A 1 253 ? 35.460 3.861   80.829 1.00 30.85 ? 253  LYS A NZ    1 
ATOM   1940 N  N     . VAL A 1 254 ? 38.350 3.714   76.062 1.00 26.61 ? 254  VAL A N     1 
ATOM   1941 C  CA    . VAL A 1 254 ? 38.199 5.109   75.671 1.00 24.76 ? 254  VAL A CA    1 
ATOM   1942 C  C     . VAL A 1 254 ? 37.969 5.234   74.169 1.00 24.88 ? 254  VAL A C     1 
ATOM   1943 O  O     . VAL A 1 254 ? 37.105 5.998   73.725 1.00 24.00 ? 254  VAL A O     1 
ATOM   1944 C  CB    . VAL A 1 254 ? 39.445 5.913   76.064 1.00 22.94 ? 254  VAL A CB    1 
ATOM   1945 C  CG1   . VAL A 1 254 ? 39.310 7.357   75.617 1.00 21.35 ? 254  VAL A CG1   1 
ATOM   1946 C  CG2   . VAL A 1 254 ? 39.633 5.834   77.558 1.00 21.99 ? 254  VAL A CG2   1 
ATOM   1947 N  N     . ALA A 1 255 ? 38.742 4.476   73.395 1.00 24.41 ? 255  ALA A N     1 
ATOM   1948 C  CA    . ALA A 1 255 ? 38.635 4.489   71.941 1.00 23.72 ? 255  ALA A CA    1 
ATOM   1949 C  C     . ALA A 1 255 ? 37.202 4.187   71.499 1.00 23.69 ? 255  ALA A C     1 
ATOM   1950 O  O     . ALA A 1 255 ? 36.655 4.862   70.621 1.00 23.18 ? 255  ALA A O     1 
ATOM   1951 C  CB    . ALA A 1 255 ? 39.603 3.469   71.339 1.00 23.69 ? 255  ALA A CB    1 
ATOM   1952 N  N     . CYS A 1 256 ? 36.591 3.176   72.108 1.00 23.28 ? 256  CYS A N     1 
ATOM   1953 C  CA    . CYS A 1 256 ? 35.227 2.819   71.757 1.00 23.58 ? 256  CYS A CA    1 
ATOM   1954 C  C     . CYS A 1 256 ? 34.202 3.806   72.279 1.00 23.72 ? 256  CYS A C     1 
ATOM   1955 O  O     . CYS A 1 256 ? 33.176 4.016   71.637 1.00 23.91 ? 256  CYS A O     1 
ATOM   1956 C  CB    . CYS A 1 256 ? 34.892 1.415   72.252 1.00 25.18 ? 256  CYS A CB    1 
ATOM   1957 S  SG    . CYS A 1 256 ? 35.406 0.124   71.105 1.00 27.94 ? 256  CYS A SG    1 
ATOM   1958 N  N     . GLU A 1 257 ? 34.468 4.414   73.436 1.00 24.28 ? 257  GLU A N     1 
ATOM   1959 C  CA    . GLU A 1 257 ? 33.534 5.386   74.001 1.00 24.25 ? 257  GLU A CA    1 
ATOM   1960 C  C     . GLU A 1 257 ? 33.469 6.643   73.143 1.00 23.34 ? 257  GLU A C     1 
ATOM   1961 O  O     . GLU A 1 257 ? 32.391 7.199   72.939 1.00 23.55 ? 257  GLU A O     1 
ATOM   1962 C  CB    . GLU A 1 257 ? 33.914 5.742   75.442 1.00 25.90 ? 257  GLU A CB    1 
ATOM   1963 C  CG    . GLU A 1 257 ? 33.842 4.549   76.378 1.00 29.39 ? 257  GLU A CG    1 
ATOM   1964 C  CD    . GLU A 1 257 ? 34.056 4.905   77.834 1.00 30.33 ? 257  GLU A CD    1 
ATOM   1965 O  OE1   . GLU A 1 257 ? 34.857 5.818   78.117 1.00 31.41 ? 257  GLU A OE1   1 
ATOM   1966 O  OE2   . GLU A 1 257 ? 33.431 4.251   78.699 1.00 32.28 ? 257  GLU A OE2   1 
ATOM   1967 N  N     . LYS A 1 258 ? 34.609 7.099   72.634 1.00 22.19 ? 258  LYS A N     1 
ATOM   1968 C  CA    . LYS A 1 258 ? 34.597 8.278   71.771 1.00 20.92 ? 258  LYS A CA    1 
ATOM   1969 C  C     . LYS A 1 258 ? 33.968 7.899   70.426 1.00 19.75 ? 258  LYS A C     1 
ATOM   1970 O  O     . LYS A 1 258 ? 33.175 8.654   69.865 1.00 19.07 ? 258  LYS A O     1 
ATOM   1971 C  CB    . LYS A 1 258 ? 36.020 8.832   71.565 1.00 20.01 ? 258  LYS A CB    1 
ATOM   1972 C  CG    . LYS A 1 258 ? 36.511 9.703   72.725 1.00 20.85 ? 258  LYS A CG    1 
ATOM   1973 C  CD    . LYS A 1 258 ? 37.867 10.334  72.462 1.00 21.47 ? 258  LYS A CD    1 
ATOM   1974 C  CE    . LYS A 1 258 ? 38.278 11.256  73.602 1.00 23.17 ? 258  LYS A CE    1 
ATOM   1975 N  NZ    . LYS A 1 258 ? 39.636 11.864  73.394 1.00 26.82 ? 258  LYS A NZ    1 
ATOM   1976 N  N     . THR A 1 259 ? 34.299 6.712   69.929 1.00 18.15 ? 259  THR A N     1 
ATOM   1977 C  CA    . THR A 1 259 ? 33.767 6.249   68.651 1.00 16.96 ? 259  THR A CA    1 
ATOM   1978 C  C     . THR A 1 259 ? 32.247 6.120   68.666 1.00 17.45 ? 259  THR A C     1 
ATOM   1979 O  O     . THR A 1 259 ? 31.555 6.612   67.769 1.00 17.31 ? 259  THR A O     1 
ATOM   1980 C  CB    . THR A 1 259 ? 34.388 4.890   68.263 1.00 17.15 ? 259  THR A CB    1 
ATOM   1981 O  OG1   . THR A 1 259 ? 35.806 5.046   68.138 1.00 15.65 ? 259  THR A OG1   1 
ATOM   1982 C  CG2   . THR A 1 259 ? 33.818 4.383   66.945 1.00 13.97 ? 259  THR A CG2   1 
ATOM   1983 N  N     . VAL A 1 260 ? 31.731 5.460   69.690 1.00 15.86 ? 260  VAL A N     1 
ATOM   1984 C  CA    . VAL A 1 260 ? 30.302 5.270   69.801 1.00 15.14 ? 260  VAL A CA    1 
ATOM   1985 C  C     . VAL A 1 260 ? 29.578 6.572   70.145 1.00 14.83 ? 260  VAL A C     1 
ATOM   1986 O  O     . VAL A 1 260 ? 28.435 6.768   69.741 1.00 15.88 ? 260  VAL A O     1 
ATOM   1987 C  CB    . VAL A 1 260 ? 29.998 4.180   70.842 1.00 16.31 ? 260  VAL A CB    1 
ATOM   1988 C  CG1   . VAL A 1 260 ? 28.512 4.078   71.086 1.00 18.56 ? 260  VAL A CG1   1 
ATOM   1989 C  CG2   . VAL A 1 260 ? 30.516 2.858   70.335 1.00 17.59 ? 260  VAL A CG2   1 
ATOM   1990 N  N     . SER A 1 261 ? 30.233 7.466   70.881 1.00 13.37 ? 261  SER A N     1 
ATOM   1991 C  CA    . SER A 1 261 ? 29.599 8.735   71.219 1.00 12.48 ? 261  SER A CA    1 
ATOM   1992 C  C     . SER A 1 261 ? 29.344 9.525   69.942 1.00 12.85 ? 261  SER A C     1 
ATOM   1993 O  O     . SER A 1 261 ? 28.238 10.022  69.736 1.00 11.81 ? 261  SER A O     1 
ATOM   1994 C  CB    . SER A 1 261 ? 30.476 9.556   72.165 1.00 13.22 ? 261  SER A CB    1 
ATOM   1995 O  OG    . SER A 1 261 ? 30.402 9.065   73.489 1.00 12.49 ? 261  SER A OG    1 
ATOM   1996 N  N     . ALA A 1 262 ? 30.371 9.627   69.094 1.00 13.03 ? 262  ALA A N     1 
ATOM   1997 C  CA    . ALA A 1 262 ? 30.287 10.339  67.817 1.00 13.43 ? 262  ALA A CA    1 
ATOM   1998 C  C     . ALA A 1 262 ? 29.146 9.767   66.983 1.00 15.49 ? 262  ALA A C     1 
ATOM   1999 O  O     . ALA A 1 262 ? 28.329 10.496  66.418 1.00 14.81 ? 262  ALA A O     1 
ATOM   2000 C  CB    . ALA A 1 262 ? 31.593 10.191  67.065 1.00 12.99 ? 262  ALA A CB    1 
ATOM   2001 N  N     . MET A 1 263 ? 29.111 8.444   66.917 1.00 18.52 ? 263  MET A N     1 
ATOM   2002 C  CA    . MET A 1 263 ? 28.092 7.701   66.190 1.00 20.34 ? 263  MET A CA    1 
ATOM   2003 C  C     . MET A 1 263 ? 26.702 8.207   66.614 1.00 20.07 ? 263  MET A C     1 
ATOM   2004 O  O     . MET A 1 263 ? 25.834 8.470   65.782 1.00 18.85 ? 263  MET A O     1 
ATOM   2005 C  CB    . MET A 1 263 ? 28.268 6.221   66.536 1.00 23.38 ? 263  MET A CB    1 
ATOM   2006 C  CG    . MET A 1 263 ? 28.118 5.220   65.391 1.00 29.43 ? 263  MET A CG    1 
ATOM   2007 S  SD    . MET A 1 263 ? 28.872 5.659   63.816 1.00 29.26 ? 263  MET A SD    1 
ATOM   2008 C  CE    . MET A 1 263 ? 27.374 5.785   62.896 1.00 30.85 ? 263  MET A CE    1 
ATOM   2009 N  N     . HIS A 1 264 ? 26.506 8.354   67.920 1.00 19.99 ? 264  HIS A N     1 
ATOM   2010 C  CA    . HIS A 1 264 ? 25.237 8.819   68.469 1.00 18.82 ? 264  HIS A CA    1 
ATOM   2011 C  C     . HIS A 1 264 ? 24.887 10.235  67.985 1.00 18.47 ? 264  HIS A C     1 
ATOM   2012 O  O     . HIS A 1 264 ? 23.779 10.495  67.507 1.00 15.40 ? 264  HIS A O     1 
ATOM   2013 C  CB    . HIS A 1 264 ? 25.311 8.771   69.999 1.00 19.28 ? 264  HIS A CB    1 
ATOM   2014 C  CG    . HIS A 1 264 ? 24.076 9.263   70.687 1.00 21.26 ? 264  HIS A CG    1 
ATOM   2015 N  ND1   . HIS A 1 264 ? 23.942 10.557  71.145 1.00 20.43 ? 264  HIS A ND1   1 
ATOM   2016 C  CD2   . HIS A 1 264 ? 22.907 8.640   70.970 1.00 22.37 ? 264  HIS A CD2   1 
ATOM   2017 C  CE1   . HIS A 1 264 ? 22.743 10.711  71.678 1.00 21.52 ? 264  HIS A CE1   1 
ATOM   2018 N  NE2   . HIS A 1 264 ? 22.095 9.564   71.585 1.00 23.70 ? 264  HIS A NE2   1 
ATOM   2019 N  N     . HIS A 1 265 ? 25.844 11.146  68.096 1.00 17.70 ? 265  HIS A N     1 
ATOM   2020 C  CA    . HIS A 1 265 ? 25.610 12.513  67.692 1.00 17.65 ? 265  HIS A CA    1 
ATOM   2021 C  C     . HIS A 1 265 ? 25.256 12.599  66.213 1.00 17.90 ? 265  HIS A C     1 
ATOM   2022 O  O     . HIS A 1 265 ? 24.294 13.284  65.824 1.00 18.80 ? 265  HIS A O     1 
ATOM   2023 C  CB    . HIS A 1 265 ? 26.836 13.372  68.030 1.00 18.91 ? 265  HIS A CB    1 
ATOM   2024 C  CG    . HIS A 1 265 ? 27.154 13.407  69.497 1.00 19.91 ? 265  HIS A CG    1 
ATOM   2025 N  ND1   . HIS A 1 265 ? 26.211 13.719  70.452 1.00 19.99 ? 265  HIS A ND1   1 
ATOM   2026 C  CD2   . HIS A 1 265 ? 28.294 13.124  70.172 1.00 19.82 ? 265  HIS A CD2   1 
ATOM   2027 C  CE1   . HIS A 1 265 ? 26.753 13.620  71.654 1.00 18.67 ? 265  HIS A CE1   1 
ATOM   2028 N  NE2   . HIS A 1 265 ? 28.016 13.260  71.511 1.00 20.00 ? 265  HIS A NE2   1 
ATOM   2029 N  N     . VAL A 1 266 ? 26.007 11.896  65.378 1.00 16.34 ? 266  VAL A N     1 
ATOM   2030 C  CA    . VAL A 1 266 ? 25.713 11.936  63.950 1.00 15.86 ? 266  VAL A CA    1 
ATOM   2031 C  C     . VAL A 1 266 ? 24.331 11.369  63.618 1.00 16.20 ? 266  VAL A C     1 
ATOM   2032 O  O     . VAL A 1 266 ? 23.594 11.946  62.833 1.00 17.04 ? 266  VAL A O     1 
ATOM   2033 C  CB    . VAL A 1 266 ? 26.771 11.181  63.135 1.00 14.58 ? 266  VAL A CB    1 
ATOM   2034 C  CG1   . VAL A 1 266 ? 26.371 11.164  61.676 1.00 12.97 ? 266  VAL A CG1   1 
ATOM   2035 C  CG2   . VAL A 1 266 ? 28.124 11.858  63.299 1.00 13.26 ? 266  VAL A CG2   1 
ATOM   2036 N  N     . LEU A 1 267 ? 23.979 10.243  64.219 1.00 16.73 ? 267  LEU A N     1 
ATOM   2037 C  CA    . LEU A 1 267 ? 22.684 9.640   63.963 1.00 17.05 ? 267  LEU A CA    1 
ATOM   2038 C  C     . LEU A 1 267 ? 21.530 10.491  64.481 1.00 18.24 ? 267  LEU A C     1 
ATOM   2039 O  O     . LEU A 1 267 ? 20.497 10.606  63.823 1.00 17.47 ? 267  LEU A O     1 
ATOM   2040 C  CB    . LEU A 1 267 ? 22.631 8.234   64.570 1.00 17.43 ? 267  LEU A CB    1 
ATOM   2041 C  CG    . LEU A 1 267 ? 23.610 7.251   63.910 1.00 17.67 ? 267  LEU A CG    1 
ATOM   2042 C  CD1   . LEU A 1 267 ? 23.437 5.859   64.489 1.00 17.96 ? 267  LEU A CD1   1 
ATOM   2043 C  CD2   . LEU A 1 267 ? 23.360 7.222   62.408 1.00 15.96 ? 267  LEU A CD2   1 
ATOM   2044 N  N     . GLN A 1 268 ? 21.697 11.100  65.651 1.00 18.93 ? 268  GLN A N     1 
ATOM   2045 C  CA    . GLN A 1 268 ? 20.627 11.929  66.189 1.00 19.14 ? 268  GLN A CA    1 
ATOM   2046 C  C     . GLN A 1 268 ? 20.380 13.108  65.264 1.00 19.47 ? 268  GLN A C     1 
ATOM   2047 O  O     . GLN A 1 268 ? 19.240 13.427  64.925 1.00 19.77 ? 268  GLN A O     1 
ATOM   2048 C  CB    . GLN A 1 268 ? 20.972 12.423  67.595 1.00 19.83 ? 268  GLN A CB    1 
ATOM   2049 C  CG    . GLN A 1 268 ? 20.798 11.364  68.652 1.00 20.01 ? 268  GLN A CG    1 
ATOM   2050 C  CD    . GLN A 1 268 ? 19.394 10.810  68.664 1.00 21.65 ? 268  GLN A CD    1 
ATOM   2051 O  OE1   . GLN A 1 268 ? 19.197 9.593   68.603 1.00 21.80 ? 268  GLN A OE1   1 
ATOM   2052 N  NE2   . GLN A 1 268 ? 18.401 11.700  68.747 1.00 20.49 ? 268  GLN A NE2   1 
ATOM   2053 N  N     . ARG A 1 269 ? 21.454 13.754  64.841 1.00 18.02 ? 269  ARG A N     1 
ATOM   2054 C  CA    . ARG A 1 269 ? 21.299 14.880  63.947 1.00 16.67 ? 269  ARG A CA    1 
ATOM   2055 C  C     . ARG A 1 269 ? 20.664 14.411  62.638 1.00 16.97 ? 269  ARG A C     1 
ATOM   2056 O  O     . ARG A 1 269 ? 19.829 15.106  62.061 1.00 17.39 ? 269  ARG A O     1 
ATOM   2057 C  CB    . ARG A 1 269 ? 22.656 15.531  63.685 1.00 14.99 ? 269  ARG A CB    1 
ATOM   2058 C  CG    . ARG A 1 269 ? 22.583 16.648  62.696 1.00 16.98 ? 269  ARG A CG    1 
ATOM   2059 C  CD    . ARG A 1 269 ? 23.882 17.424  62.601 1.00 19.35 ? 269  ARG A CD    1 
ATOM   2060 N  NE    . ARG A 1 269 ? 24.174 18.158  63.825 1.00 17.44 ? 269  ARG A NE    1 
ATOM   2061 C  CZ    . ARG A 1 269 ? 25.020 17.742  64.760 1.00 19.97 ? 269  ARG A CZ    1 
ATOM   2062 N  NH1   . ARG A 1 269 ? 25.670 16.592  64.618 1.00 18.75 ? 269  ARG A NH1   1 
ATOM   2063 N  NH2   . ARG A 1 269 ? 25.217 18.479  65.844 1.00 21.59 ? 269  ARG A NH2   1 
ATOM   2064 N  N     . THR A 1 270 ? 21.038 13.216  62.192 1.00 16.62 ? 270  THR A N     1 
ATOM   2065 C  CA    . THR A 1 270 ? 20.522 12.672  60.942 1.00 18.06 ? 270  THR A CA    1 
ATOM   2066 C  C     . THR A 1 270 ? 19.036 12.365  60.964 1.00 19.78 ? 270  THR A C     1 
ATOM   2067 O  O     . THR A 1 270 ? 18.327 12.706  60.022 1.00 20.79 ? 270  THR A O     1 
ATOM   2068 C  CB    . THR A 1 270 ? 21.278 11.384  60.522 1.00 18.63 ? 270  THR A CB    1 
ATOM   2069 O  OG1   . THR A 1 270 ? 22.642 11.703  60.195 1.00 17.76 ? 270  THR A OG1   1 
ATOM   2070 C  CG2   . THR A 1 270 ? 20.600 10.741  59.308 1.00 15.51 ? 270  THR A CG2   1 
ATOM   2071 N  N     . ILE A 1 271 ? 18.566 11.720  62.027 1.00 20.57 ? 271  ILE A N     1 
ATOM   2072 C  CA    . ILE A 1 271 ? 17.155 11.369  62.141 1.00 20.62 ? 271  ILE A CA    1 
ATOM   2073 C  C     . ILE A 1 271 ? 16.283 12.604  62.376 1.00 22.69 ? 271  ILE A C     1 
ATOM   2074 O  O     . ILE A 1 271 ? 15.135 12.647  61.940 1.00 23.57 ? 271  ILE A O     1 
ATOM   2075 C  CB    . ILE A 1 271 ? 16.919 10.346  63.288 1.00 20.48 ? 271  ILE A CB    1 
ATOM   2076 C  CG1   . ILE A 1 271 ? 15.488 9.806   63.227 1.00 19.40 ? 271  ILE A CG1   1 
ATOM   2077 C  CG2   . ILE A 1 271 ? 17.170 10.997  64.640 1.00 19.60 ? 271  ILE A CG2   1 
ATOM   2078 C  CD1   . ILE A 1 271 ? 15.201 8.992   61.991 1.00 19.41 ? 271  ILE A CD1   1 
ATOM   2079 N  N     . LYS A 1 272 ? 16.821 13.608  63.062 1.00 23.87 ? 272  LYS A N     1 
ATOM   2080 C  CA    . LYS A 1 272 ? 16.053 14.818  63.320 1.00 25.54 ? 272  LYS A CA    1 
ATOM   2081 C  C     . LYS A 1 272 ? 15.823 15.586  62.031 1.00 26.12 ? 272  LYS A C     1 
ATOM   2082 O  O     . LYS A 1 272 ? 14.718 16.058  61.773 1.00 26.41 ? 272  LYS A O     1 
ATOM   2083 C  CB    . LYS A 1 272 ? 16.772 15.707  64.331 1.00 26.57 ? 272  LYS A CB    1 
ATOM   2084 C  CG    . LYS A 1 272 ? 16.881 15.092  65.716 1.00 30.89 ? 272  LYS A CG    1 
ATOM   2085 C  CD    . LYS A 1 272 ? 17.706 15.978  66.645 1.00 35.35 ? 272  LYS A CD    1 
ATOM   2086 C  CE    . LYS A 1 272 ? 17.907 15.357  68.024 1.00 35.68 ? 272  LYS A CE    1 
ATOM   2087 N  NZ    . LYS A 1 272 ? 18.804 16.216  68.861 1.00 37.52 ? 272  LYS A NZ    1 
ATOM   2088 N  N     . CYS A 1 273 ? 16.866 15.715  61.221 1.00 27.37 ? 273  CYS A N     1 
ATOM   2089 C  CA    . CYS A 1 273 ? 16.744 16.423  59.952 1.00 28.30 ? 273  CYS A CA    1 
ATOM   2090 C  C     . CYS A 1 273 ? 15.885 15.642  58.952 1.00 28.28 ? 273  CYS A C     1 
ATOM   2091 O  O     . CYS A 1 273 ? 15.164 16.236  58.156 1.00 25.57 ? 273  CYS A O     1 
ATOM   2092 C  CB    . CYS A 1 273 ? 18.134 16.704  59.356 1.00 29.91 ? 273  CYS A CB    1 
ATOM   2093 S  SG    . CYS A 1 273 ? 19.047 18.078  60.160 1.00 31.54 ? 273  CYS A SG    1 
ATOM   2094 N  N     . ALA A 1 274 ? 15.951 14.313  59.008 1.00 28.96 ? 274  ALA A N     1 
ATOM   2095 C  CA    . ALA A 1 274 ? 15.172 13.474  58.097 1.00 29.93 ? 274  ALA A CA    1 
ATOM   2096 C  C     . ALA A 1 274 ? 13.676 13.636  58.355 1.00 31.46 ? 274  ALA A C     1 
ATOM   2097 O  O     . ALA A 1 274 ? 12.896 13.810  57.417 1.00 32.63 ? 274  ALA A O     1 
ATOM   2098 C  CB    . ALA A 1 274 ? 15.577 12.007  58.242 1.00 26.53 ? 274  ALA A CB    1 
ATOM   2099 N  N     . LYS A 1 275 ? 13.278 13.586  59.623 1.00 32.44 ? 275  LYS A N     1 
ATOM   2100 C  CA    . LYS A 1 275 ? 11.871 13.731  59.973 1.00 33.67 ? 275  LYS A CA    1 
ATOM   2101 C  C     . LYS A 1 275 ? 11.349 15.134  59.661 1.00 34.84 ? 275  LYS A C     1 
ATOM   2102 O  O     . LYS A 1 275 ? 10.187 15.308  59.292 1.00 35.57 ? 275  LYS A O     1 
ATOM   2103 C  CB    . LYS A 1 275 ? 11.658 13.389  61.451 1.00 32.57 ? 275  LYS A CB    1 
ATOM   2104 C  CG    . LYS A 1 275 ? 11.795 11.900  61.744 1.00 31.82 ? 275  LYS A CG    1 
ATOM   2105 C  CD    . LYS A 1 275 ? 11.464 11.569  63.185 1.00 31.94 ? 275  LYS A CD    1 
ATOM   2106 C  CE    . LYS A 1 275 ? 11.626 10.087  63.443 1.00 32.01 ? 275  LYS A CE    1 
ATOM   2107 N  NZ    . LYS A 1 275 ? 11.477 9.762   64.888 1.00 35.58 ? 275  LYS A NZ    1 
ATOM   2108 N  N     . ALA A 1 276 ? 12.222 16.124  59.794 1.00 36.45 ? 276  ALA A N     1 
ATOM   2109 C  CA    . ALA A 1 276 ? 11.878 17.514  59.518 1.00 38.51 ? 276  ALA A CA    1 
ATOM   2110 C  C     . ALA A 1 276 ? 11.666 17.777  58.018 1.00 40.86 ? 276  ALA A C     1 
ATOM   2111 O  O     . ALA A 1 276 ? 10.837 18.608  57.634 1.00 40.36 ? 276  ALA A O     1 
ATOM   2112 C  CB    . ALA A 1 276 ? 12.975 18.418  60.051 1.00 37.03 ? 276  ALA A CB    1 
ATOM   2113 N  N     . LYS A 1 277 ? 12.418 17.073  57.174 1.00 43.66 ? 277  LYS A N     1 
ATOM   2114 C  CA    . LYS A 1 277 ? 12.309 17.247  55.725 1.00 46.07 ? 277  LYS A CA    1 
ATOM   2115 C  C     . LYS A 1 277 ? 11.142 16.476  55.118 1.00 47.29 ? 277  LYS A C     1 
ATOM   2116 O  O     . LYS A 1 277 ? 10.566 16.912  54.116 1.00 47.15 ? 277  LYS A O     1 
ATOM   2117 C  CB    . LYS A 1 277 ? 13.614 16.846  55.031 1.00 46.57 ? 277  LYS A CB    1 
ATOM   2118 C  CG    . LYS A 1 277 ? 14.793 17.741  55.382 1.00 47.95 ? 277  LYS A CG    1 
ATOM   2119 C  CD    . LYS A 1 277 ? 14.449 19.210  55.172 1.00 49.39 ? 277  LYS A CD    1 
ATOM   2120 C  CE    . LYS A 1 277 ? 15.643 20.125  55.433 1.00 50.50 ? 277  LYS A CE    1 
ATOM   2121 N  NZ    . LYS A 1 277 ? 16.511 20.311  54.227 1.00 51.06 ? 277  LYS A NZ    1 
ATOM   2122 N  N     . SER A 1 278 ? 10.805 15.327  55.701 1.00 48.26 ? 278  SER A N     1 
ATOM   2123 C  CA    . SER A 1 278 ? 9.668  14.555  55.207 1.00 50.08 ? 278  SER A CA    1 
ATOM   2124 C  C     . SER A 1 278 ? 8.420  15.206  55.800 1.00 50.99 ? 278  SER A C     1 
ATOM   2125 O  O     . SER A 1 278 ? 8.523  16.213  56.499 1.00 51.02 ? 278  SER A O     1 
ATOM   2126 C  CB    . SER A 1 278 ? 9.762  13.083  55.636 1.00 50.26 ? 278  SER A CB    1 
ATOM   2127 O  OG    . SER A 1 278 ? 10.682 12.898  56.695 1.00 51.56 ? 278  SER A OG    1 
ATOM   2128 N  N     . GLY A 1 279 ? 7.247  14.651  55.533 1.00 51.86 ? 279  GLY A N     1 
ATOM   2129 C  CA    . GLY A 1 279 ? 6.042  15.252  56.072 1.00 52.92 ? 279  GLY A CA    1 
ATOM   2130 C  C     . GLY A 1 279 ? 5.675  14.752  57.454 1.00 53.83 ? 279  GLY A C     1 
ATOM   2131 O  O     . GLY A 1 279 ? 6.440  14.024  58.100 1.00 53.68 ? 279  GLY A O     1 
ATOM   2132 N  N     . GLU A 1 280 ? 4.500  15.163  57.918 1.00 54.17 ? 280  GLU A N     1 
ATOM   2133 C  CA    . GLU A 1 280 ? 4.010  14.733  59.216 1.00 54.84 ? 280  GLU A CA    1 
ATOM   2134 C  C     . GLU A 1 280 ? 3.617  13.274  59.014 1.00 53.78 ? 280  GLU A C     1 
ATOM   2135 O  O     . GLU A 1 280 ? 3.024  12.928  57.987 1.00 53.05 ? 280  GLU A O     1 
ATOM   2136 C  CB    . GLU A 1 280 ? 2.782  15.561  59.631 1.00 57.06 ? 280  GLU A CB    1 
ATOM   2137 C  CG    . GLU A 1 280 ? 3.058  17.034  59.935 1.00 60.50 ? 280  GLU A CG    1 
ATOM   2138 C  CD    . GLU A 1 280 ? 3.368  17.296  61.405 1.00 62.72 ? 280  GLU A CD    1 
ATOM   2139 O  OE1   . GLU A 1 280 ? 3.827  18.414  61.720 1.00 63.52 ? 280  GLU A OE1   1 
ATOM   2140 O  OE2   . GLU A 1 280 ? 3.146  16.395  62.249 1.00 64.28 ? 280  GLU A OE2   1 
ATOM   2141 N  N     . GLY A 1 281 ? 3.965  12.423  59.974 1.00 53.37 ? 281  GLY A N     1 
ATOM   2142 C  CA    . GLY A 1 281 ? 3.630  11.012  59.876 1.00 53.10 ? 281  GLY A CA    1 
ATOM   2143 C  C     . GLY A 1 281 ? 4.213  10.310  58.661 1.00 52.50 ? 281  GLY A C     1 
ATOM   2144 O  O     . GLY A 1 281 ? 4.008  9.109   58.474 1.00 53.28 ? 281  GLY A O     1 
ATOM   2145 N  N     . VAL A 1 282 ? 4.934  11.057  57.828 1.00 51.14 ? 282  VAL A N     1 
ATOM   2146 C  CA    . VAL A 1 282 ? 5.549  10.491  56.633 1.00 48.00 ? 282  VAL A CA    1 
ATOM   2147 C  C     . VAL A 1 282 ? 6.893  9.893   57.005 1.00 46.46 ? 282  VAL A C     1 
ATOM   2148 O  O     . VAL A 1 282 ? 7.706  10.533  57.675 1.00 45.64 ? 282  VAL A O     1 
ATOM   2149 C  CB    . VAL A 1 282 ? 5.777  11.561  55.537 1.00 47.78 ? 282  VAL A CB    1 
ATOM   2150 C  CG1   . VAL A 1 282 ? 6.470  10.931  54.341 1.00 46.56 ? 282  VAL A CG1   1 
ATOM   2151 C  CG2   . VAL A 1 282 ? 4.449  12.173  55.115 1.00 47.93 ? 282  VAL A CG2   1 
ATOM   2152 N  N     . LYS A 1 283 ? 7.115  8.660   56.570 1.00 44.96 ? 283  LYS A N     1 
ATOM   2153 C  CA    . LYS A 1 283 ? 8.361  7.962   56.846 1.00 44.32 ? 283  LYS A CA    1 
ATOM   2154 C  C     . LYS A 1 283 ? 9.505  8.525   56.020 1.00 41.72 ? 283  LYS A C     1 
ATOM   2155 O  O     . LYS A 1 283 ? 9.372  8.715   54.814 1.00 42.22 ? 283  LYS A O     1 
ATOM   2156 C  CB    . LYS A 1 283 ? 8.201  6.477   56.543 1.00 47.24 ? 283  LYS A CB    1 
ATOM   2157 C  CG    . LYS A 1 283 ? 8.028  5.625   57.775 1.00 50.14 ? 283  LYS A CG    1 
ATOM   2158 C  CD    . LYS A 1 283 ? 9.066  4.518   57.790 1.00 54.06 ? 283  LYS A CD    1 
ATOM   2159 C  CE    . LYS A 1 283 ? 8.926  3.640   59.027 1.00 55.85 ? 283  LYS A CE    1 
ATOM   2160 N  NZ    . LYS A 1 283 ? 9.542  2.291   58.820 1.00 56.62 ? 283  LYS A NZ    1 
ATOM   2161 N  N     . PRO A 1 284 ? 10.651 8.799   56.659 1.00 39.57 ? 284  PRO A N     1 
ATOM   2162 C  CA    . PRO A 1 284 ? 11.780 9.344   55.905 1.00 37.89 ? 284  PRO A CA    1 
ATOM   2163 C  C     . PRO A 1 284 ? 12.247 8.354   54.842 1.00 36.88 ? 284  PRO A C     1 
ATOM   2164 O  O     . PRO A 1 284 ? 12.271 7.145   55.079 1.00 37.27 ? 284  PRO A O     1 
ATOM   2165 C  CB    . PRO A 1 284 ? 12.833 9.577   56.985 1.00 38.00 ? 284  PRO A CB    1 
ATOM   2166 C  CG    . PRO A 1 284 ? 12.012 9.817   58.219 1.00 38.10 ? 284  PRO A CG    1 
ATOM   2167 C  CD    . PRO A 1 284 ? 10.958 8.747   58.097 1.00 38.96 ? 284  PRO A CD    1 
ATOM   2168 N  N     . SER A 1 285 ? 12.603 8.870   53.669 1.00 35.56 ? 285  SER A N     1 
ATOM   2169 C  CA    . SER A 1 285 ? 13.074 8.031   52.568 1.00 33.88 ? 285  SER A CA    1 
ATOM   2170 C  C     . SER A 1 285 ? 14.590 7.872   52.658 1.00 32.97 ? 285  SER A C     1 
ATOM   2171 O  O     . SER A 1 285 ? 15.272 8.681   53.282 1.00 33.33 ? 285  SER A O     1 
ATOM   2172 C  CB    . SER A 1 285 ? 12.714 8.671   51.230 1.00 34.33 ? 285  SER A CB    1 
ATOM   2173 O  OG    . SER A 1 285 ? 13.422 9.888   51.047 1.00 34.24 ? 285  SER A OG    1 
ATOM   2174 N  N     . PRO A 1 286 ? 15.142 6.829   52.028 1.00 32.35 ? 286  PRO A N     1 
ATOM   2175 C  CA    . PRO A 1 286 ? 16.594 6.641   52.092 1.00 30.87 ? 286  PRO A CA    1 
ATOM   2176 C  C     . PRO A 1 286 ? 17.393 7.867   51.657 1.00 29.56 ? 286  PRO A C     1 
ATOM   2177 O  O     . PRO A 1 286 ? 18.503 8.105   52.134 1.00 28.56 ? 286  PRO A O     1 
ATOM   2178 C  CB    . PRO A 1 286 ? 16.828 5.419   51.196 1.00 30.55 ? 286  PRO A CB    1 
ATOM   2179 C  CG    . PRO A 1 286 ? 15.651 5.423   50.278 1.00 31.50 ? 286  PRO A CG    1 
ATOM   2180 C  CD    . PRO A 1 286 ? 14.516 5.802   51.184 1.00 31.62 ? 286  PRO A CD    1 
ATOM   2181 N  N     . ALA A 1 287 ? 16.823 8.654   50.756 1.00 29.36 ? 287  ALA A N     1 
ATOM   2182 C  CA    . ALA A 1 287 ? 17.498 9.852   50.277 1.00 28.36 ? 287  ALA A CA    1 
ATOM   2183 C  C     . ALA A 1 287 ? 17.554 10.886  51.393 1.00 27.35 ? 287  ALA A C     1 
ATOM   2184 O  O     . ALA A 1 287 ? 18.505 11.660  51.489 1.00 27.32 ? 287  ALA A O     1 
ATOM   2185 C  CB    . ALA A 1 287 ? 16.758 10.424  49.073 1.00 28.62 ? 287  ALA A CB    1 
ATOM   2186 N  N     . GLN A 1 288 ? 16.528 10.895  52.235 1.00 25.46 ? 288  GLN A N     1 
ATOM   2187 C  CA    . GLN A 1 288 ? 16.461 11.840  53.334 1.00 23.46 ? 288  GLN A CA    1 
ATOM   2188 C  C     . GLN A 1 288 ? 17.286 11.357  54.528 1.00 22.09 ? 288  GLN A C     1 
ATOM   2189 O  O     . GLN A 1 288 ? 17.665 12.146  55.396 1.00 22.51 ? 288  GLN A O     1 
ATOM   2190 C  CB    . GLN A 1 288 ? 14.995 12.052  53.731 1.00 25.95 ? 288  GLN A CB    1 
ATOM   2191 C  CG    . GLN A 1 288 ? 14.133 12.587  52.593 1.00 31.57 ? 288  GLN A CG    1 
ATOM   2192 C  CD    . GLN A 1 288 ? 12.644 12.576  52.908 1.00 36.11 ? 288  GLN A CD    1 
ATOM   2193 O  OE1   . GLN A 1 288 ? 12.078 11.531  53.244 1.00 39.53 ? 288  GLN A OE1   1 
ATOM   2194 N  NE2   . GLN A 1 288 ? 12.000 13.739  52.794 1.00 36.67 ? 288  GLN A NE2   1 
ATOM   2195 N  N     . LEU A 1 289 ? 17.581 10.062  54.558 1.00 20.00 ? 289  LEU A N     1 
ATOM   2196 C  CA    . LEU A 1 289 ? 18.342 9.477   55.656 1.00 18.28 ? 289  LEU A CA    1 
ATOM   2197 C  C     . LEU A 1 289 ? 19.849 9.466   55.449 1.00 17.88 ? 289  LEU A C     1 
ATOM   2198 O  O     . LEU A 1 289 ? 20.581 8.888   56.253 1.00 18.17 ? 289  LEU A O     1 
ATOM   2199 C  CB    . LEU A 1 289 ? 17.855 8.052   55.941 1.00 17.20 ? 289  LEU A CB    1 
ATOM   2200 C  CG    . LEU A 1 289 ? 16.471 7.966   56.592 1.00 19.60 ? 289  LEU A CG    1 
ATOM   2201 C  CD1   . LEU A 1 289 ? 16.058 6.514   56.752 1.00 17.98 ? 289  LEU A CD1   1 
ATOM   2202 C  CD2   . LEU A 1 289 ? 16.511 8.664   57.958 1.00 22.16 ? 289  LEU A CD2   1 
ATOM   2203 N  N     . GLU A 1 290 ? 20.322 10.089  54.377 1.00 17.06 ? 290  GLU A N     1 
ATOM   2204 C  CA    . GLU A 1 290 ? 21.753 10.130  54.138 1.00 16.52 ? 290  GLU A CA    1 
ATOM   2205 C  C     . GLU A 1 290 ? 22.393 10.810  55.342 1.00 16.78 ? 290  GLU A C     1 
ATOM   2206 O  O     . GLU A 1 290 ? 21.894 11.822  55.826 1.00 16.93 ? 290  GLU A O     1 
ATOM   2207 C  CB    . GLU A 1 290 ? 22.046 10.911  52.867 1.00 15.93 ? 290  GLU A CB    1 
ATOM   2208 C  CG    . GLU A 1 290 ? 21.703 10.165  51.581 1.00 19.17 ? 290  GLU A CG    1 
ATOM   2209 C  CD    . GLU A 1 290 ? 22.715 9.070   51.211 1.00 19.53 ? 290  GLU A CD    1 
ATOM   2210 O  OE1   . GLU A 1 290 ? 22.597 8.526   50.096 1.00 18.39 ? 290  GLU A OE1   1 
ATOM   2211 O  OE2   . GLU A 1 290 ? 23.617 8.755   52.021 1.00 19.14 ? 290  GLU A OE2   1 
ATOM   2212 N  N     . LEU A 1 291 ? 23.492 10.250  55.830 1.00 16.43 ? 291  LEU A N     1 
ATOM   2213 C  CA    . LEU A 1 291 ? 24.172 10.802  56.992 1.00 17.54 ? 291  LEU A CA    1 
ATOM   2214 C  C     . LEU A 1 291 ? 24.496 12.295  56.887 1.00 19.25 ? 291  LEU A C     1 
ATOM   2215 O  O     . LEU A 1 291 ? 24.987 12.769  55.862 1.00 20.12 ? 291  LEU A O     1 
ATOM   2216 C  CB    . LEU A 1 291 ? 25.464 10.018  57.262 1.00 16.48 ? 291  LEU A CB    1 
ATOM   2217 C  CG    . LEU A 1 291 ? 25.336 8.516   57.541 1.00 16.21 ? 291  LEU A CG    1 
ATOM   2218 C  CD1   . LEU A 1 291 ? 26.722 7.932   57.746 1.00 15.81 ? 291  LEU A CD1   1 
ATOM   2219 C  CD2   . LEU A 1 291 ? 24.468 8.269   58.761 1.00 14.89 ? 291  LEU A CD2   1 
ATOM   2220 N  N     . ARG A 1 292 ? 24.206 13.037  57.950 1.00 20.73 ? 292  ARG A N     1 
ATOM   2221 C  CA    . ARG A 1 292 ? 24.514 14.464  57.978 1.00 21.37 ? 292  ARG A CA    1 
ATOM   2222 C  C     . ARG A 1 292 ? 25.963 14.595  58.449 1.00 20.87 ? 292  ARG A C     1 
ATOM   2223 O  O     . ARG A 1 292 ? 26.246 15.031  59.558 1.00 18.73 ? 292  ARG A O     1 
ATOM   2224 C  CB    . ARG A 1 292 ? 23.560 15.205  58.918 1.00 23.89 ? 292  ARG A CB    1 
ATOM   2225 C  CG    . ARG A 1 292 ? 22.115 15.276  58.412 1.00 28.31 ? 292  ARG A CG    1 
ATOM   2226 C  CD    . ARG A 1 292 ? 21.992 16.091  57.116 1.00 32.67 ? 292  ARG A CD    1 
ATOM   2227 N  NE    . ARG A 1 292 ? 20.603 16.254  56.678 1.00 38.34 ? 292  ARG A NE    1 
ATOM   2228 C  CZ    . ARG A 1 292 ? 19.820 15.260  56.249 1.00 41.57 ? 292  ARG A CZ    1 
ATOM   2229 N  NH1   . ARG A 1 292 ? 20.287 14.015  56.190 1.00 42.30 ? 292  ARG A NH1   1 
ATOM   2230 N  NH2   . ARG A 1 292 ? 18.560 15.504  55.892 1.00 41.28 ? 292  ARG A NH2   1 
ATOM   2231 N  N     . MET A 1 293 ? 26.868 14.191  57.568 1.00 21.79 ? 293  MET A N     1 
ATOM   2232 C  CA    . MET A 1 293 ? 28.310 14.193  57.802 1.00 21.68 ? 293  MET A CA    1 
ATOM   2233 C  C     . MET A 1 293 ? 28.928 15.577  58.000 1.00 21.16 ? 293  MET A C     1 
ATOM   2234 O  O     . MET A 1 293 ? 29.577 15.844  59.004 1.00 19.71 ? 293  MET A O     1 
ATOM   2235 C  CB    . MET A 1 293 ? 28.992 13.505  56.617 1.00 22.83 ? 293  MET A CB    1 
ATOM   2236 C  CG    . MET A 1 293 ? 30.421 13.074  56.850 1.00 25.16 ? 293  MET A CG    1 
ATOM   2237 S  SD    . MET A 1 293 ? 30.543 11.789  58.120 1.00 28.54 ? 293  MET A SD    1 
ATOM   2238 C  CE    . MET A 1 293 ? 29.730 10.427  57.334 1.00 28.40 ? 293  MET A CE    1 
ATOM   2239 N  N     . VAL A 1 294 ? 28.743 16.441  57.011 1.00 21.25 ? 294  VAL A N     1 
ATOM   2240 C  CA    . VAL A 1 294 ? 29.289 17.790  57.035 1.00 19.66 ? 294  VAL A CA    1 
ATOM   2241 C  C     . VAL A 1 294 ? 28.813 18.594  58.247 1.00 20.94 ? 294  VAL A C     1 
ATOM   2242 O  O     . VAL A 1 294 ? 29.608 19.288  58.897 1.00 20.19 ? 294  VAL A O     1 
ATOM   2243 C  CB    . VAL A 1 294 ? 28.928 18.523  55.706 1.00 18.21 ? 294  VAL A CB    1 
ATOM   2244 C  CG1   . VAL A 1 294 ? 29.184 20.019  55.807 1.00 16.99 ? 294  VAL A CG1   1 
ATOM   2245 C  CG2   . VAL A 1 294 ? 29.754 17.943  54.589 1.00 16.63 ? 294  VAL A CG2   1 
ATOM   2246 N  N     . GLN A 1 295 ? 27.523 18.485  58.553 1.00 18.54 ? 295  GLN A N     1 
ATOM   2247 C  CA    . GLN A 1 295 ? 26.944 19.206  59.669 1.00 18.02 ? 295  GLN A CA    1 
ATOM   2248 C  C     . GLN A 1 295 ? 27.283 18.595  61.026 1.00 18.26 ? 295  GLN A C     1 
ATOM   2249 O  O     . GLN A 1 295 ? 26.789 19.069  62.043 1.00 20.96 ? 295  GLN A O     1 
ATOM   2250 C  CB    . GLN A 1 295 ? 25.421 19.270  59.519 1.00 19.68 ? 295  GLN A CB    1 
ATOM   2251 C  CG    . GLN A 1 295 ? 24.936 19.824  58.189 1.00 21.03 ? 295  GLN A CG    1 
ATOM   2252 C  CD    . GLN A 1 295 ? 24.848 18.771  57.105 1.00 22.71 ? 295  GLN A CD    1 
ATOM   2253 O  OE1   . GLN A 1 295 ? 25.286 17.632  57.286 1.00 23.28 ? 295  GLN A OE1   1 
ATOM   2254 N  NE2   . GLN A 1 295 ? 24.279 19.147  55.963 1.00 23.62 ? 295  GLN A NE2   1 
ATOM   2255 N  N     . SER A 1 296 ? 28.101 17.546  61.054 1.00 16.14 ? 296  SER A N     1 
ATOM   2256 C  CA    . SER A 1 296 ? 28.470 16.906  62.318 1.00 15.43 ? 296  SER A CA    1 
ATOM   2257 C  C     . SER A 1 296 ? 29.954 17.063  62.583 1.00 17.10 ? 296  SER A C     1 
ATOM   2258 O  O     . SER A 1 296 ? 30.511 16.421  63.479 1.00 16.16 ? 296  SER A O     1 
ATOM   2259 C  CB    . SER A 1 296 ? 28.134 15.416  62.297 1.00 14.51 ? 296  SER A CB    1 
ATOM   2260 O  OG    . SER A 1 296 ? 26.755 15.206  62.080 1.00 15.84 ? 296  SER A OG    1 
ATOM   2261 N  N     . LYS A 1 297 ? 30.586 17.927  61.798 1.00 18.34 ? 297  LYS A N     1 
ATOM   2262 C  CA    . LYS A 1 297 ? 32.014 18.167  61.915 1.00 19.29 ? 297  LYS A CA    1 
ATOM   2263 C  C     . LYS A 1 297 ? 32.527 18.323  63.355 1.00 20.06 ? 297  LYS A C     1 
ATOM   2264 O  O     . LYS A 1 297 ? 33.495 17.664  63.742 1.00 18.22 ? 297  LYS A O     1 
ATOM   2265 C  CB    . LYS A 1 297 ? 32.403 19.399  61.091 1.00 18.70 ? 297  LYS A CB    1 
ATOM   2266 C  CG    . LYS A 1 297 ? 33.899 19.631  61.023 1.00 20.36 ? 297  LYS A CG    1 
ATOM   2267 C  CD    . LYS A 1 297 ? 34.242 20.911  60.282 1.00 23.43 ? 297  LYS A CD    1 
ATOM   2268 C  CE    . LYS A 1 297 ? 33.761 22.150  61.028 1.00 24.83 ? 297  LYS A CE    1 
ATOM   2269 N  NZ    . LYS A 1 297 ? 34.190 23.413  60.363 1.00 25.03 ? 297  LYS A NZ    1 
ATOM   2270 N  N     . LYS A 1 298 ? 31.886 19.184  64.143 1.00 21.70 ? 298  LYS A N     1 
ATOM   2271 C  CA    . LYS A 1 298 ? 32.332 19.424  65.513 1.00 23.02 ? 298  LYS A CA    1 
ATOM   2272 C  C     . LYS A 1 298 ? 32.193 18.177  66.379 1.00 22.53 ? 298  LYS A C     1 
ATOM   2273 O  O     . LYS A 1 298 ? 33.067 17.886  67.198 1.00 22.09 ? 298  LYS A O     1 
ATOM   2274 C  CB    . LYS A 1 298 ? 31.544 20.574  66.148 1.00 26.01 ? 298  LYS A CB    1 
ATOM   2275 C  CG    . LYS A 1 298 ? 31.589 21.922  65.418 1.00 31.30 ? 298  LYS A CG    1 
ATOM   2276 C  CD    . LYS A 1 298 ? 32.811 22.793  65.764 1.00 36.06 ? 298  LYS A CD    1 
ATOM   2277 C  CE    . LYS A 1 298 ? 33.946 22.661  64.734 1.00 39.01 ? 298  LYS A CE    1 
ATOM   2278 N  NZ    . LYS A 1 298 ? 34.750 23.925  64.556 1.00 39.62 ? 298  LYS A NZ    1 
ATOM   2279 N  N     . ASP A 1 299 ? 31.100 17.440  66.196 1.00 22.22 ? 299  ASP A N     1 
ATOM   2280 C  CA    . ASP A 1 299 ? 30.848 16.223  66.973 1.00 21.84 ? 299  ASP A CA    1 
ATOM   2281 C  C     . ASP A 1 299 ? 31.851 15.110  66.666 1.00 22.30 ? 299  ASP A C     1 
ATOM   2282 O  O     . ASP A 1 299 ? 32.192 14.311  67.538 1.00 23.33 ? 299  ASP A O     1 
ATOM   2283 C  CB    . ASP A 1 299 ? 29.421 15.729  66.722 1.00 20.32 ? 299  ASP A CB    1 
ATOM   2284 C  CG    . ASP A 1 299 ? 28.373 16.598  67.403 1.00 21.01 ? 299  ASP A CG    1 
ATOM   2285 O  OD1   . ASP A 1 299 ? 27.291 16.808  66.823 1.00 23.27 ? 299  ASP A OD1   1 
ATOM   2286 O  OD2   . ASP A 1 299 ? 28.616 17.068  68.525 1.00 21.48 ? 299  ASP A OD2   1 
ATOM   2287 N  N     . ILE A 1 300 ? 32.322 15.066  65.426 1.00 21.94 ? 300  ILE A N     1 
ATOM   2288 C  CA    . ILE A 1 300 ? 33.290 14.066  65.002 1.00 21.11 ? 300  ILE A CA    1 
ATOM   2289 C  C     . ILE A 1 300 ? 34.680 14.429  65.536 1.00 21.98 ? 300  ILE A C     1 
ATOM   2290 O  O     . ILE A 1 300 ? 35.454 13.556  65.931 1.00 21.33 ? 300  ILE A O     1 
ATOM   2291 C  CB    . ILE A 1 300 ? 33.318 13.973  63.451 1.00 20.00 ? 300  ILE A CB    1 
ATOM   2292 C  CG1   . ILE A 1 300 ? 32.009 13.358  62.947 1.00 17.94 ? 300  ILE A CG1   1 
ATOM   2293 C  CG2   . ILE A 1 300 ? 34.513 13.160  62.987 1.00 20.89 ? 300  ILE A CG2   1 
ATOM   2294 C  CD1   . ILE A 1 300 ? 31.817 13.452  61.447 1.00 15.69 ? 300  ILE A CD1   1 
ATOM   2295 N  N     . GLU A 1 301 ? 34.983 15.726  65.555 1.00 22.97 ? 301  GLU A N     1 
ATOM   2296 C  CA    . GLU A 1 301 ? 36.274 16.221  66.030 1.00 24.54 ? 301  GLU A CA    1 
ATOM   2297 C  C     . GLU A 1 301 ? 36.466 15.998  67.524 1.00 24.46 ? 301  GLU A C     1 
ATOM   2298 O  O     . GLU A 1 301 ? 37.533 15.574  67.970 1.00 23.72 ? 301  GLU A O     1 
ATOM   2299 C  CB    . GLU A 1 301 ? 36.410 17.714  65.730 1.00 25.20 ? 301  GLU A CB    1 
ATOM   2300 C  CG    . GLU A 1 301 ? 36.713 18.052  64.284 1.00 30.08 ? 301  GLU A CG    1 
ATOM   2301 C  CD    . GLU A 1 301 ? 36.570 19.533  64.000 1.00 33.15 ? 301  GLU A CD    1 
ATOM   2302 O  OE1   . GLU A 1 301 ? 36.999 19.991  62.920 1.00 36.01 ? 301  GLU A OE1   1 
ATOM   2303 O  OE2   . GLU A 1 301 ? 36.015 20.245  64.859 1.00 36.05 ? 301  GLU A OE2   1 
ATOM   2304 N  N     . SER A 1 302 ? 35.425 16.294  68.292 1.00 24.10 ? 302  SER A N     1 
ATOM   2305 C  CA    . SER A 1 302 ? 35.474 16.140  69.736 1.00 23.18 ? 302  SER A CA    1 
ATOM   2306 C  C     . SER A 1 302 ? 34.093 15.793  70.249 1.00 22.20 ? 302  SER A C     1 
ATOM   2307 O  O     . SER A 1 302 ? 33.324 16.670  70.635 1.00 19.95 ? 302  SER A O     1 
ATOM   2308 C  CB    . SER A 1 302 ? 35.942 17.437  70.381 1.00 24.90 ? 302  SER A CB    1 
ATOM   2309 O  OG    . SER A 1 302 ? 36.032 17.275  71.781 1.00 30.05 ? 302  SER A OG    1 
ATOM   2310 N  N     . PRO A 1 303 ? 33.760 14.497  70.267 1.00 21.16 ? 303  PRO A N     1 
ATOM   2311 C  CA    . PRO A 1 303 ? 32.454 14.025  70.734 1.00 20.46 ? 303  PRO A CA    1 
ATOM   2312 C  C     . PRO A 1 303 ? 32.217 14.051  72.245 1.00 21.39 ? 303  PRO A C     1 
ATOM   2313 O  O     . PRO A 1 303 ? 33.059 13.592  73.021 1.00 21.29 ? 303  PRO A O     1 
ATOM   2314 C  CB    . PRO A 1 303 ? 32.401 12.607  70.180 1.00 21.07 ? 303  PRO A CB    1 
ATOM   2315 C  CG    . PRO A 1 303 ? 33.821 12.171  70.297 1.00 19.00 ? 303  PRO A CG    1 
ATOM   2316 C  CD    . PRO A 1 303 ? 34.579 13.372  69.781 1.00 20.21 ? 303  PRO A CD    1 
ATOM   2317 N  N     . GLU A 1 304 ? 31.074 14.600  72.657 1.00 20.73 ? 304  GLU A N     1 
ATOM   2318 C  CA    . GLU A 1 304 ? 30.709 14.627  74.074 1.00 19.17 ? 304  GLU A CA    1 
ATOM   2319 C  C     . GLU A 1 304 ? 30.377 13.186  74.400 1.00 19.26 ? 304  GLU A C     1 
ATOM   2320 O  O     . GLU A 1 304 ? 29.486 12.611  73.770 1.00 18.50 ? 304  GLU A O     1 
ATOM   2321 C  CB    . GLU A 1 304 ? 29.452 15.457  74.318 1.00 19.48 ? 304  GLU A CB    1 
ATOM   2322 C  CG    . GLU A 1 304 ? 29.678 16.941  74.480 1.00 25.17 ? 304  GLU A CG    1 
ATOM   2323 C  CD    . GLU A 1 304 ? 30.585 17.281  75.651 1.00 27.34 ? 304  GLU A CD    1 
ATOM   2324 O  OE1   . GLU A 1 304 ? 30.301 16.839  76.791 1.00 26.81 ? 304  GLU A OE1   1 
ATOM   2325 O  OE2   . GLU A 1 304 ? 31.583 18.003  75.422 1.00 29.21 ? 304  GLU A OE2   1 
ATOM   2326 N  N     . ILE A 1 305 ? 31.076 12.597  75.363 1.00 17.07 ? 305  ILE A N     1 
ATOM   2327 C  CA    . ILE A 1 305 ? 30.796 11.212  75.714 1.00 16.91 ? 305  ILE A CA    1 
ATOM   2328 C  C     . ILE A 1 305 ? 29.368 11.028  76.235 1.00 17.84 ? 305  ILE A C     1 
ATOM   2329 O  O     . ILE A 1 305 ? 28.931 11.748  77.134 1.00 18.59 ? 305  ILE A O     1 
ATOM   2330 C  CB    . ILE A 1 305 ? 31.773 10.694  76.771 1.00 16.11 ? 305  ILE A CB    1 
ATOM   2331 C  CG1   . ILE A 1 305 ? 33.210 10.904  76.287 1.00 15.73 ? 305  ILE A CG1   1 
ATOM   2332 C  CG2   . ILE A 1 305 ? 31.479 9.228   77.067 1.00 13.79 ? 305  ILE A CG2   1 
ATOM   2333 C  CD1   . ILE A 1 305 ? 33.501 10.336  74.910 1.00 15.78 ? 305  ILE A CD1   1 
ATOM   2334 N  N     . VAL A 1 306 ? 28.646 10.067  75.660 1.00 17.60 ? 306  VAL A N     1 
ATOM   2335 C  CA    . VAL A 1 306 ? 27.274 9.789   76.075 1.00 17.83 ? 306  VAL A CA    1 
ATOM   2336 C  C     . VAL A 1 306 ? 27.019 8.322   76.433 1.00 18.90 ? 306  VAL A C     1 
ATOM   2337 O  O     . VAL A 1 306 ? 25.893 7.954   76.774 1.00 18.03 ? 306  VAL A O     1 
ATOM   2338 C  CB    . VAL A 1 306 ? 26.245 10.242  75.005 1.00 15.90 ? 306  VAL A CB    1 
ATOM   2339 C  CG1   . VAL A 1 306 ? 26.306 11.740  74.849 1.00 15.23 ? 306  VAL A CG1   1 
ATOM   2340 C  CG2   . VAL A 1 306 ? 26.510 9.554   73.674 1.00 15.24 ? 306  VAL A CG2   1 
ATOM   2341 N  N     . VAL A 1 307 ? 28.060 7.494   76.347 1.00 20.63 ? 307  VAL A N     1 
ATOM   2342 C  CA    . VAL A 1 307 ? 27.966 6.078   76.708 1.00 23.35 ? 307  VAL A CA    1 
ATOM   2343 C  C     . VAL A 1 307 ? 29.183 5.699   77.543 1.00 24.83 ? 307  VAL A C     1 
ATOM   2344 O  O     . VAL A 1 307 ? 30.255 6.285   77.416 1.00 24.09 ? 307  VAL A O     1 
ATOM   2345 C  CB    . VAL A 1 307 ? 27.941 5.143   75.484 1.00 23.85 ? 307  VAL A CB    1 
ATOM   2346 C  CG1   . VAL A 1 307 ? 26.667 5.357   74.680 1.00 26.39 ? 307  VAL A CG1   1 
ATOM   2347 C  CG2   . VAL A 1 307 ? 29.172 5.388   74.631 1.00 25.04 ? 307  VAL A CG2   1 
ATOM   2348 N  N     . GLN A 1 308 ? 29.012 4.720   78.412 1.00 26.94 ? 308  GLN A N     1 
ATOM   2349 C  CA    . GLN A 1 308 ? 30.114 4.277   79.240 1.00 29.51 ? 308  GLN A CA    1 
ATOM   2350 C  C     . GLN A 1 308 ? 30.296 2.811   78.967 1.00 30.05 ? 308  GLN A C     1 
ATOM   2351 O  O     . GLN A 1 308 ? 29.341 2.043   79.055 1.00 30.05 ? 308  GLN A O     1 
ATOM   2352 C  CB    . GLN A 1 308 ? 29.802 4.477   80.715 1.00 31.16 ? 308  GLN A CB    1 
ATOM   2353 C  CG    . GLN A 1 308 ? 30.970 4.154   81.628 1.00 34.19 ? 308  GLN A CG    1 
ATOM   2354 C  CD    . GLN A 1 308 ? 30.610 4.306   83.099 1.00 36.08 ? 308  GLN A CD    1 
ATOM   2355 O  OE1   . GLN A 1 308 ? 31.477 4.276   83.971 1.00 35.93 ? 308  GLN A OE1   1 
ATOM   2356 N  NE2   . GLN A 1 308 ? 29.322 4.465   83.378 1.00 36.93 ? 308  GLN A NE2   1 
ATOM   2357 N  N     . ALA A 1 309 ? 31.518 2.429   78.618 1.00 31.55 ? 309  ALA A N     1 
ATOM   2358 C  CA    . ALA A 1 309 ? 31.822 1.036   78.335 1.00 33.49 ? 309  ALA A CA    1 
ATOM   2359 C  C     . ALA A 1 309 ? 32.078 0.318   79.655 1.00 34.69 ? 309  ALA A C     1 
ATOM   2360 O  O     . ALA A 1 309 ? 32.801 0.825   80.518 1.00 34.66 ? 309  ALA A O     1 
ATOM   2361 C  CB    . ALA A 1 309 ? 33.051 0.940   77.442 1.00 33.36 ? 309  ALA A CB    1 
ATOM   2362 N  N     . THR A 1 310 ? 31.467 -0.846  79.834 1.00 35.62 ? 310  THR A N     1 
ATOM   2363 C  CA    . THR A 1 310 ? 31.700 -1.582  81.059 1.00 37.27 ? 310  THR A CA    1 
ATOM   2364 C  C     . THR A 1 310 ? 32.767 -2.637  80.780 1.00 37.46 ? 310  THR A C     1 
ATOM   2365 O  O     . THR A 1 310 ? 32.710 -3.367  79.780 1.00 37.59 ? 310  THR A O     1 
ATOM   2366 C  CB    . THR A 1 310 ? 30.385 -2.216  81.624 1.00 37.79 ? 310  THR A CB    1 
ATOM   2367 O  OG1   . THR A 1 310 ? 30.588 -3.612  81.893 1.00 38.19 ? 310  THR A OG1   1 
ATOM   2368 C  CG2   . THR A 1 310 ? 29.223 -2.029  80.654 1.00 38.31 ? 310  THR A CG2   1 
ATOM   2369 N  N     . VAL A 1 311 ? 33.766 -2.674  81.655 1.00 37.42 ? 311  VAL A N     1 
ATOM   2370 C  CA    . VAL A 1 311 ? 34.860 -3.619  81.532 1.00 37.41 ? 311  VAL A CA    1 
ATOM   2371 C  C     . VAL A 1 311 ? 34.405 -4.992  82.018 1.00 38.63 ? 311  VAL A C     1 
ATOM   2372 O  O     . VAL A 1 311 ? 33.904 -5.126  83.133 1.00 38.80 ? 311  VAL A O     1 
ATOM   2373 C  CB    . VAL A 1 311 ? 36.064 -3.157  82.365 1.00 36.40 ? 311  VAL A CB    1 
ATOM   2374 C  CG1   . VAL A 1 311 ? 37.248 -4.068  82.117 1.00 35.90 ? 311  VAL A CG1   1 
ATOM   2375 C  CG2   . VAL A 1 311 ? 36.410 -1.720  82.016 1.00 34.64 ? 311  VAL A CG2   1 
ATOM   2376 N  N     . LEU A 1 312 ? 34.575 -6.006  81.176 1.00 39.89 ? 312  LEU A N     1 
ATOM   2377 C  CA    . LEU A 1 312 ? 34.184 -7.369  81.520 1.00 40.74 ? 312  LEU A CA    1 
ATOM   2378 C  C     . LEU A 1 312 ? 35.334 -8.195  82.113 1.00 41.86 ? 312  LEU A C     1 
ATOM   2379 O  O     . LEU A 1 312 ? 36.446 -7.647  82.295 1.00 41.96 ? 312  LEU A O     1 
ATOM   2380 C  CB    . LEU A 1 312 ? 33.638 -8.072  80.283 1.00 40.69 ? 312  LEU A CB    1 
ATOM   2381 C  CG    . LEU A 1 312 ? 32.440 -7.378  79.638 1.00 41.91 ? 312  LEU A CG    1 
ATOM   2382 C  CD1   . LEU A 1 312 ? 32.144 -8.036  78.300 1.00 42.75 ? 312  LEU A CD1   1 
ATOM   2383 C  CD2   . LEU A 1 312 ? 31.229 -7.468  80.548 1.00 41.32 ? 312  LEU A CD2   1 
ATOM   2384 O  OXT   . LEU A 1 312 ? 35.102 -9.391  82.396 1.00 42.76 ? 312  LEU A OXT   1 
ATOM   2385 N  N     . GLU B 1 4   ? 21.023 24.487  53.785 1.00 37.68 ? 4    GLU B N     1 
ATOM   2386 C  CA    . GLU B 1 4   ? 22.065 23.614  53.156 1.00 38.59 ? 4    GLU B CA    1 
ATOM   2387 C  C     . GLU B 1 4   ? 22.279 23.897  51.672 1.00 35.22 ? 4    GLU B C     1 
ATOM   2388 O  O     . GLU B 1 4   ? 21.332 23.909  50.894 1.00 34.04 ? 4    GLU B O     1 
ATOM   2389 C  CB    . GLU B 1 4   ? 21.704 22.129  53.338 1.00 42.92 ? 4    GLU B CB    1 
ATOM   2390 C  CG    . GLU B 1 4   ? 20.220 21.842  53.576 1.00 48.44 ? 4    GLU B CG    1 
ATOM   2391 C  CD    . GLU B 1 4   ? 19.906 20.344  53.591 1.00 52.21 ? 4    GLU B CD    1 
ATOM   2392 O  OE1   . GLU B 1 4   ? 19.315 19.855  54.582 1.00 53.92 ? 4    GLU B OE1   1 
ATOM   2393 O  OE2   . GLU B 1 4   ? 20.251 19.654  52.602 1.00 54.18 ? 4    GLU B OE2   1 
ATOM   2394 N  N     . CYS B 1 5   ? 23.527 24.134  51.284 1.00 31.69 ? 5    CYS B N     1 
ATOM   2395 C  CA    . CYS B 1 5   ? 23.842 24.390  49.885 1.00 29.47 ? 5    CYS B CA    1 
ATOM   2396 C  C     . CYS B 1 5   ? 24.530 23.160  49.297 1.00 27.85 ? 5    CYS B C     1 
ATOM   2397 O  O     . CYS B 1 5   ? 25.516 22.673  49.847 1.00 28.79 ? 5    CYS B O     1 
ATOM   2398 C  CB    . CYS B 1 5   ? 24.738 25.633  49.745 1.00 29.65 ? 5    CYS B CB    1 
ATOM   2399 S  SG    . CYS B 1 5   ? 23.817 27.195  49.540 1.00 31.91 ? 5    CYS B SG    1 
ATOM   2400 N  N     . ARG B 1 6   ? 24.005 22.647  48.188 1.00 24.85 ? 6    ARG B N     1 
ATOM   2401 C  CA    . ARG B 1 6   ? 24.587 21.464  47.560 1.00 21.34 ? 6    ARG B CA    1 
ATOM   2402 C  C     . ARG B 1 6   ? 25.362 21.764  46.267 1.00 19.20 ? 6    ARG B C     1 
ATOM   2403 O  O     . ARG B 1 6   ? 24.856 22.402  45.345 1.00 16.92 ? 6    ARG B O     1 
ATOM   2404 C  CB    . ARG B 1 6   ? 23.494 20.426  47.300 1.00 22.72 ? 6    ARG B CB    1 
ATOM   2405 C  CG    . ARG B 1 6   ? 24.009 19.078  46.831 1.00 21.85 ? 6    ARG B CG    1 
ATOM   2406 C  CD    . ARG B 1 6   ? 22.845 18.148  46.592 1.00 23.85 ? 6    ARG B CD    1 
ATOM   2407 N  NE    . ARG B 1 6   ? 22.194 17.772  47.843 1.00 23.74 ? 6    ARG B NE    1 
ATOM   2408 C  CZ    . ARG B 1 6   ? 22.562 16.737  48.590 1.00 23.15 ? 6    ARG B CZ    1 
ATOM   2409 N  NH1   . ARG B 1 6   ? 23.578 15.969  48.212 1.00 22.08 ? 6    ARG B NH1   1 
ATOM   2410 N  NH2   . ARG B 1 6   ? 21.908 16.466  49.711 1.00 23.51 ? 6    ARG B NH2   1 
ATOM   2411 N  N     . VAL B 1 7   ? 26.598 21.282  46.224 1.00 17.20 ? 7    VAL B N     1 
ATOM   2412 C  CA    . VAL B 1 7   ? 27.490 21.487  45.096 1.00 15.32 ? 7    VAL B CA    1 
ATOM   2413 C  C     . VAL B 1 7   ? 27.748 20.216  44.288 1.00 15.39 ? 7    VAL B C     1 
ATOM   2414 O  O     . VAL B 1 7   ? 28.069 19.163  44.847 1.00 13.76 ? 7    VAL B O     1 
ATOM   2415 C  CB    . VAL B 1 7   ? 28.873 21.991  45.575 1.00 15.51 ? 7    VAL B CB    1 
ATOM   2416 C  CG1   . VAL B 1 7   ? 29.759 22.255  44.385 1.00 14.70 ? 7    VAL B CG1   1 
ATOM   2417 C  CG2   . VAL B 1 7   ? 28.728 23.227  46.438 1.00 14.51 ? 7    VAL B CG2   1 
ATOM   2418 N  N     . LEU B 1 8   ? 27.610 20.321  42.969 1.00 15.00 ? 8    LEU B N     1 
ATOM   2419 C  CA    . LEU B 1 8   ? 27.906 19.204  42.080 1.00 12.89 ? 8    LEU B CA    1 
ATOM   2420 C  C     . LEU B 1 8   ? 29.257 19.566  41.473 1.00 12.97 ? 8    LEU B C     1 
ATOM   2421 O  O     . LEU B 1 8   ? 29.362 20.478  40.666 1.00 11.90 ? 8    LEU B O     1 
ATOM   2422 C  CB    . LEU B 1 8   ? 26.854 19.054  40.980 1.00 11.29 ? 8    LEU B CB    1 
ATOM   2423 C  CG    . LEU B 1 8   ? 27.133 17.971  39.926 1.00 11.21 ? 8    LEU B CG    1 
ATOM   2424 C  CD1   . LEU B 1 8   ? 27.366 16.627  40.576 1.00 9.85  ? 8    LEU B CD1   1 
ATOM   2425 C  CD2   . LEU B 1 8   ? 25.964 17.895  38.982 1.00 11.98 ? 8    LEU B CD2   1 
ATOM   2426 N  N     . SER B 1 9   ? 30.291 18.860  41.912 1.00 13.92 ? 9    SER B N     1 
ATOM   2427 C  CA    . SER B 1 9   ? 31.647 19.084  41.454 1.00 13.17 ? 9    SER B CA    1 
ATOM   2428 C  C     . SER B 1 9   ? 32.086 17.939  40.540 1.00 14.03 ? 9    SER B C     1 
ATOM   2429 O  O     . SER B 1 9   ? 32.104 16.779  40.948 1.00 13.34 ? 9    SER B O     1 
ATOM   2430 C  CB    . SER B 1 9   ? 32.570 19.172  42.663 1.00 11.64 ? 9    SER B CB    1 
ATOM   2431 O  OG    . SER B 1 9   ? 33.902 19.354  42.252 1.00 11.93 ? 9    SER B OG    1 
ATOM   2432 N  N     . ILE B 1 10  ? 32.435 18.280  39.304 1.00 14.30 ? 10   ILE B N     1 
ATOM   2433 C  CA    . ILE B 1 10  ? 32.875 17.297  38.317 1.00 13.74 ? 10   ILE B CA    1 
ATOM   2434 C  C     . ILE B 1 10  ? 34.334 17.560  37.945 1.00 14.10 ? 10   ILE B C     1 
ATOM   2435 O  O     . ILE B 1 10  ? 34.622 18.404  37.104 1.00 15.11 ? 10   ILE B O     1 
ATOM   2436 C  CB    . ILE B 1 10  ? 32.009 17.382  37.044 1.00 13.20 ? 10   ILE B CB    1 
ATOM   2437 C  CG1   . ILE B 1 10  ? 30.528 17.337  37.417 1.00 13.46 ? 10   ILE B CG1   1 
ATOM   2438 C  CG2   . ILE B 1 10  ? 32.331 16.229  36.124 1.00 13.20 ? 10   ILE B CG2   1 
ATOM   2439 C  CD1   . ILE B 1 10  ? 29.606 17.379  36.235 1.00 11.63 ? 10   ILE B CD1   1 
ATOM   2440 N  N     . GLN B 1 11  ? 35.255 16.846  38.584 1.00 14.45 ? 11   GLN B N     1 
ATOM   2441 C  CA    . GLN B 1 11  ? 36.679 17.022  38.318 1.00 15.01 ? 11   GLN B CA    1 
ATOM   2442 C  C     . GLN B 1 11  ? 37.426 15.726  38.573 1.00 15.88 ? 11   GLN B C     1 
ATOM   2443 O  O     . GLN B 1 11  ? 36.865 14.766  39.107 1.00 17.96 ? 11   GLN B O     1 
ATOM   2444 C  CB    . GLN B 1 11  ? 37.261 18.106  39.221 1.00 15.48 ? 11   GLN B CB    1 
ATOM   2445 C  CG    . GLN B 1 11  ? 36.528 19.423  39.175 1.00 17.03 ? 11   GLN B CG    1 
ATOM   2446 C  CD    . GLN B 1 11  ? 37.131 20.439  40.112 1.00 16.66 ? 11   GLN B CD    1 
ATOM   2447 O  OE1   . GLN B 1 11  ? 38.308 20.765  40.006 1.00 18.46 ? 11   GLN B OE1   1 
ATOM   2448 N  NE2   . GLN B 1 11  ? 36.326 20.949  41.038 1.00 18.46 ? 11   GLN B NE2   1 
ATOM   2449 N  N     . SER B 1 12  ? 38.705 15.715  38.216 1.00 15.36 ? 12   SER B N     1 
ATOM   2450 C  CA    . SER B 1 12  ? 39.537 14.532  38.388 1.00 15.38 ? 12   SER B CA    1 
ATOM   2451 C  C     . SER B 1 12  ? 39.732 14.125  39.845 1.00 16.40 ? 12   SER B C     1 
ATOM   2452 O  O     . SER B 1 12  ? 39.501 14.914  40.767 1.00 15.79 ? 12   SER B O     1 
ATOM   2453 C  CB    . SER B 1 12  ? 40.906 14.766  37.754 1.00 14.63 ? 12   SER B CB    1 
ATOM   2454 O  OG    . SER B 1 12  ? 41.642 15.731  38.485 1.00 16.49 ? 12   SER B OG    1 
ATOM   2455 N  N     . HIS B 1 13  ? 40.161 12.879  40.033 1.00 16.29 ? 13   HIS B N     1 
ATOM   2456 C  CA    . HIS B 1 13  ? 40.434 12.329  41.354 1.00 16.87 ? 13   HIS B CA    1 
ATOM   2457 C  C     . HIS B 1 13  ? 41.795 11.641  41.340 1.00 17.48 ? 13   HIS B C     1 
ATOM   2458 O  O     . HIS B 1 13  ? 42.113 10.914  40.406 1.00 18.24 ? 13   HIS B O     1 
ATOM   2459 C  CB    . HIS B 1 13  ? 39.370 11.295  41.749 1.00 19.51 ? 13   HIS B CB    1 
ATOM   2460 C  CG    . HIS B 1 13  ? 39.687 10.562  43.019 1.00 21.34 ? 13   HIS B CG    1 
ATOM   2461 N  ND1   . HIS B 1 13  ? 39.507 11.122  44.266 1.00 22.84 ? 13   HIS B ND1   1 
ATOM   2462 C  CD2   . HIS B 1 13  ? 40.250 9.348   43.231 1.00 20.48 ? 13   HIS B CD2   1 
ATOM   2463 C  CE1   . HIS B 1 13  ? 39.949 10.286  45.190 1.00 23.20 ? 13   HIS B CE1   1 
ATOM   2464 N  NE2   . HIS B 1 13  ? 40.407 9.202   44.589 1.00 20.33 ? 13   HIS B NE2   1 
ATOM   2465 N  N     . VAL B 1 14  ? 42.604 11.884  42.362 1.00 16.97 ? 14   VAL B N     1 
ATOM   2466 C  CA    . VAL B 1 14  ? 43.902 11.226  42.472 1.00 17.65 ? 14   VAL B CA    1 
ATOM   2467 C  C     . VAL B 1 14  ? 43.932 10.493  43.817 1.00 19.19 ? 14   VAL B C     1 
ATOM   2468 O  O     . VAL B 1 14  ? 43.438 11.010  44.819 1.00 21.31 ? 14   VAL B O     1 
ATOM   2469 C  CB    . VAL B 1 14  ? 45.092 12.231  42.403 1.00 17.63 ? 14   VAL B CB    1 
ATOM   2470 C  CG1   . VAL B 1 14  ? 45.315 12.678  40.974 1.00 15.71 ? 14   VAL B CG1   1 
ATOM   2471 C  CG2   . VAL B 1 14  ? 44.822 13.427  43.295 1.00 18.58 ? 14   VAL B CG2   1 
ATOM   2472 N  N     . VAL B 1 15  ? 44.491 9.288   43.827 1.00 18.38 ? 15   VAL B N     1 
ATOM   2473 C  CA    . VAL B 1 15  ? 44.576 8.485   45.038 1.00 16.82 ? 15   VAL B CA    1 
ATOM   2474 C  C     . VAL B 1 15  ? 45.343 9.262   46.110 1.00 16.83 ? 15   VAL B C     1 
ATOM   2475 O  O     . VAL B 1 15  ? 44.873 9.435   47.249 1.00 14.35 ? 15   VAL B O     1 
ATOM   2476 C  CB    . VAL B 1 15  ? 45.281 7.138   44.729 1.00 16.75 ? 15   VAL B CB    1 
ATOM   2477 C  CG1   . VAL B 1 15  ? 45.418 6.299   45.985 1.00 17.47 ? 15   VAL B CG1   1 
ATOM   2478 C  CG2   . VAL B 1 15  ? 44.482 6.379   43.686 1.00 16.51 ? 15   VAL B CG2   1 
ATOM   2479 N  N     . ARG B 1 16  ? 46.518 9.742   45.717 1.00 15.89 ? 16   ARG B N     1 
ATOM   2480 C  CA    . ARG B 1 16  ? 47.394 10.508  46.591 1.00 15.43 ? 16   ARG B CA    1 
ATOM   2481 C  C     . ARG B 1 16  ? 47.493 11.963  46.123 1.00 14.03 ? 16   ARG B C     1 
ATOM   2482 O  O     . ARG B 1 16  ? 47.384 12.249  44.935 1.00 13.76 ? 16   ARG B O     1 
ATOM   2483 C  CB    . ARG B 1 16  ? 48.789 9.892   46.583 1.00 16.05 ? 16   ARG B CB    1 
ATOM   2484 C  CG    . ARG B 1 16  ? 49.821 10.741  47.274 1.00 17.24 ? 16   ARG B CG    1 
ATOM   2485 C  CD    . ARG B 1 16  ? 51.170 10.544  46.648 1.00 19.59 ? 16   ARG B CD    1 
ATOM   2486 N  NE    . ARG B 1 16  ? 52.151 11.486  47.178 1.00 23.10 ? 16   ARG B NE    1 
ATOM   2487 C  CZ    . ARG B 1 16  ? 52.734 11.389  48.371 1.00 23.37 ? 16   ARG B CZ    1 
ATOM   2488 N  NH1   . ARG B 1 16  ? 52.443 10.378  49.186 1.00 24.13 ? 16   ARG B NH1   1 
ATOM   2489 N  NH2   . ARG B 1 16  ? 53.617 12.309  48.744 1.00 23.41 ? 16   ARG B NH2   1 
ATOM   2490 N  N     . GLY B 1 17  ? 47.694 12.875  47.066 1.00 12.74 ? 17   GLY B N     1 
ATOM   2491 C  CA    . GLY B 1 17  ? 47.830 14.279  46.718 1.00 12.05 ? 17   GLY B CA    1 
ATOM   2492 C  C     . GLY B 1 17  ? 46.537 15.060  46.585 1.00 12.14 ? 17   GLY B C     1 
ATOM   2493 O  O     . GLY B 1 17  ? 45.450 14.541  46.850 1.00 10.36 ? 17   GLY B O     1 
ATOM   2494 N  N     . TYR B 1 18  ? 46.661 16.314  46.158 1.00 11.58 ? 18   TYR B N     1 
ATOM   2495 C  CA    . TYR B 1 18  ? 45.503 17.183  46.002 1.00 12.08 ? 18   TYR B CA    1 
ATOM   2496 C  C     . TYR B 1 18  ? 45.456 17.961  44.694 1.00 13.71 ? 18   TYR B C     1 
ATOM   2497 O  O     . TYR B 1 18  ? 46.251 18.880  44.457 1.00 12.90 ? 18   TYR B O     1 
ATOM   2498 C  CB    . TYR B 1 18  ? 45.427 18.164  47.173 1.00 12.48 ? 18   TYR B CB    1 
ATOM   2499 C  CG    . TYR B 1 18  ? 45.333 17.461  48.493 1.00 12.21 ? 18   TYR B CG    1 
ATOM   2500 C  CD1   . TYR B 1 18  ? 46.484 17.056  49.172 1.00 12.20 ? 18   TYR B CD1   1 
ATOM   2501 C  CD2   . TYR B 1 18  ? 44.093 17.093  49.014 1.00 12.62 ? 18   TYR B CD2   1 
ATOM   2502 C  CE1   . TYR B 1 18  ? 46.400 16.289  50.338 1.00 12.89 ? 18   TYR B CE1   1 
ATOM   2503 C  CE2   . TYR B 1 18  ? 43.995 16.328  50.172 1.00 13.25 ? 18   TYR B CE2   1 
ATOM   2504 C  CZ    . TYR B 1 18  ? 45.152 15.925  50.826 1.00 14.56 ? 18   TYR B CZ    1 
ATOM   2505 O  OH    . TYR B 1 18  ? 45.055 15.128  51.944 1.00 16.82 ? 18   TYR B OH    1 
ATOM   2506 N  N     . VAL B 1 19  ? 44.502 17.580  43.852 1.00 12.95 ? 19   VAL B N     1 
ATOM   2507 C  CA    . VAL B 1 19  ? 44.279 18.222  42.568 1.00 12.25 ? 19   VAL B CA    1 
ATOM   2508 C  C     . VAL B 1 19  ? 42.825 17.917  42.206 1.00 12.49 ? 19   VAL B C     1 
ATOM   2509 O  O     . VAL B 1 19  ? 42.252 16.942  42.700 1.00 13.29 ? 19   VAL B O     1 
ATOM   2510 C  CB    . VAL B 1 19  ? 45.251 17.669  41.497 1.00 10.85 ? 19   VAL B CB    1 
ATOM   2511 C  CG1   . VAL B 1 19  ? 44.913 16.239  41.167 1.00 11.85 ? 19   VAL B CG1   1 
ATOM   2512 C  CG2   . VAL B 1 19  ? 45.192 18.512  40.264 1.00 12.27 ? 19   VAL B CG2   1 
ATOM   2513 N  N     . GLY B 1 20  ? 42.215 18.757  41.375 1.00 11.93 ? 20   GLY B N     1 
ATOM   2514 C  CA    . GLY B 1 20  ? 40.830 18.530  40.995 1.00 11.93 ? 20   GLY B CA    1 
ATOM   2515 C  C     . GLY B 1 20  ? 39.898 18.368  42.184 1.00 12.99 ? 20   GLY B C     1 
ATOM   2516 O  O     . GLY B 1 20  ? 39.947 19.150  43.131 1.00 11.21 ? 20   GLY B O     1 
ATOM   2517 N  N     . ASN B 1 21  ? 39.048 17.344  42.138 1.00 14.33 ? 21   ASN B N     1 
ATOM   2518 C  CA    . ASN B 1 21  ? 38.094 17.070  43.209 1.00 14.41 ? 21   ASN B CA    1 
ATOM   2519 C  C     . ASN B 1 21  ? 38.723 16.843  44.583 1.00 14.83 ? 21   ASN B C     1 
ATOM   2520 O  O     . ASN B 1 21  ? 38.078 17.041  45.611 1.00 12.18 ? 21   ASN B O     1 
ATOM   2521 C  CB    . ASN B 1 21  ? 37.234 15.866  42.834 1.00 16.75 ? 21   ASN B CB    1 
ATOM   2522 C  CG    . ASN B 1 21  ? 35.864 16.269  42.356 1.00 18.63 ? 21   ASN B CG    1 
ATOM   2523 O  OD1   . ASN B 1 21  ? 35.113 15.463  41.808 1.00 20.38 ? 21   ASN B OD1   1 
ATOM   2524 N  ND2   . ASN B 1 21  ? 35.521 17.526  42.575 1.00 19.80 ? 21   ASN B ND2   1 
ATOM   2525 N  N     . ARG B 1 22  ? 39.979 16.420  44.608 1.00 15.03 ? 22   ARG B N     1 
ATOM   2526 C  CA    . ARG B 1 22  ? 40.651 16.190  45.881 1.00 16.43 ? 22   ARG B CA    1 
ATOM   2527 C  C     . ARG B 1 22  ? 40.989 17.509  46.565 1.00 16.58 ? 22   ARG B C     1 
ATOM   2528 O  O     . ARG B 1 22  ? 40.999 17.599  47.797 1.00 17.63 ? 22   ARG B O     1 
ATOM   2529 C  CB    . ARG B 1 22  ? 41.915 15.361  45.661 1.00 16.00 ? 22   ARG B CB    1 
ATOM   2530 C  CG    . ARG B 1 22  ? 41.624 13.884  45.482 1.00 15.35 ? 22   ARG B CG    1 
ATOM   2531 C  CD    . ARG B 1 22  ? 41.508 13.208  46.826 1.00 13.88 ? 22   ARG B CD    1 
ATOM   2532 N  NE    . ARG B 1 22  ? 42.790 13.277  47.516 1.00 13.92 ? 22   ARG B NE    1 
ATOM   2533 C  CZ    . ARG B 1 22  ? 43.127 12.521  48.550 1.00 12.16 ? 22   ARG B CZ    1 
ATOM   2534 N  NH1   . ARG B 1 22  ? 42.273 11.633  49.029 1.00 14.49 ? 22   ARG B NH1   1 
ATOM   2535 N  NH2   . ARG B 1 22  ? 44.329 12.638  49.086 1.00 13.12 ? 22   ARG B NH2   1 
ATOM   2536 N  N     . ALA B 1 23  ? 41.245 18.529  45.753 1.00 16.16 ? 23   ALA B N     1 
ATOM   2537 C  CA    . ALA B 1 23  ? 41.581 19.856  46.249 1.00 16.40 ? 23   ALA B CA    1 
ATOM   2538 C  C     . ALA B 1 23  ? 40.328 20.697  46.505 1.00 16.50 ? 23   ALA B C     1 
ATOM   2539 O  O     . ALA B 1 23  ? 40.372 21.689  47.228 1.00 18.58 ? 23   ALA B O     1 
ATOM   2540 C  CB    . ALA B 1 23  ? 42.481 20.564  45.241 1.00 15.44 ? 23   ALA B CB    1 
ATOM   2541 N  N     . ALA B 1 24  ? 39.208 20.293  45.925 1.00 15.30 ? 24   ALA B N     1 
ATOM   2542 C  CA    . ALA B 1 24  ? 37.979 21.048  46.081 1.00 14.21 ? 24   ALA B CA    1 
ATOM   2543 C  C     . ALA B 1 24  ? 36.981 20.526  47.118 1.00 15.10 ? 24   ALA B C     1 
ATOM   2544 O  O     . ALA B 1 24  ? 36.257 21.319  47.722 1.00 15.88 ? 24   ALA B O     1 
ATOM   2545 C  CB    . ALA B 1 24  ? 37.294 21.166  44.733 1.00 13.52 ? 24   ALA B CB    1 
ATOM   2546 N  N     . THR B 1 25  ? 36.934 19.217  47.340 1.00 12.88 ? 25   THR B N     1 
ATOM   2547 C  CA    . THR B 1 25  ? 35.958 18.682  48.278 1.00 12.18 ? 25   THR B CA    1 
ATOM   2548 C  C     . THR B 1 25  ? 36.203 19.019  49.752 1.00 12.91 ? 25   THR B C     1 
ATOM   2549 O  O     . THR B 1 25  ? 35.323 19.580  50.413 1.00 10.70 ? 25   THR B O     1 
ATOM   2550 C  CB    . THR B 1 25  ? 35.808 17.138  48.128 1.00 12.97 ? 25   THR B CB    1 
ATOM   2551 O  OG1   . THR B 1 25  ? 35.528 16.811  46.761 1.00 12.66 ? 25   THR B OG1   1 
ATOM   2552 C  CG2   . THR B 1 25  ? 34.651 16.625  48.979 1.00 11.20 ? 25   THR B CG2   1 
ATOM   2553 N  N     . PHE B 1 26  ? 37.384 18.689  50.273 1.00 13.14 ? 26   PHE B N     1 
ATOM   2554 C  CA    . PHE B 1 26  ? 37.653 18.953  51.682 1.00 12.76 ? 26   PHE B CA    1 
ATOM   2555 C  C     . PHE B 1 26  ? 37.378 20.401  52.090 1.00 12.59 ? 26   PHE B C     1 
ATOM   2556 O  O     . PHE B 1 26  ? 36.720 20.639  53.100 1.00 11.12 ? 26   PHE B O     1 
ATOM   2557 C  CB    . PHE B 1 26  ? 39.087 18.561  52.064 1.00 12.14 ? 26   PHE B CB    1 
ATOM   2558 C  CG    . PHE B 1 26  ? 39.381 18.731  53.528 1.00 11.42 ? 26   PHE B CG    1 
ATOM   2559 C  CD1   . PHE B 1 26  ? 38.738 17.938  54.479 1.00 9.87  ? 26   PHE B CD1   1 
ATOM   2560 C  CD2   . PHE B 1 26  ? 40.262 19.722  53.964 1.00 11.06 ? 26   PHE B CD2   1 
ATOM   2561 C  CE1   . PHE B 1 26  ? 38.966 18.134  55.849 1.00 9.38  ? 26   PHE B CE1   1 
ATOM   2562 C  CE2   . PHE B 1 26  ? 40.499 19.928  55.334 1.00 8.59  ? 26   PHE B CE2   1 
ATOM   2563 C  CZ    . PHE B 1 26  ? 39.851 19.135  56.274 1.00 8.25  ? 26   PHE B CZ    1 
ATOM   2564 N  N     . PRO B 1 27  ? 37.868 21.387  51.311 1.00 11.80 ? 27   PRO B N     1 
ATOM   2565 C  CA    . PRO B 1 27  ? 37.628 22.795  51.658 1.00 11.01 ? 27   PRO B CA    1 
ATOM   2566 C  C     . PRO B 1 27  ? 36.138 23.136  51.732 1.00 11.37 ? 27   PRO B C     1 
ATOM   2567 O  O     . PRO B 1 27  ? 35.677 23.757  52.687 1.00 11.11 ? 27   PRO B O     1 
ATOM   2568 C  CB    . PRO B 1 27  ? 38.339 23.551  50.543 1.00 10.61 ? 27   PRO B CB    1 
ATOM   2569 C  CG    . PRO B 1 27  ? 39.467 22.628  50.181 1.00 11.01 ? 27   PRO B CG    1 
ATOM   2570 C  CD    . PRO B 1 27  ? 38.782 21.289  50.157 1.00 11.66 ? 27   PRO B CD    1 
ATOM   2571 N  N     . LEU B 1 28  ? 35.382 22.725  50.726 1.00 11.03 ? 28   LEU B N     1 
ATOM   2572 C  CA    . LEU B 1 28  ? 33.956 23.007  50.715 1.00 12.47 ? 28   LEU B CA    1 
ATOM   2573 C  C     . LEU B 1 28  ? 33.229 22.303  51.856 1.00 15.15 ? 28   LEU B C     1 
ATOM   2574 O  O     . LEU B 1 28  ? 32.274 22.843  52.428 1.00 13.96 ? 28   LEU B O     1 
ATOM   2575 C  CB    . LEU B 1 28  ? 33.347 22.596  49.373 1.00 10.46 ? 28   LEU B CB    1 
ATOM   2576 C  CG    . LEU B 1 28  ? 33.678 23.544  48.226 1.00 8.96  ? 28   LEU B CG    1 
ATOM   2577 C  CD1   . LEU B 1 28  ? 33.144 22.975  46.931 1.00 8.84  ? 28   LEU B CD1   1 
ATOM   2578 C  CD2   . LEU B 1 28  ? 33.073 24.919  48.511 1.00 8.75  ? 28   LEU B CD2   1 
ATOM   2579 N  N     . GLN B 1 29  ? 33.678 21.096  52.191 1.00 17.15 ? 29   GLN B N     1 
ATOM   2580 C  CA    . GLN B 1 29  ? 33.049 20.350  53.270 1.00 17.89 ? 29   GLN B CA    1 
ATOM   2581 C  C     . GLN B 1 29  ? 33.283 21.019  54.624 1.00 17.97 ? 29   GLN B C     1 
ATOM   2582 O  O     . GLN B 1 29  ? 32.339 21.176  55.402 1.00 19.55 ? 29   GLN B O     1 
ATOM   2583 C  CB    . GLN B 1 29  ? 33.549 18.902  53.287 1.00 16.76 ? 29   GLN B CB    1 
ATOM   2584 C  CG    . GLN B 1 29  ? 33.110 18.097  52.070 1.00 14.15 ? 29   GLN B CG    1 
ATOM   2585 C  CD    . GLN B 1 29  ? 33.612 16.673  52.115 1.00 12.48 ? 29   GLN B CD    1 
ATOM   2586 O  OE1   . GLN B 1 29  ? 34.800 16.444  52.293 1.00 11.08 ? 29   GLN B OE1   1 
ATOM   2587 N  NE2   . GLN B 1 29  ? 32.712 15.710  51.950 1.00 12.07 ? 29   GLN B NE2   1 
ATOM   2588 N  N     . VAL B 1 30  ? 34.516 21.429  54.919 1.00 16.49 ? 30   VAL B N     1 
ATOM   2589 C  CA    . VAL B 1 30  ? 34.753 22.079  56.206 1.00 15.83 ? 30   VAL B CA    1 
ATOM   2590 C  C     . VAL B 1 30  ? 34.065 23.440  56.243 1.00 16.52 ? 30   VAL B C     1 
ATOM   2591 O  O     . VAL B 1 30  ? 33.782 23.957  57.322 1.00 18.76 ? 30   VAL B O     1 
ATOM   2592 C  CB    . VAL B 1 30  ? 36.262 22.269  56.531 1.00 12.89 ? 30   VAL B CB    1 
ATOM   2593 C  CG1   . VAL B 1 30  ? 36.951 20.941  56.546 1.00 11.22 ? 30   VAL B CG1   1 
ATOM   2594 C  CG2   . VAL B 1 30  ? 36.909 23.199  55.543 1.00 11.63 ? 30   VAL B CG2   1 
ATOM   2595 N  N     . LEU B 1 31  ? 33.791 24.021  55.074 1.00 15.29 ? 31   LEU B N     1 
ATOM   2596 C  CA    . LEU B 1 31  ? 33.114 25.316  55.021 1.00 13.61 ? 31   LEU B CA    1 
ATOM   2597 C  C     . LEU B 1 31  ? 31.593 25.166  55.109 1.00 13.99 ? 31   LEU B C     1 
ATOM   2598 O  O     . LEU B 1 31  ? 30.858 26.146  55.074 1.00 14.02 ? 31   LEU B O     1 
ATOM   2599 C  CB    . LEU B 1 31  ? 33.502 26.080  53.754 1.00 12.68 ? 31   LEU B CB    1 
ATOM   2600 C  CG    . LEU B 1 31  ? 34.888 26.731  53.797 1.00 13.07 ? 31   LEU B CG    1 
ATOM   2601 C  CD1   . LEU B 1 31  ? 35.309 27.167  52.403 1.00 13.34 ? 31   LEU B CD1   1 
ATOM   2602 C  CD2   . LEU B 1 31  ? 34.871 27.912  54.751 1.00 10.19 ? 31   LEU B CD2   1 
ATOM   2603 N  N     . GLY B 1 32  ? 31.121 23.933  55.214 1.00 14.23 ? 32   GLY B N     1 
ATOM   2604 C  CA    . GLY B 1 32  ? 29.697 23.717  55.356 1.00 14.86 ? 32   GLY B CA    1 
ATOM   2605 C  C     . GLY B 1 32  ? 28.899 23.320  54.137 1.00 16.25 ? 32   GLY B C     1 
ATOM   2606 O  O     . GLY B 1 32  ? 27.671 23.240  54.211 1.00 15.34 ? 32   GLY B O     1 
ATOM   2607 N  N     . PHE B 1 33  ? 29.565 23.060  53.018 1.00 17.14 ? 33   PHE B N     1 
ATOM   2608 C  CA    . PHE B 1 33  ? 28.834 22.678  51.810 1.00 17.07 ? 33   PHE B CA    1 
ATOM   2609 C  C     . PHE B 1 33  ? 28.659 21.173  51.615 1.00 16.73 ? 33   PHE B C     1 
ATOM   2610 O  O     . PHE B 1 33  ? 29.534 20.373  51.950 1.00 17.43 ? 33   PHE B O     1 
ATOM   2611 C  CB    . PHE B 1 33  ? 29.499 23.280  50.569 1.00 15.78 ? 33   PHE B CB    1 
ATOM   2612 C  CG    . PHE B 1 33  ? 29.460 24.775  50.537 1.00 15.66 ? 33   PHE B CG    1 
ATOM   2613 C  CD1   . PHE B 1 33  ? 30.293 25.525  51.361 1.00 15.00 ? 33   PHE B CD1   1 
ATOM   2614 C  CD2   . PHE B 1 33  ? 28.562 25.439  49.709 1.00 16.36 ? 33   PHE B CD2   1 
ATOM   2615 C  CE1   . PHE B 1 33  ? 30.231 26.918  51.358 1.00 16.37 ? 33   PHE B CE1   1 
ATOM   2616 C  CE2   . PHE B 1 33  ? 28.491 26.834  49.700 1.00 16.57 ? 33   PHE B CE2   1 
ATOM   2617 C  CZ    . PHE B 1 33  ? 29.327 27.575  50.527 1.00 15.19 ? 33   PHE B CZ    1 
ATOM   2618 N  N     . GLU B 1 34  ? 27.499 20.800  51.087 1.00 16.21 ? 34   GLU B N     1 
ATOM   2619 C  CA    . GLU B 1 34  ? 27.184 19.408  50.804 1.00 16.35 ? 34   GLU B CA    1 
ATOM   2620 C  C     . GLU B 1 34  ? 27.759 19.193  49.406 1.00 16.42 ? 34   GLU B C     1 
ATOM   2621 O  O     . GLU B 1 34  ? 27.259 19.754  48.438 1.00 17.85 ? 34   GLU B O     1 
ATOM   2622 C  CB    . GLU B 1 34  ? 25.669 19.217  50.800 1.00 14.90 ? 34   GLU B CB    1 
ATOM   2623 C  CG    . GLU B 1 34  ? 25.197 17.778  50.713 1.00 18.13 ? 34   GLU B CG    1 
ATOM   2624 C  CD    . GLU B 1 34  ? 25.574 16.948  51.936 1.00 19.92 ? 34   GLU B CD    1 
ATOM   2625 O  OE1   . GLU B 1 34  ? 26.346 15.976  51.776 1.00 18.86 ? 34   GLU B OE1   1 
ATOM   2626 O  OE2   . GLU B 1 34  ? 25.098 17.266  53.054 1.00 21.25 ? 34   GLU B OE2   1 
ATOM   2627 N  N     . VAL B 1 35  ? 28.817 18.398  49.299 1.00 16.15 ? 35   VAL B N     1 
ATOM   2628 C  CA    . VAL B 1 35  ? 29.453 18.172  48.008 1.00 15.99 ? 35   VAL B CA    1 
ATOM   2629 C  C     . VAL B 1 35  ? 29.200 16.813  47.375 1.00 15.13 ? 35   VAL B C     1 
ATOM   2630 O  O     . VAL B 1 35  ? 29.503 15.777  47.958 1.00 15.09 ? 35   VAL B O     1 
ATOM   2631 C  CB    . VAL B 1 35  ? 30.981 18.351  48.106 1.00 15.45 ? 35   VAL B CB    1 
ATOM   2632 C  CG1   . VAL B 1 35  ? 31.601 18.270  46.729 1.00 14.77 ? 35   VAL B CG1   1 
ATOM   2633 C  CG2   . VAL B 1 35  ? 31.309 19.677  48.767 1.00 17.34 ? 35   VAL B CG2   1 
ATOM   2634 N  N     . ASP B 1 36  ? 28.642 16.832  46.171 1.00 15.39 ? 36   ASP B N     1 
ATOM   2635 C  CA    . ASP B 1 36  ? 28.387 15.619  45.406 1.00 16.14 ? 36   ASP B CA    1 
ATOM   2636 C  C     . ASP B 1 36  ? 29.523 15.591  44.391 1.00 16.75 ? 36   ASP B C     1 
ATOM   2637 O  O     . ASP B 1 36  ? 29.611 16.469  43.543 1.00 17.58 ? 36   ASP B O     1 
ATOM   2638 C  CB    . ASP B 1 36  ? 27.035 15.716  44.705 1.00 15.96 ? 36   ASP B CB    1 
ATOM   2639 C  CG    . ASP B 1 36  ? 25.875 15.397  45.634 1.00 18.37 ? 36   ASP B CG    1 
ATOM   2640 O  OD1   . ASP B 1 36  ? 26.076 15.423  46.866 1.00 19.87 ? 36   ASP B OD1   1 
ATOM   2641 O  OD2   . ASP B 1 36  ? 24.761 15.122  45.139 1.00 20.35 ? 36   ASP B OD2   1 
ATOM   2642 N  N     . ALA B 1 37  ? 30.404 14.600  44.480 1.00 16.77 ? 37   ALA B N     1 
ATOM   2643 C  CA    . ALA B 1 37  ? 31.546 14.544  43.576 1.00 17.47 ? 37   ALA B CA    1 
ATOM   2644 C  C     . ALA B 1 37  ? 31.503 13.470  42.504 1.00 18.64 ? 37   ALA B C     1 
ATOM   2645 O  O     . ALA B 1 37  ? 31.338 12.288  42.798 1.00 21.09 ? 37   ALA B O     1 
ATOM   2646 C  CB    . ALA B 1 37  ? 32.817 14.394  44.374 1.00 16.70 ? 37   ALA B CB    1 
ATOM   2647 N  N     . VAL B 1 38  ? 31.656 13.903  41.259 1.00 17.16 ? 38   VAL B N     1 
ATOM   2648 C  CA    . VAL B 1 38  ? 31.688 13.012  40.118 1.00 16.30 ? 38   VAL B CA    1 
ATOM   2649 C  C     . VAL B 1 38  ? 33.149 13.053  39.718 1.00 17.08 ? 38   VAL B C     1 
ATOM   2650 O  O     . VAL B 1 38  ? 33.662 14.111  39.370 1.00 15.37 ? 38   VAL B O     1 
ATOM   2651 C  CB    . VAL B 1 38  ? 30.828 13.548  38.937 1.00 17.62 ? 38   VAL B CB    1 
ATOM   2652 C  CG1   . VAL B 1 38  ? 31.076 12.701  37.677 1.00 15.35 ? 38   VAL B CG1   1 
ATOM   2653 C  CG2   . VAL B 1 38  ? 29.342 13.538  39.312 1.00 13.02 ? 38   VAL B CG2   1 
ATOM   2654 N  N     . ASN B 1 39  ? 33.829 11.915  39.789 1.00 17.73 ? 39   ASN B N     1 
ATOM   2655 C  CA    . ASN B 1 39  ? 35.236 11.881  39.416 1.00 18.97 ? 39   ASN B CA    1 
ATOM   2656 C  C     . ASN B 1 39  ? 35.388 11.603  37.934 1.00 18.57 ? 39   ASN B C     1 
ATOM   2657 O  O     . ASN B 1 39  ? 35.077 10.516  37.455 1.00 18.47 ? 39   ASN B O     1 
ATOM   2658 C  CB    . ASN B 1 39  ? 35.971 10.830  40.239 1.00 20.92 ? 39   ASN B CB    1 
ATOM   2659 C  CG    . ASN B 1 39  ? 35.891 11.110  41.717 1.00 19.39 ? 39   ASN B CG    1 
ATOM   2660 O  OD1   . ASN B 1 39  ? 36.060 12.244  42.139 1.00 22.17 ? 39   ASN B OD1   1 
ATOM   2661 N  ND2   . ASN B 1 39  ? 35.639 10.083  42.508 1.00 21.73 ? 39   ASN B ND2   1 
ATOM   2662 N  N     . SER B 1 40  ? 35.865 12.605  37.207 1.00 17.51 ? 40   SER B N     1 
ATOM   2663 C  CA    . SER B 1 40  ? 36.038 12.481  35.769 1.00 17.66 ? 40   SER B CA    1 
ATOM   2664 C  C     . SER B 1 40  ? 37.138 11.489  35.398 1.00 18.02 ? 40   SER B C     1 
ATOM   2665 O  O     . SER B 1 40  ? 37.153 10.968  34.285 1.00 18.80 ? 40   SER B O     1 
ATOM   2666 C  CB    . SER B 1 40  ? 36.312 13.859  35.158 1.00 15.61 ? 40   SER B CB    1 
ATOM   2667 O  OG    . SER B 1 40  ? 37.444 14.464  35.747 1.00 16.54 ? 40   SER B OG    1 
ATOM   2668 N  N     . VAL B 1 41  ? 38.060 11.238  36.325 1.00 17.71 ? 41   VAL B N     1 
ATOM   2669 C  CA    . VAL B 1 41  ? 39.148 10.278  36.113 1.00 16.27 ? 41   VAL B CA    1 
ATOM   2670 C  C     . VAL B 1 41  ? 39.651 9.849   37.484 1.00 17.16 ? 41   VAL B C     1 
ATOM   2671 O  O     . VAL B 1 41  ? 39.325 10.479  38.490 1.00 20.39 ? 41   VAL B O     1 
ATOM   2672 C  CB    . VAL B 1 41  ? 40.360 10.884  35.356 1.00 15.34 ? 41   VAL B CB    1 
ATOM   2673 C  CG1   . VAL B 1 41  ? 39.907 11.572  34.102 1.00 16.12 ? 41   VAL B CG1   1 
ATOM   2674 C  CG2   . VAL B 1 41  ? 41.116 11.847  36.253 1.00 14.81 ? 41   VAL B CG2   1 
ATOM   2675 N  N     . GLN B 1 42  ? 40.419 8.770   37.525 1.00 15.69 ? 42   GLN B N     1 
ATOM   2676 C  CA    . GLN B 1 42  ? 41.003 8.316   38.768 1.00 15.88 ? 42   GLN B CA    1 
ATOM   2677 C  C     . GLN B 1 42  ? 42.420 7.883   38.476 1.00 18.02 ? 42   GLN B C     1 
ATOM   2678 O  O     . GLN B 1 42  ? 42.648 6.837   37.874 1.00 18.41 ? 42   GLN B O     1 
ATOM   2679 C  CB    . GLN B 1 42  ? 40.237 7.146   39.396 1.00 16.88 ? 42   GLN B CB    1 
ATOM   2680 C  CG    . GLN B 1 42  ? 40.992 6.544   40.606 1.00 17.08 ? 42   GLN B CG    1 
ATOM   2681 C  CD    . GLN B 1 42  ? 40.168 5.581   41.446 1.00 16.69 ? 42   GLN B CD    1 
ATOM   2682 O  OE1   . GLN B 1 42  ? 39.560 4.649   40.928 1.00 19.70 ? 42   GLN B OE1   1 
ATOM   2683 N  NE2   . GLN B 1 42  ? 40.161 5.797   42.756 1.00 15.60 ? 42   GLN B NE2   1 
ATOM   2684 N  N     . PHE B 1 43  ? 43.370 8.711   38.892 1.00 20.22 ? 43   PHE B N     1 
ATOM   2685 C  CA    . PHE B 1 43  ? 44.782 8.434   38.707 1.00 21.48 ? 43   PHE B CA    1 
ATOM   2686 C  C     . PHE B 1 43  ? 45.445 8.216   40.057 1.00 21.81 ? 43   PHE B C     1 
ATOM   2687 O  O     . PHE B 1 43  ? 44.873 8.544   41.089 1.00 20.55 ? 43   PHE B O     1 
ATOM   2688 C  CB    . PHE B 1 43  ? 45.445 9.589   37.958 1.00 23.19 ? 43   PHE B CB    1 
ATOM   2689 C  CG    . PHE B 1 43  ? 45.203 9.552   36.490 1.00 26.65 ? 43   PHE B CG    1 
ATOM   2690 C  CD1   . PHE B 1 43  ? 44.620 10.622  35.835 1.00 30.33 ? 43   PHE B CD1   1 
ATOM   2691 C  CD2   . PHE B 1 43  ? 45.518 8.413   35.761 1.00 30.25 ? 43   PHE B CD2   1 
ATOM   2692 C  CE1   . PHE B 1 43  ? 44.345 10.557  34.468 1.00 32.44 ? 43   PHE B CE1   1 
ATOM   2693 C  CE2   . PHE B 1 43  ? 45.250 8.333   34.396 1.00 31.95 ? 43   PHE B CE2   1 
ATOM   2694 C  CZ    . PHE B 1 43  ? 44.660 9.407   33.749 1.00 32.17 ? 43   PHE B CZ    1 
ATOM   2695 N  N     . SER B 1 44  ? 46.644 7.649   40.043 1.00 22.29 ? 44   SER B N     1 
ATOM   2696 C  CA    . SER B 1 44  ? 47.381 7.377   41.272 1.00 23.17 ? 44   SER B CA    1 
ATOM   2697 C  C     . SER B 1 44  ? 47.886 8.669   41.893 1.00 23.92 ? 44   SER B C     1 
ATOM   2698 O  O     . SER B 1 44  ? 48.032 8.773   43.115 1.00 23.54 ? 44   SER B O     1 
ATOM   2699 C  CB    . SER B 1 44  ? 48.579 6.476   40.973 1.00 23.74 ? 44   SER B CB    1 
ATOM   2700 O  OG    . SER B 1 44  ? 49.485 7.121   40.082 1.00 22.90 ? 44   SER B OG    1 
ATOM   2701 N  N     . ASN B 1 45  ? 48.148 9.653   41.038 1.00 23.51 ? 45   ASN B N     1 
ATOM   2702 C  CA    . ASN B 1 45  ? 48.671 10.939  41.479 1.00 23.42 ? 45   ASN B CA    1 
ATOM   2703 C  C     . ASN B 1 45  ? 48.633 11.896  40.294 1.00 23.17 ? 45   ASN B C     1 
ATOM   2704 O  O     . ASN B 1 45  ? 48.208 11.511  39.207 1.00 22.93 ? 45   ASN B O     1 
ATOM   2705 C  CB    . ASN B 1 45  ? 50.103 10.738  41.958 1.00 23.12 ? 45   ASN B CB    1 
ATOM   2706 C  CG    . ASN B 1 45  ? 50.924 9.933   40.971 1.00 22.66 ? 45   ASN B CG    1 
ATOM   2707 O  OD1   . ASN B 1 45  ? 51.337 10.444  39.929 1.00 24.01 ? 45   ASN B OD1   1 
ATOM   2708 N  ND2   . ASN B 1 45  ? 51.144 8.660   41.281 1.00 21.25 ? 45   ASN B ND2   1 
ATOM   2709 N  N     . HIS B 1 46  ? 49.078 13.135  40.482 1.00 23.00 ? 46   HIS B N     1 
ATOM   2710 C  CA    . HIS B 1 46  ? 49.037 14.073  39.371 1.00 22.86 ? 46   HIS B CA    1 
ATOM   2711 C  C     . HIS B 1 46  ? 50.230 13.928  38.444 1.00 23.85 ? 46   HIS B C     1 
ATOM   2712 O  O     . HIS B 1 46  ? 51.224 13.291  38.801 1.00 23.43 ? 46   HIS B O     1 
ATOM   2713 C  CB    . HIS B 1 46  ? 48.869 15.520  39.871 1.00 22.02 ? 46   HIS B CB    1 
ATOM   2714 C  CG    . HIS B 1 46  ? 50.048 16.077  40.605 1.00 21.02 ? 46   HIS B CG    1 
ATOM   2715 N  ND1   . HIS B 1 46  ? 51.280 16.260  40.012 1.00 20.82 ? 46   HIS B ND1   1 
ATOM   2716 C  CD2   . HIS B 1 46  ? 50.154 16.587  41.854 1.00 21.67 ? 46   HIS B CD2   1 
ATOM   2717 C  CE1   . HIS B 1 46  ? 52.091 16.862  40.864 1.00 20.38 ? 46   HIS B CE1   1 
ATOM   2718 N  NE2   . HIS B 1 46  ? 51.433 17.073  41.989 1.00 21.52 ? 46   HIS B NE2   1 
ATOM   2719 N  N     . THR B 1 47  ? 50.114 14.500  37.247 1.00 24.84 ? 47   THR B N     1 
ATOM   2720 C  CA    . THR B 1 47  ? 51.161 14.404  36.225 1.00 25.70 ? 47   THR B CA    1 
ATOM   2721 C  C     . THR B 1 47  ? 52.466 15.151  36.496 1.00 27.08 ? 47   THR B C     1 
ATOM   2722 O  O     . THR B 1 47  ? 53.345 15.191  35.640 1.00 28.35 ? 47   THR B O     1 
ATOM   2723 C  CB    . THR B 1 47  ? 50.622 14.832  34.837 1.00 26.10 ? 47   THR B CB    1 
ATOM   2724 O  OG1   . THR B 1 47  ? 50.245 16.213  34.862 1.00 27.79 ? 47   THR B OG1   1 
ATOM   2725 C  CG2   . THR B 1 47  ? 49.405 14.004  34.471 1.00 24.00 ? 47   THR B CG2   1 
ATOM   2726 N  N     . GLY B 1 48  ? 52.595 15.739  37.679 1.00 27.77 ? 48   GLY B N     1 
ATOM   2727 C  CA    . GLY B 1 48  ? 53.824 16.430  38.015 1.00 27.71 ? 48   GLY B CA    1 
ATOM   2728 C  C     . GLY B 1 48  ? 54.866 15.416  38.455 1.00 29.01 ? 48   GLY B C     1 
ATOM   2729 O  O     . GLY B 1 48  ? 56.044 15.746  38.569 1.00 31.27 ? 48   GLY B O     1 
ATOM   2730 N  N     . TYR B 1 49  ? 54.423 14.186  38.719 1.00 28.41 ? 49   TYR B N     1 
ATOM   2731 C  CA    . TYR B 1 49  ? 55.306 13.096  39.134 1.00 28.18 ? 49   TYR B CA    1 
ATOM   2732 C  C     . TYR B 1 49  ? 55.882 12.468  37.865 1.00 28.53 ? 49   TYR B C     1 
ATOM   2733 O  O     . TYR B 1 49  ? 55.373 12.716  36.776 1.00 28.27 ? 49   TYR B O     1 
ATOM   2734 C  CB    . TYR B 1 49  ? 54.513 12.039  39.916 1.00 28.16 ? 49   TYR B CB    1 
ATOM   2735 C  CG    . TYR B 1 49  ? 54.048 12.477  41.289 1.00 26.66 ? 49   TYR B CG    1 
ATOM   2736 C  CD1   . TYR B 1 49  ? 54.638 11.961  42.440 1.00 26.80 ? 49   TYR B CD1   1 
ATOM   2737 C  CD2   . TYR B 1 49  ? 53.008 13.397  41.439 1.00 25.56 ? 49   TYR B CD2   1 
ATOM   2738 C  CE1   . TYR B 1 49  ? 54.204 12.348  43.709 1.00 27.86 ? 49   TYR B CE1   1 
ATOM   2739 C  CE2   . TYR B 1 49  ? 52.565 13.791  42.704 1.00 24.24 ? 49   TYR B CE2   1 
ATOM   2740 C  CZ    . TYR B 1 49  ? 53.167 13.265  43.832 1.00 26.11 ? 49   TYR B CZ    1 
ATOM   2741 O  OH    . TYR B 1 49  ? 52.748 13.662  45.084 1.00 25.85 ? 49   TYR B OH    1 
ATOM   2742 N  N     . SER B 1 50  ? 56.931 11.659  37.994 1.00 29.22 ? 50   SER B N     1 
ATOM   2743 C  CA    . SER B 1 50  ? 57.532 11.025  36.819 1.00 29.81 ? 50   SER B CA    1 
ATOM   2744 C  C     . SER B 1 50  ? 56.704 9.867   36.275 1.00 29.68 ? 50   SER B C     1 
ATOM   2745 O  O     . SER B 1 50  ? 56.863 9.464   35.126 1.00 31.52 ? 50   SER B O     1 
ATOM   2746 C  CB    . SER B 1 50  ? 58.955 10.553  37.126 1.00 30.16 ? 50   SER B CB    1 
ATOM   2747 O  OG    . SER B 1 50  ? 59.091 10.178  38.479 1.00 33.49 ? 50   SER B OG    1 
ATOM   2748 N  N     . HIS B 1 51  ? 55.812 9.339   37.098 1.00 29.18 ? 51   HIS B N     1 
ATOM   2749 C  CA    . HIS B 1 51  ? 54.956 8.245   36.676 1.00 29.99 ? 51   HIS B CA    1 
ATOM   2750 C  C     . HIS B 1 51  ? 53.534 8.515   37.114 1.00 29.23 ? 51   HIS B C     1 
ATOM   2751 O  O     . HIS B 1 51  ? 53.293 9.324   38.006 1.00 31.25 ? 51   HIS B O     1 
ATOM   2752 C  CB    . HIS B 1 51  ? 55.415 6.939   37.310 1.00 32.97 ? 51   HIS B CB    1 
ATOM   2753 C  CG    . HIS B 1 51  ? 56.790 6.521   36.900 1.00 36.66 ? 51   HIS B CG    1 
ATOM   2754 N  ND1   . HIS B 1 51  ? 57.064 5.981   35.661 1.00 35.32 ? 51   HIS B ND1   1 
ATOM   2755 C  CD2   . HIS B 1 51  ? 57.973 6.589   37.556 1.00 36.41 ? 51   HIS B CD2   1 
ATOM   2756 C  CE1   . HIS B 1 51  ? 58.360 5.733   35.573 1.00 35.69 ? 51   HIS B CE1   1 
ATOM   2757 N  NE2   . HIS B 1 51  ? 58.933 6.092   36.708 1.00 36.74 ? 51   HIS B NE2   1 
ATOM   2758 N  N     . TRP B 1 52  ? 52.592 7.840   36.479 1.00 27.15 ? 52   TRP B N     1 
ATOM   2759 C  CA    . TRP B 1 52  ? 51.199 7.978   36.840 1.00 25.77 ? 52   TRP B CA    1 
ATOM   2760 C  C     . TRP B 1 52  ? 50.391 6.963   36.063 1.00 24.95 ? 52   TRP B C     1 
ATOM   2761 O  O     . TRP B 1 52  ? 50.665 6.697   34.892 1.00 25.31 ? 52   TRP B O     1 
ATOM   2762 C  CB    . TRP B 1 52  ? 50.702 9.396   36.568 1.00 27.06 ? 52   TRP B CB    1 
ATOM   2763 C  CG    . TRP B 1 52  ? 50.545 9.757   35.133 1.00 29.46 ? 52   TRP B CG    1 
ATOM   2764 C  CD1   . TRP B 1 52  ? 49.543 9.364   34.285 1.00 29.59 ? 52   TRP B CD1   1 
ATOM   2765 C  CD2   . TRP B 1 52  ? 51.380 10.646  34.385 1.00 31.11 ? 52   TRP B CD2   1 
ATOM   2766 N  NE1   . TRP B 1 52  ? 49.701 9.964   33.055 1.00 32.45 ? 52   TRP B NE1   1 
ATOM   2767 C  CE2   . TRP B 1 52  ? 50.818 10.758  33.090 1.00 31.60 ? 52   TRP B CE2   1 
ATOM   2768 C  CE3   . TRP B 1 52  ? 52.544 11.368  34.686 1.00 31.57 ? 52   TRP B CE3   1 
ATOM   2769 C  CZ2   . TRP B 1 52  ? 51.387 11.560  32.093 1.00 31.18 ? 52   TRP B CZ2   1 
ATOM   2770 C  CZ3   . TRP B 1 52  ? 53.111 12.166  33.696 1.00 31.83 ? 52   TRP B CZ3   1 
ATOM   2771 C  CH2   . TRP B 1 52  ? 52.526 12.257  32.414 1.00 32.09 ? 52   TRP B CH2   1 
ATOM   2772 N  N     . LYS B 1 53  ? 49.409 6.379   36.735 1.00 22.66 ? 53   LYS B N     1 
ATOM   2773 C  CA    . LYS B 1 53  ? 48.554 5.387   36.124 1.00 21.74 ? 53   LYS B CA    1 
ATOM   2774 C  C     . LYS B 1 53  ? 47.134 5.625   36.596 1.00 21.67 ? 53   LYS B C     1 
ATOM   2775 O  O     . LYS B 1 53  ? 46.925 6.153   37.690 1.00 23.49 ? 53   LYS B O     1 
ATOM   2776 C  CB    . LYS B 1 53  ? 49.025 3.986   36.516 1.00 22.06 ? 53   LYS B CB    1 
ATOM   2777 C  CG    . LYS B 1 53  ? 50.367 3.618   35.907 1.00 24.06 ? 53   LYS B CG    1 
ATOM   2778 C  CD    . LYS B 1 53  ? 50.778 2.204   36.248 1.00 26.67 ? 53   LYS B CD    1 
ATOM   2779 C  CE    . LYS B 1 53  ? 51.967 1.792   35.403 1.00 29.16 ? 53   LYS B CE    1 
ATOM   2780 N  NZ    . LYS B 1 53  ? 51.616 1.865   33.954 1.00 32.22 ? 53   LYS B NZ    1 
ATOM   2781 N  N     . GLY B 1 54  ? 46.161 5.252   35.771 1.00 20.34 ? 54   GLY B N     1 
ATOM   2782 C  CA    . GLY B 1 54  ? 44.774 5.428   36.153 1.00 19.97 ? 54   GLY B CA    1 
ATOM   2783 C  C     . GLY B 1 54  ? 43.804 5.212   35.013 1.00 21.31 ? 54   GLY B C     1 
ATOM   2784 O  O     . GLY B 1 54  ? 44.192 4.831   33.911 1.00 22.64 ? 54   GLY B O     1 
ATOM   2785 N  N     . GLN B 1 55  ? 42.531 5.463   35.276 1.00 22.18 ? 55   GLN B N     1 
ATOM   2786 C  CA    . GLN B 1 55  ? 41.511 5.283   34.261 1.00 24.99 ? 55   GLN B CA    1 
ATOM   2787 C  C     . GLN B 1 55  ? 40.723 6.570   34.022 1.00 25.48 ? 55   GLN B C     1 
ATOM   2788 O  O     . GLN B 1 55  ? 40.608 7.413   34.909 1.00 27.09 ? 55   GLN B O     1 
ATOM   2789 C  CB    . GLN B 1 55  ? 40.541 4.174   34.679 1.00 28.21 ? 55   GLN B CB    1 
ATOM   2790 C  CG    . GLN B 1 55  ? 41.193 2.864   35.106 1.00 32.79 ? 55   GLN B CG    1 
ATOM   2791 C  CD    . GLN B 1 55  ? 41.866 2.942   36.472 1.00 34.46 ? 55   GLN B CD    1 
ATOM   2792 O  OE1   . GLN B 1 55  ? 41.301 3.477   37.429 1.00 35.00 ? 55   GLN B OE1   1 
ATOM   2793 N  NE2   . GLN B 1 55  ? 43.075 2.389   36.570 1.00 35.80 ? 55   GLN B NE2   1 
ATOM   2794 N  N     . VAL B 1 56  ? 40.179 6.715   32.820 1.00 24.92 ? 56   VAL B N     1 
ATOM   2795 C  CA    . VAL B 1 56  ? 39.389 7.887   32.485 1.00 25.07 ? 56   VAL B CA    1 
ATOM   2796 C  C     . VAL B 1 56  ? 37.931 7.526   32.274 1.00 24.83 ? 56   VAL B C     1 
ATOM   2797 O  O     . VAL B 1 56  ? 37.597 6.393   31.936 1.00 24.50 ? 56   VAL B O     1 
ATOM   2798 C  CB    . VAL B 1 56  ? 39.897 8.588   31.209 1.00 25.51 ? 56   VAL B CB    1 
ATOM   2799 C  CG1   . VAL B 1 56  ? 40.831 9.719   31.578 1.00 27.33 ? 56   VAL B CG1   1 
ATOM   2800 C  CG2   . VAL B 1 56  ? 40.618 7.610   30.332 1.00 26.36 ? 56   VAL B CG2   1 
ATOM   2801 N  N     . LEU B 1 57  ? 37.070 8.508   32.492 1.00 24.47 ? 57   LEU B N     1 
ATOM   2802 C  CA    . LEU B 1 57  ? 35.638 8.343   32.321 1.00 24.70 ? 57   LEU B CA    1 
ATOM   2803 C  C     . LEU B 1 57  ? 35.285 9.023   30.991 1.00 25.98 ? 57   LEU B C     1 
ATOM   2804 O  O     . LEU B 1 57  ? 35.783 10.116  30.703 1.00 25.17 ? 57   LEU B O     1 
ATOM   2805 C  CB    . LEU B 1 57  ? 34.899 9.045   33.462 1.00 24.66 ? 57   LEU B CB    1 
ATOM   2806 C  CG    . LEU B 1 57  ? 33.740 8.327   34.140 1.00 24.74 ? 57   LEU B CG    1 
ATOM   2807 C  CD1   . LEU B 1 57  ? 34.332 7.287   35.064 1.00 27.31 ? 57   LEU B CD1   1 
ATOM   2808 C  CD2   . LEU B 1 57  ? 32.878 9.299   34.934 1.00 23.05 ? 57   LEU B CD2   1 
ATOM   2809 N  N     . ASN B 1 58  ? 34.456 8.381   30.170 1.00 26.18 ? 58   ASN B N     1 
ATOM   2810 C  CA    . ASN B 1 58  ? 34.056 9.001   28.913 1.00 26.63 ? 58   ASN B CA    1 
ATOM   2811 C  C     . ASN B 1 58  ? 32.709 9.676   29.113 1.00 28.08 ? 58   ASN B C     1 
ATOM   2812 O  O     . ASN B 1 58  ? 32.027 9.430   30.111 1.00 28.74 ? 58   ASN B O     1 
ATOM   2813 C  CB    . ASN B 1 58  ? 33.979 7.980   27.762 1.00 26.52 ? 58   ASN B CB    1 
ATOM   2814 C  CG    . ASN B 1 58  ? 33.057 6.811   28.056 1.00 27.08 ? 58   ASN B CG    1 
ATOM   2815 O  OD1   . ASN B 1 58  ? 31.916 6.984   28.484 1.00 27.38 ? 58   ASN B OD1   1 
ATOM   2816 N  ND2   . ASN B 1 58  ? 33.547 5.604   27.800 1.00 28.07 ? 58   ASN B ND2   1 
ATOM   2817 N  N     . SER B 1 59  ? 32.334 10.533  28.173 1.00 28.04 ? 59   SER B N     1 
ATOM   2818 C  CA    . SER B 1 59  ? 31.067 11.248  28.259 1.00 28.10 ? 59   SER B CA    1 
ATOM   2819 C  C     . SER B 1 59  ? 29.855 10.365  28.539 1.00 27.60 ? 59   SER B C     1 
ATOM   2820 O  O     . SER B 1 59  ? 28.893 10.817  29.150 1.00 26.32 ? 59   SER B O     1 
ATOM   2821 C  CB    . SER B 1 59  ? 30.834 12.029  26.973 1.00 30.00 ? 59   SER B CB    1 
ATOM   2822 O  OG    . SER B 1 59  ? 31.018 11.186  25.845 1.00 33.44 ? 59   SER B OG    1 
ATOM   2823 N  N     . ASP B 1 60  ? 29.894 9.115   28.091 1.00 27.83 ? 60   ASP B N     1 
ATOM   2824 C  CA    . ASP B 1 60  ? 28.779 8.204   28.313 1.00 28.70 ? 60   ASP B CA    1 
ATOM   2825 C  C     . ASP B 1 60  ? 28.664 7.806   29.769 1.00 27.37 ? 60   ASP B C     1 
ATOM   2826 O  O     . ASP B 1 60  ? 27.570 7.732   30.320 1.00 25.87 ? 60   ASP B O     1 
ATOM   2827 C  CB    . ASP B 1 60  ? 28.943 6.945   27.481 1.00 34.10 ? 60   ASP B CB    1 
ATOM   2828 C  CG    . ASP B 1 60  ? 28.844 7.210   25.996 1.00 38.01 ? 60   ASP B CG    1 
ATOM   2829 O  OD1   . ASP B 1 60  ? 27.901 7.920   25.576 1.00 41.70 ? 60   ASP B OD1   1 
ATOM   2830 O  OD2   . ASP B 1 60  ? 29.700 6.686   25.248 1.00 40.06 ? 60   ASP B OD2   1 
ATOM   2831 N  N     . GLU B 1 61  ? 29.801 7.536   30.392 1.00 26.24 ? 61   GLU B N     1 
ATOM   2832 C  CA    . GLU B 1 61  ? 29.803 7.148   31.787 1.00 26.37 ? 61   GLU B CA    1 
ATOM   2833 C  C     . GLU B 1 61  ? 29.361 8.318   32.655 1.00 27.17 ? 61   GLU B C     1 
ATOM   2834 O  O     . GLU B 1 61  ? 28.670 8.127   33.653 1.00 26.56 ? 61   GLU B O     1 
ATOM   2835 C  CB    . GLU B 1 61  ? 31.186 6.657   32.177 1.00 25.63 ? 61   GLU B CB    1 
ATOM   2836 C  CG    . GLU B 1 61  ? 31.622 5.488   31.326 1.00 24.48 ? 61   GLU B CG    1 
ATOM   2837 C  CD    . GLU B 1 61  ? 32.992 4.985   31.682 1.00 24.80 ? 61   GLU B CD    1 
ATOM   2838 O  OE1   . GLU B 1 61  ? 33.086 3.882   32.250 1.00 29.77 ? 61   GLU B OE1   1 
ATOM   2839 O  OE2   . GLU B 1 61  ? 33.980 5.689   31.403 1.00 24.13 ? 61   GLU B OE2   1 
ATOM   2840 N  N     . LEU B 1 62  ? 29.751 9.531   32.271 1.00 27.61 ? 62   LEU B N     1 
ATOM   2841 C  CA    . LEU B 1 62  ? 29.340 10.717  33.008 1.00 27.41 ? 62   LEU B CA    1 
ATOM   2842 C  C     . LEU B 1 62  ? 27.815 10.781  32.965 1.00 27.93 ? 62   LEU B C     1 
ATOM   2843 O  O     . LEU B 1 62  ? 27.163 10.982  33.987 1.00 28.58 ? 62   LEU B O     1 
ATOM   2844 C  CB    . LEU B 1 62  ? 29.926 11.984  32.377 1.00 27.38 ? 62   LEU B CB    1 
ATOM   2845 C  CG    . LEU B 1 62  ? 29.280 13.309  32.822 1.00 28.02 ? 62   LEU B CG    1 
ATOM   2846 C  CD1   . LEU B 1 62  ? 29.426 13.503  34.319 1.00 24.82 ? 62   LEU B CD1   1 
ATOM   2847 C  CD2   . LEU B 1 62  ? 29.920 14.459  32.071 1.00 29.21 ? 62   LEU B CD2   1 
ATOM   2848 N  N     . GLN B 1 63  ? 27.253 10.600  31.776 1.00 28.67 ? 63   GLN B N     1 
ATOM   2849 C  CA    . GLN B 1 63  ? 25.806 10.629  31.601 1.00 30.18 ? 63   GLN B CA    1 
ATOM   2850 C  C     . GLN B 1 63  ? 25.082 9.570   32.435 1.00 29.29 ? 63   GLN B C     1 
ATOM   2851 O  O     . GLN B 1 63  ? 24.004 9.829   32.963 1.00 29.36 ? 63   GLN B O     1 
ATOM   2852 C  CB    . GLN B 1 63  ? 25.452 10.443  30.127 1.00 33.09 ? 63   GLN B CB    1 
ATOM   2853 C  CG    . GLN B 1 63  ? 23.975 10.220  29.893 1.00 37.42 ? 63   GLN B CG    1 
ATOM   2854 C  CD    . GLN B 1 63  ? 23.366 11.278  29.013 1.00 41.56 ? 63   GLN B CD    1 
ATOM   2855 O  OE1   . GLN B 1 63  ? 23.765 11.451  27.857 1.00 44.34 ? 63   GLN B OE1   1 
ATOM   2856 N  NE2   . GLN B 1 63  ? 22.388 11.997  29.551 1.00 44.32 ? 63   GLN B NE2   1 
ATOM   2857 N  N     . GLU B 1 64  ? 25.664 8.377   32.531 1.00 28.48 ? 64   GLU B N     1 
ATOM   2858 C  CA    . GLU B 1 64  ? 25.072 7.293   33.313 1.00 28.02 ? 64   GLU B CA    1 
ATOM   2859 C  C     . GLU B 1 64  ? 24.886 7.725   34.764 1.00 25.66 ? 64   GLU B C     1 
ATOM   2860 O  O     . GLU B 1 64  ? 23.827 7.520   35.355 1.00 23.99 ? 64   GLU B O     1 
ATOM   2861 C  CB    . GLU B 1 64  ? 25.976 6.060   33.287 1.00 30.90 ? 64   GLU B CB    1 
ATOM   2862 C  CG    . GLU B 1 64  ? 25.828 5.158   32.087 1.00 36.28 ? 64   GLU B CG    1 
ATOM   2863 C  CD    . GLU B 1 64  ? 26.915 4.090   32.048 1.00 40.85 ? 64   GLU B CD    1 
ATOM   2864 O  OE1   . GLU B 1 64  ? 27.232 3.507   33.113 1.00 43.34 ? 64   GLU B OE1   1 
ATOM   2865 O  OE2   . GLU B 1 64  ? 27.452 3.827   30.951 1.00 42.92 ? 64   GLU B OE2   1 
ATOM   2866 N  N     . LEU B 1 65  ? 25.938 8.315   35.329 1.00 23.31 ? 65   LEU B N     1 
ATOM   2867 C  CA    . LEU B 1 65  ? 25.927 8.777   36.709 1.00 21.43 ? 65   LEU B CA    1 
ATOM   2868 C  C     . LEU B 1 65  ? 24.858 9.835   36.924 1.00 22.06 ? 65   LEU B C     1 
ATOM   2869 O  O     . LEU B 1 65  ? 24.062 9.737   37.857 1.00 22.51 ? 65   LEU B O     1 
ATOM   2870 C  CB    . LEU B 1 65  ? 27.301 9.326   37.086 1.00 17.86 ? 65   LEU B CB    1 
ATOM   2871 C  CG    . LEU B 1 65  ? 28.413 8.277   37.132 1.00 16.50 ? 65   LEU B CG    1 
ATOM   2872 C  CD1   . LEU B 1 65  ? 29.768 8.942   37.323 1.00 16.27 ? 65   LEU B CD1   1 
ATOM   2873 C  CD2   . LEU B 1 65  ? 28.120 7.296   38.247 1.00 14.15 ? 65   LEU B CD2   1 
ATOM   2874 N  N     . TYR B 1 66  ? 24.835 10.841  36.056 1.00 23.27 ? 66   TYR B N     1 
ATOM   2875 C  CA    . TYR B 1 66  ? 23.841 11.898  36.159 1.00 24.01 ? 66   TYR B CA    1 
ATOM   2876 C  C     . TYR B 1 66  ? 22.433 11.302  36.069 1.00 25.02 ? 66   TYR B C     1 
ATOM   2877 O  O     . TYR B 1 66  ? 21.519 11.718  36.782 1.00 25.48 ? 66   TYR B O     1 
ATOM   2878 C  CB    . TYR B 1 66  ? 24.036 12.926  35.045 1.00 23.77 ? 66   TYR B CB    1 
ATOM   2879 C  CG    . TYR B 1 66  ? 22.973 13.997  35.057 1.00 26.64 ? 66   TYR B CG    1 
ATOM   2880 C  CD1   . TYR B 1 66  ? 22.886 14.908  36.108 1.00 27.72 ? 66   TYR B CD1   1 
ATOM   2881 C  CD2   . TYR B 1 66  ? 22.025 14.075  34.040 1.00 26.83 ? 66   TYR B CD2   1 
ATOM   2882 C  CE1   . TYR B 1 66  ? 21.878 15.868  36.144 1.00 29.37 ? 66   TYR B CE1   1 
ATOM   2883 C  CE2   . TYR B 1 66  ? 21.014 15.026  34.066 1.00 27.48 ? 66   TYR B CE2   1 
ATOM   2884 C  CZ    . TYR B 1 66  ? 20.945 15.920  35.117 1.00 29.81 ? 66   TYR B CZ    1 
ATOM   2885 O  OH    . TYR B 1 66  ? 19.942 16.867  35.143 1.00 31.26 ? 66   TYR B OH    1 
ATOM   2886 N  N     . ASP B 1 67  ? 22.268 10.324  35.187 1.00 26.39 ? 67   ASP B N     1 
ATOM   2887 C  CA    . ASP B 1 67  ? 20.985 9.658   35.000 1.00 27.50 ? 67   ASP B CA    1 
ATOM   2888 C  C     . ASP B 1 67  ? 20.500 8.995   36.288 1.00 26.29 ? 67   ASP B C     1 
ATOM   2889 O  O     . ASP B 1 67  ? 19.299 8.965   36.573 1.00 23.36 ? 67   ASP B O     1 
ATOM   2890 C  CB    . ASP B 1 67  ? 21.111 8.597   33.914 1.00 32.00 ? 67   ASP B CB    1 
ATOM   2891 C  CG    . ASP B 1 67  ? 20.202 8.858   32.756 1.00 36.67 ? 67   ASP B CG    1 
ATOM   2892 O  OD1   . ASP B 1 67  ? 19.313 9.729   32.903 1.00 39.62 ? 67   ASP B OD1   1 
ATOM   2893 O  OD2   . ASP B 1 67  ? 20.369 8.191   31.710 1.00 39.16 ? 67   ASP B OD2   1 
ATOM   2894 N  N     . GLY B 1 68  ? 21.448 8.448   37.048 1.00 25.73 ? 68   GLY B N     1 
ATOM   2895 C  CA    . GLY B 1 68  ? 21.122 7.796   38.301 1.00 23.90 ? 68   GLY B CA    1 
ATOM   2896 C  C     . GLY B 1 68  ? 20.537 8.794   39.281 1.00 23.50 ? 68   GLY B C     1 
ATOM   2897 O  O     . GLY B 1 68  ? 19.551 8.511   39.955 1.00 22.77 ? 68   GLY B O     1 
ATOM   2898 N  N     . LEU B 1 69  ? 21.149 9.970   39.362 1.00 22.68 ? 69   LEU B N     1 
ATOM   2899 C  CA    . LEU B 1 69  ? 20.674 11.019  40.250 1.00 22.32 ? 69   LEU B CA    1 
ATOM   2900 C  C     . LEU B 1 69  ? 19.295 11.475  39.802 1.00 23.27 ? 69   LEU B C     1 
ATOM   2901 O  O     . LEU B 1 69  ? 18.394 11.657  40.616 1.00 24.14 ? 69   LEU B O     1 
ATOM   2902 C  CB    . LEU B 1 69  ? 21.635 12.203  40.212 1.00 21.76 ? 69   LEU B CB    1 
ATOM   2903 C  CG    . LEU B 1 69  ? 23.090 11.902  40.584 1.00 20.57 ? 69   LEU B CG    1 
ATOM   2904 C  CD1   . LEU B 1 69  ? 23.937 13.133  40.328 1.00 18.22 ? 69   LEU B CD1   1 
ATOM   2905 C  CD2   . LEU B 1 69  ? 23.176 11.461  42.035 1.00 17.91 ? 69   LEU B CD2   1 
ATOM   2906 N  N     . LYS B 1 70  ? 19.147 11.657  38.495 1.00 24.78 ? 70   LYS B N     1 
ATOM   2907 C  CA    . LYS B 1 70  ? 17.895 12.089  37.878 1.00 25.04 ? 70   LYS B CA    1 
ATOM   2908 C  C     . LYS B 1 70  ? 16.768 11.075  38.110 1.00 25.15 ? 70   LYS B C     1 
ATOM   2909 O  O     . LYS B 1 70  ? 15.647 11.463  38.465 1.00 25.15 ? 70   LYS B O     1 
ATOM   2910 C  CB    . LYS B 1 70  ? 18.136 12.286  36.379 1.00 27.88 ? 70   LYS B CB    1 
ATOM   2911 C  CG    . LYS B 1 70  ? 17.017 12.921  35.559 1.00 31.07 ? 70   LYS B CG    1 
ATOM   2912 C  CD    . LYS B 1 70  ? 17.519 13.047  34.114 1.00 34.26 ? 70   LYS B CD    1 
ATOM   2913 C  CE    . LYS B 1 70  ? 16.450 13.496  33.115 1.00 35.95 ? 70   LYS B CE    1 
ATOM   2914 N  NZ    . LYS B 1 70  ? 16.139 14.952  33.150 1.00 35.65 ? 70   LYS B NZ    1 
ATOM   2915 N  N     . LEU B 1 71  ? 17.060 9.786   37.906 1.00 23.45 ? 71   LEU B N     1 
ATOM   2916 C  CA    . LEU B 1 71  ? 16.063 8.727   38.102 1.00 22.45 ? 71   LEU B CA    1 
ATOM   2917 C  C     . LEU B 1 71  ? 15.551 8.684   39.544 1.00 22.98 ? 71   LEU B C     1 
ATOM   2918 O  O     . LEU B 1 71  ? 14.420 8.260   39.794 1.00 21.59 ? 71   LEU B O     1 
ATOM   2919 C  CB    . LEU B 1 71  ? 16.650 7.358   37.741 1.00 22.32 ? 71   LEU B CB    1 
ATOM   2920 C  CG    . LEU B 1 71  ? 16.909 7.005   36.273 1.00 20.88 ? 71   LEU B CG    1 
ATOM   2921 C  CD1   . LEU B 1 71  ? 17.704 5.710   36.195 1.00 20.05 ? 71   LEU B CD1   1 
ATOM   2922 C  CD2   . LEU B 1 71  ? 15.594 6.869   35.532 1.00 18.00 ? 71   LEU B CD2   1 
ATOM   2923 N  N     . ASN B 1 72  ? 16.395 9.114   40.485 1.00 23.08 ? 72   ASN B N     1 
ATOM   2924 C  CA    . ASN B 1 72  ? 16.048 9.139   41.904 1.00 23.81 ? 72   ASN B CA    1 
ATOM   2925 C  C     . ASN B 1 72  ? 15.508 10.498  42.358 1.00 26.16 ? 72   ASN B C     1 
ATOM   2926 O  O     . ASN B 1 72  ? 15.237 10.708  43.545 1.00 26.35 ? 72   ASN B O     1 
ATOM   2927 C  CB    . ASN B 1 72  ? 17.265 8.766   42.749 1.00 23.03 ? 72   ASN B CB    1 
ATOM   2928 C  CG    . ASN B 1 72  ? 17.592 7.289   42.674 1.00 23.61 ? 72   ASN B CG    1 
ATOM   2929 O  OD1   . ASN B 1 72  ? 16.734 6.444   42.924 1.00 24.58 ? 72   ASN B OD1   1 
ATOM   2930 N  ND2   . ASN B 1 72  ? 18.839 6.969   42.342 1.00 22.46 ? 72   ASN B ND2   1 
ATOM   2931 N  N     . HIS B 1 73  ? 15.363 11.415  41.406 1.00 27.36 ? 73   HIS B N     1 
ATOM   2932 C  CA    . HIS B 1 73  ? 14.846 12.748  41.677 1.00 27.43 ? 73   HIS B CA    1 
ATOM   2933 C  C     . HIS B 1 73  ? 15.692 13.507  42.679 1.00 26.19 ? 73   HIS B C     1 
ATOM   2934 O  O     . HIS B 1 73  ? 15.171 14.307  43.452 1.00 25.81 ? 73   HIS B O     1 
ATOM   2935 C  CB    . HIS B 1 73  ? 13.417 12.654  42.200 1.00 30.87 ? 73   HIS B CB    1 
ATOM   2936 C  CG    . HIS B 1 73  ? 12.514 11.844  41.331 1.00 35.06 ? 73   HIS B CG    1 
ATOM   2937 N  ND1   . HIS B 1 73  ? 12.207 12.205  40.034 1.00 38.60 ? 73   HIS B ND1   1 
ATOM   2938 C  CD2   . HIS B 1 73  ? 11.873 10.674  41.557 1.00 36.26 ? 73   HIS B CD2   1 
ATOM   2939 C  CE1   . HIS B 1 73  ? 11.419 11.290  39.500 1.00 38.17 ? 73   HIS B CE1   1 
ATOM   2940 N  NE2   . HIS B 1 73  ? 11.201 10.349  40.403 1.00 38.74 ? 73   HIS B NE2   1 
ATOM   2941 N  N     . VAL B 1 74  ? 16.994 13.252  42.679 1.00 25.88 ? 74   VAL B N     1 
ATOM   2942 C  CA    . VAL B 1 74  ? 17.884 13.952  43.592 1.00 27.28 ? 74   VAL B CA    1 
ATOM   2943 C  C     . VAL B 1 74  ? 18.895 14.781  42.821 1.00 28.62 ? 74   VAL B C     1 
ATOM   2944 O  O     . VAL B 1 74  ? 20.033 14.952  43.257 1.00 30.00 ? 74   VAL B O     1 
ATOM   2945 C  CB    . VAL B 1 74  ? 18.646 12.985  44.527 1.00 26.45 ? 74   VAL B CB    1 
ATOM   2946 C  CG1   . VAL B 1 74  ? 17.663 12.271  45.433 1.00 24.58 ? 74   VAL B CG1   1 
ATOM   2947 C  CG2   . VAL B 1 74  ? 19.475 11.995  43.709 1.00 25.58 ? 74   VAL B CG2   1 
ATOM   2948 N  N     . ASN B 1 75  ? 18.469 15.288  41.666 1.00 30.02 ? 75   ASN B N     1 
ATOM   2949 C  CA    . ASN B 1 75  ? 19.321 16.116  40.829 1.00 30.35 ? 75   ASN B CA    1 
ATOM   2950 C  C     . ASN B 1 75  ? 19.002 17.596  41.042 1.00 30.21 ? 75   ASN B C     1 
ATOM   2951 O  O     . ASN B 1 75  ? 18.798 18.346  40.087 1.00 31.49 ? 75   ASN B O     1 
ATOM   2952 C  CB    . ASN B 1 75  ? 19.145 15.737  39.352 1.00 31.39 ? 75   ASN B CB    1 
ATOM   2953 C  CG    . ASN B 1 75  ? 17.745 16.024  38.832 1.00 32.85 ? 75   ASN B CG    1 
ATOM   2954 O  OD1   . ASN B 1 75  ? 16.749 15.674  39.468 1.00 32.58 ? 75   ASN B OD1   1 
ATOM   2955 N  ND2   . ASN B 1 75  ? 17.665 16.653  37.660 1.00 32.24 ? 75   ASN B ND2   1 
ATOM   2956 N  N     . GLN B 1 76  ? 18.934 18.002  42.308 1.00 29.52 ? 76   GLN B N     1 
ATOM   2957 C  CA    . GLN B 1 76  ? 18.679 19.389  42.663 1.00 29.04 ? 76   GLN B CA    1 
ATOM   2958 C  C     . GLN B 1 76  ? 19.973 19.949  43.216 1.00 27.62 ? 76   GLN B C     1 
ATOM   2959 O  O     . GLN B 1 76  ? 20.454 19.494  44.249 1.00 27.39 ? 76   GLN B O     1 
ATOM   2960 C  CB    . GLN B 1 76  ? 17.615 19.510  43.749 1.00 31.73 ? 76   GLN B CB    1 
ATOM   2961 C  CG    . GLN B 1 76  ? 16.191 19.337  43.301 1.00 37.72 ? 76   GLN B CG    1 
ATOM   2962 C  CD    . GLN B 1 76  ? 15.647 17.983  43.678 1.00 43.58 ? 76   GLN B CD    1 
ATOM   2963 O  OE1   . GLN B 1 76  ? 15.654 17.052  42.869 1.00 46.64 ? 76   GLN B OE1   1 
ATOM   2964 N  NE2   . GLN B 1 76  ? 15.182 17.854  44.922 1.00 44.85 ? 76   GLN B NE2   1 
ATOM   2965 N  N     . TYR B 1 77  ? 20.538 20.936  42.533 1.00 26.60 ? 77   TYR B N     1 
ATOM   2966 C  CA    . TYR B 1 77  ? 21.780 21.541  42.988 1.00 24.54 ? 77   TYR B CA    1 
ATOM   2967 C  C     . TYR B 1 77  ? 21.714 23.055  43.076 1.00 23.17 ? 77   TYR B C     1 
ATOM   2968 O  O     . TYR B 1 77  ? 20.862 23.693  42.458 1.00 22.40 ? 77   TYR B O     1 
ATOM   2969 C  CB    . TYR B 1 77  ? 22.935 21.125  42.079 1.00 23.98 ? 77   TYR B CB    1 
ATOM   2970 C  CG    . TYR B 1 77  ? 23.251 19.656  42.197 1.00 25.09 ? 77   TYR B CG    1 
ATOM   2971 C  CD1   . TYR B 1 77  ? 22.634 18.722  41.368 1.00 24.89 ? 77   TYR B CD1   1 
ATOM   2972 C  CD2   . TYR B 1 77  ? 24.130 19.191  43.173 1.00 24.49 ? 77   TYR B CD2   1 
ATOM   2973 C  CE1   . TYR B 1 77  ? 22.885 17.358  41.512 1.00 24.50 ? 77   TYR B CE1   1 
ATOM   2974 C  CE2   . TYR B 1 77  ? 24.383 17.835  43.324 1.00 24.70 ? 77   TYR B CE2   1 
ATOM   2975 C  CZ    . TYR B 1 77  ? 23.758 16.923  42.491 1.00 23.73 ? 77   TYR B CZ    1 
ATOM   2976 O  OH    . TYR B 1 77  ? 23.999 15.576  42.652 1.00 24.57 ? 77   TYR B OH    1 
ATOM   2977 N  N     . ASP B 1 78  ? 22.618 23.617  43.868 1.00 20.85 ? 78   ASP B N     1 
ATOM   2978 C  CA    . ASP B 1 78  ? 22.691 25.052  44.049 1.00 19.17 ? 78   ASP B CA    1 
ATOM   2979 C  C     . ASP B 1 78  ? 23.901 25.588  43.299 1.00 17.92 ? 78   ASP B C     1 
ATOM   2980 O  O     . ASP B 1 78  ? 23.906 26.725  42.837 1.00 16.51 ? 78   ASP B O     1 
ATOM   2981 C  CB    . ASP B 1 78  ? 22.793 25.370  45.539 1.00 19.74 ? 78   ASP B CB    1 
ATOM   2982 C  CG    . ASP B 1 78  ? 21.561 24.943  46.297 1.00 19.08 ? 78   ASP B CG    1 
ATOM   2983 O  OD1   . ASP B 1 78  ? 20.469 25.438  45.961 1.00 17.99 ? 78   ASP B OD1   1 
ATOM   2984 O  OD2   . ASP B 1 78  ? 21.673 24.108  47.216 1.00 20.14 ? 78   ASP B OD2   1 
ATOM   2985 N  N     . TYR B 1 79  ? 24.921 24.747  43.183 1.00 16.56 ? 79   TYR B N     1 
ATOM   2986 C  CA    . TYR B 1 79  ? 26.151 25.094  42.494 1.00 16.54 ? 79   TYR B CA    1 
ATOM   2987 C  C     . TYR B 1 79  ? 26.666 23.886  41.707 1.00 17.87 ? 79   TYR B C     1 
ATOM   2988 O  O     . TYR B 1 79  ? 26.452 22.730  42.093 1.00 18.83 ? 79   TYR B O     1 
ATOM   2989 C  CB    . TYR B 1 79  ? 27.256 25.463  43.492 1.00 16.92 ? 79   TYR B CB    1 
ATOM   2990 C  CG    . TYR B 1 79  ? 27.066 26.791  44.208 1.00 17.92 ? 79   TYR B CG    1 
ATOM   2991 C  CD1   . TYR B 1 79  ? 26.167 26.892  45.275 1.00 16.96 ? 79   TYR B CD1   1 
ATOM   2992 C  CD2   . TYR B 1 79  ? 27.810 27.899  43.803 1.00 19.24 ? 79   TYR B CD2   1 
ATOM   2993 C  CE1   . TYR B 1 79  ? 26.007 28.116  45.934 1.00 18.06 ? 79   TYR B CE1   1 
ATOM   2994 C  CE2   . TYR B 1 79  ? 27.649 29.122  44.458 1.00 19.72 ? 79   TYR B CE2   1 
ATOM   2995 C  CZ    . TYR B 1 79  ? 26.747 29.231  45.523 1.00 19.83 ? 79   TYR B CZ    1 
ATOM   2996 O  OH    . TYR B 1 79  ? 26.591 30.424  46.154 1.00 22.69 ? 79   TYR B OH    1 
ATOM   2997 N  N     . VAL B 1 80  ? 27.312 24.201  40.613 1.00 16.22 ? 80   VAL B N     1 
ATOM   2998 C  CA    . VAL B 1 80  ? 28.024 23.224  39.782 1.00 14.38 ? 80   VAL B CA    1 
ATOM   2999 C  C     . VAL B 1 80  ? 29.423 23.777  39.658 1.00 15.10 ? 80   VAL B C     1 
ATOM   3000 O  O     . VAL B 1 80  ? 29.610 24.977  39.440 1.00 16.51 ? 80   VAL B O     1 
ATOM   3001 C  CB    . VAL B 1 80  ? 27.382 23.077  38.397 1.00 14.13 ? 80   VAL B CB    1 
ATOM   3002 C  CG1   . VAL B 1 80  ? 28.160 22.122  37.479 1.00 10.01 ? 80   VAL B CG1   1 
ATOM   3003 C  CG2   . VAL B 1 80  ? 25.956 22.528  38.439 1.00 10.54 ? 80   VAL B CG2   1 
ATOM   3004 N  N     . LEU B 1 81  ? 30.398 22.933  39.815 1.00 14.65 ? 81   LEU B N     1 
ATOM   3005 C  CA    . LEU B 1 81  ? 31.784 23.394  39.780 1.00 14.37 ? 81   LEU B CA    1 
ATOM   3006 C  C     . LEU B 1 81  ? 32.617 22.466  38.909 1.00 14.93 ? 81   LEU B C     1 
ATOM   3007 O  O     . LEU B 1 81  ? 32.669 21.260  39.164 1.00 16.13 ? 81   LEU B O     1 
ATOM   3008 C  CB    . LEU B 1 81  ? 32.306 23.425  41.227 1.00 13.23 ? 81   LEU B CB    1 
ATOM   3009 C  CG    . LEU B 1 81  ? 33.826 23.532  41.367 1.00 12.15 ? 81   LEU B CG    1 
ATOM   3010 C  CD1   . LEU B 1 81  ? 34.371 24.901  40.957 1.00 11.13 ? 81   LEU B CD1   1 
ATOM   3011 C  CD2   . LEU B 1 81  ? 34.295 23.313  42.812 1.00 10.68 ? 81   LEU B CD2   1 
ATOM   3012 N  N     . THR B 1 82  ? 33.260 23.023  37.885 1.00 13.78 ? 82   THR B N     1 
ATOM   3013 C  CA    . THR B 1 82  ? 34.092 22.226  36.984 1.00 14.07 ? 82   THR B CA    1 
ATOM   3014 C  C     . THR B 1 82  ? 35.457 22.866  36.782 1.00 15.54 ? 82   THR B C     1 
ATOM   3015 O  O     . THR B 1 82  ? 35.632 24.068  36.993 1.00 15.11 ? 82   THR B O     1 
ATOM   3016 C  CB    . THR B 1 82  ? 33.457 22.075  35.587 1.00 12.99 ? 82   THR B CB    1 
ATOM   3017 O  OG1   . THR B 1 82  ? 33.377 23.362  34.969 1.00 13.88 ? 82   THR B OG1   1 
ATOM   3018 C  CG2   . THR B 1 82  ? 32.067 21.458  35.670 1.00 9.58  ? 82   THR B CG2   1 
ATOM   3019 N  N     . GLY B 1 83  ? 36.418 22.052  36.359 1.00 17.07 ? 83   GLY B N     1 
ATOM   3020 C  CA    . GLY B 1 83  ? 37.757 22.551  36.121 1.00 19.35 ? 83   GLY B CA    1 
ATOM   3021 C  C     . GLY B 1 83  ? 38.399 21.895  34.919 1.00 21.83 ? 83   GLY B C     1 
ATOM   3022 O  O     . GLY B 1 83  ? 37.813 21.850  33.839 1.00 21.84 ? 83   GLY B O     1 
ATOM   3023 N  N     . TYR B 1 84  ? 39.607 21.374  35.111 1.00 24.63 ? 84   TYR B N     1 
ATOM   3024 C  CA    . TYR B 1 84  ? 40.343 20.724  34.035 1.00 28.06 ? 84   TYR B CA    1 
ATOM   3025 C  C     . TYR B 1 84  ? 39.540 19.627  33.338 1.00 29.89 ? 84   TYR B C     1 
ATOM   3026 O  O     . TYR B 1 84  ? 38.846 18.846  33.981 1.00 30.22 ? 84   TYR B O     1 
ATOM   3027 C  CB    . TYR B 1 84  ? 41.643 20.129  34.566 1.00 29.16 ? 84   TYR B CB    1 
ATOM   3028 C  CG    . TYR B 1 84  ? 42.542 19.611  33.476 1.00 33.12 ? 84   TYR B CG    1 
ATOM   3029 C  CD1   . TYR B 1 84  ? 43.385 20.469  32.773 1.00 37.13 ? 84   TYR B CD1   1 
ATOM   3030 C  CD2   . TYR B 1 84  ? 42.522 18.268  33.112 1.00 35.29 ? 84   TYR B CD2   1 
ATOM   3031 C  CE1   . TYR B 1 84  ? 44.191 20.001  31.726 1.00 38.79 ? 84   TYR B CE1   1 
ATOM   3032 C  CE2   . TYR B 1 84  ? 43.320 17.787  32.069 1.00 37.32 ? 84   TYR B CE2   1 
ATOM   3033 C  CZ    . TYR B 1 84  ? 44.150 18.657  31.382 1.00 38.44 ? 84   TYR B CZ    1 
ATOM   3034 O  OH    . TYR B 1 84  ? 44.934 18.179  30.360 1.00 39.80 ? 84   TYR B OH    1 
ATOM   3035 N  N     . THR B 1 85  ? 39.631 19.604  32.011 1.00 31.68 ? 85   THR B N     1 
ATOM   3036 C  CA    . THR B 1 85  ? 38.971 18.622  31.154 1.00 32.29 ? 85   THR B CA    1 
ATOM   3037 C  C     . THR B 1 85  ? 39.829 18.590  29.906 1.00 34.80 ? 85   THR B C     1 
ATOM   3038 O  O     . THR B 1 85  ? 40.308 19.624  29.444 1.00 34.86 ? 85   THR B O     1 
ATOM   3039 C  CB    . THR B 1 85  ? 37.563 19.033  30.742 1.00 31.76 ? 85   THR B CB    1 
ATOM   3040 O  OG1   . THR B 1 85  ? 36.812 19.403  31.900 1.00 33.18 ? 85   THR B OG1   1 
ATOM   3041 C  CG2   . THR B 1 85  ? 36.870 17.871  30.058 1.00 32.43 ? 85   THR B CG2   1 
ATOM   3042 N  N     . ARG B 1 86  ? 40.012 17.407  29.346 1.00 37.05 ? 86   ARG B N     1 
ATOM   3043 C  CA    . ARG B 1 86  ? 40.873 17.264  28.180 1.00 38.94 ? 86   ARG B CA    1 
ATOM   3044 C  C     . ARG B 1 86  ? 40.117 16.679  26.998 1.00 37.30 ? 86   ARG B C     1 
ATOM   3045 O  O     . ARG B 1 86  ? 40.670 16.510  25.917 1.00 38.37 ? 86   ARG B O     1 
ATOM   3046 C  CB    . ARG B 1 86  ? 42.047 16.365  28.577 1.00 42.45 ? 86   ARG B CB    1 
ATOM   3047 C  CG    . ARG B 1 86  ? 43.052 16.022  27.503 1.00 46.69 ? 86   ARG B CG    1 
ATOM   3048 C  CD    . ARG B 1 86  ? 43.603 14.624  27.776 1.00 51.79 ? 86   ARG B CD    1 
ATOM   3049 N  NE    . ARG B 1 86  ? 42.745 13.584  27.208 1.00 56.18 ? 86   ARG B NE    1 
ATOM   3050 C  CZ    . ARG B 1 86  ? 42.704 13.285  25.909 1.00 58.59 ? 86   ARG B CZ    1 
ATOM   3051 N  NH1   . ARG B 1 86  ? 43.477 13.948  25.052 1.00 58.86 ? 86   ARG B NH1   1 
ATOM   3052 N  NH2   . ARG B 1 86  ? 41.887 12.335  25.463 1.00 59.01 ? 86   ARG B NH2   1 
ATOM   3053 N  N     . ASP B 1 87  ? 38.838 16.408  27.211 1.00 34.50 ? 87   ASP B N     1 
ATOM   3054 C  CA    . ASP B 1 87  ? 37.981 15.808  26.204 1.00 33.89 ? 87   ASP B CA    1 
ATOM   3055 C  C     . ASP B 1 87  ? 36.773 16.704  25.907 1.00 34.60 ? 87   ASP B C     1 
ATOM   3056 O  O     . ASP B 1 87  ? 35.914 16.897  26.766 1.00 34.47 ? 87   ASP B O     1 
ATOM   3057 C  CB    . ASP B 1 87  ? 37.559 14.435  26.737 1.00 33.59 ? 87   ASP B CB    1 
ATOM   3058 C  CG    . ASP B 1 87  ? 36.377 13.839  26.011 1.00 32.42 ? 87   ASP B CG    1 
ATOM   3059 O  OD1   . ASP B 1 87  ? 35.870 12.807  26.490 1.00 32.60 ? 87   ASP B OD1   1 
ATOM   3060 O  OD2   . ASP B 1 87  ? 35.950 14.381  24.979 1.00 32.51 ? 87   ASP B OD2   1 
ATOM   3061 N  N     . LYS B 1 88  ? 36.703 17.241  24.687 1.00 34.97 ? 88   LYS B N     1 
ATOM   3062 C  CA    . LYS B 1 88  ? 35.606 18.133  24.313 1.00 35.60 ? 88   LYS B CA    1 
ATOM   3063 C  C     . LYS B 1 88  ? 34.234 17.487  24.417 1.00 34.44 ? 88   LYS B C     1 
ATOM   3064 O  O     . LYS B 1 88  ? 33.238 18.153  24.697 1.00 33.84 ? 88   LYS B O     1 
ATOM   3065 C  CB    . LYS B 1 88  ? 35.803 18.680  22.893 1.00 38.98 ? 88   LYS B CB    1 
ATOM   3066 C  CG    . LYS B 1 88  ? 35.574 17.690  21.763 1.00 42.61 ? 88   LYS B CG    1 
ATOM   3067 C  CD    . LYS B 1 88  ? 35.825 18.364  20.411 1.00 46.90 ? 88   LYS B CD    1 
ATOM   3068 C  CE    . LYS B 1 88  ? 35.791 17.374  19.241 1.00 49.48 ? 88   LYS B CE    1 
ATOM   3069 N  NZ    . LYS B 1 88  ? 34.570 17.525  18.378 1.00 51.35 ? 88   LYS B NZ    1 
ATOM   3070 N  N     . SER B 1 89  ? 34.182 16.184  24.193 1.00 33.91 ? 89   SER B N     1 
ATOM   3071 C  CA    . SER B 1 89  ? 32.927 15.457  24.262 1.00 33.14 ? 89   SER B CA    1 
ATOM   3072 C  C     . SER B 1 89  ? 32.387 15.453  25.697 1.00 31.99 ? 89   SER B C     1 
ATOM   3073 O  O     . SER B 1 89  ? 31.179 15.573  25.928 1.00 31.68 ? 89   SER B O     1 
ATOM   3074 C  CB    . SER B 1 89  ? 33.145 14.034  23.772 1.00 33.19 ? 89   SER B CB    1 
ATOM   3075 O  OG    . SER B 1 89  ? 31.906 13.410  23.517 1.00 38.46 ? 89   SER B OG    1 
ATOM   3076 N  N     . PHE B 1 90  ? 33.298 15.317  26.652 1.00 30.56 ? 90   PHE B N     1 
ATOM   3077 C  CA    . PHE B 1 90  ? 32.962 15.313  28.070 1.00 29.20 ? 90   PHE B CA    1 
ATOM   3078 C  C     . PHE B 1 90  ? 32.453 16.707  28.484 1.00 28.16 ? 90   PHE B C     1 
ATOM   3079 O  O     . PHE B 1 90  ? 31.437 16.842  29.180 1.00 25.03 ? 90   PHE B O     1 
ATOM   3080 C  CB    . PHE B 1 90  ? 34.217 14.967  28.873 1.00 29.22 ? 90   PHE B CB    1 
ATOM   3081 C  CG    . PHE B 1 90  ? 33.952 14.629  30.312 1.00 29.73 ? 90   PHE B CG    1 
ATOM   3082 C  CD1   . PHE B 1 90  ? 33.599 13.340  30.681 1.00 28.54 ? 90   PHE B CD1   1 
ATOM   3083 C  CD2   . PHE B 1 90  ? 34.070 15.602  31.301 1.00 30.59 ? 90   PHE B CD2   1 
ATOM   3084 C  CE1   . PHE B 1 90  ? 33.371 13.023  32.008 1.00 30.22 ? 90   PHE B CE1   1 
ATOM   3085 C  CE2   . PHE B 1 90  ? 33.843 15.294  32.636 1.00 29.67 ? 90   PHE B CE2   1 
ATOM   3086 C  CZ    . PHE B 1 90  ? 33.494 14.006  32.991 1.00 30.21 ? 90   PHE B CZ    1 
ATOM   3087 N  N     . LEU B 1 91  ? 33.181 17.733  28.046 1.00 27.42 ? 91   LEU B N     1 
ATOM   3088 C  CA    . LEU B 1 91  ? 32.862 19.127  28.347 1.00 26.59 ? 91   LEU B CA    1 
ATOM   3089 C  C     . LEU B 1 91  ? 31.500 19.500  27.784 1.00 26.31 ? 91   LEU B C     1 
ATOM   3090 O  O     . LEU B 1 91  ? 30.721 20.213  28.420 1.00 25.55 ? 91   LEU B O     1 
ATOM   3091 C  CB    . LEU B 1 91  ? 33.942 20.041  27.756 1.00 26.19 ? 91   LEU B CB    1 
ATOM   3092 C  CG    . LEU B 1 91  ? 33.932 21.540  28.070 1.00 24.68 ? 91   LEU B CG    1 
ATOM   3093 C  CD1   . LEU B 1 91  ? 34.059 21.760  29.562 1.00 22.77 ? 91   LEU B CD1   1 
ATOM   3094 C  CD2   . LEU B 1 91  ? 35.085 22.210  27.334 1.00 24.42 ? 91   LEU B CD2   1 
ATOM   3095 N  N     . ALA B 1 92  ? 31.217 19.018  26.582 1.00 26.06 ? 92   ALA B N     1 
ATOM   3096 C  CA    . ALA B 1 92  ? 29.943 19.297  25.945 1.00 25.30 ? 92   ALA B CA    1 
ATOM   3097 C  C     . ALA B 1 92  ? 28.841 18.655  26.762 1.00 25.47 ? 92   ALA B C     1 
ATOM   3098 O  O     . ALA B 1 92  ? 27.748 19.207  26.875 1.00 24.70 ? 92   ALA B O     1 
ATOM   3099 C  CB    . ALA B 1 92  ? 29.937 18.748  24.541 1.00 26.42 ? 92   ALA B CB    1 
ATOM   3100 N  N     . MET B 1 93  ? 29.134 17.484  27.326 1.00 25.74 ? 93   MET B N     1 
ATOM   3101 C  CA    . MET B 1 93  ? 28.169 16.770  28.155 1.00 26.77 ? 93   MET B CA    1 
ATOM   3102 C  C     . MET B 1 93  ? 27.907 17.560  29.441 1.00 27.05 ? 93   MET B C     1 
ATOM   3103 O  O     . MET B 1 93  ? 26.784 17.584  29.950 1.00 26.14 ? 93   MET B O     1 
ATOM   3104 C  CB    . MET B 1 93  ? 28.694 15.374  28.492 1.00 29.44 ? 93   MET B CB    1 
ATOM   3105 C  CG    . MET B 1 93  ? 27.752 14.524  29.349 1.00 33.44 ? 93   MET B CG    1 
ATOM   3106 S  SD    . MET B 1 93  ? 26.131 14.206  28.583 1.00 38.53 ? 93   MET B SD    1 
ATOM   3107 C  CE    . MET B 1 93  ? 26.590 12.985  27.352 1.00 38.40 ? 93   MET B CE    1 
ATOM   3108 N  N     . VAL B 1 94  ? 28.945 18.210  29.961 1.00 25.69 ? 94   VAL B N     1 
ATOM   3109 C  CA    . VAL B 1 94  ? 28.811 19.014  31.169 1.00 24.89 ? 94   VAL B CA    1 
ATOM   3110 C  C     . VAL B 1 94  ? 27.852 20.176  30.936 1.00 24.93 ? 94   VAL B C     1 
ATOM   3111 O  O     . VAL B 1 94  ? 27.002 20.463  31.777 1.00 23.59 ? 94   VAL B O     1 
ATOM   3112 C  CB    . VAL B 1 94  ? 30.175 19.573  31.627 1.00 26.07 ? 94   VAL B CB    1 
ATOM   3113 C  CG1   . VAL B 1 94  ? 29.984 20.571  32.762 1.00 26.00 ? 94   VAL B CG1   1 
ATOM   3114 C  CG2   . VAL B 1 94  ? 31.069 18.431  32.083 1.00 26.43 ? 94   VAL B CG2   1 
ATOM   3115 N  N     . VAL B 1 95  ? 27.985 20.839  29.792 1.00 24.90 ? 95   VAL B N     1 
ATOM   3116 C  CA    . VAL B 1 95  ? 27.114 21.964  29.467 1.00 24.78 ? 95   VAL B CA    1 
ATOM   3117 C  C     . VAL B 1 95  ? 25.641 21.543  29.393 1.00 25.85 ? 95   VAL B C     1 
ATOM   3118 O  O     . VAL B 1 95  ? 24.760 22.284  29.828 1.00 25.75 ? 95   VAL B O     1 
ATOM   3119 C  CB    . VAL B 1 95  ? 27.521 22.632  28.130 1.00 24.33 ? 95   VAL B CB    1 
ATOM   3120 C  CG1   . VAL B 1 95  ? 26.645 23.839  27.871 1.00 22.94 ? 95   VAL B CG1   1 
ATOM   3121 C  CG2   . VAL B 1 95  ? 28.975 23.056  28.181 1.00 23.67 ? 95   VAL B CG2   1 
ATOM   3122 N  N     . ASP B 1 96  ? 25.366 20.364  28.840 1.00 26.00 ? 96   ASP B N     1 
ATOM   3123 C  CA    . ASP B 1 96  ? 23.986 19.886  28.756 1.00 26.70 ? 96   ASP B CA    1 
ATOM   3124 C  C     . ASP B 1 96  ? 23.430 19.723  30.159 1.00 25.57 ? 96   ASP B C     1 
ATOM   3125 O  O     . ASP B 1 96  ? 22.306 20.136  30.443 1.00 26.02 ? 96   ASP B O     1 
ATOM   3126 C  CB    . ASP B 1 96  ? 23.913 18.536  28.046 1.00 30.43 ? 96   ASP B CB    1 
ATOM   3127 C  CG    . ASP B 1 96  ? 24.177 18.637  26.566 1.00 33.15 ? 96   ASP B CG    1 
ATOM   3128 O  OD1   . ASP B 1 96  ? 24.436 17.580  25.956 1.00 36.00 ? 96   ASP B OD1   1 
ATOM   3129 O  OD2   . ASP B 1 96  ? 24.117 19.761  26.015 1.00 33.52 ? 96   ASP B OD2   1 
ATOM   3130 N  N     . ILE B 1 97  ? 24.227 19.109  31.028 1.00 24.37 ? 97   ILE B N     1 
ATOM   3131 C  CA    . ILE B 1 97  ? 23.851 18.882  32.415 1.00 23.57 ? 97   ILE B CA    1 
ATOM   3132 C  C     . ILE B 1 97  ? 23.575 20.200  33.158 1.00 24.26 ? 97   ILE B C     1 
ATOM   3133 O  O     . ILE B 1 97  ? 22.582 20.310  33.896 1.00 23.12 ? 97   ILE B O     1 
ATOM   3134 C  CB    . ILE B 1 97  ? 24.951 18.084  33.140 1.00 22.35 ? 97   ILE B CB    1 
ATOM   3135 C  CG1   . ILE B 1 97  ? 24.996 16.662  32.572 1.00 22.16 ? 97   ILE B CG1   1 
ATOM   3136 C  CG2   . ILE B 1 97  ? 24.692 18.059  34.644 1.00 22.92 ? 97   ILE B CG2   1 
ATOM   3137 C  CD1   . ILE B 1 97  ? 26.005 15.753  33.244 1.00 20.14 ? 97   ILE B CD1   1 
ATOM   3138 N  N     . VAL B 1 98  ? 24.439 21.196  32.955 1.00 23.80 ? 98   VAL B N     1 
ATOM   3139 C  CA    . VAL B 1 98  ? 24.263 22.493  33.602 1.00 24.68 ? 98   VAL B CA    1 
ATOM   3140 C  C     . VAL B 1 98  ? 22.979 23.168  33.138 1.00 25.42 ? 98   VAL B C     1 
ATOM   3141 O  O     . VAL B 1 98  ? 22.223 23.698  33.950 1.00 25.49 ? 98   VAL B O     1 
ATOM   3142 C  CB    . VAL B 1 98  ? 25.440 23.448  33.309 1.00 25.31 ? 98   VAL B CB    1 
ATOM   3143 C  CG1   . VAL B 1 98  ? 25.151 24.833  33.900 1.00 25.26 ? 98   VAL B CG1   1 
ATOM   3144 C  CG2   . VAL B 1 98  ? 26.730 22.886  33.894 1.00 24.84 ? 98   VAL B CG2   1 
ATOM   3145 N  N     . GLN B 1 99  ? 22.737 23.150  31.831 1.00 26.92 ? 99   GLN B N     1 
ATOM   3146 C  CA    . GLN B 1 99  ? 21.540 23.766  31.278 1.00 28.99 ? 99   GLN B CA    1 
ATOM   3147 C  C     . GLN B 1 99  ? 20.288 23.136  31.862 1.00 28.93 ? 99   GLN B C     1 
ATOM   3148 O  O     . GLN B 1 99  ? 19.359 23.834  32.279 1.00 27.78 ? 99   GLN B O     1 
ATOM   3149 C  CB    . GLN B 1 99  ? 21.518 23.622  29.761 1.00 31.30 ? 99   GLN B CB    1 
ATOM   3150 C  CG    . GLN B 1 99  ? 22.686 24.284  29.069 1.00 38.43 ? 99   GLN B CG    1 
ATOM   3151 C  CD    . GLN B 1 99  ? 22.531 24.302  27.555 1.00 43.37 ? 99   GLN B CD    1 
ATOM   3152 O  OE1   . GLN B 1 99  ? 23.494 24.083  26.815 1.00 45.14 ? 99   GLN B OE1   1 
ATOM   3153 N  NE2   . GLN B 1 99  ? 21.314 24.576  27.084 1.00 46.36 ? 99   GLN B NE2   1 
ATOM   3154 N  N     . GLU B 1 100 ? 20.266 21.809  31.889 1.00 29.01 ? 100  GLU B N     1 
ATOM   3155 C  CA    . GLU B 1 100 ? 19.124 21.084  32.420 1.00 29.85 ? 100  GLU B CA    1 
ATOM   3156 C  C     . GLU B 1 100 ? 18.901 21.425  33.895 1.00 29.73 ? 100  GLU B C     1 
ATOM   3157 O  O     . GLU B 1 100 ? 17.762 21.594  34.337 1.00 29.32 ? 100  GLU B O     1 
ATOM   3158 C  CB    . GLU B 1 100 ? 19.339 19.581  32.251 1.00 31.53 ? 100  GLU B CB    1 
ATOM   3159 C  CG    . GLU B 1 100 ? 18.114 18.742  32.592 1.00 35.34 ? 100  GLU B CG    1 
ATOM   3160 C  CD    . GLU B 1 100 ? 18.344 17.261  32.372 1.00 37.06 ? 100  GLU B CD    1 
ATOM   3161 O  OE1   . GLU B 1 100 ? 18.695 16.866  31.236 1.00 37.13 ? 100  GLU B OE1   1 
ATOM   3162 O  OE2   . GLU B 1 100 ? 18.172 16.491  33.341 1.00 38.31 ? 100  GLU B OE2   1 
ATOM   3163 N  N     . LEU B 1 101 ? 19.987 21.529  34.654 1.00 28.61 ? 101  LEU B N     1 
ATOM   3164 C  CA    . LEU B 1 101 ? 19.882 21.865  36.068 1.00 28.13 ? 101  LEU B CA    1 
ATOM   3165 C  C     . LEU B 1 101 ? 19.372 23.290  36.264 1.00 29.12 ? 101  LEU B C     1 
ATOM   3166 O  O     . LEU B 1 101 ? 18.532 23.534  37.132 1.00 28.90 ? 101  LEU B O     1 
ATOM   3167 C  CB    . LEU B 1 101 ? 21.233 21.697  36.761 1.00 26.64 ? 101  LEU B CB    1 
ATOM   3168 C  CG    . LEU B 1 101 ? 21.716 20.260  36.968 1.00 25.17 ? 101  LEU B CG    1 
ATOM   3169 C  CD1   . LEU B 1 101 ? 23.118 20.275  37.548 1.00 23.79 ? 101  LEU B CD1   1 
ATOM   3170 C  CD2   . LEU B 1 101 ? 20.758 19.521  37.891 1.00 22.56 ? 101  LEU B CD2   1 
ATOM   3171 N  N     . LYS B 1 102 ? 19.870 24.228  35.462 1.00 30.12 ? 102  LYS B N     1 
ATOM   3172 C  CA    . LYS B 1 102 ? 19.429 25.611  35.581 1.00 32.39 ? 102  LYS B CA    1 
ATOM   3173 C  C     . LYS B 1 102 ? 17.959 25.742  35.248 1.00 35.55 ? 102  LYS B C     1 
ATOM   3174 O  O     . LYS B 1 102 ? 17.334 26.763  35.529 1.00 36.06 ? 102  LYS B O     1 
ATOM   3175 C  CB    . LYS B 1 102 ? 20.257 26.536  34.689 1.00 29.91 ? 102  LYS B CB    1 
ATOM   3176 C  CG    . LYS B 1 102 ? 21.543 26.979  35.363 1.00 29.44 ? 102  LYS B CG    1 
ATOM   3177 C  CD    . LYS B 1 102 ? 22.235 28.116  34.641 1.00 26.47 ? 102  LYS B CD    1 
ATOM   3178 C  CE    . LYS B 1 102 ? 23.401 28.625  35.472 1.00 23.70 ? 102  LYS B CE    1 
ATOM   3179 N  NZ    . LYS B 1 102 ? 24.198 29.654  34.777 1.00 22.66 ? 102  LYS B NZ    1 
ATOM   3180 N  N     . GLN B 1 103 ? 17.399 24.699  34.653 1.00 39.95 ? 103  GLN B N     1 
ATOM   3181 C  CA    . GLN B 1 103 ? 15.987 24.711  34.311 1.00 43.84 ? 103  GLN B CA    1 
ATOM   3182 C  C     . GLN B 1 103 ? 15.140 24.526  35.564 1.00 44.84 ? 103  GLN B C     1 
ATOM   3183 O  O     . GLN B 1 103 ? 14.147 25.228  35.755 1.00 45.70 ? 103  GLN B O     1 
ATOM   3184 C  CB    . GLN B 1 103 ? 15.667 23.607  33.309 1.00 47.47 ? 103  GLN B CB    1 
ATOM   3185 C  CG    . GLN B 1 103 ? 15.629 24.063  31.860 1.00 53.59 ? 103  GLN B CG    1 
ATOM   3186 C  CD    . GLN B 1 103 ? 14.393 23.545  31.140 1.00 57.55 ? 103  GLN B CD    1 
ATOM   3187 O  OE1   . GLN B 1 103 ? 13.606 22.779  31.709 1.00 59.11 ? 103  GLN B OE1   1 
ATOM   3188 N  NE2   . GLN B 1 103 ? 14.213 23.960  29.889 1.00 59.47 ? 103  GLN B NE2   1 
ATOM   3189 N  N     . GLN B 1 104 ? 15.532 23.586  36.420 1.00 45.25 ? 104  GLN B N     1 
ATOM   3190 C  CA    . GLN B 1 104 ? 14.790 23.338  37.651 1.00 45.80 ? 104  GLN B CA    1 
ATOM   3191 C  C     . GLN B 1 104 ? 15.089 24.403  38.691 1.00 44.76 ? 104  GLN B C     1 
ATOM   3192 O  O     . GLN B 1 104 ? 14.253 24.714  39.540 1.00 44.36 ? 104  GLN B O     1 
ATOM   3193 C  CB    . GLN B 1 104 ? 15.173 21.999  38.263 1.00 49.11 ? 104  GLN B CB    1 
ATOM   3194 C  CG    . GLN B 1 104 ? 15.219 20.833  37.329 1.00 52.43 ? 104  GLN B CG    1 
ATOM   3195 C  CD    . GLN B 1 104 ? 15.378 19.550  38.105 1.00 56.13 ? 104  GLN B CD    1 
ATOM   3196 O  OE1   . GLN B 1 104 ? 16.104 19.508  39.106 1.00 57.67 ? 104  GLN B OE1   1 
ATOM   3197 N  NE2   . GLN B 1 104 ? 14.709 18.493  37.656 1.00 58.32 ? 104  GLN B NE2   1 
ATOM   3198 N  N     . ASN B 1 105 ? 16.302 24.938  38.640 1.00 42.41 ? 105  ASN B N     1 
ATOM   3199 C  CA    . ASN B 1 105 ? 16.710 25.949  39.593 1.00 40.16 ? 105  ASN B CA    1 
ATOM   3200 C  C     . ASN B 1 105 ? 17.408 27.091  38.888 1.00 39.12 ? 105  ASN B C     1 
ATOM   3201 O  O     . ASN B 1 105 ? 18.625 27.078  38.715 1.00 38.22 ? 105  ASN B O     1 
ATOM   3202 C  CB    . ASN B 1 105 ? 17.623 25.324  40.644 1.00 40.48 ? 105  ASN B CB    1 
ATOM   3203 C  CG    . ASN B 1 105 ? 18.028 26.303  41.717 1.00 40.18 ? 105  ASN B CG    1 
ATOM   3204 O  OD1   . ASN B 1 105 ? 17.351 27.300  41.957 1.00 40.05 ? 105  ASN B OD1   1 
ATOM   3205 N  ND2   . ASN B 1 105 ? 19.130 26.012  42.387 1.00 41.01 ? 105  ASN B ND2   1 
ATOM   3206 N  N     . PRO B 1 106 ? 16.632 28.108  38.480 1.00 37.48 ? 106  PRO B N     1 
ATOM   3207 C  CA    . PRO B 1 106 ? 17.123 29.299  37.780 1.00 36.45 ? 106  PRO B CA    1 
ATOM   3208 C  C     . PRO B 1 106 ? 18.212 29.982  38.578 1.00 36.34 ? 106  PRO B C     1 
ATOM   3209 O  O     . PRO B 1 106 ? 18.992 30.763  38.036 1.00 36.88 ? 106  PRO B O     1 
ATOM   3210 C  CB    . PRO B 1 106 ? 15.890 30.191  37.686 1.00 35.94 ? 106  PRO B CB    1 
ATOM   3211 C  CG    . PRO B 1 106 ? 14.742 29.262  37.866 1.00 35.13 ? 106  PRO B CG    1 
ATOM   3212 C  CD    . PRO B 1 106 ? 15.222 28.274  38.867 1.00 35.72 ? 106  PRO B CD    1 
ATOM   3213 N  N     . ARG B 1 107 ? 18.251 29.690  39.873 1.00 34.70 ? 107  ARG B N     1 
ATOM   3214 C  CA    . ARG B 1 107 ? 19.230 30.300  40.755 1.00 34.01 ? 107  ARG B CA    1 
ATOM   3215 C  C     . ARG B 1 107 ? 20.513 29.547  40.946 1.00 31.23 ? 107  ARG B C     1 
ATOM   3216 O  O     . ARG B 1 107 ? 21.360 29.949  41.734 1.00 31.03 ? 107  ARG B O     1 
ATOM   3217 C  CB    . ARG B 1 107 ? 18.606 30.565  42.102 1.00 39.25 ? 107  ARG B CB    1 
ATOM   3218 C  CG    . ARG B 1 107 ? 17.805 31.820  42.063 1.00 47.67 ? 107  ARG B CG    1 
ATOM   3219 C  CD    . ARG B 1 107 ? 16.674 31.730  43.020 1.00 54.18 ? 107  ARG B CD    1 
ATOM   3220 N  NE    . ARG B 1 107 ? 16.937 32.404  44.285 1.00 61.47 ? 107  ARG B NE    1 
ATOM   3221 C  CZ    . ARG B 1 107 ? 16.594 31.889  45.458 1.00 64.57 ? 107  ARG B CZ    1 
ATOM   3222 N  NH1   . ARG B 1 107 ? 16.003 30.700  45.487 1.00 66.81 ? 107  ARG B NH1   1 
ATOM   3223 N  NH2   . ARG B 1 107 ? 16.791 32.565  46.588 1.00 65.79 ? 107  ARG B NH2   1 
ATOM   3224 N  N     . LEU B 1 108 ? 20.659 28.452  40.223 1.00 27.75 ? 108  LEU B N     1 
ATOM   3225 C  CA    . LEU B 1 108 ? 21.864 27.672  40.318 1.00 25.00 ? 108  LEU B CA    1 
ATOM   3226 C  C     . LEU B 1 108 ? 23.011 28.533  39.814 1.00 23.74 ? 108  LEU B C     1 
ATOM   3227 O  O     . LEU B 1 108 ? 22.856 29.286  38.859 1.00 24.37 ? 108  LEU B O     1 
ATOM   3228 C  CB    . LEU B 1 108 ? 21.727 26.406  39.475 1.00 25.23 ? 108  LEU B CB    1 
ATOM   3229 C  CG    . LEU B 1 108 ? 22.928 25.465  39.437 1.00 23.98 ? 108  LEU B CG    1 
ATOM   3230 C  CD1   . LEU B 1 108 ? 22.438 24.041  39.233 1.00 25.10 ? 108  LEU B CD1   1 
ATOM   3231 C  CD2   . LEU B 1 108 ? 23.885 25.893  38.341 1.00 23.12 ? 108  LEU B CD2   1 
ATOM   3232 N  N     . VAL B 1 109 ? 24.154 28.426  40.476 1.00 21.93 ? 109  VAL B N     1 
ATOM   3233 C  CA    . VAL B 1 109 ? 25.339 29.177  40.097 1.00 17.46 ? 109  VAL B CA    1 
ATOM   3234 C  C     . VAL B 1 109 ? 26.356 28.186  39.559 1.00 16.53 ? 109  VAL B C     1 
ATOM   3235 O  O     . VAL B 1 109 ? 26.643 27.175  40.193 1.00 14.58 ? 109  VAL B O     1 
ATOM   3236 C  CB    . VAL B 1 109 ? 25.941 29.915  41.314 1.00 17.34 ? 109  VAL B CB    1 
ATOM   3237 C  CG1   . VAL B 1 109 ? 27.231 30.606  40.925 1.00 14.99 ? 109  VAL B CG1   1 
ATOM   3238 C  CG2   . VAL B 1 109 ? 24.936 30.905  41.858 1.00 14.68 ? 109  VAL B CG2   1 
ATOM   3239 N  N     . TYR B 1 110 ? 26.883 28.467  38.378 1.00 15.37 ? 110  TYR B N     1 
ATOM   3240 C  CA    . TYR B 1 110 ? 27.873 27.593  37.777 1.00 14.86 ? 110  TYR B CA    1 
ATOM   3241 C  C     . TYR B 1 110 ? 29.235 28.274  37.846 1.00 16.03 ? 110  TYR B C     1 
ATOM   3242 O  O     . TYR B 1 110 ? 29.449 29.325  37.239 1.00 15.45 ? 110  TYR B O     1 
ATOM   3243 C  CB    . TYR B 1 110 ? 27.492 27.294  36.326 1.00 14.67 ? 110  TYR B CB    1 
ATOM   3244 C  CG    . TYR B 1 110 ? 28.515 26.508  35.530 1.00 15.42 ? 110  TYR B CG    1 
ATOM   3245 C  CD1   . TYR B 1 110 ? 28.504 26.544  34.136 1.00 12.86 ? 110  TYR B CD1   1 
ATOM   3246 C  CD2   . TYR B 1 110 ? 29.492 25.730  36.162 1.00 15.67 ? 110  TYR B CD2   1 
ATOM   3247 C  CE1   . TYR B 1 110 ? 29.438 25.835  33.391 1.00 13.87 ? 110  TYR B CE1   1 
ATOM   3248 C  CE2   . TYR B 1 110 ? 30.431 25.012  35.423 1.00 14.28 ? 110  TYR B CE2   1 
ATOM   3249 C  CZ    . TYR B 1 110 ? 30.398 25.072  34.037 1.00 15.21 ? 110  TYR B CZ    1 
ATOM   3250 O  OH    . TYR B 1 110 ? 31.313 24.368  33.288 1.00 16.08 ? 110  TYR B OH    1 
ATOM   3251 N  N     . VAL B 1 111 ? 30.144 27.677  38.611 1.00 16.38 ? 111  VAL B N     1 
ATOM   3252 C  CA    . VAL B 1 111 ? 31.493 28.205  38.758 1.00 17.37 ? 111  VAL B CA    1 
ATOM   3253 C  C     . VAL B 1 111 ? 32.388 27.403  37.819 1.00 19.85 ? 111  VAL B C     1 
ATOM   3254 O  O     . VAL B 1 111 ? 32.450 26.177  37.919 1.00 20.96 ? 111  VAL B O     1 
ATOM   3255 C  CB    . VAL B 1 111 ? 31.992 28.047  40.196 1.00 15.42 ? 111  VAL B CB    1 
ATOM   3256 C  CG1   . VAL B 1 111 ? 33.400 28.556  40.302 1.00 15.59 ? 111  VAL B CG1   1 
ATOM   3257 C  CG2   . VAL B 1 111 ? 31.083 28.806  41.143 1.00 15.33 ? 111  VAL B CG2   1 
ATOM   3258 N  N     . CYS B 1 112 ? 33.076 28.091  36.908 1.00 20.04 ? 112  CYS B N     1 
ATOM   3259 C  CA    . CYS B 1 112 ? 33.926 27.418  35.937 1.00 18.96 ? 112  CYS B CA    1 
ATOM   3260 C  C     . CYS B 1 112 ? 35.356 27.919  35.837 1.00 19.49 ? 112  CYS B C     1 
ATOM   3261 O  O     . CYS B 1 112 ? 35.599 29.107  35.663 1.00 17.59 ? 112  CYS B O     1 
ATOM   3262 C  CB    . CYS B 1 112 ? 33.279 27.503  34.547 1.00 19.61 ? 112  CYS B CB    1 
ATOM   3263 S  SG    . CYS B 1 112 ? 34.282 26.812  33.198 1.00 20.12 ? 112  CYS B SG    1 
ATOM   3264 N  N     . ASP B 1 113 ? 36.301 26.996  35.949 1.00 20.32 ? 113  ASP B N     1 
ATOM   3265 C  CA    . ASP B 1 113 ? 37.712 27.322  35.804 1.00 22.28 ? 113  ASP B CA    1 
ATOM   3266 C  C     . ASP B 1 113 ? 38.046 26.702  34.436 1.00 23.65 ? 113  ASP B C     1 
ATOM   3267 O  O     . ASP B 1 113 ? 38.173 25.488  34.307 1.00 24.05 ? 113  ASP B O     1 
ATOM   3268 C  CB    . ASP B 1 113 ? 38.526 26.689  36.940 1.00 20.31 ? 113  ASP B CB    1 
ATOM   3269 C  CG    . ASP B 1 113 ? 40.023 26.896  36.774 1.00 22.86 ? 113  ASP B CG    1 
ATOM   3270 O  OD1   . ASP B 1 113 ? 40.413 27.725  35.924 1.00 25.18 ? 113  ASP B OD1   1 
ATOM   3271 O  OD2   . ASP B 1 113 ? 40.817 26.237  37.488 1.00 22.83 ? 113  ASP B OD2   1 
ATOM   3272 N  N     . PRO B 1 114 ? 38.162 27.536  33.388 1.00 24.08 ? 114  PRO B N     1 
ATOM   3273 C  CA    . PRO B 1 114 ? 38.463 27.068  32.026 1.00 25.09 ? 114  PRO B CA    1 
ATOM   3274 C  C     . PRO B 1 114 ? 39.927 26.741  31.781 1.00 24.84 ? 114  PRO B C     1 
ATOM   3275 O  O     . PRO B 1 114 ? 40.626 27.485  31.107 1.00 26.12 ? 114  PRO B O     1 
ATOM   3276 C  CB    . PRO B 1 114 ? 37.979 28.227  31.168 1.00 24.71 ? 114  PRO B CB    1 
ATOM   3277 C  CG    . PRO B 1 114 ? 38.386 29.416  32.001 1.00 22.37 ? 114  PRO B CG    1 
ATOM   3278 C  CD    . PRO B 1 114 ? 38.030 29.007  33.422 1.00 23.50 ? 114  PRO B CD    1 
ATOM   3279 N  N     . VAL B 1 115 ? 40.385 25.616  32.307 1.00 25.39 ? 115  VAL B N     1 
ATOM   3280 C  CA    . VAL B 1 115 ? 41.785 25.229  32.169 1.00 26.70 ? 115  VAL B CA    1 
ATOM   3281 C  C     . VAL B 1 115 ? 42.177 24.863  30.738 1.00 28.14 ? 115  VAL B C     1 
ATOM   3282 O  O     . VAL B 1 115 ? 41.559 24.005  30.100 1.00 28.52 ? 115  VAL B O     1 
ATOM   3283 C  CB    . VAL B 1 115 ? 42.103 24.052  33.119 1.00 25.30 ? 115  VAL B CB    1 
ATOM   3284 C  CG1   . VAL B 1 115 ? 43.596 23.723  33.174 1.00 23.18 ? 115  VAL B CG1   1 
ATOM   3285 C  CG2   . VAL B 1 115 ? 41.673 24.327  34.561 1.00 22.45 ? 115  VAL B CG2   1 
ATOM   3286 N  N     . MET B 1 116 ? 43.232 25.534  30.281 1.00 29.15 ? 116  MET B N     1 
ATOM   3287 C  CA    . MET B 1 116 ? 43.763 25.327  28.928 1.00 31.36 ? 116  MET B CA    1 
ATOM   3288 C  C     . MET B 1 116 ? 45.290 25.466  28.900 1.00 34.42 ? 116  MET B C     1 
ATOM   3289 O  O     . MET B 1 116 ? 45.971 24.881  28.048 1.00 34.37 ? 116  MET B O     1 
ATOM   3290 C  CB    . MET B 1 116 ? 43.135 26.328  27.964 1.00 29.89 ? 116  MET B CB    1 
ATOM   3291 C  CG    . MET B 1 116 ? 41.641 26.070  27.764 1.00 31.39 ? 116  MET B CG    1 
ATOM   3292 S  SD    . MET B 1 116 ? 40.867 27.233  26.667 1.00 30.33 ? 116  MET B SD    1 
ATOM   3293 C  CE    . MET B 1 116 ? 40.556 28.762  27.522 1.00 31.79 ? 116  MET B CE    1 
ATOM   3294 N  N     . GLY B 1 117 ? 45.832 26.239  29.825 1.00 38.25 ? 117  GLY B N     1 
ATOM   3295 C  CA    . GLY B 1 117 ? 47.290 26.411  29.882 1.00 44.06 ? 117  GLY B CA    1 
ATOM   3296 C  C     . GLY B 1 117 ? 47.711 27.566  30.764 1.00 47.98 ? 117  GLY B C     1 
ATOM   3297 O  O     . GLY B 1 117 ? 46.877 28.129  31.465 1.00 48.70 ? 117  GLY B O     1 
ATOM   3298 N  N     . ASP B 1 118 ? 48.995 27.919  30.731 1.00 52.11 ? 118  ASP B N     1 
ATOM   3299 C  CA    . ASP B 1 118 ? 49.512 29.023  31.543 1.00 57.17 ? 118  ASP B CA    1 
ATOM   3300 C  C     . ASP B 1 118 ? 50.606 29.761  30.764 1.00 59.83 ? 118  ASP B C     1 
ATOM   3301 O  O     . ASP B 1 118 ? 51.009 29.329  29.682 1.00 60.02 ? 118  ASP B O     1 
ATOM   3302 C  CB    . ASP B 1 118 ? 50.097 28.480  32.863 1.00 58.67 ? 118  ASP B CB    1 
ATOM   3303 C  CG    . ASP B 1 118 ? 49.928 29.450  34.034 1.00 59.88 ? 118  ASP B CG    1 
ATOM   3304 O  OD1   . ASP B 1 118 ? 50.138 30.667  33.840 1.00 61.09 ? 118  ASP B OD1   1 
ATOM   3305 O  OD2   . ASP B 1 118 ? 49.596 28.991  35.153 1.00 59.24 ? 118  ASP B OD2   1 
ATOM   3306 N  N     . GLN B 1 119 ? 51.064 30.882  31.314 1.00 62.88 ? 119  GLN B N     1 
ATOM   3307 C  CA    . GLN B 1 119 ? 52.137 31.674  30.710 1.00 66.28 ? 119  GLN B CA    1 
ATOM   3308 C  C     . GLN B 1 119 ? 53.295 31.605  31.710 1.00 68.25 ? 119  GLN B C     1 
ATOM   3309 O  O     . GLN B 1 119 ? 53.478 32.519  32.521 1.00 69.43 ? 119  GLN B O     1 
ATOM   3310 C  CB    . GLN B 1 119 ? 51.705 33.140  30.520 1.00 67.44 ? 119  GLN B CB    1 
ATOM   3311 C  CG    . GLN B 1 119 ? 50.399 33.340  29.750 1.00 69.16 ? 119  GLN B CG    1 
ATOM   3312 C  CD    . GLN B 1 119 ? 50.511 34.383  28.641 1.00 70.39 ? 119  GLN B CD    1 
ATOM   3313 O  OE1   . GLN B 1 119 ? 51.308 34.232  27.711 1.00 71.55 ? 119  GLN B OE1   1 
ATOM   3314 N  NE2   . GLN B 1 119 ? 49.710 35.441  28.734 1.00 68.96 ? 119  GLN B NE2   1 
ATOM   3315 N  N     . ARG B 1 120 ? 54.060 30.513  31.662 1.00 69.03 ? 120  ARG B N     1 
ATOM   3316 C  CA    . ARG B 1 120 ? 55.185 30.298  32.580 1.00 69.98 ? 120  ARG B CA    1 
ATOM   3317 C  C     . ARG B 1 120 ? 56.182 31.448  32.692 1.00 70.48 ? 120  ARG B C     1 
ATOM   3318 O  O     . ARG B 1 120 ? 56.538 31.870  33.797 1.00 70.29 ? 120  ARG B O     1 
ATOM   3319 C  CB    . ARG B 1 120 ? 55.954 29.030  32.202 1.00 70.36 ? 120  ARG B CB    1 
ATOM   3320 C  CG    . ARG B 1 120 ? 55.572 27.794  33.000 1.00 69.85 ? 120  ARG B CG    1 
ATOM   3321 C  CD    . ARG B 1 120 ? 54.285 27.168  32.500 1.00 70.48 ? 120  ARG B CD    1 
ATOM   3322 N  NE    . ARG B 1 120 ? 54.235 25.750  32.846 1.00 71.09 ? 120  ARG B NE    1 
ATOM   3323 C  CZ    . ARG B 1 120 ? 53.717 24.808  32.063 1.00 71.10 ? 120  ARG B CZ    1 
ATOM   3324 N  NH1   . ARG B 1 120 ? 53.196 25.133  30.881 1.00 69.49 ? 120  ARG B NH1   1 
ATOM   3325 N  NH2   . ARG B 1 120 ? 53.735 23.538  32.456 1.00 69.91 ? 120  ARG B NH2   1 
ATOM   3326 N  N     . ASN B 1 121 ? 56.646 31.933  31.545 1.00 70.63 ? 121  ASN B N     1 
ATOM   3327 C  CA    . ASN B 1 121 ? 57.607 33.026  31.505 1.00 71.02 ? 121  ASN B CA    1 
ATOM   3328 C  C     . ASN B 1 121 ? 57.130 34.137  30.574 1.00 71.01 ? 121  ASN B C     1 
ATOM   3329 O  O     . ASN B 1 121 ? 57.052 35.301  30.970 1.00 71.88 ? 121  ASN B O     1 
ATOM   3330 C  CB    . ASN B 1 121 ? 58.980 32.501  31.053 1.00 70.72 ? 121  ASN B CB    1 
ATOM   3331 C  CG    . ASN B 1 121 ? 58.904 31.627  29.794 1.00 71.70 ? 121  ASN B CG    1 
ATOM   3332 O  OD1   . ASN B 1 121 ? 57.826 31.396  29.233 1.00 70.85 ? 121  ASN B OD1   1 
ATOM   3333 N  ND2   . ASN B 1 121 ? 60.060 31.136  29.351 1.00 71.91 ? 121  ASN B ND2   1 
ATOM   3334 N  N     . GLY B 1 122 ? 56.804 33.770  29.339 1.00 71.37 ? 122  GLY B N     1 
ATOM   3335 C  CA    . GLY B 1 122 ? 56.339 34.748  28.374 1.00 71.11 ? 122  GLY B CA    1 
ATOM   3336 C  C     . GLY B 1 122 ? 55.459 34.133  27.303 1.00 70.99 ? 122  GLY B C     1 
ATOM   3337 O  O     . GLY B 1 122 ? 54.529 34.778  26.810 1.00 70.95 ? 122  GLY B O     1 
ATOM   3338 N  N     . GLU B 1 123 ? 55.744 32.880  26.945 1.00 70.62 ? 123  GLU B N     1 
ATOM   3339 C  CA    . GLU B 1 123 ? 54.970 32.190  25.917 1.00 70.31 ? 123  GLU B CA    1 
ATOM   3340 C  C     . GLU B 1 123 ? 53.971 31.197  26.515 1.00 69.61 ? 123  GLU B C     1 
ATOM   3341 O  O     . GLU B 1 123 ? 54.307 30.419  27.414 1.00 69.91 ? 123  GLU B O     1 
ATOM   3342 C  CB    . GLU B 1 123 ? 55.915 31.468  24.949 1.00 69.80 ? 123  GLU B CB    1 
ATOM   3343 C  CG    . GLU B 1 123 ? 57.184 32.254  24.630 1.00 69.81 ? 123  GLU B CG    1 
ATOM   3344 C  CD    . GLU B 1 123 ? 57.843 31.830  23.324 1.00 71.06 ? 123  GLU B CD    1 
ATOM   3345 O  OE1   . GLU B 1 123 ? 58.052 30.614  23.119 1.00 70.39 ? 123  GLU B OE1   1 
ATOM   3346 O  OE2   . GLU B 1 123 ? 58.161 32.719  22.502 1.00 71.71 ? 123  GLU B OE2   1 
ATOM   3347 N  N     . GLY B 1 124 ? 52.740 31.239  26.012 1.00 69.20 ? 124  GLY B N     1 
ATOM   3348 C  CA    . GLY B 1 124 ? 51.706 30.343  26.493 1.00 67.93 ? 124  GLY B CA    1 
ATOM   3349 C  C     . GLY B 1 124 ? 51.903 28.936  25.967 1.00 67.42 ? 124  GLY B C     1 
ATOM   3350 O  O     . GLY B 1 124 ? 52.447 28.740  24.876 1.00 67.10 ? 124  GLY B O     1 
ATOM   3351 N  N     . ALA B 1 125 ? 51.465 27.955  26.753 1.00 66.78 ? 125  ALA B N     1 
ATOM   3352 C  CA    . ALA B 1 125 ? 51.576 26.542  26.391 1.00 65.54 ? 125  ALA B CA    1 
ATOM   3353 C  C     . ALA B 1 125 ? 50.262 25.840  26.744 1.00 64.34 ? 125  ALA B C     1 
ATOM   3354 O  O     . ALA B 1 125 ? 49.844 25.842  27.903 1.00 64.19 ? 125  ALA B O     1 
ATOM   3355 C  CB    . ALA B 1 125 ? 52.750 25.898  27.141 1.00 65.09 ? 125  ALA B CB    1 
ATOM   3356 N  N     . MET B 1 126 ? 49.621 25.240  25.744 1.00 62.86 ? 126  MET B N     1 
ATOM   3357 C  CA    . MET B 1 126 ? 48.341 24.558  25.937 1.00 61.62 ? 126  MET B CA    1 
ATOM   3358 C  C     . MET B 1 126 ? 48.403 23.110  26.450 1.00 60.01 ? 126  MET B C     1 
ATOM   3359 O  O     . MET B 1 126 ? 49.042 22.252  25.846 1.00 59.68 ? 126  MET B O     1 
ATOM   3360 C  CB    . MET B 1 126 ? 47.541 24.608  24.631 1.00 62.50 ? 126  MET B CB    1 
ATOM   3361 C  CG    . MET B 1 126 ? 47.234 26.022  24.165 1.00 63.32 ? 126  MET B CG    1 
ATOM   3362 S  SD    . MET B 1 126 ? 45.547 26.173  23.546 1.00 66.18 ? 126  MET B SD    1 
ATOM   3363 C  CE    . MET B 1 126 ? 45.827 26.461  21.767 1.00 66.65 ? 126  MET B CE    1 
ATOM   3364 N  N     . TYR B 1 127 ? 47.723 22.850  27.567 1.00 58.87 ? 127  TYR B N     1 
ATOM   3365 C  CA    . TYR B 1 127 ? 47.675 21.513  28.170 1.00 57.54 ? 127  TYR B CA    1 
ATOM   3366 C  C     . TYR B 1 127 ? 46.568 20.689  27.530 1.00 55.84 ? 127  TYR B C     1 
ATOM   3367 O  O     . TYR B 1 127 ? 46.557 19.460  27.609 1.00 56.50 ? 127  TYR B O     1 
ATOM   3368 C  CB    . TYR B 1 127 ? 47.341 21.570  29.666 1.00 58.20 ? 127  TYR B CB    1 
ATOM   3369 C  CG    . TYR B 1 127 ? 48.162 22.501  30.524 1.00 59.14 ? 127  TYR B CG    1 
ATOM   3370 C  CD1   . TYR B 1 127 ? 49.536 22.646  30.327 1.00 59.19 ? 127  TYR B CD1   1 
ATOM   3371 C  CD2   . TYR B 1 127 ? 47.567 23.194  31.582 1.00 59.04 ? 127  TYR B CD2   1 
ATOM   3372 C  CE1   . TYR B 1 127 ? 50.297 23.457  31.164 1.00 60.03 ? 127  TYR B CE1   1 
ATOM   3373 C  CE2   . TYR B 1 127 ? 48.315 24.003  32.426 1.00 60.06 ? 127  TYR B CE2   1 
ATOM   3374 C  CZ    . TYR B 1 127 ? 49.681 24.133  32.213 1.00 61.04 ? 127  TYR B CZ    1 
ATOM   3375 O  OH    . TYR B 1 127 ? 50.425 24.946  33.042 1.00 62.23 ? 127  TYR B OH    1 
ATOM   3376 N  N     . VAL B 1 128 ? 45.621 21.378  26.917 1.00 53.56 ? 128  VAL B N     1 
ATOM   3377 C  CA    . VAL B 1 128 ? 44.485 20.717  26.315 1.00 51.06 ? 128  VAL B CA    1 
ATOM   3378 C  C     . VAL B 1 128 ? 44.462 20.822  24.801 1.00 50.06 ? 128  VAL B C     1 
ATOM   3379 O  O     . VAL B 1 128 ? 44.996 21.771  24.221 1.00 48.59 ? 128  VAL B O     1 
ATOM   3380 C  CB    . VAL B 1 128 ? 43.183 21.317  26.877 1.00 50.77 ? 128  VAL B CB    1 
ATOM   3381 C  CG1   . VAL B 1 128 ? 41.982 20.643  26.265 1.00 50.41 ? 128  VAL B CG1   1 
ATOM   3382 C  CG2   . VAL B 1 128 ? 43.165 21.168  28.386 1.00 50.42 ? 128  VAL B CG2   1 
ATOM   3383 N  N     . PRO B 1 129 ? 43.879 19.815  24.135 1.00 49.24 ? 129  PRO B N     1 
ATOM   3384 C  CA    . PRO B 1 129 ? 43.825 19.891  22.678 1.00 49.47 ? 129  PRO B CA    1 
ATOM   3385 C  C     . PRO B 1 129 ? 43.152 21.203  22.310 1.00 49.69 ? 129  PRO B C     1 
ATOM   3386 O  O     . PRO B 1 129 ? 42.202 21.631  22.968 1.00 50.44 ? 129  PRO B O     1 
ATOM   3387 C  CB    . PRO B 1 129 ? 42.999 18.658  22.282 1.00 48.94 ? 129  PRO B CB    1 
ATOM   3388 C  CG    . PRO B 1 129 ? 42.465 18.091  23.592 1.00 49.34 ? 129  PRO B CG    1 
ATOM   3389 C  CD    . PRO B 1 129 ? 43.499 18.474  24.603 1.00 50.09 ? 129  PRO B CD    1 
ATOM   3390 N  N     . ASP B 1 130 ? 43.660 21.843  21.265 1.00 49.61 ? 130  ASP B N     1 
ATOM   3391 C  CA    . ASP B 1 130 ? 43.142 23.127  20.817 1.00 49.08 ? 130  ASP B CA    1 
ATOM   3392 C  C     . ASP B 1 130 ? 41.648 23.105  20.505 1.00 48.28 ? 130  ASP B C     1 
ATOM   3393 O  O     . ASP B 1 130 ? 40.974 24.128  20.618 1.00 48.44 ? 130  ASP B O     1 
ATOM   3394 C  CB    . ASP B 1 130 ? 43.915 23.601  19.578 1.00 50.82 ? 130  ASP B CB    1 
ATOM   3395 C  CG    . ASP B 1 130 ? 45.419 23.373  19.699 1.00 52.78 ? 130  ASP B CG    1 
ATOM   3396 O  OD1   . ASP B 1 130 ? 46.040 23.877  20.666 1.00 54.44 ? 130  ASP B OD1   1 
ATOM   3397 O  OD2   . ASP B 1 130 ? 45.980 22.682  18.820 1.00 52.89 ? 130  ASP B OD2   1 
ATOM   3398 N  N     . ASP B 1 131 ? 41.119 21.947  20.122 1.00 46.58 ? 131  ASP B N     1 
ATOM   3399 C  CA    . ASP B 1 131 ? 39.703 21.875  19.786 1.00 45.22 ? 131  ASP B CA    1 
ATOM   3400 C  C     . ASP B 1 131 ? 38.766 22.086  20.967 1.00 44.30 ? 131  ASP B C     1 
ATOM   3401 O  O     . ASP B 1 131 ? 37.558 21.876  20.843 1.00 44.70 ? 131  ASP B O     1 
ATOM   3402 C  CB    . ASP B 1 131 ? 39.359 20.552  19.091 1.00 46.48 ? 131  ASP B CB    1 
ATOM   3403 C  CG    . ASP B 1 131 ? 39.672 19.341  19.943 1.00 48.65 ? 131  ASP B CG    1 
ATOM   3404 O  OD1   . ASP B 1 131 ? 38.882 18.374  19.908 1.00 47.91 ? 131  ASP B OD1   1 
ATOM   3405 O  OD2   . ASP B 1 131 ? 40.713 19.347  20.634 1.00 51.53 ? 131  ASP B OD2   1 
ATOM   3406 N  N     . LEU B 1 132 ? 39.309 22.498  22.110 1.00 42.50 ? 132  LEU B N     1 
ATOM   3407 C  CA    . LEU B 1 132 ? 38.468 22.755  23.276 1.00 39.64 ? 132  LEU B CA    1 
ATOM   3408 C  C     . LEU B 1 132 ? 38.077 24.224  23.355 1.00 37.76 ? 132  LEU B C     1 
ATOM   3409 O  O     . LEU B 1 132 ? 36.962 24.556  23.765 1.00 36.47 ? 132  LEU B O     1 
ATOM   3410 C  CB    . LEU B 1 132 ? 39.173 22.358  24.574 1.00 38.74 ? 132  LEU B CB    1 
ATOM   3411 C  CG    . LEU B 1 132 ? 38.557 21.110  25.207 1.00 38.51 ? 132  LEU B CG    1 
ATOM   3412 C  CD1   . LEU B 1 132 ? 39.069 19.892  24.476 1.00 40.48 ? 132  LEU B CD1   1 
ATOM   3413 C  CD2   . LEU B 1 132 ? 38.904 21.021  26.675 1.00 38.18 ? 132  LEU B CD2   1 
ATOM   3414 N  N     . LEU B 1 133 ? 38.998 25.096  22.949 1.00 35.79 ? 133  LEU B N     1 
ATOM   3415 C  CA    . LEU B 1 133 ? 38.768 26.537  22.985 1.00 33.93 ? 133  LEU B CA    1 
ATOM   3416 C  C     . LEU B 1 133 ? 37.407 26.944  22.426 1.00 33.53 ? 133  LEU B C     1 
ATOM   3417 O  O     . LEU B 1 133 ? 36.698 27.750  23.030 1.00 33.91 ? 133  LEU B O     1 
ATOM   3418 C  CB    . LEU B 1 133 ? 39.876 27.268  22.230 1.00 32.45 ? 133  LEU B CB    1 
ATOM   3419 C  CG    . LEU B 1 133 ? 39.770 28.791  22.228 1.00 32.26 ? 133  LEU B CG    1 
ATOM   3420 C  CD1   . LEU B 1 133 ? 39.651 29.317  23.643 1.00 30.60 ? 133  LEU B CD1   1 
ATOM   3421 C  CD2   . LEU B 1 133 ? 40.990 29.369  21.548 1.00 34.32 ? 133  LEU B CD2   1 
ATOM   3422 N  N     . PRO B 1 134 ? 37.026 26.399  21.262 1.00 32.84 ? 134  PRO B N     1 
ATOM   3423 C  CA    . PRO B 1 134 ? 35.727 26.750  20.679 1.00 30.87 ? 134  PRO B CA    1 
ATOM   3424 C  C     . PRO B 1 134 ? 34.560 26.359  21.580 1.00 29.60 ? 134  PRO B C     1 
ATOM   3425 O  O     . PRO B 1 134 ? 33.562 27.072  21.649 1.00 28.21 ? 134  PRO B O     1 
ATOM   3426 C  CB    . PRO B 1 134 ? 35.710 25.967  19.368 1.00 31.75 ? 134  PRO B CB    1 
ATOM   3427 C  CG    . PRO B 1 134 ? 37.149 25.867  19.002 1.00 31.50 ? 134  PRO B CG    1 
ATOM   3428 C  CD    . PRO B 1 134 ? 37.808 25.566  20.331 1.00 32.97 ? 134  PRO B CD    1 
ATOM   3429 N  N     . VAL B 1 135 ? 34.685 25.217  22.257 1.00 29.32 ? 135  VAL B N     1 
ATOM   3430 C  CA    . VAL B 1 135 ? 33.626 24.729  23.143 1.00 29.22 ? 135  VAL B CA    1 
ATOM   3431 C  C     . VAL B 1 135 ? 33.479 25.617  24.374 1.00 29.60 ? 135  VAL B C     1 
ATOM   3432 O  O     . VAL B 1 135 ? 32.357 25.926  24.799 1.00 28.29 ? 135  VAL B O     1 
ATOM   3433 C  CB    . VAL B 1 135 ? 33.895 23.282  23.605 1.00 27.82 ? 135  VAL B CB    1 
ATOM   3434 C  CG1   . VAL B 1 135 ? 32.741 22.775  24.452 1.00 27.72 ? 135  VAL B CG1   1 
ATOM   3435 C  CG2   . VAL B 1 135 ? 34.076 22.390  22.409 1.00 28.52 ? 135  VAL B CG2   1 
ATOM   3436 N  N     . TYR B 1 136 ? 34.615 26.018  24.942 1.00 29.45 ? 136  TYR B N     1 
ATOM   3437 C  CA    . TYR B 1 136 ? 34.632 26.888  26.111 1.00 29.69 ? 136  TYR B CA    1 
ATOM   3438 C  C     . TYR B 1 136 ? 34.020 28.226  25.767 1.00 31.12 ? 136  TYR B C     1 
ATOM   3439 O  O     . TYR B 1 136 ? 33.183 28.756  26.500 1.00 30.06 ? 136  TYR B O     1 
ATOM   3440 C  CB    . TYR B 1 136 ? 36.063 27.107  26.586 1.00 27.60 ? 136  TYR B CB    1 
ATOM   3441 C  CG    . TYR B 1 136 ? 36.459 26.161  27.678 1.00 27.34 ? 136  TYR B CG    1 
ATOM   3442 C  CD1   . TYR B 1 136 ? 37.668 25.474  27.631 1.00 28.05 ? 136  TYR B CD1   1 
ATOM   3443 C  CD2   . TYR B 1 136 ? 35.606 25.928  28.758 1.00 27.81 ? 136  TYR B CD2   1 
ATOM   3444 C  CE1   . TYR B 1 136 ? 38.016 24.570  28.635 1.00 26.79 ? 136  TYR B CE1   1 
ATOM   3445 C  CE2   . TYR B 1 136 ? 35.942 25.034  29.762 1.00 25.75 ? 136  TYR B CE2   1 
ATOM   3446 C  CZ    . TYR B 1 136 ? 37.143 24.359  29.695 1.00 25.97 ? 136  TYR B CZ    1 
ATOM   3447 O  OH    . TYR B 1 136 ? 37.454 23.471  30.691 1.00 25.86 ? 136  TYR B OH    1 
ATOM   3448 N  N     . ARG B 1 137 ? 34.454 28.747  24.626 1.00 33.24 ? 137  ARG B N     1 
ATOM   3449 C  CA    . ARG B 1 137 ? 34.021 30.035  24.107 1.00 34.25 ? 137  ARG B CA    1 
ATOM   3450 C  C     . ARG B 1 137 ? 32.540 30.170  23.815 1.00 34.50 ? 137  ARG B C     1 
ATOM   3451 O  O     . ARG B 1 137 ? 31.885 31.093  24.297 1.00 34.38 ? 137  ARG B O     1 
ATOM   3452 C  CB    . ARG B 1 137 ? 34.791 30.342  22.835 1.00 34.54 ? 137  ARG B CB    1 
ATOM   3453 C  CG    . ARG B 1 137 ? 35.511 31.650  22.877 1.00 38.56 ? 137  ARG B CG    1 
ATOM   3454 C  CD    . ARG B 1 137 ? 35.987 31.986  21.498 1.00 42.21 ? 137  ARG B CD    1 
ATOM   3455 N  NE    . ARG B 1 137 ? 37.405 31.760  21.275 1.00 44.69 ? 137  ARG B NE    1 
ATOM   3456 C  CZ    . ARG B 1 137 ? 37.960 31.846  20.077 1.00 46.69 ? 137  ARG B CZ    1 
ATOM   3457 N  NH1   . ARG B 1 137 ? 37.200 32.147  19.031 1.00 50.70 ? 137  ARG B NH1   1 
ATOM   3458 N  NH2   . ARG B 1 137 ? 39.259 31.641  19.923 1.00 47.35 ? 137  ARG B NH2   1 
ATOM   3459 N  N     . GLU B 1 138 ? 32.005 29.241  23.035 1.00 35.71 ? 138  GLU B N     1 
ATOM   3460 C  CA    . GLU B 1 138 ? 30.608 29.314  22.641 1.00 36.79 ? 138  GLU B CA    1 
ATOM   3461 C  C     . GLU B 1 138 ? 29.597 28.516  23.453 1.00 35.53 ? 138  GLU B C     1 
ATOM   3462 O  O     . GLU B 1 138 ? 28.407 28.823  23.423 1.00 35.35 ? 138  GLU B O     1 
ATOM   3463 C  CB    . GLU B 1 138 ? 30.525 28.969  21.157 1.00 39.16 ? 138  GLU B CB    1 
ATOM   3464 C  CG    . GLU B 1 138 ? 31.704 29.599  20.435 1.00 45.87 ? 138  GLU B CG    1 
ATOM   3465 C  CD    . GLU B 1 138 ? 31.632 29.530  18.933 1.00 49.37 ? 138  GLU B CD    1 
ATOM   3466 O  OE1   . GLU B 1 138 ? 30.767 28.799  18.400 1.00 52.81 ? 138  GLU B OE1   1 
ATOM   3467 O  OE2   . GLU B 1 138 ? 32.463 30.210  18.288 1.00 50.38 ? 138  GLU B OE2   1 
ATOM   3468 N  N     . LYS B 1 139 ? 30.051 27.518  24.201 1.00 35.28 ? 139  LYS B N     1 
ATOM   3469 C  CA    . LYS B 1 139 ? 29.117 26.723  24.984 1.00 34.44 ? 139  LYS B CA    1 
ATOM   3470 C  C     . LYS B 1 139 ? 29.249 26.826  26.496 1.00 33.02 ? 139  LYS B C     1 
ATOM   3471 O  O     . LYS B 1 139 ? 28.248 26.948  27.197 1.00 32.07 ? 139  LYS B O     1 
ATOM   3472 C  CB    . LYS B 1 139 ? 29.204 25.264  24.556 1.00 35.58 ? 139  LYS B CB    1 
ATOM   3473 C  CG    . LYS B 1 139 ? 28.732 25.064  23.147 1.00 38.26 ? 139  LYS B CG    1 
ATOM   3474 C  CD    . LYS B 1 139 ? 28.645 23.608  22.792 1.00 42.48 ? 139  LYS B CD    1 
ATOM   3475 C  CE    . LYS B 1 139 ? 27.543 23.383  21.774 1.00 43.79 ? 139  LYS B CE    1 
ATOM   3476 N  NZ    . LYS B 1 139 ? 27.664 22.047  21.141 1.00 44.62 ? 139  LYS B NZ    1 
ATOM   3477 N  N     . VAL B 1 140 ? 30.473 26.782  27.006 1.00 32.27 ? 140  VAL B N     1 
ATOM   3478 C  CA    . VAL B 1 140 ? 30.674 26.853  28.447 1.00 31.41 ? 140  VAL B CA    1 
ATOM   3479 C  C     . VAL B 1 140 ? 30.527 28.264  29.036 1.00 30.88 ? 140  VAL B C     1 
ATOM   3480 O  O     . VAL B 1 140 ? 29.621 28.508  29.839 1.00 31.18 ? 140  VAL B O     1 
ATOM   3481 C  CB    . VAL B 1 140 ? 32.051 26.284  28.844 1.00 30.77 ? 140  VAL B CB    1 
ATOM   3482 C  CG1   . VAL B 1 140 ? 32.134 26.130  30.354 1.00 29.15 ? 140  VAL B CG1   1 
ATOM   3483 C  CG2   . VAL B 1 140 ? 32.271 24.949  28.167 1.00 30.93 ? 140  VAL B CG2   1 
ATOM   3484 N  N     . VAL B 1 141 ? 31.403 29.187  28.640 1.00 29.47 ? 141  VAL B N     1 
ATOM   3485 C  CA    . VAL B 1 141 ? 31.360 30.557  29.163 1.00 28.37 ? 141  VAL B CA    1 
ATOM   3486 C  C     . VAL B 1 141 ? 29.952 31.185  29.164 1.00 27.22 ? 141  VAL B C     1 
ATOM   3487 O  O     . VAL B 1 141 ? 29.549 31.823  30.138 1.00 26.28 ? 141  VAL B O     1 
ATOM   3488 C  CB    . VAL B 1 141 ? 32.357 31.484  28.397 1.00 27.98 ? 141  VAL B CB    1 
ATOM   3489 C  CG1   . VAL B 1 141 ? 32.317 32.887  28.967 1.00 27.71 ? 141  VAL B CG1   1 
ATOM   3490 C  CG2   . VAL B 1 141 ? 33.771 30.941  28.518 1.00 27.62 ? 141  VAL B CG2   1 
ATOM   3491 N  N     . PRO B 1 142 ? 29.189 31.019  28.074 1.00 26.60 ? 142  PRO B N     1 
ATOM   3492 C  CA    . PRO B 1 142 ? 27.840 31.598  28.032 1.00 25.69 ? 142  PRO B CA    1 
ATOM   3493 C  C     . PRO B 1 142 ? 26.892 31.169  29.158 1.00 24.85 ? 142  PRO B C     1 
ATOM   3494 O  O     . PRO B 1 142 ? 25.955 31.890  29.476 1.00 25.11 ? 142  PRO B O     1 
ATOM   3495 C  CB    . PRO B 1 142 ? 27.332 31.173  26.660 1.00 25.74 ? 142  PRO B CB    1 
ATOM   3496 C  CG    . PRO B 1 142 ? 28.583 31.211  25.832 1.00 26.97 ? 142  PRO B CG    1 
ATOM   3497 C  CD    . PRO B 1 142 ? 29.607 30.562  26.734 1.00 26.41 ? 142  PRO B CD    1 
ATOM   3498 N  N     . VAL B 1 143 ? 27.122 30.009  29.766 1.00 24.74 ? 143  VAL B N     1 
ATOM   3499 C  CA    . VAL B 1 143 ? 26.229 29.560  30.837 1.00 24.27 ? 143  VAL B CA    1 
ATOM   3500 C  C     . VAL B 1 143 ? 26.903 29.574  32.214 1.00 22.83 ? 143  VAL B C     1 
ATOM   3501 O  O     . VAL B 1 143 ? 26.304 29.173  33.219 1.00 20.78 ? 143  VAL B O     1 
ATOM   3502 C  CB    . VAL B 1 143 ? 25.624 28.142  30.525 1.00 24.69 ? 143  VAL B CB    1 
ATOM   3503 C  CG1   . VAL B 1 143 ? 25.879 27.772  29.092 1.00 25.82 ? 143  VAL B CG1   1 
ATOM   3504 C  CG2   . VAL B 1 143 ? 26.207 27.087  31.425 1.00 28.65 ? 143  VAL B CG2   1 
ATOM   3505 N  N     . ALA B 1 144 ? 28.143 30.062  32.248 1.00 21.62 ? 144  ALA B N     1 
ATOM   3506 C  CA    . ALA B 1 144 ? 28.924 30.170  33.482 1.00 21.01 ? 144  ALA B CA    1 
ATOM   3507 C  C     . ALA B 1 144 ? 28.597 31.462  34.222 1.00 21.60 ? 144  ALA B C     1 
ATOM   3508 O  O     . ALA B 1 144 ? 28.422 32.511  33.606 1.00 22.69 ? 144  ALA B O     1 
ATOM   3509 C  CB    . ALA B 1 144 ? 30.405 30.138  33.162 1.00 18.56 ? 144  ALA B CB    1 
ATOM   3510 N  N     . ASP B 1 145 ? 28.530 31.388  35.546 1.00 21.98 ? 145  ASP B N     1 
ATOM   3511 C  CA    . ASP B 1 145 ? 28.232 32.562  36.366 1.00 21.45 ? 145  ASP B CA    1 
ATOM   3512 C  C     . ASP B 1 145 ? 29.491 33.181  36.995 1.00 20.79 ? 145  ASP B C     1 
ATOM   3513 O  O     . ASP B 1 145 ? 29.559 34.394  37.210 1.00 20.56 ? 145  ASP B O     1 
ATOM   3514 C  CB    . ASP B 1 145 ? 27.224 32.177  37.436 1.00 21.93 ? 145  ASP B CB    1 
ATOM   3515 C  CG    . ASP B 1 145 ? 25.919 31.691  36.839 1.00 24.01 ? 145  ASP B CG    1 
ATOM   3516 O  OD1   . ASP B 1 145 ? 25.216 32.508  36.210 1.00 25.71 ? 145  ASP B OD1   1 
ATOM   3517 O  OD2   . ASP B 1 145 ? 25.593 30.493  36.983 1.00 26.37 ? 145  ASP B OD2   1 
ATOM   3518 N  N     . ILE B 1 146 ? 30.484 32.340  37.276 1.00 18.70 ? 146  ILE B N     1 
ATOM   3519 C  CA    . ILE B 1 146 ? 31.758 32.781  37.845 1.00 15.46 ? 146  ILE B CA    1 
ATOM   3520 C  C     . ILE B 1 146 ? 32.850 32.021  37.100 1.00 16.45 ? 146  ILE B C     1 
ATOM   3521 O  O     . ILE B 1 146 ? 32.799 30.797  37.016 1.00 15.36 ? 146  ILE B O     1 
ATOM   3522 C  CB    . ILE B 1 146 ? 31.875 32.432  39.352 1.00 13.54 ? 146  ILE B CB    1 
ATOM   3523 C  CG1   . ILE B 1 146 ? 30.777 33.143  40.141 1.00 13.45 ? 146  ILE B CG1   1 
ATOM   3524 C  CG2   . ILE B 1 146 ? 33.239 32.828  39.874 1.00 10.74 ? 146  ILE B CG2   1 
ATOM   3525 C  CD1   . ILE B 1 146 ? 30.648 32.698  41.562 1.00 11.47 ? 146  ILE B CD1   1 
ATOM   3526 N  N     . ILE B 1 147 ? 33.816 32.736  36.534 1.00 15.70 ? 147  ILE B N     1 
ATOM   3527 C  CA    . ILE B 1 147 ? 34.903 32.070  35.834 1.00 15.46 ? 147  ILE B CA    1 
ATOM   3528 C  C     . ILE B 1 147 ? 36.210 32.537  36.424 1.00 16.80 ? 147  ILE B C     1 
ATOM   3529 O  O     . ILE B 1 147 ? 36.330 33.681  36.854 1.00 18.52 ? 147  ILE B O     1 
ATOM   3530 C  CB    . ILE B 1 147 ? 34.893 32.339  34.311 1.00 16.17 ? 147  ILE B CB    1 
ATOM   3531 C  CG1   . ILE B 1 147 ? 34.824 33.835  34.029 1.00 16.42 ? 147  ILE B CG1   1 
ATOM   3532 C  CG2   . ILE B 1 147 ? 33.732 31.604  33.673 1.00 15.47 ? 147  ILE B CG2   1 
ATOM   3533 C  CD1   . ILE B 1 147 ? 35.036 34.168  32.572 1.00 16.87 ? 147  ILE B CD1   1 
ATOM   3534 N  N     . THR B 1 148 ? 37.191 31.648  36.447 1.00 16.81 ? 148  THR B N     1 
ATOM   3535 C  CA    . THR B 1 148 ? 38.476 31.976  37.034 1.00 16.80 ? 148  THR B CA    1 
ATOM   3536 C  C     . THR B 1 148 ? 39.631 31.652  36.115 1.00 18.06 ? 148  THR B C     1 
ATOM   3537 O  O     . THR B 1 148 ? 40.458 30.816  36.438 1.00 19.62 ? 148  THR B O     1 
ATOM   3538 C  CB    . THR B 1 148 ? 38.683 31.206  38.350 1.00 15.18 ? 148  THR B CB    1 
ATOM   3539 O  OG1   . THR B 1 148 ? 38.601 29.803  38.088 1.00 13.65 ? 148  THR B OG1   1 
ATOM   3540 C  CG2   . THR B 1 148 ? 37.622 31.574  39.366 1.00 15.07 ? 148  THR B CG2   1 
ATOM   3541 N  N     . PRO B 1 149 ? 39.715 32.319  34.959 1.00 19.06 ? 149  PRO B N     1 
ATOM   3542 C  CA    . PRO B 1 149 ? 40.814 32.045  34.030 1.00 19.82 ? 149  PRO B CA    1 
ATOM   3543 C  C     . PRO B 1 149 ? 42.098 32.732  34.461 1.00 23.08 ? 149  PRO B C     1 
ATOM   3544 O  O     . PRO B 1 149 ? 42.068 33.649  35.286 1.00 25.31 ? 149  PRO B O     1 
ATOM   3545 C  CB    . PRO B 1 149 ? 40.298 32.630  32.732 1.00 19.42 ? 149  PRO B CB    1 
ATOM   3546 C  CG    . PRO B 1 149 ? 39.594 33.867  33.222 1.00 19.32 ? 149  PRO B CG    1 
ATOM   3547 C  CD    . PRO B 1 149 ? 38.809 33.346  34.413 1.00 18.75 ? 149  PRO B CD    1 
ATOM   3548 N  N     . ASN B 1 150 ? 43.232 32.279  33.937 1.00 24.60 ? 150  ASN B N     1 
ATOM   3549 C  CA    . ASN B 1 150 ? 44.486 32.964  34.228 1.00 26.47 ? 150  ASN B CA    1 
ATOM   3550 C  C     . ASN B 1 150 ? 44.646 33.908  33.031 1.00 26.89 ? 150  ASN B C     1 
ATOM   3551 O  O     . ASN B 1 150 ? 43.808 33.900  32.130 1.00 26.88 ? 150  ASN B O     1 
ATOM   3552 C  CB    . ASN B 1 150 ? 45.667 31.994  34.309 1.00 27.78 ? 150  ASN B CB    1 
ATOM   3553 C  CG    . ASN B 1 150 ? 45.742 31.061  33.128 1.00 29.08 ? 150  ASN B CG    1 
ATOM   3554 O  OD1   . ASN B 1 150 ? 45.317 31.400  32.020 1.00 31.16 ? 150  ASN B OD1   1 
ATOM   3555 N  ND2   . ASN B 1 150 ? 46.304 29.879  33.350 1.00 27.73 ? 150  ASN B ND2   1 
ATOM   3556 N  N     . GLN B 1 151 ? 45.696 34.716  33.004 1.00 27.85 ? 151  GLN B N     1 
ATOM   3557 C  CA    . GLN B 1 151 ? 45.866 35.639  31.892 1.00 30.06 ? 151  GLN B CA    1 
ATOM   3558 C  C     . GLN B 1 151 ? 45.804 34.912  30.550 1.00 31.41 ? 151  GLN B C     1 
ATOM   3559 O  O     . GLN B 1 151 ? 45.054 35.310  29.653 1.00 31.11 ? 151  GLN B O     1 
ATOM   3560 C  CB    . GLN B 1 151 ? 47.194 36.395  32.003 1.00 30.21 ? 151  GLN B CB    1 
ATOM   3561 C  CG    . GLN B 1 151 ? 47.284 37.599  31.070 1.00 31.06 ? 151  GLN B CG    1 
ATOM   3562 C  CD    . GLN B 1 151 ? 48.665 38.215  31.035 1.00 30.89 ? 151  GLN B CD    1 
ATOM   3563 O  OE1   . GLN B 1 151 ? 49.239 38.537  32.069 1.00 31.69 ? 151  GLN B OE1   1 
ATOM   3564 N  NE2   . GLN B 1 151 ? 49.204 38.388  29.838 1.00 32.45 ? 151  GLN B NE2   1 
ATOM   3565 N  N     . PHE B 1 152 ? 46.584 33.842  30.421 1.00 32.33 ? 152  PHE B N     1 
ATOM   3566 C  CA    . PHE B 1 152 ? 46.626 33.076  29.183 1.00 32.82 ? 152  PHE B CA    1 
ATOM   3567 C  C     . PHE B 1 152 ? 45.243 32.635  28.713 1.00 33.08 ? 152  PHE B C     1 
ATOM   3568 O  O     . PHE B 1 152 ? 44.901 32.777  27.539 1.00 33.22 ? 152  PHE B O     1 
ATOM   3569 C  CB    . PHE B 1 152 ? 47.523 31.847  29.356 1.00 34.07 ? 152  PHE B CB    1 
ATOM   3570 C  CG    . PHE B 1 152 ? 47.659 31.014  28.108 1.00 36.33 ? 152  PHE B CG    1 
ATOM   3571 C  CD1   . PHE B 1 152 ? 48.237 31.541  26.955 1.00 37.29 ? 152  PHE B CD1   1 
ATOM   3572 C  CD2   . PHE B 1 152 ? 47.193 29.704  28.081 1.00 37.06 ? 152  PHE B CD2   1 
ATOM   3573 C  CE1   . PHE B 1 152 ? 48.342 30.770  25.794 1.00 38.21 ? 152  PHE B CE1   1 
ATOM   3574 C  CE2   . PHE B 1 152 ? 47.294 28.928  26.926 1.00 37.02 ? 152  PHE B CE2   1 
ATOM   3575 C  CZ    . PHE B 1 152 ? 47.869 29.460  25.783 1.00 37.16 ? 152  PHE B CZ    1 
ATOM   3576 N  N     . GLU B 1 153 ? 44.446 32.103  29.631 1.00 33.45 ? 153  GLU B N     1 
ATOM   3577 C  CA    . GLU B 1 153 ? 43.107 31.627  29.299 1.00 33.01 ? 153  GLU B CA    1 
ATOM   3578 C  C     . GLU B 1 153 ? 42.143 32.757  28.959 1.00 32.70 ? 153  GLU B C     1 
ATOM   3579 O  O     . GLU B 1 153 ? 41.281 32.614  28.089 1.00 31.18 ? 153  GLU B O     1 
ATOM   3580 C  CB    . GLU B 1 153 ? 42.568 30.784  30.454 1.00 33.12 ? 153  GLU B CB    1 
ATOM   3581 C  CG    . GLU B 1 153 ? 43.331 29.486  30.616 1.00 34.19 ? 153  GLU B CG    1 
ATOM   3582 C  CD    . GLU B 1 153 ? 43.267 28.919  32.021 1.00 35.53 ? 153  GLU B CD    1 
ATOM   3583 O  OE1   . GLU B 1 153 ? 42.752 29.606  32.929 1.00 36.66 ? 153  GLU B OE1   1 
ATOM   3584 O  OE2   . GLU B 1 153 ? 43.748 27.782  32.217 1.00 36.52 ? 153  GLU B OE2   1 
ATOM   3585 N  N     . ALA B 1 154 ? 42.292 33.880  29.652 1.00 33.35 ? 154  ALA B N     1 
ATOM   3586 C  CA    . ALA B 1 154 ? 41.454 35.043  29.406 1.00 32.94 ? 154  ALA B CA    1 
ATOM   3587 C  C     . ALA B 1 154 ? 41.711 35.549  27.982 1.00 32.57 ? 154  ALA B C     1 
ATOM   3588 O  O     . ALA B 1 154 ? 40.781 35.961  27.289 1.00 32.91 ? 154  ALA B O     1 
ATOM   3589 C  CB    . ALA B 1 154 ? 41.770 36.135  30.423 1.00 33.03 ? 154  ALA B CB    1 
ATOM   3590 N  N     . GLU B 1 155 ? 42.970 35.504  27.549 1.00 31.66 ? 155  GLU B N     1 
ATOM   3591 C  CA    . GLU B 1 155 ? 43.340 35.950  26.209 1.00 30.59 ? 155  GLU B CA    1 
ATOM   3592 C  C     . GLU B 1 155 ? 42.745 35.050  25.128 1.00 30.80 ? 155  GLU B C     1 
ATOM   3593 O  O     . GLU B 1 155 ? 42.170 35.539  24.162 1.00 30.87 ? 155  GLU B O     1 
ATOM   3594 C  CB    . GLU B 1 155 ? 44.862 35.999  26.060 1.00 29.62 ? 155  GLU B CB    1 
ATOM   3595 C  CG    . GLU B 1 155 ? 45.548 36.918  27.050 1.00 30.07 ? 155  GLU B CG    1 
ATOM   3596 C  CD    . GLU B 1 155 ? 47.044 36.989  26.839 1.00 31.17 ? 155  GLU B CD    1 
ATOM   3597 O  OE1   . GLU B 1 155 ? 47.635 35.972  26.423 1.00 33.11 ? 155  GLU B OE1   1 
ATOM   3598 O  OE2   . GLU B 1 155 ? 47.635 38.057  27.102 1.00 32.34 ? 155  GLU B OE2   1 
ATOM   3599 N  N     . LEU B 1 156 ? 42.878 33.739  25.288 1.00 31.17 ? 156  LEU B N     1 
ATOM   3600 C  CA    . LEU B 1 156 ? 42.333 32.801  24.311 1.00 32.06 ? 156  LEU B CA    1 
ATOM   3601 C  C     . LEU B 1 156 ? 40.818 32.950  24.142 1.00 33.27 ? 156  LEU B C     1 
ATOM   3602 O  O     . LEU B 1 156 ? 40.303 32.945  23.020 1.00 35.18 ? 156  LEU B O     1 
ATOM   3603 C  CB    . LEU B 1 156 ? 42.645 31.356  24.719 1.00 31.91 ? 156  LEU B CB    1 
ATOM   3604 C  CG    . LEU B 1 156 ? 44.104 30.898  24.746 1.00 31.09 ? 156  LEU B CG    1 
ATOM   3605 C  CD1   . LEU B 1 156 ? 44.158 29.474  25.238 1.00 30.84 ? 156  LEU B CD1   1 
ATOM   3606 C  CD2   . LEU B 1 156 ? 44.723 30.991  23.371 1.00 29.76 ? 156  LEU B CD2   1 
ATOM   3607 N  N     . LEU B 1 157 ? 40.108 33.084  25.256 1.00 32.61 ? 157  LEU B N     1 
ATOM   3608 C  CA    . LEU B 1 157 ? 38.655 33.208  25.227 1.00 31.55 ? 157  LEU B CA    1 
ATOM   3609 C  C     . LEU B 1 157 ? 38.153 34.449  24.508 1.00 31.98 ? 157  LEU B C     1 
ATOM   3610 O  O     . LEU B 1 157 ? 37.086 34.430  23.887 1.00 31.57 ? 157  LEU B O     1 
ATOM   3611 C  CB    . LEU B 1 157 ? 38.096 33.196  26.655 1.00 29.85 ? 157  LEU B CB    1 
ATOM   3612 C  CG    . LEU B 1 157 ? 38.117 31.891  27.449 1.00 27.40 ? 157  LEU B CG    1 
ATOM   3613 C  CD1   . LEU B 1 157 ? 37.738 32.181  28.883 1.00 27.69 ? 157  LEU B CD1   1 
ATOM   3614 C  CD2   . LEU B 1 157 ? 37.159 30.890  26.829 1.00 25.19 ? 157  LEU B CD2   1 
ATOM   3615 N  N     . THR B 1 158 ? 38.919 35.531  24.589 1.00 31.87 ? 158  THR B N     1 
ATOM   3616 C  CA    . THR B 1 158 ? 38.503 36.775  23.964 1.00 32.60 ? 158  THR B CA    1 
ATOM   3617 C  C     . THR B 1 158 ? 39.286 37.123  22.705 1.00 33.88 ? 158  THR B C     1 
ATOM   3618 O  O     . THR B 1 158 ? 38.989 38.116  22.040 1.00 34.88 ? 158  THR B O     1 
ATOM   3619 C  CB    . THR B 1 158 ? 38.623 37.941  24.957 1.00 30.75 ? 158  THR B CB    1 
ATOM   3620 O  OG1   . THR B 1 158 ? 39.987 38.070  25.364 1.00 29.21 ? 158  THR B OG1   1 
ATOM   3621 C  CG2   . THR B 1 158 ? 37.745 37.694  26.182 1.00 27.83 ? 158  THR B CG2   1 
ATOM   3622 N  N     . GLY B 1 159 ? 40.282 36.306  22.379 1.00 33.90 ? 159  GLY B N     1 
ATOM   3623 C  CA    . GLY B 1 159 ? 41.087 36.561  21.201 1.00 34.04 ? 159  GLY B CA    1 
ATOM   3624 C  C     . GLY B 1 159 ? 41.885 37.844  21.307 1.00 35.34 ? 159  GLY B C     1 
ATOM   3625 O  O     . GLY B 1 159 ? 42.379 38.355  20.306 1.00 35.54 ? 159  GLY B O     1 
ATOM   3626 N  N     . ARG B 1 160 ? 42.018 38.364  22.523 1.00 37.04 ? 160  ARG B N     1 
ATOM   3627 C  CA    . ARG B 1 160 ? 42.758 39.596  22.740 1.00 38.24 ? 160  ARG B CA    1 
ATOM   3628 C  C     . ARG B 1 160 ? 43.971 39.407  23.635 1.00 39.63 ? 160  ARG B C     1 
ATOM   3629 O  O     . ARG B 1 160 ? 43.984 38.560  24.519 1.00 40.49 ? 160  ARG B O     1 
ATOM   3630 C  CB    . ARG B 1 160 ? 41.847 40.654  23.337 1.00 37.96 ? 160  ARG B CB    1 
ATOM   3631 C  CG    . ARG B 1 160 ? 42.155 42.010  22.808 1.00 38.62 ? 160  ARG B CG    1 
ATOM   3632 C  CD    . ARG B 1 160 ? 41.274 43.050  23.410 1.00 39.45 ? 160  ARG B CD    1 
ATOM   3633 N  NE    . ARG B 1 160 ? 42.080 44.221  23.695 1.00 40.21 ? 160  ARG B NE    1 
ATOM   3634 C  CZ    . ARG B 1 160 ? 41.612 45.340  24.221 1.00 40.52 ? 160  ARG B CZ    1 
ATOM   3635 N  NH1   . ARG B 1 160 ? 40.328 45.449  24.517 1.00 40.77 ? 160  ARG B NH1   1 
ATOM   3636 N  NH2   . ARG B 1 160 ? 42.442 46.342  24.467 1.00 44.26 ? 160  ARG B NH2   1 
ATOM   3637 N  N     . LYS B 1 161 ? 44.990 40.222  23.400 1.00 41.03 ? 161  LYS B N     1 
ATOM   3638 C  CA    . LYS B 1 161 ? 46.230 40.154  24.154 1.00 42.09 ? 161  LYS B CA    1 
ATOM   3639 C  C     . LYS B 1 161 ? 46.222 41.195  25.271 1.00 42.38 ? 161  LYS B C     1 
ATOM   3640 O  O     . LYS B 1 161 ? 45.692 42.290  25.097 1.00 43.84 ? 161  LYS B O     1 
ATOM   3641 C  CB    . LYS B 1 161 ? 47.397 40.424  23.211 1.00 44.72 ? 161  LYS B CB    1 
ATOM   3642 C  CG    . LYS B 1 161 ? 48.541 39.468  23.348 1.00 47.57 ? 161  LYS B CG    1 
ATOM   3643 C  CD    . LYS B 1 161 ? 48.378 38.254  22.458 1.00 52.70 ? 161  LYS B CD    1 
ATOM   3644 C  CE    . LYS B 1 161 ? 49.291 37.150  22.959 1.00 56.14 ? 161  LYS B CE    1 
ATOM   3645 N  NZ    . LYS B 1 161 ? 49.519 36.049  21.987 1.00 57.84 ? 161  LYS B NZ    1 
ATOM   3646 N  N     . ILE B 1 162 ? 46.818 40.861  26.410 1.00 41.22 ? 162  ILE B N     1 
ATOM   3647 C  CA    . ILE B 1 162 ? 46.858 41.779  27.544 1.00 40.95 ? 162  ILE B CA    1 
ATOM   3648 C  C     . ILE B 1 162 ? 48.276 42.293  27.774 1.00 42.00 ? 162  ILE B C     1 
ATOM   3649 O  O     . ILE B 1 162 ? 49.190 41.517  28.052 1.00 42.52 ? 162  ILE B O     1 
ATOM   3650 C  CB    . ILE B 1 162 ? 46.331 41.086  28.834 1.00 39.59 ? 162  ILE B CB    1 
ATOM   3651 C  CG1   . ILE B 1 162 ? 44.873 40.671  28.630 1.00 38.78 ? 162  ILE B CG1   1 
ATOM   3652 C  CG2   . ILE B 1 162 ? 46.450 42.017  30.029 1.00 39.26 ? 162  ILE B CG2   1 
ATOM   3653 C  CD1   . ILE B 1 162 ? 44.241 39.997  29.819 1.00 38.65 ? 162  ILE B CD1   1 
ATOM   3654 N  N     . HIS B 1 163 ? 48.456 43.607  27.652 1.00 43.05 ? 163  HIS B N     1 
ATOM   3655 C  CA    . HIS B 1 163 ? 49.769 44.213  27.843 1.00 43.64 ? 163  HIS B CA    1 
ATOM   3656 C  C     . HIS B 1 163 ? 49.799 45.134  29.060 1.00 42.58 ? 163  HIS B C     1 
ATOM   3657 O  O     . HIS B 1 163 ? 50.869 45.560  29.498 1.00 42.62 ? 163  HIS B O     1 
ATOM   3658 C  CB    . HIS B 1 163 ? 50.182 45.018  26.600 1.00 46.04 ? 163  HIS B CB    1 
ATOM   3659 C  CG    . HIS B 1 163 ? 49.950 44.304  25.302 1.00 48.64 ? 163  HIS B CG    1 
ATOM   3660 N  ND1   . HIS B 1 163 ? 50.249 42.969  25.119 1.00 49.49 ? 163  HIS B ND1   1 
ATOM   3661 C  CD2   . HIS B 1 163 ? 49.461 44.746  24.118 1.00 49.14 ? 163  HIS B CD2   1 
ATOM   3662 C  CE1   . HIS B 1 163 ? 49.951 42.622  23.879 1.00 49.64 ? 163  HIS B CE1   1 
ATOM   3663 N  NE2   . HIS B 1 163 ? 49.472 43.680  23.251 1.00 48.46 ? 163  HIS B NE2   1 
ATOM   3664 N  N     . SER B 1 164 ? 48.628 45.440  29.608 1.00 41.14 ? 164  SER B N     1 
ATOM   3665 C  CA    . SER B 1 164 ? 48.558 46.328  30.760 1.00 40.58 ? 164  SER B CA    1 
ATOM   3666 C  C     . SER B 1 164 ? 47.322 46.092  31.605 1.00 40.26 ? 164  SER B C     1 
ATOM   3667 O  O     . SER B 1 164 ? 46.415 45.363  31.212 1.00 40.63 ? 164  SER B O     1 
ATOM   3668 C  CB    . SER B 1 164 ? 48.558 47.781  30.295 1.00 41.29 ? 164  SER B CB    1 
ATOM   3669 O  OG    . SER B 1 164 ? 47.407 48.046  29.516 1.00 40.93 ? 164  SER B OG    1 
ATOM   3670 N  N     . GLN B 1 165 ? 47.288 46.727  32.767 1.00 39.30 ? 165  GLN B N     1 
ATOM   3671 C  CA    . GLN B 1 165 ? 46.156 46.592  33.663 1.00 39.00 ? 165  GLN B CA    1 
ATOM   3672 C  C     . GLN B 1 165 ? 44.862 47.078  32.996 1.00 40.46 ? 165  GLN B C     1 
ATOM   3673 O  O     . GLN B 1 165 ? 43.795 46.502  33.204 1.00 39.81 ? 165  GLN B O     1 
ATOM   3674 C  CB    . GLN B 1 165 ? 46.410 47.389  34.941 1.00 38.21 ? 165  GLN B CB    1 
ATOM   3675 C  CG    . GLN B 1 165 ? 45.379 47.152  36.024 1.00 38.29 ? 165  GLN B CG    1 
ATOM   3676 C  CD    . GLN B 1 165 ? 45.555 48.069  37.219 1.00 38.78 ? 165  GLN B CD    1 
ATOM   3677 O  OE1   . GLN B 1 165 ? 44.889 49.098  37.339 1.00 38.71 ? 165  GLN B OE1   1 
ATOM   3678 N  NE2   . GLN B 1 165 ? 46.464 47.703  38.105 1.00 39.94 ? 165  GLN B NE2   1 
ATOM   3679 N  N     . GLU B 1 166 ? 44.957 48.136  32.192 1.00 41.97 ? 166  GLU B N     1 
ATOM   3680 C  CA    . GLU B 1 166 ? 43.780 48.681  31.522 1.00 42.26 ? 166  GLU B CA    1 
ATOM   3681 C  C     . GLU B 1 166 ? 43.233 47.712  30.486 1.00 40.50 ? 166  GLU B C     1 
ATOM   3682 O  O     . GLU B 1 166 ? 42.022 47.626  30.295 1.00 39.95 ? 166  GLU B O     1 
ATOM   3683 C  CB    . GLU B 1 166 ? 44.105 50.016  30.844 1.00 44.41 ? 166  GLU B CB    1 
ATOM   3684 C  CG    . GLU B 1 166 ? 44.763 51.047  31.755 1.00 49.89 ? 166  GLU B CG    1 
ATOM   3685 C  CD    . GLU B 1 166 ? 46.249 50.769  32.003 1.00 52.67 ? 166  GLU B CD    1 
ATOM   3686 O  OE1   . GLU B 1 166 ? 47.018 50.635  31.023 1.00 54.47 ? 166  GLU B OE1   1 
ATOM   3687 O  OE2   . GLU B 1 166 ? 46.654 50.694  33.181 1.00 53.32 ? 166  GLU B OE2   1 
ATOM   3688 N  N     . GLU B 1 167 ? 44.125 46.987  29.819 1.00 38.98 ? 167  GLU B N     1 
ATOM   3689 C  CA    . GLU B 1 167 ? 43.708 46.033  28.806 1.00 39.65 ? 167  GLU B CA    1 
ATOM   3690 C  C     . GLU B 1 167 ? 43.043 44.831  29.449 1.00 38.57 ? 167  GLU B C     1 
ATOM   3691 O  O     . GLU B 1 167 ? 42.114 44.247  28.883 1.00 39.45 ? 167  GLU B O     1 
ATOM   3692 C  CB    . GLU B 1 167 ? 44.899 45.579  27.962 1.00 41.36 ? 167  GLU B CB    1 
ATOM   3693 C  CG    . GLU B 1 167 ? 45.392 46.631  26.981 1.00 43.89 ? 167  GLU B CG    1 
ATOM   3694 C  CD    . GLU B 1 167 ? 46.470 46.114  26.036 1.00 44.30 ? 167  GLU B CD    1 
ATOM   3695 O  OE1   . GLU B 1 167 ? 46.988 46.922  25.238 1.00 47.63 ? 167  GLU B OE1   1 
ATOM   3696 O  OE2   . GLU B 1 167 ? 46.800 44.911  26.083 1.00 42.24 ? 167  GLU B OE2   1 
ATOM   3697 N  N     . ALA B 1 168 ? 43.523 44.468  30.635 1.00 36.54 ? 168  ALA B N     1 
ATOM   3698 C  CA    . ALA B 1 168 ? 42.966 43.343  31.374 1.00 33.75 ? 168  ALA B CA    1 
ATOM   3699 C  C     . ALA B 1 168 ? 41.511 43.649  31.718 1.00 32.73 ? 168  ALA B C     1 
ATOM   3700 O  O     . ALA B 1 168 ? 40.629 42.808  31.548 1.00 32.33 ? 168  ALA B O     1 
ATOM   3701 C  CB    . ALA B 1 168 ? 43.766 43.112  32.638 1.00 32.60 ? 168  ALA B CB    1 
ATOM   3702 N  N     . LEU B 1 169 ? 41.275 44.863  32.203 1.00 32.18 ? 169  LEU B N     1 
ATOM   3703 C  CA    . LEU B 1 169 ? 39.938 45.311  32.568 1.00 31.56 ? 169  LEU B CA    1 
ATOM   3704 C  C     . LEU B 1 169 ? 39.011 45.284  31.359 1.00 31.32 ? 169  LEU B C     1 
ATOM   3705 O  O     . LEU B 1 169 ? 37.817 45.030  31.494 1.00 32.06 ? 169  LEU B O     1 
ATOM   3706 C  CB    . LEU B 1 169 ? 39.995 46.732  33.138 1.00 33.14 ? 169  LEU B CB    1 
ATOM   3707 C  CG    . LEU B 1 169 ? 40.853 46.935  34.392 1.00 32.79 ? 169  LEU B CG    1 
ATOM   3708 C  CD1   . LEU B 1 169 ? 40.889 48.404  34.773 1.00 32.22 ? 169  LEU B CD1   1 
ATOM   3709 C  CD2   . LEU B 1 169 ? 40.287 46.108  35.526 1.00 32.80 ? 169  LEU B CD2   1 
ATOM   3710 N  N     . GLU B 1 170 ? 39.558 45.553  30.179 1.00 30.63 ? 170  GLU B N     1 
ATOM   3711 C  CA    . GLU B 1 170 ? 38.758 45.540  28.966 1.00 30.15 ? 170  GLU B CA    1 
ATOM   3712 C  C     . GLU B 1 170 ? 38.413 44.104  28.606 1.00 29.81 ? 170  GLU B C     1 
ATOM   3713 O  O     . GLU B 1 170 ? 37.287 43.812  28.190 1.00 29.99 ? 170  GLU B O     1 
ATOM   3714 C  CB    . GLU B 1 170 ? 39.514 46.205  27.819 1.00 31.28 ? 170  GLU B CB    1 
ATOM   3715 C  CG    . GLU B 1 170 ? 39.658 47.698  27.974 1.00 32.14 ? 170  GLU B CG    1 
ATOM   3716 C  CD    . GLU B 1 170 ? 40.422 48.325  26.838 1.00 32.39 ? 170  GLU B CD    1 
ATOM   3717 O  OE1   . GLU B 1 170 ? 40.819 49.495  26.971 1.00 35.71 ? 170  GLU B OE1   1 
ATOM   3718 O  OE2   . GLU B 1 170 ? 40.624 47.656  25.812 1.00 32.35 ? 170  GLU B OE2   1 
ATOM   3719 N  N     . VAL B 1 171 ? 39.381 43.207  28.773 1.00 28.16 ? 171  VAL B N     1 
ATOM   3720 C  CA    . VAL B 1 171 ? 39.156 41.803  28.475 1.00 28.08 ? 171  VAL B CA    1 
ATOM   3721 C  C     . VAL B 1 171 ? 38.120 41.224  29.425 1.00 28.10 ? 171  VAL B C     1 
ATOM   3722 O  O     . VAL B 1 171 ? 37.305 40.390  29.030 1.00 28.37 ? 171  VAL B O     1 
ATOM   3723 C  CB    . VAL B 1 171 ? 40.445 40.994  28.589 1.00 28.60 ? 171  VAL B CB    1 
ATOM   3724 C  CG1   . VAL B 1 171 ? 40.130 39.513  28.520 1.00 28.79 ? 171  VAL B CG1   1 
ATOM   3725 C  CG2   . VAL B 1 171 ? 41.392 41.382  27.459 1.00 29.77 ? 171  VAL B CG2   1 
ATOM   3726 N  N     . MET B 1 172 ? 38.148 41.669  30.679 1.00 27.80 ? 172  MET B N     1 
ATOM   3727 C  CA    . MET B 1 172 ? 37.187 41.197  31.668 1.00 26.80 ? 172  MET B CA    1 
ATOM   3728 C  C     . MET B 1 172 ? 35.779 41.687  31.345 1.00 26.25 ? 172  MET B C     1 
ATOM   3729 O  O     . MET B 1 172 ? 34.798 41.025  31.674 1.00 25.82 ? 172  MET B O     1 
ATOM   3730 C  CB    . MET B 1 172 ? 37.589 41.648  33.072 1.00 27.38 ? 172  MET B CB    1 
ATOM   3731 C  CG    . MET B 1 172 ? 38.905 41.050  33.549 1.00 29.63 ? 172  MET B CG    1 
ATOM   3732 S  SD    . MET B 1 172 ? 39.067 41.051  35.342 1.00 29.32 ? 172  MET B SD    1 
ATOM   3733 C  CE    . MET B 1 172 ? 39.899 42.598  35.592 1.00 31.62 ? 172  MET B CE    1 
ATOM   3734 N  N     . ASP B 1 173 ? 35.684 42.850  30.704 1.00 25.57 ? 173  ASP B N     1 
ATOM   3735 C  CA    . ASP B 1 173 ? 34.393 43.402  30.315 1.00 24.91 ? 173  ASP B CA    1 
ATOM   3736 C  C     . ASP B 1 173 ? 33.868 42.563  29.158 1.00 24.27 ? 173  ASP B C     1 
ATOM   3737 O  O     . ASP B 1 173 ? 32.677 42.292  29.063 1.00 22.63 ? 173  ASP B O     1 
ATOM   3738 C  CB    . ASP B 1 173 ? 34.544 44.861  29.877 1.00 27.54 ? 173  ASP B CB    1 
ATOM   3739 C  CG    . ASP B 1 173 ? 34.479 45.843  31.039 1.00 28.06 ? 173  ASP B CG    1 
ATOM   3740 O  OD1   . ASP B 1 173 ? 34.910 47.001  30.859 1.00 29.29 ? 173  ASP B OD1   1 
ATOM   3741 O  OD2   . ASP B 1 173 ? 33.985 45.471  32.121 1.00 30.03 ? 173  ASP B OD2   1 
ATOM   3742 N  N     . MET B 1 174 ? 34.772 42.142  28.282 1.00 24.15 ? 174  MET B N     1 
ATOM   3743 C  CA    . MET B 1 174 ? 34.390 41.321  27.144 1.00 25.07 ? 174  MET B CA    1 
ATOM   3744 C  C     . MET B 1 174 ? 33.828 39.988  27.635 1.00 25.42 ? 174  MET B C     1 
ATOM   3745 O  O     . MET B 1 174 ? 32.868 39.454  27.068 1.00 24.64 ? 174  MET B O     1 
ATOM   3746 C  CB    . MET B 1 174 ? 35.597 41.093  26.230 1.00 25.80 ? 174  MET B CB    1 
ATOM   3747 C  CG    . MET B 1 174 ? 36.020 42.324  25.453 1.00 27.57 ? 174  MET B CG    1 
ATOM   3748 S  SD    . MET B 1 174 ? 37.573 42.078  24.558 1.00 30.13 ? 174  MET B SD    1 
ATOM   3749 C  CE    . MET B 1 174 ? 36.969 41.213  23.108 1.00 33.98 ? 174  MET B CE    1 
ATOM   3750 N  N     . LEU B 1 175 ? 34.429 39.456  28.694 1.00 24.86 ? 175  LEU B N     1 
ATOM   3751 C  CA    . LEU B 1 175 ? 33.981 38.201  29.272 1.00 24.92 ? 175  LEU B CA    1 
ATOM   3752 C  C     . LEU B 1 175 ? 32.605 38.366  29.916 1.00 25.39 ? 175  LEU B C     1 
ATOM   3753 O  O     . LEU B 1 175 ? 31.776 37.460  29.857 1.00 24.87 ? 175  LEU B O     1 
ATOM   3754 C  CB    . LEU B 1 175 ? 35.000 37.711  30.295 1.00 25.01 ? 175  LEU B CB    1 
ATOM   3755 C  CG    . LEU B 1 175 ? 36.308 37.258  29.644 1.00 25.60 ? 175  LEU B CG    1 
ATOM   3756 C  CD1   . LEU B 1 175 ? 37.394 37.067  30.682 1.00 24.28 ? 175  LEU B CD1   1 
ATOM   3757 C  CD2   . LEU B 1 175 ? 36.055 35.974  28.884 1.00 25.82 ? 175  LEU B CD2   1 
ATOM   3758 N  N     . HIS B 1 176 ? 32.357 39.523  30.524 1.00 26.09 ? 176  HIS B N     1 
ATOM   3759 C  CA    . HIS B 1 176 ? 31.059 39.783  31.140 1.00 27.40 ? 176  HIS B CA    1 
ATOM   3760 C  C     . HIS B 1 176 ? 29.963 39.745  30.080 1.00 28.10 ? 176  HIS B C     1 
ATOM   3761 O  O     . HIS B 1 176 ? 28.872 39.224  30.327 1.00 28.47 ? 176  HIS B O     1 
ATOM   3762 C  CB    . HIS B 1 176 ? 31.041 41.149  31.828 1.00 28.07 ? 176  HIS B CB    1 
ATOM   3763 C  CG    . HIS B 1 176 ? 31.762 41.181  33.142 1.00 29.58 ? 176  HIS B CG    1 
ATOM   3764 N  ND1   . HIS B 1 176 ? 31.439 40.343  34.187 1.00 30.23 ? 176  HIS B ND1   1 
ATOM   3765 C  CD2   . HIS B 1 176 ? 32.761 41.976  33.594 1.00 28.73 ? 176  HIS B CD2   1 
ATOM   3766 C  CE1   . HIS B 1 176 ? 32.205 40.622  35.226 1.00 29.28 ? 176  HIS B CE1   1 
ATOM   3767 N  NE2   . HIS B 1 176 ? 33.016 41.610  34.892 1.00 28.59 ? 176  HIS B NE2   1 
ATOM   3768 N  N     . SER B 1 177 ? 30.260 40.299  28.902 1.00 28.80 ? 177  SER B N     1 
ATOM   3769 C  CA    . SER B 1 177 ? 29.314 40.334  27.782 1.00 28.89 ? 177  SER B CA    1 
ATOM   3770 C  C     . SER B 1 177 ? 29.009 38.934  27.302 1.00 28.51 ? 177  SER B C     1 
ATOM   3771 O  O     . SER B 1 177 ? 27.939 38.685  26.757 1.00 29.97 ? 177  SER B O     1 
ATOM   3772 C  CB    . SER B 1 177 ? 29.883 41.089  26.583 1.00 29.82 ? 177  SER B CB    1 
ATOM   3773 O  OG    . SER B 1 177 ? 30.680 42.180  26.976 1.00 32.90 ? 177  SER B OG    1 
ATOM   3774 N  N     . MET B 1 178 ? 29.976 38.034  27.466 1.00 27.39 ? 178  MET B N     1 
ATOM   3775 C  CA    . MET B 1 178 ? 29.814 36.652  27.048 1.00 25.27 ? 178  MET B CA    1 
ATOM   3776 C  C     . MET B 1 178 ? 28.960 35.881  28.040 1.00 24.68 ? 178  MET B C     1 
ATOM   3777 O  O     . MET B 1 178 ? 28.482 34.795  27.735 1.00 26.20 ? 178  MET B O     1 
ATOM   3778 C  CB    . MET B 1 178 ? 31.178 35.980  26.892 1.00 25.58 ? 178  MET B CB    1 
ATOM   3779 C  CG    . MET B 1 178 ? 31.983 36.491  25.711 1.00 25.82 ? 178  MET B CG    1 
ATOM   3780 S  SD    . MET B 1 178 ? 33.720 35.970  25.712 1.00 25.02 ? 178  MET B SD    1 
ATOM   3781 C  CE    . MET B 1 178 ? 33.579 34.269  25.121 1.00 28.74 ? 178  MET B CE    1 
ATOM   3782 N  N     . GLY B 1 179 ? 28.762 36.428  29.235 1.00 23.44 ? 179  GLY B N     1 
ATOM   3783 C  CA    . GLY B 1 179 ? 27.925 35.720  30.178 1.00 22.14 ? 179  GLY B CA    1 
ATOM   3784 C  C     . GLY B 1 179 ? 28.126 35.880  31.669 1.00 21.58 ? 179  GLY B C     1 
ATOM   3785 O  O     . GLY B 1 179 ? 27.241 36.408  32.335 1.00 22.07 ? 179  GLY B O     1 
ATOM   3786 N  N     . PRO B 1 180 ? 29.260 35.422  32.227 1.00 21.36 ? 180  PRO B N     1 
ATOM   3787 C  CA    . PRO B 1 180 ? 29.557 35.512  33.663 1.00 20.81 ? 180  PRO B CA    1 
ATOM   3788 C  C     . PRO B 1 180 ? 29.563 36.896  34.319 1.00 21.32 ? 180  PRO B C     1 
ATOM   3789 O  O     . PRO B 1 180 ? 30.274 37.798  33.878 1.00 19.85 ? 180  PRO B O     1 
ATOM   3790 C  CB    . PRO B 1 180 ? 30.909 34.801  33.777 1.00 21.03 ? 180  PRO B CB    1 
ATOM   3791 C  CG    . PRO B 1 180 ? 31.525 35.011  32.447 1.00 19.05 ? 180  PRO B CG    1 
ATOM   3792 C  CD    . PRO B 1 180 ? 30.369 34.764  31.518 1.00 20.58 ? 180  PRO B CD    1 
ATOM   3793 N  N     . ASP B 1 181 ? 28.768 37.046  35.382 1.00 21.66 ? 181  ASP B N     1 
ATOM   3794 C  CA    . ASP B 1 181 ? 28.688 38.311  36.117 1.00 21.13 ? 181  ASP B CA    1 
ATOM   3795 C  C     . ASP B 1 181 ? 29.915 38.515  36.993 1.00 21.09 ? 181  ASP B C     1 
ATOM   3796 O  O     . ASP B 1 181 ? 30.174 39.623  37.468 1.00 20.21 ? 181  ASP B O     1 
ATOM   3797 C  CB    . ASP B 1 181 ? 27.446 38.370  37.008 1.00 22.13 ? 181  ASP B CB    1 
ATOM   3798 C  CG    . ASP B 1 181 ? 26.178 38.641  36.227 1.00 25.36 ? 181  ASP B CG    1 
ATOM   3799 O  OD1   . ASP B 1 181 ? 26.244 39.386  35.229 1.00 28.50 ? 181  ASP B OD1   1 
ATOM   3800 O  OD2   . ASP B 1 181 ? 25.110 38.124  36.616 1.00 26.90 ? 181  ASP B OD2   1 
ATOM   3801 N  N     . THR B 1 182 ? 30.666 37.441  37.215 1.00 19.97 ? 182  THR B N     1 
ATOM   3802 C  CA    . THR B 1 182 ? 31.872 37.528  38.029 1.00 18.13 ? 182  THR B CA    1 
ATOM   3803 C  C     . THR B 1 182 ? 33.056 36.949  37.265 1.00 19.17 ? 182  THR B C     1 
ATOM   3804 O  O     . THR B 1 182 ? 32.990 35.836  36.746 1.00 21.27 ? 182  THR B O     1 
ATOM   3805 C  CB    . THR B 1 182 ? 31.711 36.766  39.364 1.00 16.14 ? 182  THR B CB    1 
ATOM   3806 O  OG1   . THR B 1 182 ? 30.596 37.297  40.094 1.00 13.00 ? 182  THR B OG1   1 
ATOM   3807 C  CG2   . THR B 1 182 ? 32.962 36.914  40.203 1.00 14.08 ? 182  THR B CG2   1 
ATOM   3808 N  N     . VAL B 1 183 ? 34.139 37.712  37.185 1.00 18.55 ? 183  VAL B N     1 
ATOM   3809 C  CA    . VAL B 1 183 ? 35.330 37.261  36.475 1.00 16.96 ? 183  VAL B CA    1 
ATOM   3810 C  C     . VAL B 1 183 ? 36.551 37.520  37.351 1.00 17.98 ? 183  VAL B C     1 
ATOM   3811 O  O     . VAL B 1 183 ? 36.733 38.624  37.859 1.00 18.83 ? 183  VAL B O     1 
ATOM   3812 C  CB    . VAL B 1 183 ? 35.512 38.023  35.118 1.00 15.46 ? 183  VAL B CB    1 
ATOM   3813 C  CG1   . VAL B 1 183 ? 36.794 37.581  34.430 1.00 12.63 ? 183  VAL B CG1   1 
ATOM   3814 C  CG2   . VAL B 1 183 ? 34.321 37.777  34.206 1.00 12.39 ? 183  VAL B CG2   1 
ATOM   3815 N  N     . VAL B 1 184 ? 37.376 36.498  37.547 1.00 17.59 ? 184  VAL B N     1 
ATOM   3816 C  CA    . VAL B 1 184 ? 38.581 36.667  38.342 1.00 17.89 ? 184  VAL B CA    1 
ATOM   3817 C  C     . VAL B 1 184 ? 39.779 36.108  37.596 1.00 18.83 ? 184  VAL B C     1 
ATOM   3818 O  O     . VAL B 1 184 ? 39.837 34.912  37.318 1.00 17.85 ? 184  VAL B O     1 
ATOM   3819 C  CB    . VAL B 1 184 ? 38.496 35.950  39.714 1.00 18.36 ? 184  VAL B CB    1 
ATOM   3820 C  CG1   . VAL B 1 184 ? 39.810 36.125  40.462 1.00 15.56 ? 184  VAL B CG1   1 
ATOM   3821 C  CG2   . VAL B 1 184 ? 37.349 36.516  40.539 1.00 16.97 ? 184  VAL B CG2   1 
ATOM   3822 N  N     . ILE B 1 185 ? 40.717 36.986  37.247 1.00 19.91 ? 185  ILE B N     1 
ATOM   3823 C  CA    . ILE B 1 185 ? 41.929 36.570  36.565 1.00 21.48 ? 185  ILE B CA    1 
ATOM   3824 C  C     . ILE B 1 185 ? 42.876 36.266  37.715 1.00 22.23 ? 185  ILE B C     1 
ATOM   3825 O  O     . ILE B 1 185 ? 43.457 37.162  38.331 1.00 23.28 ? 185  ILE B O     1 
ATOM   3826 C  CB    . ILE B 1 185 ? 42.479 37.690  35.638 1.00 22.55 ? 185  ILE B CB    1 
ATOM   3827 C  CG1   . ILE B 1 185 ? 41.488 37.933  34.500 1.00 22.11 ? 185  ILE B CG1   1 
ATOM   3828 C  CG2   . ILE B 1 185 ? 43.843 37.292  35.045 1.00 20.68 ? 185  ILE B CG2   1 
ATOM   3829 C  CD1   . ILE B 1 185 ? 41.996 38.890  33.456 1.00 26.46 ? 185  ILE B CD1   1 
ATOM   3830 N  N     . THR B 1 186 ? 43.003 34.975  37.998 1.00 22.63 ? 186  THR B N     1 
ATOM   3831 C  CA    . THR B 1 186 ? 43.800 34.468  39.100 1.00 22.60 ? 186  THR B CA    1 
ATOM   3832 C  C     . THR B 1 186 ? 45.299 34.717  39.117 1.00 24.27 ? 186  THR B C     1 
ATOM   3833 O  O     . THR B 1 186 ? 45.901 34.703  40.187 1.00 26.81 ? 186  THR B O     1 
ATOM   3834 C  CB    . THR B 1 186 ? 43.554 32.971  39.268 1.00 20.27 ? 186  THR B CB    1 
ATOM   3835 O  OG1   . THR B 1 186 ? 43.916 32.293  38.062 1.00 20.84 ? 186  THR B OG1   1 
ATOM   3836 C  CG2   . THR B 1 186 ? 42.083 32.710  39.560 1.00 17.56 ? 186  THR B CG2   1 
ATOM   3837 N  N     . SER B 1 187 ? 45.912 34.929  37.960 1.00 25.66 ? 187  SER B N     1 
ATOM   3838 C  CA    . SER B 1 187 ? 47.347 35.194  37.920 1.00 28.23 ? 187  SER B CA    1 
ATOM   3839 C  C     . SER B 1 187 ? 47.679 35.800  36.572 1.00 29.50 ? 187  SER B C     1 
ATOM   3840 O  O     . SER B 1 187 ? 47.015 35.505  35.587 1.00 28.25 ? 187  SER B O     1 
ATOM   3841 C  CB    . SER B 1 187 ? 48.152 33.908  38.145 1.00 28.30 ? 187  SER B CB    1 
ATOM   3842 O  OG    . SER B 1 187 ? 48.072 33.042  37.032 1.00 29.68 ? 187  SER B OG    1 
ATOM   3843 N  N     . SER B 1 188 ? 48.707 36.643  36.533 1.00 32.37 ? 188  SER B N     1 
ATOM   3844 C  CA    . SER B 1 188 ? 49.080 37.315  35.298 1.00 34.94 ? 188  SER B CA    1 
ATOM   3845 C  C     . SER B 1 188 ? 50.562 37.655  35.258 1.00 37.80 ? 188  SER B C     1 
ATOM   3846 O  O     . SER B 1 188 ? 51.259 37.542  36.264 1.00 38.31 ? 188  SER B O     1 
ATOM   3847 C  CB    . SER B 1 188 ? 48.294 38.610  35.181 1.00 33.12 ? 188  SER B CB    1 
ATOM   3848 O  OG    . SER B 1 188 ? 48.694 39.485  36.220 1.00 30.17 ? 188  SER B OG    1 
ATOM   3849 N  N     . ASN B 1 189 ? 51.017 38.100  34.087 1.00 40.80 ? 189  ASN B N     1 
ATOM   3850 C  CA    . ASN B 1 189 ? 52.405 38.497  33.864 1.00 42.26 ? 189  ASN B CA    1 
ATOM   3851 C  C     . ASN B 1 189 ? 52.584 39.992  34.100 1.00 42.07 ? 189  ASN B C     1 
ATOM   3852 O  O     . ASN B 1 189 ? 53.689 40.505  33.999 1.00 41.52 ? 189  ASN B O     1 
ATOM   3853 C  CB    . ASN B 1 189 ? 52.828 38.180  32.429 1.00 45.35 ? 189  ASN B CB    1 
ATOM   3854 C  CG    . ASN B 1 189 ? 52.671 36.713  32.085 1.00 49.55 ? 189  ASN B CG    1 
ATOM   3855 O  OD1   . ASN B 1 189 ? 53.582 36.090  31.529 1.00 52.92 ? 189  ASN B OD1   1 
ATOM   3856 N  ND2   . ASN B 1 189 ? 51.509 36.149  32.404 1.00 51.33 ? 189  ASN B ND2   1 
ATOM   3857 N  N     . LEU B 1 190 ? 51.492 40.688  34.400 1.00 42.67 ? 190  LEU B N     1 
ATOM   3858 C  CA    . LEU B 1 190 ? 51.546 42.124  34.639 1.00 44.06 ? 190  LEU B CA    1 
ATOM   3859 C  C     . LEU B 1 190 ? 52.420 42.451  35.836 1.00 45.55 ? 190  LEU B C     1 
ATOM   3860 O  O     . LEU B 1 190 ? 52.295 41.836  36.889 1.00 45.63 ? 190  LEU B O     1 
ATOM   3861 C  CB    . LEU B 1 190 ? 50.139 42.669  34.863 1.00 43.95 ? 190  LEU B CB    1 
ATOM   3862 C  CG    . LEU B 1 190 ? 49.262 42.596  33.617 1.00 43.67 ? 190  LEU B CG    1 
ATOM   3863 C  CD1   . LEU B 1 190 ? 47.921 41.998  33.960 1.00 43.21 ? 190  LEU B CD1   1 
ATOM   3864 C  CD2   . LEU B 1 190 ? 49.097 43.980  33.044 1.00 46.68 ? 190  LEU B CD2   1 
ATOM   3865 N  N     . LEU B 1 191 ? 53.313 43.417  35.667 1.00 47.26 ? 191  LEU B N     1 
ATOM   3866 C  CA    . LEU B 1 191 ? 54.196 43.815  36.749 1.00 49.27 ? 191  LEU B CA    1 
ATOM   3867 C  C     . LEU B 1 191 ? 53.361 44.570  37.772 1.00 50.42 ? 191  LEU B C     1 
ATOM   3868 O  O     . LEU B 1 191 ? 52.634 45.503  37.424 1.00 50.81 ? 191  LEU B O     1 
ATOM   3869 C  CB    . LEU B 1 191 ? 55.304 44.726  36.222 1.00 51.21 ? 191  LEU B CB    1 
ATOM   3870 C  CG    . LEU B 1 191 ? 56.723 44.441  36.712 1.00 51.83 ? 191  LEU B CG    1 
ATOM   3871 C  CD1   . LEU B 1 191 ? 57.487 43.701  35.615 1.00 52.96 ? 191  LEU B CD1   1 
ATOM   3872 C  CD2   . LEU B 1 191 ? 57.422 45.747  37.058 1.00 51.43 ? 191  LEU B CD2   1 
ATOM   3873 N  N     . SER B 1 192 ? 53.460 44.165  39.032 1.00 51.35 ? 192  SER B N     1 
ATOM   3874 C  CA    . SER B 1 192 ? 52.699 44.815  40.090 1.00 52.24 ? 192  SER B CA    1 
ATOM   3875 C  C     . SER B 1 192 ? 53.447 46.027  40.606 1.00 52.94 ? 192  SER B C     1 
ATOM   3876 O  O     . SER B 1 192 ? 54.676 46.021  40.686 1.00 52.32 ? 192  SER B O     1 
ATOM   3877 C  CB    . SER B 1 192 ? 52.471 43.855  41.254 1.00 52.14 ? 192  SER B CB    1 
ATOM   3878 O  OG    . SER B 1 192 ? 52.794 42.532  40.883 1.00 53.65 ? 192  SER B OG    1 
ATOM   3879 N  N     . PRO B 1 193 ? 52.712 47.094  40.948 1.00 53.92 ? 193  PRO B N     1 
ATOM   3880 C  CA    . PRO B 1 193 ? 53.351 48.308  41.464 1.00 54.26 ? 193  PRO B CA    1 
ATOM   3881 C  C     . PRO B 1 193 ? 54.169 48.069  42.744 1.00 54.56 ? 193  PRO B C     1 
ATOM   3882 O  O     . PRO B 1 193 ? 55.119 48.801  43.022 1.00 54.49 ? 193  PRO B O     1 
ATOM   3883 C  CB    . PRO B 1 193 ? 52.170 49.271  41.669 1.00 54.74 ? 193  PRO B CB    1 
ATOM   3884 C  CG    . PRO B 1 193 ? 50.937 48.373  41.659 1.00 54.02 ? 193  PRO B CG    1 
ATOM   3885 C  CD    . PRO B 1 193 ? 51.291 47.334  40.645 1.00 53.88 ? 193  PRO B CD    1 
ATOM   3886 N  N     . ARG B 1 194 ? 53.810 47.035  43.503 1.00 54.38 ? 194  ARG B N     1 
ATOM   3887 C  CA    . ARG B 1 194 ? 54.513 46.700  44.745 1.00 53.67 ? 194  ARG B CA    1 
ATOM   3888 C  C     . ARG B 1 194 ? 55.897 46.097  44.527 1.00 52.45 ? 194  ARG B C     1 
ATOM   3889 O  O     . ARG B 1 194 ? 56.800 46.289  45.339 1.00 52.96 ? 194  ARG B O     1 
ATOM   3890 C  CB    . ARG B 1 194 ? 53.682 45.725  45.579 1.00 54.60 ? 194  ARG B CB    1 
ATOM   3891 C  CG    . ARG B 1 194 ? 53.006 46.358  46.776 1.00 56.78 ? 194  ARG B CG    1 
ATOM   3892 C  CD    . ARG B 1 194 ? 53.618 45.875  48.076 1.00 58.42 ? 194  ARG B CD    1 
ATOM   3893 N  NE    . ARG B 1 194 ? 52.632 45.168  48.888 1.00 61.43 ? 194  ARG B NE    1 
ATOM   3894 C  CZ    . ARG B 1 194 ? 52.895 44.596  50.059 1.00 62.83 ? 194  ARG B CZ    1 
ATOM   3895 N  NH1   . ARG B 1 194 ? 54.121 44.646  50.567 1.00 63.12 ? 194  ARG B NH1   1 
ATOM   3896 N  NH2   . ARG B 1 194 ? 51.930 43.969  50.721 1.00 64.09 ? 194  ARG B NH2   1 
ATOM   3897 N  N     . GLY B 1 195 ? 56.063 45.358  43.437 1.00 50.85 ? 195  GLY B N     1 
ATOM   3898 C  CA    . GLY B 1 195 ? 57.350 44.745  43.170 1.00 48.97 ? 195  GLY B CA    1 
ATOM   3899 C  C     . GLY B 1 195 ? 57.274 43.564  42.222 1.00 47.82 ? 195  GLY B C     1 
ATOM   3900 O  O     . GLY B 1 195 ? 56.209 42.976  42.012 1.00 46.11 ? 195  GLY B O     1 
ATOM   3901 N  N     . SER B 1 196 ? 58.423 43.208  41.658 1.00 46.86 ? 196  SER B N     1 
ATOM   3902 C  CA    . SER B 1 196 ? 58.514 42.111  40.707 1.00 47.05 ? 196  SER B CA    1 
ATOM   3903 C  C     . SER B 1 196 ? 58.295 40.746  41.345 1.00 46.43 ? 196  SER B C     1 
ATOM   3904 O  O     . SER B 1 196 ? 58.178 39.734  40.644 1.00 47.30 ? 196  SER B O     1 
ATOM   3905 C  CB    . SER B 1 196 ? 59.881 42.129  40.029 1.00 47.57 ? 196  SER B CB    1 
ATOM   3906 O  OG    . SER B 1 196 ? 60.904 41.982  40.995 1.00 47.99 ? 196  SER B OG    1 
ATOM   3907 N  N     . ASP B 1 197 ? 58.242 40.719  42.675 1.00 44.58 ? 197  ASP B N     1 
ATOM   3908 C  CA    . ASP B 1 197 ? 58.046 39.473  43.409 1.00 41.99 ? 197  ASP B CA    1 
ATOM   3909 C  C     . ASP B 1 197 ? 56.603 39.225  43.779 1.00 40.71 ? 197  ASP B C     1 
ATOM   3910 O  O     . ASP B 1 197 ? 56.296 38.240  44.453 1.00 40.40 ? 197  ASP B O     1 
ATOM   3911 C  CB    . ASP B 1 197 ? 58.875 39.473  44.682 1.00 41.36 ? 197  ASP B CB    1 
ATOM   3912 C  CG    . ASP B 1 197 ? 60.336 39.285  44.413 1.00 41.31 ? 197  ASP B CG    1 
ATOM   3913 O  OD1   . ASP B 1 197 ? 61.136 39.731  45.253 1.00 42.64 ? 197  ASP B OD1   1 
ATOM   3914 O  OD2   . ASP B 1 197 ? 60.684 38.683  43.376 1.00 40.74 ? 197  ASP B OD2   1 
ATOM   3915 N  N     . TYR B 1 198 ? 55.717 40.120  43.359 1.00 38.57 ? 198  TYR B N     1 
ATOM   3916 C  CA    . TYR B 1 198 ? 54.309 39.952  43.661 1.00 36.47 ? 198  TYR B CA    1 
ATOM   3917 C  C     . TYR B 1 198 ? 53.531 39.472  42.454 1.00 35.66 ? 198  TYR B C     1 
ATOM   3918 O  O     . TYR B 1 198 ? 53.828 39.836  41.324 1.00 34.84 ? 198  TYR B O     1 
ATOM   3919 C  CB    . TYR B 1 198 ? 53.708 41.258  44.181 1.00 36.17 ? 198  TYR B CB    1 
ATOM   3920 C  CG    . TYR B 1 198 ? 54.205 41.644  45.552 1.00 35.58 ? 198  TYR B CG    1 
ATOM   3921 C  CD1   . TYR B 1 198 ? 55.435 42.278  45.721 1.00 35.05 ? 198  TYR B CD1   1 
ATOM   3922 C  CD2   . TYR B 1 198 ? 53.462 41.334  46.689 1.00 35.95 ? 198  TYR B CD2   1 
ATOM   3923 C  CE1   . TYR B 1 198 ? 55.914 42.594  46.990 1.00 34.59 ? 198  TYR B CE1   1 
ATOM   3924 C  CE2   . TYR B 1 198 ? 53.930 41.642  47.960 1.00 36.10 ? 198  TYR B CE2   1 
ATOM   3925 C  CZ    . TYR B 1 198 ? 55.153 42.269  48.106 1.00 35.21 ? 198  TYR B CZ    1 
ATOM   3926 O  OH    . TYR B 1 198 ? 55.596 42.558  49.374 1.00 34.51 ? 198  TYR B OH    1 
ATOM   3927 N  N     . LEU B 1 199 ? 52.544 38.627  42.716 1.00 35.92 ? 199  LEU B N     1 
ATOM   3928 C  CA    . LEU B 1 199 ? 51.676 38.086  41.689 1.00 35.54 ? 199  LEU B CA    1 
ATOM   3929 C  C     . LEU B 1 199 ? 50.431 38.962  41.669 1.00 34.91 ? 199  LEU B C     1 
ATOM   3930 O  O     . LEU B 1 199 ? 49.865 39.291  42.719 1.00 33.64 ? 199  LEU B O     1 
ATOM   3931 C  CB    . LEU B 1 199 ? 51.264 36.661  42.038 1.00 36.83 ? 199  LEU B CB    1 
ATOM   3932 C  CG    . LEU B 1 199 ? 51.830 35.572  41.138 1.00 39.57 ? 199  LEU B CG    1 
ATOM   3933 C  CD1   . LEU B 1 199 ? 51.448 34.169  41.629 1.00 41.60 ? 199  LEU B CD1   1 
ATOM   3934 C  CD2   . LEU B 1 199 ? 51.326 35.669  39.702 1.00 39.40 ? 199  LEU B CD2   1 
ATOM   3935 N  N     . MET B 1 200 ? 50.016 39.345  40.490 1.00 35.66 ? 200  MET B N     1 
ATOM   3936 C  CA    . MET B 1 200 ? 48.850 40.218  40.354 1.00 35.63 ? 200  MET B CA    1 
ATOM   3937 C  C     . MET B 1 200 ? 47.640 39.439  39.851 1.00 33.53 ? 200  MET B C     1 
ATOM   3938 O  O     . MET B 1 200 ? 47.723 38.682  38.879 1.00 32.65 ? 200  MET B O     1 
ATOM   3939 C  CB    . MET B 1 200 ? 49.150 41.343  39.371 1.00 39.80 ? 200  MET B CB    1 
ATOM   3940 C  CG    . MET B 1 200 ? 48.210 42.537  39.528 1.00 44.70 ? 200  MET B CG    1 
ATOM   3941 S  SD    . MET B 1 200 ? 48.777 43.976  38.652 1.00 51.14 ? 200  MET B SD    1 
ATOM   3942 C  CE    . MET B 1 200 ? 47.402 44.795  37.877 1.00 51.48 ? 200  MET B CE    1 
ATOM   3943 N  N     . ALA B 1 201 ? 46.548 39.653  40.545 1.00 31.75 ? 201  ALA B N     1 
ATOM   3944 C  CA    . ALA B 1 201 ? 45.255 39.060  40.204 1.00 29.89 ? 201  ALA B CA    1 
ATOM   3945 C  C     . ALA B 1 201 ? 44.260 40.200  40.094 1.00 29.61 ? 201  ALA B C     1 
ATOM   3946 O  O     . ALA B 1 201 ? 44.370 41.202  40.800 1.00 29.84 ? 201  ALA B O     1 
ATOM   3947 C  CB    . ALA B 1 201 ? 44.827 38.079  41.296 1.00 29.00 ? 201  ALA B CB    1 
ATOM   3948 N  N     . LEU B 1 202 ? 43.294 40.054  39.199 1.00 29.07 ? 202  LEU B N     1 
ATOM   3949 C  CA    . LEU B 1 202 ? 42.293 41.084  38.999 1.00 27.75 ? 202  LEU B CA    1 
ATOM   3950 C  C     . LEU B 1 202 ? 40.913 40.476  39.146 1.00 27.05 ? 202  LEU B C     1 
ATOM   3951 O  O     . LEU B 1 202 ? 40.709 39.318  38.810 1.00 28.00 ? 202  LEU B O     1 
ATOM   3952 C  CB    . LEU B 1 202 ? 42.470 41.690  37.609 1.00 27.67 ? 202  LEU B CB    1 
ATOM   3953 C  CG    . LEU B 1 202 ? 43.779 42.460  37.436 1.00 27.34 ? 202  LEU B CG    1 
ATOM   3954 C  CD1   . LEU B 1 202 ? 44.162 42.519  35.977 1.00 28.45 ? 202  LEU B CD1   1 
ATOM   3955 C  CD2   . LEU B 1 202 ? 43.617 43.851  38.016 1.00 26.44 ? 202  LEU B CD2   1 
ATOM   3956 N  N     . GLY B 1 203 ? 39.969 41.254  39.659 1.00 26.65 ? 203  GLY B N     1 
ATOM   3957 C  CA    . GLY B 1 203 ? 38.625 40.740  39.827 1.00 25.92 ? 203  GLY B CA    1 
ATOM   3958 C  C     . GLY B 1 203 ? 37.599 41.749  39.376 1.00 25.42 ? 203  GLY B C     1 
ATOM   3959 O  O     . GLY B 1 203 ? 37.806 42.939  39.544 1.00 25.69 ? 203  GLY B O     1 
ATOM   3960 N  N     . SER B 1 204 ? 36.492 41.269  38.820 1.00 26.52 ? 204  SER B N     1 
ATOM   3961 C  CA    . SER B 1 204 ? 35.432 42.140  38.328 1.00 28.13 ? 204  SER B CA    1 
ATOM   3962 C  C     . SER B 1 204 ? 34.068 41.480  38.505 1.00 28.56 ? 204  SER B C     1 
ATOM   3963 O  O     . SER B 1 204 ? 33.882 40.327  38.131 1.00 28.67 ? 204  SER B O     1 
ATOM   3964 C  CB    . SER B 1 204 ? 35.673 42.449  36.847 1.00 28.80 ? 204  SER B CB    1 
ATOM   3965 O  OG    . SER B 1 204 ? 34.713 43.359  36.349 1.00 31.46 ? 204  SER B OG    1 
ATOM   3966 N  N     . GLN B 1 205 ? 33.117 42.205  39.080 1.00 29.62 ? 205  GLN B N     1 
ATOM   3967 C  CA    . GLN B 1 205 ? 31.782 41.660  39.278 1.00 32.51 ? 205  GLN B CA    1 
ATOM   3968 C  C     . GLN B 1 205 ? 30.722 42.647  38.812 1.00 34.49 ? 205  GLN B C     1 
ATOM   3969 O  O     . GLN B 1 205 ? 30.673 43.794  39.259 1.00 33.56 ? 205  GLN B O     1 
ATOM   3970 C  CB    . GLN B 1 205 ? 31.557 41.299  40.748 1.00 33.55 ? 205  GLN B CB    1 
ATOM   3971 C  CG    . GLN B 1 205 ? 30.109 40.963  41.073 1.00 34.25 ? 205  GLN B CG    1 
ATOM   3972 C  CD    . GLN B 1 205 ? 29.921 40.492  42.491 1.00 35.01 ? 205  GLN B CD    1 
ATOM   3973 O  OE1   . GLN B 1 205 ? 30.498 41.047  43.423 1.00 37.94 ? 205  GLN B OE1   1 
ATOM   3974 N  NE2   . GLN B 1 205 ? 29.099 39.468  42.667 1.00 36.66 ? 205  GLN B NE2   1 
ATOM   3975 N  N     . ARG B 1 206 ? 29.856 42.181  37.924 1.00 37.28 ? 206  ARG B N     1 
ATOM   3976 C  CA    . ARG B 1 206 ? 28.821 43.029  37.365 1.00 40.27 ? 206  ARG B CA    1 
ATOM   3977 C  C     . ARG B 1 206 ? 27.432 42.893  37.987 1.00 40.92 ? 206  ARG B C     1 
ATOM   3978 O  O     . ARG B 1 206 ? 26.980 41.805  38.354 1.00 41.89 ? 206  ARG B O     1 
ATOM   3979 C  CB    . ARG B 1 206 ? 28.755 42.793  35.858 1.00 42.48 ? 206  ARG B CB    1 
ATOM   3980 C  CG    . ARG B 1 206 ? 28.240 43.975  35.085 1.00 46.48 ? 206  ARG B CG    1 
ATOM   3981 C  CD    . ARG B 1 206 ? 28.353 43.753  33.587 1.00 49.98 ? 206  ARG B CD    1 
ATOM   3982 N  NE    . ARG B 1 206 ? 29.536 44.394  33.018 1.00 53.99 ? 206  ARG B NE    1 
ATOM   3983 C  CZ    . ARG B 1 206 ? 29.768 44.509  31.712 1.00 56.21 ? 206  ARG B CZ    1 
ATOM   3984 N  NH1   . ARG B 1 206 ? 28.892 44.024  30.834 1.00 56.26 ? 206  ARG B NH1   1 
ATOM   3985 N  NH2   . ARG B 1 206 ? 30.873 45.111  31.282 1.00 56.16 ? 206  ARG B NH2   1 
ATOM   3986 N  N     . THR B 1 207 ? 26.765 44.028  38.105 1.00 41.57 ? 207  THR B N     1 
ATOM   3987 C  CA    . THR B 1 207 ? 25.432 44.076  38.666 1.00 43.60 ? 207  THR B CA    1 
ATOM   3988 C  C     . THR B 1 207 ? 24.590 45.060  37.881 1.00 45.88 ? 207  THR B C     1 
ATOM   3989 O  O     . THR B 1 207 ? 24.839 46.266  37.902 1.00 45.85 ? 207  THR B O     1 
ATOM   3990 C  CB    . THR B 1 207 ? 25.460 44.525  40.114 1.00 43.04 ? 207  THR B CB    1 
ATOM   3991 O  OG1   . THR B 1 207 ? 26.277 43.625  40.867 1.00 43.00 ? 207  THR B OG1   1 
ATOM   3992 C  CG2   . THR B 1 207 ? 24.058 44.532  40.686 1.00 43.21 ? 207  THR B CG2   1 
ATOM   3993 N  N     . ARG B 1 208 ? 23.594 44.534  37.180 1.00 48.00 ? 208  ARG B N     1 
ATOM   3994 C  CA    . ARG B 1 208 ? 22.707 45.360  36.387 1.00 49.83 ? 208  ARG B CA    1 
ATOM   3995 C  C     . ARG B 1 208 ? 21.635 45.922  37.314 1.00 50.25 ? 208  ARG B C     1 
ATOM   3996 O  O     . ARG B 1 208 ? 20.846 45.174  37.892 1.00 49.66 ? 208  ARG B O     1 
ATOM   3997 C  CB    . ARG B 1 208 ? 22.077 44.519  35.277 1.00 51.75 ? 208  ARG B CB    1 
ATOM   3998 C  CG    . ARG B 1 208 ? 22.247 45.098  33.883 1.00 55.33 ? 208  ARG B CG    1 
ATOM   3999 C  CD    . ARG B 1 208 ? 20.929 45.645  33.363 1.00 59.70 ? 208  ARG B CD    1 
ATOM   4000 N  NE    . ARG B 1 208 ? 19.945 44.581  33.169 1.00 62.09 ? 208  ARG B NE    1 
ATOM   4001 C  CZ    . ARG B 1 208 ? 18.642 44.781  32.991 1.00 62.93 ? 208  ARG B CZ    1 
ATOM   4002 N  NH1   . ARG B 1 208 ? 18.144 46.013  32.984 1.00 62.69 ? 208  ARG B NH1   1 
ATOM   4003 N  NH2   . ARG B 1 208 ? 17.836 43.743  32.821 1.00 64.06 ? 208  ARG B NH2   1 
ATOM   4004 N  N     . ALA B 1 209 ? 21.635 47.245  37.469 1.00 51.26 ? 209  ALA B N     1 
ATOM   4005 C  CA    . ALA B 1 209 ? 20.674 47.933  38.326 1.00 52.00 ? 209  ALA B CA    1 
ATOM   4006 C  C     . ALA B 1 209 ? 19.281 47.904  37.699 1.00 52.35 ? 209  ALA B C     1 
ATOM   4007 O  O     . ALA B 1 209 ? 19.134 47.744  36.482 1.00 52.37 ? 209  ALA B O     1 
ATOM   4008 C  CB    . ALA B 1 209 ? 21.122 49.374  38.567 1.00 51.84 ? 209  ALA B CB    1 
ATOM   4009 N  N     . PRO B 1 210 ? 18.238 48.071  38.529 1.00 52.13 ? 210  PRO B N     1 
ATOM   4010 C  CA    . PRO B 1 210 ? 16.834 48.062  38.091 1.00 51.83 ? 210  PRO B CA    1 
ATOM   4011 C  C     . PRO B 1 210 ? 16.523 48.971  36.887 1.00 51.33 ? 210  PRO B C     1 
ATOM   4012 O  O     . PRO B 1 210 ? 15.836 48.561  35.946 1.00 51.08 ? 210  PRO B O     1 
ATOM   4013 C  CB    . PRO B 1 210 ? 16.077 48.485  39.354 1.00 52.48 ? 210  PRO B CB    1 
ATOM   4014 C  CG    . PRO B 1 210 ? 16.986 48.014  40.478 1.00 53.36 ? 210  PRO B CG    1 
ATOM   4015 C  CD    . PRO B 1 210 ? 18.346 48.400  39.963 1.00 52.33 ? 210  PRO B CD    1 
ATOM   4016 N  N     . ASP B 1 211 ? 17.035 50.200  36.924 1.00 49.82 ? 211  ASP B N     1 
ATOM   4017 C  CA    . ASP B 1 211 ? 16.812 51.174  35.857 1.00 48.09 ? 211  ASP B CA    1 
ATOM   4018 C  C     . ASP B 1 211 ? 17.625 50.917  34.585 1.00 47.14 ? 211  ASP B C     1 
ATOM   4019 O  O     . ASP B 1 211 ? 17.581 51.708  33.647 1.00 46.05 ? 211  ASP B O     1 
ATOM   4020 C  CB    . ASP B 1 211 ? 17.111 52.580  36.383 1.00 49.08 ? 211  ASP B CB    1 
ATOM   4021 C  CG    . ASP B 1 211 ? 18.507 52.696  36.966 1.00 50.59 ? 211  ASP B CG    1 
ATOM   4022 O  OD1   . ASP B 1 211 ? 18.790 53.701  37.658 1.00 52.22 ? 211  ASP B OD1   1 
ATOM   4023 O  OD2   . ASP B 1 211 ? 19.325 51.781  36.729 1.00 50.39 ? 211  ASP B OD2   1 
ATOM   4024 N  N     . GLY B 1 212 ? 18.366 49.815  34.549 1.00 46.33 ? 212  GLY B N     1 
ATOM   4025 C  CA    . GLY B 1 212 ? 19.158 49.508  33.370 1.00 44.52 ? 212  GLY B CA    1 
ATOM   4026 C  C     . GLY B 1 212 ? 20.581 50.034  33.429 1.00 43.75 ? 212  GLY B C     1 
ATOM   4027 O  O     . GLY B 1 212 ? 21.334 49.941  32.451 1.00 43.14 ? 212  GLY B O     1 
ATOM   4028 N  N     . SER B 1 213 ? 20.951 50.613  34.569 1.00 42.14 ? 213  SER B N     1 
ATOM   4029 C  CA    . SER B 1 213 ? 22.303 51.122  34.736 1.00 39.55 ? 213  SER B CA    1 
ATOM   4030 C  C     . SER B 1 213 ? 23.128 49.912  35.145 1.00 38.37 ? 213  SER B C     1 
ATOM   4031 O  O     . SER B 1 213 ? 22.590 48.935  35.663 1.00 38.32 ? 213  SER B O     1 
ATOM   4032 C  CB    . SER B 1 213 ? 22.355 52.207  35.816 1.00 38.65 ? 213  SER B CB    1 
ATOM   4033 O  OG    . SER B 1 213 ? 21.939 51.712  37.070 1.00 38.27 ? 213  SER B OG    1 
ATOM   4034 N  N     . VAL B 1 214 ? 24.431 49.971  34.916 1.00 36.06 ? 214  VAL B N     1 
ATOM   4035 C  CA    . VAL B 1 214 ? 25.292 48.848  35.236 1.00 34.29 ? 214  VAL B CA    1 
ATOM   4036 C  C     . VAL B 1 214 ? 26.400 49.205  36.224 1.00 34.60 ? 214  VAL B C     1 
ATOM   4037 O  O     . VAL B 1 214 ? 27.296 49.984  35.904 1.00 35.33 ? 214  VAL B O     1 
ATOM   4038 C  CB    . VAL B 1 214 ? 25.924 48.286  33.932 1.00 33.65 ? 214  VAL B CB    1 
ATOM   4039 C  CG1   . VAL B 1 214 ? 26.918 47.184  34.249 1.00 32.51 ? 214  VAL B CG1   1 
ATOM   4040 C  CG2   . VAL B 1 214 ? 24.829 47.778  33.009 1.00 31.63 ? 214  VAL B CG2   1 
ATOM   4041 N  N     . VAL B 1 215 ? 26.339 48.650  37.431 1.00 34.60 ? 215  VAL B N     1 
ATOM   4042 C  CA    . VAL B 1 215 ? 27.391 48.914  38.404 1.00 33.76 ? 215  VAL B CA    1 
ATOM   4043 C  C     . VAL B 1 215 ? 28.373 47.758  38.369 1.00 33.62 ? 215  VAL B C     1 
ATOM   4044 O  O     . VAL B 1 215 ? 27.989 46.592  38.447 1.00 32.95 ? 215  VAL B O     1 
ATOM   4045 C  CB    . VAL B 1 215 ? 26.864 49.052  39.832 1.00 35.44 ? 215  VAL B CB    1 
ATOM   4046 C  CG1   . VAL B 1 215 ? 28.027 49.406  40.759 1.00 33.34 ? 215  VAL B CG1   1 
ATOM   4047 C  CG2   . VAL B 1 215 ? 25.779 50.124  39.887 1.00 35.03 ? 215  VAL B CG2   1 
ATOM   4048 N  N     . THR B 1 216 ? 29.649 48.100  38.265 1.00 33.22 ? 216  THR B N     1 
ATOM   4049 C  CA    . THR B 1 216 ? 30.705 47.109  38.176 1.00 32.98 ? 216  THR B CA    1 
ATOM   4050 C  C     . THR B 1 216 ? 31.786 47.302  39.234 1.00 34.19 ? 216  THR B C     1 
ATOM   4051 O  O     . THR B 1 216 ? 32.410 48.359  39.285 1.00 34.94 ? 216  THR B O     1 
ATOM   4052 C  CB    . THR B 1 216 ? 31.368 47.188  36.793 1.00 31.45 ? 216  THR B CB    1 
ATOM   4053 O  OG1   . THR B 1 216 ? 30.394 46.910  35.786 1.00 31.22 ? 216  THR B OG1   1 
ATOM   4054 C  CG2   . THR B 1 216 ? 32.511 46.204  36.678 1.00 30.31 ? 216  THR B CG2   1 
ATOM   4055 N  N     . GLN B 1 217 ? 32.005 46.299  40.082 1.00 34.01 ? 217  GLN B N     1 
ATOM   4056 C  CA    . GLN B 1 217 ? 33.059 46.414  41.077 1.00 34.18 ? 217  GLN B CA    1 
ATOM   4057 C  C     . GLN B 1 217 ? 34.325 45.754  40.526 1.00 33.40 ? 217  GLN B C     1 
ATOM   4058 O  O     . GLN B 1 217 ? 34.303 44.604  40.092 1.00 32.72 ? 217  GLN B O     1 
ATOM   4059 C  CB    . GLN B 1 217 ? 32.674 45.759  42.410 1.00 36.03 ? 217  GLN B CB    1 
ATOM   4060 C  CG    . GLN B 1 217 ? 33.869 45.755  43.375 1.00 43.18 ? 217  GLN B CG    1 
ATOM   4061 C  CD    . GLN B 1 217 ? 33.588 45.180  44.757 1.00 46.43 ? 217  GLN B CD    1 
ATOM   4062 O  OE1   . GLN B 1 217 ? 32.676 44.370  44.947 1.00 49.07 ? 217  GLN B OE1   1 
ATOM   4063 N  NE2   . GLN B 1 217 ? 34.403 45.585  45.732 1.00 47.78 ? 217  GLN B NE2   1 
ATOM   4064 N  N     . ARG B 1 218 ? 35.425 46.495  40.525 1.00 32.47 ? 218  ARG B N     1 
ATOM   4065 C  CA    . ARG B 1 218 ? 36.694 45.970  40.033 1.00 32.40 ? 218  ARG B CA    1 
ATOM   4066 C  C     . ARG B 1 218 ? 37.729 46.080  41.135 1.00 31.88 ? 218  ARG B C     1 
ATOM   4067 O  O     . ARG B 1 218 ? 37.762 47.072  41.855 1.00 31.57 ? 218  ARG B O     1 
ATOM   4068 C  CB    . ARG B 1 218 ? 37.172 46.748  38.805 1.00 33.77 ? 218  ARG B CB    1 
ATOM   4069 C  CG    . ARG B 1 218 ? 36.275 46.599  37.594 1.00 36.79 ? 218  ARG B CG    1 
ATOM   4070 C  CD    . ARG B 1 218 ? 36.836 47.327  36.381 1.00 38.70 ? 218  ARG B CD    1 
ATOM   4071 N  NE    . ARG B 1 218 ? 35.935 47.234  35.234 1.00 40.78 ? 218  ARG B NE    1 
ATOM   4072 C  CZ    . ARG B 1 218 ? 35.135 48.213  34.823 1.00 41.76 ? 218  ARG B CZ    1 
ATOM   4073 N  NH1   . ARG B 1 218 ? 35.120 49.373  35.460 1.00 42.88 ? 218  ARG B NH1   1 
ATOM   4074 N  NH2   . ARG B 1 218 ? 34.341 48.032  33.776 1.00 41.90 ? 218  ARG B NH2   1 
ATOM   4075 N  N     . ILE B 1 219 ? 38.575 45.062  41.263 1.00 30.96 ? 219  ILE B N     1 
ATOM   4076 C  CA    . ILE B 1 219 ? 39.593 45.052  42.306 1.00 29.84 ? 219  ILE B CA    1 
ATOM   4077 C  C     . ILE B 1 219 ? 40.915 44.474  41.822 1.00 30.81 ? 219  ILE B C     1 
ATOM   4078 O  O     . ILE B 1 219 ? 40.968 43.732  40.840 1.00 30.12 ? 219  ILE B O     1 
ATOM   4079 C  CB    . ILE B 1 219 ? 39.138 44.205  43.520 1.00 28.30 ? 219  ILE B CB    1 
ATOM   4080 C  CG1   . ILE B 1 219 ? 38.955 42.752  43.087 1.00 28.39 ? 219  ILE B CG1   1 
ATOM   4081 C  CG2   . ILE B 1 219 ? 37.835 44.739  44.089 1.00 26.73 ? 219  ILE B CG2   1 
ATOM   4082 C  CD1   . ILE B 1 219 ? 38.465 41.833  44.179 1.00 28.08 ? 219  ILE B CD1   1 
ATOM   4083 N  N     . ARG B 1 220 ? 41.985 44.826  42.522 1.00 31.49 ? 220  ARG B N     1 
ATOM   4084 C  CA    . ARG B 1 220 ? 43.300 44.305  42.199 1.00 33.52 ? 220  ARG B CA    1 
ATOM   4085 C  C     . ARG B 1 220 ? 43.872 43.710  43.465 1.00 34.45 ? 220  ARG B C     1 
ATOM   4086 O  O     . ARG B 1 220 ? 43.630 44.217  44.558 1.00 33.78 ? 220  ARG B O     1 
ATOM   4087 C  CB    . ARG B 1 220 ? 44.242 45.394  41.701 1.00 35.74 ? 220  ARG B CB    1 
ATOM   4088 C  CG    . ARG B 1 220 ? 45.633 44.860  41.348 1.00 36.57 ? 220  ARG B CG    1 
ATOM   4089 C  CD    . ARG B 1 220 ? 46.544 45.984  40.936 1.00 38.20 ? 220  ARG B CD    1 
ATOM   4090 N  NE    . ARG B 1 220 ? 46.606 46.981  41.989 1.00 41.21 ? 220  ARG B NE    1 
ATOM   4091 C  CZ    . ARG B 1 220 ? 46.779 48.277  41.781 1.00 43.52 ? 220  ARG B CZ    1 
ATOM   4092 N  NH1   . ARG B 1 220 ? 46.908 48.744  40.550 1.00 44.97 ? 220  ARG B NH1   1 
ATOM   4093 N  NH2   . ARG B 1 220 ? 46.810 49.112  42.810 1.00 46.88 ? 220  ARG B NH2   1 
ATOM   4094 N  N     . MET B 1 221 ? 44.629 42.632  43.306 1.00 35.76 ? 221  MET B N     1 
ATOM   4095 C  CA    . MET B 1 221 ? 45.251 41.950  44.428 1.00 37.68 ? 221  MET B CA    1 
ATOM   4096 C  C     . MET B 1 221 ? 46.679 41.565  44.114 1.00 38.18 ? 221  MET B C     1 
ATOM   4097 O  O     . MET B 1 221 ? 46.986 41.091  43.023 1.00 38.55 ? 221  MET B O     1 
ATOM   4098 C  CB    . MET B 1 221 ? 44.472 40.697  44.778 1.00 39.85 ? 221  MET B CB    1 
ATOM   4099 C  CG    . MET B 1 221 ? 43.115 40.986  45.333 1.00 45.38 ? 221  MET B CG    1 
ATOM   4100 S  SD    . MET B 1 221 ? 42.203 39.472  45.509 1.00 50.92 ? 221  MET B SD    1 
ATOM   4101 C  CE    . MET B 1 221 ? 41.677 39.245  43.815 1.00 50.42 ? 221  MET B CE    1 
ATOM   4102 N  N     . GLU B 1 222 ? 47.553 41.762  45.088 1.00 39.24 ? 222  GLU B N     1 
ATOM   4103 C  CA    . GLU B 1 222 ? 48.953 41.438  44.918 1.00 40.51 ? 222  GLU B CA    1 
ATOM   4104 C  C     . GLU B 1 222 ? 49.363 40.485  46.030 1.00 40.36 ? 222  GLU B C     1 
ATOM   4105 O  O     . GLU B 1 222 ? 49.152 40.749  47.212 1.00 41.61 ? 222  GLU B O     1 
ATOM   4106 C  CB    . GLU B 1 222 ? 49.764 42.732  44.930 1.00 42.23 ? 222  GLU B CB    1 
ATOM   4107 C  CG    . GLU B 1 222 ? 49.143 43.766  43.993 1.00 45.55 ? 222  GLU B CG    1 
ATOM   4108 C  CD    . GLU B 1 222 ? 49.998 44.992  43.783 1.00 47.90 ? 222  GLU B CD    1 
ATOM   4109 O  OE1   . GLU B 1 222 ? 50.283 45.700  44.767 1.00 50.94 ? 222  GLU B OE1   1 
ATOM   4110 O  OE2   . GLU B 1 222 ? 50.382 45.253  42.626 1.00 50.41 ? 222  GLU B OE2   1 
ATOM   4111 N  N     . MET B 1 223 ? 49.932 39.359  45.631 1.00 39.66 ? 223  MET B N     1 
ATOM   4112 C  CA    . MET B 1 223 ? 50.336 38.332  46.571 1.00 38.99 ? 223  MET B CA    1 
ATOM   4113 C  C     . MET B 1 223 ? 51.806 38.039  46.348 1.00 37.13 ? 223  MET B C     1 
ATOM   4114 O  O     . MET B 1 223 ? 52.249 37.964  45.206 1.00 36.83 ? 223  MET B O     1 
ATOM   4115 C  CB    . MET B 1 223 ? 49.507 37.086  46.298 1.00 41.28 ? 223  MET B CB    1 
ATOM   4116 C  CG    . MET B 1 223 ? 48.071 37.412  45.928 1.00 44.95 ? 223  MET B CG    1 
ATOM   4117 S  SD    . MET B 1 223 ? 47.238 36.032  45.127 1.00 50.23 ? 223  MET B SD    1 
ATOM   4118 C  CE    . MET B 1 223 ? 46.740 36.761  43.594 1.00 49.53 ? 223  MET B CE    1 
ATOM   4119 N  N     . HIS B 1 224 ? 52.564 37.876  47.427 1.00 34.20 ? 224  HIS B N     1 
ATOM   4120 C  CA    . HIS B 1 224 ? 53.987 37.592  47.295 1.00 31.89 ? 224  HIS B CA    1 
ATOM   4121 C  C     . HIS B 1 224 ? 54.186 36.174  46.766 1.00 30.84 ? 224  HIS B C     1 
ATOM   4122 O  O     . HIS B 1 224 ? 53.617 35.228  47.294 1.00 30.48 ? 224  HIS B O     1 
ATOM   4123 C  CB    . HIS B 1 224 ? 54.690 37.767  48.647 1.00 30.20 ? 224  HIS B CB    1 
ATOM   4124 C  CG    . HIS B 1 224 ? 56.183 37.676  48.569 1.00 30.15 ? 224  HIS B CG    1 
ATOM   4125 N  ND1   . HIS B 1 224 ? 56.860 36.475  48.556 1.00 29.23 ? 224  HIS B ND1   1 
ATOM   4126 C  CD2   . HIS B 1 224 ? 57.127 38.640  48.447 1.00 30.00 ? 224  HIS B CD2   1 
ATOM   4127 C  CE1   . HIS B 1 224 ? 58.155 36.702  48.427 1.00 29.41 ? 224  HIS B CE1   1 
ATOM   4128 N  NE2   . HIS B 1 224 ? 58.344 38.007  48.359 1.00 30.15 ? 224  HIS B NE2   1 
ATOM   4129 N  N     . LYS B 1 225 ? 54.987 36.031  45.714 1.00 31.11 ? 225  LYS B N     1 
ATOM   4130 C  CA    . LYS B 1 225 ? 55.243 34.716  45.133 1.00 32.03 ? 225  LYS B CA    1 
ATOM   4131 C  C     . LYS B 1 225 ? 55.991 33.819  46.124 1.00 31.46 ? 225  LYS B C     1 
ATOM   4132 O  O     . LYS B 1 225 ? 56.872 34.274  46.862 1.00 30.16 ? 225  LYS B O     1 
ATOM   4133 C  CB    . LYS B 1 225 ? 56.104 34.839  43.868 1.00 32.15 ? 225  LYS B CB    1 
ATOM   4134 C  CG    . LYS B 1 225 ? 55.439 35.610  42.727 1.00 36.03 ? 225  LYS B CG    1 
ATOM   4135 C  CD    . LYS B 1 225 ? 56.164 35.422  41.386 1.00 39.61 ? 225  LYS B CD    1 
ATOM   4136 C  CE    . LYS B 1 225 ? 57.213 36.503  41.108 1.00 40.30 ? 225  LYS B CE    1 
ATOM   4137 N  NZ    . LYS B 1 225 ? 58.030 36.218  39.917 1.00 41.97 ? 225  LYS B NZ    1 
ATOM   4138 N  N     . VAL B 1 226 ? 55.597 32.558  46.129 1.00 31.08 ? 226  VAL B N     1 
ATOM   4139 C  CA    . VAL B 1 226 ? 56.292 31.522  46.907 1.00 30.35 ? 226  VAL B CA    1 
ATOM   4140 C  C     . VAL B 1 226 ? 57.228 30.853  45.918 1.00 31.81 ? 226  VAL B C     1 
ATOM   4141 O  O     . VAL B 1 226 ? 56.846 30.575  44.776 1.00 33.01 ? 226  VAL B O     1 
ATOM   4142 C  CB    . VAL B 1 226 ? 55.299 30.515  47.496 1.00 27.94 ? 226  VAL B CB    1 
ATOM   4143 C  CG1   . VAL B 1 226 ? 55.980 29.422  48.330 1.00 24.43 ? 226  VAL B CG1   1 
ATOM   4144 C  CG2   . VAL B 1 226 ? 54.265 31.154  48.426 1.00 26.67 ? 226  VAL B CG2   1 
ATOM   4145 N  N     . ASP B 1 227 ? 58.441 30.602  46.334 1.00 33.30 ? 227  ASP B N     1 
ATOM   4146 C  CA    . ASP B 1 227 ? 59.449 30.068  45.412 1.00 35.12 ? 227  ASP B CA    1 
ATOM   4147 C  C     . ASP B 1 227 ? 59.323 28.569  45.152 1.00 33.33 ? 227  ASP B C     1 
ATOM   4148 O  O     . ASP B 1 227 ? 60.168 27.790  45.580 1.00 34.29 ? 227  ASP B O     1 
ATOM   4149 C  CB    . ASP B 1 227 ? 60.855 30.324  45.936 1.00 39.98 ? 227  ASP B CB    1 
ATOM   4150 C  CG    . ASP B 1 227 ? 61.906 30.202  44.835 1.00 44.57 ? 227  ASP B CG    1 
ATOM   4151 O  OD1   . ASP B 1 227 ? 62.934 29.449  45.013 1.00 48.00 ? 227  ASP B OD1   1 
ATOM   4152 O  OD2   . ASP B 1 227 ? 61.757 30.849  43.728 1.00 46.80 ? 227  ASP B OD2   1 
ATOM   4153 N  N     . ALA B 1 228 ? 58.287 28.171  44.422 1.00 30.89 ? 228  ALA B N     1 
ATOM   4154 C  CA    . ALA B 1 228 ? 58.069 26.766  44.118 1.00 28.35 ? 228  ALA B CA    1 
ATOM   4155 C  C     . ALA B 1 228 ? 56.923 26.623  43.136 1.00 27.56 ? 228  ALA B C     1 
ATOM   4156 O  O     . ALA B 1 228 ? 56.155 27.559  42.925 1.00 27.56 ? 228  ALA B O     1 
ATOM   4157 C  CB    . ALA B 1 228 ? 57.747 26.000  45.402 1.00 27.33 ? 228  ALA B CB    1 
ATOM   4158 N  N     . VAL B 1 229 ? 56.812 25.443  42.538 1.00 26.80 ? 229  VAL B N     1 
ATOM   4159 C  CA    . VAL B 1 229 ? 55.735 25.164  41.603 1.00 26.06 ? 229  VAL B CA    1 
ATOM   4160 C  C     . VAL B 1 229 ? 54.734 24.249  42.290 1.00 25.70 ? 229  VAL B C     1 
ATOM   4161 O  O     . VAL B 1 229 ? 55.077 23.133  42.680 1.00 26.32 ? 229  VAL B O     1 
ATOM   4162 C  CB    . VAL B 1 229 ? 56.252 24.453  40.344 1.00 26.78 ? 229  VAL B CB    1 
ATOM   4163 C  CG1   . VAL B 1 229 ? 55.083 24.035  39.464 1.00 25.96 ? 229  VAL B CG1   1 
ATOM   4164 C  CG2   . VAL B 1 229 ? 57.177 25.376  39.577 1.00 26.66 ? 229  VAL B CG2   1 
ATOM   4165 N  N     . PHE B 1 230 ? 53.502 24.726  42.442 1.00 24.36 ? 230  PHE B N     1 
ATOM   4166 C  CA    . PHE B 1 230 ? 52.451 23.938  43.084 1.00 23.09 ? 230  PHE B CA    1 
ATOM   4167 C  C     . PHE B 1 230 ? 51.447 23.409  42.074 1.00 21.43 ? 230  PHE B C     1 
ATOM   4168 O  O     . PHE B 1 230 ? 51.331 23.931  40.966 1.00 21.66 ? 230  PHE B O     1 
ATOM   4169 C  CB    . PHE B 1 230 ? 51.696 24.776  44.126 1.00 23.98 ? 230  PHE B CB    1 
ATOM   4170 C  CG    . PHE B 1 230 ? 52.546 25.230  45.272 1.00 25.37 ? 230  PHE B CG    1 
ATOM   4171 C  CD1   . PHE B 1 230 ? 53.048 26.526  45.311 1.00 25.84 ? 230  PHE B CD1   1 
ATOM   4172 C  CD2   . PHE B 1 230 ? 52.863 24.355  46.309 1.00 24.63 ? 230  PHE B CD2   1 
ATOM   4173 C  CE1   . PHE B 1 230 ? 53.861 26.947  46.369 1.00 25.95 ? 230  PHE B CE1   1 
ATOM   4174 C  CE2   . PHE B 1 230 ? 53.674 24.768  47.367 1.00 24.94 ? 230  PHE B CE2   1 
ATOM   4175 C  CZ    . PHE B 1 230 ? 54.173 26.064  47.396 1.00 24.33 ? 230  PHE B CZ    1 
ATOM   4176 N  N     . VAL B 1 231 ? 50.717 22.374  42.466 1.00 17.98 ? 231  VAL B N     1 
ATOM   4177 C  CA    . VAL B 1 231 ? 49.707 21.803  41.603 1.00 15.81 ? 231  VAL B CA    1 
ATOM   4178 C  C     . VAL B 1 231 ? 48.413 21.702  42.400 1.00 17.24 ? 231  VAL B C     1 
ATOM   4179 O  O     . VAL B 1 231 ? 48.431 21.357  43.580 1.00 19.25 ? 231  VAL B O     1 
ATOM   4180 C  CB    . VAL B 1 231 ? 50.120 20.410  41.099 1.00 14.71 ? 231  VAL B CB    1 
ATOM   4181 C  CG1   . VAL B 1 231 ? 49.034 19.838  40.218 1.00 13.89 ? 231  VAL B CG1   1 
ATOM   4182 C  CG2   . VAL B 1 231 ? 51.395 20.509  40.317 1.00 13.41 ? 231  VAL B CG2   1 
ATOM   4183 N  N     . GLY B 1 232 ? 47.293 22.020  41.757 1.00 16.43 ? 232  GLY B N     1 
ATOM   4184 C  CA    . GLY B 1 232 ? 46.009 21.955  42.431 1.00 15.73 ? 232  GLY B CA    1 
ATOM   4185 C  C     . GLY B 1 232 ? 45.620 23.272  43.076 1.00 16.18 ? 232  GLY B C     1 
ATOM   4186 O  O     . GLY B 1 232 ? 44.537 23.396  43.653 1.00 16.62 ? 232  GLY B O     1 
ATOM   4187 N  N     . THR B 1 233 ? 46.502 24.262  42.975 1.00 15.48 ? 233  THR B N     1 
ATOM   4188 C  CA    . THR B 1 233 ? 46.245 25.572  43.553 1.00 14.99 ? 233  THR B CA    1 
ATOM   4189 C  C     . THR B 1 233 ? 45.096 26.297  42.872 1.00 13.80 ? 233  THR B C     1 
ATOM   4190 O  O     . THR B 1 233 ? 44.335 27.004  43.533 1.00 13.96 ? 233  THR B O     1 
ATOM   4191 C  CB    . THR B 1 233 ? 47.506 26.442  43.518 1.00 14.87 ? 233  THR B CB    1 
ATOM   4192 O  OG1   . THR B 1 233 ? 48.174 26.262  42.265 1.00 16.12 ? 233  THR B OG1   1 
ATOM   4193 C  CG2   . THR B 1 233 ? 48.446 26.056  44.662 1.00 13.77 ? 233  THR B CG2   1 
ATOM   4194 N  N     . GLY B 1 234 ? 44.958 26.115  41.561 1.00 12.66 ? 234  GLY B N     1 
ATOM   4195 C  CA    . GLY B 1 234 ? 43.859 26.749  40.848 1.00 12.68 ? 234  GLY B CA    1 
ATOM   4196 C  C     . GLY B 1 234 ? 42.524 26.121  41.232 1.00 13.18 ? 234  GLY B C     1 
ATOM   4197 O  O     . GLY B 1 234 ? 41.494 26.789  41.306 1.00 12.49 ? 234  GLY B O     1 
ATOM   4198 N  N     . ASP B 1 235 ? 42.534 24.819  41.478 1.00 13.61 ? 235  ASP B N     1 
ATOM   4199 C  CA    . ASP B 1 235 ? 41.315 24.133  41.858 1.00 13.76 ? 235  ASP B CA    1 
ATOM   4200 C  C     . ASP B 1 235 ? 40.920 24.593  43.258 1.00 14.71 ? 235  ASP B C     1 
ATOM   4201 O  O     . ASP B 1 235 ? 39.747 24.892  43.522 1.00 13.85 ? 235  ASP B O     1 
ATOM   4202 C  CB    . ASP B 1 235 ? 41.533 22.616  41.831 1.00 16.05 ? 235  ASP B CB    1 
ATOM   4203 C  CG    . ASP B 1 235 ? 42.014 22.118  40.476 1.00 16.76 ? 235  ASP B CG    1 
ATOM   4204 O  OD1   . ASP B 1 235 ? 41.417 22.516  39.449 1.00 17.69 ? 235  ASP B OD1   1 
ATOM   4205 O  OD2   . ASP B 1 235 ? 42.982 21.325  40.439 1.00 16.20 ? 235  ASP B OD2   1 
ATOM   4206 N  N     . LEU B 1 236 ? 41.904 24.651  44.153 1.00 14.54 ? 236  LEU B N     1 
ATOM   4207 C  CA    . LEU B 1 236 ? 41.656 25.089  45.519 1.00 13.87 ? 236  LEU B CA    1 
ATOM   4208 C  C     . LEU B 1 236 ? 41.085 26.502  45.487 1.00 14.42 ? 236  LEU B C     1 
ATOM   4209 O  O     . LEU B 1 236 ? 40.135 26.813  46.209 1.00 15.29 ? 236  LEU B O     1 
ATOM   4210 C  CB    . LEU B 1 236 ? 42.951 25.070  46.336 1.00 13.12 ? 236  LEU B CB    1 
ATOM   4211 C  CG    . LEU B 1 236 ? 42.850 25.550  47.794 1.00 12.28 ? 236  LEU B CG    1 
ATOM   4212 C  CD1   . LEU B 1 236 ? 41.868 24.673  48.555 1.00 10.27 ? 236  LEU B CD1   1 
ATOM   4213 C  CD2   . LEU B 1 236 ? 44.221 25.514  48.463 1.00 8.74  ? 236  LEU B CD2   1 
ATOM   4214 N  N     . PHE B 1 237 ? 41.661 27.350  44.638 1.00 13.64 ? 237  PHE B N     1 
ATOM   4215 C  CA    . PHE B 1 237 ? 41.207 28.729  44.511 1.00 13.58 ? 237  PHE B CA    1 
ATOM   4216 C  C     . PHE B 1 237 ? 39.723 28.812  44.175 1.00 13.07 ? 237  PHE B C     1 
ATOM   4217 O  O     . PHE B 1 237 ? 38.943 29.422  44.908 1.00 13.00 ? 237  PHE B O     1 
ATOM   4218 C  CB    . PHE B 1 237 ? 41.988 29.451  43.424 1.00 14.04 ? 237  PHE B CB    1 
ATOM   4219 C  CG    . PHE B 1 237 ? 41.720 30.926  43.373 1.00 16.63 ? 237  PHE B CG    1 
ATOM   4220 C  CD1   . PHE B 1 237 ? 42.525 31.823  44.073 1.00 17.22 ? 237  PHE B CD1   1 
ATOM   4221 C  CD2   . PHE B 1 237 ? 40.646 31.424  42.652 1.00 18.00 ? 237  PHE B CD2   1 
ATOM   4222 C  CE1   . PHE B 1 237 ? 42.261 33.202  44.054 1.00 17.01 ? 237  PHE B CE1   1 
ATOM   4223 C  CE2   . PHE B 1 237 ? 40.373 32.803  42.628 1.00 19.55 ? 237  PHE B CE2   1 
ATOM   4224 C  CZ    . PHE B 1 237 ? 41.185 33.690  43.331 1.00 16.81 ? 237  PHE B CZ    1 
ATOM   4225 N  N     . ALA B 1 238 ? 39.344 28.200  43.057 1.00 12.11 ? 238  ALA B N     1 
ATOM   4226 C  CA    . ALA B 1 238 ? 37.958 28.205  42.600 1.00 11.41 ? 238  ALA B CA    1 
ATOM   4227 C  C     . ALA B 1 238 ? 36.969 27.643  43.616 1.00 11.55 ? 238  ALA B C     1 
ATOM   4228 O  O     . ALA B 1 238 ? 35.833 28.107  43.704 1.00 11.73 ? 238  ALA B O     1 
ATOM   4229 C  CB    . ALA B 1 238 ? 37.846 27.431  41.298 1.00 10.16 ? 238  ALA B CB    1 
ATOM   4230 N  N     . ALA B 1 239 ? 37.393 26.642  44.378 1.00 11.53 ? 239  ALA B N     1 
ATOM   4231 C  CA    . ALA B 1 239 ? 36.515 26.022  45.367 1.00 11.82 ? 239  ALA B CA    1 
ATOM   4232 C  C     . ALA B 1 239 ? 36.225 26.960  46.525 1.00 11.83 ? 239  ALA B C     1 
ATOM   4233 O  O     . ALA B 1 239 ? 35.090 27.068  46.985 1.00 12.61 ? 239  ALA B O     1 
ATOM   4234 C  CB    . ALA B 1 239 ? 37.141 24.724  45.885 1.00 11.77 ? 239  ALA B CB    1 
ATOM   4235 N  N     . MET B 1 240 ? 37.260 27.640  46.996 1.00 12.73 ? 240  MET B N     1 
ATOM   4236 C  CA    . MET B 1 240 ? 37.098 28.559  48.106 1.00 13.77 ? 240  MET B CA    1 
ATOM   4237 C  C     . MET B 1 240 ? 36.385 29.836  47.683 1.00 14.62 ? 240  MET B C     1 
ATOM   4238 O  O     . MET B 1 240 ? 35.614 30.394  48.468 1.00 17.19 ? 240  MET B O     1 
ATOM   4239 C  CB    . MET B 1 240 ? 38.453 28.871  48.728 1.00 11.82 ? 240  MET B CB    1 
ATOM   4240 C  CG    . MET B 1 240 ? 39.116 27.655  49.326 1.00 8.58  ? 240  MET B CG    1 
ATOM   4241 S  SD    . MET B 1 240 ? 40.462 28.119  50.396 1.00 10.21 ? 240  MET B SD    1 
ATOM   4242 C  CE    . MET B 1 240 ? 41.708 28.614  49.219 1.00 9.00  ? 240  MET B CE    1 
ATOM   4243 N  N     . LEU B 1 241 ? 36.625 30.295  46.453 1.00 13.77 ? 241  LEU B N     1 
ATOM   4244 C  CA    . LEU B 1 241 ? 35.952 31.492  45.950 1.00 13.62 ? 241  LEU B CA    1 
ATOM   4245 C  C     . LEU B 1 241 ? 34.446 31.226  45.902 1.00 13.51 ? 241  LEU B C     1 
ATOM   4246 O  O     . LEU B 1 241 ? 33.637 32.119  46.149 1.00 14.86 ? 241  LEU B O     1 
ATOM   4247 C  CB    . LEU B 1 241 ? 36.451 31.855  44.549 1.00 13.05 ? 241  LEU B CB    1 
ATOM   4248 C  CG    . LEU B 1 241 ? 35.811 33.084  43.892 1.00 12.04 ? 241  LEU B CG    1 
ATOM   4249 C  CD1   . LEU B 1 241 ? 36.047 34.300  44.778 1.00 12.75 ? 241  LEU B CD1   1 
ATOM   4250 C  CD2   . LEU B 1 241 ? 36.398 33.308  42.499 1.00 11.32 ? 241  LEU B CD2   1 
ATOM   4251 N  N     . LEU B 1 242 ? 34.071 29.990  45.593 1.00 13.50 ? 242  LEU B N     1 
ATOM   4252 C  CA    . LEU B 1 242 ? 32.666 29.618  45.534 1.00 14.89 ? 242  LEU B CA    1 
ATOM   4253 C  C     . LEU B 1 242 ? 32.044 29.820  46.915 1.00 15.31 ? 242  LEU B C     1 
ATOM   4254 O  O     . LEU B 1 242 ? 30.991 30.444  47.050 1.00 15.38 ? 242  LEU B O     1 
ATOM   4255 C  CB    . LEU B 1 242 ? 32.532 28.151  45.100 1.00 14.55 ? 242  LEU B CB    1 
ATOM   4256 C  CG    . LEU B 1 242 ? 31.151 27.544  44.792 1.00 15.85 ? 242  LEU B CG    1 
ATOM   4257 C  CD1   . LEU B 1 242 ? 31.348 26.173  44.135 1.00 13.80 ? 242  LEU B CD1   1 
ATOM   4258 C  CD2   . LEU B 1 242 ? 30.301 27.416  46.063 1.00 15.36 ? 242  LEU B CD2   1 
ATOM   4259 N  N     . ALA B 1 243 ? 32.717 29.295  47.937 1.00 16.89 ? 243  ALA B N     1 
ATOM   4260 C  CA    . ALA B 1 243 ? 32.252 29.385  49.320 1.00 16.95 ? 243  ALA B CA    1 
ATOM   4261 C  C     . ALA B 1 243 ? 32.112 30.817  49.815 1.00 17.54 ? 243  ALA B C     1 
ATOM   4262 O  O     . ALA B 1 243 ? 31.073 31.216  50.353 1.00 13.91 ? 243  ALA B O     1 
ATOM   4263 C  CB    . ALA B 1 243 ? 33.209 28.635  50.229 1.00 17.45 ? 243  ALA B CB    1 
ATOM   4264 N  N     . TRP B 1 244 ? 33.178 31.583  49.638 1.00 18.57 ? 244  TRP B N     1 
ATOM   4265 C  CA    . TRP B 1 244 ? 33.193 32.958  50.091 1.00 20.01 ? 244  TRP B CA    1 
ATOM   4266 C  C     . TRP B 1 244 ? 32.290 33.900  49.292 1.00 21.41 ? 244  TRP B C     1 
ATOM   4267 O  O     . TRP B 1 244 ? 31.803 34.892  49.836 1.00 21.69 ? 244  TRP B O     1 
ATOM   4268 C  CB    . TRP B 1 244 ? 34.642 33.454  50.131 1.00 19.34 ? 244  TRP B CB    1 
ATOM   4269 C  CG    . TRP B 1 244 ? 35.441 32.727  51.186 1.00 20.08 ? 244  TRP B CG    1 
ATOM   4270 C  CD1   . TRP B 1 244 ? 36.603 32.018  51.006 1.00 20.49 ? 244  TRP B CD1   1 
ATOM   4271 C  CD2   . TRP B 1 244 ? 35.121 32.618  52.580 1.00 19.35 ? 244  TRP B CD2   1 
ATOM   4272 N  NE1   . TRP B 1 244 ? 37.020 31.478  52.200 1.00 18.27 ? 244  TRP B NE1   1 
ATOM   4273 C  CE2   . TRP B 1 244 ? 36.132 31.831  53.182 1.00 19.90 ? 244  TRP B CE2   1 
ATOM   4274 C  CE3   . TRP B 1 244 ? 34.081 33.111  53.381 1.00 18.21 ? 244  TRP B CE3   1 
ATOM   4275 C  CZ2   . TRP B 1 244 ? 36.127 31.524  54.551 1.00 20.34 ? 244  TRP B CZ2   1 
ATOM   4276 C  CZ3   . TRP B 1 244 ? 34.079 32.806  54.739 1.00 19.19 ? 244  TRP B CZ3   1 
ATOM   4277 C  CH2   . TRP B 1 244 ? 35.097 32.020  55.310 1.00 18.80 ? 244  TRP B CH2   1 
ATOM   4278 N  N     . THR B 1 245 ? 32.047 33.608  48.018 1.00 21.19 ? 245  THR B N     1 
ATOM   4279 C  CA    . THR B 1 245 ? 31.170 34.486  47.257 1.00 21.42 ? 245  THR B CA    1 
ATOM   4280 C  C     . THR B 1 245 ? 29.741 34.193  47.682 1.00 22.68 ? 245  THR B C     1 
ATOM   4281 O  O     . THR B 1 245 ? 28.861 35.045  47.566 1.00 23.90 ? 245  THR B O     1 
ATOM   4282 C  CB    . THR B 1 245 ? 31.315 34.296  45.731 1.00 20.01 ? 245  THR B CB    1 
ATOM   4283 O  OG1   . THR B 1 245 ? 31.196 32.909  45.397 1.00 19.63 ? 245  THR B OG1   1 
ATOM   4284 C  CG2   . THR B 1 245 ? 32.655 34.828  45.263 1.00 18.43 ? 245  THR B CG2   1 
ATOM   4285 N  N     . HIS B 1 246 ? 29.513 32.985  48.186 1.00 23.63 ? 246  HIS B N     1 
ATOM   4286 C  CA    . HIS B 1 246 ? 28.184 32.609  48.652 1.00 25.11 ? 246  HIS B CA    1 
ATOM   4287 C  C     . HIS B 1 246 ? 27.835 33.420  49.901 1.00 26.56 ? 246  HIS B C     1 
ATOM   4288 O  O     . HIS B 1 246 ? 26.701 33.859  50.060 1.00 25.02 ? 246  HIS B O     1 
ATOM   4289 C  CB    . HIS B 1 246 ? 28.126 31.113  48.977 1.00 25.16 ? 246  HIS B CB    1 
ATOM   4290 C  CG    . HIS B 1 246 ? 26.867 30.699  49.678 1.00 24.77 ? 246  HIS B CG    1 
ATOM   4291 N  ND1   . HIS B 1 246 ? 25.637 30.666  49.050 1.00 26.98 ? 246  HIS B ND1   1 
ATOM   4292 C  CD2   . HIS B 1 246 ? 26.637 30.365  50.969 1.00 22.48 ? 246  HIS B CD2   1 
ATOM   4293 C  CE1   . HIS B 1 246 ? 24.706 30.333  49.926 1.00 24.70 ? 246  HIS B CE1   1 
ATOM   4294 N  NE2   . HIS B 1 246 ? 25.286 30.145  51.099 1.00 23.41 ? 246  HIS B NE2   1 
ATOM   4295 N  N     . LYS B 1 247 ? 28.819 33.612  50.780 1.00 29.85 ? 247  LYS B N     1 
ATOM   4296 C  CA    . LYS B 1 247 ? 28.633 34.370  52.018 1.00 32.58 ? 247  LYS B CA    1 
ATOM   4297 C  C     . LYS B 1 247 ? 28.584 35.865  51.771 1.00 32.06 ? 247  LYS B C     1 
ATOM   4298 O  O     . LYS B 1 247 ? 27.844 36.584  52.426 1.00 32.58 ? 247  LYS B O     1 
ATOM   4299 C  CB    . LYS B 1 247 ? 29.760 34.084  53.009 1.00 36.42 ? 247  LYS B CB    1 
ATOM   4300 C  CG    . LYS B 1 247 ? 29.329 33.275  54.211 1.00 42.04 ? 247  LYS B CG    1 
ATOM   4301 C  CD    . LYS B 1 247 ? 30.291 33.488  55.370 1.00 46.45 ? 247  LYS B CD    1 
ATOM   4302 C  CE    . LYS B 1 247 ? 29.939 32.612  56.571 1.00 48.41 ? 247  LYS B CE    1 
ATOM   4303 N  NZ    . LYS B 1 247 ? 30.885 32.869  57.703 1.00 50.48 ? 247  LYS B NZ    1 
ATOM   4304 N  N     . HIS B 1 248 ? 29.394 36.331  50.834 1.00 31.78 ? 248  HIS B N     1 
ATOM   4305 C  CA    . HIS B 1 248 ? 29.431 37.741  50.496 1.00 32.51 ? 248  HIS B CA    1 
ATOM   4306 C  C     . HIS B 1 248 ? 29.032 37.853  49.033 1.00 33.09 ? 248  HIS B C     1 
ATOM   4307 O  O     . HIS B 1 248 ? 29.845 38.179  48.172 1.00 33.51 ? 248  HIS B O     1 
ATOM   4308 C  CB    . HIS B 1 248 ? 30.837 38.282  50.730 1.00 33.33 ? 248  HIS B CB    1 
ATOM   4309 C  CG    . HIS B 1 248 ? 31.358 37.995  52.102 1.00 34.92 ? 248  HIS B CG    1 
ATOM   4310 N  ND1   . HIS B 1 248 ? 30.761 38.491  53.240 1.00 35.11 ? 248  HIS B ND1   1 
ATOM   4311 C  CD2   . HIS B 1 248 ? 32.384 37.219  52.522 1.00 35.90 ? 248  HIS B CD2   1 
ATOM   4312 C  CE1   . HIS B 1 248 ? 31.397 38.030  54.303 1.00 37.23 ? 248  HIS B CE1   1 
ATOM   4313 N  NE2   . HIS B 1 248 ? 32.386 37.256  53.895 1.00 36.15 ? 248  HIS B NE2   1 
ATOM   4314 N  N     . PRO B 1 249 ? 27.757 37.578  48.738 1.00 33.48 ? 249  PRO B N     1 
ATOM   4315 C  CA    . PRO B 1 249 ? 27.190 37.623  47.387 1.00 35.03 ? 249  PRO B CA    1 
ATOM   4316 C  C     . PRO B 1 249 ? 27.390 38.910  46.585 1.00 35.96 ? 249  PRO B C     1 
ATOM   4317 O  O     . PRO B 1 249 ? 27.546 38.869  45.361 1.00 34.39 ? 249  PRO B O     1 
ATOM   4318 C  CB    . PRO B 1 249 ? 25.711 37.303  47.628 1.00 35.04 ? 249  PRO B CB    1 
ATOM   4319 C  CG    . PRO B 1 249 ? 25.479 37.798  49.014 1.00 34.32 ? 249  PRO B CG    1 
ATOM   4320 C  CD    . PRO B 1 249 ? 26.703 37.309  49.727 1.00 33.38 ? 249  PRO B CD    1 
ATOM   4321 N  N     . ASN B 1 250 ? 27.389 40.049  47.266 1.00 36.74 ? 250  ASN B N     1 
ATOM   4322 C  CA    . ASN B 1 250 ? 27.553 41.316  46.571 1.00 38.06 ? 250  ASN B CA    1 
ATOM   4323 C  C     . ASN B 1 250 ? 28.873 42.008  46.853 1.00 37.44 ? 250  ASN B C     1 
ATOM   4324 O  O     . ASN B 1 250 ? 29.077 43.146  46.441 1.00 38.64 ? 250  ASN B O     1 
ATOM   4325 C  CB    . ASN B 1 250 ? 26.410 42.258  46.940 1.00 41.69 ? 250  ASN B CB    1 
ATOM   4326 C  CG    . ASN B 1 250 ? 25.078 41.790  46.402 1.00 44.35 ? 250  ASN B CG    1 
ATOM   4327 O  OD1   . ASN B 1 250 ? 24.901 41.647  45.188 1.00 45.58 ? 250  ASN B OD1   1 
ATOM   4328 N  ND2   . ASN B 1 250 ? 24.128 41.551  47.302 1.00 45.70 ? 250  ASN B ND2   1 
ATOM   4329 N  N     . ASN B 1 251 ? 29.775 41.329  47.545 1.00 35.81 ? 251  ASN B N     1 
ATOM   4330 C  CA    . ASN B 1 251 ? 31.045 41.944  47.870 1.00 34.59 ? 251  ASN B CA    1 
ATOM   4331 C  C     . ASN B 1 251 ? 32.229 41.128  47.376 1.00 34.44 ? 251  ASN B C     1 
ATOM   4332 O  O     . ASN B 1 251 ? 32.801 40.327  48.120 1.00 35.12 ? 251  ASN B O     1 
ATOM   4333 C  CB    . ASN B 1 251 ? 31.149 42.139  49.379 1.00 35.86 ? 251  ASN B CB    1 
ATOM   4334 C  CG    . ASN B 1 251 ? 32.101 43.247  49.751 1.00 35.81 ? 251  ASN B CG    1 
ATOM   4335 O  OD1   . ASN B 1 251 ? 33.152 43.414  49.129 1.00 36.05 ? 251  ASN B OD1   1 
ATOM   4336 N  ND2   . ASN B 1 251 ? 31.743 44.010  50.778 1.00 39.04 ? 251  ASN B ND2   1 
ATOM   4337 N  N     . LEU B 1 252 ? 32.605 41.339  46.120 1.00 32.71 ? 252  LEU B N     1 
ATOM   4338 C  CA    . LEU B 1 252 ? 33.731 40.619  45.550 1.00 30.05 ? 252  LEU B CA    1 
ATOM   4339 C  C     . LEU B 1 252 ? 35.031 40.939  46.296 1.00 29.35 ? 252  LEU B C     1 
ATOM   4340 O  O     . LEU B 1 252 ? 35.938 40.108  46.351 1.00 30.22 ? 252  LEU B O     1 
ATOM   4341 C  CB    . LEU B 1 252 ? 33.886 40.968  44.071 1.00 27.64 ? 252  LEU B CB    1 
ATOM   4342 C  CG    . LEU B 1 252 ? 34.954 40.151  43.342 1.00 26.12 ? 252  LEU B CG    1 
ATOM   4343 C  CD1   . LEU B 1 252 ? 34.546 38.694  43.309 1.00 24.41 ? 252  LEU B CD1   1 
ATOM   4344 C  CD2   . LEU B 1 252 ? 35.139 40.677  41.945 1.00 24.22 ? 252  LEU B CD2   1 
ATOM   4345 N  N     . LYS B 1 253 ? 35.119 42.134  46.873 1.00 27.73 ? 253  LYS B N     1 
ATOM   4346 C  CA    . LYS B 1 253 ? 36.322 42.534  47.597 1.00 27.31 ? 253  LYS B CA    1 
ATOM   4347 C  C     . LYS B 1 253 ? 36.623 41.600  48.767 1.00 26.72 ? 253  LYS B C     1 
ATOM   4348 O  O     . LYS B 1 253 ? 37.727 41.056  48.871 1.00 25.54 ? 253  LYS B O     1 
ATOM   4349 C  CB    . LYS B 1 253 ? 36.189 43.975  48.110 1.00 27.52 ? 253  LYS B CB    1 
ATOM   4350 C  CG    . LYS B 1 253 ? 37.387 44.457  48.941 1.00 30.32 ? 253  LYS B CG    1 
ATOM   4351 C  CD    . LYS B 1 253 ? 37.314 45.953  49.247 1.00 32.51 ? 253  LYS B CD    1 
ATOM   4352 C  CE    . LYS B 1 253 ? 37.902 46.282  50.620 1.00 31.63 ? 253  LYS B CE    1 
ATOM   4353 N  NZ    . LYS B 1 253 ? 39.246 46.902  50.539 1.00 29.77 ? 253  LYS B NZ    1 
ATOM   4354 N  N     . VAL B 1 254 ? 35.638 41.414  49.640 1.00 24.81 ? 254  VAL B N     1 
ATOM   4355 C  CA    . VAL B 1 254 ? 35.796 40.557  50.809 1.00 24.02 ? 254  VAL B CA    1 
ATOM   4356 C  C     . VAL B 1 254 ? 35.973 39.087  50.433 1.00 23.61 ? 254  VAL B C     1 
ATOM   4357 O  O     . VAL B 1 254 ? 36.808 38.382  51.010 1.00 22.88 ? 254  VAL B O     1 
ATOM   4358 C  CB    . VAL B 1 254 ? 34.587 40.713  51.748 1.00 24.24 ? 254  VAL B CB    1 
ATOM   4359 C  CG1   . VAL B 1 254 ? 34.717 39.780  52.943 1.00 24.41 ? 254  VAL B CG1   1 
ATOM   4360 C  CG2   . VAL B 1 254 ? 34.501 42.150  52.212 1.00 23.82 ? 254  VAL B CG2   1 
ATOM   4361 N  N     . ALA B 1 255 ? 35.186 38.635  49.460 1.00 22.21 ? 255  ALA B N     1 
ATOM   4362 C  CA    . ALA B 1 255 ? 35.250 37.258  48.985 1.00 20.63 ? 255  ALA B CA    1 
ATOM   4363 C  C     . ALA B 1 255 ? 36.658 36.915  48.502 1.00 19.85 ? 255  ALA B C     1 
ATOM   4364 O  O     . ALA B 1 255 ? 37.176 35.829  48.779 1.00 19.11 ? 255  ALA B O     1 
ATOM   4365 C  CB    . ALA B 1 255 ? 34.246 37.049  47.854 1.00 20.92 ? 255  ALA B CB    1 
ATOM   4366 N  N     . CYS B 1 256 ? 37.272 37.840  47.776 1.00 17.77 ? 256  CYS B N     1 
ATOM   4367 C  CA    . CYS B 1 256 ? 38.610 37.607  47.280 1.00 18.89 ? 256  CYS B CA    1 
ATOM   4368 C  C     . CYS B 1 256 ? 39.670 37.718  48.362 1.00 20.28 ? 256  CYS B C     1 
ATOM   4369 O  O     . CYS B 1 256 ? 40.667 36.989  48.325 1.00 20.22 ? 256  CYS B O     1 
ATOM   4370 C  CB    . CYS B 1 256 ? 38.928 38.559  46.131 1.00 19.89 ? 256  CYS B CB    1 
ATOM   4371 S  SG    . CYS B 1 256 ? 38.280 37.995  44.528 1.00 19.98 ? 256  CYS B SG    1 
ATOM   4372 N  N     . GLU B 1 257 ? 39.460 38.612  49.330 1.00 20.56 ? 257  GLU B N     1 
ATOM   4373 C  CA    . GLU B 1 257 ? 40.425 38.777  50.418 1.00 20.15 ? 257  GLU B CA    1 
ATOM   4374 C  C     . GLU B 1 257 ? 40.467 37.534  51.291 1.00 18.96 ? 257  GLU B C     1 
ATOM   4375 O  O     . GLU B 1 257 ? 41.538 37.108  51.724 1.00 18.51 ? 257  GLU B O     1 
ATOM   4376 C  CB    . GLU B 1 257 ? 40.100 40.006  51.267 1.00 20.80 ? 257  GLU B CB    1 
ATOM   4377 C  CG    . GLU B 1 257 ? 40.127 41.293  50.463 1.00 24.74 ? 257  GLU B CG    1 
ATOM   4378 C  CD    . GLU B 1 257 ? 40.011 42.546  51.306 1.00 25.27 ? 257  GLU B CD    1 
ATOM   4379 O  OE1   . GLU B 1 257 ? 39.205 42.562  52.260 1.00 25.40 ? 257  GLU B OE1   1 
ATOM   4380 O  OE2   . GLU B 1 257 ? 40.720 43.527  50.997 1.00 27.57 ? 257  GLU B OE2   1 
ATOM   4381 N  N     . LYS B 1 258 ? 39.307 36.943  51.549 1.00 17.49 ? 258  LYS B N     1 
ATOM   4382 C  CA    . LYS B 1 258 ? 39.289 35.730  52.353 1.00 19.28 ? 258  LYS B CA    1 
ATOM   4383 C  C     . LYS B 1 258 ? 39.877 34.578  51.538 1.00 19.63 ? 258  LYS B C     1 
ATOM   4384 O  O     . LYS B 1 258 ? 40.659 33.775  52.049 1.00 20.28 ? 258  LYS B O     1 
ATOM   4385 C  CB    . LYS B 1 258 ? 37.862 35.393  52.818 1.00 20.28 ? 258  LYS B CB    1 
ATOM   4386 C  CG    . LYS B 1 258 ? 37.355 36.291  53.958 1.00 21.86 ? 258  LYS B CG    1 
ATOM   4387 C  CD    . LYS B 1 258 ? 36.077 35.760  54.629 1.00 24.43 ? 258  LYS B CD    1 
ATOM   4388 C  CE    . LYS B 1 258 ? 35.643 36.672  55.798 1.00 26.16 ? 258  LYS B CE    1 
ATOM   4389 N  NZ    . LYS B 1 258 ? 34.331 36.303  56.439 1.00 26.60 ? 258  LYS B NZ    1 
ATOM   4390 N  N     . THR B 1 259 ? 39.519 34.516  50.261 1.00 18.80 ? 259  THR B N     1 
ATOM   4391 C  CA    . THR B 1 259 ? 40.015 33.464  49.385 1.00 17.31 ? 259  THR B CA    1 
ATOM   4392 C  C     . THR B 1 259 ? 41.533 33.491  49.242 1.00 16.97 ? 259  THR B C     1 
ATOM   4393 O  O     . THR B 1 259 ? 42.200 32.461  49.388 1.00 17.32 ? 259  THR B O     1 
ATOM   4394 C  CB    . THR B 1 259 ? 39.388 33.583  47.994 1.00 18.08 ? 259  THR B CB    1 
ATOM   4395 O  OG1   . THR B 1 259 ? 37.966 33.463  48.112 1.00 17.83 ? 259  THR B OG1   1 
ATOM   4396 C  CG2   . THR B 1 259 ? 39.921 32.493  47.072 1.00 15.30 ? 259  THR B CG2   1 
ATOM   4397 N  N     . VAL B 1 260 ? 42.082 34.665  48.955 1.00 14.64 ? 260  VAL B N     1 
ATOM   4398 C  CA    . VAL B 1 260 ? 43.521 34.791  48.790 1.00 13.46 ? 260  VAL B CA    1 
ATOM   4399 C  C     . VAL B 1 260 ? 44.274 34.624  50.122 1.00 13.02 ? 260  VAL B C     1 
ATOM   4400 O  O     . VAL B 1 260 ? 45.396 34.108  50.154 1.00 10.54 ? 260  VAL B O     1 
ATOM   4401 C  CB    . VAL B 1 260 ? 43.876 36.149  48.125 1.00 13.59 ? 260  VAL B CB    1 
ATOM   4402 C  CG1   . VAL B 1 260 ? 45.382 36.332  48.080 1.00 15.67 ? 260  VAL B CG1   1 
ATOM   4403 C  CG2   . VAL B 1 260 ? 43.311 36.196  46.713 1.00 14.01 ? 260  VAL B CG2   1 
ATOM   4404 N  N     . SER B 1 261 ? 43.664 35.050  51.223 1.00 14.30 ? 261  SER B N     1 
ATOM   4405 C  CA    . SER B 1 261 ? 44.320 34.898  52.520 1.00 15.17 ? 261  SER B CA    1 
ATOM   4406 C  C     . SER B 1 261 ? 44.513 33.416  52.827 1.00 14.89 ? 261  SER B C     1 
ATOM   4407 O  O     . SER B 1 261 ? 45.582 33.005  53.289 1.00 15.02 ? 261  SER B O     1 
ATOM   4408 C  CB    . SER B 1 261 ? 43.504 35.565  53.636 1.00 16.78 ? 261  SER B CB    1 
ATOM   4409 O  OG    . SER B 1 261 ? 43.591 36.978  53.544 1.00 17.93 ? 261  SER B OG    1 
ATOM   4410 N  N     . ALA B 1 262 ? 43.481 32.618  52.564 1.00 12.94 ? 262  ALA B N     1 
ATOM   4411 C  CA    . ALA B 1 262 ? 43.550 31.181  52.794 1.00 13.70 ? 262  ALA B CA    1 
ATOM   4412 C  C     . ALA B 1 262 ? 44.652 30.559  51.926 1.00 16.22 ? 262  ALA B C     1 
ATOM   4413 O  O     . ALA B 1 262 ? 45.426 29.713  52.395 1.00 15.50 ? 262  ALA B O     1 
ATOM   4414 C  CB    . ALA B 1 262 ? 42.213 30.541  52.482 1.00 13.60 ? 262  ALA B CB    1 
ATOM   4415 N  N     . MET B 1 263 ? 44.718 30.971  50.660 1.00 17.95 ? 263  MET B N     1 
ATOM   4416 C  CA    . MET B 1 263 ? 45.750 30.459  49.761 1.00 18.85 ? 263  MET B CA    1 
ATOM   4417 C  C     . MET B 1 263 ? 47.117 30.659  50.411 1.00 19.54 ? 263  MET B C     1 
ATOM   4418 O  O     . MET B 1 263 ? 47.958 29.752  50.428 1.00 19.18 ? 263  MET B O     1 
ATOM   4419 C  CB    . MET B 1 263 ? 45.757 31.204  48.417 1.00 21.64 ? 263  MET B CB    1 
ATOM   4420 C  CG    . MET B 1 263 ? 44.764 30.740  47.367 1.00 22.95 ? 263  MET B CG    1 
ATOM   4421 S  SD    . MET B 1 263 ? 44.702 28.957  47.103 1.00 24.98 ? 263  MET B SD    1 
ATOM   4422 C  CE    . MET B 1 263 ? 46.361 28.565  46.661 1.00 22.29 ? 263  MET B CE    1 
ATOM   4423 N  N     . HIS B 1 264 ? 47.335 31.867  50.925 1.00 18.61 ? 264  HIS B N     1 
ATOM   4424 C  CA    . HIS B 1 264 ? 48.598 32.226  51.558 1.00 18.43 ? 264  HIS B CA    1 
ATOM   4425 C  C     . HIS B 1 264 ? 48.957 31.287  52.701 1.00 19.08 ? 264  HIS B C     1 
ATOM   4426 O  O     . HIS B 1 264 ? 50.053 30.723  52.741 1.00 18.32 ? 264  HIS B O     1 
ATOM   4427 C  CB    . HIS B 1 264 ? 48.523 33.665  52.066 1.00 19.22 ? 264  HIS B CB    1 
ATOM   4428 C  CG    . HIS B 1 264 ? 49.789 34.157  52.694 1.00 19.66 ? 264  HIS B CG    1 
ATOM   4429 N  ND1   . HIS B 1 264 ? 49.975 34.200  54.058 1.00 19.98 ? 264  HIS B ND1   1 
ATOM   4430 C  CD2   . HIS B 1 264 ? 50.931 34.628  52.143 1.00 21.02 ? 264  HIS B CD2   1 
ATOM   4431 C  CE1   . HIS B 1 264 ? 51.178 34.679  54.322 1.00 19.40 ? 264  HIS B CE1   1 
ATOM   4432 N  NE2   . HIS B 1 264 ? 51.779 34.946  53.177 1.00 21.43 ? 264  HIS B NE2   1 
ATOM   4433 N  N     . HIS B 1 265 ? 48.023 31.120  53.628 1.00 17.78 ? 265  HIS B N     1 
ATOM   4434 C  CA    . HIS B 1 265 ? 48.239 30.252  54.768 1.00 17.03 ? 265  HIS B CA    1 
ATOM   4435 C  C     . HIS B 1 265 ? 48.554 28.821  54.359 1.00 16.43 ? 265  HIS B C     1 
ATOM   4436 O  O     . HIS B 1 265 ? 49.476 28.208  54.903 1.00 17.86 ? 265  HIS B O     1 
ATOM   4437 C  CB    . HIS B 1 265 ? 47.017 30.295  55.685 1.00 17.26 ? 265  HIS B CB    1 
ATOM   4438 C  CG    . HIS B 1 265 ? 46.744 31.655  56.247 1.00 17.38 ? 265  HIS B CG    1 
ATOM   4439 N  ND1   . HIS B 1 265 ? 47.722 32.417  56.849 1.00 16.58 ? 265  HIS B ND1   1 
ATOM   4440 C  CD2   . HIS B 1 265 ? 45.608 32.390  56.296 1.00 16.64 ? 265  HIS B CD2   1 
ATOM   4441 C  CE1   . HIS B 1 265 ? 47.202 33.565  57.246 1.00 15.92 ? 265  HIS B CE1   1 
ATOM   4442 N  NE2   . HIS B 1 265 ? 45.920 33.573  56.923 1.00 18.63 ? 265  HIS B NE2   1 
ATOM   4443 N  N     . VAL B 1 266 ? 47.800 28.291  53.400 1.00 15.70 ? 266  VAL B N     1 
ATOM   4444 C  CA    . VAL B 1 266 ? 48.020 26.928  52.933 1.00 13.58 ? 266  VAL B CA    1 
ATOM   4445 C  C     . VAL B 1 266 ? 49.372 26.777  52.273 1.00 13.15 ? 266  VAL B C     1 
ATOM   4446 O  O     . VAL B 1 266 ? 50.083 25.822  52.555 1.00 14.10 ? 266  VAL B O     1 
ATOM   4447 C  CB    . VAL B 1 266 ? 46.940 26.489  51.940 1.00 11.47 ? 266  VAL B CB    1 
ATOM   4448 C  CG1   . VAL B 1 266 ? 47.260 25.110  51.404 1.00 11.28 ? 266  VAL B CG1   1 
ATOM   4449 C  CG2   . VAL B 1 266 ? 45.590 26.487  52.623 1.00 8.73  ? 266  VAL B CG2   1 
ATOM   4450 N  N     . LEU B 1 267 ? 49.736 27.720  51.406 1.00 14.82 ? 267  LEU B N     1 
ATOM   4451 C  CA    . LEU B 1 267 ? 51.020 27.651  50.704 1.00 15.50 ? 267  LEU B CA    1 
ATOM   4452 C  C     . LEU B 1 267 ? 52.219 27.829  51.621 1.00 15.79 ? 267  LEU B C     1 
ATOM   4453 O  O     . LEU B 1 267 ? 53.249 27.201  51.423 1.00 16.49 ? 267  LEU B O     1 
ATOM   4454 C  CB    . LEU B 1 267 ? 51.074 28.681  49.572 1.00 14.81 ? 267  LEU B CB    1 
ATOM   4455 C  CG    . LEU B 1 267 ? 50.052 28.426  48.464 1.00 13.73 ? 267  LEU B CG    1 
ATOM   4456 C  CD1   . LEU B 1 267 ? 50.245 29.415  47.337 1.00 13.71 ? 267  LEU B CD1   1 
ATOM   4457 C  CD2   . LEU B 1 267 ? 50.221 27.022  47.952 1.00 12.72 ? 267  LEU B CD2   1 
ATOM   4458 N  N     . GLN B 1 268 ? 52.093 28.686  52.624 1.00 16.66 ? 268  GLN B N     1 
ATOM   4459 C  CA    . GLN B 1 268 ? 53.195 28.893  53.549 1.00 18.01 ? 268  GLN B CA    1 
ATOM   4460 C  C     . GLN B 1 268 ? 53.435 27.613  54.323 1.00 19.06 ? 268  GLN B C     1 
ATOM   4461 O  O     . GLN B 1 268 ? 54.572 27.154  54.448 1.00 19.52 ? 268  GLN B O     1 
ATOM   4462 C  CB    . GLN B 1 268 ? 52.883 30.035  54.513 1.00 18.95 ? 268  GLN B CB    1 
ATOM   4463 C  CG    . GLN B 1 268 ? 53.068 31.406  53.887 1.00 21.54 ? 268  GLN B CG    1 
ATOM   4464 C  CD    . GLN B 1 268 ? 54.494 31.625  53.442 1.00 22.56 ? 268  GLN B CD    1 
ATOM   4465 O  OE1   . GLN B 1 268 ? 54.750 32.032  52.306 1.00 23.96 ? 268  GLN B OE1   1 
ATOM   4466 N  NE2   . GLN B 1 268 ? 55.438 31.348  54.338 1.00 22.09 ? 268  GLN B NE2   1 
ATOM   4467 N  N     . ARG B 1 269 ? 52.361 27.026  54.837 1.00 18.19 ? 269  ARG B N     1 
ATOM   4468 C  CA    . ARG B 1 269 ? 52.506 25.796  55.581 1.00 18.58 ? 269  ARG B CA    1 
ATOM   4469 C  C     . ARG B 1 269 ? 53.074 24.710  54.671 1.00 19.61 ? 269  ARG B C     1 
ATOM   4470 O  O     . ARG B 1 269 ? 53.900 23.902  55.103 1.00 22.30 ? 269  ARG B O     1 
ATOM   4471 C  CB    . ARG B 1 269 ? 51.158 25.361  56.162 1.00 17.61 ? 269  ARG B CB    1 
ATOM   4472 C  CG    . ARG B 1 269 ? 51.200 24.004  56.839 1.00 17.15 ? 269  ARG B CG    1 
ATOM   4473 C  CD    . ARG B 1 269 ? 49.891 23.654  57.522 1.00 18.10 ? 269  ARG B CD    1 
ATOM   4474 N  NE    . ARG B 1 269 ? 49.636 24.537  58.654 1.00 21.93 ? 269  ARG B NE    1 
ATOM   4475 C  CZ    . ARG B 1 269 ? 48.867 25.620  58.604 1.00 21.67 ? 269  ARG B CZ    1 
ATOM   4476 N  NH1   . ARG B 1 269 ? 48.262 25.956  57.468 1.00 19.30 ? 269  ARG B NH1   1 
ATOM   4477 N  NH2   . ARG B 1 269 ? 48.715 26.374  59.689 1.00 21.35 ? 269  ARG B NH2   1 
ATOM   4478 N  N     . THR B 1 270 ? 52.654 24.703  53.409 1.00 18.30 ? 270  THR B N     1 
ATOM   4479 C  CA    . THR B 1 270 ? 53.120 23.697  52.461 1.00 17.70 ? 270  THR B CA    1 
ATOM   4480 C  C     . THR B 1 270 ? 54.599 23.798  52.116 1.00 17.66 ? 270  THR B C     1 
ATOM   4481 O  O     . THR B 1 270 ? 55.284 22.786  52.058 1.00 17.58 ? 270  THR B O     1 
ATOM   4482 C  CB    . THR B 1 270 ? 52.303 23.735  51.141 1.00 18.89 ? 270  THR B CB    1 
ATOM   4483 O  OG1   . THR B 1 270 ? 50.932 23.396  51.413 1.00 18.12 ? 270  THR B OG1   1 
ATOM   4484 C  CG2   . THR B 1 270 ? 52.883 22.739  50.119 1.00 17.61 ? 270  THR B CG2   1 
ATOM   4485 N  N     . ILE B 1 271 ? 55.093 25.010  51.890 1.00 17.69 ? 271  ILE B N     1 
ATOM   4486 C  CA    . ILE B 1 271 ? 56.496 25.186  51.533 1.00 18.81 ? 271  ILE B CA    1 
ATOM   4487 C  C     . ILE B 1 271 ? 57.413 24.964  52.732 1.00 20.44 ? 271  ILE B C     1 
ATOM   4488 O  O     . ILE B 1 271 ? 58.544 24.508  52.575 1.00 20.19 ? 271  ILE B O     1 
ATOM   4489 C  CB    . ILE B 1 271 ? 56.754 26.597  50.918 1.00 18.87 ? 271  ILE B CB    1 
ATOM   4490 C  CG1   . ILE B 1 271 ? 58.174 26.678  50.345 1.00 18.58 ? 271  ILE B CG1   1 
ATOM   4491 C  CG2   . ILE B 1 271 ? 56.577 27.670  51.975 1.00 18.92 ? 271  ILE B CG2   1 
ATOM   4492 C  CD1   . ILE B 1 271 ? 58.450 25.712  49.212 1.00 15.53 ? 271  ILE B CD1   1 
ATOM   4493 N  N     . LYS B 1 272 ? 56.929 25.280  53.931 1.00 22.60 ? 272  LYS B N     1 
ATOM   4494 C  CA    . LYS B 1 272 ? 57.727 25.080  55.140 1.00 24.67 ? 272  LYS B CA    1 
ATOM   4495 C  C     . LYS B 1 272 ? 57.935 23.588  55.377 1.00 25.34 ? 272  LYS B C     1 
ATOM   4496 O  O     . LYS B 1 272 ? 59.053 23.144  55.654 1.00 24.80 ? 272  LYS B O     1 
ATOM   4497 C  CB    . LYS B 1 272 ? 57.042 25.706  56.358 1.00 26.25 ? 272  LYS B CB    1 
ATOM   4498 C  CG    . LYS B 1 272 ? 57.075 27.230  56.379 1.00 30.78 ? 272  LYS B CG    1 
ATOM   4499 C  CD    . LYS B 1 272 ? 56.234 27.817  57.523 1.00 33.28 ? 272  LYS B CD    1 
ATOM   4500 C  CE    . LYS B 1 272 ? 56.064 29.339  57.378 1.00 34.93 ? 272  LYS B CE    1 
ATOM   4501 N  NZ    . LYS B 1 272 ? 55.052 29.904  58.325 1.00 34.00 ? 272  LYS B NZ    1 
ATOM   4502 N  N     . CYS B 1 273 ? 56.857 22.818  55.262 1.00 25.84 ? 273  CYS B N     1 
ATOM   4503 C  CA    . CYS B 1 273 ? 56.937 21.380  55.454 1.00 28.19 ? 273  CYS B CA    1 
ATOM   4504 C  C     . CYS B 1 273 ? 57.749 20.696  54.363 1.00 28.50 ? 273  CYS B C     1 
ATOM   4505 O  O     . CYS B 1 273 ? 58.456 19.724  54.625 1.00 29.42 ? 273  CYS B O     1 
ATOM   4506 C  CB    . CYS B 1 273 ? 55.537 20.773  55.525 1.00 29.91 ? 273  CYS B CB    1 
ATOM   4507 S  SG    . CYS B 1 273 ? 54.863 20.750  57.201 1.00 35.17 ? 273  CYS B SG    1 
ATOM   4508 N  N     . ALA B 1 274 ? 57.657 21.205  53.142 1.00 28.79 ? 274  ALA B N     1 
ATOM   4509 C  CA    . ALA B 1 274 ? 58.404 20.631  52.031 1.00 29.59 ? 274  ALA B CA    1 
ATOM   4510 C  C     . ALA B 1 274 ? 59.909 20.774  52.247 1.00 31.04 ? 274  ALA B C     1 
ATOM   4511 O  O     . ALA B 1 274 ? 60.656 19.814  52.095 1.00 32.29 ? 274  ALA B O     1 
ATOM   4512 C  CB    . ALA B 1 274 ? 58.002 21.300  50.729 1.00 28.10 ? 274  ALA B CB    1 
ATOM   4513 N  N     . LYS B 1 275 ? 60.352 21.973  52.606 1.00 32.78 ? 275  LYS B N     1 
ATOM   4514 C  CA    . LYS B 1 275 ? 61.768 22.217  52.826 1.00 35.56 ? 275  LYS B CA    1 
ATOM   4515 C  C     . LYS B 1 275 ? 62.320 21.406  53.998 1.00 38.04 ? 275  LYS B C     1 
ATOM   4516 O  O     . LYS B 1 275 ? 63.480 20.982  53.978 1.00 39.96 ? 275  LYS B O     1 
ATOM   4517 C  CB    . LYS B 1 275 ? 62.015 23.714  53.052 1.00 34.96 ? 275  LYS B CB    1 
ATOM   4518 C  CG    . LYS B 1 275 ? 61.716 24.573  51.828 1.00 32.76 ? 275  LYS B CG    1 
ATOM   4519 C  CD    . LYS B 1 275 ? 62.088 26.032  52.030 1.00 31.22 ? 275  LYS B CD    1 
ATOM   4520 C  CE    . LYS B 1 275 ? 61.965 26.801  50.713 1.00 35.31 ? 275  LYS B CE    1 
ATOM   4521 N  NZ    . LYS B 1 275 ? 62.331 28.253  50.815 1.00 34.05 ? 275  LYS B NZ    1 
ATOM   4522 N  N     . ALA B 1 276 ? 61.489 21.179  55.010 1.00 38.99 ? 276  ALA B N     1 
ATOM   4523 C  CA    . ALA B 1 276 ? 61.919 20.417  56.178 1.00 39.68 ? 276  ALA B CA    1 
ATOM   4524 C  C     . ALA B 1 276 ? 62.049 18.930  55.847 1.00 39.73 ? 276  ALA B C     1 
ATOM   4525 O  O     . ALA B 1 276 ? 62.878 18.227  56.421 1.00 39.64 ? 276  ALA B O     1 
ATOM   4526 C  CB    . ALA B 1 276 ? 60.932 20.620  57.328 1.00 38.84 ? 276  ALA B CB    1 
ATOM   4527 N  N     . LYS B 1 277 ? 61.226 18.461  54.917 1.00 40.68 ? 277  LYS B N     1 
ATOM   4528 C  CA    . LYS B 1 277 ? 61.242 17.060  54.513 1.00 43.23 ? 277  LYS B CA    1 
ATOM   4529 C  C     . LYS B 1 277 ? 62.302 16.750  53.466 1.00 44.62 ? 277  LYS B C     1 
ATOM   4530 O  O     . LYS B 1 277 ? 62.778 15.617  53.369 1.00 45.66 ? 277  LYS B O     1 
ATOM   4531 C  CB    . LYS B 1 277 ? 59.877 16.657  53.963 1.00 43.54 ? 277  LYS B CB    1 
ATOM   4532 C  CG    . LYS B 1 277 ? 58.836 16.412  55.025 1.00 47.09 ? 277  LYS B CG    1 
ATOM   4533 C  CD    . LYS B 1 277 ? 59.221 15.222  55.889 1.00 50.09 ? 277  LYS B CD    1 
ATOM   4534 C  CE    . LYS B 1 277 ? 58.185 14.966  56.979 1.00 53.09 ? 277  LYS B CE    1 
ATOM   4535 N  NZ    . LYS B 1 277 ? 56.842 14.632  56.413 1.00 54.77 ? 277  LYS B NZ    1 
ATOM   4536 N  N     . SER B 1 278 ? 62.661 17.761  52.685 1.00 46.38 ? 278  SER B N     1 
ATOM   4537 C  CA    . SER B 1 278 ? 63.651 17.629  51.624 1.00 48.66 ? 278  SER B CA    1 
ATOM   4538 C  C     . SER B 1 278 ? 65.059 17.367  52.151 1.00 50.41 ? 278  SER B C     1 
ATOM   4539 O  O     . SER B 1 278 ? 65.691 16.356  51.814 1.00 51.24 ? 278  SER B O     1 
ATOM   4540 C  CB    . SER B 1 278 ? 63.702 18.910  50.797 1.00 48.20 ? 278  SER B CB    1 
ATOM   4541 O  OG    . SER B 1 278 ? 62.397 19.266  50.367 1.00 48.98 ? 278  SER B OG    1 
ATOM   4542 N  N     . GLY B 1 279 ? 65.488 18.294  52.956 1.00 51.38 ? 279  GLY B N     1 
ATOM   4543 C  CA    . GLY B 1 279 ? 66.842 18.336  53.501 1.00 53.39 ? 279  GLY B CA    1 
ATOM   4544 C  C     . GLY B 1 279 ? 67.355 19.709  53.135 1.00 54.09 ? 279  GLY B C     1 
ATOM   4545 O  O     . GLY B 1 279 ? 66.732 20.425  52.346 1.00 53.50 ? 279  GLY B O     1 
ATOM   4546 N  N     . GLU B 1 280 ? 68.469 20.107  53.674 1.00 54.95 ? 280  GLU B N     1 
ATOM   4547 C  CA    . GLU B 1 280 ? 68.952 21.459  53.390 1.00 55.41 ? 280  GLU B CA    1 
ATOM   4548 C  C     . GLU B 1 280 ? 69.677 21.525  52.052 1.00 53.96 ? 280  GLU B C     1 
ATOM   4549 O  O     . GLU B 1 280 ? 70.455 20.636  51.697 1.00 54.46 ? 280  GLU B O     1 
ATOM   4550 C  CB    . GLU B 1 280 ? 69.844 21.949  54.537 1.00 57.96 ? 280  GLU B CB    1 
ATOM   4551 C  CG    . GLU B 1 280 ? 71.337 21.771  54.289 1.00 62.54 ? 280  GLU B CG    1 
ATOM   4552 C  CD    . GLU B 1 280 ? 72.188 22.784  55.059 1.00 65.06 ? 280  GLU B CD    1 
ATOM   4553 O  OE1   . GLU B 1 280 ? 73.473 22.748  54.967 1.00 66.59 ? 280  GLU B OE1   1 
ATOM   4554 O  OE2   . GLU B 1 280 ? 71.619 23.680  55.792 1.00 66.79 ? 280  GLU B OE2   1 
ATOM   4555 N  N     . GLY B 1 281 ? 69.400 22.594  51.316 1.00 51.93 ? 281  GLY B N     1 
ATOM   4556 C  CA    . GLY B 1 281 ? 70.010 22.784  50.016 1.00 50.68 ? 281  GLY B CA    1 
ATOM   4557 C  C     . GLY B 1 281 ? 69.312 21.950  48.965 1.00 50.36 ? 281  GLY B C     1 
ATOM   4558 O  O     . GLY B 1 281 ? 69.408 22.236  47.772 1.00 50.85 ? 281  GLY B O     1 
ATOM   4559 N  N     . VAL B 1 282 ? 68.601 20.915  49.405 1.00 49.99 ? 282  VAL B N     1 
ATOM   4560 C  CA    . VAL B 1 282 ? 67.898 20.036  48.475 1.00 49.31 ? 282  VAL B CA    1 
ATOM   4561 C  C     . VAL B 1 282 ? 66.551 20.624  48.081 1.00 48.40 ? 282  VAL B C     1 
ATOM   4562 O  O     . VAL B 1 282 ? 65.773 21.059  48.931 1.00 48.45 ? 282  VAL B O     1 
ATOM   4563 C  CB    . VAL B 1 282 ? 67.667 18.623  49.074 1.00 49.25 ? 282  VAL B CB    1 
ATOM   4564 C  CG1   . VAL B 1 282 ? 66.927 17.749  48.063 1.00 47.39 ? 282  VAL B CG1   1 
ATOM   4565 C  CG2   . VAL B 1 282 ? 69.001 17.987  49.452 1.00 48.89 ? 282  VAL B CG2   1 
ATOM   4566 N  N     . LYS B 1 283 ? 66.278 20.631  46.784 1.00 47.14 ? 283  LYS B N     1 
ATOM   4567 C  CA    . LYS B 1 283 ? 65.027 21.171  46.289 1.00 45.48 ? 283  LYS B CA    1 
ATOM   4568 C  C     . LYS B 1 283 ? 63.865 20.228  46.542 1.00 44.10 ? 283  LYS B C     1 
ATOM   4569 O  O     . LYS B 1 283 ? 63.965 19.018  46.328 1.00 45.13 ? 283  LYS B O     1 
ATOM   4570 C  CB    . LYS B 1 283 ? 65.128 21.458  44.801 1.00 47.06 ? 283  LYS B CB    1 
ATOM   4571 C  CG    . LYS B 1 283 ? 64.719 22.860  44.481 1.00 50.19 ? 283  LYS B CG    1 
ATOM   4572 C  CD    . LYS B 1 283 ? 64.490 23.066  43.003 1.00 53.94 ? 283  LYS B CD    1 
ATOM   4573 C  CE    . LYS B 1 283 ? 64.029 24.498  42.757 1.00 56.61 ? 283  LYS B CE    1 
ATOM   4574 N  NZ    . LYS B 1 283 ? 63.784 24.795  41.316 1.00 57.09 ? 283  LYS B NZ    1 
ATOM   4575 N  N     . PRO B 1 284 ? 62.736 20.773  47.007 1.00 41.55 ? 284  PRO B N     1 
ATOM   4576 C  CA    . PRO B 1 284 ? 61.572 19.931  47.278 1.00 39.59 ? 284  PRO B CA    1 
ATOM   4577 C  C     . PRO B 1 284 ? 61.064 19.278  46.003 1.00 38.19 ? 284  PRO B C     1 
ATOM   4578 O  O     . PRO B 1 284 ? 60.999 19.920  44.959 1.00 37.12 ? 284  PRO B O     1 
ATOM   4579 C  CB    . PRO B 1 284 ? 60.561 20.917  47.863 1.00 39.55 ? 284  PRO B CB    1 
ATOM   4580 C  CG    . PRO B 1 284 ? 61.430 21.948  48.508 1.00 40.09 ? 284  PRO B CG    1 
ATOM   4581 C  CD    . PRO B 1 284 ? 62.501 22.150  47.467 1.00 40.49 ? 284  PRO B CD    1 
ATOM   4582 N  N     . SER B 1 285 ? 60.713 17.999  46.097 1.00 36.90 ? 285  SER B N     1 
ATOM   4583 C  CA    . SER B 1 285 ? 60.185 17.255  44.959 1.00 34.95 ? 285  SER B CA    1 
ATOM   4584 C  C     . SER B 1 285 ? 58.675 17.445  44.893 1.00 33.79 ? 285  SER B C     1 
ATOM   4585 O  O     . SER B 1 285 ? 58.038 17.803  45.883 1.00 32.86 ? 285  SER B O     1 
ATOM   4586 C  CB    . SER B 1 285 ? 60.487 15.767  45.110 1.00 35.73 ? 285  SER B CB    1 
ATOM   4587 O  OG    . SER B 1 285 ? 59.740 15.208  46.176 1.00 36.53 ? 285  SER B OG    1 
ATOM   4588 N  N     . PRO B 1 286 ? 58.077 17.203  43.720 1.00 32.82 ? 286  PRO B N     1 
ATOM   4589 C  CA    . PRO B 1 286 ? 56.626 17.366  43.602 1.00 31.03 ? 286  PRO B CA    1 
ATOM   4590 C  C     . PRO B 1 286 ? 55.841 16.548  44.632 1.00 29.53 ? 286  PRO B C     1 
ATOM   4591 O  O     . PRO B 1 286 ? 54.749 16.938  45.047 1.00 27.82 ? 286  PRO B O     1 
ATOM   4592 C  CB    . PRO B 1 286 ? 56.344 16.954  42.151 1.00 31.67 ? 286  PRO B CB    1 
ATOM   4593 C  CG    . PRO B 1 286 ? 57.506 16.061  41.799 1.00 34.19 ? 286  PRO B CG    1 
ATOM   4594 C  CD    . PRO B 1 286 ? 58.665 16.771  42.440 1.00 33.24 ? 286  PRO B CD    1 
ATOM   4595 N  N     . ALA B 1 287 ? 56.401 15.420  45.051 1.00 28.40 ? 287  ALA B N     1 
ATOM   4596 C  CA    . ALA B 1 287 ? 55.736 14.582  46.037 1.00 27.04 ? 287  ALA B CA    1 
ATOM   4597 C  C     . ALA B 1 287 ? 55.774 15.279  47.392 1.00 26.26 ? 287  ALA B C     1 
ATOM   4598 O  O     . ALA B 1 287 ? 54.864 15.118  48.207 1.00 28.14 ? 287  ALA B O     1 
ATOM   4599 C  CB    . ALA B 1 287 ? 56.416 13.217  46.121 1.00 26.12 ? 287  ALA B CB    1 
ATOM   4600 N  N     . GLN B 1 288 ? 56.824 16.057  47.633 1.00 23.60 ? 288  GLN B N     1 
ATOM   4601 C  CA    . GLN B 1 288 ? 56.956 16.763  48.899 1.00 23.51 ? 288  GLN B CA    1 
ATOM   4602 C  C     . GLN B 1 288 ? 56.169 18.064  48.882 1.00 22.74 ? 288  GLN B C     1 
ATOM   4603 O  O     . GLN B 1 288 ? 55.864 18.645  49.933 1.00 22.51 ? 288  GLN B O     1 
ATOM   4604 C  CB    . GLN B 1 288 ? 58.431 17.046  49.196 1.00 25.22 ? 288  GLN B CB    1 
ATOM   4605 C  CG    . GLN B 1 288 ? 59.267 15.787  49.331 1.00 30.88 ? 288  GLN B CG    1 
ATOM   4606 C  CD    . GLN B 1 288 ? 60.759 16.062  49.383 1.00 34.28 ? 288  GLN B CD    1 
ATOM   4607 O  OE1   . GLN B 1 288 ? 61.309 16.774  48.535 1.00 34.72 ? 288  GLN B OE1   1 
ATOM   4608 N  NE2   . GLN B 1 288 ? 61.429 15.484  50.375 1.00 39.36 ? 288  GLN B NE2   1 
ATOM   4609 N  N     . LEU B 1 289 ? 55.822 18.512  47.683 1.00 21.95 ? 289  LEU B N     1 
ATOM   4610 C  CA    . LEU B 1 289 ? 55.080 19.754  47.532 1.00 19.82 ? 289  LEU B CA    1 
ATOM   4611 C  C     . LEU B 1 289 ? 53.564 19.608  47.505 1.00 19.16 ? 289  LEU B C     1 
ATOM   4612 O  O     . LEU B 1 289 ? 52.859 20.590  47.292 1.00 19.72 ? 289  LEU B O     1 
ATOM   4613 C  CB    . LEU B 1 289 ? 55.554 20.511  46.285 1.00 20.79 ? 289  LEU B CB    1 
ATOM   4614 C  CG    . LEU B 1 289 ? 56.927 21.191  46.404 1.00 21.16 ? 289  LEU B CG    1 
ATOM   4615 C  CD1   . LEU B 1 289 ? 57.321 21.792  45.062 1.00 20.43 ? 289  LEU B CD1   1 
ATOM   4616 C  CD2   . LEU B 1 289 ? 56.878 22.271  47.484 1.00 17.93 ? 289  LEU B CD2   1 
ATOM   4617 N  N     . GLU B 1 290 ? 53.052 18.401  47.720 1.00 17.93 ? 290  GLU B N     1 
ATOM   4618 C  CA    . GLU B 1 290 ? 51.604 18.220  47.736 1.00 17.80 ? 290  GLU B CA    1 
ATOM   4619 C  C     . GLU B 1 290 ? 51.018 19.149  48.804 1.00 18.42 ? 290  GLU B C     1 
ATOM   4620 O  O     . GLU B 1 290 ? 51.543 19.243  49.914 1.00 19.12 ? 290  GLU B O     1 
ATOM   4621 C  CB    . GLU B 1 290 ? 51.246 16.769  48.064 1.00 18.41 ? 290  GLU B CB    1 
ATOM   4622 C  CG    . GLU B 1 290 ? 51.506 15.786  46.942 1.00 18.39 ? 290  GLU B CG    1 
ATOM   4623 C  CD    . GLU B 1 290 ? 50.506 15.911  45.812 1.00 19.08 ? 290  GLU B CD    1 
ATOM   4624 O  OE1   . GLU B 1 290 ? 50.648 15.178  44.812 1.00 22.04 ? 290  GLU B OE1   1 
ATOM   4625 O  OE2   . GLU B 1 290 ? 49.576 16.734  45.915 1.00 17.88 ? 290  GLU B OE2   1 
ATOM   4626 N  N     . LEU B 1 291 ? 49.935 19.839  48.470 1.00 18.90 ? 291  LEU B N     1 
ATOM   4627 C  CA    . LEU B 1 291 ? 49.312 20.760  49.416 1.00 20.47 ? 291  LEU B CA    1 
ATOM   4628 C  C     . LEU B 1 291 ? 49.017 20.134  50.778 1.00 20.70 ? 291  LEU B C     1 
ATOM   4629 O  O     . LEU B 1 291 ? 48.522 19.009  50.863 1.00 20.41 ? 291  LEU B O     1 
ATOM   4630 C  CB    . LEU B 1 291 ? 48.011 21.320  48.832 1.00 20.28 ? 291  LEU B CB    1 
ATOM   4631 C  CG    . LEU B 1 291 ? 48.136 22.113  47.531 1.00 19.89 ? 291  LEU B CG    1 
ATOM   4632 C  CD1   . LEU B 1 291 ? 46.757 22.546  47.065 1.00 18.83 ? 291  LEU B CD1   1 
ATOM   4633 C  CD2   . LEU B 1 291 ? 49.036 23.312  47.751 1.00 17.41 ? 291  LEU B CD2   1 
ATOM   4634 N  N     . ARG B 1 292 ? 49.337 20.868  51.840 1.00 21.50 ? 292  ARG B N     1 
ATOM   4635 C  CA    . ARG B 1 292 ? 49.073 20.400  53.194 1.00 22.92 ? 292  ARG B CA    1 
ATOM   4636 C  C     . ARG B 1 292 ? 47.650 20.842  53.527 1.00 22.07 ? 292  ARG B C     1 
ATOM   4637 O  O     . ARG B 1 292 ? 47.420 21.748  54.326 1.00 20.31 ? 292  ARG B O     1 
ATOM   4638 C  CB    . ARG B 1 292 ? 50.088 20.996  54.168 1.00 24.42 ? 292  ARG B CB    1 
ATOM   4639 C  CG    . ARG B 1 292 ? 51.499 20.459  53.979 1.00 26.60 ? 292  ARG B CG    1 
ATOM   4640 C  CD    . ARG B 1 292 ? 51.558 18.961  54.269 1.00 31.87 ? 292  ARG B CD    1 
ATOM   4641 N  NE    . ARG B 1 292 ? 52.922 18.429  54.243 1.00 38.06 ? 292  ARG B NE    1 
ATOM   4642 C  CZ    . ARG B 1 292 ? 53.684 18.333  53.151 1.00 41.92 ? 292  ARG B CZ    1 
ATOM   4643 N  NH1   . ARG B 1 292 ? 53.229 18.730  51.965 1.00 41.27 ? 292  ARG B NH1   1 
ATOM   4644 N  NH2   . ARG B 1 292 ? 54.919 17.847  53.244 1.00 44.46 ? 292  ARG B NH2   1 
ATOM   4645 N  N     . MET B 1 293 ? 46.707 20.173  52.871 1.00 22.77 ? 293  MET B N     1 
ATOM   4646 C  CA    . MET B 1 293 ? 45.274 20.416  52.982 1.00 23.18 ? 293  MET B CA    1 
ATOM   4647 C  C     . MET B 1 293 ? 44.697 20.159  54.373 1.00 22.86 ? 293  MET B C     1 
ATOM   4648 O  O     . MET B 1 293 ? 44.099 21.052  54.976 1.00 23.73 ? 293  MET B O     1 
ATOM   4649 C  CB    . MET B 1 293 ? 44.549 19.539  51.955 1.00 24.11 ? 293  MET B CB    1 
ATOM   4650 C  CG    . MET B 1 293 ? 43.105 19.918  51.664 1.00 27.58 ? 293  MET B CG    1 
ATOM   4651 S  SD    . MET B 1 293 ? 42.942 21.560  50.923 1.00 29.66 ? 293  MET B SD    1 
ATOM   4652 C  CE    . MET B 1 293 ? 43.849 21.333  49.371 1.00 30.05 ? 293  MET B CE    1 
ATOM   4653 N  N     . VAL B 1 294 ? 44.862 18.930  54.862 1.00 21.90 ? 294  VAL B N     1 
ATOM   4654 C  CA    . VAL B 1 294 ? 44.357 18.515  56.171 1.00 19.55 ? 294  VAL B CA    1 
ATOM   4655 C  C     . VAL B 1 294 ? 44.897 19.363  57.334 1.00 19.19 ? 294  VAL B C     1 
ATOM   4656 O  O     . VAL B 1 294 ? 44.157 19.730  58.251 1.00 18.54 ? 294  VAL B O     1 
ATOM   4657 C  CB    . VAL B 1 294 ? 44.691 17.018  56.411 1.00 18.71 ? 294  VAL B CB    1 
ATOM   4658 C  CG1   . VAL B 1 294 ? 44.432 16.638  57.848 1.00 17.52 ? 294  VAL B CG1   1 
ATOM   4659 C  CG2   . VAL B 1 294 ? 43.849 16.152  55.481 1.00 19.10 ? 294  VAL B CG2   1 
ATOM   4660 N  N     . GLN B 1 295 ? 46.184 19.680  57.286 1.00 17.70 ? 295  GLN B N     1 
ATOM   4661 C  CA    . GLN B 1 295 ? 46.819 20.463  58.333 1.00 18.07 ? 295  GLN B CA    1 
ATOM   4662 C  C     . GLN B 1 295 ? 46.502 21.952  58.247 1.00 18.84 ? 295  GLN B C     1 
ATOM   4663 O  O     . GLN B 1 295 ? 47.025 22.740  59.037 1.00 19.42 ? 295  GLN B O     1 
ATOM   4664 C  CB    . GLN B 1 295 ? 48.335 20.278  58.279 1.00 18.98 ? 295  GLN B CB    1 
ATOM   4665 C  CG    . GLN B 1 295 ? 48.795 18.828  58.313 1.00 23.44 ? 295  GLN B CG    1 
ATOM   4666 C  CD    . GLN B 1 295 ? 48.814 18.156  56.936 1.00 26.32 ? 295  GLN B CD    1 
ATOM   4667 O  OE1   . GLN B 1 295 ? 48.305 18.699  55.950 1.00 27.41 ? 295  GLN B OE1   1 
ATOM   4668 N  NE2   . GLN B 1 295 ? 49.402 16.962  56.870 1.00 26.29 ? 295  GLN B NE2   1 
ATOM   4669 N  N     . SER B 1 296 ? 45.661 22.341  57.291 1.00 17.88 ? 296  SER B N     1 
ATOM   4670 C  CA    . SER B 1 296 ? 45.299 23.748  57.112 1.00 15.78 ? 296  SER B CA    1 
ATOM   4671 C  C     . SER B 1 296 ? 43.818 23.975  57.373 1.00 16.37 ? 296  SER B C     1 
ATOM   4672 O  O     . SER B 1 296 ? 43.285 25.042  57.079 1.00 14.98 ? 296  SER B O     1 
ATOM   4673 C  CB    . SER B 1 296 ? 45.630 24.209  55.688 1.00 16.21 ? 296  SER B CB    1 
ATOM   4674 O  OG    . SER B 1 296 ? 47.016 24.115  55.413 1.00 13.27 ? 296  SER B OG    1 
ATOM   4675 N  N     . LYS B 1 297 ? 43.161 22.964  57.924 1.00 16.67 ? 297  LYS B N     1 
ATOM   4676 C  CA    . LYS B 1 297 ? 41.741 23.034  58.221 1.00 18.28 ? 297  LYS B CA    1 
ATOM   4677 C  C     . LYS B 1 297 ? 41.301 24.341  58.868 1.00 20.93 ? 297  LYS B C     1 
ATOM   4678 O  O     . LYS B 1 297 ? 40.359 24.980  58.402 1.00 21.53 ? 297  LYS B O     1 
ATOM   4679 C  CB    . LYS B 1 297 ? 41.328 21.871  59.126 1.00 18.12 ? 297  LYS B CB    1 
ATOM   4680 C  CG    . LYS B 1 297 ? 39.852 21.893  59.479 1.00 19.28 ? 297  LYS B CG    1 
ATOM   4681 C  CD    . LYS B 1 297 ? 39.463 20.752  60.400 1.00 23.60 ? 297  LYS B CD    1 
ATOM   4682 C  CE    . LYS B 1 297 ? 40.063 20.906  61.792 1.00 24.94 ? 297  LYS B CE    1 
ATOM   4683 N  NZ    . LYS B 1 297 ? 39.642 19.780  62.671 1.00 25.90 ? 297  LYS B NZ    1 
ATOM   4684 N  N     . LYS B 1 298 ? 41.966 24.725  59.954 1.00 23.13 ? 298  LYS B N     1 
ATOM   4685 C  CA    . LYS B 1 298 ? 41.627 25.950  60.673 1.00 23.92 ? 298  LYS B CA    1 
ATOM   4686 C  C     . LYS B 1 298 ? 41.724 27.187  59.774 1.00 22.78 ? 298  LYS B C     1 
ATOM   4687 O  O     . LYS B 1 298 ? 40.823 28.034  59.761 1.00 21.17 ? 298  LYS B O     1 
ATOM   4688 C  CB    . LYS B 1 298 ? 42.554 26.098  61.889 1.00 28.36 ? 298  LYS B CB    1 
ATOM   4689 C  CG    . LYS B 1 298 ? 41.873 25.867  63.232 1.00 32.42 ? 298  LYS B CG    1 
ATOM   4690 C  CD    . LYS B 1 298 ? 41.158 24.524  63.319 1.00 36.86 ? 298  LYS B CD    1 
ATOM   4691 C  CE    . LYS B 1 298 ? 39.985 24.612  64.313 1.00 40.95 ? 298  LYS B CE    1 
ATOM   4692 N  NZ    . LYS B 1 298 ? 39.305 23.308  64.643 1.00 43.58 ? 298  LYS B NZ    1 
ATOM   4693 N  N     . ASP B 1 299 ? 42.814 27.276  59.019 1.00 21.60 ? 299  ASP B N     1 
ATOM   4694 C  CA    . ASP B 1 299 ? 43.055 28.402  58.125 1.00 21.39 ? 299  ASP B CA    1 
ATOM   4695 C  C     . ASP B 1 299 ? 42.014 28.503  57.009 1.00 21.75 ? 299  ASP B C     1 
ATOM   4696 O  O     . ASP B 1 299 ? 41.661 29.597  56.585 1.00 23.15 ? 299  ASP B O     1 
ATOM   4697 C  CB    . ASP B 1 299 ? 44.467 28.292  57.543 1.00 21.68 ? 299  ASP B CB    1 
ATOM   4698 C  CG    . ASP B 1 299 ? 45.554 28.600  58.570 1.00 21.77 ? 299  ASP B CG    1 
ATOM   4699 O  OD1   . ASP B 1 299 ? 46.633 27.981  58.518 1.00 23.46 ? 299  ASP B OD1   1 
ATOM   4700 O  OD2   . ASP B 1 299 ? 45.341 29.476  59.426 1.00 23.80 ? 299  ASP B OD2   1 
ATOM   4701 N  N     . ILE B 1 300 ? 41.518 27.366  56.535 1.00 20.79 ? 300  ILE B N     1 
ATOM   4702 C  CA    . ILE B 1 300 ? 40.510 27.349  55.479 1.00 20.36 ? 300  ILE B CA    1 
ATOM   4703 C  C     . ILE B 1 300 ? 39.134 27.746  56.034 1.00 22.18 ? 300  ILE B C     1 
ATOM   4704 O  O     . ILE B 1 300 ? 38.339 28.402  55.361 1.00 21.39 ? 300  ILE B O     1 
ATOM   4705 C  CB    . ILE B 1 300 ? 40.431 25.940  54.828 1.00 18.21 ? 300  ILE B CB    1 
ATOM   4706 C  CG1   . ILE B 1 300 ? 41.716 25.662  54.054 1.00 15.46 ? 300  ILE B CG1   1 
ATOM   4707 C  CG2   . ILE B 1 300 ? 39.221 25.835  53.908 1.00 16.55 ? 300  ILE B CG2   1 
ATOM   4708 C  CD1   . ILE B 1 300 ? 41.835 24.242  53.596 1.00 16.16 ? 300  ILE B CD1   1 
ATOM   4709 N  N     . GLU B 1 301 ? 38.863 27.340  57.272 1.00 25.09 ? 301  GLU B N     1 
ATOM   4710 C  CA    . GLU B 1 301 ? 37.600 27.644  57.940 1.00 26.54 ? 301  GLU B CA    1 
ATOM   4711 C  C     . GLU B 1 301 ? 37.456 29.132  58.227 1.00 26.42 ? 301  GLU B C     1 
ATOM   4712 O  O     . GLU B 1 301 ? 36.405 29.722  57.983 1.00 25.52 ? 301  GLU B O     1 
ATOM   4713 C  CB    . GLU B 1 301 ? 37.499 26.874  59.263 1.00 28.49 ? 301  GLU B CB    1 
ATOM   4714 C  CG    . GLU B 1 301 ? 37.174 25.392  59.132 1.00 34.92 ? 301  GLU B CG    1 
ATOM   4715 C  CD    . GLU B 1 301 ? 37.265 24.643  60.460 1.00 38.60 ? 301  GLU B CD    1 
ATOM   4716 O  OE1   . GLU B 1 301 ? 36.806 23.478  60.531 1.00 41.21 ? 301  GLU B OE1   1 
ATOM   4717 O  OE2   . GLU B 1 301 ? 37.804 25.210  61.434 1.00 40.92 ? 301  GLU B OE2   1 
ATOM   4718 N  N     . SER B 1 302 ? 38.518 29.733  58.753 1.00 26.92 ? 302  SER B N     1 
ATOM   4719 C  CA    . SER B 1 302 ? 38.506 31.151  59.103 1.00 27.64 ? 302  SER B CA    1 
ATOM   4720 C  C     . SER B 1 302 ? 39.903 31.734  58.916 1.00 25.72 ? 302  SER B C     1 
ATOM   4721 O  O     . SER B 1 302 ? 40.698 31.794  59.854 1.00 27.83 ? 302  SER B O     1 
ATOM   4722 C  CB    . SER B 1 302 ? 38.060 31.318  60.560 1.00 28.09 ? 302  SER B CB    1 
ATOM   4723 O  OG    . SER B 1 302 ? 37.971 32.687  60.909 1.00 31.51 ? 302  SER B OG    1 
ATOM   4724 N  N     . PRO B 1 303 ? 40.209 32.190  57.701 1.00 22.86 ? 303  PRO B N     1 
ATOM   4725 C  CA    . PRO B 1 303 ? 41.523 32.760  57.399 1.00 21.81 ? 303  PRO B CA    1 
ATOM   4726 C  C     . PRO B 1 303 ? 41.806 34.155  57.934 1.00 20.58 ? 303  PRO B C     1 
ATOM   4727 O  O     . PRO B 1 303 ? 40.980 35.055  57.801 1.00 19.79 ? 303  PRO B O     1 
ATOM   4728 C  CB    . PRO B 1 303 ? 41.561 32.719  55.876 1.00 20.91 ? 303  PRO B CB    1 
ATOM   4729 C  CG    . PRO B 1 303 ? 40.128 33.027  55.522 1.00 21.91 ? 303  PRO B CG    1 
ATOM   4730 C  CD    . PRO B 1 303 ? 39.339 32.190  56.510 1.00 22.60 ? 303  PRO B CD    1 
ATOM   4731 N  N     . GLU B 1 304 ? 42.976 34.321  58.546 1.00 19.27 ? 304  GLU B N     1 
ATOM   4732 C  CA    . GLU B 1 304 ? 43.393 35.627  59.032 1.00 19.06 ? 304  GLU B CA    1 
ATOM   4733 C  C     . GLU B 1 304 ? 43.706 36.403  57.766 1.00 19.00 ? 304  GLU B C     1 
ATOM   4734 O  O     . GLU B 1 304 ? 44.538 35.972  56.968 1.00 20.10 ? 304  GLU B O     1 
ATOM   4735 C  CB    . GLU B 1 304 ? 44.671 35.530  59.867 1.00 22.01 ? 304  GLU B CB    1 
ATOM   4736 C  CG    . GLU B 1 304 ? 44.463 35.161  61.327 1.00 24.84 ? 304  GLU B CG    1 
ATOM   4737 C  CD    . GLU B 1 304 ? 43.510 36.105  62.028 1.00 25.94 ? 304  GLU B CD    1 
ATOM   4738 O  OE1   . GLU B 1 304 ? 43.722 37.332  61.969 1.00 27.94 ? 304  GLU B OE1   1 
ATOM   4739 O  OE2   . GLU B 1 304 ? 42.546 35.613  62.644 1.00 25.48 ? 304  GLU B OE2   1 
ATOM   4740 N  N     . ILE B 1 305 ? 43.050 37.539  57.573 1.00 16.67 ? 305  ILE B N     1 
ATOM   4741 C  CA    . ILE B 1 305 ? 43.292 38.338  56.378 1.00 16.15 ? 305  ILE B CA    1 
ATOM   4742 C  C     . ILE B 1 305 ? 44.727 38.860  56.338 1.00 17.11 ? 305  ILE B C     1 
ATOM   4743 O  O     . ILE B 1 305 ? 45.198 39.454  57.308 1.00 17.83 ? 305  ILE B O     1 
ATOM   4744 C  CB    . ILE B 1 305 ? 42.325 39.536  56.305 1.00 15.03 ? 305  ILE B CB    1 
ATOM   4745 C  CG1   . ILE B 1 305 ? 40.876 39.053  56.428 1.00 12.78 ? 305  ILE B CG1   1 
ATOM   4746 C  CG2   . ILE B 1 305 ? 42.537 40.294  55.013 1.00 14.31 ? 305  ILE B CG2   1 
ATOM   4747 C  CD1   . ILE B 1 305 ? 40.491 37.981  55.443 1.00 13.93 ? 305  ILE B CD1   1 
ATOM   4748 N  N     . VAL B 1 306 ? 45.411 38.646  55.214 1.00 17.24 ? 306  VAL B N     1 
ATOM   4749 C  CA    . VAL B 1 306 ? 46.791 39.095  55.069 1.00 18.93 ? 306  VAL B CA    1 
ATOM   4750 C  C     . VAL B 1 306 ? 47.042 39.922  53.805 1.00 21.86 ? 306  VAL B C     1 
ATOM   4751 O  O     . VAL B 1 306 ? 48.170 40.375  53.566 1.00 22.25 ? 306  VAL B O     1 
ATOM   4752 C  CB    . VAL B 1 306 ? 47.768 37.897  55.093 1.00 18.09 ? 306  VAL B CB    1 
ATOM   4753 C  CG1   . VAL B 1 306 ? 47.713 37.218  56.451 1.00 13.55 ? 306  VAL B CG1   1 
ATOM   4754 C  CG2   . VAL B 1 306 ? 47.422 36.913  53.974 1.00 17.38 ? 306  VAL B CG2   1 
ATOM   4755 N  N     . VAL B 1 307 ? 46.002 40.098  52.991 1.00 22.84 ? 307  VAL B N     1 
ATOM   4756 C  CA    . VAL B 1 307 ? 46.104 40.906  51.769 1.00 23.81 ? 307  VAL B CA    1 
ATOM   4757 C  C     . VAL B 1 307 ? 44.898 41.821  51.719 1.00 25.29 ? 307  VAL B C     1 
ATOM   4758 O  O     . VAL B 1 307 ? 43.821 41.480  52.206 1.00 24.79 ? 307  VAL B O     1 
ATOM   4759 C  CB    . VAL B 1 307 ? 46.090 40.069  50.454 1.00 22.18 ? 307  VAL B CB    1 
ATOM   4760 C  CG1   . VAL B 1 307 ? 47.261 39.109  50.409 1.00 21.86 ? 307  VAL B CG1   1 
ATOM   4761 C  CG2   . VAL B 1 307 ? 44.783 39.327  50.337 1.00 24.30 ? 307  VAL B CG2   1 
ATOM   4762 N  N     . GLN B 1 308 ? 45.081 42.995  51.136 1.00 27.71 ? 308  GLN B N     1 
ATOM   4763 C  CA    . GLN B 1 308 ? 43.988 43.934  51.014 1.00 29.72 ? 308  GLN B CA    1 
ATOM   4764 C  C     . GLN B 1 308 ? 43.776 44.187  49.535 1.00 30.38 ? 308  GLN B C     1 
ATOM   4765 O  O     . GLN B 1 308 ? 44.718 44.466  48.792 1.00 30.12 ? 308  GLN B O     1 
ATOM   4766 C  CB    . GLN B 1 308 ? 44.315 45.242  51.731 1.00 31.20 ? 308  GLN B CB    1 
ATOM   4767 C  CG    . GLN B 1 308 ? 43.155 46.221  51.775 1.00 33.28 ? 308  GLN B CG    1 
ATOM   4768 C  CD    . GLN B 1 308 ? 43.557 47.576  52.320 1.00 35.79 ? 308  GLN B CD    1 
ATOM   4769 O  OE1   . GLN B 1 308 ? 42.704 48.413  52.624 1.00 36.68 ? 308  GLN B OE1   1 
ATOM   4770 N  NE2   . GLN B 1 308 ? 44.864 47.804  52.440 1.00 35.92 ? 308  GLN B NE2   1 
ATOM   4771 N  N     . ALA B 1 309 ? 42.529 44.059  49.106 1.00 31.54 ? 309  ALA B N     1 
ATOM   4772 C  CA    . ALA B 1 309 ? 42.189 44.288  47.717 1.00 32.62 ? 309  ALA B CA    1 
ATOM   4773 C  C     . ALA B 1 309 ? 42.030 45.784  47.479 1.00 32.79 ? 309  ALA B C     1 
ATOM   4774 O  O     . ALA B 1 309 ? 41.426 46.498  48.282 1.00 34.03 ? 309  ALA B O     1 
ATOM   4775 C  CB    . ALA B 1 309 ? 40.900 43.554  47.369 1.00 32.01 ? 309  ALA B CB    1 
ATOM   4776 N  N     . THR B 1 310 ? 42.599 46.247  46.378 1.00 33.02 ? 310  THR B N     1 
ATOM   4777 C  CA    . THR B 1 310 ? 42.525 47.647  45.990 1.00 33.46 ? 310  THR B CA    1 
ATOM   4778 C  C     . THR B 1 310 ? 41.324 47.813  45.064 1.00 33.70 ? 310  THR B C     1 
ATOM   4779 O  O     . THR B 1 310 ? 41.222 47.108  44.064 1.00 32.46 ? 310  THR B O     1 
ATOM   4780 C  CB    . THR B 1 310 ? 43.765 48.063  45.204 1.00 34.39 ? 310  THR B CB    1 
ATOM   4781 O  OG1   . THR B 1 310 ? 44.945 47.794  45.978 1.00 35.72 ? 310  THR B OG1   1 
ATOM   4782 C  CG2   . THR B 1 310 ? 43.689 49.530  44.860 1.00 35.05 ? 310  THR B CG2   1 
ATOM   4783 N  N     . VAL B 1 311 ? 40.408 48.721  45.387 1.00 34.01 ? 311  VAL B N     1 
ATOM   4784 C  CA    . VAL B 1 311 ? 39.258 48.923  44.518 1.00 33.16 ? 311  VAL B CA    1 
ATOM   4785 C  C     . VAL B 1 311 ? 39.682 49.841  43.386 1.00 34.29 ? 311  VAL B C     1 
ATOM   4786 O  O     . VAL B 1 311 ? 40.248 50.905  43.623 1.00 32.93 ? 311  VAL B O     1 
ATOM   4787 C  CB    . VAL B 1 311 ? 38.090 49.554  45.254 1.00 32.14 ? 311  VAL B CB    1 
ATOM   4788 C  CG1   . VAL B 1 311 ? 36.904 49.635  44.329 1.00 31.74 ? 311  VAL B CG1   1 
ATOM   4789 C  CG2   . VAL B 1 311 ? 37.753 48.730  46.474 1.00 33.42 ? 311  VAL B CG2   1 
ATOM   4790 N  N     . LEU B 1 312 ? 39.412 49.407  42.158 1.00 35.44 ? 312  LEU B N     1 
ATOM   4791 C  CA    . LEU B 1 312 ? 39.773 50.141  40.951 1.00 36.14 ? 312  LEU B CA    1 
ATOM   4792 C  C     . LEU B 1 312 ? 38.686 51.051  40.387 1.00 37.41 ? 312  LEU B C     1 
ATOM   4793 O  O     . LEU B 1 312 ? 37.575 51.084  40.952 1.00 38.74 ? 312  LEU B O     1 
ATOM   4794 C  CB    . LEU B 1 312 ? 40.208 49.148  39.881 1.00 35.69 ? 312  LEU B CB    1 
ATOM   4795 C  CG    . LEU B 1 312 ? 41.712 48.898  39.798 1.00 36.31 ? 312  LEU B CG    1 
ATOM   4796 C  CD1   . LEU B 1 312 ? 42.302 48.779  41.183 1.00 37.51 ? 312  LEU B CD1   1 
ATOM   4797 C  CD2   . LEU B 1 312 ? 41.973 47.648  38.991 1.00 36.31 ? 312  LEU B CD2   1 
ATOM   4798 O  OXT   . LEU B 1 312 ? 38.968 51.729  39.376 1.00 38.41 ? 312  LEU B OXT   1 
HETATM 4799 ZN ZN    . ZN  C 2 .   ? 29.132 -3.966  58.567 1.00 55.50 ? 402  ZN  A ZN    1 
HETATM 4800 P  PB    . ADP D 3 .   ? 27.086 -3.885  61.088 1.00 58.08 ? 401  ADP A PB    1 
HETATM 4801 O  O1B   . ADP D 3 .   ? 26.883 -4.473  62.473 1.00 54.17 ? 401  ADP A O1B   1 
HETATM 4802 O  O2B   . ADP D 3 .   ? 28.567 -4.116  60.508 1.00 54.05 ? 401  ADP A O2B   1 
HETATM 4803 O  O3B   . ADP D 3 .   ? 26.029 -4.386  60.144 1.00 51.18 ? 401  ADP A O3B   1 
HETATM 4804 P  PA    . ADP D 3 .   ? 25.881 -1.364  61.210 1.00 55.18 ? 401  ADP A PA    1 
HETATM 4805 O  O1A   . ADP D 3 .   ? 24.883 -1.975  61.947 1.00 50.63 ? 401  ADP A O1A   1 
HETATM 4806 O  O2A   . ADP D 3 .   ? 25.146 -0.836  59.950 1.00 52.81 ? 401  ADP A O2A   1 
HETATM 4807 O  O3A   . ADP D 3 .   ? 27.003 -2.355  60.989 1.00 52.67 ? 401  ADP A O3A   1 
HETATM 4808 O  "O5'" . ADP D 3 .   ? 26.805 -0.410  62.103 1.00 48.75 ? 401  ADP A "O5'" 1 
HETATM 4809 C  "C5'" . ADP D 3 .   ? 26.557 -0.341  63.378 1.00 39.21 ? 401  ADP A "C5'" 1 
HETATM 4810 C  "C4'" . ADP D 3 .   ? 27.204 0.789   64.043 1.00 38.31 ? 401  ADP A "C4'" 1 
HETATM 4811 O  "O4'" . ADP D 3 .   ? 26.261 1.740   63.672 1.00 37.29 ? 401  ADP A "O4'" 1 
HETATM 4812 C  "C3'" . ADP D 3 .   ? 27.085 0.587   65.581 1.00 38.06 ? 401  ADP A "C3'" 1 
HETATM 4813 O  "O3'" . ADP D 3 .   ? 28.169 1.266   66.307 1.00 40.28 ? 401  ADP A "O3'" 1 
HETATM 4814 C  "C2'" . ADP D 3 .   ? 25.737 1.182   65.917 1.00 37.17 ? 401  ADP A "C2'" 1 
HETATM 4815 O  "O2'" . ADP D 3 .   ? 25.703 1.788   67.200 1.00 40.11 ? 401  ADP A "O2'" 1 
HETATM 4816 C  "C1'" . ADP D 3 .   ? 25.426 2.121   64.753 1.00 34.48 ? 401  ADP A "C1'" 1 
HETATM 4817 N  N9    . ADP D 3 .   ? 23.975 2.007   64.328 1.00 31.84 ? 401  ADP A N9    1 
HETATM 4818 C  C8    . ADP D 3 .   ? 23.524 1.505   63.134 1.00 28.95 ? 401  ADP A C8    1 
HETATM 4819 N  N7    . ADP D 3 .   ? 22.187 1.569   63.103 1.00 30.76 ? 401  ADP A N7    1 
HETATM 4820 C  C5    . ADP D 3 .   ? 21.764 2.104   64.233 1.00 29.89 ? 401  ADP A C5    1 
HETATM 4821 C  C6    . ADP D 3 .   ? 20.514 2.419   64.783 1.00 28.41 ? 401  ADP A C6    1 
HETATM 4822 N  N6    . ADP D 3 .   ? 19.391 2.206   64.067 1.00 23.59 ? 401  ADP A N6    1 
HETATM 4823 N  N1    . ADP D 3 .   ? 20.437 2.983   66.046 1.00 30.09 ? 401  ADP A N1    1 
HETATM 4824 C  C2    . ADP D 3 .   ? 21.552 3.220   66.795 1.00 30.28 ? 401  ADP A C2    1 
HETATM 4825 N  N3    . ADP D 3 .   ? 22.761 2.921   66.266 1.00 28.92 ? 401  ADP A N3    1 
HETATM 4826 C  C4    . ADP D 3 .   ? 22.915 2.360   65.035 1.00 30.04 ? 401  ADP A C4    1 
HETATM 4827 ZN ZN    . ZN  E 2 .   ? 44.159 27.349  36.222 1.00 40.84 ? 1402 ZN  B ZN    1 
HETATM 4828 P  PB    . ADP F 3 .   ? 46.455 29.737  37.317 1.00 44.43 ? 1401 ADP B PB    1 
HETATM 4829 O  O1B   . ADP F 3 .   ? 46.376 31.246  37.281 1.00 47.15 ? 1401 ADP B O1B   1 
HETATM 4830 O  O2B   . ADP F 3 .   ? 45.095 29.031  36.854 1.00 42.74 ? 1401 ADP B O2B   1 
HETATM 4831 O  O3B   . ADP F 3 .   ? 47.645 29.255  36.544 1.00 42.76 ? 1401 ADP B O3B   1 
HETATM 4832 P  PA    . ADP F 3 .   ? 47.723 29.037  39.707 1.00 40.06 ? 1401 ADP B PA    1 
HETATM 4833 O  O1A   . ADP F 3 .   ? 48.596 30.085  39.483 1.00 41.50 ? 1401 ADP B O1A   1 
HETATM 4834 O  O2A   . ADP F 3 .   ? 48.674 27.835  39.691 1.00 39.38 ? 1401 ADP B O2A   1 
HETATM 4835 O  O3A   . ADP F 3 .   ? 46.614 29.100  38.688 1.00 41.82 ? 1401 ADP B O3A   1 
HETATM 4836 O  "O5'" . ADP F 3 .   ? 46.735 29.344  40.934 1.00 39.43 ? 1401 ADP B "O5'" 1 
HETATM 4837 C  "C5'" . ADP F 3 .   ? 46.807 30.544  41.435 1.00 32.67 ? 1401 ADP B "C5'" 1 
HETATM 4838 C  "C4'" . ADP F 3 .   ? 46.238 30.736  42.788 1.00 32.27 ? 1401 ADP B "C4'" 1 
HETATM 4839 O  "O4'" . ADP F 3 .   ? 47.236 30.081  43.507 1.00 30.09 ? 1401 ADP B "O4'" 1 
HETATM 4840 C  "C3'" . ADP F 3 .   ? 46.364 32.248  43.095 1.00 29.62 ? 1401 ADP B "C3'" 1 
HETATM 4841 O  "O3'" . ADP F 3 .   ? 45.361 32.722  44.026 1.00 32.77 ? 1401 ADP B "O3'" 1 
HETATM 4842 C  "C2'" . ADP F 3 .   ? 47.740 32.381  43.660 1.00 27.69 ? 1401 ADP B "C2'" 1 
HETATM 4843 O  "O2'" . ADP F 3 .   ? 47.810 33.379  44.643 1.00 30.67 ? 1401 ADP B "O2'" 1 
HETATM 4844 C  "C1'" . ADP F 3 .   ? 48.103 30.981  44.154 1.00 26.35 ? 1401 ADP B "C1'" 1 
HETATM 4845 N  N9    . ADP F 3 .   ? 49.542 30.628  43.813 1.00 23.35 ? 1401 ADP B N9    1 
HETATM 4846 C  C8    . ADP F 3 .   ? 49.946 29.661  42.944 1.00 20.29 ? 1401 ADP B C8    1 
HETATM 4847 N  N7    . ADP F 3 .   ? 51.280 29.626  42.911 1.00 19.81 ? 1401 ADP B N7    1 
HETATM 4848 C  C5    . ADP F 3 .   ? 51.745 30.530  43.736 1.00 20.80 ? 1401 ADP B C5    1 
HETATM 4849 C  C6    . ADP F 3 .   ? 53.008 30.954  44.135 1.00 20.32 ? 1401 ADP B C6    1 
HETATM 4850 N  N6    . ADP F 3 .   ? 54.105 30.367  43.636 1.00 22.19 ? 1401 ADP B N6    1 
HETATM 4851 N  N1    . ADP F 3 .   ? 53.137 31.963  45.050 1.00 22.04 ? 1401 ADP B N1    1 
HETATM 4852 C  C2    . ADP F 3 .   ? 52.056 32.582  45.588 1.00 23.04 ? 1401 ADP B C2    1 
HETATM 4853 N  N3    . ADP F 3 .   ? 50.831 32.177  45.213 1.00 20.68 ? 1401 ADP B N3    1 
HETATM 4854 C  C4    . ADP F 3 .   ? 50.628 31.179  44.319 1.00 21.85 ? 1401 ADP B C4    1 
HETATM 4855 O  O     . HOH G 4 .   ? 33.325 -0.291  52.128 1.00 13.52 ? 403  HOH A O     1 
HETATM 4856 O  O     . HOH G 4 .   ? 30.799 -3.742  61.357 1.00 40.17 ? 404  HOH A O     1 
HETATM 4857 O  O     . HOH G 4 .   ? 30.142 16.174  50.864 1.00 21.30 ? 405  HOH A O     1 
HETATM 4858 O  O     . HOH G 4 .   ? 24.172 7.317   48.385 1.00 14.18 ? 406  HOH A O     1 
HETATM 4859 O  O     . HOH G 4 .   ? 34.006 12.986  47.939 1.00 13.66 ? 407  HOH A O     1 
HETATM 4860 O  O     . HOH G 4 .   ? 22.070 14.865  45.130 1.00 39.22 ? 408  HOH A O     1 
HETATM 4861 O  O     . HOH G 4 .   ? 21.770 6.537   55.220 1.00 15.34 ? 409  HOH A O     1 
HETATM 4862 O  O     . HOH G 4 .   ? 29.910 1.311   33.739 1.00 32.16 ? 410  HOH A O     1 
HETATM 4863 O  O     . HOH G 4 .   ? 24.161 7.824   54.317 1.00 11.25 ? 411  HOH A O     1 
HETATM 4864 O  O     . HOH G 4 .   ? 34.850 10.969  66.401 1.00 16.22 ? 412  HOH A O     1 
HETATM 4865 O  O     . HOH G 4 .   ? 18.553 4.158   54.415 1.00 30.56 ? 413  HOH A O     1 
HETATM 4866 O  O     . HOH G 4 .   ? 37.423 -5.515  54.026 1.00 15.25 ? 414  HOH A O     1 
HETATM 4867 O  O     . HOH G 4 .   ? 27.217 13.776  77.925 1.00 36.17 ? 415  HOH A O     1 
HETATM 4868 O  O     . HOH G 4 .   ? 21.166 -3.384  48.634 1.00 39.23 ? 416  HOH A O     1 
HETATM 4869 O  O     . HOH G 4 .   ? 33.220 -7.871  51.458 1.00 27.52 ? 417  HOH A O     1 
HETATM 4870 O  O     . HOH G 4 .   ? 17.019 8.158   68.859 1.00 17.12 ? 418  HOH A O     1 
HETATM 4871 O  O     . HOH G 4 .   ? 35.825 2.726   56.834 1.00 21.68 ? 419  HOH A O     1 
HETATM 4872 O  O     . HOH G 4 .   ? 50.988 2.212   62.282 1.00 24.69 ? 420  HOH A O     1 
HETATM 4873 O  O     . HOH G 4 .   ? 34.367 -0.204  56.501 1.00 22.25 ? 421  HOH A O     1 
HETATM 4874 O  O     . HOH G 4 .   ? 18.781 15.490  49.571 1.00 33.73 ? 422  HOH A O     1 
HETATM 4875 O  O     . HOH G 4 .   ? 32.412 -1.151  61.265 1.00 21.95 ? 423  HOH A O     1 
HETATM 4876 O  O     . HOH G 4 .   ? 34.067 12.056  53.031 1.00 35.49 ? 424  HOH A O     1 
HETATM 4877 O  O     . HOH G 4 .   ? 19.994 6.451   53.139 1.00 23.28 ? 425  HOH A O     1 
HETATM 4878 O  O     . HOH G 4 .   ? 31.734 -4.867  43.404 1.00 38.60 ? 426  HOH A O     1 
HETATM 4879 O  O     . HOH G 4 .   ? 53.447 3.178   60.892 1.00 33.56 ? 427  HOH A O     1 
HETATM 4880 O  O     . HOH G 4 .   ? 35.386 12.226  50.339 1.00 35.72 ? 428  HOH A O     1 
HETATM 4881 O  O     . HOH G 4 .   ? 38.118 -12.164 74.330 1.00 38.62 ? 429  HOH A O     1 
HETATM 4882 O  O     . HOH G 4 .   ? 37.003 10.081  49.182 1.00 31.30 ? 430  HOH A O     1 
HETATM 4883 O  O     . HOH G 4 .   ? 26.622 -3.512  39.913 1.00 34.40 ? 431  HOH A O     1 
HETATM 4884 O  O     . HOH G 4 .   ? 29.739 16.525  70.499 1.00 42.81 ? 432  HOH A O     1 
HETATM 4885 O  O     . HOH G 4 .   ? 50.215 -2.591  36.140 1.00 29.95 ? 433  HOH A O     1 
HETATM 4886 O  O     . HOH G 4 .   ? 24.618 3.751   68.311 1.00 41.27 ? 434  HOH A O     1 
HETATM 4887 O  O     . HOH G 4 .   ? 47.119 12.177  50.283 1.00 35.22 ? 435  HOH A O     1 
HETATM 4888 O  O     . HOH G 4 .   ? 30.010 -5.592  41.474 1.00 36.01 ? 436  HOH A O     1 
HETATM 4889 O  O     . HOH G 4 .   ? 33.780 -13.150 43.762 1.00 52.35 ? 437  HOH A O     1 
HETATM 4890 O  O     . HOH G 4 .   ? 14.792 7.518   67.544 1.00 59.97 ? 438  HOH A O     1 
HETATM 4891 O  O     . HOH G 4 .   ? 45.773 -4.095  67.074 1.00 31.72 ? 439  HOH A O     1 
HETATM 4892 O  O     . HOH G 4 .   ? 13.981 -1.527  69.849 1.00 50.23 ? 440  HOH A O     1 
HETATM 4893 O  O     . HOH G 4 .   ? 27.825 0.458   56.322 1.00 43.95 ? 441  HOH A O     1 
HETATM 4894 O  O     . HOH G 4 .   ? 52.719 -10.565 48.951 1.00 47.05 ? 442  HOH A O     1 
HETATM 4895 O  O     . HOH G 4 .   ? 26.562 -9.643  44.222 1.00 23.20 ? 443  HOH A O     1 
HETATM 4896 O  O     . HOH G 4 .   ? 36.700 -1.950  50.870 1.00 42.80 ? 444  HOH A O     1 
HETATM 4897 O  O     . HOH G 4 .   ? 43.669 -17.393 47.484 1.00 45.05 ? 445  HOH A O     1 
HETATM 4898 O  O     . HOH G 4 .   ? 58.486 -5.678  49.774 1.00 37.10 ? 446  HOH A O     1 
HETATM 4899 O  O     . HOH G 4 .   ? 23.382 14.604  53.758 1.00 30.46 ? 447  HOH A O     1 
HETATM 4900 O  O     . HOH G 4 .   ? 16.637 -0.675  47.050 1.00 40.67 ? 448  HOH A O     1 
HETATM 4901 O  O     . HOH G 4 .   ? 25.181 -0.106  55.135 1.00 36.60 ? 449  HOH A O     1 
HETATM 4902 O  O     . HOH G 4 .   ? 35.766 13.608  73.022 1.00 42.80 ? 450  HOH A O     1 
HETATM 4903 O  O     . HOH G 4 .   ? 29.405 0.100   51.940 1.00 47.92 ? 451  HOH A O     1 
HETATM 4904 O  O     . HOH G 4 .   ? 30.305 -12.518 81.027 1.00 41.37 ? 452  HOH A O     1 
HETATM 4905 O  O     . HOH G 4 .   ? 20.314 5.183   79.083 1.00 48.43 ? 453  HOH A O     1 
HETATM 4906 O  O     . HOH G 4 .   ? 21.166 17.071  66.984 1.00 33.00 ? 454  HOH A O     1 
HETATM 4907 O  O     . HOH G 4 .   ? 8.926  13.723  51.713 1.00 43.08 ? 455  HOH A O     1 
HETATM 4908 O  O     . HOH G 4 .   ? 22.980 -2.789  81.333 1.00 40.78 ? 456  HOH A O     1 
HETATM 4909 O  O     . HOH G 4 .   ? 11.784 7.146   64.960 1.00 45.61 ? 457  HOH A O     1 
HETATM 4910 O  O     . HOH G 4 .   ? 15.411 -1.043  49.742 1.00 40.58 ? 458  HOH A O     1 
HETATM 4911 O  O     . HOH G 4 .   ? 47.877 -10.073 61.775 1.00 44.20 ? 459  HOH A O     1 
HETATM 4912 O  O     . HOH G 4 .   ? 46.527 -12.730 70.164 1.00 59.78 ? 460  HOH A O     1 
HETATM 4913 O  O     . HOH G 4 .   ? 35.413 8.784   47.506 1.00 46.27 ? 461  HOH A O     1 
HETATM 4914 O  O     . HOH G 4 .   ? 22.227 5.666   74.055 1.00 44.48 ? 462  HOH A O     1 
HETATM 4915 O  O     . HOH G 4 .   ? 31.715 -5.264  85.792 1.00 37.15 ? 463  HOH A O     1 
HETATM 4916 O  O     . HOH G 4 .   ? 45.258 2.048   65.568 1.00 33.64 ? 464  HOH A O     1 
HETATM 4917 O  O     . HOH G 4 .   ? 31.868 -0.864  34.796 1.00 37.95 ? 465  HOH A O     1 
HETATM 4918 O  O     . HOH G 4 .   ? 36.753 14.852  51.524 1.00 38.06 ? 466  HOH A O     1 
HETATM 4919 O  O     . HOH G 4 .   ? 30.953 -11.969 40.266 1.00 36.27 ? 467  HOH A O     1 
HETATM 4920 O  O     . HOH G 4 .   ? 22.417 20.335  62.758 1.00 48.60 ? 468  HOH A O     1 
HETATM 4921 O  O     . HOH G 4 .   ? 42.708 1.332   71.700 1.00 42.02 ? 469  HOH A O     1 
HETATM 4922 O  O     . HOH G 4 .   ? 17.288 -11.416 51.753 1.00 35.54 ? 470  HOH A O     1 
HETATM 4923 O  O     . HOH H 4 .   ? 42.552 29.906  37.242 1.00 8.90  ? 1403 HOH B O     1 
HETATM 4924 O  O     . HOH H 4 .   ? 47.045 17.389  53.837 1.00 22.44 ? 1404 HOH B O     1 
HETATM 4925 O  O     . HOH H 4 .   ? 30.568 43.881  43.837 1.00 16.09 ? 1405 HOH B O     1 
HETATM 4926 O  O     . HOH H 4 .   ? 39.376 11.713  48.425 1.00 17.34 ? 1406 HOH B O     1 
HETATM 4927 O  O     . HOH H 4 .   ? 26.465 16.211  55.213 1.00 23.08 ? 1407 HOH B O     1 
HETATM 4928 O  O     . HOH H 4 .   ? 48.896 13.766  43.249 1.00 19.31 ? 1408 HOH B O     1 
HETATM 4929 O  O     . HOH H 4 .   ? 35.813 23.557  33.421 1.00 12.63 ? 1409 HOH B O     1 
HETATM 4930 O  O     . HOH H 4 .   ? 43.183 13.564  52.674 1.00 24.91 ? 1410 HOH B O     1 
HETATM 4931 O  O     . HOH H 4 .   ? 22.728 29.244  44.310 1.00 18.99 ? 1411 HOH B O     1 
HETATM 4932 O  O     . HOH H 4 .   ? 40.237 20.667  37.997 1.00 10.82 ? 1412 HOH B O     1 
HETATM 4933 O  O     . HOH H 4 .   ? 39.123 24.091  39.034 1.00 20.95 ? 1413 HOH B O     1 
HETATM 4934 O  O     . HOH H 4 .   ? 52.561 27.718  41.179 1.00 26.75 ? 1414 HOH B O     1 
HETATM 4935 O  O     . HOH H 4 .   ? 26.502 14.154  49.151 1.00 41.74 ? 1415 HOH B O     1 
HETATM 4936 O  O     . HOH H 4 .   ? 37.464 12.733  44.783 1.00 32.33 ? 1416 HOH B O     1 
HETATM 4937 O  O     . HOH H 4 .   ? 45.166 28.087  62.570 1.00 30.13 ? 1417 HOH B O     1 
HETATM 4938 O  O     . HOH H 4 .   ? 28.618 32.337  44.862 1.00 34.53 ? 1418 HOH B O     1 
HETATM 4939 O  O     . HOH H 4 .   ? 49.646 16.679  51.773 1.00 34.90 ? 1419 HOH B O     1 
HETATM 4940 O  O     . HOH H 4 .   ? 52.911 28.012  58.864 1.00 19.39 ? 1420 HOH B O     1 
HETATM 4941 O  O     . HOH H 4 .   ? 47.067 25.563  39.143 1.00 35.94 ? 1421 HOH B O     1 
HETATM 4942 O  O     . HOH H 4 .   ? 39.553 22.180  30.412 1.00 25.71 ? 1422 HOH B O     1 
HETATM 4943 O  O     . HOH H 4 .   ? 36.117 14.202  46.617 1.00 25.41 ? 1423 HOH B O     1 
HETATM 4944 O  O     . HOH H 4 .   ? 31.929 5.399   36.673 1.00 33.58 ? 1424 HOH B O     1 
HETATM 4945 O  O     . HOH H 4 .   ? 24.881 36.452  33.318 1.00 40.06 ? 1425 HOH B O     1 
HETATM 4946 O  O     . HOH H 4 .   ? 48.973 19.659  45.366 1.00 40.78 ? 1426 HOH B O     1 
HETATM 4947 O  O     . HOH H 4 .   ? 39.025 29.317  52.908 1.00 30.61 ? 1427 HOH B O     1 
HETATM 4948 O  O     . HOH H 4 .   ? 51.087 38.047  50.317 1.00 40.21 ? 1428 HOH B O     1 
HETATM 4949 O  O     . HOH H 4 .   ? 39.691 17.998  36.200 1.00 25.70 ? 1429 HOH B O     1 
HETATM 4950 O  O     . HOH H 4 .   ? 20.103 27.738  44.600 1.00 35.61 ? 1430 HOH B O     1 
HETATM 4951 O  O     . HOH H 4 .   ? 38.201 14.456  48.748 1.00 37.85 ? 1431 HOH B O     1 
HETATM 4952 O  O     . HOH H 4 .   ? 27.653 40.095  32.639 1.00 32.12 ? 1432 HOH B O     1 
HETATM 4953 O  O     . HOH H 4 .   ? 50.494 29.149  57.539 1.00 40.16 ? 1433 HOH B O     1 
HETATM 4954 O  O     . HOH H 4 .   ? 53.441 42.269  52.173 1.00 39.53 ? 1434 HOH B O     1 
HETATM 4955 O  O     . HOH H 4 .   ? 47.032 50.839  28.336 1.00 42.19 ? 1435 HOH B O     1 
HETATM 4956 O  O     . HOH H 4 .   ? 51.632 20.931  44.807 1.00 33.67 ? 1436 HOH B O     1 
HETATM 4957 O  O     . HOH H 4 .   ? 61.296 39.403  48.110 1.00 50.54 ? 1437 HOH B O     1 
HETATM 4958 O  O     . HOH H 4 .   ? 44.922 36.419  19.994 1.00 44.90 ? 1438 HOH B O     1 
HETATM 4959 O  O     . HOH H 4 .   ? 31.657 8.307   24.877 1.00 33.92 ? 1439 HOH B O     1 
HETATM 4960 O  O     . HOH H 4 .   ? 51.487 31.156  39.535 1.00 58.82 ? 1440 HOH B O     1 
HETATM 4961 O  O     . HOH H 4 .   ? 25.889 27.564  26.139 1.00 43.86 ? 1441 HOH B O     1 
HETATM 4962 O  O     . HOH H 4 .   ? 41.575 28.954  39.889 1.00 35.18 ? 1442 HOH B O     1 
HETATM 4963 O  O     . HOH H 4 .   ? 50.052 38.313  25.709 1.00 62.23 ? 1443 HOH B O     1 
HETATM 4964 O  O     . HOH H 4 .   ? 42.198 18.579  60.021 1.00 37.24 ? 1444 HOH B O     1 
HETATM 4965 O  O     . HOH H 4 .   ? 54.973 20.603  42.080 1.00 50.76 ? 1445 HOH B O     1 
HETATM 4966 O  O     . HOH H 4 .   ? 36.145 44.649  34.586 1.00 41.50 ? 1446 HOH B O     1 
HETATM 4967 O  O     . HOH H 4 .   ? 53.187 18.844  43.875 1.00 38.03 ? 1447 HOH B O     1 
HETATM 4968 O  O     . HOH H 4 .   ? 43.719 11.545  29.400 1.00 34.52 ? 1448 HOH B O     1 
HETATM 4969 O  O     . HOH H 4 .   ? 28.441 4.627   26.159 1.00 51.58 ? 1449 HOH B O     1 
HETATM 4970 O  O     . HOH H 4 .   ? 45.262 23.657  39.423 1.00 42.35 ? 1450 HOH B O     1 
HETATM 4971 O  O     . HOH H 4 .   ? 52.916 45.156  33.036 1.00 32.23 ? 1451 HOH B O     1 
HETATM 4972 O  O     . HOH H 4 .   ? 46.675 43.976  46.928 1.00 50.22 ? 1452 HOH B O     1 
HETATM 4973 O  O     . HOH H 4 .   ? 40.116 49.448  49.757 1.00 52.35 ? 1453 HOH B O     1 
HETATM 4974 O  O     . HOH H 4 .   ? 42.099 26.573  18.861 1.00 45.86 ? 1454 HOH B O     1 
HETATM 4975 O  O     . HOH H 4 .   ? 43.541 18.205  37.368 1.00 43.05 ? 1455 HOH B O     1 
HETATM 4976 O  O     . HOH H 4 .   ? 28.132 40.193  52.749 1.00 39.30 ? 1456 HOH B O     1 
HETATM 4977 O  O     . HOH H 4 .   ? 22.901 51.206  29.583 1.00 45.76 ? 1457 HOH B O     1 
HETATM 4978 O  O     . HOH H 4 .   ? 28.573 19.714  20.732 1.00 32.19 ? 1458 HOH B O     1 
HETATM 4979 O  O     . HOH H 4 .   ? 48.024 25.853  36.092 1.00 48.21 ? 1459 HOH B O     1 
HETATM 4980 O  O     . HOH H 4 .   ? 39.011 4.395   37.956 1.00 53.11 ? 1460 HOH B O     1 
HETATM 4981 O  O     . HOH H 4 .   ? 28.434 44.779  41.071 1.00 38.77 ? 1461 HOH B O     1 
HETATM 4982 O  O     . HOH H 4 .   ? 52.044 34.456  49.178 1.00 51.55 ? 1462 HOH B O     1 
HETATM 4983 O  O     . HOH H 4 .   ? 13.678 14.615  38.765 1.00 54.54 ? 1463 HOH B O     1 
HETATM 4984 O  O     . HOH H 4 .   ? 22.487 6.688   30.928 1.00 59.26 ? 1464 HOH B O     1 
HETATM 4985 O  O     . HOH H 4 .   ? 49.244 34.053  47.749 1.00 44.36 ? 1465 HOH B O     1 
HETATM 4986 O  O     . HOH H 4 .   ? 27.207 34.184  43.413 1.00 40.44 ? 1466 HOH B O     1 
HETATM 4987 O  O     . HOH H 4 .   ? 19.102 22.007  39.888 1.00 45.49 ? 1467 HOH B O     1 
HETATM 4988 O  O     . HOH H 4 .   ? 62.002 29.473  48.478 1.00 50.39 ? 1468 HOH B O     1 
HETATM 4989 O  O     . HOH H 4 .   ? 29.012 5.460   34.801 1.00 38.26 ? 1469 HOH B O     1 
HETATM 4990 O  O     . HOH H 4 .   ? 35.306 46.374  27.089 1.00 53.25 ? 1470 HOH B O     1 
HETATM 4991 O  O     . HOH H 4 .   ? 23.091 30.893  46.504 1.00 51.87 ? 1471 HOH B O     1 
HETATM 4992 O  O     . HOH H 4 .   ? 30.232 36.741  43.137 1.00 38.26 ? 1472 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   CYS 5   5   5   CYS CYS A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  HIS 51  51  51  HIS HIS A . n 
A 1 52  TRP 52  52  52  TRP TRP A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  GLN 55  55  55  GLN ALA A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 CYS 112 112 112 CYS CYS A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 MET 116 116 116 MET MET A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 MET 126 126 126 MET MET A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 HIS 176 176 176 HIS HIS A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 MET 178 178 178 MET MET A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 ARG 194 194 194 ARG ALA A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 SER 204 204 204 SER SER A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 ALA 209 209 ?   ?   ?   A . n 
A 1 210 PRO 210 210 ?   ?   ?   A . n 
A 1 211 ASP 211 211 ?   ?   ?   A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 GLN 217 217 217 GLN GLN A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 PHE 237 237 237 PHE PHE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 MET 240 240 240 MET MET A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 TRP 244 244 244 TRP TRP A . n 
A 1 245 THR 245 245 245 THR THR A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 MET 263 263 263 MET MET A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 HIS 265 265 265 HIS HIS A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 GLN 268 268 268 GLN GLN A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 THR 270 270 270 THR THR A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 CYS 273 273 273 CYS CYS A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 SER 278 278 278 SER SER A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 ALA 287 287 287 ALA ALA A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLU 2   2   ?   ?   ?   B . n 
B 1 3   GLU 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   CYS 5   5   5   CYS CYS B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  TYR 18  18  18  TYR TYR B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  ASN 21  21  21  ASN ASN B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  PRO 27  27  27  PRO PRO B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  PHE 33  33  33  PHE PHE B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ASN 45  45  45  ASN ASN B . n 
B 1 46  HIS 46  46  46  HIS HIS B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  HIS 51  51  51  HIS HIS B . n 
B 1 52  TRP 52  52  52  TRP TRP B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  TYR 66  66  66  TYR TYR B . n 
B 1 67  ASP 67  67  67  ASP ASP B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  LYS 70  70  70  LYS LYS B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  HIS 73  73  73  HIS HIS B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  ASN 75  75  75  ASN ASN B . n 
B 1 76  GLN 76  76  76  GLN GLN B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  TYR 79  79  79  TYR TYR B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  TYR 84  84  84  TYR TYR B . n 
B 1 85  THR 85  85  85  THR THR B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  PHE 90  90  90  PHE PHE B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ALA 92  92  92  ALA ALA B . n 
B 1 93  MET 93  93  93  MET MET B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  ASP 96  96  96  ASP ASP B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 GLN 103 103 103 GLN GLN B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 CYS 112 112 112 CYS CYS B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 MET 116 116 116 MET MET B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 GLN 119 119 119 GLN GLN B . n 
B 1 120 ARG 120 120 120 ARG ARG B . n 
B 1 121 ASN 121 121 121 ASN ASN B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 MET 126 126 126 MET MET B . n 
B 1 127 TYR 127 127 127 TYR TYR B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 PRO 129 129 129 PRO PRO B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 PRO 134 134 134 PRO PRO B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 TYR 136 136 136 TYR TYR B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 LYS 139 139 139 LYS LYS B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 VAL 143 143 143 VAL VAL B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASP 145 145 145 ASP ASP B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 LEU 157 157 157 LEU LEU B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 HIS 163 163 163 HIS HIS B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 GLN 165 165 165 GLN GLN B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 MET 172 172 172 MET MET B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 MET 174 174 174 MET MET B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 HIS 176 176 176 HIS HIS B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 MET 178 178 178 MET MET B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 THR 186 186 186 THR THR B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 SER 188 188 188 SER SER B . n 
B 1 189 ASN 189 189 189 ASN ASN B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 PRO 193 193 193 PRO PRO B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 GLY 195 195 195 GLY GLY B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 TYR 198 198 198 TYR TYR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 MET 200 200 200 MET MET B . n 
B 1 201 ALA 201 201 201 ALA ALA B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 SER 204 204 204 SER SER B . n 
B 1 205 GLN 205 205 205 GLN GLN B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 THR 207 207 207 THR THR B . n 
B 1 208 ARG 208 208 208 ARG ARG B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 PRO 210 210 210 PRO PRO B . n 
B 1 211 ASP 211 211 211 ASP ASP B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 THR 216 216 216 THR THR B . n 
B 1 217 GLN 217 217 217 GLN GLN B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 MET 221 221 221 MET MET B . n 
B 1 222 GLU 222 222 222 GLU GLU B . n 
B 1 223 MET 223 223 223 MET MET B . n 
B 1 224 HIS 224 224 224 HIS HIS B . n 
B 1 225 LYS 225 225 225 LYS LYS B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 ASP 227 227 227 ASP ASP B . n 
B 1 228 ALA 228 228 228 ALA ALA B . n 
B 1 229 VAL 229 229 229 VAL VAL B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 VAL 231 231 231 VAL VAL B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 THR 233 233 233 THR THR B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 PHE 237 237 237 PHE PHE B . n 
B 1 238 ALA 238 238 238 ALA ALA B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 MET 240 240 240 MET MET B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 TRP 244 244 244 TRP TRP B . n 
B 1 245 THR 245 245 245 THR THR B . n 
B 1 246 HIS 246 246 246 HIS HIS B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 PRO 249 249 249 PRO PRO B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 VAL 254 254 254 VAL VAL B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 CYS 256 256 256 CYS CYS B . n 
B 1 257 GLU 257 257 257 GLU GLU B . n 
B 1 258 LYS 258 258 258 LYS LYS B . n 
B 1 259 THR 259 259 259 THR THR B . n 
B 1 260 VAL 260 260 260 VAL VAL B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 ALA 262 262 262 ALA ALA B . n 
B 1 263 MET 263 263 263 MET MET B . n 
B 1 264 HIS 264 264 264 HIS HIS B . n 
B 1 265 HIS 265 265 265 HIS HIS B . n 
B 1 266 VAL 266 266 266 VAL VAL B . n 
B 1 267 LEU 267 267 267 LEU LEU B . n 
B 1 268 GLN 268 268 268 GLN GLN B . n 
B 1 269 ARG 269 269 269 ARG ARG B . n 
B 1 270 THR 270 270 270 THR THR B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 CYS 273 273 273 CYS CYS B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 LYS 275 275 275 LYS LYS B . n 
B 1 276 ALA 276 276 276 ALA ALA B . n 
B 1 277 LYS 277 277 277 LYS LYS B . n 
B 1 278 SER 278 278 278 SER SER B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 GLU 280 280 280 GLU GLU B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 LYS 283 283 283 LYS LYS B . n 
B 1 284 PRO 284 284 284 PRO PRO B . n 
B 1 285 SER 285 285 285 SER SER B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 ALA 287 287 287 ALA ALA B . n 
B 1 288 GLN 288 288 288 GLN GLN B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 GLU 290 290 290 GLU GLU B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 ARG 292 292 292 ARG ARG B . n 
B 1 293 MET 293 293 293 MET MET B . n 
B 1 294 VAL 294 294 294 VAL VAL B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 LYS 297 297 297 LYS LYS B . n 
B 1 298 LYS 298 298 298 LYS LYS B . n 
B 1 299 ASP 299 299 299 ASP ASP B . n 
B 1 300 ILE 300 300 300 ILE ILE B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 SER 302 302 302 SER SER B . n 
B 1 303 PRO 303 303 303 PRO PRO B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 ILE 305 305 305 ILE ILE B . n 
B 1 306 VAL 306 306 306 VAL VAL B . n 
B 1 307 VAL 307 307 307 VAL VAL B . n 
B 1 308 GLN 308 308 308 GLN GLN B . n 
B 1 309 ALA 309 309 309 ALA ALA B . n 
B 1 310 THR 310 310 310 THR THR B . n 
B 1 311 VAL 311 311 311 VAL VAL B . n 
B 1 312 LEU 312 312 312 LEU LEU B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5850  ? 
1 MORE         -96   ? 
1 'SSA (A^2)'  24490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-27 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG A MET 200 ? ? SD A MET 200 ? ? CE A MET 200 ? ? 110.05 100.20 9.85 1.60 N 
2 1 CG B MET 116 ? ? SD B MET 116 ? ? CE B MET 116 ? ? 110.00 100.20 9.80 1.60 N 
3 1 CG B MET 200 ? ? SD B MET 200 ? ? CE B MET 200 ? ? 109.94 100.20 9.74 1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 45  ? ? -170.17 -176.13 
2  1 THR A 47  ? ? -68.43  5.89    
3  1 TRP A 52  ? ? -172.12 141.07  
4  1 ASN A 75  ? ? -98.00  48.40   
5  1 ASP A 131 ? ? -65.86  7.99    
6  1 ASN B 45  ? ? -170.66 -179.64 
7  1 THR B 47  ? ? -69.17  5.30    
8  1 TRP B 52  ? ? -172.99 140.54  
9  1 ASN B 75  ? ? -99.40  48.61   
10 1 MET B 116 ? ? -145.17 -26.88  
11 1 ASN B 121 ? ? -128.57 -53.21  
12 1 ASP B 131 ? ? -67.40  9.45    
13 1 HIS B 248 ? ? -118.98 69.34   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 55  ? CG  ? A GLN 55  CG  
2  1 Y 1 A GLN 55  ? CD  ? A GLN 55  CD  
3  1 Y 1 A GLN 55  ? OE1 ? A GLN 55  OE1 
4  1 Y 1 A GLN 55  ? NE2 ? A GLN 55  NE2 
5  1 Y 1 A ARG 194 ? CG  ? A ARG 194 CG  
6  1 Y 1 A ARG 194 ? CD  ? A ARG 194 CD  
7  1 Y 1 A ARG 194 ? NE  ? A ARG 194 NE  
8  1 Y 1 A ARG 194 ? CZ  ? A ARG 194 CZ  
9  1 Y 1 A ARG 194 ? NH1 ? A ARG 194 NH1 
10 1 Y 1 A ARG 194 ? NH2 ? A ARG 194 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A GLU 2   ? A GLU 2   
3 1 Y 1 A GLU 3   ? A GLU 3   
4 1 Y 1 A ALA 209 ? A ALA 209 
5 1 Y 1 A PRO 210 ? A PRO 210 
6 1 Y 1 A ASP 211 ? A ASP 211 
7 1 Y 1 B MET 1   ? B MET 1   
8 1 Y 1 B GLU 2   ? B GLU 2   
9 1 Y 1 B GLU 3   ? B GLU 3   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                 ZN  
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 water                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  402  402 ZN  ZN2 A . 
D 3 ADP 1  401  401 ADP ADP A . 
E 2 ZN  1  1402 402 ZN  ZN2 B . 
F 3 ADP 1  1401 401 ADP ADP B . 
G 4 HOH 1  403  2   HOH WAT A . 
G 4 HOH 2  404  3   HOH WAT A . 
G 4 HOH 3  405  4   HOH WAT A . 
G 4 HOH 4  406  11  HOH WAT A . 
G 4 HOH 5  407  12  HOH WAT A . 
G 4 HOH 6  408  13  HOH WAT A . 
G 4 HOH 7  409  14  HOH WAT A . 
G 4 HOH 8  410  16  HOH WAT A . 
G 4 HOH 9  411  17  HOH WAT A . 
G 4 HOH 10 412  18  HOH WAT A . 
G 4 HOH 11 413  19  HOH WAT A . 
G 4 HOH 12 414  22  HOH WAT A . 
G 4 HOH 13 415  25  HOH WAT A . 
G 4 HOH 14 416  26  HOH WAT A . 
G 4 HOH 15 417  28  HOH WAT A . 
G 4 HOH 16 418  29  HOH WAT A . 
G 4 HOH 17 419  32  HOH WAT A . 
G 4 HOH 18 420  33  HOH WAT A . 
G 4 HOH 19 421  34  HOH WAT A . 
G 4 HOH 20 422  35  HOH WAT A . 
G 4 HOH 21 423  40  HOH WAT A . 
G 4 HOH 22 424  41  HOH WAT A . 
G 4 HOH 23 425  43  HOH WAT A . 
G 4 HOH 24 426  47  HOH WAT A . 
G 4 HOH 25 427  49  HOH WAT A . 
G 4 HOH 26 428  50  HOH WAT A . 
G 4 HOH 27 429  51  HOH WAT A . 
G 4 HOH 28 430  54  HOH WAT A . 
G 4 HOH 29 431  55  HOH WAT A . 
G 4 HOH 30 432  58  HOH WAT A . 
G 4 HOH 31 433  60  HOH WAT A . 
G 4 HOH 32 434  61  HOH WAT A . 
G 4 HOH 33 435  63  HOH WAT A . 
G 4 HOH 34 436  70  HOH WAT A . 
G 4 HOH 35 437  71  HOH WAT A . 
G 4 HOH 36 438  73  HOH WAT A . 
G 4 HOH 37 439  74  HOH WAT A . 
G 4 HOH 38 440  75  HOH WAT A . 
G 4 HOH 39 441  76  HOH WAT A . 
G 4 HOH 40 442  77  HOH WAT A . 
G 4 HOH 41 443  87  HOH WAT A . 
G 4 HOH 42 444  88  HOH WAT A . 
G 4 HOH 43 445  89  HOH WAT A . 
G 4 HOH 44 446  91  HOH WAT A . 
G 4 HOH 45 447  92  HOH WAT A . 
G 4 HOH 46 448  93  HOH WAT A . 
G 4 HOH 47 449  94  HOH WAT A . 
G 4 HOH 48 450  98  HOH WAT A . 
G 4 HOH 49 451  99  HOH WAT A . 
G 4 HOH 50 452  101 HOH WAT A . 
G 4 HOH 51 453  102 HOH WAT A . 
G 4 HOH 52 454  104 HOH WAT A . 
G 4 HOH 53 455  105 HOH WAT A . 
G 4 HOH 54 456  106 HOH WAT A . 
G 4 HOH 55 457  108 HOH WAT A . 
G 4 HOH 56 458  110 HOH WAT A . 
G 4 HOH 57 459  115 HOH WAT A . 
G 4 HOH 58 460  116 HOH WAT A . 
G 4 HOH 59 461  118 HOH WAT A . 
G 4 HOH 60 462  120 HOH WAT A . 
G 4 HOH 61 463  121 HOH WAT A . 
G 4 HOH 62 464  122 HOH WAT A . 
G 4 HOH 63 465  124 HOH WAT A . 
G 4 HOH 64 466  125 HOH WAT A . 
G 4 HOH 65 467  127 HOH WAT A . 
G 4 HOH 66 468  128 HOH WAT A . 
G 4 HOH 67 469  130 HOH WAT A . 
G 4 HOH 68 470  138 HOH WAT A . 
H 4 HOH 1  1403 1   HOH WAT B . 
H 4 HOH 2  1404 5   HOH WAT B . 
H 4 HOH 3  1405 6   HOH WAT B . 
H 4 HOH 4  1406 7   HOH WAT B . 
H 4 HOH 5  1407 8   HOH WAT B . 
H 4 HOH 6  1408 9   HOH WAT B . 
H 4 HOH 7  1409 10  HOH WAT B . 
H 4 HOH 8  1410 15  HOH WAT B . 
H 4 HOH 9  1411 20  HOH WAT B . 
H 4 HOH 10 1412 21  HOH WAT B . 
H 4 HOH 11 1413 23  HOH WAT B . 
H 4 HOH 12 1414 24  HOH WAT B . 
H 4 HOH 13 1415 27  HOH WAT B . 
H 4 HOH 14 1416 30  HOH WAT B . 
H 4 HOH 15 1417 31  HOH WAT B . 
H 4 HOH 16 1418 36  HOH WAT B . 
H 4 HOH 17 1419 37  HOH WAT B . 
H 4 HOH 18 1420 38  HOH WAT B . 
H 4 HOH 19 1421 39  HOH WAT B . 
H 4 HOH 20 1422 42  HOH WAT B . 
H 4 HOH 21 1423 44  HOH WAT B . 
H 4 HOH 22 1424 45  HOH WAT B . 
H 4 HOH 23 1425 46  HOH WAT B . 
H 4 HOH 24 1426 48  HOH WAT B . 
H 4 HOH 25 1427 52  HOH WAT B . 
H 4 HOH 26 1428 53  HOH WAT B . 
H 4 HOH 27 1429 56  HOH WAT B . 
H 4 HOH 28 1430 57  HOH WAT B . 
H 4 HOH 29 1431 59  HOH WAT B . 
H 4 HOH 30 1432 62  HOH WAT B . 
H 4 HOH 31 1433 64  HOH WAT B . 
H 4 HOH 32 1434 65  HOH WAT B . 
H 4 HOH 33 1435 66  HOH WAT B . 
H 4 HOH 34 1436 67  HOH WAT B . 
H 4 HOH 35 1437 68  HOH WAT B . 
H 4 HOH 36 1438 69  HOH WAT B . 
H 4 HOH 37 1439 72  HOH WAT B . 
H 4 HOH 38 1440 78  HOH WAT B . 
H 4 HOH 39 1441 79  HOH WAT B . 
H 4 HOH 40 1442 80  HOH WAT B . 
H 4 HOH 41 1443 81  HOH WAT B . 
H 4 HOH 42 1444 82  HOH WAT B . 
H 4 HOH 43 1445 83  HOH WAT B . 
H 4 HOH 44 1446 84  HOH WAT B . 
H 4 HOH 45 1447 85  HOH WAT B . 
H 4 HOH 46 1448 86  HOH WAT B . 
H 4 HOH 47 1449 90  HOH WAT B . 
H 4 HOH 48 1450 95  HOH WAT B . 
H 4 HOH 49 1451 96  HOH WAT B . 
H 4 HOH 50 1452 97  HOH WAT B . 
H 4 HOH 51 1453 100 HOH WAT B . 
H 4 HOH 52 1454 103 HOH WAT B . 
H 4 HOH 53 1455 107 HOH WAT B . 
H 4 HOH 54 1456 109 HOH WAT B . 
H 4 HOH 55 1457 111 HOH WAT B . 
H 4 HOH 56 1458 112 HOH WAT B . 
H 4 HOH 57 1459 113 HOH WAT B . 
H 4 HOH 58 1460 114 HOH WAT B . 
H 4 HOH 59 1461 117 HOH WAT B . 
H 4 HOH 60 1462 119 HOH WAT B . 
H 4 HOH 61 1463 123 HOH WAT B . 
H 4 HOH 62 1464 126 HOH WAT B . 
H 4 HOH 63 1465 129 HOH WAT B . 
H 4 HOH 64 1466 131 HOH WAT B . 
H 4 HOH 65 1467 132 HOH WAT B . 
H 4 HOH 66 1468 133 HOH WAT B . 
H 4 HOH 67 1469 134 HOH WAT B . 
H 4 HOH 68 1470 135 HOH WAT B . 
H 4 HOH 69 1471 136 HOH WAT B . 
H 4 HOH 70 1472 137 HOH WAT B . 
#