data_1RHJ
# 
_entry.id   1RHJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.362 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RHJ         pdb_00001rhj 10.2210/pdb1rhj/pdb 
RCSB  RCSB020749   ?            ?                   
WWPDB D_1000020749 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PAU 'Caspase-3 complex with Acetyl-Asp-Glu-Val-Asp-aldehyde' unspecified 
PDB 1RHK .                                                        unspecified 
PDB 1RHM .                                                        unspecified 
PDB 1RHQ .                                                        unspecified 
PDB 1RHR .                                                        unspecified 
PDB 1RHU .                                                        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RHJ 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, J.W.'  1 
'Rotonda, J.'   2 
'Soisson, S.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            47 
_citation.page_first                2466 
_citation.page_last                 2474 
_citation.year                      2004 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15115390 
_citation.pdbx_database_id_DOI      10.1021/jm0305523 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, J.W.'     1  ? 
primary 'Rotonda, J.'      2  ? 
primary 'Soisson, S.M.'    3  ? 
primary 'Aspiotis, R.'     4  ? 
primary 'Bayly, C.'        5  ? 
primary 'Francoeur, S.'    6  ? 
primary 'Gallant, M.'      7  ? 
primary 'Garcia-Calvo, M.' 8  ? 
primary 'Giroux, A.'       9  ? 
primary 'Grimm, E.'        10 ? 
primary 'Han, Y.'          11 ? 
primary 'McKay, D.'        12 ? 
primary 'Nicholson, D.W.'  13 ? 
primary 'Peterson, E.'     14 ? 
primary 'Renaud, J.'       15 ? 
primary 'Roy, S.'          16 ? 
primary 'Thornberry, N.'   17 ? 
primary 'Zamboni, R.'      18 ? 
# 
_cell.entry_id           1RHJ 
_cell.length_a           50.187 
_cell.length_b           68.764 
_cell.length_c           93.008 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.46 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RHJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Caspase-3 16639.902 2   3.4.22.- ? 'P17 subunit' ? 
2 polymer     man Caspase-3 12981.756 2   3.4.22.- ? 'P12 subunit' ? 
3 non-polymer syn 
;3-(2-{5-TERT-BUTYL-3-[(4-METHYL-FURAZAN-3-YLMETHYL)-AMINO]-2-OXO-2H-PYRAZIN-1-YL}-BUTYRYLAMINO)-5-(HEXYL-METHYL-AMINO)-4-OXO-PENTANOIC ACID ANION
;
574.692   2   ?        ? ?             ? 
4 water       nat water 18.015    233 ?        ? ?             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
2 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A,C ? 
2 'polypeptide(L)' no no 
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYHLEHHHHHH
;
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYHLEHHHHHH
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   SER n 
2 2   GLY n 
2 3   VAL n 
2 4   ASP n 
2 5   ASP n 
2 6   ASP n 
2 7   MET n 
2 8   ALA n 
2 9   CYS n 
2 10  HIS n 
2 11  LYS n 
2 12  ILE n 
2 13  PRO n 
2 14  VAL n 
2 15  GLU n 
2 16  ALA n 
2 17  ASP n 
2 18  PHE n 
2 19  LEU n 
2 20  TYR n 
2 21  ALA n 
2 22  TYR n 
2 23  SER n 
2 24  THR n 
2 25  ALA n 
2 26  PRO n 
2 27  GLY n 
2 28  TYR n 
2 29  TYR n 
2 30  SER n 
2 31  TRP n 
2 32  ARG n 
2 33  ASN n 
2 34  SER n 
2 35  LYS n 
2 36  ASP n 
2 37  GLY n 
2 38  SER n 
2 39  TRP n 
2 40  PHE n 
2 41  ILE n 
2 42  GLN n 
2 43  SER n 
2 44  LEU n 
2 45  CYS n 
2 46  ALA n 
2 47  MET n 
2 48  LEU n 
2 49  LYS n 
2 50  GLN n 
2 51  TYR n 
2 52  ALA n 
2 53  ASP n 
2 54  LYS n 
2 55  LEU n 
2 56  GLU n 
2 57  PHE n 
2 58  MET n 
2 59  HIS n 
2 60  ILE n 
2 61  LEU n 
2 62  THR n 
2 63  ARG n 
2 64  VAL n 
2 65  ASN n 
2 66  ARG n 
2 67  LYS n 
2 68  VAL n 
2 69  ALA n 
2 70  THR n 
2 71  GLU n 
2 72  PHE n 
2 73  GLU n 
2 74  SER n 
2 75  PHE n 
2 76  SER n 
2 77  PHE n 
2 78  ASP n 
2 79  ALA n 
2 80  THR n 
2 81  PHE n 
2 82  HIS n 
2 83  ALA n 
2 84  LYS n 
2 85  LYS n 
2 86  GLN n 
2 87  ILE n 
2 88  PRO n 
2 89  CYS n 
2 90  ILE n 
2 91  VAL n 
2 92  SER n 
2 93  MET n 
2 94  LEU n 
2 95  THR n 
2 96  LYS n 
2 97  GLU n 
2 98  LEU n 
2 99  TYR n 
2 100 PHE n 
2 101 TYR n 
2 102 HIS n 
2 103 LEU n 
2 104 GLU n 
2 105 HIS n 
2 106 HIS n 
2 107 HIS n 
2 108 HIS n 
2 109 HIS n 
2 110 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pET20b+ ? ? 
2 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ?       ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CASP3_HUMAN P42574 1 29  ? ? 
2 UNP CASP3_HUMAN P42574 2 176 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RHJ A 1 ? 147 ? P42574 29  ? 175 ? 145 297 
2 2 1RHJ B 1 ? 102 ? P42574 176 ? 277 ? 310 402 
3 1 1RHJ C 1 ? 147 ? P42574 29  ? 175 ? 645 797 
4 2 1RHJ D 1 ? 102 ? P42574 176 ? 277 ? 810 902 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 1RHJ GLU B 15  ? UNP P42574 ASP 190 variant          324 1  
2 1RHJ LEU B 103 ? UNP P42574 ?   ?   'expression tag' 403 2  
2 1RHJ GLU B 104 ? UNP P42574 ?   ?   'expression tag' 404 3  
2 1RHJ HIS B 105 ? UNP P42574 ?   ?   'expression tag' 405 4  
2 1RHJ HIS B 106 ? UNP P42574 ?   ?   'expression tag' 406 5  
2 1RHJ HIS B 107 ? UNP P42574 ?   ?   'expression tag' 407 6  
2 1RHJ HIS B 108 ? UNP P42574 ?   ?   'expression tag' 408 7  
2 1RHJ HIS B 109 ? UNP P42574 ?   ?   'expression tag' 409 8  
2 1RHJ HIS B 110 ? UNP P42574 ?   ?   'expression tag' 410 9  
4 1RHJ GLU D 15  ? UNP P42574 ASP 190 variant          824 10 
4 1RHJ LEU D 103 ? UNP P42574 ?   ?   'expression tag' 903 11 
4 1RHJ GLU D 104 ? UNP P42574 ?   ?   'expression tag' 904 12 
4 1RHJ HIS D 105 ? UNP P42574 ?   ?   'expression tag' 905 13 
4 1RHJ HIS D 106 ? UNP P42574 ?   ?   'expression tag' 906 14 
4 1RHJ HIS D 107 ? UNP P42574 ?   ?   'expression tag' 907 15 
4 1RHJ HIS D 108 ? UNP P42574 ?   ?   'expression tag' 908 16 
4 1RHJ HIS D 109 ? UNP P42574 ?   ?   'expression tag' 909 17 
4 1RHJ HIS D 110 ? UNP P42574 ?   ?   'expression tag' 910 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'       115.130 
PZN non-polymer         . 
;3-(2-{5-TERT-BUTYL-3-[(4-METHYL-FURAZAN-3-YLMETHYL)-AMINO]-2-OXO-2H-PYRAZIN-1-YL}-BUTYRYLAMINO)-5-(HEXYL-METHYL-AMINO)-4-OXO-PENTANOIC ACID ANION
;
? 'C28 H44 N7 O6 -1' 574.692 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1RHJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.66 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.65 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.pdbx_details    
'16% PEG-6000, 100 mM citrate, 20 mM L-cysteine, 5 mM glycerol, 3 mM NaN(3), pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1RHJ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             19.90 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   30288 
_reflns.number_all                   31682 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.2 
_reflns.B_iso_Wilson_estimate        10.6 
_reflns.pdbx_redundancy              3.36 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   76.6 
_reflns_shell.Rmerge_I_obs           0.164 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.41 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2730 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RHJ 
_refine.ls_number_reflns_obs                     29784 
_refine.ls_number_reflns_all                     29784 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               175071.30 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.90 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    94.1 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2987 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               24.1 
_refine.aniso_B[1][1]                            0.58 
_refine.aniso_B[2][2]                            3.84 
_refine.aniso_B[3][3]                            -4.42 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -3.76 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.368694 
_refine.solvent_model_param_bsol                 40.6566 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'Protein part of 1pau.pdb' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RHJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3740 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             233 
_refine_hist.number_atoms_total               4055 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        19.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.00  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.32  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.07  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.22  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.20  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             4086 
_refine_ls_shell.R_factor_R_work                  0.225 
_refine_ls_shell.percent_reflns_obs               87.0 
_refine_ls_shell.R_factor_R_free                  0.285 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            10.3 
_refine_ls_shell.number_reflns_R_free             469 
_refine_ls_shell.number_reflns_obs                4018 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.P PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PAR WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM     ION.TOP     'X-RAY DIFFRACTION' 
4 PYR.PAR       PYR.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RHJ 
_struct.title                     'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE-3 WITH A PRYAZINONE INHIBITOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RHJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'CYSTEINE PROTEASE, CASPASE-3, APOPAIN, CPP32, YAMA, COMPLEX (PROTEASE-INHIBITOR), HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological assembly.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 28  ? GLY A 32  C HIS A 174 GLY A 175 5 ? 5  
HELX_P HELX_P2  2  GLY A 38  ? LEU A 53  ? GLY A 181 LEU A 196 1 ? 16 
HELX_P HELX_P3  3  THR A 64  ? LYS A 77  ? THR A 207 LYS A 220 1 ? 14 
HELX_P HELX_P4  4  LEU A 108 ? PHE A 114 ? LEU A 258 PHE A 264 1 ? 7  
HELX_P HELX_P5  5  CYS A 120 ? THR A 124 ? CYS A 270 THR A 274 5 ? 5  
HELX_P HELX_P6  6  TRP B 39  ? ALA B 52  ? TRP B 348 ALA B 361 1 ? 14 
HELX_P HELX_P7  7  GLU B 56  ? PHE B 72  ? GLU B 365 PHE B 380 1 ? 17 
HELX_P HELX_P8  8  ASP B 78  E HIS B 82  I ASP B 381 HIS B 381 5 ? 5  
HELX_P HELX_P9  9  HIS C 28  ? GLY C 32  C HIS C 674 GLY C 675 5 ? 5  
HELX_P HELX_P10 10 GLY C 38  ? LEU C 53  ? GLY C 681 LEU C 696 1 ? 16 
HELX_P HELX_P11 11 THR C 64  ? GLU C 78  ? THR C 707 GLU C 721 1 ? 15 
HELX_P HELX_P12 12 LEU C 108 ? PHE C 114 ? LEU C 758 PHE C 764 1 ? 7  
HELX_P HELX_P13 13 CYS C 120 ? THR C 124 ? CYS C 770 THR C 774 5 ? 5  
HELX_P HELX_P14 14 TRP D 39  ? ALA D 52  ? TRP D 848 ALA D 861 1 ? 14 
HELX_P HELX_P15 15 GLU D 56  ? PHE D 72  ? GLU D 865 PHE D 880 1 ? 17 
HELX_P HELX_P16 16 ASP D 78  E HIS D 82  I ASP D 881 HIS D 881 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale none ? A CYS 135 SG ? ? ? 1_555 E PZN .   C9 ? ? A CYS 285 A PZN 501 1_555 ? ? ? ? ? ? ? 1.853 ? ? 
covale2 covale none ? F PZN .   C9 ? ? ? 1_555 C CYS 135 SG ? ? C PZN 502 C CYS 785 1_555 ? ? ? ? ? ? ? 1.852 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 3  ? 
C ? 2  ? 
D ? 3  ? 
E ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? parallel      
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? parallel      
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
E 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLU A 56  ? ASN A 61  ? GLU A 199 ASN A 204 
A 2  GLU A 15  ? ASN A 23  ? GLU A 162 ASN A 169 
A 3  ARG A 83  ? LEU A 91  ? ARG A 227 LEU A 235 
A 4  LYS A 128 ? GLN A 133 ? LYS A 278 GLN A 283 
A 5  PHE B 18  ? TYR B 22  ? PHE B 327 TYR B 331 
A 6  CYS B 89  ? SER B 92  ? CYS B 388 SER B 392 
A 7  CYS D 89  ? MET D 93  ? CYS D 888 MET D 893 
A 8  PHE D 18  ? TYR D 22  ? PHE D 827 TYR D 831 
A 9  LYS C 128 ? GLN C 133 ? LYS C 778 GLN C 783 
A 10 ARG C 83  ? LEU C 91  ? ARG C 727 LEU C 735 
A 11 GLU C 15  ? ASN C 23  ? GLU C 662 ASN C 669 
A 12 GLU C 56  ? ASN C 61  ? GLU C 699 ASN C 704 
B 1  GLY A 94  ? GLU A 95  ? GLY A 238 GLU A 239 
B 2  ILE A 98  ? GLY A 101 ? ILE A 242 GLY A 245 
B 3  GLY A 104 ? ASP A 107 ? GLY A 254 ASP A 257 
C 1  ARG B 32  ? ASN B 33  ? ARG B 341 ASN B 342 
C 2  GLY B 37  ? SER B 38  ? GLY B 346 SER B 347 
D 1  GLY C 94  ? GLU C 95  ? GLY C 738 GLU C 739 
D 2  ILE C 98  ? GLY C 101 ? ILE C 742 GLY C 745 
D 3  GLY C 104 ? ASP C 107 ? GLY C 754 ASP C 757 
E 1  ARG D 32  ? ASN D 33  ? ARG D 841 ASN D 842 
E 2  GLY D 37  ? SER D 38  ? GLY D 846 SER D 847 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O ARG A 58  ? O ARG A 201 N ILE A 21  ? N ILE A 167 
A 2  3  N ILE A 20  ? N ILE A 166 O VAL A 89  ? O VAL A 233 
A 3  4  N PHE A 86  ? N PHE A 230 O LEU A 129 ? O LEU A 279 
A 4  5  N PHE A 130 ? N PHE A 280 O LEU B 19  ? O LEU B 328 
A 5  6  N TYR B 20  ? N TYR B 329 O VAL B 91  ? O VAL B 390 
A 6  7  N ILE B 90  ? N ILE B 389 O SER D 92  ? O SER D 892 
A 7  8  O VAL D 91  ? O VAL D 890 N TYR D 20  ? N TYR D 829 
A 8  9  O LEU D 19  ? O LEU D 828 N PHE C 130 ? N PHE C 780 
A 9  10 O LEU C 129 ? O LEU C 779 N PHE C 86  ? N PHE C 730 
A 10 11 O VAL C 89  ? O VAL C 733 N ILE C 20  ? N ILE C 666 
A 11 12 N ASN C 23  ? N ASN C 669 O LYS C 60  ? O LYS C 703 
B 1  2  N GLU A 95  ? N GLU A 239 O ILE A 98  ? O ILE A 242 
B 2  3  N GLY A 101 ? N GLY A 245 O GLY A 104 ? O GLY A 254 
C 1  2  N ASN B 33  ? N ASN B 342 O GLY B 37  ? O GLY B 346 
D 1  2  N GLU C 95  ? N GLU C 739 O ILE C 98  ? O ILE C 742 
D 2  3  N GLY C 101 ? N GLY C 745 O GLY C 104 ? O GLY C 754 
E 1  2  N ASN D 33  ? N ASN D 842 O GLY D 37  ? O GLY D 846 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C PZN 502 ? 13 'BINDING SITE FOR RESIDUE PZN C 502' 
AC2 Software A PZN 501 ? 15 'BINDING SITE FOR RESIDUE PZN A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 HOH I .   ? HOH C 190 . ? 1_555 ? 
2  AC1 13 ARG C 36  ? ARG C 679 . ? 1_555 ? 
3  AC1 13 SER C 92  ? SER C 736 . ? 1_555 ? 
4  AC1 13 HIS C 93  ? HIS C 737 . ? 1_555 ? 
5  AC1 13 GLY C 94  ? GLY C 738 . ? 1_555 ? 
6  AC1 13 GLN C 133 ? GLN C 783 . ? 1_555 ? 
7  AC1 13 CYS C 135 ? CYS C 785 . ? 1_555 ? 
8  AC1 13 TYR D 29  ? TYR D 838 . ? 1_555 ? 
9  AC1 13 SER D 30  ? SER D 839 . ? 1_555 ? 
10 AC1 13 TRP D 31  ? TRP D 840 . ? 1_555 ? 
11 AC1 13 ARG D 32  ? ARG D 841 . ? 1_555 ? 
12 AC1 13 SER D 74  A SER D 881 . ? 1_555 ? 
13 AC1 13 PHE D 75  B PHE D 881 . ? 1_555 ? 
14 AC2 15 ARG A 36  ? ARG A 179 . ? 1_555 ? 
15 AC2 15 HIS A 93  ? HIS A 237 . ? 1_555 ? 
16 AC2 15 GLY A 94  ? GLY A 238 . ? 1_555 ? 
17 AC2 15 GLN A 133 ? GLN A 283 . ? 1_555 ? 
18 AC2 15 ALA A 134 ? ALA A 284 . ? 1_555 ? 
19 AC2 15 CYS A 135 ? CYS A 285 . ? 1_555 ? 
20 AC2 15 HOH G .   ? HOH A 519 . ? 1_555 ? 
21 AC2 15 HOH G .   ? HOH A 524 . ? 1_555 ? 
22 AC2 15 TYR B 29  ? TYR B 338 . ? 1_555 ? 
23 AC2 15 SER B 30  ? SER B 339 . ? 1_555 ? 
24 AC2 15 TRP B 31  ? TRP B 340 . ? 1_555 ? 
25 AC2 15 ARG B 32  ? ARG B 341 . ? 1_555 ? 
26 AC2 15 SER B 74  A SER B 381 . ? 1_555 ? 
27 AC2 15 PHE B 75  B PHE B 381 . ? 1_555 ? 
28 AC2 15 PHE B 81  H PHE B 381 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RHJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RHJ 
_atom_sites.fract_transf_matrix[1][1]   0.019925 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004039 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014542 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010970 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 6   ? -113.451 43.485 81.266 1.00 47.00 ? 150 ASP A N   1 
ATOM   2    C CA  . ASP A 1 6   ? -113.935 43.108 79.909 1.00 46.69 ? 150 ASP A CA  1 
ATOM   3    C C   . ASP A 1 6   ? -112.835 42.344 79.166 1.00 44.61 ? 150 ASP A C   1 
ATOM   4    O O   . ASP A 1 6   ? -111.769 42.889 78.875 1.00 44.62 ? 150 ASP A O   1 
ATOM   5    C CB  . ASP A 1 6   ? -114.333 44.367 79.134 1.00 49.33 ? 150 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 6   ? -115.537 44.144 78.229 1.00 51.73 ? 150 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 6   ? -116.441 45.008 78.230 1.00 53.39 ? 150 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 6   ? -115.579 43.116 77.516 1.00 51.08 ? 150 ASP A OD2 1 
ATOM   9    N N   . ASN A 1 7   ? -113.107 41.077 78.868 1.00 41.04 ? 151 ASN A N   1 
ATOM   10   C CA  . ASN A 1 7   ? -112.154 40.213 78.183 1.00 37.98 ? 151 ASN A CA  1 
ATOM   11   C C   . ASN A 1 7   ? -112.472 40.051 76.701 1.00 33.76 ? 151 ASN A C   1 
ATOM   12   O O   . ASN A 1 7   ? -112.216 39.004 76.110 1.00 30.61 ? 151 ASN A O   1 
ATOM   13   C CB  . ASN A 1 7   ? -112.139 38.844 78.857 1.00 42.19 ? 151 ASN A CB  1 
ATOM   14   C CG  . ASN A 1 7   ? -113.527 38.265 79.011 1.00 45.98 ? 151 ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 7   ? -114.178 37.911 78.024 1.00 49.28 ? 151 ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 7   ? -113.998 38.175 80.252 1.00 46.88 ? 151 ASN A ND2 1 
ATOM   17   N N   . SER A 1 8   ? -113.025 41.099 76.102 1.00 30.30 ? 152 SER A N   1 
ATOM   18   C CA  . SER A 1 8   ? -113.376 41.068 74.689 1.00 27.43 ? 152 SER A CA  1 
ATOM   19   C C   . SER A 1 8   ? -113.059 42.429 74.072 1.00 23.66 ? 152 SER A C   1 
ATOM   20   O O   . SER A 1 8   ? -113.455 43.459 74.606 1.00 21.06 ? 152 SER A O   1 
ATOM   21   C CB  . SER A 1 8   ? -114.864 40.739 74.539 1.00 27.49 ? 152 SER A CB  1 
ATOM   22   O OG  . SER A 1 8   ? -115.158 40.306 73.226 1.00 32.69 ? 152 SER A OG  1 
ATOM   23   N N   . TYR A 1 9   ? -112.327 42.425 72.961 1.00 21.85 ? 153 TYR A N   1 
ATOM   24   C CA  . TYR A 1 9   ? -111.953 43.663 72.289 1.00 20.24 ? 153 TYR A CA  1 
ATOM   25   C C   . TYR A 1 9   ? -113.155 44.532 71.942 1.00 21.75 ? 153 TYR A C   1 
ATOM   26   O O   . TYR A 1 9   ? -114.208 44.034 71.542 1.00 21.75 ? 153 TYR A O   1 
ATOM   27   C CB  . TYR A 1 9   ? -111.179 43.360 71.008 1.00 17.96 ? 153 TYR A CB  1 
ATOM   28   C CG  . TYR A 1 9   ? -109.752 42.915 71.219 1.00 15.83 ? 153 TYR A CG  1 
ATOM   29   C CD1 . TYR A 1 9   ? -108.808 43.776 71.782 1.00 15.35 ? 153 TYR A CD1 1 
ATOM   30   C CD2 . TYR A 1 9   ? -109.339 41.642 70.833 1.00 14.65 ? 153 TYR A CD2 1 
ATOM   31   C CE1 . TYR A 1 9   ? -107.477 43.379 71.948 1.00 16.38 ? 153 TYR A CE1 1 
ATOM   32   C CE2 . TYR A 1 9   ? -108.019 41.226 70.997 1.00 15.09 ? 153 TYR A CE2 1 
ATOM   33   C CZ  . TYR A 1 9   ? -107.090 42.096 71.552 1.00 15.37 ? 153 TYR A CZ  1 
ATOM   34   O OH  . TYR A 1 9   ? -105.785 41.691 71.703 1.00 14.19 ? 153 TYR A OH  1 
ATOM   35   N N   . LYS A 1 10  ? -112.986 45.837 72.110 1.00 23.16 ? 154 LYS A N   1 
ATOM   36   C CA  . LYS A 1 10  ? -114.032 46.799 71.784 1.00 24.38 ? 154 LYS A CA  1 
ATOM   37   C C   . LYS A 1 10  ? -114.086 46.880 70.261 1.00 24.07 ? 154 LYS A C   1 
ATOM   38   O O   . LYS A 1 10  ? -113.179 47.415 69.626 1.00 23.41 ? 154 LYS A O   1 
ATOM   39   C CB  . LYS A 1 10  ? -113.682 48.173 72.370 1.00 25.39 ? 154 LYS A CB  1 
ATOM   40   C CG  . LYS A 1 10  ? -114.648 49.305 72.006 1.00 28.08 ? 154 LYS A CG  1 
ATOM   41   C CD  . LYS A 1 10  ? -114.137 50.649 72.528 1.00 31.38 ? 154 LYS A CD  1 
ATOM   42   C CE  . LYS A 1 10  ? -115.006 51.817 72.068 1.00 32.26 ? 154 LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 10  ? -116.374 51.769 72.654 1.00 34.85 ? 154 LYS A NZ  1 
ATOM   44   N N   . MET A 1 11  ? -115.141 46.330 69.676 1.00 24.73 ? 155 MET A N   1 
ATOM   45   C CA  . MET A 1 11  ? -115.298 46.346 68.225 1.00 25.78 ? 155 MET A CA  1 
ATOM   46   C C   . MET A 1 11  ? -116.470 47.235 67.826 1.00 26.40 ? 155 MET A C   1 
ATOM   47   O O   . MET A 1 11  ? -117.094 47.023 66.787 1.00 26.00 ? 155 MET A O   1 
ATOM   48   C CB  . MET A 1 11  ? -115.537 44.928 67.700 1.00 25.35 ? 155 MET A CB  1 
ATOM   49   C CG  . MET A 1 11  ? -114.408 43.948 67.964 1.00 25.94 ? 155 MET A CG  1 
ATOM   50   S SD  . MET A 1 11  ? -112.840 44.436 67.205 1.00 27.46 ? 155 MET A SD  1 
ATOM   51   C CE  . MET A 1 11  ? -113.032 43.780 65.551 1.00 25.71 ? 155 MET A CE  1 
ATOM   52   N N   . ASP A 1 12  ? -116.766 48.233 68.652 1.00 26.69 ? 156 ASP A N   1 
ATOM   53   C CA  . ASP A 1 12  ? -117.873 49.137 68.372 1.00 28.62 ? 156 ASP A CA  1 
ATOM   54   C C   . ASP A 1 12  ? -117.420 50.545 68.001 1.00 28.64 ? 156 ASP A C   1 
ATOM   55   O O   . ASP A 1 12  ? -118.143 51.517 68.225 1.00 28.37 ? 156 ASP A O   1 
ATOM   56   C CB  . ASP A 1 12  ? -118.823 49.204 69.570 1.00 29.73 ? 156 ASP A CB  1 
ATOM   57   C CG  . ASP A 1 12  ? -118.148 49.721 70.813 1.00 30.16 ? 156 ASP A CG  1 
ATOM   58   O OD1 . ASP A 1 12  ? -117.024 50.251 70.705 1.00 32.08 ? 156 ASP A OD1 1 
ATOM   59   O OD2 . ASP A 1 12  ? -118.745 49.607 71.900 1.00 33.37 ? 156 ASP A OD2 1 
ATOM   60   N N   . TYR A 1 13  A -116.213 50.654 67.454 1.00 28.78 ? 156 TYR A N   1 
ATOM   61   C CA  . TYR A 1 13  A -115.694 51.943 67.017 1.00 29.36 ? 156 TYR A CA  1 
ATOM   62   C C   . TYR A 1 13  A -116.481 52.328 65.768 1.00 29.06 ? 156 TYR A C   1 
ATOM   63   O O   . TYR A 1 13  A -117.165 51.489 65.175 1.00 29.68 ? 156 TYR A O   1 
ATOM   64   C CB  . TYR A 1 13  A -114.211 51.826 66.663 1.00 29.54 ? 156 TYR A CB  1 
ATOM   65   C CG  . TYR A 1 13  A -113.291 51.870 67.855 1.00 31.51 ? 156 TYR A CG  1 
ATOM   66   C CD1 . TYR A 1 13  A -112.761 53.078 68.302 1.00 32.08 ? 156 TYR A CD1 1 
ATOM   67   C CD2 . TYR A 1 13  A -112.966 50.706 68.554 1.00 31.30 ? 156 TYR A CD2 1 
ATOM   68   C CE1 . TYR A 1 13  A -111.931 53.126 69.415 1.00 31.63 ? 156 TYR A CE1 1 
ATOM   69   C CE2 . TYR A 1 13  A -112.139 50.746 69.665 1.00 30.44 ? 156 TYR A CE2 1 
ATOM   70   C CZ  . TYR A 1 13  A -111.626 51.957 70.090 1.00 31.21 ? 156 TYR A CZ  1 
ATOM   71   O OH  . TYR A 1 13  A -110.820 52.004 71.198 1.00 32.00 ? 156 TYR A OH  1 
ATOM   72   N N   . PRO A 1 14  ? -116.407 53.601 65.356 1.00 28.19 ? 161 PRO A N   1 
ATOM   73   C CA  . PRO A 1 14  ? -117.141 54.014 64.158 1.00 28.91 ? 161 PRO A CA  1 
ATOM   74   C C   . PRO A 1 14  ? -116.940 53.040 62.993 1.00 29.98 ? 161 PRO A C   1 
ATOM   75   O O   . PRO A 1 14  ? -117.866 52.787 62.224 1.00 31.07 ? 161 PRO A O   1 
ATOM   76   C CB  . PRO A 1 14  ? -116.571 55.396 63.878 1.00 27.90 ? 161 PRO A CB  1 
ATOM   77   C CG  . PRO A 1 14  ? -116.367 55.931 65.267 1.00 26.19 ? 161 PRO A CG  1 
ATOM   78   C CD  . PRO A 1 14  ? -115.731 54.751 65.982 1.00 27.50 ? 161 PRO A CD  1 
ATOM   79   N N   . GLU A 1 15  ? -115.737 52.483 62.872 1.00 29.28 ? 162 GLU A N   1 
ATOM   80   C CA  . GLU A 1 15  ? -115.457 51.538 61.795 1.00 30.83 ? 162 GLU A CA  1 
ATOM   81   C C   . GLU A 1 15  ? -114.583 50.354 62.222 1.00 30.29 ? 162 GLU A C   1 
ATOM   82   O O   . GLU A 1 15  ? -113.686 50.495 63.058 1.00 29.28 ? 162 GLU A O   1 
ATOM   83   C CB  . GLU A 1 15  ? -114.815 52.272 60.614 1.00 32.78 ? 162 GLU A CB  1 
ATOM   84   C CG  . GLU A 1 15  ? -113.903 53.398 61.035 1.00 36.39 ? 162 GLU A CG  1 
ATOM   85   C CD  . GLU A 1 15  ? -113.400 54.220 59.865 1.00 37.48 ? 162 GLU A CD  1 
ATOM   86   O OE1 . GLU A 1 15  ? -112.669 53.670 59.016 1.00 40.88 ? 162 GLU A OE1 1 
ATOM   87   O OE2 . GLU A 1 15  ? -113.733 55.419 59.797 1.00 38.11 ? 162 GLU A OE2 1 
ATOM   88   N N   . MET A 1 16  A -114.869 49.187 61.647 1.00 28.02 ? 162 MET A N   1 
ATOM   89   C CA  . MET A 1 16  A -114.125 47.971 61.950 1.00 27.35 ? 162 MET A CA  1 
ATOM   90   C C   . MET A 1 16  A -112.641 48.168 61.686 1.00 25.48 ? 162 MET A C   1 
ATOM   91   O O   . MET A 1 16  A -111.796 47.670 62.436 1.00 23.58 ? 162 MET A O   1 
ATOM   92   C CB  . MET A 1 16  A -114.632 46.803 61.101 1.00 28.45 ? 162 MET A CB  1 
ATOM   93   C CG  . MET A 1 16  A -115.945 46.203 61.564 1.00 30.87 ? 162 MET A CG  1 
ATOM   94   S SD  . MET A 1 16  A -115.835 45.498 63.220 1.00 34.03 ? 162 MET A SD  1 
ATOM   95   C CE  . MET A 1 16  A -117.390 46.012 63.938 1.00 32.79 ? 162 MET A CE  1 
ATOM   96   N N   . GLY A 1 17  ? -112.330 48.890 60.612 1.00 24.19 ? 163 GLY A N   1 
ATOM   97   C CA  . GLY A 1 17  ? -110.943 49.146 60.274 1.00 20.47 ? 163 GLY A CA  1 
ATOM   98   C C   . GLY A 1 17  ? -110.553 48.736 58.865 1.00 20.37 ? 163 GLY A C   1 
ATOM   99   O O   . GLY A 1 17  ? -111.378 48.271 58.076 1.00 19.64 ? 163 GLY A O   1 
ATOM   100  N N   . LEU A 1 18  ? -109.276 48.908 58.551 1.00 20.03 ? 164 LEU A N   1 
ATOM   101  C CA  . LEU A 1 18  ? -108.756 48.566 57.239 1.00 20.65 ? 164 LEU A CA  1 
ATOM   102  C C   . LEU A 1 18  ? -108.431 47.084 57.077 1.00 21.16 ? 164 LEU A C   1 
ATOM   103  O O   . LEU A 1 18  ? -108.173 46.383 58.051 1.00 21.16 ? 164 LEU A O   1 
ATOM   104  C CB  . LEU A 1 18  ? -107.491 49.386 56.963 1.00 19.90 ? 164 LEU A CB  1 
ATOM   105  C CG  . LEU A 1 18  ? -107.650 50.778 56.344 1.00 24.01 ? 164 LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 18  ? -108.896 51.478 56.874 1.00 24.68 ? 164 LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 18  ? -106.394 51.580 56.635 1.00 23.66 ? 164 LEU A CD2 1 
ATOM   108  N N   . CYS A 1 19  ? -108.470 46.619 55.834 1.00 19.42 ? 165 CYS A N   1 
ATOM   109  C CA  . CYS A 1 19  ? -108.107 45.250 55.497 1.00 19.81 ? 165 CYS A CA  1 
ATOM   110  C C   . CYS A 1 19  ? -107.275 45.369 54.231 1.00 18.80 ? 165 CYS A C   1 
ATOM   111  O O   . CYS A 1 19  ? -107.816 45.489 53.128 1.00 18.57 ? 165 CYS A O   1 
ATOM   112  C CB  . CYS A 1 19  ? -109.326 44.375 55.220 1.00 19.45 ? 165 CYS A CB  1 
ATOM   113  S SG  . CYS A 1 19  ? -108.877 42.684 54.667 1.00 21.29 ? 165 CYS A SG  1 
ATOM   114  N N   . ILE A 1 20  ? -105.958 45.365 54.400 1.00 19.38 ? 166 ILE A N   1 
ATOM   115  C CA  . ILE A 1 20  ? -105.046 45.485 53.275 1.00 20.07 ? 166 ILE A CA  1 
ATOM   116  C C   . ILE A 1 20  ? -104.731 44.107 52.739 1.00 22.21 ? 166 ILE A C   1 
ATOM   117  O O   . ILE A 1 20  ? -104.227 43.247 53.466 1.00 22.35 ? 166 ILE A O   1 
ATOM   118  C CB  . ILE A 1 20  ? -103.729 46.170 53.685 1.00 19.61 ? 166 ILE A CB  1 
ATOM   119  C CG1 . ILE A 1 20  ? -104.018 47.539 54.309 1.00 19.52 ? 166 ILE A CG1 1 
ATOM   120  C CG2 . ILE A 1 20  ? -102.818 46.300 52.475 1.00 19.46 ? 166 ILE A CG2 1 
ATOM   121  C CD1 . ILE A 1 20  ? -104.926 48.436 53.472 1.00 15.91 ? 166 ILE A CD1 1 
ATOM   122  N N   . ILE A 1 21  ? -105.036 43.896 51.463 1.00 22.65 ? 167 ILE A N   1 
ATOM   123  C CA  . ILE A 1 21  ? -104.791 42.610 50.831 1.00 24.01 ? 167 ILE A CA  1 
ATOM   124  C C   . ILE A 1 21  ? -103.725 42.750 49.765 1.00 24.86 ? 167 ILE A C   1 
ATOM   125  O O   . ILE A 1 21  ? -103.911 43.453 48.773 1.00 27.82 ? 167 ILE A O   1 
ATOM   126  C CB  . ILE A 1 21  ? -106.074 42.045 50.175 1.00 24.85 ? 167 ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 21  ? -107.169 41.879 51.228 1.00 26.24 ? 167 ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 21  ? -105.788 40.695 49.536 1.00 23.96 ? 167 ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 21  ? -108.503 41.430 50.657 1.00 27.08 ? 167 ILE A CD1 1 
ATOM   130  N N   . ILE A 1 22  ? -102.597 42.092 49.980 1.00 23.65 ? 168 ILE A N   1 
ATOM   131  C CA  . ILE A 1 22  ? -101.518 42.143 49.017 1.00 23.49 ? 168 ILE A CA  1 
ATOM   132  C C   . ILE A 1 22  ? -101.472 40.810 48.284 1.00 24.68 ? 168 ILE A C   1 
ATOM   133  O O   . ILE A 1 22  ? -101.102 39.783 48.853 1.00 22.86 ? 168 ILE A O   1 
ATOM   134  C CB  . ILE A 1 22  ? -100.187 42.406 49.703 1.00 22.14 ? 168 ILE A CB  1 
ATOM   135  C CG1 . ILE A 1 22  ? -100.275 43.728 50.471 1.00 20.97 ? 168 ILE A CG1 1 
ATOM   136  C CG2 . ILE A 1 22  ? -99.074  42.429 48.671 1.00 21.08 ? 168 ILE A CG2 1 
ATOM   137  C CD1 . ILE A 1 22  ? -99.012  44.106 51.187 1.00 20.64 ? 168 ILE A CD1 1 
ATOM   138  N N   . ASN A 1 23  ? -101.867 40.844 47.018 1.00 25.37 ? 169 ASN A N   1 
ATOM   139  C CA  . ASN A 1 23  ? -101.907 39.650 46.193 1.00 28.03 ? 169 ASN A CA  1 
ATOM   140  C C   . ASN A 1 23  ? -100.841 39.680 45.106 1.00 27.83 ? 169 ASN A C   1 
ATOM   141  O O   . ASN A 1 23  ? -100.974 40.408 44.126 1.00 27.53 ? 169 ASN A O   1 
ATOM   142  C CB  . ASN A 1 23  ? -103.293 39.516 45.555 1.00 28.40 ? 169 ASN A CB  1 
ATOM   143  C CG  . ASN A 1 23  ? -103.470 38.203 44.821 1.00 31.34 ? 169 ASN A CG  1 
ATOM   144  O OD1 . ASN A 1 23  ? -102.750 37.909 43.875 1.00 35.31 ? 169 ASN A OD1 1 
ATOM   145  N ND2 . ASN A 1 23  ? -104.428 37.402 45.262 1.00 35.21 ? 169 ASN A ND2 1 
ATOM   146  N N   . ASN A 1 24  ? -99.788  38.889 45.288 1.00 29.12 ? 170 ASN A N   1 
ATOM   147  C CA  . ASN A 1 24  ? -98.705  38.813 44.311 1.00 31.11 ? 170 ASN A CA  1 
ATOM   148  C C   . ASN A 1 24  ? -98.796  37.535 43.483 1.00 32.65 ? 170 ASN A C   1 
ATOM   149  O O   . ASN A 1 24  ? -98.609  36.430 44.000 1.00 31.60 ? 170 ASN A O   1 
ATOM   150  C CB  . ASN A 1 24  ? -97.351  38.884 45.015 1.00 30.26 ? 170 ASN A CB  1 
ATOM   151  C CG  . ASN A 1 24  ? -96.986  40.297 45.425 1.00 32.62 ? 170 ASN A CG  1 
ATOM   152  O OD1 . ASN A 1 24  ? -95.925  40.533 46.003 1.00 33.44 ? 170 ASN A OD1 1 
ATOM   153  N ND2 . ASN A 1 24  ? -97.866  41.248 45.124 1.00 31.72 ? 170 ASN A ND2 1 
ATOM   154  N N   . LYS A 1 25  ? -99.077  37.693 42.191 1.00 35.10 ? 171 LYS A N   1 
ATOM   155  C CA  . LYS A 1 25  ? -99.219  36.550 41.293 1.00 36.14 ? 171 LYS A CA  1 
ATOM   156  C C   . LYS A 1 25  ? -98.032  36.346 40.354 1.00 36.44 ? 171 LYS A C   1 
ATOM   157  O O   . LYS A 1 25  ? -97.557  35.222 40.179 1.00 36.61 ? 171 LYS A O   1 
ATOM   158  C CB  . LYS A 1 25  ? -100.502 36.700 40.468 1.00 38.04 ? 171 LYS A CB  1 
ATOM   159  C CG  . LYS A 1 25  ? -100.835 35.496 39.594 1.00 41.34 ? 171 LYS A CG  1 
ATOM   160  C CD  . LYS A 1 25  ? -102.183 35.662 38.901 1.00 43.76 ? 171 LYS A CD  1 
ATOM   161  C CE  . LYS A 1 25  ? -102.534 34.427 38.071 1.00 47.07 ? 171 LYS A CE  1 
ATOM   162  N NZ  . LYS A 1 25  ? -103.888 34.517 37.442 1.00 48.09 ? 171 LYS A NZ  1 
ATOM   163  N N   . ASN A 1 26  ? -97.554  37.432 39.754 1.00 36.71 ? 172 ASN A N   1 
ATOM   164  C CA  . ASN A 1 26  ? -96.439  37.358 38.812 1.00 36.78 ? 172 ASN A CA  1 
ATOM   165  C C   . ASN A 1 26  ? -95.141  37.909 39.383 1.00 36.52 ? 172 ASN A C   1 
ATOM   166  O O   . ASN A 1 26  ? -95.112  39.007 39.937 1.00 36.40 ? 172 ASN A O   1 
ATOM   167  C CB  . ASN A 1 26  ? -96.796  38.116 37.535 1.00 36.46 ? 172 ASN A CB  1 
ATOM   168  C CG  . ASN A 1 26  ? -98.118  37.676 36.954 1.00 34.62 ? 172 ASN A CG  1 
ATOM   169  O OD1 . ASN A 1 26  ? -98.297  36.512 36.604 1.00 33.52 ? 172 ASN A OD1 1 
ATOM   170  N ND2 . ASN A 1 26  ? -99.058  38.608 36.851 1.00 36.27 ? 172 ASN A ND2 1 
ATOM   171  N N   . PHE A 1 27  ? -94.062  37.149 39.220 1.00 37.15 ? 173 PHE A N   1 
ATOM   172  C CA  . PHE A 1 27  ? -92.759  37.556 39.735 1.00 39.13 ? 173 PHE A CA  1 
ATOM   173  C C   . PHE A 1 27  ? -91.691  37.693 38.650 1.00 41.55 ? 173 PHE A C   1 
ATOM   174  O O   . PHE A 1 27  ? -91.646  36.909 37.697 1.00 40.93 ? 173 PHE A O   1 
ATOM   175  C CB  . PHE A 1 27  ? -92.280  36.557 40.794 1.00 36.44 ? 173 PHE A CB  1 
ATOM   176  C CG  . PHE A 1 27  ? -93.275  36.316 41.890 1.00 35.08 ? 173 PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 27  ? -94.429  35.573 41.649 1.00 33.82 ? 173 PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 27  ? -93.077  36.857 43.157 1.00 34.30 ? 173 PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 27  ? -95.373  35.375 42.653 1.00 34.34 ? 173 PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 27  ? -94.016  36.664 44.169 1.00 33.13 ? 173 PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 27  ? -95.166  35.923 43.918 1.00 33.73 ? 173 PHE A CZ  1 
ATOM   182  N N   . HIS A 1 28  ? -90.830  38.694 38.820 1.00 43.37 ? 174 HIS A N   1 
ATOM   183  C CA  . HIS A 1 28  ? -89.742  38.968 37.888 1.00 45.97 ? 174 HIS A CA  1 
ATOM   184  C C   . HIS A 1 28  ? -88.970  37.691 37.577 1.00 48.10 ? 174 HIS A C   1 
ATOM   185  O O   . HIS A 1 28  ? -88.768  36.851 38.453 1.00 48.65 ? 174 HIS A O   1 
ATOM   186  C CB  . HIS A 1 28  ? -88.797  40.013 38.491 1.00 45.15 ? 174 HIS A CB  1 
ATOM   187  C CG  . HIS A 1 28  ? -89.432  41.354 38.699 1.00 44.41 ? 174 HIS A CG  1 
ATOM   188  N ND1 . HIS A 1 28  ? -90.781  41.508 38.937 1.00 44.53 ? 174 HIS A ND1 1 
ATOM   189  C CD2 . HIS A 1 28  ? -88.899  42.597 38.734 1.00 44.80 ? 174 HIS A CD2 1 
ATOM   190  C CE1 . HIS A 1 28  ? -91.052  42.790 39.110 1.00 44.00 ? 174 HIS A CE1 1 
ATOM   191  N NE2 . HIS A 1 28  ? -89.928  43.472 38.992 1.00 44.32 ? 174 HIS A NE2 1 
ATOM   192  N N   . LYS A 1 29  ? -88.545  37.548 36.324 1.00 50.81 ? 175 LYS A N   1 
ATOM   193  C CA  . LYS A 1 29  ? -87.796  36.370 35.899 1.00 53.44 ? 175 LYS A CA  1 
ATOM   194  C C   . LYS A 1 29  ? -86.546  36.224 36.752 1.00 54.22 ? 175 LYS A C   1 
ATOM   195  O O   . LYS A 1 29  ? -86.155  35.116 37.120 1.00 55.30 ? 175 LYS A O   1 
ATOM   196  C CB  . LYS A 1 29  ? -87.380  36.499 34.432 1.00 54.91 ? 175 LYS A CB  1 
ATOM   197  C CG  . LYS A 1 29  ? -88.516  36.789 33.470 1.00 57.49 ? 175 LYS A CG  1 
ATOM   198  C CD  . LYS A 1 29  ? -87.999  36.879 32.039 1.00 59.65 ? 175 LYS A CD  1 
ATOM   199  C CE  . LYS A 1 29  ? -86.923  37.952 31.897 1.00 60.88 ? 175 LYS A CE  1 
ATOM   200  N NZ  . LYS A 1 29  ? -86.380  38.027 30.511 1.00 62.61 ? 175 LYS A NZ  1 
ATOM   201  N N   . SER A 1 30  A -85.927  37.357 37.064 1.00 54.70 ? 175 SER A N   1 
ATOM   202  C CA  . SER A 1 30  A -84.710  37.379 37.864 1.00 55.65 ? 175 SER A CA  1 
ATOM   203  C C   . SER A 1 30  A -84.866  36.735 39.240 1.00 55.82 ? 175 SER A C   1 
ATOM   204  O O   . SER A 1 30  A -83.900  36.656 40.002 1.00 56.06 ? 175 SER A O   1 
ATOM   205  C CB  . SER A 1 30  A -84.219  38.822 38.020 1.00 56.19 ? 175 SER A CB  1 
ATOM   206  O OG  . SER A 1 30  A -85.246  39.663 38.516 1.00 56.63 ? 175 SER A OG  1 
ATOM   207  N N   . THR A 1 31  B -86.073  36.270 39.558 1.00 54.71 ? 175 THR A N   1 
ATOM   208  C CA  . THR A 1 31  B -86.319  35.637 40.853 1.00 53.65 ? 175 THR A CA  1 
ATOM   209  C C   . THR A 1 31  B -86.429  34.116 40.755 1.00 52.85 ? 175 THR A C   1 
ATOM   210  O O   . THR A 1 31  B -85.986  33.397 41.652 1.00 53.35 ? 175 THR A O   1 
ATOM   211  C CB  . THR A 1 31  B -87.614  36.162 41.507 1.00 53.24 ? 175 THR A CB  1 
ATOM   212  O OG1 . THR A 1 31  B -88.748  35.715 40.755 1.00 52.18 ? 175 THR A OG1 1 
ATOM   213  C CG2 . THR A 1 31  B -87.609  37.682 41.556 1.00 53.53 ? 175 THR A CG2 1 
ATOM   214  N N   . GLY A 1 32  C -87.023  33.629 39.672 1.00 51.33 ? 175 GLY A N   1 
ATOM   215  C CA  . GLY A 1 32  C -87.175  32.195 39.511 1.00 49.84 ? 175 GLY A CA  1 
ATOM   216  C C   . GLY A 1 32  C -88.443  31.690 40.175 1.00 48.52 ? 175 GLY A C   1 
ATOM   217  O O   . GLY A 1 32  C -88.647  30.481 40.313 1.00 48.02 ? 175 GLY A O   1 
ATOM   218  N N   . MET A 1 33  ? -89.292  32.622 40.599 1.00 47.21 ? 176 MET A N   1 
ATOM   219  C CA  . MET A 1 33  ? -90.555  32.284 41.246 1.00 45.93 ? 176 MET A CA  1 
ATOM   220  C C   . MET A 1 33  ? -91.633  32.094 40.184 1.00 43.96 ? 176 MET A C   1 
ATOM   221  O O   . MET A 1 33  ? -91.759  32.901 39.261 1.00 43.14 ? 176 MET A O   1 
ATOM   222  C CB  . MET A 1 33  ? -90.980  33.395 42.218 1.00 47.36 ? 176 MET A CB  1 
ATOM   223  C CG  . MET A 1 33  ? -90.164  33.485 43.503 1.00 49.30 ? 176 MET A CG  1 
ATOM   224  S SD  . MET A 1 33  ? -90.347  32.026 44.555 1.00 54.26 ? 176 MET A SD  1 
ATOM   225  C CE  . MET A 1 33  ? -88.818  31.140 44.182 1.00 53.23 ? 176 MET A CE  1 
ATOM   226  N N   . THR A 1 34  ? -92.410  31.026 40.327 1.00 42.12 ? 177 THR A N   1 
ATOM   227  C CA  . THR A 1 34  ? -93.480  30.718 39.387 1.00 40.09 ? 177 THR A CA  1 
ATOM   228  C C   . THR A 1 34  ? -94.704  31.597 39.628 1.00 39.24 ? 177 THR A C   1 
ATOM   229  O O   . THR A 1 34  ? -94.873  32.162 40.709 1.00 39.05 ? 177 THR A O   1 
ATOM   230  C CB  . THR A 1 34  ? -93.901  29.242 39.501 1.00 40.54 ? 177 THR A CB  1 
ATOM   231  O OG1 . THR A 1 34  ? -94.375  28.976 40.828 1.00 41.36 ? 177 THR A OG1 1 
ATOM   232  C CG2 . THR A 1 34  ? -92.724  28.334 39.200 1.00 39.29 ? 177 THR A CG2 1 
ATOM   233  N N   . SER A 1 35  ? -95.549  31.715 38.608 1.00 37.36 ? 178 SER A N   1 
ATOM   234  C CA  . SER A 1 35  ? -96.767  32.513 38.701 1.00 36.12 ? 178 SER A CA  1 
ATOM   235  C C   . SER A 1 35  ? -97.745  31.772 39.614 1.00 34.23 ? 178 SER A C   1 
ATOM   236  O O   . SER A 1 35  ? -97.977  30.577 39.436 1.00 34.11 ? 178 SER A O   1 
ATOM   237  C CB  . SER A 1 35  ? -97.374  32.694 37.307 1.00 37.02 ? 178 SER A CB  1 
ATOM   238  O OG  . SER A 1 35  ? -98.439  33.628 37.325 1.00 39.52 ? 178 SER A OG  1 
ATOM   239  N N   . ARG A 1 36  ? -98.325  32.475 40.583 1.00 32.40 ? 179 ARG A N   1 
ATOM   240  C CA  . ARG A 1 36  ? -99.246  31.836 41.523 1.00 29.75 ? 179 ARG A CA  1 
ATOM   241  C C   . ARG A 1 36  ? -100.695 31.773 41.043 1.00 29.57 ? 179 ARG A C   1 
ATOM   242  O O   . ARG A 1 36  ? -101.562 32.490 41.555 1.00 28.89 ? 179 ARG A O   1 
ATOM   243  C CB  . ARG A 1 36  ? -99.176  32.541 42.885 1.00 28.25 ? 179 ARG A CB  1 
ATOM   244  C CG  . ARG A 1 36  ? -97.772  32.566 43.494 1.00 25.31 ? 179 ARG A CG  1 
ATOM   245  C CD  . ARG A 1 36  ? -97.721  33.305 44.840 1.00 22.27 ? 179 ARG A CD  1 
ATOM   246  N NE  . ARG A 1 36  ? -98.627  32.709 45.817 1.00 18.62 ? 179 ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 36  ? -99.787  33.241 46.189 1.00 18.79 ? 179 ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 36  ? -100.196 34.397 45.677 1.00 17.16 ? 179 ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 36  ? -100.553 32.603 47.057 1.00 16.93 ? 179 ARG A NH2 1 
ATOM   250  N N   . SER A 1 37  ? -100.949 30.898 40.069 1.00 28.31 ? 180 SER A N   1 
ATOM   251  C CA  . SER A 1 37  ? -102.285 30.709 39.507 1.00 27.87 ? 180 SER A CA  1 
ATOM   252  C C   . SER A 1 37  ? -103.317 30.350 40.576 1.00 26.56 ? 180 SER A C   1 
ATOM   253  O O   . SER A 1 37  ? -103.097 29.461 41.399 1.00 25.50 ? 180 SER A O   1 
ATOM   254  C CB  . SER A 1 37  ? -102.259 29.608 38.440 1.00 29.78 ? 180 SER A CB  1 
ATOM   255  O OG  . SER A 1 37  ? -101.430 29.967 37.341 1.00 33.69 ? 180 SER A OG  1 
ATOM   256  N N   . GLY A 1 38  ? -104.446 31.049 40.552 1.00 25.39 ? 181 GLY A N   1 
ATOM   257  C CA  . GLY A 1 38  ? -105.499 30.805 41.518 1.00 26.18 ? 181 GLY A CA  1 
ATOM   258  C C   . GLY A 1 38  ? -105.530 31.827 42.643 1.00 26.87 ? 181 GLY A C   1 
ATOM   259  O O   . GLY A 1 38  ? -106.530 31.949 43.349 1.00 25.58 ? 181 GLY A O   1 
ATOM   260  N N   . THR A 1 39  ? -104.444 32.577 42.805 1.00 27.17 ? 182 THR A N   1 
ATOM   261  C CA  . THR A 1 39  ? -104.377 33.567 43.874 1.00 27.95 ? 182 THR A CA  1 
ATOM   262  C C   . THR A 1 39  ? -105.426 34.666 43.735 1.00 28.35 ? 182 THR A C   1 
ATOM   263  O O   . THR A 1 39  ? -105.902 35.193 44.746 1.00 28.18 ? 182 THR A O   1 
ATOM   264  C CB  . THR A 1 39  ? -102.984 34.223 43.961 1.00 27.93 ? 182 THR A CB  1 
ATOM   265  O OG1 . THR A 1 39  ? -102.957 35.124 45.075 1.00 26.55 ? 182 THR A OG1 1 
ATOM   266  C CG2 . THR A 1 39  ? -102.670 34.985 42.675 1.00 26.84 ? 182 THR A CG2 1 
ATOM   267  N N   . ASP A 1 40  ? -105.786 35.010 42.496 1.00 28.00 ? 183 ASP A N   1 
ATOM   268  C CA  . ASP A 1 40  ? -106.795 36.048 42.258 1.00 27.37 ? 183 ASP A CA  1 
ATOM   269  C C   . ASP A 1 40  ? -108.123 35.639 42.884 1.00 25.63 ? 183 ASP A C   1 
ATOM   270  O O   . ASP A 1 40  ? -108.889 36.485 43.352 1.00 24.38 ? 183 ASP A O   1 
ATOM   271  C CB  . ASP A 1 40  ? -107.015 36.295 40.754 1.00 27.68 ? 183 ASP A CB  1 
ATOM   272  C CG  . ASP A 1 40  ? -105.817 36.942 40.076 1.00 29.23 ? 183 ASP A CG  1 
ATOM   273  O OD1 . ASP A 1 40  ? -105.020 37.607 40.767 1.00 31.78 ? 183 ASP A OD1 1 
ATOM   274  O OD2 . ASP A 1 40  ? -105.679 36.803 38.841 1.00 29.90 ? 183 ASP A OD2 1 
ATOM   275  N N   . VAL A 1 41  ? -108.392 34.337 42.874 1.00 25.04 ? 184 VAL A N   1 
ATOM   276  C CA  . VAL A 1 41  ? -109.620 33.809 43.449 1.00 24.88 ? 184 VAL A CA  1 
ATOM   277  C C   . VAL A 1 41  ? -109.623 34.112 44.942 1.00 24.92 ? 184 VAL A C   1 
ATOM   278  O O   . VAL A 1 41  ? -110.641 34.519 45.505 1.00 24.63 ? 184 VAL A O   1 
ATOM   279  C CB  . VAL A 1 41  ? -109.726 32.286 43.241 1.00 25.39 ? 184 VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 41  ? -111.000 31.758 43.894 1.00 26.49 ? 184 VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 41  ? -109.724 31.967 41.759 1.00 26.43 ? 184 VAL A CG2 1 
ATOM   282  N N   . ASP A 1 42  ? -108.476 33.911 45.580 1.00 23.80 ? 185 ASP A N   1 
ATOM   283  C CA  . ASP A 1 42  ? -108.358 34.183 47.008 1.00 23.35 ? 185 ASP A CA  1 
ATOM   284  C C   . ASP A 1 42  ? -108.566 35.672 47.266 1.00 21.87 ? 185 ASP A C   1 
ATOM   285  O O   . ASP A 1 42  ? -109.342 36.058 48.139 1.00 21.52 ? 185 ASP A O   1 
ATOM   286  C CB  . ASP A 1 42  ? -106.972 33.779 47.541 1.00 22.72 ? 185 ASP A CB  1 
ATOM   287  C CG  . ASP A 1 42  ? -106.777 32.277 47.613 1.00 23.99 ? 185 ASP A CG  1 
ATOM   288  O OD1 . ASP A 1 42  ? -107.780 31.531 47.612 1.00 25.79 ? 185 ASP A OD1 1 
ATOM   289  O OD2 . ASP A 1 42  ? -105.610 31.841 47.692 1.00 25.08 ? 185 ASP A OD2 1 
ATOM   290  N N   . ALA A 1 43  ? -107.871 36.502 46.494 1.00 21.96 ? 186 ALA A N   1 
ATOM   291  C CA  . ALA A 1 43  ? -107.956 37.951 46.655 1.00 21.32 ? 186 ALA A CA  1 
ATOM   292  C C   . ALA A 1 43  ? -109.392 38.435 46.620 1.00 21.23 ? 186 ALA A C   1 
ATOM   293  O O   . ALA A 1 43  ? -109.845 39.148 47.518 1.00 20.14 ? 186 ALA A O   1 
ATOM   294  C CB  . ALA A 1 43  ? -107.150 38.647 45.568 1.00 20.20 ? 186 ALA A CB  1 
ATOM   295  N N   . ALA A 1 44  ? -110.104 38.042 45.572 1.00 23.03 ? 187 ALA A N   1 
ATOM   296  C CA  . ALA A 1 44  ? -111.489 38.443 45.402 1.00 24.46 ? 187 ALA A CA  1 
ATOM   297  C C   . ALA A 1 44  ? -112.351 37.863 46.516 1.00 25.64 ? 187 ALA A C   1 
ATOM   298  O O   . ALA A 1 44  ? -113.278 38.514 46.999 1.00 29.01 ? 187 ALA A O   1 
ATOM   299  C CB  . ALA A 1 44  ? -111.993 37.982 44.045 1.00 24.35 ? 187 ALA A CB  1 
ATOM   300  N N   . ASN A 1 45  ? -112.028 36.643 46.927 1.00 25.52 ? 188 ASN A N   1 
ATOM   301  C CA  . ASN A 1 45  ? -112.762 35.959 47.981 1.00 26.81 ? 188 ASN A CA  1 
ATOM   302  C C   . ASN A 1 45  ? -112.622 36.728 49.299 1.00 26.41 ? 188 ASN A C   1 
ATOM   303  O O   . ASN A 1 45  ? -113.607 36.969 50.002 1.00 26.34 ? 188 ASN A O   1 
ATOM   304  C CB  . ASN A 1 45  ? -112.214 34.538 48.142 1.00 29.11 ? 188 ASN A CB  1 
ATOM   305  C CG  . ASN A 1 45  ? -113.262 33.559 48.628 1.00 32.61 ? 188 ASN A CG  1 
ATOM   306  O OD1 . ASN A 1 45  ? -113.965 33.815 49.608 1.00 34.66 ? 188 ASN A OD1 1 
ATOM   307  N ND2 . ASN A 1 45  ? -113.372 32.424 47.944 1.00 34.46 ? 188 ASN A ND2 1 
ATOM   308  N N   . LEU A 1 46  ? -111.391 37.111 49.626 1.00 25.24 ? 189 LEU A N   1 
ATOM   309  C CA  . LEU A 1 46  ? -111.109 37.854 50.853 1.00 24.46 ? 189 LEU A CA  1 
ATOM   310  C C   . LEU A 1 46  ? -111.774 39.229 50.843 1.00 23.56 ? 189 LEU A C   1 
ATOM   311  O O   . LEU A 1 46  ? -112.260 39.703 51.870 1.00 23.86 ? 189 LEU A O   1 
ATOM   312  C CB  . LEU A 1 46  ? -109.595 38.007 51.027 1.00 23.18 ? 189 LEU A CB  1 
ATOM   313  C CG  . LEU A 1 46  ? -108.800 36.743 51.374 1.00 23.31 ? 189 LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 46  ? -107.354 36.894 50.928 1.00 23.72 ? 189 LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 46  ? -108.875 36.486 52.876 1.00 22.62 ? 189 LEU A CD2 1 
ATOM   316  N N   . ARG A 1 47  ? -111.794 39.865 49.674 1.00 24.76 ? 190 ARG A N   1 
ATOM   317  C CA  . ARG A 1 47  ? -112.396 41.188 49.528 1.00 24.47 ? 190 ARG A CA  1 
ATOM   318  C C   . ARG A 1 47  ? -113.875 41.144 49.889 1.00 23.89 ? 190 ARG A C   1 
ATOM   319  O O   . ARG A 1 47  ? -114.372 42.014 50.604 1.00 24.53 ? 190 ARG A O   1 
ATOM   320  C CB  . ARG A 1 47  ? -112.232 41.692 48.088 1.00 25.74 ? 190 ARG A CB  1 
ATOM   321  C CG  . ARG A 1 47  ? -112.751 43.110 47.853 1.00 28.30 ? 190 ARG A CG  1 
ATOM   322  C CD  . ARG A 1 47  ? -112.736 43.458 46.367 1.00 31.91 ? 190 ARG A CD  1 
ATOM   323  N NE  . ARG A 1 47  ? -113.070 44.856 46.104 1.00 32.63 ? 190 ARG A NE  1 
ATOM   324  C CZ  . ARG A 1 47  ? -112.297 45.887 46.438 1.00 33.00 ? 190 ARG A CZ  1 
ATOM   325  N NH1 . ARG A 1 47  ? -111.140 45.688 47.052 1.00 32.95 ? 190 ARG A NH1 1 
ATOM   326  N NH2 . ARG A 1 47  ? -112.677 47.123 46.146 1.00 35.99 ? 190 ARG A NH2 1 
ATOM   327  N N   . GLU A 1 48  ? -114.572 40.127 49.390 1.00 24.03 ? 191 GLU A N   1 
ATOM   328  C CA  . GLU A 1 48  ? -116.001 39.967 49.651 1.00 25.34 ? 191 GLU A CA  1 
ATOM   329  C C   . GLU A 1 48  ? -116.259 39.589 51.101 1.00 24.93 ? 191 GLU A C   1 
ATOM   330  O O   . GLU A 1 48  ? -117.172 40.116 51.739 1.00 24.95 ? 191 GLU A O   1 
ATOM   331  C CB  . GLU A 1 48  ? -116.599 38.881 48.748 1.00 24.65 ? 191 GLU A CB  1 
ATOM   332  C CG  . GLU A 1 48  ? -117.721 39.375 47.860 1.00 29.91 ? 191 GLU A CG  1 
ATOM   333  C CD  . GLU A 1 48  ? -118.770 40.167 48.620 1.00 30.38 ? 191 GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 48  ? -119.540 39.566 49.397 1.00 33.19 ? 191 GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 48  ? -118.818 41.399 48.442 1.00 30.78 ? 191 GLU A OE2 1 
ATOM   336  N N   . THR A 1 49  ? -115.455 38.662 51.608 1.00 23.58 ? 192 THR A N   1 
ATOM   337  C CA  . THR A 1 49  ? -115.587 38.202 52.985 1.00 22.73 ? 192 THR A CA  1 
ATOM   338  C C   . THR A 1 49  ? -115.430 39.363 53.963 1.00 23.00 ? 192 THR A C   1 
ATOM   339  O O   . THR A 1 49  ? -116.280 39.583 54.825 1.00 23.34 ? 192 THR A O   1 
ATOM   340  C CB  . THR A 1 49  ? -114.524 37.133 53.311 1.00 22.88 ? 192 THR A CB  1 
ATOM   341  O OG1 . THR A 1 49  ? -114.719 35.992 52.463 1.00 19.82 ? 192 THR A OG1 1 
ATOM   342  C CG2 . THR A 1 49  ? -114.611 36.715 54.782 1.00 20.34 ? 192 THR A CG2 1 
ATOM   343  N N   . PHE A 1 50  ? -114.346 40.114 53.820 1.00 22.78 ? 193 PHE A N   1 
ATOM   344  C CA  . PHE A 1 50  ? -114.100 41.227 54.719 1.00 24.25 ? 193 PHE A CA  1 
ATOM   345  C C   . PHE A 1 50  ? -114.989 42.448 54.491 1.00 24.51 ? 193 PHE A C   1 
ATOM   346  O O   . PHE A 1 50  ? -115.089 43.318 55.358 1.00 24.67 ? 193 PHE A O   1 
ATOM   347  C CB  . PHE A 1 50  ? -112.612 41.581 54.697 1.00 21.69 ? 193 PHE A CB  1 
ATOM   348  C CG  . PHE A 1 50  ? -111.772 40.631 55.510 1.00 23.06 ? 193 PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 50  ? -111.656 40.791 56.889 1.00 24.02 ? 193 PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 50  ? -111.170 39.525 54.917 1.00 22.03 ? 193 PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 50  ? -110.954 39.860 57.664 1.00 22.66 ? 193 PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 50  ? -110.466 38.588 55.683 1.00 21.94 ? 193 PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 50  ? -110.361 38.758 57.059 1.00 21.42 ? 193 PHE A CZ  1 
ATOM   354  N N   . ARG A 1 51  ? -115.648 42.513 53.338 1.00 23.75 ? 194 ARG A N   1 
ATOM   355  C CA  . ARG A 1 51  ? -116.559 43.623 53.082 1.00 23.09 ? 194 ARG A CA  1 
ATOM   356  C C   . ARG A 1 51  ? -117.795 43.306 53.910 1.00 23.72 ? 194 ARG A C   1 
ATOM   357  O O   . ARG A 1 51  ? -118.389 44.190 54.527 1.00 23.29 ? 194 ARG A O   1 
ATOM   358  C CB  . ARG A 1 51  ? -116.942 43.707 51.602 1.00 21.40 ? 194 ARG A CB  1 
ATOM   359  C CG  . ARG A 1 51  ? -117.878 44.871 51.280 1.00 19.62 ? 194 ARG A CG  1 
ATOM   360  C CD  . ARG A 1 51  ? -118.321 44.853 49.828 1.00 17.67 ? 194 ARG A CD  1 
ATOM   361  N NE  . ARG A 1 51  ? -119.271 43.782 49.551 1.00 16.93 ? 194 ARG A NE  1 
ATOM   362  C CZ  . ARG A 1 51  ? -120.564 43.830 49.855 1.00 18.32 ? 194 ARG A CZ  1 
ATOM   363  N NH1 . ARG A 1 51  ? -121.075 44.902 50.446 1.00 20.53 ? 194 ARG A NH1 1 
ATOM   364  N NH2 . ARG A 1 51  ? -121.347 42.803 49.572 1.00 16.76 ? 194 ARG A NH2 1 
ATOM   365  N N   . ASN A 1 52  ? -118.166 42.028 53.924 1.00 25.20 ? 195 ASN A N   1 
ATOM   366  C CA  . ASN A 1 52  ? -119.320 41.573 54.688 1.00 27.04 ? 195 ASN A CA  1 
ATOM   367  C C   . ASN A 1 52  ? -119.072 41.780 56.175 1.00 27.11 ? 195 ASN A C   1 
ATOM   368  O O   . ASN A 1 52  ? -120.013 41.939 56.947 1.00 29.55 ? 195 ASN A O   1 
ATOM   369  C CB  . ASN A 1 52  ? -119.593 40.090 54.426 1.00 29.29 ? 195 ASN A CB  1 
ATOM   370  C CG  . ASN A 1 52  ? -119.872 39.799 52.967 1.00 32.50 ? 195 ASN A CG  1 
ATOM   371  O OD1 . ASN A 1 52  ? -120.620 40.526 52.312 1.00 34.15 ? 195 ASN A OD1 1 
ATOM   372  N ND2 . ASN A 1 52  ? -119.282 38.725 52.452 1.00 33.85 ? 195 ASN A ND2 1 
ATOM   373  N N   . LEU A 1 53  ? -117.805 41.769 56.576 1.00 25.33 ? 196 LEU A N   1 
ATOM   374  C CA  . LEU A 1 53  ? -117.459 41.961 57.979 1.00 25.36 ? 196 LEU A CA  1 
ATOM   375  C C   . LEU A 1 53  ? -117.358 43.441 58.326 1.00 25.02 ? 196 LEU A C   1 
ATOM   376  O O   . LEU A 1 53  ? -117.092 43.798 59.477 1.00 25.72 ? 196 LEU A O   1 
ATOM   377  C CB  . LEU A 1 53  ? -116.140 41.253 58.307 1.00 24.24 ? 196 LEU A CB  1 
ATOM   378  C CG  . LEU A 1 53  ? -116.191 39.722 58.243 1.00 25.23 ? 196 LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 53  ? -114.831 39.138 58.616 1.00 24.44 ? 196 LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 53  ? -117.279 39.205 59.183 1.00 25.00 ? 196 LEU A CD2 1 
ATOM   381  N N   . LYS A 1 54  ? -117.574 44.293 57.325 1.00 24.53 ? 197 LYS A N   1 
ATOM   382  C CA  . LYS A 1 54  ? -117.529 45.744 57.495 1.00 21.82 ? 197 LYS A CA  1 
ATOM   383  C C   . LYS A 1 54  ? -116.131 46.338 57.543 1.00 20.91 ? 197 LYS A C   1 
ATOM   384  O O   . LYS A 1 54  ? -115.907 47.349 58.200 1.00 19.93 ? 197 LYS A O   1 
ATOM   385  C CB  . LYS A 1 54  ? -118.308 46.161 58.748 1.00 22.97 ? 197 LYS A CB  1 
ATOM   386  C CG  . LYS A 1 54  ? -119.793 46.409 58.528 1.00 26.20 ? 197 LYS A CG  1 
ATOM   387  C CD  . LYS A 1 54  ? -120.471 45.273 57.783 1.00 28.60 ? 197 LYS A CD  1 
ATOM   388  C CE  . LYS A 1 54  ? -121.929 45.607 57.500 1.00 28.18 ? 197 LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 54  ? -122.577 44.589 56.627 1.00 28.98 ? 197 LYS A NZ  1 
ATOM   390  N N   . TYR A 1 55  ? -115.189 45.715 56.843 1.00 21.17 ? 198 TYR A N   1 
ATOM   391  C CA  . TYR A 1 55  ? -113.822 46.230 56.792 1.00 23.41 ? 198 TYR A CA  1 
ATOM   392  C C   . TYR A 1 55  ? -113.624 47.010 55.504 1.00 24.84 ? 198 TYR A C   1 
ATOM   393  O O   . TYR A 1 55  ? -114.154 46.646 54.452 1.00 25.24 ? 198 TYR A O   1 
ATOM   394  C CB  . TYR A 1 55  ? -112.780 45.098 56.835 1.00 23.29 ? 198 TYR A CB  1 
ATOM   395  C CG  . TYR A 1 55  ? -112.484 44.577 58.222 1.00 22.69 ? 198 TYR A CG  1 
ATOM   396  C CD1 . TYR A 1 55  ? -113.289 43.601 58.814 1.00 21.77 ? 198 TYR A CD1 1 
ATOM   397  C CD2 . TYR A 1 55  ? -111.422 45.095 58.962 1.00 23.13 ? 198 TYR A CD2 1 
ATOM   398  C CE1 . TYR A 1 55  ? -113.046 43.157 60.113 1.00 20.37 ? 198 TYR A CE1 1 
ATOM   399  C CE2 . TYR A 1 55  ? -111.170 44.663 60.260 1.00 20.48 ? 198 TYR A CE2 1 
ATOM   400  C CZ  . TYR A 1 55  ? -111.986 43.696 60.833 1.00 21.27 ? 198 TYR A CZ  1 
ATOM   401  O OH  . TYR A 1 55  ? -111.750 43.294 62.132 1.00 18.95 ? 198 TYR A OH  1 
ATOM   402  N N   . GLU A 1 56  ? -112.866 48.092 55.598 1.00 25.31 ? 199 GLU A N   1 
ATOM   403  C CA  . GLU A 1 56  ? -112.562 48.918 54.446 1.00 25.41 ? 199 GLU A CA  1 
ATOM   404  C C   . GLU A 1 56  ? -111.439 48.171 53.728 1.00 24.89 ? 199 GLU A C   1 
ATOM   405  O O   . GLU A 1 56  ? -110.276 48.272 54.116 1.00 23.62 ? 199 GLU A O   1 
ATOM   406  C CB  . GLU A 1 56  ? -112.076 50.290 54.919 1.00 28.76 ? 199 GLU A CB  1 
ATOM   407  C CG  . GLU A 1 56  ? -111.818 51.302 53.816 1.00 31.47 ? 199 GLU A CG  1 
ATOM   408  C CD  . GLU A 1 56  ? -111.053 52.512 54.319 1.00 33.44 ? 199 GLU A CD  1 
ATOM   409  O OE1 . GLU A 1 56  ? -111.499 53.129 55.312 1.00 36.55 ? 199 GLU A OE1 1 
ATOM   410  O OE2 . GLU A 1 56  ? -110.005 52.848 53.726 1.00 34.97 ? 199 GLU A OE2 1 
ATOM   411  N N   . VAL A 1 57  ? -111.793 47.412 52.694 1.00 24.75 ? 200 VAL A N   1 
ATOM   412  C CA  . VAL A 1 57  ? -110.810 46.624 51.951 1.00 24.32 ? 200 VAL A CA  1 
ATOM   413  C C   . VAL A 1 57  ? -110.051 47.370 50.856 1.00 25.77 ? 200 VAL A C   1 
ATOM   414  O O   . VAL A 1 57  ? -110.626 48.153 50.099 1.00 26.28 ? 200 VAL A O   1 
ATOM   415  C CB  . VAL A 1 57  ? -111.465 45.385 51.296 1.00 22.79 ? 200 VAL A CB  1 
ATOM   416  C CG1 . VAL A 1 57  ? -110.411 44.573 50.557 1.00 21.53 ? 200 VAL A CG1 1 
ATOM   417  C CG2 . VAL A 1 57  ? -112.155 44.528 52.356 1.00 21.68 ? 200 VAL A CG2 1 
ATOM   418  N N   . ARG A 1 58  ? -108.750 47.105 50.778 1.00 25.82 ? 201 ARG A N   1 
ATOM   419  C CA  . ARG A 1 58  ? -107.895 47.707 49.767 1.00 27.99 ? 201 ARG A CA  1 
ATOM   420  C C   . ARG A 1 58  ? -107.042 46.608 49.145 1.00 30.01 ? 201 ARG A C   1 
ATOM   421  O O   . ARG A 1 58  ? -106.206 46.007 49.824 1.00 30.75 ? 201 ARG A O   1 
ATOM   422  C CB  . ARG A 1 58  ? -106.972 48.764 50.380 1.00 26.22 ? 201 ARG A CB  1 
ATOM   423  C CG  . ARG A 1 58  ? -107.670 49.945 51.019 1.00 26.36 ? 201 ARG A CG  1 
ATOM   424  C CD  . ARG A 1 58  ? -106.644 50.877 51.642 1.00 27.60 ? 201 ARG A CD  1 
ATOM   425  N NE  . ARG A 1 58  ? -107.255 51.970 52.392 1.00 29.67 ? 201 ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 58  ? -106.583 52.796 53.188 1.00 28.73 ? 201 ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 58  ? -105.275 52.659 53.343 1.00 30.62 ? 201 ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 58  ? -107.220 53.758 53.835 1.00 29.73 ? 201 ARG A NH2 1 
ATOM   429  N N   . ASN A 1 59  ? -107.262 46.333 47.864 1.00 30.87 ? 202 ASN A N   1 
ATOM   430  C CA  . ASN A 1 59  ? -106.480 45.320 47.171 1.00 31.54 ? 202 ASN A CA  1 
ATOM   431  C C   . ASN A 1 59  ? -105.292 45.960 46.467 1.00 32.94 ? 202 ASN A C   1 
ATOM   432  O O   . ASN A 1 59  ? -105.409 47.039 45.886 1.00 32.76 ? 202 ASN A O   1 
ATOM   433  C CB  . ASN A 1 59  ? -107.335 44.577 46.146 1.00 31.25 ? 202 ASN A CB  1 
ATOM   434  C CG  . ASN A 1 59  ? -108.231 43.529 46.781 1.00 32.28 ? 202 ASN A CG  1 
ATOM   435  O OD1 . ASN A 1 59  ? -109.200 43.853 47.472 1.00 32.05 ? 202 ASN A OD1 1 
ATOM   436  N ND2 . ASN A 1 59  ? -107.905 42.260 46.552 1.00 30.91 ? 202 ASN A ND2 1 
ATOM   437  N N   . LYS A 1 60  ? -104.149 45.288 46.533 1.00 33.40 ? 203 LYS A N   1 
ATOM   438  C CA  . LYS A 1 60  ? -102.921 45.757 45.904 1.00 35.11 ? 203 LYS A CA  1 
ATOM   439  C C   . LYS A 1 60  ? -102.275 44.557 45.230 1.00 36.03 ? 203 LYS A C   1 
ATOM   440  O O   . LYS A 1 60  ? -101.935 43.575 45.899 1.00 37.66 ? 203 LYS A O   1 
ATOM   441  C CB  . LYS A 1 60  ? -101.974 46.326 46.961 1.00 36.70 ? 203 LYS A CB  1 
ATOM   442  C CG  . LYS A 1 60  ? -102.368 47.690 47.494 1.00 40.16 ? 203 LYS A CG  1 
ATOM   443  C CD  . LYS A 1 60  ? -102.085 48.774 46.456 1.00 44.10 ? 203 LYS A CD  1 
ATOM   444  C CE  . LYS A 1 60  ? -102.278 50.166 47.036 1.00 46.39 ? 203 LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 60  ? -101.855 51.232 46.083 1.00 47.28 ? 203 LYS A NZ  1 
ATOM   446  N N   . ASN A 1 61  ? -102.097 44.624 43.914 1.00 34.85 ? 204 ASN A N   1 
ATOM   447  C CA  . ASN A 1 61  ? -101.509 43.497 43.199 1.00 34.38 ? 204 ASN A CA  1 
ATOM   448  C C   . ASN A 1 61  ? -100.070 43.696 42.727 1.00 34.52 ? 204 ASN A C   1 
ATOM   449  O O   . ASN A 1 61  ? -99.614  44.820 42.504 1.00 33.97 ? 204 ASN A O   1 
ATOM   450  C CB  . ASN A 1 61  ? -102.386 43.118 42.003 1.00 33.22 ? 204 ASN A CB  1 
ATOM   451  C CG  . ASN A 1 61  ? -103.848 42.978 42.375 1.00 32.41 ? 204 ASN A CG  1 
ATOM   452  O OD1 . ASN A 1 61  ? -104.618 43.932 42.278 1.00 34.22 ? 204 ASN A OD1 1 
ATOM   453  N ND2 . ASN A 1 61  ? -104.235 41.791 42.815 1.00 31.89 ? 204 ASN A ND2 1 
ATOM   454  N N   . ASP A 1 62  ? -99.365  42.578 42.585 1.00 34.10 ? 205 ASP A N   1 
ATOM   455  C CA  . ASP A 1 62  ? -97.981  42.565 42.131 1.00 35.33 ? 205 ASP A CA  1 
ATOM   456  C C   . ASP A 1 62  ? -97.151  43.742 42.625 1.00 35.20 ? 205 ASP A C   1 
ATOM   457  O O   . ASP A 1 62  ? -96.830  44.650 41.858 1.00 36.71 ? 205 ASP A O   1 
ATOM   458  C CB  . ASP A 1 62  ? -97.931  42.522 40.601 1.00 35.59 ? 205 ASP A CB  1 
ATOM   459  C CG  . ASP A 1 62  ? -98.648  41.318 40.030 1.00 36.07 ? 205 ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 62  ? -98.462  40.203 40.565 1.00 37.25 ? 205 ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 62  ? -99.391  41.480 39.042 1.00 37.19 ? 205 ASP A OD2 1 
ATOM   462  N N   . LEU A 1 63  ? -96.801  43.721 43.906 1.00 34.17 ? 206 LEU A N   1 
ATOM   463  C CA  . LEU A 1 63  ? -95.997  44.787 44.488 1.00 32.06 ? 206 LEU A CA  1 
ATOM   464  C C   . LEU A 1 63  ? -94.573  44.313 44.759 1.00 31.89 ? 206 LEU A C   1 
ATOM   465  O O   . LEU A 1 63  ? -94.358  43.183 45.199 1.00 31.21 ? 206 LEU A O   1 
ATOM   466  C CB  . LEU A 1 63  ? -96.621  45.274 45.796 1.00 32.01 ? 206 LEU A CB  1 
ATOM   467  C CG  . LEU A 1 63  ? -98.045  45.832 45.779 1.00 31.83 ? 206 LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 63  ? -98.310  46.520 47.110 1.00 32.60 ? 206 LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 63  ? -98.221  46.821 44.641 1.00 32.00 ? 206 LEU A CD2 1 
ATOM   470  N N   . THR A 1 64  ? -93.598  45.173 44.482 1.00 30.68 ? 207 THR A N   1 
ATOM   471  C CA  . THR A 1 64  ? -92.201  44.827 44.726 1.00 30.45 ? 207 THR A CA  1 
ATOM   472  C C   . THR A 1 64  ? -91.989  44.877 46.234 1.00 30.16 ? 207 THR A C   1 
ATOM   473  O O   . THR A 1 64  ? -92.867  45.324 46.972 1.00 30.56 ? 207 THR A O   1 
ATOM   474  C CB  . THR A 1 64  ? -91.229  45.834 44.056 1.00 29.22 ? 207 THR A CB  1 
ATOM   475  O OG1 . THR A 1 64  ? -91.432  47.139 44.611 1.00 27.02 ? 207 THR A OG1 1 
ATOM   476  C CG2 . THR A 1 64  ? -91.463  45.888 42.551 1.00 29.30 ? 207 THR A CG2 1 
ATOM   477  N N   . ARG A 1 65  ? -90.837  44.408 46.693 1.00 31.00 ? 208 ARG A N   1 
ATOM   478  C CA  . ARG A 1 65  ? -90.544  44.432 48.116 1.00 32.43 ? 208 ARG A CA  1 
ATOM   479  C C   . ARG A 1 65  ? -90.616  45.876 48.583 1.00 31.80 ? 208 ARG A C   1 
ATOM   480  O O   . ARG A 1 65  ? -91.190  46.178 49.631 1.00 30.49 ? 208 ARG A O   1 
ATOM   481  C CB  . ARG A 1 65  ? -89.153  43.860 48.391 1.00 33.09 ? 208 ARG A CB  1 
ATOM   482  C CG  . ARG A 1 65  ? -88.079  44.350 47.445 1.00 39.07 ? 208 ARG A CG  1 
ATOM   483  C CD  . ARG A 1 65  ? -86.703  44.298 48.091 1.00 42.89 ? 208 ARG A CD  1 
ATOM   484  N NE  . ARG A 1 65  ? -86.355  42.973 48.595 1.00 47.41 ? 208 ARG A NE  1 
ATOM   485  C CZ  . ARG A 1 65  ? -85.356  42.233 48.122 1.00 49.51 ? 208 ARG A CZ  1 
ATOM   486  N NH1 . ARG A 1 65  ? -84.605  42.688 47.127 1.00 49.51 ? 208 ARG A NH1 1 
ATOM   487  N NH2 . ARG A 1 65  ? -85.098  41.045 48.651 1.00 49.08 ? 208 ARG A NH2 1 
ATOM   488  N N   . GLU A 1 66  ? -90.035  46.771 47.789 1.00 32.91 ? 209 GLU A N   1 
ATOM   489  C CA  . GLU A 1 66  ? -90.036  48.189 48.119 1.00 32.75 ? 209 GLU A CA  1 
ATOM   490  C C   . GLU A 1 66  ? -91.467  48.682 48.284 1.00 32.15 ? 209 GLU A C   1 
ATOM   491  O O   . GLU A 1 66  ? -91.792  49.375 49.249 1.00 32.55 ? 209 GLU A O   1 
ATOM   492  C CB  . GLU A 1 66  ? -89.352  49.005 47.017 1.00 34.68 ? 209 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 66  ? -87.877  48.701 46.790 1.00 37.29 ? 209 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 66  ? -87.641  47.362 46.118 1.00 38.77 ? 209 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 66  ? -88.408  47.008 45.197 1.00 37.47 ? 209 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 66  ? -86.673  46.671 46.501 1.00 41.33 ? 209 GLU A OE2 1 
ATOM   497  N N   . GLU A 1 67  ? -92.322  48.316 47.336 1.00 31.23 ? 210 GLU A N   1 
ATOM   498  C CA  . GLU A 1 67  ? -93.713  48.733 47.372 1.00 31.33 ? 210 GLU A CA  1 
ATOM   499  C C   . GLU A 1 67  ? -94.457  48.169 48.576 1.00 31.62 ? 210 GLU A C   1 
ATOM   500  O O   . GLU A 1 67  ? -95.390  48.795 49.085 1.00 29.83 ? 210 GLU A O   1 
ATOM   501  C CB  . GLU A 1 67  ? -94.415  48.319 46.083 1.00 32.08 ? 210 GLU A CB  1 
ATOM   502  C CG  . GLU A 1 67  ? -93.812  48.948 44.842 1.00 33.28 ? 210 GLU A CG  1 
ATOM   503  C CD  . GLU A 1 67  ? -94.570  48.574 43.591 1.00 35.04 ? 210 GLU A CD  1 
ATOM   504  O OE1 . GLU A 1 67  ? -94.644  47.369 43.279 1.00 35.99 ? 210 GLU A OE1 1 
ATOM   505  O OE2 . GLU A 1 67  ? -95.100  49.485 42.925 1.00 37.38 ? 210 GLU A OE2 1 
ATOM   506  N N   . ILE A 1 68  ? -94.047  46.989 49.034 1.00 30.91 ? 211 ILE A N   1 
ATOM   507  C CA  . ILE A 1 68  ? -94.699  46.387 50.186 1.00 30.47 ? 211 ILE A CA  1 
ATOM   508  C C   . ILE A 1 68  ? -94.332  47.171 51.440 1.00 31.35 ? 211 ILE A C   1 
ATOM   509  O O   . ILE A 1 68  ? -95.207  47.633 52.170 1.00 31.05 ? 211 ILE A O   1 
ATOM   510  C CB  . ILE A 1 68  ? -94.294  44.902 50.354 1.00 29.12 ? 211 ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 68  ? -94.933  44.069 49.239 1.00 27.27 ? 211 ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 68  ? -94.731  44.390 51.723 1.00 26.34 ? 211 ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 68  ? -94.574  42.605 49.272 1.00 26.68 ? 211 ILE A CD1 1 
ATOM   514  N N   . VAL A 1 69  ? -93.037  47.338 51.680 1.00 32.10 ? 212 VAL A N   1 
ATOM   515  C CA  . VAL A 1 69  ? -92.588  48.071 52.856 1.00 33.61 ? 212 VAL A CA  1 
ATOM   516  C C   . VAL A 1 69  ? -93.134  49.499 52.869 1.00 34.24 ? 212 VAL A C   1 
ATOM   517  O O   . VAL A 1 69  ? -93.582  49.992 53.905 1.00 34.13 ? 212 VAL A O   1 
ATOM   518  C CB  . VAL A 1 69  ? -91.054  48.119 52.922 1.00 34.12 ? 212 VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 69  ? -90.607  48.896 54.157 1.00 35.30 ? 212 VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 69  ? -90.501  46.702 52.950 1.00 33.75 ? 212 VAL A CG2 1 
ATOM   521  N N   . GLU A 1 70  ? -93.105  50.154 51.714 1.00 34.57 ? 213 GLU A N   1 
ATOM   522  C CA  . GLU A 1 70  ? -93.592  51.524 51.605 1.00 35.61 ? 213 GLU A CA  1 
ATOM   523  C C   . GLU A 1 70  ? -95.082  51.605 51.919 1.00 34.72 ? 213 GLU A C   1 
ATOM   524  O O   . GLU A 1 70  ? -95.537  52.519 52.610 1.00 33.48 ? 213 GLU A O   1 
ATOM   525  C CB  . GLU A 1 70  ? -93.337  52.061 50.193 1.00 39.04 ? 213 GLU A CB  1 
ATOM   526  C CG  . GLU A 1 70  ? -93.750  53.515 49.996 1.00 44.21 ? 213 GLU A CG  1 
ATOM   527  C CD  . GLU A 1 70  ? -93.725  53.951 48.535 1.00 47.29 ? 213 GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 70  ? -93.949  55.155 48.278 1.00 48.34 ? 213 GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 70  ? -93.490  53.096 47.648 1.00 47.62 ? 213 GLU A OE2 1 
ATOM   530  N N   . LEU A 1 71  ? -95.838  50.643 51.398 1.00 34.24 ? 214 LEU A N   1 
ATOM   531  C CA  . LEU A 1 71  ? -97.280  50.594 51.605 1.00 33.55 ? 214 LEU A CA  1 
ATOM   532  C C   . LEU A 1 71  ? -97.618  50.382 53.071 1.00 34.00 ? 214 LEU A C   1 
ATOM   533  O O   . LEU A 1 71  ? -98.425  51.112 53.649 1.00 32.99 ? 214 LEU A O   1 
ATOM   534  C CB  . LEU A 1 71  ? -97.894  49.464 50.775 1.00 34.12 ? 214 LEU A CB  1 
ATOM   535  C CG  . LEU A 1 71  ? -99.371  49.141 51.023 1.00 33.54 ? 214 LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 71  ? -100.215 50.368 50.754 1.00 34.06 ? 214 LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 71  ? -99.802  47.994 50.127 1.00 35.04 ? 214 LEU A CD2 1 
ATOM   538  N N   . MET A 1 72  ? -96.994  49.373 53.666 1.00 34.96 ? 215 MET A N   1 
ATOM   539  C CA  . MET A 1 72  ? -97.223  49.049 55.065 1.00 35.50 ? 215 MET A CA  1 
ATOM   540  C C   . MET A 1 72  ? -96.807  50.190 55.979 1.00 36.30 ? 215 MET A C   1 
ATOM   541  O O   . MET A 1 72  ? -97.445  50.441 57.002 1.00 35.84 ? 215 MET A O   1 
ATOM   542  C CB  . MET A 1 72  ? -96.466  47.772 55.434 1.00 36.66 ? 215 MET A CB  1 
ATOM   543  C CG  . MET A 1 72  ? -97.065  46.518 54.821 1.00 36.20 ? 215 MET A CG  1 
ATOM   544  S SD  . MET A 1 72  ? -98.823  46.362 55.232 1.00 39.96 ? 215 MET A SD  1 
ATOM   545  C CE  . MET A 1 72  ? -99.580  46.624 53.653 1.00 35.42 ? 215 MET A CE  1 
ATOM   546  N N   . ARG A 1 73  ? -95.739  50.886 55.608 1.00 36.48 ? 216 ARG A N   1 
ATOM   547  C CA  . ARG A 1 73  ? -95.265  52.001 56.408 1.00 37.44 ? 216 ARG A CA  1 
ATOM   548  C C   . ARG A 1 73  ? -96.261  53.155 56.375 1.00 36.21 ? 216 ARG A C   1 
ATOM   549  O O   . ARG A 1 73  ? -96.492  53.804 57.389 1.00 36.45 ? 216 ARG A O   1 
ATOM   550  C CB  . ARG A 1 73  ? -93.903  52.473 55.905 1.00 40.15 ? 216 ARG A CB  1 
ATOM   551  C CG  . ARG A 1 73  ? -93.274  53.563 56.758 1.00 44.46 ? 216 ARG A CG  1 
ATOM   552  C CD  . ARG A 1 73  ? -91.857  53.832 56.299 1.00 49.25 ? 216 ARG A CD  1 
ATOM   553  N NE  . ARG A 1 73  ? -91.820  54.176 54.882 1.00 52.35 ? 216 ARG A NE  1 
ATOM   554  C CZ  . ARG A 1 73  ? -90.871  53.778 54.041 1.00 54.78 ? 216 ARG A CZ  1 
ATOM   555  N NH1 . ARG A 1 73  ? -89.874  53.015 54.475 1.00 55.28 ? 216 ARG A NH1 1 
ATOM   556  N NH2 . ARG A 1 73  ? -90.920  54.138 52.763 1.00 54.54 ? 216 ARG A NH2 1 
ATOM   557  N N   . ASP A 1 74  ? -96.857  53.406 55.214 1.00 35.55 ? 217 ASP A N   1 
ATOM   558  C CA  . ASP A 1 74  ? -97.827  54.487 55.092 1.00 35.56 ? 217 ASP A CA  1 
ATOM   559  C C   . ASP A 1 74  ? -99.142  54.144 55.779 1.00 36.05 ? 217 ASP A C   1 
ATOM   560  O O   . ASP A 1 74  ? -99.798  55.011 56.363 1.00 36.39 ? 217 ASP A O   1 
ATOM   561  C CB  . ASP A 1 74  ? -98.093  54.824 53.621 1.00 37.24 ? 217 ASP A CB  1 
ATOM   562  C CG  . ASP A 1 74  ? -96.878  55.413 52.930 1.00 38.74 ? 217 ASP A CG  1 
ATOM   563  O OD1 . ASP A 1 74  ? -96.115  56.149 53.592 1.00 39.63 ? 217 ASP A OD1 1 
ATOM   564  O OD2 . ASP A 1 74  ? -96.692  55.152 51.724 1.00 39.28 ? 217 ASP A OD2 1 
ATOM   565  N N   . VAL A 1 75  ? -99.534  52.879 55.711 1.00 35.87 ? 218 VAL A N   1 
ATOM   566  C CA  . VAL A 1 75  ? -100.773 52.467 56.347 1.00 36.64 ? 218 VAL A CA  1 
ATOM   567  C C   . VAL A 1 75  ? -100.660 52.649 57.861 1.00 36.92 ? 218 VAL A C   1 
ATOM   568  O O   . VAL A 1 75  ? -101.611 53.087 58.516 1.00 36.85 ? 218 VAL A O   1 
ATOM   569  C CB  . VAL A 1 75  ? -101.112 50.988 56.015 1.00 37.08 ? 218 VAL A CB  1 
ATOM   570  C CG1 . VAL A 1 75  ? -102.284 50.517 56.856 1.00 35.80 ? 218 VAL A CG1 1 
ATOM   571  C CG2 . VAL A 1 75  ? -101.459 50.856 54.535 1.00 36.50 ? 218 VAL A CG2 1 
ATOM   572  N N   . SER A 1 76  ? -99.489  52.335 58.409 1.00 36.03 ? 219 SER A N   1 
ATOM   573  C CA  . SER A 1 76  ? -99.271  52.459 59.847 1.00 36.82 ? 219 SER A CA  1 
ATOM   574  C C   . SER A 1 76  ? -99.244  53.911 60.318 1.00 37.80 ? 219 SER A C   1 
ATOM   575  O O   . SER A 1 76  ? -99.508  54.191 61.486 1.00 38.65 ? 219 SER A O   1 
ATOM   576  C CB  . SER A 1 76  ? -97.959  51.780 60.251 1.00 35.81 ? 219 SER A CB  1 
ATOM   577  O OG  . SER A 1 76  ? -96.834  52.546 59.859 1.00 34.48 ? 219 SER A OG  1 
ATOM   578  N N   . LYS A 1 77  ? -98.922  54.831 59.413 1.00 38.47 ? 220 LYS A N   1 
ATOM   579  C CA  . LYS A 1 77  ? -98.862  56.246 59.761 1.00 39.39 ? 220 LYS A CA  1 
ATOM   580  C C   . LYS A 1 77  ? -100.225 56.922 59.695 1.00 38.39 ? 220 LYS A C   1 
ATOM   581  O O   . LYS A 1 77  ? -100.363 58.097 60.041 1.00 38.88 ? 220 LYS A O   1 
ATOM   582  C CB  . LYS A 1 77  ? -97.880  56.972 58.843 1.00 42.58 ? 220 LYS A CB  1 
ATOM   583  C CG  . LYS A 1 77  ? -96.422  56.625 59.109 1.00 46.07 ? 220 LYS A CG  1 
ATOM   584  C CD  . LYS A 1 77  ? -95.518  57.072 57.963 1.00 50.36 ? 220 LYS A CD  1 
ATOM   585  C CE  . LYS A 1 77  ? -95.604  58.573 57.709 1.00 51.90 ? 220 LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 77  ? -94.747  58.981 56.557 1.00 53.56 ? 220 LYS A NZ  1 
ATOM   587  N N   . GLU A 1 78  ? -101.231 56.180 59.246 1.00 37.07 ? 221 GLU A N   1 
ATOM   588  C CA  . GLU A 1 78  ? -102.587 56.713 59.155 1.00 35.76 ? 221 GLU A CA  1 
ATOM   589  C C   . GLU A 1 78  ? -103.165 56.817 60.552 1.00 35.86 ? 221 GLU A C   1 
ATOM   590  O O   . GLU A 1 78  ? -102.628 56.235 61.489 1.00 36.91 ? 221 GLU A O   1 
ATOM   591  C CB  . GLU A 1 78  ? -103.476 55.790 58.322 1.00 34.72 ? 221 GLU A CB  1 
ATOM   592  C CG  . GLU A 1 78  ? -103.235 55.861 56.833 1.00 33.81 ? 221 GLU A CG  1 
ATOM   593  C CD  . GLU A 1 78  ? -104.256 55.060 56.053 1.00 33.15 ? 221 GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 78  ? -105.434 55.032 56.469 1.00 31.99 ? 221 GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 78  ? -103.886 54.475 55.018 1.00 33.66 ? 221 GLU A OE2 1 
ATOM   596  N N   . ASP A 1 79  ? -104.257 57.561 60.694 1.00 36.45 ? 222 ASP A N   1 
ATOM   597  C CA  . ASP A 1 79  ? -104.900 57.701 61.991 1.00 35.74 ? 222 ASP A CA  1 
ATOM   598  C C   . ASP A 1 79  ? -105.997 56.651 62.114 1.00 34.18 ? 222 ASP A C   1 
ATOM   599  O O   . ASP A 1 79  ? -107.037 56.751 61.463 1.00 34.57 ? 222 ASP A O   1 
ATOM   600  C CB  . ASP A 1 79  ? -105.499 59.098 62.157 1.00 37.65 ? 222 ASP A CB  1 
ATOM   601  C CG  . ASP A 1 79  ? -106.283 59.238 63.448 1.00 40.89 ? 222 ASP A CG  1 
ATOM   602  O OD1 . ASP A 1 79  ? -105.741 58.870 64.509 1.00 41.85 ? 222 ASP A OD1 1 
ATOM   603  O OD2 . ASP A 1 79  ? -107.438 59.711 63.409 1.00 44.48 ? 222 ASP A OD2 1 
ATOM   604  N N   . HIS A 1 80  ? -105.754 55.647 62.953 1.00 32.21 ? 224 HIS A N   1 
ATOM   605  C CA  . HIS A 1 80  ? -106.697 54.549 63.169 1.00 31.07 ? 224 HIS A CA  1 
ATOM   606  C C   . HIS A 1 80  ? -107.605 54.761 64.389 1.00 30.41 ? 224 HIS A C   1 
ATOM   607  O O   . HIS A 1 80  ? -108.275 53.830 64.838 1.00 30.56 ? 224 HIS A O   1 
ATOM   608  C CB  . HIS A 1 80  ? -105.918 53.242 63.348 1.00 29.31 ? 224 HIS A CB  1 
ATOM   609  C CG  . HIS A 1 80  ? -105.089 52.855 62.160 1.00 27.81 ? 224 HIS A CG  1 
ATOM   610  N ND1 . HIS A 1 80  ? -105.588 52.101 61.118 1.00 26.71 ? 224 HIS A ND1 1 
ATOM   611  C CD2 . HIS A 1 80  ? -103.792 53.099 61.861 1.00 26.40 ? 224 HIS A CD2 1 
ATOM   612  C CE1 . HIS A 1 80  ? -104.630 51.895 60.231 1.00 26.51 ? 224 HIS A CE1 1 
ATOM   613  N NE2 . HIS A 1 80  ? -103.530 52.490 60.657 1.00 25.99 ? 224 HIS A NE2 1 
ATOM   614  N N   . SER A 1 81  ? -107.627 55.984 64.907 1.00 30.19 ? 225 SER A N   1 
ATOM   615  C CA  . SER A 1 81  ? -108.424 56.335 66.083 1.00 29.93 ? 225 SER A CA  1 
ATOM   616  C C   . SER A 1 81  ? -109.890 55.918 66.058 1.00 29.83 ? 225 SER A C   1 
ATOM   617  O O   . SER A 1 81  ? -110.451 55.555 67.090 1.00 29.75 ? 225 SER A O   1 
ATOM   618  C CB  . SER A 1 81  ? -108.350 57.843 66.329 1.00 30.52 ? 225 SER A CB  1 
ATOM   619  O OG  . SER A 1 81  ? -107.018 58.245 66.586 1.00 33.64 ? 225 SER A OG  1 
ATOM   620  N N   . LYS A 1 82  ? -110.519 55.980 64.892 1.00 30.41 ? 226 LYS A N   1 
ATOM   621  C CA  . LYS A 1 82  ? -111.925 55.605 64.783 1.00 31.56 ? 226 LYS A CA  1 
ATOM   622  C C   . LYS A 1 82  ? -112.100 54.177 64.272 1.00 31.36 ? 226 LYS A C   1 
ATOM   623  O O   . LYS A 1 82  ? -113.213 53.759 63.948 1.00 31.76 ? 226 LYS A O   1 
ATOM   624  C CB  . LYS A 1 82  ? -112.663 56.581 63.854 1.00 34.69 ? 226 LYS A CB  1 
ATOM   625  C CG  . LYS A 1 82  ? -112.870 57.977 64.438 1.00 37.23 ? 226 LYS A CG  1 
ATOM   626  C CD  . LYS A 1 82  ? -111.548 58.640 64.807 1.00 41.61 ? 226 LYS A CD  1 
ATOM   627  C CE  . LYS A 1 82  ? -111.764 59.975 65.517 1.00 43.04 ? 226 LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 82  ? -110.480 60.609 65.933 1.00 42.87 ? 226 LYS A NZ  1 
ATOM   629  N N   . ARG A 1 83  ? -111.000 53.429 64.206 1.00 29.88 ? 227 ARG A N   1 
ATOM   630  C CA  . ARG A 1 83  ? -111.049 52.053 63.720 1.00 28.94 ? 227 ARG A CA  1 
ATOM   631  C C   . ARG A 1 83  ? -110.807 51.039 64.838 1.00 27.15 ? 227 ARG A C   1 
ATOM   632  O O   . ARG A 1 83  ? -109.877 51.178 65.626 1.00 26.12 ? 227 ARG A O   1 
ATOM   633  C CB  . ARG A 1 83  ? -110.022 51.861 62.604 1.00 29.50 ? 227 ARG A CB  1 
ATOM   634  C CG  . ARG A 1 83  ? -110.270 52.739 61.389 1.00 27.89 ? 227 ARG A CG  1 
ATOM   635  C CD  . ARG A 1 83  ? -109.013 52.845 60.541 1.00 27.98 ? 227 ARG A CD  1 
ATOM   636  N NE  . ARG A 1 83  ? -109.210 53.667 59.352 1.00 27.47 ? 227 ARG A NE  1 
ATOM   637  C CZ  . ARG A 1 83  ? -108.223 54.109 58.581 1.00 27.83 ? 227 ARG A CZ  1 
ATOM   638  N NH1 . ARG A 1 83  ? -106.965 53.809 58.880 1.00 27.16 ? 227 ARG A NH1 1 
ATOM   639  N NH2 . ARG A 1 83  ? -108.495 54.840 57.506 1.00 27.50 ? 227 ARG A NH2 1 
ATOM   640  N N   . SER A 1 84  ? -111.658 50.019 64.885 1.00 24.89 ? 228 SER A N   1 
ATOM   641  C CA  . SER A 1 84  ? -111.593 48.970 65.898 1.00 23.31 ? 228 SER A CA  1 
ATOM   642  C C   . SER A 1 84  ? -110.389 48.042 65.791 1.00 23.59 ? 228 SER A C   1 
ATOM   643  O O   . SER A 1 84  ? -109.912 47.517 66.799 1.00 23.14 ? 228 SER A O   1 
ATOM   644  C CB  . SER A 1 84  ? -112.862 48.119 65.843 1.00 21.20 ? 228 SER A CB  1 
ATOM   645  O OG  . SER A 1 84  ? -114.011 48.889 66.129 1.00 19.30 ? 228 SER A OG  1 
ATOM   646  N N   . SER A 1 85  ? -109.899 47.835 64.575 1.00 23.21 ? 229 SER A N   1 
ATOM   647  C CA  . SER A 1 85  ? -108.778 46.932 64.380 1.00 21.91 ? 229 SER A CA  1 
ATOM   648  C C   . SER A 1 85  ? -108.059 47.149 63.056 1.00 22.11 ? 229 SER A C   1 
ATOM   649  O O   . SER A 1 85  ? -108.315 48.120 62.343 1.00 21.03 ? 229 SER A O   1 
ATOM   650  C CB  . SER A 1 85  ? -109.282 45.495 64.436 1.00 23.07 ? 229 SER A CB  1 
ATOM   651  O OG  . SER A 1 85  ? -110.261 45.278 63.430 1.00 22.80 ? 229 SER A OG  1 
ATOM   652  N N   . PHE A 1 86  ? -107.157 46.224 62.739 1.00 21.52 ? 230 PHE A N   1 
ATOM   653  C CA  . PHE A 1 86  ? -106.392 46.269 61.502 1.00 21.14 ? 230 PHE A CA  1 
ATOM   654  C C   . PHE A 1 86  ? -106.192 44.864 60.959 1.00 22.30 ? 230 PHE A C   1 
ATOM   655  O O   . PHE A 1 86  ? -105.895 43.934 61.713 1.00 22.65 ? 230 PHE A O   1 
ATOM   656  C CB  . PHE A 1 86  ? -105.019 46.900 61.720 1.00 19.12 ? 230 PHE A CB  1 
ATOM   657  C CG  . PHE A 1 86  ? -104.160 46.897 60.487 1.00 19.53 ? 230 PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 86  ? -104.544 47.615 59.355 1.00 19.37 ? 230 PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 86  ? -102.974 46.170 60.449 1.00 19.46 ? 230 PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 86  ? -103.758 47.607 58.201 1.00 19.00 ? 230 PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 86  ? -102.180 46.154 59.302 1.00 18.17 ? 230 PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 86  ? -102.575 46.876 58.176 1.00 19.13 ? 230 PHE A CZ  1 
ATOM   663  N N   . VAL A 1 87  ? -106.346 44.714 59.648 1.00 21.05 ? 231 VAL A N   1 
ATOM   664  C CA  . VAL A 1 87  ? -106.167 43.418 59.013 1.00 19.86 ? 231 VAL A CA  1 
ATOM   665  C C   . VAL A 1 87  ? -105.268 43.524 57.794 1.00 19.90 ? 231 VAL A C   1 
ATOM   666  O O   . VAL A 1 87  ? -105.456 44.395 56.950 1.00 20.90 ? 231 VAL A O   1 
ATOM   667  C CB  . VAL A 1 87  ? -107.515 42.820 58.557 1.00 20.36 ? 231 VAL A CB  1 
ATOM   668  C CG1 . VAL A 1 87  ? -107.281 41.474 57.867 1.00 19.14 ? 231 VAL A CG1 1 
ATOM   669  C CG2 . VAL A 1 87  ? -108.441 42.660 59.746 1.00 16.10 ? 231 VAL A CG2 1 
ATOM   670  N N   . CYS A 1 88  ? -104.283 42.639 57.715 1.00 19.45 ? 232 CYS A N   1 
ATOM   671  C CA  . CYS A 1 88  ? -103.387 42.603 56.572 1.00 18.51 ? 232 CYS A CA  1 
ATOM   672  C C   . CYS A 1 88  ? -103.310 41.168 56.074 1.00 19.63 ? 232 CYS A C   1 
ATOM   673  O O   . CYS A 1 88  ? -103.073 40.235 56.849 1.00 18.56 ? 232 CYS A O   1 
ATOM   674  C CB  . CYS A 1 88  ? -101.990 43.089 56.948 1.00 20.11 ? 232 CYS A CB  1 
ATOM   675  S SG  . CYS A 1 88  ? -100.799 43.023 55.579 1.00 23.02 ? 232 CYS A SG  1 
ATOM   676  N N   . VAL A 1 89  ? -103.528 40.994 54.779 1.00 20.08 ? 233 VAL A N   1 
ATOM   677  C CA  . VAL A 1 89  ? -103.471 39.677 54.175 1.00 19.88 ? 233 VAL A CA  1 
ATOM   678  C C   . VAL A 1 89  ? -102.366 39.679 53.134 1.00 20.29 ? 233 VAL A C   1 
ATOM   679  O O   . VAL A 1 89  ? -102.275 40.580 52.298 1.00 22.18 ? 233 VAL A O   1 
ATOM   680  C CB  . VAL A 1 89  ? -104.803 39.306 53.507 1.00 18.97 ? 233 VAL A CB  1 
ATOM   681  C CG1 . VAL A 1 89  ? -104.777 37.849 53.086 1.00 18.90 ? 233 VAL A CG1 1 
ATOM   682  C CG2 . VAL A 1 89  ? -105.953 39.548 54.467 1.00 17.43 ? 233 VAL A CG2 1 
ATOM   683  N N   . LEU A 1 90  ? -101.515 38.669 53.200 1.00 20.53 ? 234 LEU A N   1 
ATOM   684  C CA  . LEU A 1 90  ? -100.406 38.562 52.277 1.00 21.00 ? 234 LEU A CA  1 
ATOM   685  C C   . LEU A 1 90  ? -100.535 37.261 51.503 1.00 22.36 ? 234 LEU A C   1 
ATOM   686  O O   . LEU A 1 90  ? -100.680 36.186 52.093 1.00 22.94 ? 234 LEU A O   1 
ATOM   687  C CB  . LEU A 1 90  ? -99.095  38.603 53.060 1.00 22.07 ? 234 LEU A CB  1 
ATOM   688  C CG  . LEU A 1 90  ? -98.948  39.867 53.916 1.00 19.56 ? 234 LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 90  ? -97.849  39.676 54.945 1.00 23.83 ? 234 LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 90  ? -98.653  41.058 53.020 1.00 21.55 ? 234 LEU A CD2 1 
ATOM   691  N N   . LEU A 1 91  ? -100.499 37.372 50.180 1.00 22.08 ? 235 LEU A N   1 
ATOM   692  C CA  . LEU A 1 91  ? -100.625 36.219 49.297 1.00 22.24 ? 235 LEU A CA  1 
ATOM   693  C C   . LEU A 1 91  ? -99.424  36.231 48.366 1.00 22.15 ? 235 LEU A C   1 
ATOM   694  O O   . LEU A 1 91  ? -99.338  37.073 47.475 1.00 21.77 ? 235 LEU A O   1 
ATOM   695  C CB  . LEU A 1 91  ? -101.917 36.336 48.483 1.00 22.78 ? 235 LEU A CB  1 
ATOM   696  C CG  . LEU A 1 91  ? -103.189 36.603 49.293 1.00 22.71 ? 235 LEU A CG  1 
ATOM   697  C CD1 . LEU A 1 91  ? -104.386 36.781 48.360 1.00 23.15 ? 235 LEU A CD1 1 
ATOM   698  C CD2 . LEU A 1 91  ? -103.416 35.443 50.254 1.00 23.64 ? 235 LEU A CD2 1 
ATOM   699  N N   . SER A 1 92  ? -98.497  35.302 48.568 1.00 22.32 ? 236 SER A N   1 
ATOM   700  C CA  . SER A 1 92  ? -97.301  35.261 47.741 1.00 23.62 ? 236 SER A CA  1 
ATOM   701  C C   . SER A 1 92  ? -96.466  34.042 48.092 1.00 23.18 ? 236 SER A C   1 
ATOM   702  O O   . SER A 1 92  ? -96.922  33.156 48.815 1.00 24.04 ? 236 SER A O   1 
ATOM   703  C CB  . SER A 1 92  ? -96.482  36.537 47.979 1.00 24.46 ? 236 SER A CB  1 
ATOM   704  O OG  . SER A 1 92  ? -95.303  36.571 47.199 1.00 25.91 ? 236 SER A OG  1 
ATOM   705  N N   . HIS A 1 93  ? -95.251  33.990 47.554 1.00 23.31 ? 237 HIS A N   1 
ATOM   706  C CA  . HIS A 1 93  ? -94.332  32.901 47.857 1.00 24.13 ? 237 HIS A CA  1 
ATOM   707  C C   . HIS A 1 93  ? -93.643  33.320 49.148 1.00 23.77 ? 237 HIS A C   1 
ATOM   708  O O   . HIS A 1 93  ? -93.743  34.481 49.562 1.00 21.05 ? 237 HIS A O   1 
ATOM   709  C CB  . HIS A 1 93  ? -93.270  32.746 46.765 1.00 26.57 ? 237 HIS A CB  1 
ATOM   710  C CG  . HIS A 1 93  ? -93.788  32.178 45.482 1.00 29.97 ? 237 HIS A CG  1 
ATOM   711  N ND1 . HIS A 1 93  ? -94.283  30.896 45.380 1.00 31.21 ? 237 HIS A ND1 1 
ATOM   712  C CD2 . HIS A 1 93  ? -93.868  32.712 44.239 1.00 30.71 ? 237 HIS A CD2 1 
ATOM   713  C CE1 . HIS A 1 93  ? -94.644  30.664 44.131 1.00 32.77 ? 237 HIS A CE1 1 
ATOM   714  N NE2 . HIS A 1 93  ? -94.402  31.750 43.418 1.00 31.83 ? 237 HIS A NE2 1 
ATOM   715  N N   . GLY A 1 94  ? -92.942  32.386 49.780 1.00 24.13 ? 238 GLY A N   1 
ATOM   716  C CA  . GLY A 1 94  ? -92.252  32.725 51.006 1.00 25.35 ? 238 GLY A CA  1 
ATOM   717  C C   . GLY A 1 94  ? -91.380  31.628 51.566 1.00 25.53 ? 238 GLY A C   1 
ATOM   718  O O   . GLY A 1 94  ? -91.341  30.513 51.049 1.00 25.89 ? 238 GLY A O   1 
ATOM   719  N N   . GLU A 1 95  ? -90.667  31.977 52.630 1.00 27.31 ? 239 GLU A N   1 
ATOM   720  C CA  . GLU A 1 95  ? -89.780  31.074 53.357 1.00 28.35 ? 239 GLU A CA  1 
ATOM   721  C C   . GLU A 1 95  ? -90.153  31.345 54.807 1.00 27.52 ? 239 GLU A C   1 
ATOM   722  O O   . GLU A 1 95  ? -91.011  32.187 55.075 1.00 28.43 ? 239 GLU A O   1 
ATOM   723  C CB  . GLU A 1 95  ? -88.318  31.472 53.170 1.00 30.71 ? 239 GLU A CB  1 
ATOM   724  C CG  . GLU A 1 95  ? -87.813  31.558 51.747 1.00 35.75 ? 239 GLU A CG  1 
ATOM   725  C CD  . GLU A 1 95  ? -86.511  32.350 51.667 1.00 38.37 ? 239 GLU A CD  1 
ATOM   726  O OE1 . GLU A 1 95  ? -85.589  32.076 52.469 1.00 39.20 ? 239 GLU A OE1 1 
ATOM   727  O OE2 . GLU A 1 95  ? -86.408  33.249 50.806 1.00 40.51 ? 239 GLU A OE2 1 
ATOM   728  N N   . GLU A 1 96  ? -89.507  30.669 55.747 1.00 26.56 ? 240 GLU A N   1 
ATOM   729  C CA  . GLU A 1 96  ? -89.819  30.918 57.148 1.00 26.18 ? 240 GLU A CA  1 
ATOM   730  C C   . GLU A 1 96  ? -89.516  32.387 57.475 1.00 25.56 ? 240 GLU A C   1 
ATOM   731  O O   . GLU A 1 96  ? -88.401  32.863 57.259 1.00 24.05 ? 240 GLU A O   1 
ATOM   732  C CB  . GLU A 1 96  ? -88.992  30.001 58.052 1.00 25.55 ? 240 GLU A CB  1 
ATOM   733  C CG  . GLU A 1 96  ? -89.295  30.179 59.533 1.00 24.11 ? 240 GLU A CG  1 
ATOM   734  C CD  . GLU A 1 96  ? -90.752  29.919 59.866 1.00 24.59 ? 240 GLU A CD  1 
ATOM   735  O OE1 . GLU A 1 96  ? -91.207  28.769 59.682 1.00 22.60 ? 240 GLU A OE1 1 
ATOM   736  O OE2 . GLU A 1 96  ? -91.444  30.863 60.306 1.00 25.81 ? 240 GLU A OE2 1 
ATOM   737  N N   . GLY A 1 97  ? -90.520  33.102 57.976 1.00 24.41 ? 241 GLY A N   1 
ATOM   738  C CA  . GLY A 1 97  ? -90.341  34.501 58.327 1.00 21.49 ? 241 GLY A CA  1 
ATOM   739  C C   . GLY A 1 97  ? -90.170  35.449 57.148 1.00 22.24 ? 241 GLY A C   1 
ATOM   740  O O   . GLY A 1 97  ? -89.793  36.609 57.335 1.00 19.85 ? 241 GLY A O   1 
ATOM   741  N N   . ILE A 1 98  ? -90.464  34.976 55.939 1.00 21.34 ? 242 ILE A N   1 
ATOM   742  C CA  . ILE A 1 98  ? -90.306  35.799 54.739 1.00 21.70 ? 242 ILE A CA  1 
ATOM   743  C C   . ILE A 1 98  ? -91.459  35.686 53.741 1.00 23.55 ? 242 ILE A C   1 
ATOM   744  O O   . ILE A 1 98  ? -92.041  34.619 53.568 1.00 24.01 ? 242 ILE A O   1 
ATOM   745  C CB  . ILE A 1 98  ? -89.006  35.402 53.979 1.00 21.53 ? 242 ILE A CB  1 
ATOM   746  C CG1 . ILE A 1 98  ? -87.774  35.729 54.828 1.00 20.56 ? 242 ILE A CG1 1 
ATOM   747  C CG2 . ILE A 1 98  ? -88.951  36.093 52.616 1.00 21.32 ? 242 ILE A CG2 1 
ATOM   748  C CD1 . ILE A 1 98  ? -86.465  35.258 54.207 1.00 17.41 ? 242 ILE A CD1 1 
ATOM   749  N N   . ILE A 1 99  ? -91.783  36.799 53.090 1.00 25.23 ? 243 ILE A N   1 
ATOM   750  C CA  . ILE A 1 99  ? -92.801  36.820 52.042 1.00 25.91 ? 243 ILE A CA  1 
ATOM   751  C C   . ILE A 1 99  ? -92.161  37.574 50.879 1.00 26.65 ? 243 ILE A C   1 
ATOM   752  O O   . ILE A 1 99  ? -91.484  38.585 51.083 1.00 25.32 ? 243 ILE A O   1 
ATOM   753  C CB  . ILE A 1 99  ? -94.116  37.516 52.482 1.00 28.02 ? 243 ILE A CB  1 
ATOM   754  C CG1 . ILE A 1 99  ? -93.834  38.913 53.031 1.00 29.77 ? 243 ILE A CG1 1 
ATOM   755  C CG2 . ILE A 1 99  ? -94.849  36.640 53.491 1.00 30.68 ? 243 ILE A CG2 1 
ATOM   756  C CD1 . ILE A 1 99  ? -93.808  39.984 51.972 1.00 32.23 ? 243 ILE A CD1 1 
ATOM   757  N N   . PHE A 1 100 ? -92.362  37.082 49.661 1.00 26.03 ? 244 PHE A N   1 
ATOM   758  C CA  . PHE A 1 100 ? -91.749  37.709 48.495 1.00 27.77 ? 244 PHE A CA  1 
ATOM   759  C C   . PHE A 1 100 ? -92.505  38.812 47.775 1.00 26.75 ? 244 PHE A C   1 
ATOM   760  O O   . PHE A 1 100 ? -93.688  38.673 47.453 1.00 26.47 ? 244 PHE A O   1 
ATOM   761  C CB  . PHE A 1 100 ? -91.382  36.651 47.446 1.00 27.51 ? 244 PHE A CB  1 
ATOM   762  C CG  . PHE A 1 100 ? -90.141  35.882 47.764 1.00 28.81 ? 244 PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 100 ? -90.164  34.846 48.690 1.00 28.99 ? 244 PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 100 ? -88.940  36.198 47.140 1.00 29.18 ? 244 PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 100 ? -89.007  34.134 48.989 1.00 29.37 ? 244 PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 100 ? -87.778  35.491 47.434 1.00 29.39 ? 244 PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 100 ? -87.811  34.459 48.358 1.00 28.37 ? 244 PHE A CZ  1 
ATOM   768  N N   . GLY A 1 101 ? -91.799  39.911 47.524 1.00 27.31 ? 245 GLY A N   1 
ATOM   769  C CA  . GLY A 1 101 ? -92.374  40.996 46.759 1.00 27.07 ? 245 GLY A CA  1 
ATOM   770  C C   . GLY A 1 101 ? -92.171  40.447 45.355 1.00 28.31 ? 245 GLY A C   1 
ATOM   771  O O   . GLY A 1 101 ? -91.580  39.375 45.207 1.00 27.81 ? 245 GLY A O   1 
ATOM   772  N N   . THR A 1 102 ? -92.636  41.142 44.327 1.00 29.93 ? 246 THR A N   1 
ATOM   773  C CA  . THR A 1 102 ? -92.470  40.636 42.970 1.00 31.19 ? 246 THR A CA  1 
ATOM   774  C C   . THR A 1 102 ? -91.003  40.545 42.560 1.00 33.06 ? 246 THR A C   1 
ATOM   775  O O   . THR A 1 102 ? -90.646  39.760 41.679 1.00 33.29 ? 246 THR A O   1 
ATOM   776  C CB  . THR A 1 102 ? -93.207  41.523 41.946 1.00 31.26 ? 246 THR A CB  1 
ATOM   777  O OG1 . THR A 1 102 ? -92.721  42.869 42.040 1.00 33.21 ? 246 THR A OG1 1 
ATOM   778  C CG2 . THR A 1 102 ? -94.703  41.509 42.208 1.00 30.48 ? 246 THR A CG2 1 
ATOM   779  N N   . ASN A 1 103 ? -90.151  41.324 43.219 1.00 32.91 ? 247 ASN A N   1 
ATOM   780  C CA  . ASN A 1 103 ? -88.731  41.352 42.877 1.00 34.21 ? 247 ASN A CA  1 
ATOM   781  C C   . ASN A 1 103 ? -87.776  40.800 43.931 1.00 34.87 ? 247 ASN A C   1 
ATOM   782  O O   . ASN A 1 103 ? -86.561  40.824 43.740 1.00 34.60 ? 247 ASN A O   1 
ATOM   783  C CB  . ASN A 1 103 ? -88.323  42.787 42.547 1.00 33.19 ? 247 ASN A CB  1 
ATOM   784  C CG  . ASN A 1 103 ? -88.445  43.705 43.737 1.00 32.57 ? 247 ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 103 ? -89.286  43.492 44.606 1.00 32.54 ? 247 ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 103 ? -87.617  44.740 43.780 1.00 33.97 ? 247 ASN A ND2 1 
ATOM   787  N N   . GLY A 1 104 ? -88.306  40.311 45.045 1.00 35.42 ? 254 GLY A N   1 
ATOM   788  C CA  . GLY A 1 104 ? -87.422  39.780 46.065 1.00 35.51 ? 254 GLY A CA  1 
ATOM   789  C C   . GLY A 1 104 ? -88.044  39.581 47.431 1.00 35.20 ? 254 GLY A C   1 
ATOM   790  O O   . GLY A 1 104 ? -89.170  40.013 47.681 1.00 34.17 ? 254 GLY A O   1 
ATOM   791  N N   . PRO A 1 105 ? -87.313  38.932 48.348 1.00 35.64 ? 255 PRO A N   1 
ATOM   792  C CA  . PRO A 1 105 ? -87.775  38.658 49.711 1.00 35.86 ? 255 PRO A CA  1 
ATOM   793  C C   . PRO A 1 105 ? -87.920  39.878 50.622 1.00 35.96 ? 255 PRO A C   1 
ATOM   794  O O   . PRO A 1 105 ? -87.209  40.875 50.481 1.00 35.96 ? 255 PRO A O   1 
ATOM   795  C CB  . PRO A 1 105 ? -86.733  37.668 50.228 1.00 36.77 ? 255 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 105 ? -85.480  38.127 49.536 1.00 35.65 ? 255 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 105 ? -85.979  38.345 48.124 1.00 36.66 ? 255 PRO A CD  1 
ATOM   798  N N   . VAL A 1 106 ? -88.867  39.777 51.549 1.00 34.75 ? 256 VAL A N   1 
ATOM   799  C CA  . VAL A 1 106 ? -89.143  40.820 52.528 1.00 35.02 ? 256 VAL A CA  1 
ATOM   800  C C   . VAL A 1 106 ? -89.392  40.105 53.853 1.00 33.52 ? 256 VAL A C   1 
ATOM   801  O O   . VAL A 1 106 ? -90.241  39.215 53.932 1.00 30.78 ? 256 VAL A O   1 
ATOM   802  C CB  . VAL A 1 106 ? -90.415  41.629 52.174 1.00 36.00 ? 256 VAL A CB  1 
ATOM   803  C CG1 . VAL A 1 106 ? -90.596  42.771 53.168 1.00 35.99 ? 256 VAL A CG1 1 
ATOM   804  C CG2 . VAL A 1 106 ? -90.324  42.161 50.763 1.00 37.05 ? 256 VAL A CG2 1 
ATOM   805  N N   . ASP A 1 107 ? -88.650  40.480 54.887 1.00 33.35 ? 257 ASP A N   1 
ATOM   806  C CA  . ASP A 1 107 ? -88.825  39.848 56.188 1.00 34.26 ? 257 ASP A CA  1 
ATOM   807  C C   . ASP A 1 107 ? -90.135  40.323 56.803 1.00 31.61 ? 257 ASP A C   1 
ATOM   808  O O   . ASP A 1 107 ? -90.396  41.522 56.878 1.00 30.89 ? 257 ASP A O   1 
ATOM   809  C CB  . ASP A 1 107 ? -87.658  40.192 57.111 1.00 39.86 ? 257 ASP A CB  1 
ATOM   810  C CG  . ASP A 1 107 ? -87.602  41.664 57.444 1.00 47.62 ? 257 ASP A CG  1 
ATOM   811  O OD1 . ASP A 1 107 ? -87.498  42.484 56.501 1.00 53.05 ? 257 ASP A OD1 1 
ATOM   812  O OD2 . ASP A 1 107 ? -87.667  42.007 58.647 1.00 51.80 ? 257 ASP A OD2 1 
ATOM   813  N N   . LEU A 1 108 ? -90.959  39.373 57.231 1.00 28.51 ? 258 LEU A N   1 
ATOM   814  C CA  . LEU A 1 108 ? -92.250  39.684 57.837 1.00 27.67 ? 258 LEU A CA  1 
ATOM   815  C C   . LEU A 1 108 ? -92.131  40.583 59.062 1.00 25.44 ? 258 LEU A C   1 
ATOM   816  O O   . LEU A 1 108 ? -92.992  41.422 59.316 1.00 22.96 ? 258 LEU A O   1 
ATOM   817  C CB  . LEU A 1 108 ? -92.971  38.392 58.232 1.00 26.97 ? 258 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 108 ? -93.535  37.579 57.069 1.00 29.72 ? 258 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 108 ? -94.160  36.297 57.602 1.00 28.80 ? 258 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 108 ? -94.573  38.416 56.321 1.00 27.99 ? 258 LEU A CD2 1 
ATOM   821  N N   . LYS A 1 109 ? -91.067  40.389 59.825 1.00 25.67 ? 259 LYS A N   1 
ATOM   822  C CA  . LYS A 1 109 ? -90.853  41.181 61.022 1.00 28.47 ? 259 LYS A CA  1 
ATOM   823  C C   . LYS A 1 109 ? -90.815  42.666 60.673 1.00 29.08 ? 259 LYS A C   1 
ATOM   824  O O   . LYS A 1 109 ? -91.317  43.493 61.428 1.00 28.72 ? 259 LYS A O   1 
ATOM   825  C CB  . LYS A 1 109 ? -89.546  40.767 61.701 1.00 28.94 ? 259 LYS A CB  1 
ATOM   826  C CG  . LYS A 1 109 ? -89.437  41.193 63.158 1.00 32.17 ? 259 LYS A CG  1 
ATOM   827  C CD  . LYS A 1 109 ? -90.434  40.441 64.029 1.00 33.02 ? 259 LYS A CD  1 
ATOM   828  C CE  . LYS A 1 109 ? -90.305  40.833 65.491 1.00 33.00 ? 259 LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 109 ? -88.925  40.588 66.011 1.00 39.45 ? 259 LYS A NZ  1 
ATOM   830  N N   . LYS A 1 110 ? -90.244  43.004 59.516 1.00 30.18 ? 260 LYS A N   1 
ATOM   831  C CA  . LYS A 1 110 ? -90.145  44.406 59.110 1.00 30.89 ? 260 LYS A CA  1 
ATOM   832  C C   . LYS A 1 110 ? -91.484  45.108 58.899 1.00 30.36 ? 260 LYS A C   1 
ATOM   833  O O   . LYS A 1 110 ? -91.683  46.223 59.382 1.00 31.01 ? 260 LYS A O   1 
ATOM   834  C CB  . LYS A 1 110 ? -89.299  44.560 57.838 1.00 32.67 ? 260 LYS A CB  1 
ATOM   835  C CG  . LYS A 1 110 ? -89.030  46.022 57.490 1.00 35.81 ? 260 LYS A CG  1 
ATOM   836  C CD  . LYS A 1 110 ? -88.104  46.207 56.291 1.00 38.62 ? 260 LYS A CD  1 
ATOM   837  C CE  . LYS A 1 110 ? -87.801  47.692 56.070 1.00 39.71 ? 260 LYS A CE  1 
ATOM   838  N NZ  . LYS A 1 110 ? -86.953  47.956 54.872 1.00 41.27 ? 260 LYS A NZ  1 
ATOM   839  N N   . ILE A 1 111 ? -92.405  44.477 58.181 1.00 29.55 ? 261 ILE A N   1 
ATOM   840  C CA  . ILE A 1 111 ? -93.690  45.119 57.955 1.00 28.89 ? 261 ILE A CA  1 
ATOM   841  C C   . ILE A 1 111 ? -94.569  45.053 59.197 1.00 27.13 ? 261 ILE A C   1 
ATOM   842  O O   . ILE A 1 111 ? -95.401  45.931 59.425 1.00 26.92 ? 261 ILE A O   1 
ATOM   843  C CB  . ILE A 1 111 ? -94.420  44.518 56.731 1.00 30.78 ? 261 ILE A CB  1 
ATOM   844  C CG1 . ILE A 1 111 ? -94.558  43.006 56.866 1.00 31.44 ? 261 ILE A CG1 1 
ATOM   845  C CG2 . ILE A 1 111 ? -93.639  44.853 55.461 1.00 31.48 ? 261 ILE A CG2 1 
ATOM   846  C CD1 . ILE A 1 111 ? -95.117  42.359 55.612 1.00 34.11 ? 261 ILE A CD1 1 
ATOM   847  N N   . THR A 1 112 ? -94.365  44.025 60.011 1.00 24.50 ? 262 THR A N   1 
ATOM   848  C CA  . THR A 1 112 ? -95.124  43.874 61.244 1.00 24.12 ? 262 THR A CA  1 
ATOM   849  C C   . THR A 1 112 ? -94.716  44.926 62.288 1.00 23.41 ? 262 THR A C   1 
ATOM   850  O O   . THR A 1 112 ? -95.554  45.398 63.058 1.00 22.84 ? 262 THR A O   1 
ATOM   851  C CB  . THR A 1 112 ? -94.931  42.459 61.838 1.00 24.45 ? 262 THR A CB  1 
ATOM   852  O OG1 . THR A 1 112 ? -95.820  41.543 61.182 1.00 28.05 ? 262 THR A OG1 1 
ATOM   853  C CG2 . THR A 1 112 ? -95.222  42.446 63.323 1.00 26.37 ? 262 THR A CG2 1 
ATOM   854  N N   . ASN A 1 113 ? -93.438  45.300 62.309 1.00 23.67 ? 263 ASN A N   1 
ATOM   855  C CA  . ASN A 1 113 ? -92.955  46.286 63.279 1.00 24.26 ? 263 ASN A CA  1 
ATOM   856  C C   . ASN A 1 113 ? -93.593  47.667 63.148 1.00 23.85 ? 263 ASN A C   1 
ATOM   857  O O   . ASN A 1 113 ? -93.699  48.390 64.136 1.00 25.23 ? 263 ASN A O   1 
ATOM   858  C CB  . ASN A 1 113 ? -91.427  46.421 63.210 1.00 24.11 ? 263 ASN A CB  1 
ATOM   859  C CG  . ASN A 1 113 ? -90.703  45.197 63.757 1.00 26.44 ? 263 ASN A CG  1 
ATOM   860  O OD1 . ASN A 1 113 ? -91.194  44.516 64.662 1.00 27.85 ? 263 ASN A OD1 1 
ATOM   861  N ND2 . ASN A 1 113 ? -89.518  44.925 63.221 1.00 27.66 ? 263 ASN A ND2 1 
ATOM   862  N N   . PHE A 1 114 ? -94.013  48.046 61.945 1.00 24.19 ? 264 PHE A N   1 
ATOM   863  C CA  . PHE A 1 114 ? -94.650  49.352 61.760 1.00 24.47 ? 264 PHE A CA  1 
ATOM   864  C C   . PHE A 1 114 ? -95.880  49.452 62.653 1.00 26.03 ? 264 PHE A C   1 
ATOM   865  O O   . PHE A 1 114 ? -96.303  50.549 63.033 1.00 26.08 ? 264 PHE A O   1 
ATOM   866  C CB  . PHE A 1 114 ? -95.108  49.554 60.307 1.00 23.85 ? 264 PHE A CB  1 
ATOM   867  C CG  . PHE A 1 114 ? -93.983  49.652 59.315 1.00 26.47 ? 264 PHE A CG  1 
ATOM   868  C CD1 . PHE A 1 114 ? -93.058  50.692 59.385 1.00 25.71 ? 264 PHE A CD1 1 
ATOM   869  C CD2 . PHE A 1 114 ? -93.843  48.695 58.311 1.00 24.82 ? 264 PHE A CD2 1 
ATOM   870  C CE1 . PHE A 1 114 ? -92.012  50.775 58.472 1.00 27.32 ? 264 PHE A CE1 1 
ATOM   871  C CE2 . PHE A 1 114 ? -92.799  48.768 57.391 1.00 24.69 ? 264 PHE A CE2 1 
ATOM   872  C CZ  . PHE A 1 114 ? -91.882  49.809 57.471 1.00 27.59 ? 264 PHE A CZ  1 
ATOM   873  N N   . PHE A 1 115 ? -96.452  48.301 62.989 1.00 25.67 ? 265 PHE A N   1 
ATOM   874  C CA  . PHE A 1 115 ? -97.670  48.273 63.785 1.00 27.76 ? 265 PHE A CA  1 
ATOM   875  C C   . PHE A 1 115 ? -97.518  47.874 65.251 1.00 30.04 ? 265 PHE A C   1 
ATOM   876  O O   . PHE A 1 115 ? -98.517  47.659 65.937 1.00 29.96 ? 265 PHE A O   1 
ATOM   877  C CB  . PHE A 1 115 ? -98.679  47.350 63.101 1.00 25.92 ? 265 PHE A CB  1 
ATOM   878  C CG  . PHE A 1 115 ? -99.034  47.779 61.711 1.00 25.93 ? 265 PHE A CG  1 
ATOM   879  C CD1 . PHE A 1 115 ? -100.106 48.636 61.486 1.00 27.91 ? 265 PHE A CD1 1 
ATOM   880  C CD2 . PHE A 1 115 ? -98.276  47.359 60.625 1.00 25.41 ? 265 PHE A CD2 1 
ATOM   881  C CE1 . PHE A 1 115 ? -100.422 49.072 60.195 1.00 27.97 ? 265 PHE A CE1 1 
ATOM   882  C CE2 . PHE A 1 115 ? -98.583  47.791 59.331 1.00 27.77 ? 265 PHE A CE2 1 
ATOM   883  C CZ  . PHE A 1 115 ? -99.658  48.648 59.118 1.00 24.08 ? 265 PHE A CZ  1 
ATOM   884  N N   . ARG A 1 116 ? -96.290  47.782 65.749 1.00 32.82 ? 266 ARG A N   1 
ATOM   885  C CA  . ARG A 1 116 ? -96.132  47.391 67.137 1.00 36.49 ? 266 ARG A CA  1 
ATOM   886  C C   . ARG A 1 116 ? -96.351  48.544 68.114 1.00 38.01 ? 266 ARG A C   1 
ATOM   887  O O   . ARG A 1 116 ? -95.801  49.624 67.949 1.00 39.60 ? 266 ARG A O   1 
ATOM   888  C CB  . ARG A 1 116 ? -94.773  46.706 67.363 1.00 38.61 ? 266 ARG A CB  1 
ATOM   889  C CG  . ARG A 1 116 ? -93.522  47.557 67.289 1.00 41.62 ? 266 ARG A CG  1 
ATOM   890  C CD  . ARG A 1 116 ? -92.315  46.660 67.574 1.00 43.41 ? 266 ARG A CD  1 
ATOM   891  N NE  . ARG A 1 116 ? -91.086  47.390 67.886 1.00 46.78 ? 266 ARG A NE  1 
ATOM   892  C CZ  . ARG A 1 116 ? -90.947  48.215 68.918 1.00 47.67 ? 266 ARG A CZ  1 
ATOM   893  N NH1 . ARG A 1 116 ? -91.961  48.426 69.739 1.00 50.46 ? 266 ARG A NH1 1 
ATOM   894  N NH2 . ARG A 1 116 ? -89.790  48.818 69.143 1.00 48.15 ? 266 ARG A NH2 1 
ATOM   895  N N   . GLY A 1 117 ? -97.197  48.289 69.111 1.00 38.17 ? 267 GLY A N   1 
ATOM   896  C CA  . GLY A 1 117 ? -97.542  49.256 70.143 1.00 39.87 ? 267 GLY A CA  1 
ATOM   897  C C   . GLY A 1 117 ? -97.033  50.686 70.063 1.00 41.15 ? 267 GLY A C   1 
ATOM   898  O O   . GLY A 1 117 ? -97.757  51.594 69.650 1.00 41.95 ? 267 GLY A O   1 
ATOM   899  N N   . ASP A 1 118 ? -95.787  50.888 70.476 1.00 40.12 ? 268 ASP A N   1 
ATOM   900  C CA  . ASP A 1 118 ? -95.166  52.208 70.474 1.00 40.57 ? 268 ASP A CA  1 
ATOM   901  C C   . ASP A 1 118 ? -94.989  52.792 69.073 1.00 40.16 ? 268 ASP A C   1 
ATOM   902  O O   . ASP A 1 118 ? -94.781  53.995 68.914 1.00 40.70 ? 268 ASP A O   1 
ATOM   903  C CB  . ASP A 1 118 ? -93.807  52.128 71.170 1.00 39.73 ? 268 ASP A CB  1 
ATOM   904  C CG  . ASP A 1 118 ? -92.936  51.026 70.603 1.00 39.39 ? 268 ASP A CG  1 
ATOM   905  O OD1 . ASP A 1 118 ? -93.416  50.304 69.704 1.00 38.74 ? 268 ASP A OD1 1 
ATOM   906  O OD2 . ASP A 1 118 ? -91.780  50.875 71.055 1.00 38.89 ? 268 ASP A OD2 1 
ATOM   907  N N   . ARG A 1 119 ? -95.075  51.928 68.067 1.00 39.93 ? 269 ARG A N   1 
ATOM   908  C CA  . ARG A 1 119 ? -94.918  52.318 66.670 1.00 39.51 ? 269 ARG A CA  1 
ATOM   909  C C   . ARG A 1 119 ? -96.179  52.926 66.080 1.00 37.76 ? 269 ARG A C   1 
ATOM   910  O O   . ARG A 1 119 ? -96.126  53.947 65.400 1.00 38.14 ? 269 ARG A O   1 
ATOM   911  C CB  . ARG A 1 119 ? -94.545  51.101 65.832 1.00 41.45 ? 269 ARG A CB  1 
ATOM   912  C CG  . ARG A 1 119 ? -93.188  51.162 65.184 1.00 45.09 ? 269 ARG A CG  1 
ATOM   913  C CD  . ARG A 1 119 ? -92.087  51.128 66.212 1.00 46.29 ? 269 ARG A CD  1 
ATOM   914  N NE  . ARG A 1 119 ? -90.942  50.361 65.738 1.00 47.66 ? 269 ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 119 ? -89.765  50.335 66.350 1.00 50.07 ? 269 ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 119 ? -89.583  51.042 67.460 1.00 51.74 ? 269 ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 119 ? -88.774  49.601 65.860 1.00 49.13 ? 269 ARG A NH2 1 
ATOM   918  N N   . CYS A 1 120 ? -97.312  52.280 66.324 1.00 35.99 ? 270 CYS A N   1 
ATOM   919  C CA  . CYS A 1 120 ? -98.578  52.757 65.789 1.00 34.11 ? 270 CYS A CA  1 
ATOM   920  C C   . CYS A 1 120 ? -99.568  53.077 66.898 1.00 33.46 ? 270 CYS A C   1 
ATOM   921  O O   . CYS A 1 120 ? -100.478 52.299 67.192 1.00 33.11 ? 270 CYS A O   1 
ATOM   922  C CB  . CYS A 1 120 ? -99.169  51.711 64.846 1.00 33.32 ? 270 CYS A CB  1 
ATOM   923  S SG  . CYS A 1 120 ? -100.609 52.294 63.961 1.00 31.81 ? 270 CYS A SG  1 
ATOM   924  N N   . ARG A 1 121 ? -99.381  54.246 67.495 1.00 33.20 ? 271 ARG A N   1 
ATOM   925  C CA  . ARG A 1 121 ? -100.207 54.729 68.593 1.00 32.00 ? 271 ARG A CA  1 
ATOM   926  C C   . ARG A 1 121 ? -101.721 54.557 68.459 1.00 30.35 ? 271 ARG A C   1 
ATOM   927  O O   . ARG A 1 121 ? -102.384 54.199 69.431 1.00 27.96 ? 271 ARG A O   1 
ATOM   928  C CB  . ARG A 1 121 ? -99.889  56.202 68.840 1.00 36.44 ? 271 ARG A CB  1 
ATOM   929  C CG  . ARG A 1 121 ? -99.533  56.521 70.272 1.00 41.35 ? 271 ARG A CG  1 
ATOM   930  C CD  . ARG A 1 121 ? -98.327  55.720 70.742 1.00 45.18 ? 271 ARG A CD  1 
ATOM   931  N NE  . ARG A 1 121 ? -98.049  55.986 72.150 1.00 50.04 ? 271 ARG A NE  1 
ATOM   932  C CZ  . ARG A 1 121 ? -98.898  55.725 73.141 1.00 52.10 ? 271 ARG A CZ  1 
ATOM   933  N NH1 . ARG A 1 121 ? -100.081 55.181 72.882 1.00 52.14 ? 271 ARG A NH1 1 
ATOM   934  N NH2 . ARG A 1 121 ? -98.569  56.023 74.392 1.00 54.03 ? 271 ARG A NH2 1 
ATOM   935  N N   . SER A 1 122 ? -102.278 54.812 67.275 1.00 27.94 ? 272 SER A N   1 
ATOM   936  C CA  . SER A 1 122 ? -103.725 54.690 67.098 1.00 25.70 ? 272 SER A CA  1 
ATOM   937  C C   . SER A 1 122 ? -104.238 53.250 67.017 1.00 23.94 ? 272 SER A C   1 
ATOM   938  O O   . SER A 1 122 ? -105.441 53.019 66.916 1.00 23.88 ? 272 SER A O   1 
ATOM   939  C CB  . SER A 1 122 ? -104.192 55.490 65.871 1.00 23.88 ? 272 SER A CB  1 
ATOM   940  O OG  . SER A 1 122 ? -103.496 55.115 64.699 1.00 25.16 ? 272 SER A OG  1 
ATOM   941  N N   . LEU A 1 123 ? -103.332 52.282 67.063 1.00 22.06 ? 273 LEU A N   1 
ATOM   942  C CA  . LEU A 1 123 ? -103.741 50.882 67.023 1.00 21.59 ? 273 LEU A CA  1 
ATOM   943  C C   . LEU A 1 123 ? -103.358 50.185 68.325 1.00 21.96 ? 273 LEU A C   1 
ATOM   944  O O   . LEU A 1 123 ? -103.637 48.997 68.518 1.00 20.13 ? 273 LEU A O   1 
ATOM   945  C CB  . LEU A 1 123 ? -103.096 50.160 65.837 1.00 19.48 ? 273 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 123 ? -103.706 50.486 64.472 1.00 20.42 ? 273 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 123 ? -102.933 49.772 63.372 1.00 20.27 ? 273 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 123 ? -105.168 50.064 64.459 1.00 18.84 ? 273 LEU A CD2 1 
ATOM   949  N N   . THR A 1 124 ? -102.724 50.936 69.221 1.00 20.91 ? 274 THR A N   1 
ATOM   950  C CA  . THR A 1 124 ? -102.301 50.386 70.499 1.00 21.80 ? 274 THR A CA  1 
ATOM   951  C C   . THR A 1 124 ? -103.514 49.835 71.241 1.00 21.53 ? 274 THR A C   1 
ATOM   952  O O   . THR A 1 124 ? -104.541 50.510 71.353 1.00 22.38 ? 274 THR A O   1 
ATOM   953  C CB  . THR A 1 124 ? -101.621 51.458 71.374 1.00 21.16 ? 274 THR A CB  1 
ATOM   954  O OG1 . THR A 1 124 ? -100.535 52.047 70.651 1.00 19.10 ? 274 THR A OG1 1 
ATOM   955  C CG2 . THR A 1 124 ? -101.079 50.833 72.661 1.00 23.68 ? 274 THR A CG2 1 
ATOM   956  N N   . GLY A 1 125 ? -103.395 48.605 71.735 1.00 19.76 ? 275 GLY A N   1 
ATOM   957  C CA  . GLY A 1 125 ? -104.495 47.996 72.465 1.00 19.29 ? 275 GLY A CA  1 
ATOM   958  C C   . GLY A 1 125 ? -105.595 47.437 71.582 1.00 17.75 ? 275 GLY A C   1 
ATOM   959  O O   . GLY A 1 125 ? -106.588 46.900 72.079 1.00 17.61 ? 275 GLY A O   1 
ATOM   960  N N   . LYS A 1 126 ? -105.420 47.574 70.270 1.00 16.45 ? 276 LYS A N   1 
ATOM   961  C CA  . LYS A 1 126 ? -106.389 47.076 69.302 1.00 16.08 ? 276 LYS A CA  1 
ATOM   962  C C   . LYS A 1 126 ? -105.811 45.859 68.583 1.00 14.07 ? 276 LYS A C   1 
ATOM   963  O O   . LYS A 1 126 ? -104.604 45.776 68.357 1.00 13.38 ? 276 LYS A O   1 
ATOM   964  C CB  . LYS A 1 126 ? -106.731 48.157 68.269 1.00 17.23 ? 276 LYS A CB  1 
ATOM   965  C CG  . LYS A 1 126 ? -107.387 49.402 68.837 1.00 19.34 ? 276 LYS A CG  1 
ATOM   966  C CD  . LYS A 1 126 ? -107.631 50.425 67.737 1.00 21.32 ? 276 LYS A CD  1 
ATOM   967  C CE  . LYS A 1 126 ? -108.316 51.679 68.277 1.00 24.60 ? 276 LYS A CE  1 
ATOM   968  N NZ  . LYS A 1 126 ? -108.455 52.728 67.217 1.00 22.80 ? 276 LYS A NZ  1 
ATOM   969  N N   . PRO A 1 127 ? -106.673 44.904 68.205 1.00 14.14 ? 277 PRO A N   1 
ATOM   970  C CA  . PRO A 1 127 ? -106.254 43.683 67.510 1.00 14.95 ? 277 PRO A CA  1 
ATOM   971  C C   . PRO A 1 127 ? -105.694 43.907 66.107 1.00 16.43 ? 277 PRO A C   1 
ATOM   972  O O   . PRO A 1 127 ? -106.343 44.510 65.244 1.00 14.69 ? 277 PRO A O   1 
ATOM   973  C CB  . PRO A 1 127 ? -107.524 42.833 67.514 1.00 15.68 ? 277 PRO A CB  1 
ATOM   974  C CG  . PRO A 1 127 ? -108.622 43.867 67.484 1.00 13.51 ? 277 PRO A CG  1 
ATOM   975  C CD  . PRO A 1 127 ? -108.125 44.889 68.468 1.00 12.97 ? 277 PRO A CD  1 
ATOM   976  N N   . LYS A 1 128 ? -104.472 43.420 65.903 1.00 15.09 ? 278 LYS A N   1 
ATOM   977  C CA  . LYS A 1 128 ? -103.770 43.540 64.629 1.00 15.78 ? 278 LYS A CA  1 
ATOM   978  C C   . LYS A 1 128 ? -103.575 42.139 64.050 1.00 15.20 ? 278 LYS A C   1 
ATOM   979  O O   . LYS A 1 128 ? -102.775 41.356 64.553 1.00 15.74 ? 278 LYS A O   1 
ATOM   980  C CB  . LYS A 1 128 ? -102.421 44.239 64.855 1.00 16.32 ? 278 LYS A CB  1 
ATOM   981  C CG  . LYS A 1 128 ? -102.575 45.653 65.421 1.00 18.55 ? 278 LYS A CG  1 
ATOM   982  C CD  . LYS A 1 128 ? -101.247 46.271 65.853 1.00 16.76 ? 278 LYS A CD  1 
ATOM   983  C CE  . LYS A 1 128 ? -100.902 45.929 67.296 1.00 15.50 ? 278 LYS A CE  1 
ATOM   984  N NZ  . LYS A 1 128 ? -101.814 46.619 68.248 1.00 15.13 ? 278 LYS A NZ  1 
ATOM   985  N N   . LEU A 1 129 ? -104.312 41.842 62.985 1.00 14.16 ? 279 LEU A N   1 
ATOM   986  C CA  . LEU A 1 129 ? -104.285 40.531 62.347 1.00 15.08 ? 279 LEU A CA  1 
ATOM   987  C C   . LEU A 1 129 ? -103.498 40.438 61.051 1.00 16.29 ? 279 LEU A C   1 
ATOM   988  O O   . LEU A 1 129 ? -103.688 41.235 60.131 1.00 15.57 ? 279 LEU A O   1 
ATOM   989  C CB  . LEU A 1 129 ? -105.716 40.074 62.064 1.00 14.95 ? 279 LEU A CB  1 
ATOM   990  C CG  . LEU A 1 129 ? -106.714 40.353 63.188 1.00 17.98 ? 279 LEU A CG  1 
ATOM   991  C CD1 . LEU A 1 129 ? -108.110 39.969 62.731 1.00 18.79 ? 279 LEU A CD1 1 
ATOM   992  C CD2 . LEU A 1 129 ? -106.309 39.574 64.438 1.00 17.53 ? 279 LEU A CD2 1 
ATOM   993  N N   . PHE A 1 130 ? -102.617 39.449 60.982 1.00 14.63 ? 280 PHE A N   1 
ATOM   994  C CA  . PHE A 1 130 ? -101.845 39.222 59.779 1.00 15.57 ? 280 PHE A CA  1 
ATOM   995  C C   . PHE A 1 130 ? -102.138 37.801 59.309 1.00 15.70 ? 280 PHE A C   1 
ATOM   996  O O   . PHE A 1 130 ? -101.781 36.823 59.964 1.00 14.36 ? 280 PHE A O   1 
ATOM   997  C CB  . PHE A 1 130 ? -100.355 39.434 60.046 1.00 15.43 ? 280 PHE A CB  1 
ATOM   998  C CG  . PHE A 1 130 ? -99.999  40.871 60.340 1.00 17.35 ? 280 PHE A CG  1 
ATOM   999  C CD1 . PHE A 1 130 ? -100.297 41.441 61.572 1.00 15.81 ? 280 PHE A CD1 1 
ATOM   1000 C CD2 . PHE A 1 130 ? -99.401  41.666 59.364 1.00 17.77 ? 280 PHE A CD2 1 
ATOM   1001 C CE1 . PHE A 1 130 ? -100.006 42.784 61.831 1.00 16.64 ? 280 PHE A CE1 1 
ATOM   1002 C CE2 . PHE A 1 130 ? -99.106  43.010 59.612 1.00 17.48 ? 280 PHE A CE2 1 
ATOM   1003 C CZ  . PHE A 1 130 ? -99.411  43.569 60.854 1.00 16.12 ? 280 PHE A CZ  1 
ATOM   1004 N N   . ILE A 1 131 ? -102.831 37.708 58.183 1.00 15.56 ? 281 ILE A N   1 
ATOM   1005 C CA  . ILE A 1 131 ? -103.200 36.433 57.586 1.00 15.70 ? 281 ILE A CA  1 
ATOM   1006 C C   . ILE A 1 131 ? -102.197 36.192 56.464 1.00 17.10 ? 281 ILE A C   1 
ATOM   1007 O O   . ILE A 1 131 ? -102.132 36.958 55.494 1.00 15.60 ? 281 ILE A O   1 
ATOM   1008 C CB  . ILE A 1 131 ? -104.631 36.507 57.030 1.00 17.16 ? 281 ILE A CB  1 
ATOM   1009 C CG1 . ILE A 1 131 ? -105.595 36.866 58.169 1.00 18.30 ? 281 ILE A CG1 1 
ATOM   1010 C CG2 . ILE A 1 131 ? -105.018 35.190 56.386 1.00 16.28 ? 281 ILE A CG2 1 
ATOM   1011 C CD1 . ILE A 1 131 ? -107.027 37.157 57.723 1.00 19.83 ? 281 ILE A CD1 1 
ATOM   1012 N N   . ILE A 1 132 ? -101.425 35.119 56.593 1.00 16.27 ? 282 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 132 ? -100.378 34.826 55.624 1.00 17.21 ? 282 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 132 ? -100.475 33.509 54.860 1.00 16.99 ? 282 ILE A C   1 
ATOM   1015 O O   . ILE A 1 132 ? -100.424 32.432 55.444 1.00 16.51 ? 282 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 132 ? -99.013  34.870 56.327 1.00 18.05 ? 282 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 132 ? -98.957  36.109 57.232 1.00 18.64 ? 282 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 132 ? -97.887  34.888 55.299 1.00 17.23 ? 282 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 132 ? -97.740  36.179 58.125 1.00 21.78 ? 282 ILE A CD1 1 
ATOM   1020 N N   . GLN A 1 133 ? -100.610 33.611 53.544 1.00 17.69 ? 283 GLN A N   1 
ATOM   1021 C CA  . GLN A 1 133 ? -100.666 32.440 52.676 1.00 16.39 ? 283 GLN A CA  1 
ATOM   1022 C C   . GLN A 1 133 ? -99.352  32.440 51.916 1.00 16.93 ? 283 GLN A C   1 
ATOM   1023 O O   . GLN A 1 133 ? -99.158  33.218 50.978 1.00 16.51 ? 283 GLN A O   1 
ATOM   1024 C CB  . GLN A 1 133 ? -101.849 32.525 51.704 1.00 15.73 ? 283 GLN A CB  1 
ATOM   1025 C CG  . GLN A 1 133 ? -101.819 31.516 50.551 1.00 15.60 ? 283 GLN A CG  1 
ATOM   1026 C CD  . GLN A 1 133 ? -101.648 30.084 51.026 1.00 18.47 ? 283 GLN A CD  1 
ATOM   1027 O OE1 . GLN A 1 133 ? -102.376 29.614 51.904 1.00 17.65 ? 283 GLN A OE1 1 
ATOM   1028 N NE2 . GLN A 1 133 ? -100.681 29.377 50.442 1.00 19.96 ? 283 GLN A NE2 1 
ATOM   1029 N N   . ALA A 1 134 ? -98.443  31.579 52.356 1.00 17.30 ? 284 ALA A N   1 
ATOM   1030 C CA  . ALA A 1 134 ? -97.127  31.448 51.747 1.00 19.34 ? 284 ALA A CA  1 
ATOM   1031 C C   . ALA A 1 134 ? -96.398  30.314 52.442 1.00 20.52 ? 284 ALA A C   1 
ATOM   1032 O O   . ALA A 1 134 ? -96.772  29.909 53.542 1.00 19.23 ? 284 ALA A O   1 
ATOM   1033 C CB  . ALA A 1 134 ? -96.332  32.746 51.890 1.00 16.72 ? 284 ALA A CB  1 
ATOM   1034 N N   . CYS A 1 135 ? -95.363  29.801 51.790 1.00 20.57 ? 285 CYS A N   1 
ATOM   1035 C CA  . CYS A 1 135 ? -94.581  28.712 52.343 1.00 22.53 ? 285 CYS A CA  1 
ATOM   1036 C C   . CYS A 1 135 ? -93.695  29.223 53.470 1.00 22.57 ? 285 CYS A C   1 
ATOM   1037 O O   . CYS A 1 135 ? -93.322  30.402 53.499 1.00 19.74 ? 285 CYS A O   1 
ATOM   1038 C CB  . CYS A 1 135 ? -93.735  28.056 51.239 1.00 25.34 ? 285 CYS A CB  1 
ATOM   1039 S SG  . CYS A 1 135 ? -94.626  27.337 49.836 1.00 29.17 ? 285 CYS A SG  1 
ATOM   1040 N N   . ARG A 1 136 ? -93.384  28.324 54.400 1.00 21.30 ? 286 ARG A N   1 
ATOM   1041 C CA  . ARG A 1 136 ? -92.543  28.637 55.545 1.00 21.29 ? 286 ARG A CA  1 
ATOM   1042 C C   . ARG A 1 136 ? -91.380  27.655 55.561 1.00 22.23 ? 286 ARG A C   1 
ATOM   1043 O O   . ARG A 1 136 ? -90.751  27.433 56.595 1.00 22.72 ? 286 ARG A O   1 
ATOM   1044 C CB  . ARG A 1 136 ? -93.344  28.508 56.843 1.00 19.02 ? 286 ARG A CB  1 
ATOM   1045 C CG  . ARG A 1 136 ? -94.594  29.368 56.886 1.00 21.66 ? 286 ARG A CG  1 
ATOM   1046 C CD  . ARG A 1 136 ? -95.326  29.226 58.213 1.00 23.31 ? 286 ARG A CD  1 
ATOM   1047 N NE  . ARG A 1 136 ? -94.577  29.808 59.326 1.00 24.65 ? 286 ARG A NE  1 
ATOM   1048 C CZ  . ARG A 1 136 ? -94.966  29.767 60.596 1.00 23.76 ? 286 ARG A CZ  1 
ATOM   1049 N NH1 . ARG A 1 136 ? -96.099  29.170 60.932 1.00 23.07 ? 286 ARG A NH1 1 
ATOM   1050 N NH2 . ARG A 1 136 ? -94.222  30.331 61.532 1.00 26.31 ? 286 ARG A NH2 1 
ATOM   1051 N N   . GLY A 1 137 ? -91.113  27.060 54.403 1.00 22.11 ? 287 GLY A N   1 
ATOM   1052 C CA  . GLY A 1 137 ? -90.034  26.099 54.297 1.00 22.55 ? 287 GLY A CA  1 
ATOM   1053 C C   . GLY A 1 137 ? -90.273  25.125 53.163 1.00 23.50 ? 287 GLY A C   1 
ATOM   1054 O O   . GLY A 1 137 ? -91.098  25.378 52.282 1.00 21.84 ? 287 GLY A O   1 
ATOM   1055 N N   . THR A 1 138 ? -89.558  24.005 53.189 1.00 23.96 ? 288 THR A N   1 
ATOM   1056 C CA  . THR A 1 138 ? -89.693  22.998 52.148 1.00 23.95 ? 288 THR A CA  1 
ATOM   1057 C C   . THR A 1 138 ? -89.976  21.609 52.697 1.00 24.38 ? 288 THR A C   1 
ATOM   1058 O O   . THR A 1 138 ? -89.677  20.612 52.038 1.00 25.26 ? 288 THR A O   1 
ATOM   1059 C CB  . THR A 1 138 ? -88.425  22.930 51.279 1.00 24.36 ? 288 THR A CB  1 
ATOM   1060 O OG1 . THR A 1 138 ? -87.305  22.573 52.099 1.00 25.61 ? 288 THR A OG1 1 
ATOM   1061 C CG2 . THR A 1 138 ? -88.161  24.279 50.614 1.00 23.85 ? 288 THR A CG2 1 
ATOM   1062 N N   . GLU A 1 139 ? -90.530  21.534 53.907 1.00 24.13 ? 289 GLU A N   1 
ATOM   1063 C CA  . GLU A 1 139 ? -90.870  20.241 54.490 1.00 24.00 ? 289 GLU A CA  1 
ATOM   1064 C C   . GLU A 1 139 ? -92.259  19.861 53.994 1.00 24.00 ? 289 GLU A C   1 
ATOM   1065 O O   . GLU A 1 139 ? -93.149  20.710 53.897 1.00 24.28 ? 289 GLU A O   1 
ATOM   1066 C CB  . GLU A 1 139 ? -90.885  20.291 56.026 1.00 25.76 ? 289 GLU A CB  1 
ATOM   1067 C CG  . GLU A 1 139 ? -89.513  20.337 56.691 1.00 27.69 ? 289 GLU A CG  1 
ATOM   1068 C CD  . GLU A 1 139 ? -89.592  20.324 58.219 1.00 28.92 ? 289 GLU A CD  1 
ATOM   1069 O OE1 . GLU A 1 139 ? -90.007  19.299 58.802 1.00 29.90 ? 289 GLU A OE1 1 
ATOM   1070 O OE2 . GLU A 1 139 ? -89.241  21.344 58.842 1.00 29.98 ? 289 GLU A OE2 1 
ATOM   1071 N N   . LEU A 1 140 ? -92.441  18.589 53.668 1.00 23.86 ? 290 LEU A N   1 
ATOM   1072 C CA  . LEU A 1 140 ? -93.732  18.107 53.201 1.00 24.42 ? 290 LEU A CA  1 
ATOM   1073 C C   . LEU A 1 140 ? -94.369  17.243 54.285 1.00 23.12 ? 290 LEU A C   1 
ATOM   1074 O O   . LEU A 1 140 ? -93.684  16.496 54.982 1.00 22.54 ? 290 LEU A O   1 
ATOM   1075 C CB  . LEU A 1 140 ? -93.563  17.297 51.904 1.00 25.27 ? 290 LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 140 ? -93.231  18.083 50.627 1.00 26.44 ? 290 LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 140 ? -92.752  17.140 49.525 1.00 27.83 ? 290 LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 140 ? -94.458  18.847 50.176 1.00 26.73 ? 290 LEU A CD2 1 
ATOM   1079 N N   . ASP A 1 141 ? -95.683  17.360 54.434 1.00 23.77 ? 291 ASP A N   1 
ATOM   1080 C CA  . ASP A 1 141 ? -96.415  16.580 55.425 1.00 22.34 ? 291 ASP A CA  1 
ATOM   1081 C C   . ASP A 1 141 ? -97.087  15.431 54.671 1.00 23.94 ? 291 ASP A C   1 
ATOM   1082 O O   . ASP A 1 141 ? -98.050  15.640 53.924 1.00 22.43 ? 291 ASP A O   1 
ATOM   1083 C CB  . ASP A 1 141 ? -97.468  17.458 56.100 1.00 20.84 ? 291 ASP A CB  1 
ATOM   1084 C CG  . ASP A 1 141 ? -97.927  16.905 57.437 1.00 21.54 ? 291 ASP A CG  1 
ATOM   1085 O OD1 . ASP A 1 141 ? -98.240  15.699 57.514 1.00 22.59 ? 291 ASP A OD1 1 
ATOM   1086 O OD2 . ASP A 1 141 ? -97.988  17.683 58.413 1.00 17.86 ? 291 ASP A OD2 1 
ATOM   1087 N N   . CYS A 1 142 ? -96.570  14.219 54.852 1.00 26.72 ? 292 CYS A N   1 
ATOM   1088 C CA  . CYS A 1 142 ? -97.125  13.060 54.161 1.00 30.59 ? 292 CYS A CA  1 
ATOM   1089 C C   . CYS A 1 142 ? -98.432  12.547 54.768 1.00 31.38 ? 292 CYS A C   1 
ATOM   1090 O O   . CYS A 1 142 ? -99.139  11.747 54.151 1.00 31.74 ? 292 CYS A O   1 
ATOM   1091 C CB  . CYS A 1 142 ? -96.087  11.941 54.109 1.00 31.41 ? 292 CYS A CB  1 
ATOM   1092 S SG  . CYS A 1 142 ? -94.573  12.420 53.244 1.00 37.67 ? 292 CYS A SG  1 
ATOM   1093 N N   . GLY A 1 143 ? -98.757  13.017 55.968 1.00 32.43 ? 293 GLY A N   1 
ATOM   1094 C CA  . GLY A 1 143 ? -99.987  12.598 56.615 1.00 34.48 ? 293 GLY A CA  1 
ATOM   1095 C C   . GLY A 1 143 ? -99.891  11.246 57.292 1.00 36.36 ? 293 GLY A C   1 
ATOM   1096 O O   . GLY A 1 143 ? -98.883  10.551 57.165 1.00 35.40 ? 293 GLY A O   1 
ATOM   1097 N N   . ILE A 1 144 ? -100.943 10.871 58.014 1.00 38.54 ? 294 ILE A N   1 
ATOM   1098 C CA  . ILE A 1 144 ? -100.980 9.592  58.714 1.00 41.12 ? 294 ILE A CA  1 
ATOM   1099 C C   . ILE A 1 144 ? -102.411 9.064  58.782 1.00 44.24 ? 294 ILE A C   1 
ATOM   1100 O O   . ILE A 1 144 ? -103.371 9.831  58.670 1.00 43.89 ? 294 ILE A O   1 
ATOM   1101 C CB  . ILE A 1 144 ? -100.421 9.726  60.155 1.00 40.82 ? 294 ILE A CB  1 
ATOM   1102 C CG1 . ILE A 1 144 ? -100.470 8.373  60.870 1.00 40.74 ? 294 ILE A CG1 1 
ATOM   1103 C CG2 . ILE A 1 144 ? -101.230 10.750 60.937 1.00 39.16 ? 294 ILE A CG2 1 
ATOM   1104 C CD1 . ILE A 1 144 ? -99.668  7.288  60.187 1.00 42.11 ? 294 ILE A CD1 1 
ATOM   1105 N N   . GLU A 1 145 ? -102.540 7.752  58.959 1.00 47.14 ? 295 GLU A N   1 
ATOM   1106 C CA  . GLU A 1 145 ? -103.840 7.093  59.057 1.00 50.55 ? 295 GLU A CA  1 
ATOM   1107 C C   . GLU A 1 145 ? -104.588 7.131  57.732 1.00 50.94 ? 295 GLU A C   1 
ATOM   1108 O O   . GLU A 1 145 ? -105.622 7.832  57.665 1.00 52.63 ? 295 GLU A O   1 
ATOM   1109 C CB  . GLU A 1 145 ? -104.690 7.753  60.146 1.00 52.58 ? 295 GLU A CB  1 
ATOM   1110 C CG  . GLU A 1 145 ? -106.005 7.051  60.414 1.00 57.61 ? 295 GLU A CG  1 
ATOM   1111 C CD  . GLU A 1 145 ? -106.921 7.855  61.314 1.00 61.13 ? 295 GLU A CD  1 
ATOM   1112 O OE1 . GLU A 1 145 ? -107.352 8.952  60.895 1.00 62.31 ? 295 GLU A OE1 1 
ATOM   1113 O OE2 . GLU A 1 145 ? -107.210 7.391  62.439 1.00 63.14 ? 295 GLU A OE2 1 
ATOM   1114 N N   . LYS B 2 11  ? -99.147  50.268 81.100 1.00 35.00 ? 320 LYS B N   1 
ATOM   1115 C CA  . LYS B 2 11  ? -97.994  49.860 80.242 1.00 34.14 ? 320 LYS B CA  1 
ATOM   1116 C C   . LYS B 2 11  ? -98.175  48.429 79.718 1.00 31.73 ? 320 LYS B C   1 
ATOM   1117 O O   . LYS B 2 11  ? -98.324  47.486 80.498 1.00 30.81 ? 320 LYS B O   1 
ATOM   1118 C CB  . LYS B 2 11  ? -96.706  49.968 81.058 1.00 35.89 ? 320 LYS B CB  1 
ATOM   1119 C CG  . LYS B 2 11  ? -95.430  50.090 80.247 1.00 37.49 ? 320 LYS B CG  1 
ATOM   1120 C CD  . LYS B 2 11  ? -94.403  50.903 81.034 1.00 38.34 ? 320 LYS B CD  1 
ATOM   1121 C CE  . LYS B 2 11  ? -93.040  50.914 80.368 1.00 37.94 ? 320 LYS B CE  1 
ATOM   1122 N NZ  . LYS B 2 11  ? -92.394  49.578 80.464 1.00 38.16 ? 320 LYS B NZ  1 
ATOM   1123 N N   . ILE B 2 12  ? -98.175  48.272 78.397 1.00 28.32 ? 321 ILE B N   1 
ATOM   1124 C CA  . ILE B 2 12  ? -98.335  46.949 77.800 1.00 25.78 ? 321 ILE B CA  1 
ATOM   1125 C C   . ILE B 2 12  ? -97.201  46.610 76.833 1.00 23.17 ? 321 ILE B C   1 
ATOM   1126 O O   . ILE B 2 12  ? -96.498  47.495 76.348 1.00 24.62 ? 321 ILE B O   1 
ATOM   1127 C CB  . ILE B 2 12  ? -99.651  46.831 77.013 1.00 25.96 ? 321 ILE B CB  1 
ATOM   1128 C CG1 . ILE B 2 12  ? -99.611  47.762 75.798 1.00 25.80 ? 321 ILE B CG1 1 
ATOM   1129 C CG2 . ILE B 2 12  ? -100.827 47.152 77.918 1.00 28.08 ? 321 ILE B CG2 1 
ATOM   1130 C CD1 . ILE B 2 12  ? -100.771 47.575 74.839 1.00 27.07 ? 321 ILE B CD1 1 
ATOM   1131 N N   . PRO B 2 13  ? -97.008  45.314 76.548 1.00 20.56 ? 322 PRO B N   1 
ATOM   1132 C CA  . PRO B 2 13  ? -95.951  44.887 75.626 1.00 19.07 ? 322 PRO B CA  1 
ATOM   1133 C C   . PRO B 2 13  ? -96.222  45.465 74.242 1.00 18.32 ? 322 PRO B C   1 
ATOM   1134 O O   . PRO B 2 13  ? -97.376  45.559 73.830 1.00 19.19 ? 322 PRO B O   1 
ATOM   1135 C CB  . PRO B 2 13  ? -96.071  43.366 75.644 1.00 17.62 ? 322 PRO B CB  1 
ATOM   1136 C CG  . PRO B 2 13  ? -96.591  43.090 77.030 1.00 18.57 ? 322 PRO B CG  1 
ATOM   1137 C CD  . PRO B 2 13  ? -97.639  44.154 77.199 1.00 17.82 ? 322 PRO B CD  1 
ATOM   1138 N N   . VAL B 2 14  ? -95.171  45.856 73.528 1.00 17.95 ? 323 VAL B N   1 
ATOM   1139 C CA  . VAL B 2 14  ? -95.351  46.418 72.195 1.00 18.75 ? 323 VAL B CA  1 
ATOM   1140 C C   . VAL B 2 14  ? -95.669  45.318 71.188 1.00 19.88 ? 323 VAL B C   1 
ATOM   1141 O O   . VAL B 2 14  ? -96.091  45.602 70.068 1.00 21.37 ? 323 VAL B O   1 
ATOM   1142 C CB  . VAL B 2 14  ? -94.090  47.201 71.717 1.00 20.24 ? 323 VAL B CB  1 
ATOM   1143 C CG1 . VAL B 2 14  ? -93.820  48.390 72.652 1.00 16.81 ? 323 VAL B CG1 1 
ATOM   1144 C CG2 . VAL B 2 14  ? -92.880  46.273 71.668 1.00 18.04 ? 323 VAL B CG2 1 
ATOM   1145 N N   . GLU B 2 15  ? -95.470  44.062 71.587 1.00 18.26 ? 324 GLU B N   1 
ATOM   1146 C CA  . GLU B 2 15  ? -95.759  42.930 70.708 1.00 17.31 ? 324 GLU B CA  1 
ATOM   1147 C C   . GLU B 2 15  ? -97.150  42.375 71.010 1.00 16.70 ? 324 GLU B C   1 
ATOM   1148 O O   . GLU B 2 15  ? -97.615  41.440 70.355 1.00 14.90 ? 324 GLU B O   1 
ATOM   1149 C CB  . GLU B 2 15  ? -94.713  41.821 70.891 1.00 19.17 ? 324 GLU B CB  1 
ATOM   1150 C CG  . GLU B 2 15  ? -93.310  42.201 70.443 1.00 25.47 ? 324 GLU B CG  1 
ATOM   1151 C CD  . GLU B 2 15  ? -93.163  42.228 68.928 1.00 28.00 ? 324 GLU B CD  1 
ATOM   1152 O OE1 . GLU B 2 15  ? -94.188  42.388 68.235 1.00 33.40 ? 324 GLU B OE1 1 
ATOM   1153 O OE2 . GLU B 2 15  ? -92.024  42.101 68.432 1.00 28.92 ? 324 GLU B OE2 1 
ATOM   1154 N N   . ALA B 2 16  ? -97.813  42.955 72.006 1.00 14.76 ? 325 ALA B N   1 
ATOM   1155 C CA  . ALA B 2 16  ? -99.142  42.497 72.386 1.00 14.03 ? 325 ALA B CA  1 
ATOM   1156 C C   . ALA B 2 16  ? -100.199 42.867 71.357 1.00 13.98 ? 325 ALA B C   1 
ATOM   1157 O O   . ALA B 2 16  ? -100.040 43.821 70.595 1.00 12.29 ? 325 ALA B O   1 
ATOM   1158 C CB  . ALA B 2 16  ? -99.524  43.067 73.749 1.00 12.99 ? 325 ALA B CB  1 
ATOM   1159 N N   . ASP B 2 17  ? -101.268 42.077 71.340 1.00 13.84 ? 326 ASP B N   1 
ATOM   1160 C CA  . ASP B 2 17  ? -102.413 42.273 70.463 1.00 15.03 ? 326 ASP B CA  1 
ATOM   1161 C C   . ASP B 2 17  ? -102.181 42.010 68.989 1.00 15.59 ? 326 ASP B C   1 
ATOM   1162 O O   . ASP B 2 17  ? -102.828 42.604 68.125 1.00 14.73 ? 326 ASP B O   1 
ATOM   1163 C CB  . ASP B 2 17  ? -102.981 43.677 70.653 1.00 16.12 ? 326 ASP B CB  1 
ATOM   1164 C CG  . ASP B 2 17  ? -103.265 43.984 72.100 1.00 14.39 ? 326 ASP B CG  1 
ATOM   1165 O OD1 . ASP B 2 17  ? -103.977 43.190 72.755 1.00 14.00 ? 326 ASP B OD1 1 
ATOM   1166 O OD2 . ASP B 2 17  ? -102.778 45.025 72.579 1.00 16.77 ? 326 ASP B OD2 1 
ATOM   1167 N N   . PHE B 2 18  ? -101.253 41.113 68.710 1.00 15.14 ? 327 PHE B N   1 
ATOM   1168 C CA  . PHE B 2 18  ? -100.960 40.722 67.347 1.00 15.35 ? 327 PHE B CA  1 
ATOM   1169 C C   . PHE B 2 18  ? -101.469 39.302 67.191 1.00 15.48 ? 327 PHE B C   1 
ATOM   1170 O O   . PHE B 2 18  ? -101.452 38.520 68.148 1.00 14.41 ? 327 PHE B O   1 
ATOM   1171 C CB  . PHE B 2 18  ? -99.451  40.735 67.099 1.00 15.67 ? 327 PHE B CB  1 
ATOM   1172 C CG  . PHE B 2 18  ? -98.922  42.060 66.644 1.00 16.78 ? 327 PHE B CG  1 
ATOM   1173 C CD1 . PHE B 2 18  ? -98.829  42.356 65.282 1.00 17.41 ? 327 PHE B CD1 1 
ATOM   1174 C CD2 . PHE B 2 18  ? -98.510  43.015 67.569 1.00 16.16 ? 327 PHE B CD2 1 
ATOM   1175 C CE1 . PHE B 2 18  ? -98.331  43.583 64.852 1.00 17.71 ? 327 PHE B CE1 1 
ATOM   1176 C CE2 . PHE B 2 18  ? -98.009  44.249 67.146 1.00 16.14 ? 327 PHE B CE2 1 
ATOM   1177 C CZ  . PHE B 2 18  ? -97.920  44.531 65.789 1.00 14.64 ? 327 PHE B CZ  1 
ATOM   1178 N N   . LEU B 2 19  ? -101.967 38.983 66.004 1.00 14.84 ? 328 LEU B N   1 
ATOM   1179 C CA  . LEU B 2 19  ? -102.406 37.627 65.721 1.00 13.39 ? 328 LEU B CA  1 
ATOM   1180 C C   . LEU B 2 19  ? -101.924 37.286 64.323 1.00 12.81 ? 328 LEU B C   1 
ATOM   1181 O O   . LEU B 2 19  ? -102.167 38.033 63.378 1.00 10.71 ? 328 LEU B O   1 
ATOM   1182 C CB  . LEU B 2 19  ? -103.926 37.471 65.783 1.00 14.36 ? 328 LEU B CB  1 
ATOM   1183 C CG  . LEU B 2 19  ? -104.247 36.022 65.381 1.00 16.59 ? 328 LEU B CG  1 
ATOM   1184 C CD1 . LEU B 2 19  ? -104.888 35.294 66.537 1.00 14.91 ? 328 LEU B CD1 1 
ATOM   1185 C CD2 . LEU B 2 19  ? -105.135 35.994 64.145 1.00 15.41 ? 328 LEU B CD2 1 
ATOM   1186 N N   . TYR B 2 20  ? -101.222 36.168 64.195 1.00 12.26 ? 329 TYR B N   1 
ATOM   1187 C CA  . TYR B 2 20  ? -100.739 35.759 62.888 1.00 14.44 ? 329 TYR B CA  1 
ATOM   1188 C C   . TYR B 2 20  ? -101.373 34.428 62.517 1.00 14.38 ? 329 TYR B C   1 
ATOM   1189 O O   . TYR B 2 20  ? -101.097 33.405 63.147 1.00 16.46 ? 329 TYR B O   1 
ATOM   1190 C CB  . TYR B 2 20  ? -99.211  35.610 62.885 1.00 16.17 ? 329 TYR B CB  1 
ATOM   1191 C CG  . TYR B 2 20  ? -98.457  36.773 63.486 1.00 20.63 ? 329 TYR B CG  1 
ATOM   1192 C CD1 . TYR B 2 20  ? -98.389  36.944 64.864 1.00 20.47 ? 329 TYR B CD1 1 
ATOM   1193 C CD2 . TYR B 2 20  ? -97.804  37.703 62.673 1.00 23.43 ? 329 TYR B CD2 1 
ATOM   1194 C CE1 . TYR B 2 20  ? -97.684  38.018 65.426 1.00 24.03 ? 329 TYR B CE1 1 
ATOM   1195 C CE2 . TYR B 2 20  ? -97.096  38.782 63.226 1.00 24.70 ? 329 TYR B CE2 1 
ATOM   1196 C CZ  . TYR B 2 20  ? -97.045  38.931 64.604 1.00 24.81 ? 329 TYR B CZ  1 
ATOM   1197 O OH  . TYR B 2 20  ? -96.384  40.007 65.158 1.00 27.04 ? 329 TYR B OH  1 
ATOM   1198 N N   . ALA B 2 21  ? -102.228 34.443 61.504 1.00 12.17 ? 330 ALA B N   1 
ATOM   1199 C CA  . ALA B 2 21  ? -102.872 33.227 61.054 1.00 12.71 ? 330 ALA B CA  1 
ATOM   1200 C C   . ALA B 2 21  ? -102.068 32.691 59.876 1.00 13.92 ? 330 ALA B C   1 
ATOM   1201 O O   . ALA B 2 21  ? -102.265 33.101 58.737 1.00 12.44 ? 330 ALA B O   1 
ATOM   1202 C CB  . ALA B 2 21  ? -104.312 33.515 60.638 1.00 11.78 ? 330 ALA B CB  1 
ATOM   1203 N N   . TYR B 2 22  ? -101.140 31.788 60.166 1.00 16.20 ? 331 TYR B N   1 
ATOM   1204 C CA  . TYR B 2 22  ? -100.320 31.201 59.127 1.00 16.85 ? 331 TYR B CA  1 
ATOM   1205 C C   . TYR B 2 22  ? -101.099 30.077 58.463 1.00 16.87 ? 331 TYR B C   1 
ATOM   1206 O O   . TYR B 2 22  ? -101.864 29.361 59.118 1.00 15.66 ? 331 TYR B O   1 
ATOM   1207 C CB  . TYR B 2 22  ? -99.018  30.664 59.723 1.00 17.31 ? 331 TYR B CB  1 
ATOM   1208 C CG  . TYR B 2 22  ? -98.053  31.748 60.144 1.00 19.10 ? 331 TYR B CG  1 
ATOM   1209 C CD1 . TYR B 2 22  ? -97.320  32.464 59.197 1.00 18.96 ? 331 TYR B CD1 1 
ATOM   1210 C CD2 . TYR B 2 22  ? -97.881  32.069 61.493 1.00 19.53 ? 331 TYR B CD2 1 
ATOM   1211 C CE1 . TYR B 2 22  ? -96.437  33.475 59.586 1.00 21.49 ? 331 TYR B CE1 1 
ATOM   1212 C CE2 . TYR B 2 22  ? -97.008  33.071 61.890 1.00 19.72 ? 331 TYR B CE2 1 
ATOM   1213 C CZ  . TYR B 2 22  ? -96.290  33.768 60.935 1.00 20.60 ? 331 TYR B CZ  1 
ATOM   1214 O OH  . TYR B 2 22  ? -95.424  34.750 61.332 1.00 23.28 ? 331 TYR B OH  1 
ATOM   1215 N N   . SER B 2 23  ? -100.900 29.937 57.156 1.00 16.26 ? 332 SER B N   1 
ATOM   1216 C CA  . SER B 2 23  ? -101.578 28.915 56.367 1.00 15.86 ? 332 SER B CA  1 
ATOM   1217 C C   . SER B 2 23  ? -100.964 27.542 56.584 1.00 15.77 ? 332 SER B C   1 
ATOM   1218 O O   . SER B 2 23  ? -101.582 26.526 56.267 1.00 13.18 ? 332 SER B O   1 
ATOM   1219 C CB  . SER B 2 23  ? -101.475 29.254 54.880 1.00 17.28 ? 332 SER B CB  1 
ATOM   1220 O OG  . SER B 2 23  ? -100.119 29.265 54.464 1.00 18.47 ? 332 SER B OG  1 
ATOM   1221 N N   . THR B 2 24  ? -99.752  27.520 57.134 1.00 13.92 ? 333 THR B N   1 
ATOM   1222 C CA  . THR B 2 24  ? -99.037  26.269 57.338 1.00 14.05 ? 333 THR B CA  1 
ATOM   1223 C C   . THR B 2 24  ? -98.099  26.322 58.554 1.00 14.34 ? 333 THR B C   1 
ATOM   1224 O O   . THR B 2 24  ? -97.780  27.400 59.069 1.00 14.73 ? 333 THR B O   1 
ATOM   1225 C CB  . THR B 2 24  ? -98.219  25.925 56.053 1.00 12.33 ? 333 THR B CB  1 
ATOM   1226 O OG1 . THR B 2 24  ? -97.798  24.557 56.084 1.00 12.39 ? 333 THR B OG1 1 
ATOM   1227 C CG2 . THR B 2 24  ? -96.982  26.822 55.956 1.00 12.05 ? 333 THR B CG2 1 
ATOM   1228 N N   . ALA B 2 25  ? -97.659  25.149 59.002 1.00 12.64 ? 334 ALA B N   1 
ATOM   1229 C CA  . ALA B 2 25  ? -96.769  25.047 60.152 1.00 14.20 ? 334 ALA B CA  1 
ATOM   1230 C C   . ALA B 2 25  ? -95.351  25.497 59.805 1.00 14.67 ? 334 ALA B C   1 
ATOM   1231 O O   . ALA B 2 25  ? -94.930  25.411 58.655 1.00 14.88 ? 334 ALA B O   1 
ATOM   1232 C CB  . ALA B 2 25  ? -96.741  23.602 60.665 1.00 15.47 ? 334 ALA B CB  1 
ATOM   1233 N N   . PRO B 2 26  ? -94.591  25.975 60.805 1.00 15.21 ? 335 PRO B N   1 
ATOM   1234 C CA  . PRO B 2 26  ? -93.213  26.434 60.597 1.00 15.38 ? 335 PRO B CA  1 
ATOM   1235 C C   . PRO B 2 26  ? -92.373  25.419 59.815 1.00 16.75 ? 335 PRO B C   1 
ATOM   1236 O O   . PRO B 2 26  ? -92.394  24.223 60.116 1.00 15.18 ? 335 PRO B O   1 
ATOM   1237 C CB  . PRO B 2 26  ? -92.690  26.606 62.017 1.00 15.46 ? 335 PRO B CB  1 
ATOM   1238 C CG  . PRO B 2 26  ? -93.921  27.013 62.775 1.00 18.24 ? 335 PRO B CG  1 
ATOM   1239 C CD  . PRO B 2 26  ? -94.982  26.099 62.221 1.00 15.43 ? 335 PRO B CD  1 
ATOM   1240 N N   . GLY B 2 27  ? -91.643  25.901 58.814 1.00 17.02 ? 336 GLY B N   1 
ATOM   1241 C CA  . GLY B 2 27  ? -90.788  25.025 58.029 1.00 18.81 ? 336 GLY B CA  1 
ATOM   1242 C C   . GLY B 2 27  ? -91.475  24.253 56.915 1.00 19.24 ? 336 GLY B C   1 
ATOM   1243 O O   . GLY B 2 27  ? -90.804  23.567 56.139 1.00 18.95 ? 336 GLY B O   1 
ATOM   1244 N N   . TYR B 2 28  ? -92.798  24.367 56.817 1.00 17.32 ? 337 TYR B N   1 
ATOM   1245 C CA  . TYR B 2 28  ? -93.528  23.639 55.784 1.00 16.35 ? 337 TYR B CA  1 
ATOM   1246 C C   . TYR B 2 28  ? -93.996  24.431 54.585 1.00 17.19 ? 337 TYR B C   1 
ATOM   1247 O O   . TYR B 2 28  ? -94.104  25.662 54.612 1.00 16.15 ? 337 TYR B O   1 
ATOM   1248 C CB  . TYR B 2 28  ? -94.758  22.934 56.365 1.00 14.58 ? 337 TYR B CB  1 
ATOM   1249 C CG  . TYR B 2 28  ? -94.436  21.688 57.142 1.00 14.15 ? 337 TYR B CG  1 
ATOM   1250 C CD1 . TYR B 2 28  ? -93.935  21.777 58.438 1.00 13.45 ? 337 TYR B CD1 1 
ATOM   1251 C CD2 . TYR B 2 28  ? -94.611  20.414 56.575 1.00 11.95 ? 337 TYR B CD2 1 
ATOM   1252 C CE1 . TYR B 2 28  ? -93.615  20.640 59.166 1.00 14.46 ? 337 TYR B CE1 1 
ATOM   1253 C CE2 . TYR B 2 28  ? -94.288  19.259 57.296 1.00 10.76 ? 337 TYR B CE2 1 
ATOM   1254 C CZ  . TYR B 2 28  ? -93.791  19.384 58.597 1.00 12.94 ? 337 TYR B CZ  1 
ATOM   1255 O OH  . TYR B 2 28  ? -93.476  18.270 59.345 1.00 13.15 ? 337 TYR B OH  1 
ATOM   1256 N N   . TYR B 2 29  ? -94.287  23.672 53.532 1.00 18.76 ? 338 TYR B N   1 
ATOM   1257 C CA  . TYR B 2 29  ? -94.806  24.196 52.279 1.00 18.50 ? 338 TYR B CA  1 
ATOM   1258 C C   . TYR B 2 29  ? -96.268  24.534 52.544 1.00 18.41 ? 338 TYR B C   1 
ATOM   1259 O O   . TYR B 2 29  ? -96.860  24.046 53.509 1.00 16.73 ? 338 TYR B O   1 
ATOM   1260 C CB  . TYR B 2 29  ? -94.783  23.114 51.204 1.00 18.68 ? 338 TYR B CB  1 
ATOM   1261 C CG  . TYR B 2 29  ? -93.467  22.856 50.503 1.00 19.31 ? 338 TYR B CG  1 
ATOM   1262 C CD1 . TYR B 2 29  ? -92.946  23.777 49.594 1.00 17.66 ? 338 TYR B CD1 1 
ATOM   1263 C CD2 . TYR B 2 29  ? -92.811  21.630 50.647 1.00 19.07 ? 338 TYR B CD2 1 
ATOM   1264 C CE1 . TYR B 2 29  ? -91.815  23.479 48.832 1.00 17.48 ? 338 TYR B CE1 1 
ATOM   1265 C CE2 . TYR B 2 29  ? -91.682  21.321 49.889 1.00 19.04 ? 338 TYR B CE2 1 
ATOM   1266 C CZ  . TYR B 2 29  ? -91.193  22.248 48.983 1.00 19.97 ? 338 TYR B CZ  1 
ATOM   1267 O OH  . TYR B 2 29  ? -90.094  21.937 48.213 1.00 21.12 ? 338 TYR B OH  1 
ATOM   1268 N N   . SER B 2 30  ? -96.846  25.356 51.677 1.00 20.57 ? 339 SER B N   1 
ATOM   1269 C CA  . SER B 2 30  ? -98.258  25.722 51.778 1.00 21.39 ? 339 SER B CA  1 
ATOM   1270 C C   . SER B 2 30  ? -98.860  25.517 50.388 1.00 21.91 ? 339 SER B C   1 
ATOM   1271 O O   . SER B 2 30  ? -98.334  26.032 49.398 1.00 21.78 ? 339 SER B O   1 
ATOM   1272 C CB  . SER B 2 30  ? -98.415  27.176 52.208 1.00 20.34 ? 339 SER B CB  1 
ATOM   1273 O OG  . SER B 2 30  ? -99.787  27.503 52.332 1.00 20.76 ? 339 SER B OG  1 
ATOM   1274 N N   . TRP B 2 31  ? -99.963  24.778 50.314 1.00 22.47 ? 340 TRP B N   1 
ATOM   1275 C CA  . TRP B 2 31  ? -100.584 24.467 49.028 1.00 22.19 ? 340 TRP B CA  1 
ATOM   1276 C C   . TRP B 2 31  ? -101.675 25.387 48.493 1.00 23.19 ? 340 TRP B C   1 
ATOM   1277 O O   . TRP B 2 31  ? -102.487 25.942 49.236 1.00 22.50 ? 340 TRP B O   1 
ATOM   1278 C CB  . TRP B 2 31  ? -101.114 23.034 49.043 1.00 21.88 ? 340 TRP B CB  1 
ATOM   1279 C CG  . TRP B 2 31  ? -100.059 21.998 49.220 1.00 20.76 ? 340 TRP B CG  1 
ATOM   1280 C CD1 . TRP B 2 31  ? -99.581  21.509 50.399 1.00 22.63 ? 340 TRP B CD1 1 
ATOM   1281 C CD2 . TRP B 2 31  ? -99.363  21.297 48.182 1.00 22.89 ? 340 TRP B CD2 1 
ATOM   1282 N NE1 . TRP B 2 31  ? -98.633  20.541 50.163 1.00 21.69 ? 340 TRP B NE1 1 
ATOM   1283 C CE2 . TRP B 2 31  ? -98.479  20.391 48.810 1.00 22.80 ? 340 TRP B CE2 1 
ATOM   1284 C CE3 . TRP B 2 31  ? -99.399  21.345 46.780 1.00 22.29 ? 340 TRP B CE3 1 
ATOM   1285 C CZ2 . TRP B 2 31  ? -97.637  19.537 48.084 1.00 22.40 ? 340 TRP B CZ2 1 
ATOM   1286 C CZ3 . TRP B 2 31  ? -98.560  20.496 46.059 1.00 23.56 ? 340 TRP B CZ3 1 
ATOM   1287 C CH2 . TRP B 2 31  ? -97.692  19.605 46.715 1.00 23.23 ? 340 TRP B CH2 1 
ATOM   1288 N N   . ARG B 2 32  ? -101.689 25.507 47.170 1.00 24.07 ? 341 ARG B N   1 
ATOM   1289 C CA  . ARG B 2 32  ? -102.636 26.349 46.458 1.00 25.24 ? 341 ARG B CA  1 
ATOM   1290 C C   . ARG B 2 32  ? -103.195 25.584 45.257 1.00 25.13 ? 341 ARG B C   1 
ATOM   1291 O O   . ARG B 2 32  ? -102.451 24.906 44.551 1.00 24.72 ? 341 ARG B O   1 
ATOM   1292 C CB  . ARG B 2 32  ? -101.925 27.611 45.960 1.00 25.76 ? 341 ARG B CB  1 
ATOM   1293 C CG  . ARG B 2 32  ? -102.839 28.617 45.289 1.00 30.67 ? 341 ARG B CG  1 
ATOM   1294 C CD  . ARG B 2 32  ? -102.057 29.751 44.641 1.00 33.57 ? 341 ARG B CD  1 
ATOM   1295 N NE  . ARG B 2 32  ? -101.445 29.331 43.384 1.00 39.91 ? 341 ARG B NE  1 
ATOM   1296 C CZ  . ARG B 2 32  ? -100.191 28.914 43.253 1.00 39.10 ? 341 ARG B CZ  1 
ATOM   1297 N NH1 . ARG B 2 32  ? -99.391  28.863 44.305 1.00 38.23 ? 341 ARG B NH1 1 
ATOM   1298 N NH2 . ARG B 2 32  ? -99.743  28.539 42.063 1.00 41.05 ? 341 ARG B NH2 1 
ATOM   1299 N N   . ASN B 2 33  ? -104.500 25.689 45.029 1.00 25.41 ? 342 ASN B N   1 
ATOM   1300 C CA  . ASN B 2 33  ? -105.124 25.014 43.897 1.00 24.99 ? 342 ASN B CA  1 
ATOM   1301 C C   . ASN B 2 33  ? -105.287 26.023 42.761 1.00 26.01 ? 342 ASN B C   1 
ATOM   1302 O O   . ASN B 2 33  ? -105.747 27.145 42.971 1.00 24.82 ? 342 ASN B O   1 
ATOM   1303 C CB  . ASN B 2 33  ? -106.479 24.427 44.307 1.00 23.59 ? 342 ASN B CB  1 
ATOM   1304 C CG  . ASN B 2 33  ? -107.224 23.800 43.137 1.00 23.27 ? 342 ASN B CG  1 
ATOM   1305 O OD1 . ASN B 2 33  ? -107.762 24.501 42.284 1.00 20.96 ? 342 ASN B OD1 1 
ATOM   1306 N ND2 . ASN B 2 33  ? -107.245 22.471 43.089 1.00 21.44 ? 342 ASN B ND2 1 
ATOM   1307 N N   . SER B 2 34  ? -104.895 25.612 41.560 1.00 28.85 ? 343 SER B N   1 
ATOM   1308 C CA  . SER B 2 34  ? -104.944 26.460 40.367 1.00 30.27 ? 343 SER B CA  1 
ATOM   1309 C C   . SER B 2 34  ? -106.254 27.175 40.068 1.00 30.89 ? 343 SER B C   1 
ATOM   1310 O O   . SER B 2 34  ? -106.241 28.288 39.553 1.00 30.96 ? 343 SER B O   1 
ATOM   1311 C CB  . SER B 2 34  ? -104.549 25.641 39.140 1.00 31.37 ? 343 SER B CB  1 
ATOM   1312 O OG  . SER B 2 34  ? -103.249 25.103 39.297 1.00 35.12 ? 343 SER B OG  1 
ATOM   1313 N N   . LYS B 2 35  ? -107.385 26.551 40.372 1.00 31.77 ? 344 LYS B N   1 
ATOM   1314 C CA  . LYS B 2 35  ? -108.655 27.194 40.074 1.00 32.71 ? 344 LYS B CA  1 
ATOM   1315 C C   . LYS B 2 35  ? -109.454 27.641 41.290 1.00 31.41 ? 344 LYS B C   1 
ATOM   1316 O O   . LYS B 2 35  ? -110.249 28.570 41.191 1.00 31.09 ? 344 LYS B O   1 
ATOM   1317 C CB  . LYS B 2 35  ? -109.537 26.274 39.218 1.00 34.77 ? 344 LYS B CB  1 
ATOM   1318 C CG  . LYS B 2 35  ? -110.247 25.182 40.003 1.00 38.45 ? 344 LYS B CG  1 
ATOM   1319 C CD  . LYS B 2 35  ? -111.456 24.623 39.238 1.00 41.40 ? 344 LYS B CD  1 
ATOM   1320 C CE  . LYS B 2 35  ? -112.220 23.609 40.095 1.00 43.78 ? 344 LYS B CE  1 
ATOM   1321 N NZ  . LYS B 2 35  ? -113.482 23.125 39.462 1.00 45.10 ? 344 LYS B NZ  1 
ATOM   1322 N N   . ASP B 2 36  ? -109.251 26.984 42.429 1.00 30.15 ? 345 ASP B N   1 
ATOM   1323 C CA  . ASP B 2 36  ? -109.997 27.320 43.637 1.00 30.64 ? 345 ASP B CA  1 
ATOM   1324 C C   . ASP B 2 36  ? -109.252 28.274 44.566 1.00 30.21 ? 345 ASP B C   1 
ATOM   1325 O O   . ASP B 2 36  ? -109.860 28.920 45.419 1.00 30.08 ? 345 ASP B O   1 
ATOM   1326 C CB  . ASP B 2 36  ? -110.344 26.044 44.416 1.00 30.17 ? 345 ASP B CB  1 
ATOM   1327 C CG  . ASP B 2 36  ? -110.886 24.936 43.526 1.00 31.24 ? 345 ASP B CG  1 
ATOM   1328 O OD1 . ASP B 2 36  ? -111.803 25.197 42.719 1.00 32.25 ? 345 ASP B OD1 1 
ATOM   1329 O OD2 . ASP B 2 36  ? -110.399 23.793 43.641 1.00 32.03 ? 345 ASP B OD2 1 
ATOM   1330 N N   . GLY B 2 37  ? -107.938 28.362 44.393 1.00 29.36 ? 346 GLY B N   1 
ATOM   1331 C CA  . GLY B 2 37  ? -107.135 29.209 45.254 1.00 27.72 ? 346 GLY B CA  1 
ATOM   1332 C C   . GLY B 2 37  ? -106.450 28.330 46.287 1.00 27.09 ? 346 GLY B C   1 
ATOM   1333 O O   . GLY B 2 37  ? -106.505 27.097 46.190 1.00 24.66 ? 346 GLY B O   1 
ATOM   1334 N N   . SER B 2 38  ? -105.810 28.953 47.276 1.00 25.48 ? 347 SER B N   1 
ATOM   1335 C CA  . SER B 2 38  ? -105.115 28.215 48.331 1.00 23.51 ? 347 SER B CA  1 
ATOM   1336 C C   . SER B 2 38  ? -106.097 27.509 49.255 1.00 22.02 ? 347 SER B C   1 
ATOM   1337 O O   . SER B 2 38  ? -107.198 28.003 49.505 1.00 22.09 ? 347 SER B O   1 
ATOM   1338 C CB  . SER B 2 38  ? -104.241 29.159 49.161 1.00 20.84 ? 347 SER B CB  1 
ATOM   1339 O OG  . SER B 2 38  ? -105.031 30.110 49.852 1.00 19.42 ? 347 SER B OG  1 
ATOM   1340 N N   . TRP B 2 39  ? -105.691 26.349 49.762 1.00 21.86 ? 348 TRP B N   1 
ATOM   1341 C CA  . TRP B 2 39  ? -106.540 25.580 50.665 1.00 21.24 ? 348 TRP B CA  1 
ATOM   1342 C C   . TRP B 2 39  ? -106.912 26.401 51.893 1.00 21.44 ? 348 TRP B C   1 
ATOM   1343 O O   . TRP B 2 39  ? -108.059 26.380 52.352 1.00 20.09 ? 348 TRP B O   1 
ATOM   1344 C CB  . TRP B 2 39  ? -105.813 24.331 51.144 1.00 20.34 ? 348 TRP B CB  1 
ATOM   1345 C CG  . TRP B 2 39  ? -105.344 23.419 50.066 1.00 21.85 ? 348 TRP B CG  1 
ATOM   1346 C CD1 . TRP B 2 39  ? -105.661 23.474 48.733 1.00 21.62 ? 348 TRP B CD1 1 
ATOM   1347 C CD2 . TRP B 2 39  ? -104.517 22.264 50.236 1.00 20.48 ? 348 TRP B CD2 1 
ATOM   1348 N NE1 . TRP B 2 39  ? -105.085 22.417 48.072 1.00 20.37 ? 348 TRP B NE1 1 
ATOM   1349 C CE2 . TRP B 2 39  ? -104.380 21.657 48.970 1.00 18.84 ? 348 TRP B CE2 1 
ATOM   1350 C CE3 . TRP B 2 39  ? -103.884 21.676 51.343 1.00 19.85 ? 348 TRP B CE3 1 
ATOM   1351 C CZ2 . TRP B 2 39  ? -103.629 20.494 48.776 1.00 19.62 ? 348 TRP B CZ2 1 
ATOM   1352 C CZ3 . TRP B 2 39  ? -103.136 20.517 51.150 1.00 18.04 ? 348 TRP B CZ3 1 
ATOM   1353 C CH2 . TRP B 2 39  ? -103.018 19.937 49.876 1.00 19.40 ? 348 TRP B CH2 1 
ATOM   1354 N N   . PHE B 2 40  ? -105.918 27.116 52.418 1.00 19.68 ? 349 PHE B N   1 
ATOM   1355 C CA  . PHE B 2 40  ? -106.095 27.923 53.612 1.00 18.06 ? 349 PHE B CA  1 
ATOM   1356 C C   . PHE B 2 40  ? -107.028 29.113 53.431 1.00 18.09 ? 349 PHE B C   1 
ATOM   1357 O O   . PHE B 2 40  ? -107.917 29.344 54.255 1.00 17.61 ? 349 PHE B O   1 
ATOM   1358 C CB  . PHE B 2 40  ? -104.729 28.407 54.118 1.00 15.52 ? 349 PHE B CB  1 
ATOM   1359 C CG  . PHE B 2 40  ? -104.807 29.283 55.336 1.00 13.06 ? 349 PHE B CG  1 
ATOM   1360 C CD1 . PHE B 2 40  ? -105.264 28.770 56.550 1.00 11.45 ? 349 PHE B CD1 1 
ATOM   1361 C CD2 . PHE B 2 40  ? -104.426 30.622 55.271 1.00 11.70 ? 349 PHE B CD2 1 
ATOM   1362 C CE1 . PHE B 2 40  ? -105.342 29.578 57.689 1.00 9.85  ? 349 PHE B CE1 1 
ATOM   1363 C CE2 . PHE B 2 40  ? -104.498 31.439 56.402 1.00 13.17 ? 349 PHE B CE2 1 
ATOM   1364 C CZ  . PHE B 2 40  ? -104.958 30.914 57.616 1.00 13.56 ? 349 PHE B CZ  1 
ATOM   1365 N N   . ILE B 2 41  ? -106.830 29.877 52.363 1.00 17.47 ? 350 ILE B N   1 
ATOM   1366 C CA  . ILE B 2 41  ? -107.675 31.040 52.160 1.00 16.60 ? 350 ILE B CA  1 
ATOM   1367 C C   . ILE B 2 41  ? -109.108 30.644 51.853 1.00 16.91 ? 350 ILE B C   1 
ATOM   1368 O O   . ILE B 2 41  ? -110.037 31.242 52.398 1.00 17.29 ? 350 ILE B O   1 
ATOM   1369 C CB  . ILE B 2 41  ? -107.134 31.972 51.042 1.00 16.34 ? 350 ILE B CB  1 
ATOM   1370 C CG1 . ILE B 2 41  ? -105.808 32.603 51.482 1.00 14.69 ? 350 ILE B CG1 1 
ATOM   1371 C CG2 . ILE B 2 41  ? -108.146 33.082 50.746 1.00 12.62 ? 350 ILE B CG2 1 
ATOM   1372 C CD1 . ILE B 2 41  ? -105.913 33.433 52.755 1.00 18.69 ? 350 ILE B CD1 1 
ATOM   1373 N N   . GLN B 2 42  ? -109.312 29.632 51.015 1.00 17.43 ? 351 GLN B N   1 
ATOM   1374 C CA  . GLN B 2 42  ? -110.688 29.258 50.723 1.00 18.94 ? 351 GLN B CA  1 
ATOM   1375 C C   . GLN B 2 42  ? -111.347 28.713 51.983 1.00 17.93 ? 351 GLN B C   1 
ATOM   1376 O O   . GLN B 2 42  ? -112.541 28.917 52.197 1.00 19.01 ? 351 GLN B O   1 
ATOM   1377 C CB  . GLN B 2 42  ? -110.775 28.268 49.547 1.00 20.42 ? 351 GLN B CB  1 
ATOM   1378 C CG  . GLN B 2 42  ? -110.462 26.823 49.819 1.00 25.37 ? 351 GLN B CG  1 
ATOM   1379 C CD  . GLN B 2 42  ? -110.529 25.980 48.538 1.00 29.62 ? 351 GLN B CD  1 
ATOM   1380 O OE1 . GLN B 2 42  ? -109.650 26.064 47.671 1.00 29.60 ? 351 GLN B OE1 1 
ATOM   1381 N NE2 . GLN B 2 42  ? -111.581 25.176 48.413 1.00 31.14 ? 351 GLN B NE2 1 
ATOM   1382 N N   . SER B 2 43  ? -110.566 28.050 52.832 1.00 16.66 ? 352 SER B N   1 
ATOM   1383 C CA  . SER B 2 43  ? -111.113 27.523 54.075 1.00 16.55 ? 352 SER B CA  1 
ATOM   1384 C C   . SER B 2 43  ? -111.434 28.663 55.043 1.00 15.21 ? 352 SER B C   1 
ATOM   1385 O O   . SER B 2 43  ? -112.494 28.670 55.665 1.00 14.84 ? 352 SER B O   1 
ATOM   1386 C CB  . SER B 2 43  ? -110.141 26.535 54.713 1.00 15.64 ? 352 SER B CB  1 
ATOM   1387 O OG  . SER B 2 43  ? -110.101 25.334 53.956 1.00 17.75 ? 352 SER B OG  1 
ATOM   1388 N N   . LEU B 2 44  ? -110.534 29.637 55.146 1.00 14.19 ? 353 LEU B N   1 
ATOM   1389 C CA  . LEU B 2 44  ? -110.746 30.780 56.028 1.00 15.89 ? 353 LEU B CA  1 
ATOM   1390 C C   . LEU B 2 44  ? -111.991 31.573 55.638 1.00 16.65 ? 353 LEU B C   1 
ATOM   1391 O O   . LEU B 2 44  ? -112.797 31.939 56.491 1.00 17.76 ? 353 LEU B O   1 
ATOM   1392 C CB  . LEU B 2 44  ? -109.530 31.713 56.004 1.00 16.86 ? 353 LEU B CB  1 
ATOM   1393 C CG  . LEU B 2 44  ? -109.707 33.011 56.800 1.00 17.56 ? 353 LEU B CG  1 
ATOM   1394 C CD1 . LEU B 2 44  ? -110.025 32.695 58.263 1.00 15.20 ? 353 LEU B CD1 1 
ATOM   1395 C CD2 . LEU B 2 44  ? -108.444 33.861 56.679 1.00 16.82 ? 353 LEU B CD2 1 
ATOM   1396 N N   . CYS B 2 45  ? -112.150 31.844 54.349 1.00 17.26 ? 354 CYS B N   1 
ATOM   1397 C CA  . CYS B 2 45  ? -113.316 32.589 53.897 1.00 19.49 ? 354 CYS B CA  1 
ATOM   1398 C C   . CYS B 2 45  ? -114.611 31.829 54.189 1.00 18.91 ? 354 CYS B C   1 
ATOM   1399 O O   . CYS B 2 45  ? -115.562 32.394 54.735 1.00 18.16 ? 354 CYS B O   1 
ATOM   1400 C CB  . CYS B 2 45  ? -113.203 32.893 52.404 1.00 22.89 ? 354 CYS B CB  1 
ATOM   1401 S SG  . CYS B 2 45  ? -112.012 34.211 52.029 1.00 28.62 ? 354 CYS B SG  1 
ATOM   1402 N N   . ALA B 2 46  ? -114.636 30.546 53.843 1.00 16.88 ? 355 ALA B N   1 
ATOM   1403 C CA  . ALA B 2 46  ? -115.813 29.728 54.083 1.00 15.49 ? 355 ALA B CA  1 
ATOM   1404 C C   . ALA B 2 46  ? -116.155 29.662 55.573 1.00 17.00 ? 355 ALA B C   1 
ATOM   1405 O O   . ALA B 2 46  ? -117.328 29.707 55.947 1.00 15.91 ? 355 ALA B O   1 
ATOM   1406 C CB  . ALA B 2 46  ? -115.599 28.330 53.531 1.00 14.89 ? 355 ALA B CB  1 
ATOM   1407 N N   . MET B 2 47  ? -115.138 29.570 56.430 1.00 17.81 ? 356 MET B N   1 
ATOM   1408 C CA  . MET B 2 47  ? -115.390 29.500 57.867 1.00 17.93 ? 356 MET B CA  1 
ATOM   1409 C C   . MET B 2 47  ? -115.903 30.822 58.409 1.00 18.09 ? 356 MET B C   1 
ATOM   1410 O O   . MET B 2 47  ? -116.793 30.856 59.257 1.00 20.97 ? 356 MET B O   1 
ATOM   1411 C CB  . MET B 2 47  ? -114.128 29.061 58.619 1.00 18.33 ? 356 MET B CB  1 
ATOM   1412 C CG  . MET B 2 47  ? -113.781 27.597 58.406 1.00 18.17 ? 356 MET B CG  1 
ATOM   1413 S SD  . MET B 2 47  ? -115.198 26.503 58.735 1.00 22.01 ? 356 MET B SD  1 
ATOM   1414 C CE  . MET B 2 47  ? -115.949 26.362 57.077 1.00 21.39 ? 356 MET B CE  1 
ATOM   1415 N N   . LEU B 2 48  ? -115.350 31.916 57.912 1.00 18.94 ? 357 LEU B N   1 
ATOM   1416 C CA  . LEU B 2 48  ? -115.797 33.224 58.353 1.00 19.43 ? 357 LEU B CA  1 
ATOM   1417 C C   . LEU B 2 48  ? -117.239 33.447 57.912 1.00 20.65 ? 357 LEU B C   1 
ATOM   1418 O O   . LEU B 2 48  ? -118.010 34.082 58.620 1.00 20.86 ? 357 LEU B O   1 
ATOM   1419 C CB  . LEU B 2 48  ? -114.890 34.328 57.787 1.00 18.76 ? 357 LEU B CB  1 
ATOM   1420 C CG  . LEU B 2 48  ? -113.539 34.501 58.495 1.00 21.44 ? 357 LEU B CG  1 
ATOM   1421 C CD1 . LEU B 2 48  ? -112.700 35.562 57.789 1.00 19.35 ? 357 LEU B CD1 1 
ATOM   1422 C CD2 . LEU B 2 48  ? -113.786 34.894 59.956 1.00 18.80 ? 357 LEU B CD2 1 
ATOM   1423 N N   . LYS B 2 49  ? -117.602 32.912 56.748 1.00 21.69 ? 358 LYS B N   1 
ATOM   1424 C CA  . LYS B 2 49  ? -118.958 33.069 56.230 1.00 24.23 ? 358 LYS B CA  1 
ATOM   1425 C C   . LYS B 2 49  ? -119.996 32.397 57.120 1.00 24.06 ? 358 LYS B C   1 
ATOM   1426 O O   . LYS B 2 49  ? -121.042 32.973 57.420 1.00 23.55 ? 358 LYS B O   1 
ATOM   1427 C CB  . LYS B 2 49  ? -119.061 32.486 54.817 1.00 26.48 ? 358 LYS B CB  1 
ATOM   1428 C CG  . LYS B 2 49  ? -118.147 33.145 53.793 1.00 31.22 ? 358 LYS B CG  1 
ATOM   1429 C CD  . LYS B 2 49  ? -117.888 32.210 52.610 1.00 32.91 ? 358 LYS B CD  1 
ATOM   1430 C CE  . LYS B 2 49  ? -116.693 32.670 51.774 1.00 33.30 ? 358 LYS B CE  1 
ATOM   1431 N NZ  . LYS B 2 49  ? -116.154 31.561 50.938 1.00 30.43 ? 358 LYS B NZ  1 
ATOM   1432 N N   . GLN B 2 50  ? -119.707 31.176 57.549 1.00 26.31 ? 359 GLN B N   1 
ATOM   1433 C CA  . GLN B 2 50  ? -120.648 30.445 58.387 1.00 26.90 ? 359 GLN B CA  1 
ATOM   1434 C C   . GLN B 2 50  ? -120.658 30.861 59.843 1.00 25.99 ? 359 GLN B C   1 
ATOM   1435 O O   . GLN B 2 50  ? -121.711 30.855 60.471 1.00 27.20 ? 359 GLN B O   1 
ATOM   1436 C CB  . GLN B 2 50  ? -120.360 28.943 58.344 1.00 29.92 ? 359 GLN B CB  1 
ATOM   1437 C CG  . GLN B 2 50  ? -120.306 28.330 56.958 1.00 35.66 ? 359 GLN B CG  1 
ATOM   1438 C CD  . GLN B 2 50  ? -120.048 26.832 57.001 1.00 37.07 ? 359 GLN B CD  1 
ATOM   1439 O OE1 . GLN B 2 50  ? -119.745 26.211 55.979 1.00 39.08 ? 359 GLN B OE1 1 
ATOM   1440 N NE2 . GLN B 2 50  ? -120.171 26.244 58.188 1.00 37.31 ? 359 GLN B NE2 1 
ATOM   1441 N N   . TYR B 2 51  ? -119.497 31.238 60.377 1.00 24.65 ? 360 TYR B N   1 
ATOM   1442 C CA  . TYR B 2 51  ? -119.401 31.565 61.800 1.00 22.60 ? 360 TYR B CA  1 
ATOM   1443 C C   . TYR B 2 51  ? -118.985 32.957 62.271 1.00 23.81 ? 360 TYR B C   1 
ATOM   1444 O O   . TYR B 2 51  ? -118.965 33.208 63.480 1.00 25.56 ? 360 TYR B O   1 
ATOM   1445 C CB  . TYR B 2 51  ? -118.472 30.549 62.462 1.00 20.86 ? 360 TYR B CB  1 
ATOM   1446 C CG  . TYR B 2 51  ? -118.861 29.115 62.206 1.00 18.58 ? 360 TYR B CG  1 
ATOM   1447 C CD1 . TYR B 2 51  ? -119.973 28.551 62.828 1.00 20.64 ? 360 TYR B CD1 1 
ATOM   1448 C CD2 . TYR B 2 51  ? -118.125 28.325 61.332 1.00 19.07 ? 360 TYR B CD2 1 
ATOM   1449 C CE1 . TYR B 2 51  ? -120.340 27.231 62.583 1.00 19.91 ? 360 TYR B CE1 1 
ATOM   1450 C CE2 . TYR B 2 51  ? -118.482 27.005 61.078 1.00 18.27 ? 360 TYR B CE2 1 
ATOM   1451 C CZ  . TYR B 2 51  ? -119.591 26.465 61.705 1.00 19.78 ? 360 TYR B CZ  1 
ATOM   1452 O OH  . TYR B 2 51  ? -119.958 25.166 61.438 1.00 19.19 ? 360 TYR B OH  1 
ATOM   1453 N N   . ALA B 2 52  ? -118.645 33.862 61.362 1.00 22.89 ? 361 ALA B N   1 
ATOM   1454 C CA  . ALA B 2 52  ? -118.222 35.190 61.796 1.00 23.53 ? 361 ALA B CA  1 
ATOM   1455 C C   . ALA B 2 52  ? -119.274 35.864 62.664 1.00 24.21 ? 361 ALA B C   1 
ATOM   1456 O O   . ALA B 2 52  ? -118.965 36.766 63.440 1.00 23.26 ? 361 ALA B O   1 
ATOM   1457 C CB  . ALA B 2 52  ? -117.904 36.063 60.598 1.00 23.98 ? 361 ALA B CB  1 
ATOM   1458 N N   . ASP B 2 53  ? -120.517 35.418 62.542 1.00 26.31 ? 362 ASP B N   1 
ATOM   1459 C CA  . ASP B 2 53  ? -121.601 36.016 63.312 1.00 29.80 ? 362 ASP B CA  1 
ATOM   1460 C C   . ASP B 2 53  ? -121.896 35.267 64.609 1.00 28.93 ? 362 ASP B C   1 
ATOM   1461 O O   . ASP B 2 53  ? -122.790 35.649 65.357 1.00 28.60 ? 362 ASP B O   1 
ATOM   1462 C CB  . ASP B 2 53  ? -122.866 36.084 62.451 1.00 33.60 ? 362 ASP B CB  1 
ATOM   1463 C CG  . ASP B 2 53  ? -123.453 34.713 62.166 1.00 38.90 ? 362 ASP B CG  1 
ATOM   1464 O OD1 . ASP B 2 53  ? -122.678 33.741 62.018 1.00 40.83 ? 362 ASP B OD1 1 
ATOM   1465 O OD2 . ASP B 2 53  ? -124.693 34.610 62.078 1.00 42.10 ? 362 ASP B OD2 1 
ATOM   1466 N N   . LYS B 2 54  ? -121.130 34.218 64.884 1.00 28.96 ? 363 LYS B N   1 
ATOM   1467 C CA  . LYS B 2 54  ? -121.341 33.427 66.089 1.00 29.92 ? 363 LYS B CA  1 
ATOM   1468 C C   . LYS B 2 54  ? -120.089 33.155 66.916 1.00 28.58 ? 363 LYS B C   1 
ATOM   1469 O O   . LYS B 2 54  ? -120.027 33.510 68.091 1.00 30.01 ? 363 LYS B O   1 
ATOM   1470 C CB  . LYS B 2 54  ? -121.982 32.088 65.716 1.00 31.42 ? 363 LYS B CB  1 
ATOM   1471 C CG  . LYS B 2 54  ? -123.370 32.218 65.130 1.00 35.59 ? 363 LYS B CG  1 
ATOM   1472 C CD  . LYS B 2 54  ? -123.715 31.050 64.220 1.00 38.64 ? 363 LYS B CD  1 
ATOM   1473 C CE  . LYS B 2 54  ? -125.147 31.176 63.710 1.00 42.82 ? 363 LYS B CE  1 
ATOM   1474 N NZ  . LYS B 2 54  ? -125.423 32.525 63.129 1.00 43.42 ? 363 LYS B NZ  1 
ATOM   1475 N N   . LEU B 2 55  ? -119.098 32.525 66.291 1.00 26.89 ? 364 LEU B N   1 
ATOM   1476 C CA  . LEU B 2 55  ? -117.861 32.135 66.965 1.00 25.03 ? 364 LEU B CA  1 
ATOM   1477 C C   . LEU B 2 55  ? -116.793 33.197 67.196 1.00 22.72 ? 364 LEU B C   1 
ATOM   1478 O O   . LEU B 2 55  ? -116.617 34.115 66.397 1.00 21.34 ? 364 LEU B O   1 
ATOM   1479 C CB  . LEU B 2 55  ? -117.215 30.974 66.208 1.00 25.02 ? 364 LEU B CB  1 
ATOM   1480 C CG  . LEU B 2 55  ? -118.096 29.755 65.938 1.00 26.88 ? 364 LEU B CG  1 
ATOM   1481 C CD1 . LEU B 2 55  ? -117.291 28.712 65.178 1.00 25.66 ? 364 LEU B CD1 1 
ATOM   1482 C CD2 . LEU B 2 55  ? -118.612 29.191 67.253 1.00 27.44 ? 364 LEU B CD2 1 
ATOM   1483 N N   . GLU B 2 56  ? -116.078 33.042 68.306 1.00 21.25 ? 365 GLU B N   1 
ATOM   1484 C CA  . GLU B 2 56  ? -114.981 33.931 68.662 1.00 18.67 ? 365 GLU B CA  1 
ATOM   1485 C C   . GLU B 2 56  ? -113.912 33.592 67.613 1.00 17.73 ? 365 GLU B C   1 
ATOM   1486 O O   . GLU B 2 56  ? -113.809 32.441 67.176 1.00 16.22 ? 365 GLU B O   1 
ATOM   1487 C CB  . GLU B 2 56  ? -114.515 33.607 70.088 1.00 19.00 ? 365 GLU B CB  1 
ATOM   1488 C CG  . GLU B 2 56  ? -113.490 34.557 70.679 1.00 17.95 ? 365 GLU B CG  1 
ATOM   1489 C CD  . GLU B 2 56  ? -112.116 34.335 70.095 1.00 18.20 ? 365 GLU B CD  1 
ATOM   1490 O OE1 . GLU B 2 56  ? -111.739 33.156 69.946 1.00 14.37 ? 365 GLU B OE1 1 
ATOM   1491 O OE2 . GLU B 2 56  ? -111.418 35.329 69.792 1.00 18.80 ? 365 GLU B OE2 1 
ATOM   1492 N N   . PHE B 2 57  ? -113.126 34.575 67.197 1.00 16.84 ? 366 PHE B N   1 
ATOM   1493 C CA  . PHE B 2 57  ? -112.133 34.334 66.145 1.00 18.20 ? 366 PHE B CA  1 
ATOM   1494 C C   . PHE B 2 57  ? -111.209 33.112 66.268 1.00 18.56 ? 366 PHE B C   1 
ATOM   1495 O O   . PHE B 2 57  ? -110.943 32.444 65.268 1.00 18.22 ? 366 PHE B O   1 
ATOM   1496 C CB  . PHE B 2 57  ? -111.294 35.592 65.922 1.00 18.37 ? 366 PHE B CB  1 
ATOM   1497 C CG  . PHE B 2 57  ? -110.478 35.555 64.661 1.00 19.63 ? 366 PHE B CG  1 
ATOM   1498 C CD1 . PHE B 2 57  ? -111.036 35.085 63.473 1.00 21.08 ? 366 PHE B CD1 1 
ATOM   1499 C CD2 . PHE B 2 57  ? -109.163 36.014 64.649 1.00 21.11 ? 366 PHE B CD2 1 
ATOM   1500 C CE1 . PHE B 2 57  ? -110.296 35.075 62.286 1.00 21.57 ? 366 PHE B CE1 1 
ATOM   1501 C CE2 . PHE B 2 57  ? -108.412 36.009 63.468 1.00 21.76 ? 366 PHE B CE2 1 
ATOM   1502 C CZ  . PHE B 2 57  ? -108.978 35.540 62.287 1.00 20.55 ? 366 PHE B CZ  1 
ATOM   1503 N N   . MET B 2 58  ? -110.718 32.816 67.469 1.00 18.18 ? 367 MET B N   1 
ATOM   1504 C CA  . MET B 2 58  ? -109.834 31.664 67.658 1.00 18.13 ? 367 MET B CA  1 
ATOM   1505 C C   . MET B 2 58  ? -110.525 30.352 67.296 1.00 15.80 ? 367 MET B C   1 
ATOM   1506 O O   . MET B 2 58  ? -109.926 29.460 66.698 1.00 13.52 ? 367 MET B O   1 
ATOM   1507 C CB  . MET B 2 58  ? -109.344 31.583 69.113 1.00 19.38 ? 367 MET B CB  1 
ATOM   1508 C CG  . MET B 2 58  ? -108.463 32.735 69.549 1.00 23.04 ? 367 MET B CG  1 
ATOM   1509 S SD  . MET B 2 58  ? -107.003 32.928 68.490 1.00 30.59 ? 367 MET B SD  1 
ATOM   1510 C CE  . MET B 2 58  ? -107.625 34.223 67.358 1.00 28.98 ? 367 MET B CE  1 
ATOM   1511 N N   . HIS B 2 59  ? -111.783 30.227 67.684 1.00 16.30 ? 368 HIS B N   1 
ATOM   1512 C CA  . HIS B 2 59  ? -112.531 29.013 67.387 1.00 17.63 ? 368 HIS B CA  1 
ATOM   1513 C C   . HIS B 2 59  ? -112.829 28.911 65.889 1.00 16.12 ? 368 HIS B C   1 
ATOM   1514 O O   . HIS B 2 59  ? -112.946 27.817 65.345 1.00 15.12 ? 368 HIS B O   1 
ATOM   1515 C CB  . HIS B 2 59  ? -113.806 28.978 68.235 1.00 18.62 ? 368 HIS B CB  1 
ATOM   1516 C CG  . HIS B 2 59  ? -113.536 28.769 69.697 1.00 25.13 ? 368 HIS B CG  1 
ATOM   1517 N ND1 . HIS B 2 59  ? -114.535 28.724 70.648 1.00 26.62 ? 368 HIS B ND1 1 
ATOM   1518 C CD2 . HIS B 2 59  ? -112.374 28.563 70.365 1.00 24.47 ? 368 HIS B CD2 1 
ATOM   1519 C CE1 . HIS B 2 59  ? -114.000 28.496 71.836 1.00 27.57 ? 368 HIS B CE1 1 
ATOM   1520 N NE2 . HIS B 2 59  ? -112.689 28.394 71.691 1.00 24.98 ? 368 HIS B NE2 1 
ATOM   1521 N N   . ILE B 2 60  ? -112.933 30.053 65.219 1.00 15.07 ? 369 ILE B N   1 
ATOM   1522 C CA  . ILE B 2 60  ? -113.174 30.047 63.778 1.00 13.54 ? 369 ILE B CA  1 
ATOM   1523 C C   . ILE B 2 60  ? -111.902 29.557 63.105 1.00 13.15 ? 369 ILE B C   1 
ATOM   1524 O O   . ILE B 2 60  ? -111.948 28.758 62.162 1.00 13.21 ? 369 ILE B O   1 
ATOM   1525 C CB  . ILE B 2 60  ? -113.503 31.462 63.228 1.00 14.01 ? 369 ILE B CB  1 
ATOM   1526 C CG1 . ILE B 2 60  ? -114.847 31.946 63.789 1.00 11.98 ? 369 ILE B CG1 1 
ATOM   1527 C CG2 . ILE B 2 60  ? -113.552 31.431 61.698 1.00 12.77 ? 369 ILE B CG2 1 
ATOM   1528 C CD1 . ILE B 2 60  ? -115.268 33.305 63.295 1.00 15.53 ? 369 ILE B CD1 1 
ATOM   1529 N N   . LEU B 2 61  ? -110.758 30.034 63.592 1.00 10.70 ? 370 LEU B N   1 
ATOM   1530 C CA  . LEU B 2 61  ? -109.482 29.616 63.024 1.00 11.41 ? 370 LEU B CA  1 
ATOM   1531 C C   . LEU B 2 61  ? -109.207 28.134 63.313 1.00 11.68 ? 370 LEU B C   1 
ATOM   1532 O O   . LEU B 2 61  ? -108.506 27.467 62.549 1.00 11.50 ? 370 LEU B O   1 
ATOM   1533 C CB  . LEU B 2 61  ? -108.332 30.483 63.558 1.00 10.05 ? 370 LEU B CB  1 
ATOM   1534 C CG  . LEU B 2 61  ? -108.228 31.927 63.035 1.00 11.83 ? 370 LEU B CG  1 
ATOM   1535 C CD1 . LEU B 2 61  ? -107.004 32.596 63.643 1.00 8.82  ? 370 LEU B CD1 1 
ATOM   1536 C CD2 . LEU B 2 61  ? -108.115 31.937 61.508 1.00 7.59  ? 370 LEU B CD2 1 
ATOM   1537 N N   . THR B 2 62  ? -109.748 27.620 64.414 1.00 11.67 ? 371 THR B N   1 
ATOM   1538 C CA  . THR B 2 62  ? -109.551 26.213 64.736 1.00 14.21 ? 371 THR B CA  1 
ATOM   1539 C C   . THR B 2 62  ? -110.356 25.391 63.730 1.00 15.71 ? 371 THR B C   1 
ATOM   1540 O O   . THR B 2 62  ? -109.917 24.327 63.294 1.00 17.65 ? 371 THR B O   1 
ATOM   1541 C CB  . THR B 2 62  ? -110.007 25.893 66.170 1.00 14.12 ? 371 THR B CB  1 
ATOM   1542 O OG1 . THR B 2 62  ? -109.210 26.642 67.095 1.00 14.05 ? 371 THR B OG1 1 
ATOM   1543 C CG2 . THR B 2 62  ? -109.836 24.400 66.469 1.00 12.90 ? 371 THR B CG2 1 
ATOM   1544 N N   . ARG B 2 63  ? -111.523 25.908 63.351 1.00 16.18 ? 372 ARG B N   1 
ATOM   1545 C CA  . ARG B 2 63  ? -112.371 25.244 62.368 1.00 18.40 ? 372 ARG B CA  1 
ATOM   1546 C C   . ARG B 2 63  ? -111.628 25.229 61.038 1.00 18.20 ? 372 ARG B C   1 
ATOM   1547 O O   . ARG B 2 63  ? -111.712 24.263 60.280 1.00 17.89 ? 372 ARG B O   1 
ATOM   1548 C CB  . ARG B 2 63  ? -113.694 25.995 62.194 1.00 20.45 ? 372 ARG B CB  1 
ATOM   1549 C CG  . ARG B 2 63  ? -114.600 25.965 63.407 1.00 26.48 ? 372 ARG B CG  1 
ATOM   1550 C CD  . ARG B 2 63  ? -115.007 24.545 63.753 1.00 31.09 ? 372 ARG B CD  1 
ATOM   1551 N NE  . ARG B 2 63  ? -116.021 24.505 64.804 1.00 35.47 ? 372 ARG B NE  1 
ATOM   1552 C CZ  . ARG B 2 63  ? -117.264 24.951 64.657 1.00 36.88 ? 372 ARG B CZ  1 
ATOM   1553 N NH1 . ARG B 2 63  ? -117.640 25.471 63.499 1.00 39.02 ? 372 ARG B NH1 1 
ATOM   1554 N NH2 . ARG B 2 63  ? -118.134 24.865 65.657 1.00 34.42 ? 372 ARG B NH2 1 
ATOM   1555 N N   . VAL B 2 64  ? -110.903 26.312 60.759 1.00 16.76 ? 373 VAL B N   1 
ATOM   1556 C CA  . VAL B 2 64  ? -110.136 26.421 59.526 1.00 15.61 ? 373 VAL B CA  1 
ATOM   1557 C C   . VAL B 2 64  ? -109.050 25.352 59.556 1.00 15.42 ? 373 VAL B C   1 
ATOM   1558 O O   . VAL B 2 64  ? -108.814 24.674 58.557 1.00 16.36 ? 373 VAL B O   1 
ATOM   1559 C CB  . VAL B 2 64  ? -109.491 27.825 59.386 1.00 16.61 ? 373 VAL B CB  1 
ATOM   1560 C CG1 . VAL B 2 64  ? -108.605 27.882 58.145 1.00 15.53 ? 373 VAL B CG1 1 
ATOM   1561 C CG2 . VAL B 2 64  ? -110.574 28.887 59.312 1.00 13.91 ? 373 VAL B CG2 1 
ATOM   1562 N N   . ASN B 2 65  ? -108.399 25.199 60.710 1.00 15.24 ? 374 ASN B N   1 
ATOM   1563 C CA  . ASN B 2 65  ? -107.354 24.188 60.873 1.00 14.20 ? 374 ASN B CA  1 
ATOM   1564 C C   . ASN B 2 65  ? -107.913 22.800 60.531 1.00 16.39 ? 374 ASN B C   1 
ATOM   1565 O O   . ASN B 2 65  ? -107.271 22.021 59.816 1.00 15.53 ? 374 ASN B O   1 
ATOM   1566 C CB  . ASN B 2 65  ? -106.833 24.167 62.321 1.00 14.95 ? 374 ASN B CB  1 
ATOM   1567 C CG  . ASN B 2 65  ? -105.750 25.209 62.586 1.00 13.82 ? 374 ASN B CG  1 
ATOM   1568 O OD1 . ASN B 2 65  ? -105.513 26.104 61.782 1.00 17.20 ? 374 ASN B OD1 1 
ATOM   1569 N ND2 . ASN B 2 65  ? -105.091 25.090 63.730 1.00 14.68 ? 374 ASN B ND2 1 
ATOM   1570 N N   . ARG B 2 66  ? -109.107 22.497 61.042 1.00 15.01 ? 375 ARG B N   1 
ATOM   1571 C CA  . ARG B 2 66  ? -109.733 21.196 60.803 1.00 16.71 ? 375 ARG B CA  1 
ATOM   1572 C C   . ARG B 2 66  ? -110.135 20.988 59.340 1.00 16.02 ? 375 ARG B C   1 
ATOM   1573 O O   . ARG B 2 66  ? -109.936 19.910 58.788 1.00 15.80 ? 375 ARG B O   1 
ATOM   1574 C CB  . ARG B 2 66  ? -110.968 21.002 61.711 1.00 16.33 ? 375 ARG B CB  1 
ATOM   1575 C CG  . ARG B 2 66  ? -111.592 19.611 61.574 1.00 21.02 ? 375 ARG B CG  1 
ATOM   1576 C CD  . ARG B 2 66  ? -112.392 19.145 62.797 1.00 23.74 ? 375 ARG B CD  1 
ATOM   1577 N NE  . ARG B 2 66  ? -113.746 19.694 62.867 1.00 30.33 ? 375 ARG B NE  1 
ATOM   1578 C CZ  . ARG B 2 66  ? -114.086 20.808 63.513 1.00 34.60 ? 375 ARG B CZ  1 
ATOM   1579 N NH1 . ARG B 2 66  ? -113.169 21.521 64.162 1.00 35.91 ? 375 ARG B NH1 1 
ATOM   1580 N NH2 . ARG B 2 66  ? -115.355 21.207 63.522 1.00 34.72 ? 375 ARG B NH2 1 
ATOM   1581 N N   . LYS B 2 67  ? -110.694 22.020 58.719 1.00 15.69 ? 376 LYS B N   1 
ATOM   1582 C CA  . LYS B 2 67  ? -111.128 21.924 57.330 1.00 15.97 ? 376 LYS B CA  1 
ATOM   1583 C C   . LYS B 2 67  ? -109.950 21.660 56.400 1.00 16.03 ? 376 LYS B C   1 
ATOM   1584 O O   . LYS B 2 67  ? -110.013 20.783 55.539 1.00 15.42 ? 376 LYS B O   1 
ATOM   1585 C CB  . LYS B 2 67  ? -111.866 23.209 56.926 1.00 15.96 ? 376 LYS B CB  1 
ATOM   1586 C CG  . LYS B 2 67  ? -112.561 23.157 55.570 1.00 16.33 ? 376 LYS B CG  1 
ATOM   1587 C CD  . LYS B 2 67  ? -113.495 24.351 55.398 1.00 19.07 ? 376 LYS B CD  1 
ATOM   1588 C CE  . LYS B 2 67  ? -114.071 24.434 53.982 1.00 21.11 ? 376 LYS B CE  1 
ATOM   1589 N NZ  . LYS B 2 67  ? -114.929 23.264 53.639 1.00 18.62 ? 376 LYS B NZ  1 
ATOM   1590 N N   . VAL B 2 68  ? -108.868 22.409 56.581 1.00 16.89 ? 377 VAL B N   1 
ATOM   1591 C CA  . VAL B 2 68  ? -107.682 22.235 55.749 1.00 16.01 ? 377 VAL B CA  1 
ATOM   1592 C C   . VAL B 2 68  ? -107.029 20.873 55.963 1.00 17.25 ? 377 VAL B C   1 
ATOM   1593 O O   . VAL B 2 68  ? -106.623 20.207 55.009 1.00 17.54 ? 377 VAL B O   1 
ATOM   1594 C CB  . VAL B 2 68  ? -106.635 23.309 56.056 1.00 15.57 ? 377 VAL B CB  1 
ATOM   1595 C CG1 . VAL B 2 68  ? -105.367 23.058 55.226 1.00 15.79 ? 377 VAL B CG1 1 
ATOM   1596 C CG2 . VAL B 2 68  ? -107.213 24.689 55.764 1.00 15.75 ? 377 VAL B CG2 1 
ATOM   1597 N N   . ALA B 2 69  ? -106.936 20.466 57.225 1.00 17.29 ? 378 ALA B N   1 
ATOM   1598 C CA  . ALA B 2 69  ? -106.314 19.201 57.590 1.00 18.35 ? 378 ALA B CA  1 
ATOM   1599 C C   . ALA B 2 69  ? -107.093 17.969 57.153 1.00 20.77 ? 378 ALA B C   1 
ATOM   1600 O O   . ALA B 2 69  ? -106.522 16.894 56.996 1.00 19.40 ? 378 ALA B O   1 
ATOM   1601 C CB  . ALA B 2 69  ? -106.098 19.154 59.105 1.00 17.31 ? 378 ALA B CB  1 
ATOM   1602 N N   . THR B 2 70  ? -108.395 18.116 56.953 1.00 23.44 ? 379 THR B N   1 
ATOM   1603 C CA  . THR B 2 70  ? -109.206 16.968 56.583 1.00 27.07 ? 379 THR B CA  1 
ATOM   1604 C C   . THR B 2 70  ? -109.712 16.919 55.148 1.00 26.58 ? 379 THR B C   1 
ATOM   1605 O O   . THR B 2 70  ? -109.676 15.875 54.511 1.00 27.48 ? 379 THR B O   1 
ATOM   1606 C CB  . THR B 2 70  ? -110.416 16.851 57.531 1.00 28.38 ? 379 THR B CB  1 
ATOM   1607 O OG1 . THR B 2 70  ? -109.954 16.535 58.851 1.00 31.17 ? 379 THR B OG1 1 
ATOM   1608 C CG2 . THR B 2 70  ? -111.359 15.758 57.063 1.00 31.92 ? 379 THR B CG2 1 
ATOM   1609 N N   . GLU B 2 71  A -110.169 18.051 54.634 1.00 27.35 ? 379 GLU B N   1 
ATOM   1610 C CA  . GLU B 2 71  A -110.726 18.094 53.290 1.00 27.62 ? 379 GLU B CA  1 
ATOM   1611 C C   . GLU B 2 71  A -109.751 18.310 52.141 1.00 26.90 ? 379 GLU B C   1 
ATOM   1612 O O   . GLU B 2 71  A -110.155 18.337 50.981 1.00 27.33 ? 379 GLU B O   1 
ATOM   1613 C CB  . GLU B 2 71  A -111.818 19.160 53.250 1.00 27.87 ? 379 GLU B CB  1 
ATOM   1614 C CG  . GLU B 2 71  A -113.001 18.822 54.139 1.00 29.17 ? 379 GLU B CG  1 
ATOM   1615 C CD  . GLU B 2 71  A -113.914 20.005 54.386 1.00 30.17 ? 379 GLU B CD  1 
ATOM   1616 O OE1 . GLU B 2 71  A -113.972 20.909 53.528 1.00 30.30 ? 379 GLU B OE1 1 
ATOM   1617 O OE2 . GLU B 2 71  A -114.587 20.021 55.437 1.00 33.85 ? 379 GLU B OE2 1 
ATOM   1618 N N   . PHE B 2 72  ? -108.468 18.442 52.446 1.00 26.56 ? 380 PHE B N   1 
ATOM   1619 C CA  . PHE B 2 72  ? -107.495 18.679 51.390 1.00 24.06 ? 380 PHE B CA  1 
ATOM   1620 C C   . PHE B 2 72  ? -106.312 17.717 51.359 1.00 22.54 ? 380 PHE B C   1 
ATOM   1621 O O   . PHE B 2 72  ? -105.825 17.270 52.393 1.00 22.79 ? 380 PHE B O   1 
ATOM   1622 C CB  . PHE B 2 72  ? -106.967 20.107 51.499 1.00 21.45 ? 380 PHE B CB  1 
ATOM   1623 C CG  . PHE B 2 72  ? -108.003 21.165 51.237 1.00 22.63 ? 380 PHE B CG  1 
ATOM   1624 C CD1 . PHE B 2 72  ? -108.211 21.651 49.949 1.00 21.83 ? 380 PHE B CD1 1 
ATOM   1625 C CD2 . PHE B 2 72  ? -108.743 21.712 52.285 1.00 22.38 ? 380 PHE B CD2 1 
ATOM   1626 C CE1 . PHE B 2 72  ? -109.135 22.674 49.709 1.00 21.66 ? 380 PHE B CE1 1 
ATOM   1627 C CE2 . PHE B 2 72  ? -109.666 22.734 52.054 1.00 22.13 ? 380 PHE B CE2 1 
ATOM   1628 C CZ  . PHE B 2 72  ? -109.861 23.217 50.760 1.00 20.58 ? 380 PHE B CZ  1 
ATOM   1629 N N   . GLU B 2 73  ? -105.868 17.408 50.146 1.00 22.46 ? 381 GLU B N   1 
ATOM   1630 C CA  . GLU B 2 73  ? -104.715 16.549 49.912 1.00 22.54 ? 381 GLU B CA  1 
ATOM   1631 C C   . GLU B 2 73  ? -104.213 16.874 48.508 1.00 22.60 ? 381 GLU B C   1 
ATOM   1632 O O   . GLU B 2 73  ? -105.012 17.112 47.599 1.00 22.29 ? 381 GLU B O   1 
ATOM   1633 C CB  . GLU B 2 73  ? -105.089 15.068 50.004 1.00 22.89 ? 381 GLU B CB  1 
ATOM   1634 C CG  . GLU B 2 73  ? -103.890 14.147 49.844 1.00 24.74 ? 381 GLU B CG  1 
ATOM   1635 C CD  . GLU B 2 73  ? -104.254 12.682 49.978 1.00 27.31 ? 381 GLU B CD  1 
ATOM   1636 O OE1 . GLU B 2 73  ? -104.778 12.293 51.046 1.00 26.67 ? 381 GLU B OE1 1 
ATOM   1637 O OE2 . GLU B 2 73  ? -104.015 11.922 49.014 1.00 27.22 ? 381 GLU B OE2 1 
ATOM   1638 N N   . SER B 2 74  A -102.896 16.894 48.327 1.00 22.95 ? 381 SER B N   1 
ATOM   1639 C CA  . SER B 2 74  A -102.333 17.214 47.018 1.00 23.41 ? 381 SER B CA  1 
ATOM   1640 C C   . SER B 2 74  A -102.408 16.043 46.047 1.00 23.63 ? 381 SER B C   1 
ATOM   1641 O O   . SER B 2 74  A -102.281 14.882 46.442 1.00 23.96 ? 381 SER B O   1 
ATOM   1642 C CB  . SER B 2 74  A -100.870 17.663 47.152 1.00 23.11 ? 381 SER B CB  1 
ATOM   1643 O OG  . SER B 2 74  A -100.026 16.583 47.526 1.00 22.58 ? 381 SER B OG  1 
ATOM   1644 N N   . PHE B 2 75  B -102.625 16.369 44.776 1.00 23.81 ? 381 PHE B N   1 
ATOM   1645 C CA  . PHE B 2 75  B -102.689 15.382 43.707 1.00 24.27 ? 381 PHE B CA  1 
ATOM   1646 C C   . PHE B 2 75  B -101.699 15.830 42.648 1.00 23.40 ? 381 PHE B C   1 
ATOM   1647 O O   . PHE B 2 75  B -101.917 16.838 41.983 1.00 24.20 ? 381 PHE B O   1 
ATOM   1648 C CB  . PHE B 2 75  B -104.092 15.305 43.104 1.00 23.88 ? 381 PHE B CB  1 
ATOM   1649 C CG  . PHE B 2 75  B -104.183 14.383 41.919 1.00 28.13 ? 381 PHE B CG  1 
ATOM   1650 C CD1 . PHE B 2 75  B -103.927 14.850 40.634 1.00 27.92 ? 381 PHE B CD1 1 
ATOM   1651 C CD2 . PHE B 2 75  B -104.472 13.030 42.093 1.00 28.76 ? 381 PHE B CD2 1 
ATOM   1652 C CE1 . PHE B 2 75  B -103.955 13.981 39.539 1.00 28.75 ? 381 PHE B CE1 1 
ATOM   1653 C CE2 . PHE B 2 75  B -104.500 12.159 41.008 1.00 28.48 ? 381 PHE B CE2 1 
ATOM   1654 C CZ  . PHE B 2 75  B -104.240 12.636 39.729 1.00 28.36 ? 381 PHE B CZ  1 
ATOM   1655 N N   . SER B 2 76  C -100.612 15.083 42.494 1.00 23.57 ? 381 SER B N   1 
ATOM   1656 C CA  . SER B 2 76  C -99.578  15.442 41.527 1.00 24.86 ? 381 SER B CA  1 
ATOM   1657 C C   . SER B 2 76  C -99.005  14.239 40.787 1.00 25.97 ? 381 SER B C   1 
ATOM   1658 O O   . SER B 2 76  C -98.853  13.160 41.362 1.00 26.12 ? 381 SER B O   1 
ATOM   1659 C CB  . SER B 2 76  C -98.442  16.184 42.245 1.00 25.15 ? 381 SER B CB  1 
ATOM   1660 O OG  . SER B 2 76  C -97.356  16.445 41.372 1.00 27.03 ? 381 SER B OG  1 
ATOM   1661 N N   . PHE B 2 77  D -98.692  14.422 39.507 1.00 27.79 ? 381 PHE B N   1 
ATOM   1662 C CA  . PHE B 2 77  D -98.116  13.333 38.728 1.00 29.47 ? 381 PHE B CA  1 
ATOM   1663 C C   . PHE B 2 77  D -96.696  13.118 39.240 1.00 29.81 ? 381 PHE B C   1 
ATOM   1664 O O   . PHE B 2 77  D -96.065  12.099 38.956 1.00 28.98 ? 381 PHE B O   1 
ATOM   1665 C CB  . PHE B 2 77  D -98.087  13.676 37.235 1.00 28.97 ? 381 PHE B CB  1 
ATOM   1666 C CG  . PHE B 2 77  D -99.426  14.078 36.675 1.00 29.94 ? 381 PHE B CG  1 
ATOM   1667 C CD1 . PHE B 2 77  D -100.576 13.356 36.984 1.00 29.85 ? 381 PHE B CD1 1 
ATOM   1668 C CD2 . PHE B 2 77  D -99.533  15.167 35.821 1.00 28.95 ? 381 PHE B CD2 1 
ATOM   1669 C CE1 . PHE B 2 77  D -101.815 13.714 36.449 1.00 30.28 ? 381 PHE B CE1 1 
ATOM   1670 C CE2 . PHE B 2 77  D -100.766 15.535 35.279 1.00 31.72 ? 381 PHE B CE2 1 
ATOM   1671 C CZ  . PHE B 2 77  D -101.910 14.805 35.594 1.00 30.92 ? 381 PHE B CZ  1 
ATOM   1672 N N   . ASP B 2 78  E -96.206  14.096 39.998 1.00 29.97 ? 381 ASP B N   1 
ATOM   1673 C CA  . ASP B 2 78  E -94.866  14.041 40.583 1.00 30.50 ? 381 ASP B CA  1 
ATOM   1674 C C   . ASP B 2 78  E -94.957  13.376 41.959 1.00 30.31 ? 381 ASP B C   1 
ATOM   1675 O O   . ASP B 2 78  E -95.442  13.981 42.916 1.00 29.95 ? 381 ASP B O   1 
ATOM   1676 C CB  . ASP B 2 78  E -94.304  15.455 40.738 1.00 31.58 ? 381 ASP B CB  1 
ATOM   1677 C CG  . ASP B 2 78  E -92.875  15.465 41.257 1.00 34.17 ? 381 ASP B CG  1 
ATOM   1678 O OD1 . ASP B 2 78  E -92.434  14.444 41.834 1.00 32.76 ? 381 ASP B OD1 1 
ATOM   1679 O OD2 . ASP B 2 78  E -92.196  16.504 41.094 1.00 33.95 ? 381 ASP B OD2 1 
ATOM   1680 N N   . ALA B 2 79  F -94.482  12.138 42.053 1.00 30.50 ? 381 ALA B N   1 
ATOM   1681 C CA  . ALA B 2 79  F -94.525  11.379 43.300 1.00 31.37 ? 381 ALA B CA  1 
ATOM   1682 C C   . ALA B 2 79  F -94.067  12.169 44.528 1.00 31.95 ? 381 ALA B C   1 
ATOM   1683 O O   . ALA B 2 79  F -94.605  11.994 45.621 1.00 33.25 ? 381 ALA B O   1 
ATOM   1684 C CB  . ALA B 2 79  F -93.689  10.103 43.160 1.00 30.57 ? 381 ALA B CB  1 
ATOM   1685 N N   . THR B 2 80  G -93.078  13.038 44.347 1.00 31.01 ? 381 THR B N   1 
ATOM   1686 C CA  . THR B 2 80  G -92.555  13.838 45.451 1.00 30.36 ? 381 THR B CA  1 
ATOM   1687 C C   . THR B 2 80  G -93.596  14.767 46.082 1.00 28.97 ? 381 THR B C   1 
ATOM   1688 O O   . THR B 2 80  G -93.595  14.980 47.292 1.00 28.32 ? 381 THR B O   1 
ATOM   1689 C CB  . THR B 2 80  G -91.360  14.694 44.991 1.00 31.00 ? 381 THR B CB  1 
ATOM   1690 O OG1 . THR B 2 80  G -90.304  13.836 44.542 1.00 33.56 ? 381 THR B OG1 1 
ATOM   1691 C CG2 . THR B 2 80  G -90.853  15.562 46.137 1.00 31.50 ? 381 THR B CG2 1 
ATOM   1692 N N   . PHE B 2 81  H -94.487  15.316 45.264 1.00 27.08 ? 381 PHE B N   1 
ATOM   1693 C CA  . PHE B 2 81  H -95.497  16.231 45.769 1.00 24.96 ? 381 PHE B CA  1 
ATOM   1694 C C   . PHE B 2 81  H -96.903  15.659 45.795 1.00 23.87 ? 381 PHE B C   1 
ATOM   1695 O O   . PHE B 2 81  H -97.873  16.405 45.929 1.00 23.89 ? 381 PHE B O   1 
ATOM   1696 C CB  . PHE B 2 81  H -95.493  17.519 44.941 1.00 25.12 ? 381 PHE B CB  1 
ATOM   1697 C CG  . PHE B 2 81  H -94.214  18.296 45.038 1.00 24.80 ? 381 PHE B CG  1 
ATOM   1698 C CD1 . PHE B 2 81  H -93.199  18.119 44.104 1.00 24.90 ? 381 PHE B CD1 1 
ATOM   1699 C CD2 . PHE B 2 81  H -94.014  19.196 46.081 1.00 25.30 ? 381 PHE B CD2 1 
ATOM   1700 C CE1 . PHE B 2 81  H -92.001  18.828 44.209 1.00 24.97 ? 381 PHE B CE1 1 
ATOM   1701 C CE2 . PHE B 2 81  H -92.821  19.908 46.193 1.00 25.61 ? 381 PHE B CE2 1 
ATOM   1702 C CZ  . PHE B 2 81  H -91.813  19.722 45.253 1.00 24.51 ? 381 PHE B CZ  1 
ATOM   1703 N N   . HIS B 2 82  I -97.013  14.340 45.691 1.00 23.86 ? 381 HIS B N   1 
ATOM   1704 C CA  . HIS B 2 82  I -98.315  13.684 45.667 1.00 21.92 ? 381 HIS B CA  1 
ATOM   1705 C C   . HIS B 2 82  I -98.836  13.184 47.012 1.00 21.25 ? 381 HIS B C   1 
ATOM   1706 O O   . HIS B 2 82  I -98.080  12.669 47.836 1.00 21.53 ? 381 HIS B O   1 
ATOM   1707 C CB  . HIS B 2 82  I -98.289  12.509 44.684 1.00 22.02 ? 381 HIS B CB  1 
ATOM   1708 C CG  . HIS B 2 82  I -99.595  11.788 44.589 1.00 19.09 ? 381 HIS B CG  1 
ATOM   1709 N ND1 . HIS B 2 82  I -100.758 12.410 44.191 1.00 18.93 ? 381 HIS B ND1 1 
ATOM   1710 C CD2 . HIS B 2 82  I -99.940  10.517 44.908 1.00 20.21 ? 381 HIS B CD2 1 
ATOM   1711 C CE1 . HIS B 2 82  I -101.764 11.558 44.273 1.00 20.03 ? 381 HIS B CE1 1 
ATOM   1712 N NE2 . HIS B 2 82  I -101.294 10.402 44.706 1.00 18.09 ? 381 HIS B NE2 1 
ATOM   1713 N N   . ALA B 2 83  ? -100.144 13.331 47.210 1.00 22.10 ? 382 ALA B N   1 
ATOM   1714 C CA  . ALA B 2 83  ? -100.821 12.895 48.429 1.00 20.56 ? 382 ALA B CA  1 
ATOM   1715 C C   . ALA B 2 83  ? -100.272 13.535 49.707 1.00 20.44 ? 382 ALA B C   1 
ATOM   1716 O O   . ALA B 2 83  ? -100.137 12.869 50.739 1.00 19.59 ? 382 ALA B O   1 
ATOM   1717 C CB  . ALA B 2 83  ? -100.767 11.364 48.542 1.00 20.29 ? 382 ALA B CB  1 
ATOM   1718 N N   . LYS B 2 84  ? -99.963  14.827 49.637 1.00 20.80 ? 383 LYS B N   1 
ATOM   1719 C CA  . LYS B 2 84  ? -99.446  15.557 50.790 1.00 20.42 ? 383 LYS B CA  1 
ATOM   1720 C C   . LYS B 2 84  ? -100.576 16.268 51.527 1.00 20.63 ? 383 LYS B C   1 
ATOM   1721 O O   . LYS B 2 84  ? -101.614 16.593 50.946 1.00 20.24 ? 383 LYS B O   1 
ATOM   1722 C CB  . LYS B 2 84  ? -98.386  16.573 50.353 1.00 20.69 ? 383 LYS B CB  1 
ATOM   1723 C CG  . LYS B 2 84  ? -97.225  15.953 49.600 1.00 21.40 ? 383 LYS B CG  1 
ATOM   1724 C CD  . LYS B 2 84  ? -96.603  14.806 50.387 1.00 22.34 ? 383 LYS B CD  1 
ATOM   1725 C CE  . LYS B 2 84  ? -95.577  14.063 49.536 1.00 23.85 ? 383 LYS B CE  1 
ATOM   1726 N NZ  . LYS B 2 84  ? -94.943  12.932 50.259 1.00 24.93 ? 383 LYS B NZ  1 
ATOM   1727 N N   . LYS B 2 85  ? -100.359 16.515 52.812 1.00 19.92 ? 384 LYS B N   1 
ATOM   1728 C CA  . LYS B 2 85  ? -101.357 17.155 53.645 1.00 18.59 ? 384 LYS B CA  1 
ATOM   1729 C C   . LYS B 2 85  ? -100.863 18.496 54.168 1.00 18.26 ? 384 LYS B C   1 
ATOM   1730 O O   . LYS B 2 85  ? -99.702  18.870 53.968 1.00 16.20 ? 384 LYS B O   1 
ATOM   1731 C CB  . LYS B 2 85  ? -101.700 16.231 54.812 1.00 19.96 ? 384 LYS B CB  1 
ATOM   1732 C CG  . LYS B 2 85  ? -102.290 14.892 54.395 1.00 20.38 ? 384 LYS B CG  1 
ATOM   1733 C CD  . LYS B 2 85  ? -103.730 15.043 53.906 1.00 22.02 ? 384 LYS B CD  1 
ATOM   1734 C CE  . LYS B 2 85  ? -104.661 15.452 55.040 1.00 23.56 ? 384 LYS B CE  1 
ATOM   1735 N NZ  . LYS B 2 85  ? -106.073 15.669 54.593 1.00 24.55 ? 384 LYS B NZ  1 
ATOM   1736 N N   . GLN B 2 86  ? -101.743 19.215 54.853 1.00 16.66 ? 385 GLN B N   1 
ATOM   1737 C CA  . GLN B 2 86  ? -101.375 20.515 55.391 1.00 16.36 ? 385 GLN B CA  1 
ATOM   1738 C C   . GLN B 2 86  ? -102.134 20.862 56.665 1.00 15.94 ? 385 GLN B C   1 
ATOM   1739 O O   . GLN B 2 86  ? -103.304 20.500 56.830 1.00 13.94 ? 385 GLN B O   1 
ATOM   1740 C CB  . GLN B 2 86  ? -101.629 21.595 54.336 1.00 15.79 ? 385 GLN B CB  1 
ATOM   1741 C CG  . GLN B 2 86  ? -101.247 23.015 54.760 1.00 19.68 ? 385 GLN B CG  1 
ATOM   1742 C CD  . GLN B 2 86  ? -101.444 24.029 53.641 1.00 21.03 ? 385 GLN B CD  1 
ATOM   1743 O OE1 . GLN B 2 86  ? -101.001 23.810 52.514 1.00 22.42 ? 385 GLN B OE1 1 
ATOM   1744 N NE2 . GLN B 2 86  ? -102.104 25.146 53.948 1.00 20.37 ? 385 GLN B NE2 1 
ATOM   1745 N N   . ILE B 2 87  ? -101.451 21.545 57.577 1.00 15.51 ? 386 ILE B N   1 
ATOM   1746 C CA  . ILE B 2 87  ? -102.085 22.000 58.807 1.00 14.25 ? 386 ILE B CA  1 
ATOM   1747 C C   . ILE B 2 87  ? -101.719 23.470 58.980 1.00 13.60 ? 386 ILE B C   1 
ATOM   1748 O O   . ILE B 2 87  ? -100.553 23.841 58.877 1.00 15.14 ? 386 ILE B O   1 
ATOM   1749 C CB  . ILE B 2 87  ? -101.631 21.189 60.058 1.00 14.21 ? 386 ILE B CB  1 
ATOM   1750 C CG1 . ILE B 2 87  ? -102.475 21.600 61.265 1.00 14.46 ? 386 ILE B CG1 1 
ATOM   1751 C CG2 . ILE B 2 87  ? -100.158 21.440 60.373 1.00 15.38 ? 386 ILE B CG2 1 
ATOM   1752 C CD1 . ILE B 2 87  ? -103.950 21.297 61.114 1.00 15.95 ? 386 ILE B CD1 1 
ATOM   1753 N N   . PRO B 2 88  ? -102.720 24.335 59.197 1.00 12.70 ? 387 PRO B N   1 
ATOM   1754 C CA  . PRO B 2 88  ? -102.424 25.762 59.374 1.00 12.77 ? 387 PRO B CA  1 
ATOM   1755 C C   . PRO B 2 88  ? -101.803 25.978 60.752 1.00 13.79 ? 387 PRO B C   1 
ATOM   1756 O O   . PRO B 2 88  ? -101.762 25.054 61.564 1.00 12.18 ? 387 PRO B O   1 
ATOM   1757 C CB  . PRO B 2 88  ? -103.794 26.426 59.245 1.00 11.56 ? 387 PRO B CB  1 
ATOM   1758 C CG  . PRO B 2 88  ? -104.570 25.441 58.398 1.00 11.64 ? 387 PRO B CG  1 
ATOM   1759 C CD  . PRO B 2 88  ? -104.160 24.126 58.997 1.00 10.74 ? 387 PRO B CD  1 
ATOM   1760 N N   . CYS B 2 89  ? -101.329 27.195 61.011 1.00 13.93 ? 388 CYS B N   1 
ATOM   1761 C CA  . CYS B 2 89  ? -100.691 27.512 62.285 1.00 12.50 ? 388 CYS B CA  1 
ATOM   1762 C C   . CYS B 2 89  ? -101.151 28.855 62.833 1.00 13.02 ? 388 CYS B C   1 
ATOM   1763 O O   . CYS B 2 89  ? -100.790 29.913 62.314 1.00 14.97 ? 388 CYS B O   1 
ATOM   1764 C CB  . CYS B 2 89  ? -99.173  27.512 62.106 1.00 13.98 ? 388 CYS B CB  1 
ATOM   1765 S SG  . CYS B 2 89  ? -98.198  27.875 63.587 1.00 17.83 ? 388 CYS B SG  1 
ATOM   1766 N N   . ILE B 2 90  ? -101.958 28.803 63.886 1.00 12.91 ? 389 ILE B N   1 
ATOM   1767 C CA  . ILE B 2 90  ? -102.493 30.001 64.529 1.00 10.77 ? 389 ILE B CA  1 
ATOM   1768 C C   . ILE B 2 90  ? -101.503 30.496 65.590 1.00 11.95 ? 389 ILE B C   1 
ATOM   1769 O O   . ILE B 2 90  ? -101.145 29.755 66.502 1.00 11.41 ? 389 ILE B O   1 
ATOM   1770 C CB  . ILE B 2 90  ? -103.844 29.694 65.216 1.00 8.89  ? 389 ILE B CB  1 
ATOM   1771 C CG1 . ILE B 2 90  ? -104.790 29.003 64.232 1.00 6.79  ? 389 ILE B CG1 1 
ATOM   1772 C CG2 . ILE B 2 90  ? -104.475 30.974 65.728 1.00 8.44  ? 389 ILE B CG2 1 
ATOM   1773 C CD1 . ILE B 2 90  ? -105.989 28.339 64.912 1.00 4.12  ? 389 ILE B CD1 1 
ATOM   1774 N N   . VAL B 2 91  ? -101.053 31.741 65.460 1.00 11.40 ? 390 VAL B N   1 
ATOM   1775 C CA  . VAL B 2 91  ? -100.112 32.318 66.410 1.00 11.96 ? 390 VAL B CA  1 
ATOM   1776 C C   . VAL B 2 91  ? -100.731 33.565 67.038 1.00 12.14 ? 390 VAL B C   1 
ATOM   1777 O O   . VAL B 2 91  ? -100.799 34.617 66.408 1.00 12.82 ? 390 VAL B O   1 
ATOM   1778 C CB  . VAL B 2 91  ? -98.797  32.708 65.717 1.00 12.18 ? 390 VAL B CB  1 
ATOM   1779 C CG1 . VAL B 2 91  ? -97.793  33.187 66.753 1.00 13.60 ? 390 VAL B CG1 1 
ATOM   1780 C CG2 . VAL B 2 91  ? -98.241  31.514 64.951 1.00 12.88 ? 390 VAL B CG2 1 
ATOM   1781 N N   . SER B 2 92  ? -101.169 33.450 68.286 1.00 12.25 ? 392 SER B N   1 
ATOM   1782 C CA  . SER B 2 92  ? -101.812 34.575 68.948 1.00 12.22 ? 392 SER B CA  1 
ATOM   1783 C C   . SER B 2 92  ? -101.095 35.227 70.121 1.00 12.91 ? 392 SER B C   1 
ATOM   1784 O O   . SER B 2 92  ? -100.661 34.560 71.069 1.00 11.00 ? 392 SER B O   1 
ATOM   1785 C CB  . SER B 2 92  ? -103.206 34.172 69.427 1.00 13.30 ? 392 SER B CB  1 
ATOM   1786 O OG  . SER B 2 92  ? -103.765 35.184 70.251 1.00 13.42 ? 392 SER B OG  1 
ATOM   1787 N N   . MET B 2 93  ? -100.993 36.550 70.043 1.00 11.13 ? 393 MET B N   1 
ATOM   1788 C CA  . MET B 2 93  ? -100.411 37.353 71.102 1.00 12.63 ? 393 MET B CA  1 
ATOM   1789 C C   . MET B 2 93  ? -101.541 38.271 71.517 1.00 13.43 ? 393 MET B C   1 
ATOM   1790 O O   . MET B 2 93  ? -101.312 39.366 72.018 1.00 13.52 ? 393 MET B O   1 
ATOM   1791 C CB  . MET B 2 93  ? -99.221  38.182 70.602 1.00 14.64 ? 393 MET B CB  1 
ATOM   1792 C CG  . MET B 2 93  ? -97.866  37.519 70.838 1.00 17.08 ? 393 MET B CG  1 
ATOM   1793 S SD  . MET B 2 93  ? -97.083  36.852 69.343 1.00 26.51 ? 393 MET B SD  1 
ATOM   1794 C CE  . MET B 2 93  ? -98.380  35.901 68.695 1.00 21.42 ? 393 MET B CE  1 
ATOM   1795 N N   . LEU B 2 94  ? -102.769 37.813 71.282 1.00 13.25 ? 394 LEU B N   1 
ATOM   1796 C CA  . LEU B 2 94  ? -103.948 38.594 71.622 1.00 14.08 ? 394 LEU B CA  1 
ATOM   1797 C C   . LEU B 2 94  ? -104.190 38.577 73.114 1.00 16.11 ? 394 LEU B C   1 
ATOM   1798 O O   . LEU B 2 94  ? -103.893 37.603 73.802 1.00 13.37 ? 394 LEU B O   1 
ATOM   1799 C CB  . LEU B 2 94  ? -105.189 38.071 70.893 1.00 13.28 ? 394 LEU B CB  1 
ATOM   1800 C CG  . LEU B 2 94  ? -105.163 38.133 69.364 1.00 12.70 ? 394 LEU B CG  1 
ATOM   1801 C CD1 . LEU B 2 94  ? -106.517 37.668 68.827 1.00 12.81 ? 394 LEU B CD1 1 
ATOM   1802 C CD2 . LEU B 2 94  ? -104.852 39.559 68.900 1.00 10.81 ? 394 LEU B CD2 1 
ATOM   1803 N N   . THR B 2 95  ? -104.764 39.672 73.589 1.00 17.01 ? 395 THR B N   1 
ATOM   1804 C CA  . THR B 2 95  ? -105.042 39.879 74.996 1.00 18.13 ? 395 THR B CA  1 
ATOM   1805 C C   . THR B 2 95  ? -106.509 39.684 75.371 1.00 17.51 ? 395 THR B C   1 
ATOM   1806 O O   . THR B 2 95  ? -106.843 39.529 76.547 1.00 17.69 ? 395 THR B O   1 
ATOM   1807 C CB  . THR B 2 95  ? -104.572 41.294 75.376 1.00 17.59 ? 395 THR B CB  1 
ATOM   1808 O OG1 . THR B 2 95  ? -103.160 41.259 75.616 1.00 26.31 ? 395 THR B OG1 1 
ATOM   1809 C CG2 . THR B 2 95  ? -105.292 41.811 76.591 1.00 27.83 ? 395 THR B CG2 1 
ATOM   1810 N N   . LYS B 2 96  ? -107.381 39.688 74.369 1.00 16.71 ? 396 LYS B N   1 
ATOM   1811 C CA  . LYS B 2 96  ? -108.809 39.520 74.599 1.00 17.12 ? 396 LYS B CA  1 
ATOM   1812 C C   . LYS B 2 96  ? -109.405 38.672 73.493 1.00 17.64 ? 396 LYS B C   1 
ATOM   1813 O O   . LYS B 2 96  ? -108.746 38.383 72.490 1.00 15.77 ? 396 LYS B O   1 
ATOM   1814 C CB  . LYS B 2 96  ? -109.519 40.876 74.599 1.00 18.75 ? 396 LYS B CB  1 
ATOM   1815 C CG  . LYS B 2 96  ? -108.957 41.896 75.575 1.00 19.97 ? 396 LYS B CG  1 
ATOM   1816 C CD  . LYS B 2 96  ? -109.749 43.203 75.512 1.00 20.69 ? 396 LYS B CD  1 
ATOM   1817 C CE  . LYS B 2 96  ? -109.268 44.218 76.547 1.00 20.38 ? 396 LYS B CE  1 
ATOM   1818 N NZ  . LYS B 2 96  ? -110.005 45.513 76.427 1.00 23.96 ? 396 LYS B NZ  1 
ATOM   1819 N N   . GLU B 2 97  ? -110.660 38.280 73.680 1.00 18.35 ? 397 GLU B N   1 
ATOM   1820 C CA  . GLU B 2 97  ? -111.359 37.492 72.683 1.00 21.21 ? 397 GLU B CA  1 
ATOM   1821 C C   . GLU B 2 97  ? -111.814 38.448 71.588 1.00 20.15 ? 397 GLU B C   1 
ATOM   1822 O O   . GLU B 2 97  ? -112.117 39.611 71.856 1.00 18.56 ? 397 GLU B O   1 
ATOM   1823 C CB  . GLU B 2 97  ? -112.545 36.770 73.326 1.00 23.49 ? 397 GLU B CB  1 
ATOM   1824 C CG  . GLU B 2 97  ? -112.130 35.489 74.044 1.00 30.76 ? 397 GLU B CG  1 
ATOM   1825 C CD  . GLU B 2 97  ? -113.165 35.010 75.042 1.00 35.44 ? 397 GLU B CD  1 
ATOM   1826 O OE1 . GLU B 2 97  ? -114.375 35.114 74.739 1.00 36.51 ? 397 GLU B OE1 1 
ATOM   1827 O OE2 . GLU B 2 97  ? -112.768 34.521 76.127 1.00 39.18 ? 397 GLU B OE2 1 
ATOM   1828 N N   . LEU B 2 98  ? -111.838 37.964 70.351 1.00 19.65 ? 398 LEU B N   1 
ATOM   1829 C CA  . LEU B 2 98  ? -112.232 38.796 69.225 1.00 19.26 ? 398 LEU B CA  1 
ATOM   1830 C C   . LEU B 2 98  ? -113.499 38.307 68.548 1.00 19.81 ? 398 LEU B C   1 
ATOM   1831 O O   . LEU B 2 98  ? -113.594 37.150 68.144 1.00 19.94 ? 398 LEU B O   1 
ATOM   1832 C CB  . LEU B 2 98  ? -111.094 38.865 68.201 1.00 19.19 ? 398 LEU B CB  1 
ATOM   1833 C CG  . LEU B 2 98  ? -111.329 39.696 66.932 1.00 19.55 ? 398 LEU B CG  1 
ATOM   1834 C CD1 . LEU B 2 98  ? -111.650 41.138 67.300 1.00 19.41 ? 398 LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 2 98  ? -110.084 39.645 66.055 1.00 21.36 ? 398 LEU B CD2 1 
ATOM   1836 N N   . TYR B 2 99  ? -114.468 39.209 68.437 1.00 20.06 ? 399 TYR B N   1 
ATOM   1837 C CA  . TYR B 2 99  ? -115.752 38.929 67.803 1.00 21.68 ? 399 TYR B CA  1 
ATOM   1838 C C   . TYR B 2 99  ? -115.996 39.941 66.681 1.00 22.68 ? 399 TYR B C   1 
ATOM   1839 O O   . TYR B 2 99  ? -115.831 41.143 66.875 1.00 21.32 ? 399 TYR B O   1 
ATOM   1840 C CB  . TYR B 2 99  ? -116.878 39.039 68.830 1.00 22.18 ? 399 TYR B CB  1 
ATOM   1841 C CG  . TYR B 2 99  ? -116.846 37.975 69.901 1.00 21.67 ? 399 TYR B CG  1 
ATOM   1842 C CD1 . TYR B 2 99  ? -117.297 36.682 69.643 1.00 19.56 ? 399 TYR B CD1 1 
ATOM   1843 C CD2 . TYR B 2 99  ? -116.354 38.261 71.173 1.00 22.04 ? 399 TYR B CD2 1 
ATOM   1844 C CE1 . TYR B 2 99  ? -117.259 35.698 70.629 1.00 21.12 ? 399 TYR B CE1 1 
ATOM   1845 C CE2 . TYR B 2 99  ? -116.309 37.289 72.165 1.00 20.87 ? 399 TYR B CE2 1 
ATOM   1846 C CZ  . TYR B 2 99  ? -116.760 36.011 71.888 1.00 20.66 ? 399 TYR B CZ  1 
ATOM   1847 O OH  . TYR B 2 99  ? -116.695 35.052 72.868 1.00 20.19 ? 399 TYR B OH  1 
ATOM   1848 N N   . PHE B 2 100 ? -116.398 39.455 65.515 1.00 25.53 ? 400 PHE B N   1 
ATOM   1849 C CA  . PHE B 2 100 ? -116.656 40.332 64.384 1.00 30.61 ? 400 PHE B CA  1 
ATOM   1850 C C   . PHE B 2 100 ? -118.058 40.941 64.393 1.00 34.68 ? 400 PHE B C   1 
ATOM   1851 O O   . PHE B 2 100 ? -118.629 41.215 63.338 1.00 37.90 ? 400 PHE B O   1 
ATOM   1852 C CB  . PHE B 2 100 ? -116.420 39.570 63.081 1.00 28.99 ? 400 PHE B CB  1 
ATOM   1853 C CG  . PHE B 2 100 ? -115.002 39.120 62.902 1.00 27.95 ? 400 PHE B CG  1 
ATOM   1854 C CD1 . PHE B 2 100 ? -113.985 40.050 62.682 1.00 27.23 ? 400 PHE B CD1 1 
ATOM   1855 C CD2 . PHE B 2 100 ? -114.670 37.773 62.994 1.00 27.14 ? 400 PHE B CD2 1 
ATOM   1856 C CE1 . PHE B 2 100 ? -112.653 39.639 62.558 1.00 25.64 ? 400 PHE B CE1 1 
ATOM   1857 C CE2 . PHE B 2 100 ? -113.344 37.355 62.873 1.00 26.20 ? 400 PHE B CE2 1 
ATOM   1858 C CZ  . PHE B 2 100 ? -112.335 38.287 62.656 1.00 25.45 ? 400 PHE B CZ  1 
ATOM   1859 N N   . TYR B 2 101 ? -118.607 41.160 65.584 1.00 37.92 ? 401 TYR B N   1 
ATOM   1860 C CA  . TYR B 2 101 ? -119.939 41.746 65.714 1.00 40.82 ? 401 TYR B CA  1 
ATOM   1861 C C   . TYR B 2 101 ? -120.112 42.366 67.098 1.00 42.43 ? 401 TYR B C   1 
ATOM   1862 O O   . TYR B 2 101 ? -119.170 42.241 67.917 1.00 44.15 ? 401 TYR B O   1 
ATOM   1863 C CB  . TYR B 2 101 ? -121.007 40.675 65.479 1.00 40.24 ? 401 TYR B CB  1 
ATOM   1864 C CG  . TYR B 2 101 ? -120.966 39.537 66.474 1.00 41.13 ? 401 TYR B CG  1 
ATOM   1865 C CD1 . TYR B 2 101 ? -121.518 39.675 67.749 1.00 40.56 ? 401 TYR B CD1 1 
ATOM   1866 C CD2 . TYR B 2 101 ? -120.357 38.323 66.148 1.00 40.65 ? 401 TYR B CD2 1 
ATOM   1867 C CE1 . TYR B 2 101 ? -121.466 38.634 68.673 1.00 39.86 ? 401 TYR B CE1 1 
ATOM   1868 C CE2 . TYR B 2 101 ? -120.299 37.276 67.065 1.00 38.88 ? 401 TYR B CE2 1 
ATOM   1869 C CZ  . TYR B 2 101 ? -120.855 37.440 68.325 1.00 39.60 ? 401 TYR B CZ  1 
ATOM   1870 O OH  . TYR B 2 101 ? -120.797 36.416 69.240 1.00 39.15 ? 401 TYR B OH  1 
ATOM   1871 N N   . ASP C 1 6   ? -118.930 17.346 65.610 1.00 47.05 ? 650 ASP C N   1 
ATOM   1872 C CA  . ASP C 1 6   ? -118.046 17.251 66.806 1.00 46.95 ? 650 ASP C CA  1 
ATOM   1873 C C   . ASP C 1 6   ? -116.810 18.131 66.634 1.00 45.28 ? 650 ASP C C   1 
ATOM   1874 O O   . ASP C 1 6   ? -115.820 17.722 66.022 1.00 44.61 ? 650 ASP C O   1 
ATOM   1875 C CB  . ASP C 1 6   ? -117.613 15.801 67.032 1.00 49.86 ? 650 ASP C CB  1 
ATOM   1876 C CG  . ASP C 1 6   ? -116.707 15.647 68.241 1.00 53.13 ? 650 ASP C CG  1 
ATOM   1877 O OD1 . ASP C 1 6   ? -117.157 15.976 69.362 1.00 54.16 ? 650 ASP C OD1 1 
ATOM   1878 O OD2 . ASP C 1 6   ? -115.547 15.202 68.069 1.00 53.70 ? 650 ASP C OD2 1 
ATOM   1879 N N   . ASN C 1 7   ? -116.873 19.339 67.184 1.00 41.95 ? 651 ASN C N   1 
ATOM   1880 C CA  . ASN C 1 7   ? -115.766 20.278 67.082 1.00 39.36 ? 651 ASN C CA  1 
ATOM   1881 C C   . ASN C 1 7   ? -114.976 20.410 68.385 1.00 35.23 ? 651 ASN C C   1 
ATOM   1882 O O   . ASN C 1 7   ? -114.266 21.395 68.589 1.00 32.75 ? 651 ASN C O   1 
ATOM   1883 C CB  . ASN C 1 7   ? -116.288 21.650 66.657 1.00 42.87 ? 651 ASN C CB  1 
ATOM   1884 C CG  . ASN C 1 7   ? -117.304 22.206 67.631 1.00 45.64 ? 651 ASN C CG  1 
ATOM   1885 O OD1 . ASN C 1 7   ? -118.292 21.545 67.955 1.00 47.26 ? 651 ASN C OD1 1 
ATOM   1886 N ND2 . ASN C 1 7   ? -117.070 23.426 68.104 1.00 46.69 ? 651 ASN C ND2 1 
ATOM   1887 N N   . SER C 1 8   ? -115.111 19.424 69.267 1.00 30.93 ? 652 SER C N   1 
ATOM   1888 C CA  . SER C 1 8   ? -114.377 19.441 70.527 1.00 27.84 ? 652 SER C CA  1 
ATOM   1889 C C   . SER C 1 8   ? -113.745 18.074 70.737 1.00 24.30 ? 652 SER C C   1 
ATOM   1890 O O   . SER C 1 8   ? -114.367 17.048 70.459 1.00 22.27 ? 652 SER C O   1 
ATOM   1891 C CB  . SER C 1 8   ? -115.304 19.776 71.696 1.00 29.13 ? 652 SER C CB  1 
ATOM   1892 O OG  . SER C 1 8   ? -116.046 18.643 72.099 1.00 35.95 ? 652 SER C OG  1 
ATOM   1893 N N   . TYR C 1 9   ? -112.504 18.061 71.214 1.00 23.00 ? 653 TYR C N   1 
ATOM   1894 C CA  . TYR C 1 9   ? -111.789 16.812 71.448 1.00 20.35 ? 653 TYR C CA  1 
ATOM   1895 C C   . TYR C 1 9   ? -112.495 15.909 72.443 1.00 19.54 ? 653 TYR C C   1 
ATOM   1896 O O   . TYR C 1 9   ? -113.009 16.366 73.462 1.00 18.53 ? 653 TYR C O   1 
ATOM   1897 C CB  . TYR C 1 9   ? -110.372 17.080 71.964 1.00 17.28 ? 653 TYR C CB  1 
ATOM   1898 C CG  . TYR C 1 9   ? -109.411 17.609 70.926 1.00 15.95 ? 653 TYR C CG  1 
ATOM   1899 C CD1 . TYR C 1 9   ? -109.036 16.833 69.828 1.00 14.71 ? 653 TYR C CD1 1 
ATOM   1900 C CD2 . TYR C 1 9   ? -108.854 18.878 71.054 1.00 13.39 ? 653 TYR C CD2 1 
ATOM   1901 C CE1 . TYR C 1 9   ? -108.121 17.313 68.883 1.00 15.16 ? 653 TYR C CE1 1 
ATOM   1902 C CE2 . TYR C 1 9   ? -107.948 19.366 70.120 1.00 12.68 ? 653 TYR C CE2 1 
ATOM   1903 C CZ  . TYR C 1 9   ? -107.583 18.584 69.041 1.00 12.93 ? 653 TYR C CZ  1 
ATOM   1904 O OH  . TYR C 1 9   ? -106.670 19.084 68.138 1.00 11.29 ? 653 TYR C OH  1 
ATOM   1905 N N   . LYS C 1 10  ? -112.505 14.619 72.131 1.00 20.12 ? 654 LYS C N   1 
ATOM   1906 C CA  . LYS C 1 10  ? -113.107 13.616 72.999 1.00 20.06 ? 654 LYS C CA  1 
ATOM   1907 C C   . LYS C 1 10  ? -112.198 13.544 74.225 1.00 19.71 ? 654 LYS C C   1 
ATOM   1908 O O   . LYS C 1 10  ? -111.028 13.194 74.122 1.00 18.88 ? 654 LYS C O   1 
ATOM   1909 C CB  . LYS C 1 10  ? -113.149 12.268 72.272 1.00 20.56 ? 654 LYS C CB  1 
ATOM   1910 C CG  . LYS C 1 10  ? -113.528 11.071 73.130 1.00 23.38 ? 654 LYS C CG  1 
ATOM   1911 C CD  . LYS C 1 10  ? -113.374 9.775  72.328 1.00 27.36 ? 654 LYS C CD  1 
ATOM   1912 C CE  . LYS C 1 10  ? -113.526 8.527  73.202 1.00 26.49 ? 654 LYS C CE  1 
ATOM   1913 N NZ  . LYS C 1 10  ? -114.918 8.349  73.679 1.00 28.47 ? 654 LYS C NZ  1 
ATOM   1914 N N   . MET C 1 11  ? -112.735 13.901 75.381 1.00 20.80 ? 655 MET C N   1 
ATOM   1915 C CA  . MET C 1 11  ? -111.956 13.896 76.610 1.00 21.32 ? 655 MET C CA  1 
ATOM   1916 C C   . MET C 1 11  ? -112.579 12.970 77.646 1.00 22.55 ? 655 MET C C   1 
ATOM   1917 O O   . MET C 1 11  ? -112.387 13.156 78.848 1.00 24.11 ? 655 MET C O   1 
ATOM   1918 C CB  . MET C 1 11  ? -111.876 15.315 77.181 1.00 17.87 ? 655 MET C CB  1 
ATOM   1919 C CG  . MET C 1 11  ? -111.225 16.343 76.265 1.00 18.08 ? 655 MET C CG  1 
ATOM   1920 S SD  . MET C 1 11  ? -109.477 16.011 75.948 1.00 18.34 ? 655 MET C SD  1 
ATOM   1921 C CE  . MET C 1 11  ? -108.756 16.614 77.474 1.00 15.27 ? 655 MET C CE  1 
ATOM   1922 N N   . ASP C 1 12  ? -113.319 11.972 77.173 1.00 23.04 ? 656 ASP C N   1 
ATOM   1923 C CA  . ASP C 1 12  ? -113.989 11.021 78.052 1.00 24.19 ? 656 ASP C CA  1 
ATOM   1924 C C   . ASP C 1 12  ? -113.310 9.655  78.104 1.00 23.11 ? 656 ASP C C   1 
ATOM   1925 O O   . ASP C 1 12  ? -113.944 8.660  78.442 1.00 21.03 ? 656 ASP C O   1 
ATOM   1926 C CB  . ASP C 1 12  ? -115.441 10.849 77.614 1.00 26.57 ? 656 ASP C CB  1 
ATOM   1927 C CG  . ASP C 1 12  ? -115.565 10.637 76.133 1.00 27.74 ? 656 ASP C CG  1 
ATOM   1928 O OD1 . ASP C 1 12  ? -114.854 9.769  75.607 1.00 30.01 ? 656 ASP C OD1 1 
ATOM   1929 O OD2 . ASP C 1 12  ? -116.370 11.341 75.490 1.00 36.22 ? 656 ASP C OD2 1 
ATOM   1930 N N   . TYR C 1 13  A -112.031 9.608  77.747 1.00 22.18 ? 656 TYR C N   1 
ATOM   1931 C CA  . TYR C 1 13  A -111.277 8.361  77.814 1.00 21.09 ? 656 TYR C CA  1 
ATOM   1932 C C   . TYR C 1 13  A -111.099 8.042  79.293 1.00 20.40 ? 656 TYR C C   1 
ATOM   1933 O O   . TYR C 1 13  A -111.309 8.904  80.145 1.00 20.90 ? 656 TYR C O   1 
ATOM   1934 C CB  . TYR C 1 13  A -109.901 8.528  77.167 1.00 20.03 ? 656 TYR C CB  1 
ATOM   1935 C CG  . TYR C 1 13  A -109.909 8.466  75.659 1.00 22.17 ? 656 TYR C CG  1 
ATOM   1936 C CD1 . TYR C 1 13  A -109.680 7.261  74.990 1.00 21.74 ? 656 TYR C CD1 1 
ATOM   1937 C CD2 . TYR C 1 13  A -110.132 9.614  74.893 1.00 22.62 ? 656 TYR C CD2 1 
ATOM   1938 C CE1 . TYR C 1 13  A -109.667 7.204  73.598 1.00 22.11 ? 656 TYR C CE1 1 
ATOM   1939 C CE2 . TYR C 1 13  A -110.122 9.565  73.498 1.00 21.33 ? 656 TYR C CE2 1 
ATOM   1940 C CZ  . TYR C 1 13  A -109.886 8.361  72.863 1.00 21.90 ? 656 TYR C CZ  1 
ATOM   1941 O OH  . TYR C 1 13  A -109.840 8.309  71.494 1.00 23.76 ? 656 TYR C OH  1 
ATOM   1942 N N   . PRO C 1 14  ? -110.723 6.797  79.620 1.00 20.54 ? 661 PRO C N   1 
ATOM   1943 C CA  . PRO C 1 14  ? -110.531 6.436  81.029 1.00 19.74 ? 661 PRO C CA  1 
ATOM   1944 C C   . PRO C 1 14  ? -109.557 7.370  81.759 1.00 21.09 ? 661 PRO C C   1 
ATOM   1945 O O   . PRO C 1 14  ? -109.658 7.552  82.969 1.00 22.09 ? 661 PRO C O   1 
ATOM   1946 C CB  . PRO C 1 14  ? -110.005 5.003  80.944 1.00 17.09 ? 661 PRO C CB  1 
ATOM   1947 C CG  . PRO C 1 14  ? -110.715 4.471  79.741 1.00 17.29 ? 661 PRO C CG  1 
ATOM   1948 C CD  . PRO C 1 14  ? -110.583 5.613  78.750 1.00 17.72 ? 661 PRO C CD  1 
ATOM   1949 N N   . GLU C 1 15  ? -108.624 7.971  81.023 1.00 20.54 ? 662 GLU C N   1 
ATOM   1950 C CA  . GLU C 1 15  ? -107.636 8.867  81.631 1.00 21.02 ? 662 GLU C CA  1 
ATOM   1951 C C   . GLU C 1 15  ? -107.406 10.128 80.799 1.00 20.00 ? 662 GLU C C   1 
ATOM   1952 O O   . GLU C 1 15  ? -107.406 10.068 79.570 1.00 19.30 ? 662 GLU C O   1 
ATOM   1953 C CB  . GLU C 1 15  ? -106.302 8.131  81.801 1.00 22.46 ? 662 GLU C CB  1 
ATOM   1954 C CG  . GLU C 1 15  ? -106.448 6.689  82.271 1.00 26.23 ? 662 GLU C CG  1 
ATOM   1955 C CD  . GLU C 1 15  ? -105.126 5.935  82.273 1.00 29.43 ? 662 GLU C CD  1 
ATOM   1956 O OE1 . GLU C 1 15  ? -104.120 6.469  81.756 1.00 29.58 ? 662 GLU C OE1 1 
ATOM   1957 O OE2 . GLU C 1 15  ? -105.095 4.801  82.791 1.00 32.81 ? 662 GLU C OE2 1 
ATOM   1958 N N   . MET C 1 16  A -107.212 11.262 81.477 1.00 17.99 ? 662 MET C N   1 
ATOM   1959 C CA  . MET C 1 16  A -106.964 12.535 80.802 1.00 16.85 ? 662 MET C CA  1 
ATOM   1960 C C   . MET C 1 16  A -105.625 12.465 80.084 1.00 16.64 ? 662 MET C C   1 
ATOM   1961 O O   . MET C 1 16  A -105.469 13.003 78.983 1.00 16.08 ? 662 MET C O   1 
ATOM   1962 C CB  . MET C 1 16  A -106.947 13.690 81.807 1.00 16.54 ? 662 MET C CB  1 
ATOM   1963 C CG  . MET C 1 16  A -108.330 14.096 82.317 1.00 19.98 ? 662 MET C CG  1 
ATOM   1964 S SD  . MET C 1 16  A -109.249 15.063 81.097 1.00 21.79 ? 662 MET C SD  1 
ATOM   1965 C CE  . MET C 1 16  A -109.736 13.875 79.995 1.00 23.75 ? 662 MET C CE  1 
ATOM   1966 N N   . GLY C 1 17  ? -104.669 11.790 80.724 1.00 16.50 ? 663 GLY C N   1 
ATOM   1967 C CA  . GLY C 1 17  ? -103.347 11.624 80.153 1.00 14.46 ? 663 GLY C CA  1 
ATOM   1968 C C   . GLY C 1 17  ? -102.194 12.000 81.071 1.00 14.69 ? 663 GLY C C   1 
ATOM   1969 O O   . GLY C 1 17  ? -102.374 12.337 82.247 1.00 13.54 ? 663 GLY C O   1 
ATOM   1970 N N   . LEU C 1 18  ? -100.992 11.933 80.512 1.00 15.11 ? 664 LEU C N   1 
ATOM   1971 C CA  . LEU C 1 18  ? -99.776  12.260 81.235 1.00 15.35 ? 664 LEU C CA  1 
ATOM   1972 C C   . LEU C 1 18  ? -99.451  13.751 81.174 1.00 15.92 ? 664 LEU C C   1 
ATOM   1973 O O   . LEU C 1 18  ? -99.790  14.440 80.212 1.00 15.35 ? 664 LEU C O   1 
ATOM   1974 C CB  . LEU C 1 18  ? -98.596  11.497 80.635 1.00 15.91 ? 664 LEU C CB  1 
ATOM   1975 C CG  . LEU C 1 18  ? -98.201  10.101 81.115 1.00 21.35 ? 664 LEU C CG  1 
ATOM   1976 C CD1 . LEU C 1 18  ? -99.406  9.281  81.538 1.00 21.79 ? 664 LEU C CD1 1 
ATOM   1977 C CD2 . LEU C 1 18  ? -97.434  9.435  79.991 1.00 19.58 ? 664 LEU C CD2 1 
ATOM   1978 N N   . CYS C 1 19  ? -98.790  14.231 82.218 1.00 14.40 ? 665 CYS C N   1 
ATOM   1979 C CA  . CYS C 1 19  ? -98.336  15.605 82.283 1.00 14.28 ? 665 CYS C CA  1 
ATOM   1980 C C   . CYS C 1 19  ? -96.879  15.500 82.698 1.00 13.07 ? 665 CYS C C   1 
ATOM   1981 O O   . CYS C 1 19  ? -96.573  15.391 83.883 1.00 13.82 ? 665 CYS C O   1 
ATOM   1982 C CB  . CYS C 1 19  ? -99.103  16.417 83.325 1.00 15.04 ? 665 CYS C CB  1 
ATOM   1983 S SG  . CYS C 1 19  ? -98.455  18.116 83.470 1.00 18.08 ? 665 CYS C SG  1 
ATOM   1984 N N   . ILE C 1 20  ? -95.981  15.500 81.719 1.00 13.66 ? 666 ILE C N   1 
ATOM   1985 C CA  . ILE C 1 20  ? -94.558  15.401 82.010 1.00 13.28 ? 666 ILE C CA  1 
ATOM   1986 C C   . ILE C 1 20  ? -94.011  16.808 82.257 1.00 14.38 ? 666 ILE C C   1 
ATOM   1987 O O   . ILE C 1 20  ? -94.106  17.677 81.391 1.00 13.57 ? 666 ILE C O   1 
ATOM   1988 C CB  . ILE C 1 20  ? -93.790  14.740 80.843 1.00 12.26 ? 666 ILE C CB  1 
ATOM   1989 C CG1 . ILE C 1 20  ? -94.406  13.375 80.526 1.00 12.77 ? 666 ILE C CG1 1 
ATOM   1990 C CG2 . ILE C 1 20  ? -92.317  14.577 81.213 1.00 12.87 ? 666 ILE C CG2 1 
ATOM   1991 C CD1 . ILE C 1 20  ? -94.447  12.408 81.695 1.00 5.36  ? 666 ILE C CD1 1 
ATOM   1992 N N   . ILE C 1 21  ? -93.472  17.035 83.455 1.00 14.00 ? 667 ILE C N   1 
ATOM   1993 C CA  . ILE C 1 21  ? -92.918  18.336 83.815 1.00 12.52 ? 667 ILE C CA  1 
ATOM   1994 C C   . ILE C 1 21  ? -91.410  18.221 84.010 1.00 13.09 ? 667 ILE C C   1 
ATOM   1995 O O   . ILE C 1 21  ? -90.952  17.509 84.906 1.00 14.32 ? 667 ILE C O   1 
ATOM   1996 C CB  . ILE C 1 21  ? -93.508  18.873 85.143 1.00 12.72 ? 667 ILE C CB  1 
ATOM   1997 C CG1 . ILE C 1 21  ? -95.024  19.052 85.040 1.00 12.86 ? 667 ILE C CG1 1 
ATOM   1998 C CG2 . ILE C 1 21  ? -92.851  20.199 85.492 1.00 14.41 ? 667 ILE C CG2 1 
ATOM   1999 C CD1 . ILE C 1 21  ? -95.685  19.402 86.375 1.00 9.10  ? 667 ILE C CD1 1 
ATOM   2000 N N   . ILE C 1 22  ? -90.646  18.912 83.169 1.00 13.82 ? 668 ILE C N   1 
ATOM   2001 C CA  . ILE C 1 22  ? -89.195  18.900 83.277 1.00 14.01 ? 668 ILE C CA  1 
ATOM   2002 C C   . ILE C 1 22  ? -88.733  20.225 83.876 1.00 15.49 ? 668 ILE C C   1 
ATOM   2003 O O   . ILE C 1 22  ? -88.763  21.269 83.216 1.00 16.20 ? 668 ILE C O   1 
ATOM   2004 C CB  . ILE C 1 22  ? -88.542  18.698 81.914 1.00 14.41 ? 668 ILE C CB  1 
ATOM   2005 C CG1 . ILE C 1 22  ? -88.988  17.359 81.327 1.00 12.90 ? 668 ILE C CG1 1 
ATOM   2006 C CG2 . ILE C 1 22  ? -87.025  18.719 82.060 1.00 14.48 ? 668 ILE C CG2 1 
ATOM   2007 C CD1 . ILE C 1 22  ? -88.391  17.071 79.973 1.00 16.98 ? 668 ILE C CD1 1 
ATOM   2008 N N   . ASN C 1 23  ? -88.309  20.155 85.133 1.00 14.90 ? 669 ASN C N   1 
ATOM   2009 C CA  . ASN C 1 23  ? -87.862  21.305 85.920 1.00 15.14 ? 669 ASN C CA  1 
ATOM   2010 C C   . ASN C 1 23  ? -86.331  21.378 85.994 1.00 15.18 ? 669 ASN C C   1 
ATOM   2011 O O   . ASN C 1 23  ? -85.716  20.709 86.820 1.00 16.19 ? 669 ASN C O   1 
ATOM   2012 C CB  . ASN C 1 23  ? -88.440  21.170 87.337 1.00 13.44 ? 669 ASN C CB  1 
ATOM   2013 C CG  . ASN C 1 23  ? -88.202  22.394 88.198 1.00 15.34 ? 669 ASN C CG  1 
ATOM   2014 O OD1 . ASN C 1 23  ? -88.052  22.285 89.413 1.00 16.61 ? 669 ASN C OD1 1 
ATOM   2015 N ND2 . ASN C 1 23  ? -88.189  23.564 87.582 1.00 12.65 ? 669 ASN C ND2 1 
ATOM   2016 N N   . ASN C 1 24  ? -85.715  22.172 85.126 1.00 15.24 ? 670 ASN C N   1 
ATOM   2017 C CA  . ASN C 1 24  ? -84.261  22.309 85.147 1.00 16.88 ? 670 ASN C CA  1 
ATOM   2018 C C   . ASN C 1 24  ? -83.876  23.597 85.866 1.00 17.44 ? 670 ASN C C   1 
ATOM   2019 O O   . ASN C 1 24  ? -84.138  24.698 85.383 1.00 18.65 ? 670 ASN C O   1 
ATOM   2020 C CB  . ASN C 1 24  ? -83.692  22.291 83.724 1.00 15.05 ? 670 ASN C CB  1 
ATOM   2021 C CG  . ASN C 1 24  ? -83.583  20.884 83.165 1.00 16.23 ? 670 ASN C CG  1 
ATOM   2022 O OD1 . ASN C 1 24  ? -83.271  20.686 81.990 1.00 17.52 ? 670 ASN C OD1 1 
ATOM   2023 N ND2 . ASN C 1 24  ? -83.833  19.896 84.014 1.00 16.46 ? 670 ASN C ND2 1 
ATOM   2024 N N   . LYS C 1 25  ? -83.265  23.441 87.035 1.00 18.24 ? 671 LYS C N   1 
ATOM   2025 C CA  . LYS C 1 25  ? -82.866  24.572 87.858 1.00 19.64 ? 671 LYS C CA  1 
ATOM   2026 C C   . LYS C 1 25  ? -81.353  24.788 87.924 1.00 19.91 ? 671 LYS C C   1 
ATOM   2027 O O   . LYS C 1 25  ? -80.873  25.913 87.787 1.00 20.69 ? 671 LYS C O   1 
ATOM   2028 C CB  . LYS C 1 25  ? -83.415  24.380 89.273 1.00 20.96 ? 671 LYS C CB  1 
ATOM   2029 C CG  . LYS C 1 25  ? -83.079  25.523 90.223 1.00 24.82 ? 671 LYS C CG  1 
ATOM   2030 C CD  . LYS C 1 25  ? -83.708  25.318 91.600 1.00 27.61 ? 671 LYS C CD  1 
ATOM   2031 C CE  . LYS C 1 25  ? -83.446  26.534 92.495 1.00 32.28 ? 671 LYS C CE  1 
ATOM   2032 N NZ  . LYS C 1 25  ? -84.044  26.401 93.857 1.00 33.60 ? 671 LYS C NZ  1 
ATOM   2033 N N   . ASN C 1 26  ? -80.603  23.711 88.129 1.00 20.63 ? 672 ASN C N   1 
ATOM   2034 C CA  . ASN C 1 26  ? -79.149  23.806 88.234 1.00 22.72 ? 672 ASN C CA  1 
ATOM   2035 C C   . ASN C 1 26  ? -78.422  23.349 86.983 1.00 22.30 ? 672 ASN C C   1 
ATOM   2036 O O   . ASN C 1 26  ? -78.577  22.216 86.542 1.00 24.40 ? 672 ASN C O   1 
ATOM   2037 C CB  . ASN C 1 26  ? -78.670  22.992 89.431 1.00 22.75 ? 672 ASN C CB  1 
ATOM   2038 C CG  . ASN C 1 26  ? -79.331  23.422 90.712 1.00 24.49 ? 672 ASN C CG  1 
ATOM   2039 O OD1 . ASN C 1 26  ? -79.186  24.565 91.140 1.00 25.31 ? 672 ASN C OD1 1 
ATOM   2040 N ND2 . ASN C 1 26  ? -80.079  22.511 91.329 1.00 26.12 ? 672 ASN C ND2 1 
ATOM   2041 N N   . PHE C 1 27  ? -77.611  24.235 86.427 1.00 23.20 ? 673 PHE C N   1 
ATOM   2042 C CA  . PHE C 1 27  ? -76.870  23.930 85.217 1.00 25.23 ? 673 PHE C CA  1 
ATOM   2043 C C   . PHE C 1 27  ? -75.367  23.795 85.448 1.00 27.82 ? 673 PHE C C   1 
ATOM   2044 O O   . PHE C 1 27  ? -74.787  24.463 86.309 1.00 26.27 ? 673 PHE C O   1 
ATOM   2045 C CB  . PHE C 1 27  ? -77.157  25.007 84.168 1.00 23.40 ? 673 PHE C CB  1 
ATOM   2046 C CG  . PHE C 1 27  ? -78.611  25.132 83.832 1.00 22.35 ? 673 PHE C CG  1 
ATOM   2047 C CD1 . PHE C 1 27  ? -79.489  25.763 84.709 1.00 19.26 ? 673 PHE C CD1 1 
ATOM   2048 C CD2 . PHE C 1 27  ? -79.123  24.542 82.675 1.00 19.96 ? 673 PHE C CD2 1 
ATOM   2049 C CE1 . PHE C 1 27  ? -80.860  25.802 84.445 1.00 19.62 ? 673 PHE C CE1 1 
ATOM   2050 C CE2 . PHE C 1 27  ? -80.493  24.578 82.404 1.00 20.35 ? 673 PHE C CE2 1 
ATOM   2051 C CZ  . PHE C 1 27  ? -81.363  25.208 83.294 1.00 16.14 ? 673 PHE C CZ  1 
ATOM   2052 N N   . HIS C 1 28  ? -74.747  22.917 84.666 1.00 31.95 ? 674 HIS C N   1 
ATOM   2053 C CA  . HIS C 1 28  ? -73.314  22.670 84.758 1.00 35.42 ? 674 HIS C CA  1 
ATOM   2054 C C   . HIS C 1 28  ? -72.525  23.960 84.583 1.00 34.95 ? 674 HIS C C   1 
ATOM   2055 O O   . HIS C 1 28  ? -72.789  24.735 83.668 1.00 33.37 ? 674 HIS C O   1 
ATOM   2056 C CB  . HIS C 1 28  ? -72.896  21.656 83.690 1.00 40.06 ? 674 HIS C CB  1 
ATOM   2057 C CG  . HIS C 1 28  ? -73.563  20.320 83.831 1.00 46.96 ? 674 HIS C CG  1 
ATOM   2058 N ND1 . HIS C 1 28  ? -74.895  20.177 84.159 1.00 48.84 ? 674 HIS C ND1 1 
ATOM   2059 C CD2 . HIS C 1 28  ? -73.087  19.062 83.651 1.00 49.22 ? 674 HIS C CD2 1 
ATOM   2060 C CE1 . HIS C 1 28  ? -75.212  18.894 84.174 1.00 48.90 ? 674 HIS C CE1 1 
ATOM   2061 N NE2 . HIS C 1 28  ? -74.132  18.196 83.867 1.00 49.28 ? 674 HIS C NE2 1 
ATOM   2062 N N   . LYS C 1 29  ? -71.557  24.173 85.472 1.00 36.34 ? 675 LYS C N   1 
ATOM   2063 C CA  . LYS C 1 29  ? -70.695  25.359 85.456 1.00 38.83 ? 675 LYS C CA  1 
ATOM   2064 C C   . LYS C 1 29  ? -70.295  25.777 84.046 1.00 37.98 ? 675 LYS C C   1 
ATOM   2065 O O   . LYS C 1 29  ? -70.388  26.950 83.681 1.00 39.16 ? 675 LYS C O   1 
ATOM   2066 C CB  . LYS C 1 29  ? -69.413  25.082 86.246 1.00 40.55 ? 675 LYS C CB  1 
ATOM   2067 C CG  . LYS C 1 29  ? -69.637  24.496 87.630 1.00 43.81 ? 675 LYS C CG  1 
ATOM   2068 C CD  . LYS C 1 29  ? -68.401  23.731 88.106 1.00 44.80 ? 675 LYS C CD  1 
ATOM   2069 C CE  . LYS C 1 29  ? -68.145  22.507 87.232 1.00 44.77 ? 675 LYS C CE  1 
ATOM   2070 N NZ  . LYS C 1 29  ? -66.943  21.742 87.653 1.00 46.30 ? 675 LYS C NZ  1 
ATOM   2071 N N   . SER C 1 30  A -69.840  24.799 83.269 1.00 37.05 ? 675 SER C N   1 
ATOM   2072 C CA  . SER C 1 30  A -69.384  25.017 81.903 1.00 35.40 ? 675 SER C CA  1 
ATOM   2073 C C   . SER C 1 30  A -70.371  25.716 80.977 1.00 33.63 ? 675 SER C C   1 
ATOM   2074 O O   . SER C 1 30  A -69.961  26.310 79.980 1.00 32.59 ? 675 SER C O   1 
ATOM   2075 C CB  . SER C 1 30  A -68.972  23.677 81.281 1.00 36.44 ? 675 SER C CB  1 
ATOM   2076 O OG  . SER C 1 30  A -70.052  22.762 81.270 1.00 36.30 ? 675 SER C OG  1 
ATOM   2077 N N   . THR C 1 31  B -71.662  25.650 81.299 1.00 32.01 ? 675 THR C N   1 
ATOM   2078 C CA  . THR C 1 31  B -72.685  26.267 80.456 1.00 30.23 ? 675 THR C CA  1 
ATOM   2079 C C   . THR C 1 31  B -72.814  27.769 80.665 1.00 29.58 ? 675 THR C C   1 
ATOM   2080 O O   . THR C 1 31  B -73.221  28.497 79.758 1.00 30.28 ? 675 THR C O   1 
ATOM   2081 C CB  . THR C 1 31  B -74.090  25.644 80.692 1.00 30.64 ? 675 THR C CB  1 
ATOM   2082 O OG1 . THR C 1 31  B -74.566  26.003 81.995 1.00 29.64 ? 675 THR C OG1 1 
ATOM   2083 C CG2 . THR C 1 31  B -74.034  24.129 80.573 1.00 28.84 ? 675 THR C CG2 1 
ATOM   2084 N N   . GLY C 1 32  C -72.478  28.234 81.861 1.00 29.26 ? 675 GLY C N   1 
ATOM   2085 C CA  . GLY C 1 32  C -72.595  29.653 82.145 1.00 29.77 ? 675 GLY C CA  1 
ATOM   2086 C C   . GLY C 1 32  C -74.044  30.059 82.374 1.00 30.17 ? 675 GLY C C   1 
ATOM   2087 O O   . GLY C 1 32  C -74.390  31.239 82.281 1.00 29.38 ? 675 GLY C O   1 
ATOM   2088 N N   . MET C 1 33  ? -74.893  29.075 82.662 1.00 28.61 ? 676 MET C N   1 
ATOM   2089 C CA  . MET C 1 33  ? -76.310  29.323 82.918 1.00 29.33 ? 676 MET C CA  1 
ATOM   2090 C C   . MET C 1 33  ? -76.500  29.558 84.414 1.00 27.10 ? 676 MET C C   1 
ATOM   2091 O O   . MET C 1 33  ? -75.954  28.827 85.243 1.00 26.34 ? 676 MET C O   1 
ATOM   2092 C CB  . MET C 1 33  ? -77.162  28.119 82.487 1.00 32.43 ? 676 MET C CB  1 
ATOM   2093 C CG  . MET C 1 33  ? -77.034  27.713 81.029 1.00 35.95 ? 676 MET C CG  1 
ATOM   2094 S SD  . MET C 1 33  ? -78.041  28.685 79.921 1.00 43.01 ? 676 MET C SD  1 
ATOM   2095 C CE  . MET C 1 33  ? -76.927  30.012 79.525 1.00 41.56 ? 676 MET C CE  1 
ATOM   2096 N N   . THR C 1 34  ? -77.279  30.573 84.757 1.00 25.09 ? 677 THR C N   1 
ATOM   2097 C CA  . THR C 1 34  ? -77.531  30.892 86.154 1.00 24.40 ? 677 THR C CA  1 
ATOM   2098 C C   . THR C 1 34  ? -78.590  29.964 86.732 1.00 22.03 ? 677 THR C C   1 
ATOM   2099 O O   . THR C 1 34  ? -79.430  29.444 86.002 1.00 22.63 ? 677 THR C O   1 
ATOM   2100 C CB  . THR C 1 34  ? -78.004  32.342 86.303 1.00 26.88 ? 677 THR C CB  1 
ATOM   2101 O OG1 . THR C 1 34  ? -79.214  32.528 85.554 1.00 27.93 ? 677 THR C OG1 1 
ATOM   2102 C CG2 . THR C 1 34  ? -76.939  33.297 85.787 1.00 26.50 ? 677 THR C CG2 1 
ATOM   2103 N N   . SER C 1 35  ? -78.527  29.746 88.041 1.00 20.55 ? 678 SER C N   1 
ATOM   2104 C CA  . SER C 1 35  ? -79.487  28.890 88.729 1.00 21.94 ? 678 SER C CA  1 
ATOM   2105 C C   . SER C 1 35  ? -80.855  29.551 88.541 1.00 20.36 ? 678 SER C C   1 
ATOM   2106 O O   . SER C 1 35  ? -80.985  30.762 88.717 1.00 18.17 ? 678 SER C O   1 
ATOM   2107 C CB  . SER C 1 35  ? -79.120  28.799 90.214 1.00 22.11 ? 678 SER C CB  1 
ATOM   2108 O OG  . SER C 1 35  ? -79.959  27.893 90.909 1.00 27.64 ? 678 SER C OG  1 
ATOM   2109 N N   . ARG C 1 36  ? -81.872  28.770 88.175 1.00 19.80 ? 679 ARG C N   1 
ATOM   2110 C CA  . ARG C 1 36  ? -83.199  29.344 87.930 1.00 17.67 ? 679 ARG C CA  1 
ATOM   2111 C C   . ARG C 1 36  ? -84.102  29.453 89.167 1.00 19.28 ? 679 ARG C C   1 
ATOM   2112 O O   . ARG C 1 36  ? -85.150  28.798 89.257 1.00 16.85 ? 679 ARG C O   1 
ATOM   2113 C CB  . ARG C 1 36  ? -83.912  28.561 86.810 1.00 16.74 ? 679 ARG C CB  1 
ATOM   2114 C CG  . ARG C 1 36  ? -83.170  28.589 85.462 1.00 15.70 ? 679 ARG C CG  1 
ATOM   2115 C CD  . ARG C 1 36  ? -83.921  27.857 84.335 1.00 13.88 ? 679 ARG C CD  1 
ATOM   2116 N NE  . ARG C 1 36  ? -85.246  28.435 84.113 1.00 13.38 ? 679 ARG C NE  1 
ATOM   2117 C CZ  . ARG C 1 36  ? -86.389  27.887 84.517 1.00 12.14 ? 679 ARG C CZ  1 
ATOM   2118 N NH1 . ARG C 1 36  ? -86.385  26.727 85.156 1.00 8.57  ? 679 ARG C NH1 1 
ATOM   2119 N NH2 . ARG C 1 36  ? -87.537  28.530 84.328 1.00 8.46  ? 679 ARG C NH2 1 
ATOM   2120 N N   . SER C 1 37  ? -83.685  30.295 90.111 1.00 17.31 ? 680 SER C N   1 
ATOM   2121 C CA  . SER C 1 37  ? -84.432  30.526 91.346 1.00 17.50 ? 680 SER C CA  1 
ATOM   2122 C C   . SER C 1 37  ? -85.904  30.779 91.038 1.00 15.41 ? 680 SER C C   1 
ATOM   2123 O O   . SER C 1 37  ? -86.234  31.571 90.153 1.00 12.75 ? 680 SER C O   1 
ATOM   2124 C CB  . SER C 1 37  ? -83.863  31.740 92.095 1.00 18.07 ? 680 SER C CB  1 
ATOM   2125 O OG  . SER C 1 37  ? -82.467  31.600 92.319 1.00 23.75 ? 680 SER C OG  1 
ATOM   2126 N N   . GLY C 1 38  ? -86.776  30.109 91.784 1.00 15.61 ? 681 GLY C N   1 
ATOM   2127 C CA  . GLY C 1 38  ? -88.205  30.260 91.580 1.00 14.80 ? 681 GLY C CA  1 
ATOM   2128 C C   . GLY C 1 38  ? -88.836  29.132 90.772 1.00 15.64 ? 681 GLY C C   1 
ATOM   2129 O O   . GLY C 1 38  ? -90.033  28.860 90.903 1.00 13.67 ? 681 GLY C O   1 
ATOM   2130 N N   . THR C 1 39  ? -88.035  28.461 89.948 1.00 14.68 ? 682 THR C N   1 
ATOM   2131 C CA  . THR C 1 39  ? -88.551  27.388 89.102 1.00 15.67 ? 682 THR C CA  1 
ATOM   2132 C C   . THR C 1 39  ? -89.261  26.279 89.877 1.00 16.16 ? 682 THR C C   1 
ATOM   2133 O O   . THR C 1 39  ? -90.240  25.719 89.386 1.00 16.00 ? 682 THR C O   1 
ATOM   2134 C CB  . THR C 1 39  ? -87.436  26.778 88.221 1.00 16.31 ? 682 THR C CB  1 
ATOM   2135 O OG1 . THR C 1 39  ? -88.029  26.048 87.135 1.00 17.30 ? 682 THR C OG1 1 
ATOM   2136 C CG2 . THR C 1 39  ? -86.539  25.840 89.044 1.00 14.87 ? 682 THR C CG2 1 
ATOM   2137 N N   . ASP C 1 40  ? -88.787  25.978 91.087 1.00 16.88 ? 683 ASP C N   1 
ATOM   2138 C CA  . ASP C 1 40  ? -89.413  24.943 91.914 1.00 16.51 ? 683 ASP C CA  1 
ATOM   2139 C C   . ASP C 1 40  ? -90.845  25.318 92.264 1.00 15.16 ? 683 ASP C C   1 
ATOM   2140 O O   . ASP C 1 40  ? -91.721  24.457 92.331 1.00 14.53 ? 683 ASP C O   1 
ATOM   2141 C CB  . ASP C 1 40  ? -88.621  24.706 93.210 1.00 16.34 ? 683 ASP C CB  1 
ATOM   2142 C CG  . ASP C 1 40  ? -87.279  24.036 92.960 1.00 18.11 ? 683 ASP C CG  1 
ATOM   2143 O OD1 . ASP C 1 40  ? -87.151  23.320 91.947 1.00 19.18 ? 683 ASP C OD1 1 
ATOM   2144 O OD2 . ASP C 1 40  ? -86.358  24.209 93.781 1.00 19.61 ? 683 ASP C OD2 1 
ATOM   2145 N N   . VAL C 1 41  ? -91.080  26.604 92.503 1.00 15.38 ? 684 VAL C N   1 
ATOM   2146 C CA  . VAL C 1 41  ? -92.422  27.070 92.821 1.00 13.71 ? 684 VAL C CA  1 
ATOM   2147 C C   . VAL C 1 41  ? -93.317  26.784 91.611 1.00 14.34 ? 684 VAL C C   1 
ATOM   2148 O O   . VAL C 1 41  ? -94.477  26.401 91.769 1.00 14.77 ? 684 VAL C O   1 
ATOM   2149 C CB  . VAL C 1 41  ? -92.431  28.581 93.116 1.00 14.18 ? 684 VAL C CB  1 
ATOM   2150 C CG1 . VAL C 1 41  ? -93.878  29.081 93.289 1.00 11.81 ? 684 VAL C CG1 1 
ATOM   2151 C CG2 . VAL C 1 41  ? -91.610  28.864 94.369 1.00 10.27 ? 684 VAL C CG2 1 
ATOM   2152 N N   . ASP C 1 42  ? -92.771  26.966 90.408 1.00 12.72 ? 685 ASP C N   1 
ATOM   2153 C CA  . ASP C 1 42  ? -93.523  26.703 89.186 1.00 14.42 ? 685 ASP C CA  1 
ATOM   2154 C C   . ASP C 1 42  ? -93.840  25.224 89.070 1.00 15.84 ? 685 ASP C C   1 
ATOM   2155 O O   . ASP C 1 42  ? -94.972  24.853 88.765 1.00 16.57 ? 685 ASP C O   1 
ATOM   2156 C CB  . ASP C 1 42  ? -92.735  27.124 87.939 1.00 14.32 ? 685 ASP C CB  1 
ATOM   2157 C CG  . ASP C 1 42  ? -92.836  28.606 87.655 1.00 14.62 ? 685 ASP C CG  1 
ATOM   2158 O OD1 . ASP C 1 42  ? -93.617  29.289 88.343 1.00 16.52 ? 685 ASP C OD1 1 
ATOM   2159 O OD2 . ASP C 1 42  ? -92.142  29.088 86.737 1.00 17.50 ? 685 ASP C OD2 1 
ATOM   2160 N N   . ALA C 1 43  ? -92.832  24.385 89.308 1.00 15.86 ? 686 ALA C N   1 
ATOM   2161 C CA  . ALA C 1 43  ? -92.999  22.940 89.203 1.00 15.49 ? 686 ALA C CA  1 
ATOM   2162 C C   . ALA C 1 43  ? -94.078  22.442 90.140 1.00 14.82 ? 686 ALA C C   1 
ATOM   2163 O O   . ALA C 1 43  ? -94.939  21.656 89.748 1.00 14.97 ? 686 ALA C O   1 
ATOM   2164 C CB  . ALA C 1 43  ? -91.670  22.229 89.494 1.00 14.67 ? 686 ALA C CB  1 
ATOM   2165 N N   . ALA C 1 44  ? -94.028  22.898 91.384 1.00 15.88 ? 687 ALA C N   1 
ATOM   2166 C CA  . ALA C 1 44  ? -95.016  22.494 92.372 1.00 16.43 ? 687 ALA C CA  1 
ATOM   2167 C C   . ALA C 1 44  ? -96.406  23.006 91.971 1.00 15.70 ? 687 ALA C C   1 
ATOM   2168 O O   . ALA C 1 44  ? -97.391  22.280 92.062 1.00 15.63 ? 687 ALA C O   1 
ATOM   2169 C CB  . ALA C 1 44  ? -94.621  23.030 93.744 1.00 15.58 ? 687 ALA C CB  1 
ATOM   2170 N N   . ASN C 1 45  ? -96.472  24.252 91.518 1.00 16.02 ? 688 ASN C N   1 
ATOM   2171 C CA  . ASN C 1 45  ? -97.734  24.856 91.101 1.00 16.91 ? 688 ASN C CA  1 
ATOM   2172 C C   . ASN C 1 45  ? -98.357  24.048 89.942 1.00 15.66 ? 688 ASN C C   1 
ATOM   2173 O O   . ASN C 1 45  ? -99.546  23.712 89.962 1.00 13.44 ? 688 ASN C O   1 
ATOM   2174 C CB  . ASN C 1 45  ? -97.479  26.305 90.680 1.00 19.38 ? 688 ASN C CB  1 
ATOM   2175 C CG  . ASN C 1 45  ? -98.740  27.139 90.650 1.00 23.62 ? 688 ASN C CG  1 
ATOM   2176 O OD1 . ASN C 1 45  ? -99.786  26.726 91.154 1.00 29.56 ? 688 ASN C OD1 1 
ATOM   2177 N ND2 . ASN C 1 45  ? -98.646  28.330 90.070 1.00 24.21 ? 688 ASN C ND2 1 
ATOM   2178 N N   . LEU C 1 46  ? -97.545  23.733 88.939 1.00 14.35 ? 689 LEU C N   1 
ATOM   2179 C CA  . LEU C 1 46  ? -98.015  22.952 87.797 1.00 13.15 ? 689 LEU C CA  1 
ATOM   2180 C C   . LEU C 1 46  ? -98.490  21.552 88.215 1.00 12.45 ? 689 LEU C C   1 
ATOM   2181 O O   . LEU C 1 46  ? -99.488  21.044 87.699 1.00 11.29 ? 689 LEU C O   1 
ATOM   2182 C CB  . LEU C 1 46  ? -96.901  22.842 86.754 1.00 11.82 ? 689 LEU C CB  1 
ATOM   2183 C CG  . LEU C 1 46  ? -96.644  24.122 85.949 1.00 11.31 ? 689 LEU C CG  1 
ATOM   2184 C CD1 . LEU C 1 46  ? -95.283  24.048 85.277 1.00 12.51 ? 689 LEU C CD1 1 
ATOM   2185 C CD2 . LEU C 1 46  ? -97.741  24.309 84.923 1.00 6.01  ? 689 LEU C CD2 1 
ATOM   2186 N N   . ARG C 1 47  ? -97.782  20.942 89.162 1.00 12.88 ? 690 ARG C N   1 
ATOM   2187 C CA  . ARG C 1 47  ? -98.133  19.605 89.647 1.00 14.94 ? 690 ARG C CA  1 
ATOM   2188 C C   . ARG C 1 47  ? -99.544  19.586 90.254 1.00 14.75 ? 690 ARG C C   1 
ATOM   2189 O O   . ARG C 1 47  ? -100.355 18.714 89.939 1.00 14.04 ? 690 ARG C O   1 
ATOM   2190 C CB  . ARG C 1 47  ? -97.108  19.141 90.693 1.00 15.76 ? 690 ARG C CB  1 
ATOM   2191 C CG  . ARG C 1 47  ? -97.302  17.704 91.186 1.00 16.48 ? 690 ARG C CG  1 
ATOM   2192 C CD  . ARG C 1 47  ? -96.287  17.366 92.277 1.00 17.47 ? 690 ARG C CD  1 
ATOM   2193 N NE  . ARG C 1 47  ? -96.340  15.966 92.700 1.00 19.02 ? 690 ARG C NE  1 
ATOM   2194 C CZ  . ARG C 1 47  ? -95.923  14.942 91.957 1.00 18.12 ? 690 ARG C CZ  1 
ATOM   2195 N NH1 . ARG C 1 47  ? -95.419  15.151 90.745 1.00 13.78 ? 690 ARG C NH1 1 
ATOM   2196 N NH2 . ARG C 1 47  ? -95.996  13.708 92.433 1.00 19.19 ? 690 ARG C NH2 1 
ATOM   2197 N N   . GLU C 1 48  ? -99.825  20.560 91.117 1.00 14.45 ? 691 GLU C N   1 
ATOM   2198 C CA  . GLU C 1 48  ? -101.130 20.675 91.774 1.00 16.55 ? 691 GLU C CA  1 
ATOM   2199 C C   . GLU C 1 48  ? -102.248 20.994 90.787 1.00 15.96 ? 691 GLU C C   1 
ATOM   2200 O O   . GLU C 1 48  ? -103.357 20.464 90.891 1.00 15.60 ? 691 GLU C O   1 
ATOM   2201 C CB  . GLU C 1 48  ? -101.102 21.788 92.830 1.00 16.75 ? 691 GLU C CB  1 
ATOM   2202 C CG  . GLU C 1 48  ? -101.380 21.323 94.253 1.00 22.02 ? 691 GLU C CG  1 
ATOM   2203 C CD  . GLU C 1 48  ? -102.603 20.432 94.376 1.00 20.54 ? 691 GLU C CD  1 
ATOM   2204 O OE1 . GLU C 1 48  ? -103.751 20.931 94.313 1.00 21.07 ? 691 GLU C OE1 1 
ATOM   2205 O OE2 . GLU C 1 48  ? -102.403 19.216 94.535 1.00 20.11 ? 691 GLU C OE2 1 
ATOM   2206 N N   . THR C 1 49  ? -101.954 21.889 89.849 1.00 14.12 ? 692 THR C N   1 
ATOM   2207 C CA  . THR C 1 49  ? -102.929 22.307 88.850 1.00 12.69 ? 692 THR C CA  1 
ATOM   2208 C C   . THR C 1 49  ? -103.371 21.152 87.970 1.00 11.39 ? 692 THR C C   1 
ATOM   2209 O O   . THR C 1 49  ? -104.558 20.919 87.785 1.00 10.37 ? 692 THR C O   1 
ATOM   2210 C CB  . THR C 1 49  ? -102.361 23.419 87.941 1.00 12.65 ? 692 THR C CB  1 
ATOM   2211 O OG1 . THR C 1 49  ? -102.015 24.563 88.734 1.00 13.97 ? 692 THR C OG1 1 
ATOM   2212 C CG2 . THR C 1 49  ? -103.395 23.824 86.884 1.00 11.19 ? 692 THR C CG2 1 
ATOM   2213 N N   . PHE C 1 50  ? -102.414 20.423 87.420 1.00 13.16 ? 693 PHE C N   1 
ATOM   2214 C CA  . PHE C 1 50  ? -102.766 19.307 86.562 1.00 14.44 ? 693 PHE C CA  1 
ATOM   2215 C C   . PHE C 1 50  ? -103.314 18.104 87.339 1.00 15.60 ? 693 PHE C C   1 
ATOM   2216 O O   . PHE C 1 50  ? -104.015 17.266 86.769 1.00 16.08 ? 693 PHE C O   1 
ATOM   2217 C CB  . PHE C 1 50  ? -101.571 18.952 85.666 1.00 13.05 ? 693 PHE C CB  1 
ATOM   2218 C CG  . PHE C 1 50  ? -101.386 19.923 84.529 1.00 15.47 ? 693 PHE C CG  1 
ATOM   2219 C CD1 . PHE C 1 50  ? -102.108 19.775 83.345 1.00 15.72 ? 693 PHE C CD1 1 
ATOM   2220 C CD2 . PHE C 1 50  ? -100.595 21.060 84.687 1.00 15.00 ? 693 PHE C CD2 1 
ATOM   2221 C CE1 . PHE C 1 50  ? -102.053 20.749 82.337 1.00 15.56 ? 693 PHE C CE1 1 
ATOM   2222 C CE2 . PHE C 1 50  ? -100.534 22.040 83.683 1.00 16.97 ? 693 PHE C CE2 1 
ATOM   2223 C CZ  . PHE C 1 50  ? -101.268 21.884 82.508 1.00 14.95 ? 693 PHE C CZ  1 
ATOM   2224 N N   . ARG C 1 51  ? -103.016 18.029 88.636 1.00 14.59 ? 694 ARG C N   1 
ATOM   2225 C CA  . ARG C 1 51  ? -103.544 16.947 89.455 1.00 14.81 ? 694 ARG C CA  1 
ATOM   2226 C C   . ARG C 1 51  ? -105.046 17.204 89.557 1.00 16.04 ? 694 ARG C C   1 
ATOM   2227 O O   . ARG C 1 51  ? -105.851 16.275 89.486 1.00 15.00 ? 694 ARG C O   1 
ATOM   2228 C CB  . ARG C 1 51  ? -102.926 16.954 90.855 1.00 14.61 ? 694 ARG C CB  1 
ATOM   2229 C CG  . ARG C 1 51  ? -103.465 15.845 91.769 1.00 13.77 ? 694 ARG C CG  1 
ATOM   2230 C CD  . ARG C 1 51  ? -102.934 15.977 93.200 1.00 12.54 ? 694 ARG C CD  1 
ATOM   2231 N NE  . ARG C 1 51  ? -103.547 17.090 93.923 1.00 10.20 ? 694 ARG C NE  1 
ATOM   2232 C CZ  . ARG C 1 51  ? -104.751 17.045 94.489 1.00 11.29 ? 694 ARG C CZ  1 
ATOM   2233 N NH1 . ARG C 1 51  ? -105.478 15.934 94.427 1.00 10.40 ? 694 ARG C NH1 1 
ATOM   2234 N NH2 . ARG C 1 51  ? -105.245 18.119 95.095 1.00 12.93 ? 694 ARG C NH2 1 
ATOM   2235 N N   . ASN C 1 52  ? -105.413 18.474 89.710 1.00 17.26 ? 695 ASN C N   1 
ATOM   2236 C CA  . ASN C 1 52  ? -106.819 18.848 89.799 1.00 19.86 ? 695 ASN C CA  1 
ATOM   2237 C C   . ASN C 1 52  ? -107.535 18.666 88.469 1.00 18.98 ? 695 ASN C C   1 
ATOM   2238 O O   . ASN C 1 52  ? -108.750 18.522 88.434 1.00 22.83 ? 695 ASN C O   1 
ATOM   2239 C CB  . ASN C 1 52  ? -106.964 20.296 90.272 1.00 21.22 ? 695 ASN C CB  1 
ATOM   2240 C CG  . ASN C 1 52  ? -106.484 20.488 91.699 1.00 26.05 ? 695 ASN C CG  1 
ATOM   2241 O OD1 . ASN C 1 52  ? -106.780 19.674 92.577 1.00 27.07 ? 695 ASN C OD1 1 
ATOM   2242 N ND2 . ASN C 1 52  ? -105.744 21.567 91.940 1.00 26.97 ? 695 ASN C ND2 1 
ATOM   2243 N N   . LEU C 1 53  ? -106.790 18.674 87.372 1.00 17.99 ? 696 LEU C N   1 
ATOM   2244 C CA  . LEU C 1 53  ? -107.396 18.484 86.060 1.00 17.14 ? 696 LEU C CA  1 
ATOM   2245 C C   . LEU C 1 53  ? -107.410 16.989 85.710 1.00 17.44 ? 696 LEU C C   1 
ATOM   2246 O O   . LEU C 1 53  ? -107.807 16.602 84.610 1.00 16.81 ? 696 LEU C O   1 
ATOM   2247 C CB  . LEU C 1 53  ? -106.629 19.295 85.001 1.00 15.43 ? 696 LEU C CB  1 
ATOM   2248 C CG  . LEU C 1 53  ? -106.676 20.824 85.210 1.00 17.52 ? 696 LEU C CG  1 
ATOM   2249 C CD1 . LEU C 1 53  ? -105.882 21.520 84.121 1.00 17.26 ? 696 LEU C CD1 1 
ATOM   2250 C CD2 . LEU C 1 53  ? -108.117 21.312 85.194 1.00 14.57 ? 696 LEU C CD2 1 
ATOM   2251 N N   . LYS C 1 54  ? -106.979 16.163 86.666 1.00 17.56 ? 697 LYS C N   1 
ATOM   2252 C CA  . LYS C 1 54  ? -106.936 14.706 86.525 1.00 16.90 ? 697 LYS C CA  1 
ATOM   2253 C C   . LYS C 1 54  ? -105.871 14.120 85.605 1.00 16.45 ? 697 LYS C C   1 
ATOM   2254 O O   . LYS C 1 54  ? -106.086 13.082 84.982 1.00 15.42 ? 697 LYS C O   1 
ATOM   2255 C CB  . LYS C 1 54  ? -108.311 14.158 86.120 1.00 19.79 ? 697 LYS C CB  1 
ATOM   2256 C CG  . LYS C 1 54  ? -109.313 14.066 87.279 1.00 22.30 ? 697 LYS C CG  1 
ATOM   2257 C CD  . LYS C 1 54  ? -109.739 15.434 87.764 1.00 27.77 ? 697 LYS C CD  1 
ATOM   2258 C CE  . LYS C 1 54  ? -110.701 15.342 88.942 1.00 28.02 ? 697 LYS C CE  1 
ATOM   2259 N NZ  . LYS C 1 54  ? -110.030 14.887 90.185 1.00 28.78 ? 697 LYS C NZ  1 
ATOM   2260 N N   . TYR C 1 55  ? -104.717 14.775 85.524 1.00 15.67 ? 698 TYR C N   1 
ATOM   2261 C CA  . TYR C 1 55  ? -103.619 14.263 84.706 1.00 15.61 ? 698 TYR C CA  1 
ATOM   2262 C C   . TYR C 1 55  ? -102.672 13.457 85.584 1.00 15.62 ? 698 TYR C C   1 
ATOM   2263 O O   . TYR C 1 55  ? -102.536 13.716 86.777 1.00 15.36 ? 698 TYR C O   1 
ATOM   2264 C CB  . TYR C 1 55  ? -102.822 15.395 84.049 1.00 14.48 ? 698 TYR C CB  1 
ATOM   2265 C CG  . TYR C 1 55  ? -103.478 15.962 82.816 1.00 16.16 ? 698 TYR C CG  1 
ATOM   2266 C CD1 . TYR C 1 55  ? -104.509 16.892 82.923 1.00 14.97 ? 698 TYR C CD1 1 
ATOM   2267 C CD2 . TYR C 1 55  ? -103.113 15.522 81.542 1.00 16.78 ? 698 TYR C CD2 1 
ATOM   2268 C CE1 . TYR C 1 55  ? -105.169 17.371 81.793 1.00 15.86 ? 698 TYR C CE1 1 
ATOM   2269 C CE2 . TYR C 1 55  ? -103.767 15.991 80.404 1.00 16.65 ? 698 TYR C CE2 1 
ATOM   2270 C CZ  . TYR C 1 55  ? -104.797 16.916 80.536 1.00 17.80 ? 698 TYR C CZ  1 
ATOM   2271 O OH  . TYR C 1 55  ? -105.467 17.381 79.419 1.00 16.82 ? 698 TYR C OH  1 
ATOM   2272 N N   . GLU C 1 56  ? -102.041 12.459 84.988 1.00 14.50 ? 699 GLU C N   1 
ATOM   2273 C CA  . GLU C 1 56  ? -101.074 11.647 85.702 1.00 14.63 ? 699 GLU C CA  1 
ATOM   2274 C C   . GLU C 1 56  ? -99.787  12.459 85.592 1.00 13.49 ? 699 GLU C C   1 
ATOM   2275 O O   . GLU C 1 56  ? -99.112  12.426 84.562 1.00 11.20 ? 699 GLU C O   1 
ATOM   2276 C CB  . GLU C 1 56  ? -100.911 10.304 85.001 1.00 15.85 ? 699 GLU C CB  1 
ATOM   2277 C CG  . GLU C 1 56  ? -100.037 9.323  85.729 1.00 21.29 ? 699 GLU C CG  1 
ATOM   2278 C CD  . GLU C 1 56  ? -99.822  8.062  84.923 1.00 23.28 ? 699 GLU C CD  1 
ATOM   2279 O OE1 . GLU C 1 56  ? -100.821 7.538  84.385 1.00 24.92 ? 699 GLU C OE1 1 
ATOM   2280 O OE2 . GLU C 1 56  ? -98.665  7.598  84.832 1.00 24.78 ? 699 GLU C OE2 1 
ATOM   2281 N N   . VAL C 1 57  ? -99.462  13.199 86.646 1.00 12.28 ? 700 VAL C N   1 
ATOM   2282 C CA  . VAL C 1 57  ? -98.283  14.053 86.635 1.00 14.09 ? 700 VAL C CA  1 
ATOM   2283 C C   . VAL C 1 57  ? -96.965  13.382 87.010 1.00 15.55 ? 700 VAL C C   1 
ATOM   2284 O O   . VAL C 1 57  ? -96.888  12.622 87.972 1.00 16.83 ? 700 VAL C O   1 
ATOM   2285 C CB  . VAL C 1 57  ? -98.490  15.268 87.567 1.00 13.20 ? 700 VAL C CB  1 
ATOM   2286 C CG1 . VAL C 1 57  ? -97.265  16.172 87.537 1.00 13.21 ? 700 VAL C CG1 1 
ATOM   2287 C CG2 . VAL C 1 57  ? -99.735  16.030 87.156 1.00 12.67 ? 700 VAL C CG2 1 
ATOM   2288 N N   . ARG C 1 58  ? -95.923  13.688 86.246 1.00 16.27 ? 701 ARG C N   1 
ATOM   2289 C CA  . ARG C 1 58  ? -94.595  13.143 86.505 1.00 17.67 ? 701 ARG C CA  1 
ATOM   2290 C C   . ARG C 1 58  ? -93.573  14.272 86.479 1.00 17.99 ? 701 ARG C C   1 
ATOM   2291 O O   . ARG C 1 58  ? -93.305  14.847 85.424 1.00 18.79 ? 701 ARG C O   1 
ATOM   2292 C CB  . ARG C 1 58  ? -94.219  12.092 85.456 1.00 14.72 ? 701 ARG C CB  1 
ATOM   2293 C CG  . ARG C 1 58  ? -95.127  10.881 85.432 1.00 15.79 ? 701 ARG C CG  1 
ATOM   2294 C CD  . ARG C 1 58  ? -94.674  9.908  84.358 1.00 19.07 ? 701 ARG C CD  1 
ATOM   2295 N NE  . ARG C 1 58  ? -95.627  8.826  84.142 1.00 20.33 ? 701 ARG C NE  1 
ATOM   2296 C CZ  . ARG C 1 58  ? -95.515  7.932  83.169 1.00 22.09 ? 701 ARG C CZ  1 
ATOM   2297 N NH1 . ARG C 1 58  ? -94.489  7.994  82.329 1.00 21.20 ? 701 ARG C NH1 1 
ATOM   2298 N NH2 . ARG C 1 58  ? -96.432  6.981  83.032 1.00 23.21 ? 701 ARG C NH2 1 
ATOM   2299 N N   . ASN C 1 59  ? -93.022  14.598 87.645 1.00 19.17 ? 702 ASN C N   1 
ATOM   2300 C CA  . ASN C 1 59  ? -92.018  15.651 87.746 1.00 22.39 ? 702 ASN C CA  1 
ATOM   2301 C C   . ASN C 1 59  ? -90.618  15.070 87.613 1.00 23.28 ? 702 ASN C C   1 
ATOM   2302 O O   . ASN C 1 59  ? -90.301  14.047 88.221 1.00 24.75 ? 702 ASN C O   1 
ATOM   2303 C CB  . ASN C 1 59  ? -92.134  16.393 89.084 1.00 21.41 ? 702 ASN C CB  1 
ATOM   2304 C CG  . ASN C 1 59  ? -93.339  17.326 89.137 1.00 22.61 ? 702 ASN C CG  1 
ATOM   2305 O OD1 . ASN C 1 59  ? -94.488  16.885 89.097 1.00 24.73 ? 702 ASN C OD1 1 
ATOM   2306 N ND2 . ASN C 1 59  ? -93.076  18.622 89.224 1.00 19.69 ? 702 ASN C ND2 1 
ATOM   2307 N N   . LYS C 1 60  ? -89.794  15.732 86.806 1.00 25.05 ? 703 LYS C N   1 
ATOM   2308 C CA  . LYS C 1 60  ? -88.407  15.330 86.564 1.00 25.00 ? 703 LYS C CA  1 
ATOM   2309 C C   . LYS C 1 60  ? -87.547  16.564 86.785 1.00 24.46 ? 703 LYS C C   1 
ATOM   2310 O O   . LYS C 1 60  ? -87.829  17.623 86.219 1.00 25.17 ? 703 LYS C O   1 
ATOM   2311 C CB  . LYS C 1 60  ? -88.245  14.835 85.127 1.00 26.52 ? 703 LYS C CB  1 
ATOM   2312 C CG  . LYS C 1 60  ? -88.983  13.536 84.841 1.00 31.35 ? 703 LYS C CG  1 
ATOM   2313 C CD  . LYS C 1 60  ? -88.384  12.387 85.640 1.00 34.42 ? 703 LYS C CD  1 
ATOM   2314 C CE  . LYS C 1 60  ? -88.978  11.054 85.215 1.00 38.85 ? 703 LYS C CE  1 
ATOM   2315 N NZ  . LYS C 1 60  ? -88.242  9.888  85.797 1.00 40.75 ? 703 LYS C NZ  1 
ATOM   2316 N N   . ASN C 1 61  ? -86.504  16.436 87.600 1.00 22.55 ? 704 ASN C N   1 
ATOM   2317 C CA  . ASN C 1 61  ? -85.647  17.576 87.901 1.00 22.47 ? 704 ASN C CA  1 
ATOM   2318 C C   . ASN C 1 61  ? -84.219  17.477 87.362 1.00 23.72 ? 704 ASN C C   1 
ATOM   2319 O O   . ASN C 1 61  ? -83.606  16.406 87.360 1.00 23.03 ? 704 ASN C O   1 
ATOM   2320 C CB  . ASN C 1 61  ? -85.616  17.801 89.414 1.00 21.86 ? 704 ASN C CB  1 
ATOM   2321 C CG  . ASN C 1 61  ? -87.008  17.985 90.004 1.00 23.16 ? 704 ASN C CG  1 
ATOM   2322 O OD1 . ASN C 1 61  ? -87.410  17.262 90.917 1.00 23.14 ? 704 ASN C OD1 1 
ATOM   2323 N ND2 . ASN C 1 61  ? -87.750  18.951 89.480 1.00 22.21 ? 704 ASN C ND2 1 
ATOM   2324 N N   . ASP C 1 62  ? -83.704  18.615 86.906 1.00 23.01 ? 705 ASP C N   1 
ATOM   2325 C CA  . ASP C 1 62  ? -82.356  18.711 86.367 1.00 23.44 ? 705 ASP C CA  1 
ATOM   2326 C C   . ASP C 1 62  ? -81.960  17.564 85.449 1.00 23.93 ? 705 ASP C C   1 
ATOM   2327 O O   . ASP C 1 62  ? -81.188  16.687 85.827 1.00 24.30 ? 705 ASP C O   1 
ATOM   2328 C CB  . ASP C 1 62  ? -81.340  18.834 87.508 1.00 25.32 ? 705 ASP C CB  1 
ATOM   2329 C CG  . ASP C 1 62  ? -81.551  20.096 88.350 1.00 26.17 ? 705 ASP C CG  1 
ATOM   2330 O OD1 . ASP C 1 62  ? -81.844  21.165 87.775 1.00 24.58 ? 705 ASP C OD1 1 
ATOM   2331 O OD2 . ASP C 1 62  ? -81.409  20.020 89.587 1.00 27.76 ? 705 ASP C OD2 1 
ATOM   2332 N N   . LEU C 1 63  ? -82.477  17.587 84.229 1.00 23.21 ? 706 LEU C N   1 
ATOM   2333 C CA  . LEU C 1 63  ? -82.167  16.553 83.259 1.00 21.95 ? 706 LEU C CA  1 
ATOM   2334 C C   . LEU C 1 63  ? -81.158  17.060 82.237 1.00 23.19 ? 706 LEU C C   1 
ATOM   2335 O O   . LEU C 1 63  ? -81.195  18.229 81.829 1.00 21.98 ? 706 LEU C O   1 
ATOM   2336 C CB  . LEU C 1 63  ? -83.435  16.110 82.529 1.00 21.68 ? 706 LEU C CB  1 
ATOM   2337 C CG  . LEU C 1 63  ? -84.589  15.494 83.325 1.00 21.88 ? 706 LEU C CG  1 
ATOM   2338 C CD1 . LEU C 1 63  ? -85.679  15.070 82.339 1.00 22.75 ? 706 LEU C CD1 1 
ATOM   2339 C CD2 . LEU C 1 63  ? -84.107  14.297 84.141 1.00 18.76 ? 706 LEU C CD2 1 
ATOM   2340 N N   . THR C 1 64  ? -80.248  16.179 81.835 1.00 22.35 ? 707 THR C N   1 
ATOM   2341 C CA  . THR C 1 64  ? -79.248  16.532 80.836 1.00 21.79 ? 707 THR C CA  1 
ATOM   2342 C C   . THR C 1 64  ? -79.955  16.479 79.487 1.00 22.28 ? 707 THR C C   1 
ATOM   2343 O O   . THR C 1 64  ? -81.066  15.957 79.383 1.00 20.48 ? 707 THR C O   1 
ATOM   2344 C CB  . THR C 1 64  ? -78.087  15.514 80.807 1.00 21.30 ? 707 THR C CB  1 
ATOM   2345 O OG1 . THR C 1 64  ? -78.606  14.209 80.512 1.00 18.96 ? 707 THR C OG1 1 
ATOM   2346 C CG2 . THR C 1 64  ? -77.366  15.480 82.151 1.00 19.70 ? 707 THR C CG2 1 
ATOM   2347 N N   . ARG C 1 65  ? -79.316  17.026 78.463 1.00 24.20 ? 708 ARG C N   1 
ATOM   2348 C CA  . ARG C 1 65  ? -79.883  17.013 77.123 1.00 25.16 ? 708 ARG C CA  1 
ATOM   2349 C C   . ARG C 1 65  ? -80.228  15.576 76.761 1.00 24.04 ? 708 ARG C C   1 
ATOM   2350 O O   . ARG C 1 65  ? -81.295  15.305 76.208 1.00 24.77 ? 708 ARG C O   1 
ATOM   2351 C CB  . ARG C 1 65  ? -78.867  17.569 76.124 1.00 28.50 ? 708 ARG C CB  1 
ATOM   2352 C CG  . ARG C 1 65  ? -77.433  17.343 76.570 1.00 32.07 ? 708 ARG C CG  1 
ATOM   2353 C CD  . ARG C 1 65  ? -76.410  17.600 75.482 1.00 36.17 ? 708 ARG C CD  1 
ATOM   2354 N NE  . ARG C 1 65  ? -76.747  18.720 74.611 1.00 39.07 ? 708 ARG C NE  1 
ATOM   2355 C CZ  . ARG C 1 65  ? -75.875  19.301 73.793 1.00 41.25 ? 708 ARG C CZ  1 
ATOM   2356 N NH1 . ARG C 1 65  ? -74.617  18.874 73.749 1.00 41.89 ? 708 ARG C NH1 1 
ATOM   2357 N NH2 . ARG C 1 65  ? -76.263  20.284 72.996 1.00 41.53 ? 708 ARG C NH2 1 
ATOM   2358 N N   . GLU C 1 66  ? -79.324  14.654 77.083 1.00 23.28 ? 709 GLU C N   1 
ATOM   2359 C CA  . GLU C 1 66  ? -79.540  13.243 76.781 1.00 22.15 ? 709 GLU C CA  1 
ATOM   2360 C C   . GLU C 1 66  ? -80.760  12.678 77.501 1.00 20.77 ? 709 GLU C C   1 
ATOM   2361 O O   . GLU C 1 66  ? -81.563  11.952 76.912 1.00 21.17 ? 709 GLU C O   1 
ATOM   2362 C CB  . GLU C 1 66  ? -78.313  12.407 77.167 1.00 24.23 ? 709 GLU C CB  1 
ATOM   2363 C CG  . GLU C 1 66  ? -77.052  12.653 76.351 1.00 25.33 ? 709 GLU C CG  1 
ATOM   2364 C CD  . GLU C 1 66  ? -76.373  13.957 76.698 1.00 28.54 ? 709 GLU C CD  1 
ATOM   2365 O OE1 . GLU C 1 66  ? -76.280  14.278 77.901 1.00 28.30 ? 709 GLU C OE1 1 
ATOM   2366 O OE2 . GLU C 1 66  ? -75.917  14.654 75.768 1.00 33.79 ? 709 GLU C OE2 1 
ATOM   2367 N N   . GLU C 1 67  ? -80.899  13.007 78.780 1.00 20.42 ? 710 GLU C N   1 
ATOM   2368 C CA  . GLU C 1 67  ? -82.020  12.501 79.568 1.00 18.53 ? 710 GLU C CA  1 
ATOM   2369 C C   . GLU C 1 67  ? -83.376  13.038 79.120 1.00 18.19 ? 710 GLU C C   1 
ATOM   2370 O O   . GLU C 1 67  ? -84.376  12.324 79.182 1.00 18.82 ? 710 GLU C O   1 
ATOM   2371 C CB  . GLU C 1 67  ? -81.783  12.799 81.045 1.00 16.77 ? 710 GLU C CB  1 
ATOM   2372 C CG  . GLU C 1 67  ? -80.575  12.056 81.594 1.00 14.50 ? 710 GLU C CG  1 
ATOM   2373 C CD  . GLU C 1 67  ? -80.249  12.437 83.016 1.00 13.46 ? 710 GLU C CD  1 
ATOM   2374 O OE1 . GLU C 1 67  ? -80.215  13.650 83.318 1.00 15.92 ? 710 GLU C OE1 1 
ATOM   2375 O OE2 . GLU C 1 67  ? -80.017  11.522 83.835 1.00 17.81 ? 710 GLU C OE2 1 
ATOM   2376 N N   . ILE C 1 68  ? -83.401  14.289 78.670 1.00 16.91 ? 711 ILE C N   1 
ATOM   2377 C CA  . ILE C 1 68  ? -84.630  14.912 78.194 1.00 14.82 ? 711 ILE C CA  1 
ATOM   2378 C C   . ILE C 1 68  ? -85.095  14.131 76.971 1.00 16.60 ? 711 ILE C C   1 
ATOM   2379 O O   . ILE C 1 68  ? -86.241  13.688 76.900 1.00 15.39 ? 711 ILE C O   1 
ATOM   2380 C CB  . ILE C 1 68  ? -84.392  16.406 77.797 1.00 12.17 ? 711 ILE C CB  1 
ATOM   2381 C CG1 . ILE C 1 68  ? -84.297  17.278 79.056 1.00 10.71 ? 711 ILE C CG1 1 
ATOM   2382 C CG2 . ILE C 1 68  ? -85.517  16.901 76.907 1.00 11.62 ? 711 ILE C CG2 1 
ATOM   2383 C CD1 . ILE C 1 68  ? -83.977  18.743 78.784 1.00 11.77 ? 711 ILE C CD1 1 
ATOM   2384 N N   . VAL C 1 69  ? -84.188  13.965 76.012 1.00 17.48 ? 712 VAL C N   1 
ATOM   2385 C CA  . VAL C 1 69  ? -84.480  13.232 74.790 1.00 19.83 ? 712 VAL C CA  1 
ATOM   2386 C C   . VAL C 1 69  ? -84.897  11.803 75.112 1.00 22.50 ? 712 VAL C C   1 
ATOM   2387 O O   . VAL C 1 69  ? -85.910  11.309 74.608 1.00 23.38 ? 712 VAL C O   1 
ATOM   2388 C CB  . VAL C 1 69  ? -83.245  13.199 73.865 1.00 22.13 ? 712 VAL C CB  1 
ATOM   2389 C CG1 . VAL C 1 69  ? -83.432  12.161 72.758 1.00 19.69 ? 712 VAL C CG1 1 
ATOM   2390 C CG2 . VAL C 1 69  ? -83.024  14.588 73.263 1.00 21.43 ? 712 VAL C CG2 1 
ATOM   2391 N N   . GLU C 1 70  ? -84.119  11.148 75.967 1.00 23.91 ? 713 GLU C N   1 
ATOM   2392 C CA  . GLU C 1 70  ? -84.395  9.768  76.348 1.00 26.01 ? 713 GLU C CA  1 
ATOM   2393 C C   . GLU C 1 70  ? -85.779  9.618  76.967 1.00 24.51 ? 713 GLU C C   1 
ATOM   2394 O O   . GLU C 1 70  ? -86.518  8.683  76.643 1.00 21.76 ? 713 GLU C O   1 
ATOM   2395 C CB  . GLU C 1 70  ? -83.324  9.277  77.326 1.00 29.43 ? 713 GLU C CB  1 
ATOM   2396 C CG  . GLU C 1 70  ? -83.472  7.831  77.746 1.00 37.35 ? 713 GLU C CG  1 
ATOM   2397 C CD  . GLU C 1 70  ? -82.298  7.348  78.593 1.00 43.34 ? 713 GLU C CD  1 
ATOM   2398 O OE1 . GLU C 1 70  ? -82.306  6.159  78.990 1.00 45.49 ? 713 GLU C OE1 1 
ATOM   2399 O OE2 . GLU C 1 70  ? -81.371  8.153  78.856 1.00 42.67 ? 713 GLU C OE2 1 
ATOM   2400 N N   . LEU C 1 71  ? -86.120  10.544 77.861 1.00 22.14 ? 714 LEU C N   1 
ATOM   2401 C CA  . LEU C 1 71  ? -87.414  10.528 78.533 1.00 21.20 ? 714 LEU C CA  1 
ATOM   2402 C C   . LEU C 1 71  ? -88.556  10.714 77.541 1.00 20.88 ? 714 LEU C C   1 
ATOM   2403 O O   . LEU C 1 71  ? -89.547  9.984  77.570 1.00 19.15 ? 714 LEU C O   1 
ATOM   2404 C CB  . LEU C 1 71  ? -87.487  11.640 79.585 1.00 20.13 ? 714 LEU C CB  1 
ATOM   2405 C CG  . LEU C 1 71  ? -88.848  11.835 80.272 1.00 21.07 ? 714 LEU C CG  1 
ATOM   2406 C CD1 . LEU C 1 71  ? -89.226  10.583 81.058 1.00 16.71 ? 714 LEU C CD1 1 
ATOM   2407 C CD2 . LEU C 1 71  ? -88.785  13.040 81.200 1.00 19.05 ? 714 LEU C CD2 1 
ATOM   2408 N N   . MET C 1 72  ? -88.406  11.701 76.667 1.00 20.91 ? 715 MET C N   1 
ATOM   2409 C CA  . MET C 1 72  ? -89.427  12.000 75.679 1.00 21.43 ? 715 MET C CA  1 
ATOM   2410 C C   . MET C 1 72  ? -89.642  10.833 74.728 1.00 22.84 ? 715 MET C C   1 
ATOM   2411 O O   . MET C 1 72  ? -90.774  10.548 74.343 1.00 21.54 ? 715 MET C O   1 
ATOM   2412 C CB  . MET C 1 72  ? -89.052  13.268 74.905 1.00 21.60 ? 715 MET C CB  1 
ATOM   2413 C CG  . MET C 1 72  ? -89.091  14.531 75.751 1.00 22.80 ? 715 MET C CG  1 
ATOM   2414 S SD  . MET C 1 72  ? -90.715  14.794 76.518 1.00 30.25 ? 715 MET C SD  1 
ATOM   2415 C CE  . MET C 1 72  ? -90.488  14.034 78.097 1.00 22.44 ? 715 MET C CE  1 
ATOM   2416 N N   . ARG C 1 73  ? -88.560  10.156 74.354 1.00 24.47 ? 716 ARG C N   1 
ATOM   2417 C CA  . ARG C 1 73  ? -88.663  9.014  73.454 1.00 26.24 ? 716 ARG C CA  1 
ATOM   2418 C C   . ARG C 1 73  ? -89.479  7.914  74.132 1.00 25.29 ? 716 ARG C C   1 
ATOM   2419 O O   . ARG C 1 73  ? -90.427  7.394  73.558 1.00 25.47 ? 716 ARG C O   1 
ATOM   2420 C CB  . ARG C 1 73  ? -87.271  8.481  73.096 1.00 27.62 ? 716 ARG C CB  1 
ATOM   2421 C CG  . ARG C 1 73  ? -87.292  7.417  72.004 1.00 32.74 ? 716 ARG C CG  1 
ATOM   2422 C CD  . ARG C 1 73  ? -85.931  6.748  71.793 1.00 36.37 ? 716 ARG C CD  1 
ATOM   2423 N NE  . ARG C 1 73  ? -85.500  5.986  72.965 1.00 41.08 ? 716 ARG C NE  1 
ATOM   2424 C CZ  . ARG C 1 73  ? -84.872  6.511  74.016 1.00 42.73 ? 716 ARG C CZ  1 
ATOM   2425 N NH1 . ARG C 1 73  ? -84.591  7.809  74.043 1.00 45.09 ? 716 ARG C NH1 1 
ATOM   2426 N NH2 . ARG C 1 73  ? -84.533  5.741  75.044 1.00 41.38 ? 716 ARG C NH2 1 
ATOM   2427 N N   . ASP C 1 74  ? -89.100  7.573  75.359 1.00 24.55 ? 717 ASP C N   1 
ATOM   2428 C CA  . ASP C 1 74  ? -89.787  6.549  76.136 1.00 24.06 ? 717 ASP C CA  1 
ATOM   2429 C C   . ASP C 1 74  ? -91.267  6.867  76.325 1.00 25.45 ? 717 ASP C C   1 
ATOM   2430 O O   . ASP C 1 74  ? -92.122  6.004  76.127 1.00 26.60 ? 717 ASP C O   1 
ATOM   2431 C CB  . ASP C 1 74  ? -89.143  6.413  77.515 1.00 26.01 ? 717 ASP C CB  1 
ATOM   2432 C CG  . ASP C 1 74  ? -87.824  5.664  77.480 1.00 28.75 ? 717 ASP C CG  1 
ATOM   2433 O OD1 . ASP C 1 74  ? -87.011  5.909  76.567 1.00 31.49 ? 717 ASP C OD1 1 
ATOM   2434 O OD2 . ASP C 1 74  ? -87.595  4.833  78.383 1.00 32.60 ? 717 ASP C OD2 1 
ATOM   2435 N N   . VAL C 1 75  ? -91.571  8.102  76.717 1.00 24.83 ? 718 VAL C N   1 
ATOM   2436 C CA  . VAL C 1 75  ? -92.957  8.493  76.943 1.00 23.68 ? 718 VAL C CA  1 
ATOM   2437 C C   . VAL C 1 75  ? -93.790  8.314  75.682 1.00 23.63 ? 718 VAL C C   1 
ATOM   2438 O O   . VAL C 1 75  ? -94.916  7.808  75.740 1.00 22.56 ? 718 VAL C O   1 
ATOM   2439 C CB  . VAL C 1 75  ? -93.063  9.965  77.425 1.00 24.14 ? 718 VAL C CB  1 
ATOM   2440 C CG1 . VAL C 1 75  ? -94.529  10.368 77.580 1.00 21.12 ? 718 VAL C CG1 1 
ATOM   2441 C CG2 . VAL C 1 75  ? -92.341  10.120 78.765 1.00 24.87 ? 718 VAL C CG2 1 
ATOM   2442 N N   . SER C 1 76  ? -93.225  8.720  74.547 1.00 23.71 ? 719 SER C N   1 
ATOM   2443 C CA  . SER C 1 76  ? -93.904  8.612  73.257 1.00 25.02 ? 719 SER C CA  1 
ATOM   2444 C C   . SER C 1 76  ? -94.080  7.154  72.851 1.00 26.77 ? 719 SER C C   1 
ATOM   2445 O O   . SER C 1 76  ? -94.944  6.829  72.035 1.00 25.73 ? 719 SER C O   1 
ATOM   2446 C CB  . SER C 1 76  ? -93.101  9.327  72.171 1.00 24.88 ? 719 SER C CB  1 
ATOM   2447 O OG  . SER C 1 76  ? -91.972  8.556  71.794 1.00 26.00 ? 719 SER C OG  1 
ATOM   2448 N N   . LYS C 1 77  ? -93.251  6.278  73.413 1.00 27.88 ? 720 LYS C N   1 
ATOM   2449 C CA  . LYS C 1 77  ? -93.326  4.859  73.094 1.00 30.39 ? 720 LYS C CA  1 
ATOM   2450 C C   . LYS C 1 77  ? -94.312  4.136  74.003 1.00 30.26 ? 720 LYS C C   1 
ATOM   2451 O O   . LYS C 1 77  ? -94.601  2.955  73.807 1.00 29.78 ? 720 LYS C O   1 
ATOM   2452 C CB  . LYS C 1 77  ? -91.936  4.221  73.184 1.00 33.43 ? 720 LYS C CB  1 
ATOM   2453 C CG  . LYS C 1 77  ? -90.980  4.691  72.083 1.00 36.37 ? 720 LYS C CG  1 
ATOM   2454 C CD  . LYS C 1 77  ? -89.600  4.059  72.218 1.00 39.70 ? 720 LYS C CD  1 
ATOM   2455 C CE  . LYS C 1 77  ? -89.669  2.543  72.102 1.00 41.14 ? 720 LYS C CE  1 
ATOM   2456 N NZ  . LYS C 1 77  ? -88.338  1.908  72.319 1.00 43.04 ? 720 LYS C NZ  1 
ATOM   2457 N N   . GLU C 1 78  ? -94.821  4.848  75.003 1.00 28.41 ? 721 GLU C N   1 
ATOM   2458 C CA  . GLU C 1 78  ? -95.803  4.273  75.909 1.00 26.79 ? 721 GLU C CA  1 
ATOM   2459 C C   . GLU C 1 78  ? -97.110  4.137  75.136 1.00 24.96 ? 721 GLU C C   1 
ATOM   2460 O O   . GLU C 1 78  ? -97.260  4.714  74.062 1.00 24.26 ? 721 GLU C O   1 
ATOM   2461 C CB  . GLU C 1 78  ? -96.025  5.186  77.117 1.00 25.98 ? 721 GLU C CB  1 
ATOM   2462 C CG  . GLU C 1 78  ? -95.231  4.810  78.349 1.00 28.42 ? 721 GLU C CG  1 
ATOM   2463 C CD  . GLU C 1 78  ? -95.574  5.674  79.549 1.00 28.68 ? 721 GLU C CD  1 
ATOM   2464 O OE1 . GLU C 1 78  ? -96.767  6.009  79.726 1.00 31.18 ? 721 GLU C OE1 1 
ATOM   2465 O OE2 . GLU C 1 78  ? -94.655  6.002  80.327 1.00 28.58 ? 721 GLU C OE2 1 
ATOM   2466 N N   . ASP C 1 79  ? -98.048  3.368  75.676 1.00 24.74 ? 722 ASP C N   1 
ATOM   2467 C CA  . ASP C 1 79  ? -99.340  3.195  75.027 1.00 24.65 ? 722 ASP C CA  1 
ATOM   2468 C C   . ASP C 1 79  ? -100.335 4.188  75.623 1.00 23.05 ? 722 ASP C C   1 
ATOM   2469 O O   . ASP C 1 79  ? -100.734 4.053  76.778 1.00 20.87 ? 722 ASP C O   1 
ATOM   2470 C CB  . ASP C 1 79  ? -99.852  1.768  75.216 1.00 26.84 ? 722 ASP C CB  1 
ATOM   2471 C CG  . ASP C 1 79  ? -101.185 1.538  74.525 1.00 30.49 ? 722 ASP C CG  1 
ATOM   2472 O OD1 . ASP C 1 79  ? -101.438 2.191  73.493 1.00 30.20 ? 722 ASP C OD1 1 
ATOM   2473 O OD2 . ASP C 1 79  ? -101.978 0.702  75.003 1.00 34.15 ? 722 ASP C OD2 1 
ATOM   2474 N N   . HIS C 1 80  ? -100.726 5.183  74.826 1.00 21.50 ? 724 HIS C N   1 
ATOM   2475 C CA  . HIS C 1 80  ? -101.653 6.222  75.268 1.00 20.97 ? 724 HIS C CA  1 
ATOM   2476 C C   . HIS C 1 80  ? -103.097 5.955  74.863 1.00 20.91 ? 724 HIS C C   1 
ATOM   2477 O O   . HIS C 1 80  ? -103.954 6.830  74.998 1.00 18.76 ? 724 HIS C O   1 
ATOM   2478 C CB  . HIS C 1 80  ? -101.213 7.571  74.695 1.00 21.10 ? 724 HIS C CB  1 
ATOM   2479 C CG  . HIS C 1 80  ? -99.857  8.006  75.154 1.00 21.27 ? 724 HIS C CG  1 
ATOM   2480 N ND1 . HIS C 1 80  ? -99.659  8.713  76.322 1.00 20.69 ? 724 HIS C ND1 1 
ATOM   2481 C CD2 . HIS C 1 80  ? -98.631  7.809  74.618 1.00 20.82 ? 724 HIS C CD2 1 
ATOM   2482 C CE1 . HIS C 1 80  ? -98.367  8.932  76.484 1.00 21.04 ? 724 HIS C CE1 1 
ATOM   2483 N NE2 . HIS C 1 80  ? -97.720  8.395  75.466 1.00 22.62 ? 724 HIS C NE2 1 
ATOM   2484 N N   . SER C 1 81  ? -103.361 4.746  74.381 1.00 21.64 ? 725 SER C N   1 
ATOM   2485 C CA  . SER C 1 81  ? -104.699 4.360  73.938 1.00 23.09 ? 725 SER C CA  1 
ATOM   2486 C C   . SER C 1 81  ? -105.826 4.772  74.877 1.00 22.35 ? 725 SER C C   1 
ATOM   2487 O O   . SER C 1 81  ? -106.852 5.277  74.429 1.00 23.17 ? 725 SER C O   1 
ATOM   2488 C CB  . SER C 1 81  ? -104.754 2.848  73.707 1.00 24.48 ? 725 SER C CB  1 
ATOM   2489 O OG  . SER C 1 81  ? -103.951 2.487  72.590 1.00 28.35 ? 725 SER C OG  1 
ATOM   2490 N N   . LYS C 1 82  ? -105.637 4.558  76.174 1.00 21.79 ? 726 LYS C N   1 
ATOM   2491 C CA  . LYS C 1 82  ? -106.653 4.913  77.159 1.00 23.70 ? 726 LYS C CA  1 
ATOM   2492 C C   . LYS C 1 82  ? -106.539 6.343  77.679 1.00 22.74 ? 726 LYS C C   1 
ATOM   2493 O O   . LYS C 1 82  ? -107.162 6.692  78.684 1.00 22.23 ? 726 LYS C O   1 
ATOM   2494 C CB  . LYS C 1 82  ? -106.602 3.944  78.347 1.00 27.32 ? 726 LYS C CB  1 
ATOM   2495 C CG  . LYS C 1 82  ? -107.284 2.602  78.099 1.00 31.31 ? 726 LYS C CG  1 
ATOM   2496 C CD  . LYS C 1 82  ? -106.622 1.833  76.968 1.00 36.01 ? 726 LYS C CD  1 
ATOM   2497 C CE  . LYS C 1 82  ? -107.384 0.548  76.646 1.00 38.81 ? 726 LYS C CE  1 
ATOM   2498 N NZ  . LYS C 1 82  ? -106.726 -0.233 75.560 1.00 39.96 ? 726 LYS C NZ  1 
ATOM   2499 N N   . ARG C 1 83  ? -105.752 7.170  76.995 1.00 20.58 ? 727 ARG C N   1 
ATOM   2500 C CA  . ARG C 1 83  ? -105.562 8.556  77.410 1.00 20.00 ? 727 ARG C CA  1 
ATOM   2501 C C   . ARG C 1 83  ? -106.177 9.543  76.424 1.00 19.75 ? 727 ARG C C   1 
ATOM   2502 O O   . ARG C 1 83  ? -106.103 9.356  75.211 1.00 19.97 ? 727 ARG C O   1 
ATOM   2503 C CB  . ARG C 1 83  ? -104.067 8.841  77.583 1.00 19.86 ? 727 ARG C CB  1 
ATOM   2504 C CG  . ARG C 1 83  ? -103.448 8.033  78.708 1.00 20.76 ? 727 ARG C CG  1 
ATOM   2505 C CD  . ARG C 1 83  ? -101.932 7.990  78.627 1.00 21.94 ? 727 ARG C CD  1 
ATOM   2506 N NE  . ARG C 1 83  ? -101.396 7.102  79.654 1.00 22.49 ? 727 ARG C NE  1 
ATOM   2507 C CZ  . ARG C 1 83  ? -100.182 6.565  79.636 1.00 19.78 ? 727 ARG C CZ  1 
ATOM   2508 N NH1 . ARG C 1 83  ? -99.344  6.815  78.639 1.00 16.72 ? 727 ARG C NH1 1 
ATOM   2509 N NH2 . ARG C 1 83  ? -99.816  5.758  80.620 1.00 20.12 ? 727 ARG C NH2 1 
ATOM   2510 N N   . SER C 1 84  ? -106.775 10.603 76.954 1.00 18.54 ? 728 SER C N   1 
ATOM   2511 C CA  . SER C 1 84  ? -107.419 11.606 76.113 1.00 19.02 ? 728 SER C CA  1 
ATOM   2512 C C   . SER C 1 84  ? -106.430 12.560 75.458 1.00 20.54 ? 728 SER C C   1 
ATOM   2513 O O   . SER C 1 84  ? -106.642 13.005 74.331 1.00 20.56 ? 728 SER C O   1 
ATOM   2514 C CB  . SER C 1 84  ? -108.422 12.423 76.933 1.00 18.58 ? 728 SER C CB  1 
ATOM   2515 O OG  . SER C 1 84  ? -109.401 11.590 77.527 1.00 18.51 ? 728 SER C OG  1 
ATOM   2516 N N   . SER C 1 85  ? -105.346 12.871 76.161 1.00 19.77 ? 729 SER C N   1 
ATOM   2517 C CA  . SER C 1 85  ? -104.369 13.812 75.629 1.00 18.72 ? 729 SER C CA  1 
ATOM   2518 C C   . SER C 1 85  ? -102.982 13.622 76.212 1.00 18.16 ? 729 SER C C   1 
ATOM   2519 O O   . SER C 1 85  ? -102.726 12.670 76.946 1.00 17.42 ? 729 SER C O   1 
ATOM   2520 C CB  . SER C 1 85  ? -104.822 15.234 75.935 1.00 18.05 ? 729 SER C CB  1 
ATOM   2521 O OG  . SER C 1 85  ? -104.919 15.408 77.338 1.00 18.02 ? 729 SER C OG  1 
ATOM   2522 N N   . PHE C 1 86  ? -102.099 14.559 75.879 1.00 16.86 ? 730 PHE C N   1 
ATOM   2523 C CA  . PHE C 1 86  ? -100.728 14.541 76.368 1.00 16.14 ? 730 PHE C CA  1 
ATOM   2524 C C   . PHE C 1 86  ? -100.234 15.946 76.680 1.00 15.24 ? 730 PHE C C   1 
ATOM   2525 O O   . PHE C 1 86  ? -100.412 16.859 75.885 1.00 16.58 ? 730 PHE C O   1 
ATOM   2526 C CB  . PHE C 1 86  ? -99.784  13.922 75.340 1.00 12.97 ? 730 PHE C CB  1 
ATOM   2527 C CG  . PHE C 1 86  ? -98.343  13.949 75.770 1.00 16.30 ? 730 PHE C CG  1 
ATOM   2528 C CD1 . PHE C 1 86  ? -97.912  13.175 76.851 1.00 16.77 ? 730 PHE C CD1 1 
ATOM   2529 C CD2 . PHE C 1 86  ? -97.424  14.771 75.130 1.00 13.66 ? 730 PHE C CD2 1 
ATOM   2530 C CE1 . PHE C 1 86  ? -96.587  13.226 77.284 1.00 16.56 ? 730 PHE C CE1 1 
ATOM   2531 C CE2 . PHE C 1 86  ? -96.103  14.827 75.556 1.00 12.52 ? 730 PHE C CE2 1 
ATOM   2532 C CZ  . PHE C 1 86  ? -95.683  14.053 76.635 1.00 14.42 ? 730 PHE C CZ  1 
ATOM   2533 N N   . VAL C 1 87  ? -99.599  16.108 77.834 1.00 14.89 ? 731 VAL C N   1 
ATOM   2534 C CA  . VAL C 1 87  ? -99.060  17.402 78.237 1.00 11.94 ? 731 VAL C CA  1 
ATOM   2535 C C   . VAL C 1 87  ? -97.605  17.285 78.657 1.00 12.34 ? 731 VAL C C   1 
ATOM   2536 O O   . VAL C 1 87  ? -97.229  16.382 79.413 1.00 11.07 ? 731 VAL C O   1 
ATOM   2537 C CB  . VAL C 1 87  ? -99.820  18.011 79.436 1.00 11.75 ? 731 VAL C CB  1 
ATOM   2538 C CG1 . VAL C 1 87  ? -99.231  19.373 79.778 1.00 8.72  ? 731 VAL C CG1 1 
ATOM   2539 C CG2 . VAL C 1 87  ? -101.299 18.138 79.114 1.00 12.27 ? 731 VAL C CG2 1 
ATOM   2540 N N   . CYS C 1 88  ? -96.794  18.205 78.152 1.00 11.08 ? 732 CYS C N   1 
ATOM   2541 C CA  . CYS C 1 88  ? -95.386  18.266 78.489 1.00 11.48 ? 732 CYS C CA  1 
ATOM   2542 C C   . CYS C 1 88  ? -95.089  19.717 78.843 1.00 12.04 ? 732 CYS C C   1 
ATOM   2543 O O   . CYS C 1 88  ? -95.453  20.631 78.100 1.00 11.58 ? 732 CYS C O   1 
ATOM   2544 C CB  . CYS C 1 88  ? -94.514  17.850 77.304 1.00 12.69 ? 732 CYS C CB  1 
ATOM   2545 S SG  . CYS C 1 88  ? -92.730  18.041 77.636 1.00 16.99 ? 732 CYS C SG  1 
ATOM   2546 N N   . VAL C 1 89  ? -94.459  19.927 79.992 1.00 13.09 ? 733 VAL C N   1 
ATOM   2547 C CA  . VAL C 1 89  ? -94.104  21.272 80.424 1.00 13.50 ? 733 VAL C CA  1 
ATOM   2548 C C   . VAL C 1 89  ? -92.589  21.306 80.592 1.00 13.35 ? 733 VAL C C   1 
ATOM   2549 O O   . VAL C 1 89  ? -92.005  20.453 81.264 1.00 12.80 ? 733 VAL C O   1 
ATOM   2550 C CB  . VAL C 1 89  ? -94.745  21.653 81.777 1.00 11.87 ? 733 VAL C CB  1 
ATOM   2551 C CG1 . VAL C 1 89  ? -94.452  23.112 82.091 1.00 12.83 ? 733 VAL C CG1 1 
ATOM   2552 C CG2 . VAL C 1 89  ? -96.230  21.413 81.745 1.00 14.31 ? 733 VAL C CG2 1 
ATOM   2553 N N   . LEU C 1 90  ? -91.970  22.297 79.968 1.00 13.43 ? 734 LEU C N   1 
ATOM   2554 C CA  . LEU C 1 90  ? -90.530  22.472 80.023 1.00 12.81 ? 734 LEU C CA  1 
ATOM   2555 C C   . LEU C 1 90  ? -90.193  23.787 80.713 1.00 13.32 ? 734 LEU C C   1 
ATOM   2556 O O   . LEU C 1 90  ? -90.583  24.867 80.253 1.00 12.86 ? 734 LEU C O   1 
ATOM   2557 C CB  . LEU C 1 90  ? -89.961  22.483 78.608 1.00 14.03 ? 734 LEU C CB  1 
ATOM   2558 C CG  . LEU C 1 90  ? -90.381  21.302 77.730 1.00 12.99 ? 734 LEU C CG  1 
ATOM   2559 C CD1 . LEU C 1 90  ? -89.961  21.574 76.285 1.00 15.39 ? 734 LEU C CD1 1 
ATOM   2560 C CD2 . LEU C 1 90  ? -89.775  20.017 78.257 1.00 11.42 ? 734 LEU C CD2 1 
ATOM   2561 N N   . LEU C 1 91  ? -89.465  23.691 81.819 1.00 14.02 ? 735 LEU C N   1 
ATOM   2562 C CA  . LEU C 1 91  ? -89.054  24.868 82.577 1.00 14.92 ? 735 LEU C CA  1 
ATOM   2563 C C   . LEU C 1 91  ? -87.533  24.936 82.501 1.00 15.93 ? 735 LEU C C   1 
ATOM   2564 O O   . LEU C 1 91  ? -86.848  24.078 83.054 1.00 16.00 ? 735 LEU C O   1 
ATOM   2565 C CB  . LEU C 1 91  ? -89.492  24.724 84.031 1.00 13.57 ? 735 LEU C CB  1 
ATOM   2566 C CG  . LEU C 1 91  ? -90.953  24.346 84.286 1.00 15.25 ? 735 LEU C CG  1 
ATOM   2567 C CD1 . LEU C 1 91  ? -91.180  24.193 85.780 1.00 15.01 ? 735 LEU C CD1 1 
ATOM   2568 C CD2 . LEU C 1 91  ? -91.876  25.420 83.706 1.00 13.62 ? 735 LEU C CD2 1 
ATOM   2569 N N   . SER C 1 92  ? -86.993  25.941 81.822 1.00 16.14 ? 736 SER C N   1 
ATOM   2570 C CA  . SER C 1 92  ? -85.543  26.023 81.715 1.00 17.07 ? 736 SER C CA  1 
ATOM   2571 C C   . SER C 1 92  ? -85.086  27.245 80.944 1.00 17.14 ? 736 SER C C   1 
ATOM   2572 O O   . SER C 1 92  ? -85.877  28.136 80.645 1.00 18.21 ? 736 SER C O   1 
ATOM   2573 C CB  . SER C 1 92  ? -85.023  24.763 81.010 1.00 18.50 ? 736 SER C CB  1 
ATOM   2574 O OG  . SER C 1 92  ? -83.610  24.740 80.916 1.00 18.71 ? 736 SER C OG  1 
ATOM   2575 N N   . HIS C 1 93  ? -83.789  27.279 80.646 1.00 16.62 ? 737 HIS C N   1 
ATOM   2576 C CA  . HIS C 1 93  ? -83.202  28.340 79.846 1.00 14.16 ? 737 HIS C CA  1 
ATOM   2577 C C   . HIS C 1 93  ? -83.455  27.902 78.405 1.00 15.23 ? 737 HIS C C   1 
ATOM   2578 O O   . HIS C 1 93  ? -83.691  26.711 78.140 1.00 11.82 ? 737 HIS C O   1 
ATOM   2579 C CB  . HIS C 1 93  ? -81.690  28.431 80.084 1.00 15.63 ? 737 HIS C CB  1 
ATOM   2580 C CG  . HIS C 1 93  ? -81.313  29.114 81.362 1.00 14.79 ? 737 HIS C CG  1 
ATOM   2581 N ND1 . HIS C 1 93  ? -81.514  30.461 81.572 1.00 16.10 ? 737 HIS C ND1 1 
ATOM   2582 C CD2 . HIS C 1 93  ? -80.743  28.637 82.495 1.00 15.67 ? 737 HIS C CD2 1 
ATOM   2583 C CE1 . HIS C 1 93  ? -81.083  30.785 82.778 1.00 16.57 ? 737 HIS C CE1 1 
ATOM   2584 N NE2 . HIS C 1 93  ? -80.610  29.697 83.359 1.00 15.95 ? 737 HIS C NE2 1 
ATOM   2585 N N   . GLY C 1 94  ? -83.405  28.851 77.478 1.00 13.31 ? 738 GLY C N   1 
ATOM   2586 C CA  . GLY C 1 94  ? -83.633  28.516 76.090 1.00 15.97 ? 738 GLY C CA  1 
ATOM   2587 C C   . GLY C 1 94  ? -83.335  29.643 75.129 1.00 15.16 ? 738 GLY C C   1 
ATOM   2588 O O   . GLY C 1 94  ? -83.033  30.762 75.549 1.00 14.76 ? 738 GLY C O   1 
ATOM   2589 N N   . GLU C 1 95  ? -83.417  29.323 73.838 1.00 15.47 ? 739 GLU C N   1 
ATOM   2590 C CA  . GLU C 1 95  ? -83.186  30.259 72.739 1.00 16.37 ? 739 GLU C CA  1 
ATOM   2591 C C   . GLU C 1 95  ? -84.308  29.932 71.783 1.00 16.54 ? 739 GLU C C   1 
ATOM   2592 O O   . GLU C 1 95  ? -85.126  29.074 72.082 1.00 17.74 ? 739 GLU C O   1 
ATOM   2593 C CB  . GLU C 1 95  ? -81.861  29.973 72.027 1.00 16.72 ? 739 GLU C CB  1 
ATOM   2594 C CG  . GLU C 1 95  ? -80.616  30.110 72.863 1.00 21.91 ? 739 GLU C CG  1 
ATOM   2595 C CD  . GLU C 1 95  ? -79.392  29.556 72.141 1.00 26.71 ? 739 GLU C CD  1 
ATOM   2596 O OE1 . GLU C 1 95  ? -79.289  29.737 70.907 1.00 29.69 ? 739 GLU C OE1 1 
ATOM   2597 O OE2 . GLU C 1 95  ? -78.530  28.946 72.804 1.00 28.38 ? 739 GLU C OE2 1 
ATOM   2598 N N   . GLU C 1 96  ? -84.344  30.584 70.628 1.00 16.91 ? 740 GLU C N   1 
ATOM   2599 C CA  . GLU C 1 96  ? -85.402  30.301 69.671 1.00 18.05 ? 740 GLU C CA  1 
ATOM   2600 C C   . GLU C 1 96  ? -85.371  28.827 69.254 1.00 19.56 ? 740 GLU C C   1 
ATOM   2601 O O   . GLU C 1 96  ? -84.346  28.324 68.796 1.00 20.07 ? 740 GLU C O   1 
ATOM   2602 C CB  . GLU C 1 96  ? -85.267  31.185 68.431 1.00 17.51 ? 740 GLU C CB  1 
ATOM   2603 C CG  . GLU C 1 96  ? -86.459  31.060 67.491 1.00 17.20 ? 740 GLU C CG  1 
ATOM   2604 C CD  . GLU C 1 96  ? -87.774  31.396 68.181 1.00 19.13 ? 740 GLU C CD  1 
ATOM   2605 O OE1 . GLU C 1 96  ? -88.017  32.590 68.461 1.00 20.42 ? 740 GLU C OE1 1 
ATOM   2606 O OE2 . GLU C 1 96  ? -88.563  30.467 68.455 1.00 20.79 ? 740 GLU C OE2 1 
ATOM   2607 N N   . GLY C 1 97  ? -86.499  28.143 69.433 1.00 20.27 ? 741 GLY C N   1 
ATOM   2608 C CA  . GLY C 1 97  ? -86.600  26.741 69.064 1.00 18.99 ? 741 GLY C CA  1 
ATOM   2609 C C   . GLY C 1 97  ? -85.672  25.815 69.828 1.00 19.42 ? 741 GLY C C   1 
ATOM   2610 O O   . GLY C 1 97  ? -85.394  24.703 69.382 1.00 18.73 ? 741 GLY C O   1 
ATOM   2611 N N   . ILE C 1 98  ? -85.214  26.255 70.995 1.00 19.36 ? 742 ILE C N   1 
ATOM   2612 C CA  . ILE C 1 98  ? -84.297  25.457 71.795 1.00 19.98 ? 742 ILE C CA  1 
ATOM   2613 C C   . ILE C 1 98  ? -84.557  25.527 73.297 1.00 20.92 ? 742 ILE C C   1 
ATOM   2614 O O   . ILE C 1 98  ? -84.975  26.560 73.823 1.00 22.18 ? 742 ILE C O   1 
ATOM   2615 C CB  . ILE C 1 98  ? -82.831  25.907 71.536 1.00 20.68 ? 742 ILE C CB  1 
ATOM   2616 C CG1 . ILE C 1 98  ? -82.381  25.435 70.148 1.00 21.66 ? 742 ILE C CG1 1 
ATOM   2617 C CG2 . ILE C 1 98  ? -81.910  25.377 72.627 1.00 20.65 ? 742 ILE C CG2 1 
ATOM   2618 C CD1 . ILE C 1 98  ? -81.021  25.968 69.728 1.00 22.05 ? 742 ILE C CD1 1 
ATOM   2619 N N   . ILE C 1 99  ? -84.315  24.414 73.978 1.00 19.36 ? 743 ILE C N   1 
ATOM   2620 C CA  . ILE C 1 99  ? -84.449  24.360 75.423 1.00 20.46 ? 743 ILE C CA  1 
ATOM   2621 C C   . ILE C 1 99  ? -83.194  23.673 75.935 1.00 19.84 ? 743 ILE C C   1 
ATOM   2622 O O   . ILE C 1 99  ? -82.686  22.739 75.308 1.00 18.89 ? 743 ILE C O   1 
ATOM   2623 C CB  . ILE C 1 99  ? -85.715  23.605 75.876 1.00 21.24 ? 743 ILE C CB  1 
ATOM   2624 C CG1 . ILE C 1 99  ? -85.788  22.228 75.218 1.00 21.83 ? 743 ILE C CG1 1 
ATOM   2625 C CG2 . ILE C 1 99  ? -86.938  24.445 75.568 1.00 24.23 ? 743 ILE C CG2 1 
ATOM   2626 C CD1 . ILE C 1 99  ? -85.110  21.146 76.016 1.00 23.46 ? 743 ILE C CD1 1 
ATOM   2627 N N   . PHE C 1 100 ? -82.690  24.145 77.069 1.00 19.67 ? 744 PHE C N   1 
ATOM   2628 C CA  . PHE C 1 100 ? -81.465  23.597 77.627 1.00 20.46 ? 744 PHE C CA  1 
ATOM   2629 C C   . PHE C 1 100 ? -81.585  22.505 78.664 1.00 19.81 ? 744 PHE C C   1 
ATOM   2630 O O   . PHE C 1 100 ? -82.403  22.580 79.582 1.00 18.42 ? 744 PHE C O   1 
ATOM   2631 C CB  . PHE C 1 100 ? -80.602  24.710 78.231 1.00 20.88 ? 744 PHE C CB  1 
ATOM   2632 C CG  . PHE C 1 100 ? -79.855  25.518 77.216 1.00 24.03 ? 744 PHE C CG  1 
ATOM   2633 C CD1 . PHE C 1 100 ? -80.497  26.513 76.488 1.00 23.53 ? 744 PHE C CD1 1 
ATOM   2634 C CD2 . PHE C 1 100 ? -78.510  25.262 76.961 1.00 25.39 ? 744 PHE C CD2 1 
ATOM   2635 C CE1 . PHE C 1 100 ? -79.812  27.236 75.521 1.00 25.41 ? 744 PHE C CE1 1 
ATOM   2636 C CE2 . PHE C 1 100 ? -77.821  25.982 75.995 1.00 25.93 ? 744 PHE C CE2 1 
ATOM   2637 C CZ  . PHE C 1 100 ? -78.474  26.969 75.274 1.00 24.70 ? 744 PHE C CZ  1 
ATOM   2638 N N   . GLY C 1 101 ? -80.768  21.472 78.485 1.00 19.26 ? 745 GLY C N   1 
ATOM   2639 C CA  . GLY C 1 101 ? -80.700  20.408 79.465 1.00 18.05 ? 745 GLY C CA  1 
ATOM   2640 C C   . GLY C 1 101 ? -79.683  21.007 80.427 1.00 17.52 ? 745 GLY C C   1 
ATOM   2641 O O   . GLY C 1 101 ? -79.075  22.034 80.118 1.00 15.72 ? 745 GLY C O   1 
ATOM   2642 N N   . THR C 1 102 ? -79.484  20.407 81.588 1.00 18.36 ? 746 THR C N   1 
ATOM   2643 C CA  . THR C 1 102 ? -78.528  20.967 82.527 1.00 19.15 ? 746 THR C CA  1 
ATOM   2644 C C   . THR C 1 102 ? -77.124  21.081 81.931 1.00 20.58 ? 746 THR C C   1 
ATOM   2645 O O   . THR C 1 102 ? -76.302  21.862 82.413 1.00 21.27 ? 746 THR C O   1 
ATOM   2646 C CB  . THR C 1 102 ? -78.439  20.110 83.786 1.00 18.81 ? 746 THR C CB  1 
ATOM   2647 O OG1 . THR C 1 102 ? -77.995  18.793 83.428 1.00 22.16 ? 746 THR C OG1 1 
ATOM   2648 C CG2 . THR C 1 102 ? -79.798  20.024 84.462 1.00 18.31 ? 746 THR C CG2 1 
ATOM   2649 N N   . ASN C 1 103 ? -76.864  20.325 80.867 1.00 19.06 ? 747 ASN C N   1 
ATOM   2650 C CA  . ASN C 1 103 ? -75.542  20.307 80.255 1.00 19.83 ? 747 ASN C CA  1 
ATOM   2651 C C   . ASN C 1 103 ? -75.453  20.759 78.803 1.00 20.00 ? 747 ASN C C   1 
ATOM   2652 O O   . ASN C 1 103 ? -74.430  20.553 78.154 1.00 19.79 ? 747 ASN C O   1 
ATOM   2653 C CB  . ASN C 1 103 ? -74.970  18.892 80.369 1.00 21.02 ? 747 ASN C CB  1 
ATOM   2654 C CG  . ASN C 1 103 ? -75.707  17.902 79.491 1.00 21.83 ? 747 ASN C CG  1 
ATOM   2655 O OD1 . ASN C 1 103 ? -76.892  18.071 79.209 1.00 22.06 ? 747 ASN C OD1 1 
ATOM   2656 N ND2 . ASN C 1 103 ? -75.012  16.860 79.063 1.00 23.13 ? 747 ASN C ND2 1 
ATOM   2657 N N   . GLY C 1 104 ? -76.505  21.380 78.288 1.00 20.64 ? 754 GLY C N   1 
ATOM   2658 C CA  . GLY C 1 104 ? -76.457  21.814 76.906 1.00 21.75 ? 754 GLY C CA  1 
ATOM   2659 C C   . GLY C 1 104 ? -77.816  21.955 76.250 1.00 22.93 ? 754 GLY C C   1 
ATOM   2660 O O   . GLY C 1 104 ? -78.830  21.545 76.807 1.00 21.98 ? 754 GLY C O   1 
ATOM   2661 N N   . PRO C 1 105 ? -77.855  22.517 75.036 1.00 23.61 ? 755 PRO C N   1 
ATOM   2662 C CA  . PRO C 1 105 ? -79.069  22.747 74.254 1.00 24.17 ? 755 PRO C CA  1 
ATOM   2663 C C   . PRO C 1 105 ? -79.711  21.526 73.609 1.00 25.18 ? 755 PRO C C   1 
ATOM   2664 O O   . PRO C 1 105 ? -79.035  20.568 73.233 1.00 27.23 ? 755 PRO C O   1 
ATOM   2665 C CB  . PRO C 1 105 ? -78.603  23.758 73.216 1.00 25.01 ? 755 PRO C CB  1 
ATOM   2666 C CG  . PRO C 1 105 ? -77.222  23.258 72.913 1.00 23.20 ? 755 PRO C CG  1 
ATOM   2667 C CD  . PRO C 1 105 ? -76.669  22.998 74.303 1.00 23.61 ? 755 PRO C CD  1 
ATOM   2668 N N   . VAL C 1 106 ? -81.033  21.587 73.491 1.00 24.81 ? 756 VAL C N   1 
ATOM   2669 C CA  . VAL C 1 106 ? -81.832  20.541 72.868 1.00 25.44 ? 756 VAL C CA  1 
ATOM   2670 C C   . VAL C 1 106 ? -82.798  21.239 71.917 1.00 24.37 ? 756 VAL C C   1 
ATOM   2671 O O   . VAL C 1 106 ? -83.438  22.219 72.300 1.00 24.96 ? 756 VAL C O   1 
ATOM   2672 C CB  . VAL C 1 106 ? -82.701  19.755 73.894 1.00 26.27 ? 756 VAL C CB  1 
ATOM   2673 C CG1 . VAL C 1 106 ? -83.529  18.704 73.153 1.00 26.72 ? 756 VAL C CG1 1 
ATOM   2674 C CG2 . VAL C 1 106 ? -81.834  19.094 74.954 1.00 23.98 ? 756 VAL C CG2 1 
ATOM   2675 N N   . ASP C 1 107 ? -82.898  20.759 70.682 1.00 23.57 ? 757 ASP C N   1 
ATOM   2676 C CA  . ASP C 1 107 ? -83.840  21.354 69.738 1.00 25.47 ? 757 ASP C CA  1 
ATOM   2677 C C   . ASP C 1 107 ? -85.246  20.890 70.124 1.00 24.56 ? 757 ASP C C   1 
ATOM   2678 O O   . ASP C 1 107 ? -85.474  19.697 70.338 1.00 23.49 ? 757 ASP C O   1 
ATOM   2679 C CB  . ASP C 1 107 ? -83.553  20.903 68.306 1.00 28.62 ? 757 ASP C CB  1 
ATOM   2680 C CG  . ASP C 1 107 ? -82.269  21.478 67.756 1.00 31.59 ? 757 ASP C CG  1 
ATOM   2681 O OD1 . ASP C 1 107 ? -82.126  22.720 67.717 1.00 32.97 ? 757 ASP C OD1 1 
ATOM   2682 O OD2 . ASP C 1 107 ? -81.403  20.679 67.352 1.00 35.74 ? 757 ASP C OD2 1 
ATOM   2683 N N   . LEU C 1 108 ? -86.181  21.828 70.220 1.00 21.91 ? 758 LEU C N   1 
ATOM   2684 C CA  . LEU C 1 108 ? -87.554  21.488 70.572 1.00 21.83 ? 758 LEU C CA  1 
ATOM   2685 C C   . LEU C 1 108 ? -88.173  20.574 69.526 1.00 20.49 ? 758 LEU C C   1 
ATOM   2686 O O   . LEU C 1 108 ? -89.027  19.748 69.838 1.00 18.62 ? 758 LEU C O   1 
ATOM   2687 C CB  . LEU C 1 108 ? -88.399  22.756 70.710 1.00 20.15 ? 758 LEU C CB  1 
ATOM   2688 C CG  . LEU C 1 108 ? -88.073  23.584 71.955 1.00 22.92 ? 758 LEU C CG  1 
ATOM   2689 C CD1 . LEU C 1 108 ? -88.821  24.925 71.927 1.00 22.48 ? 758 LEU C CD1 1 
ATOM   2690 C CD2 . LEU C 1 108 ? -88.450  22.773 73.179 1.00 21.72 ? 758 LEU C CD2 1 
ATOM   2691 N N   . LYS C 1 109 ? -87.736  20.725 68.284 1.00 22.00 ? 759 LYS C N   1 
ATOM   2692 C CA  . LYS C 1 109 ? -88.250  19.907 67.194 1.00 25.30 ? 759 LYS C CA  1 
ATOM   2693 C C   . LYS C 1 109 ? -87.881  18.448 67.452 1.00 25.32 ? 759 LYS C C   1 
ATOM   2694 O O   . LYS C 1 109 ? -88.612  17.536 67.078 1.00 26.00 ? 759 LYS C O   1 
ATOM   2695 C CB  . LYS C 1 109 ? -87.649  20.386 65.874 1.00 29.49 ? 759 LYS C CB  1 
ATOM   2696 C CG  . LYS C 1 109 ? -88.322  19.846 64.628 1.00 36.11 ? 759 LYS C CG  1 
ATOM   2697 C CD  . LYS C 1 109 ? -87.570  20.301 63.381 1.00 40.42 ? 759 LYS C CD  1 
ATOM   2698 C CE  . LYS C 1 109 ? -88.160  19.699 62.107 1.00 42.73 ? 759 LYS C CE  1 
ATOM   2699 N NZ  . LYS C 1 109 ? -87.371  20.087 60.901 1.00 41.67 ? 759 LYS C NZ  1 
ATOM   2700 N N   . LYS C 1 110 ? -86.748  18.243 68.114 1.00 24.31 ? 760 LYS C N   1 
ATOM   2701 C CA  . LYS C 1 110 ? -86.250  16.909 68.441 1.00 25.42 ? 760 LYS C CA  1 
ATOM   2702 C C   . LYS C 1 110 ? -87.170  16.110 69.361 1.00 25.66 ? 760 LYS C C   1 
ATOM   2703 O O   . LYS C 1 110 ? -87.459  14.944 69.099 1.00 25.58 ? 760 LYS C O   1 
ATOM   2704 C CB  . LYS C 1 110 ? -84.872  17.025 69.095 1.00 26.51 ? 760 LYS C CB  1 
ATOM   2705 C CG  . LYS C 1 110 ? -84.311  15.734 69.651 1.00 29.07 ? 760 LYS C CG  1 
ATOM   2706 C CD  . LYS C 1 110 ? -83.708  14.865 68.567 1.00 31.29 ? 760 LYS C CD  1 
ATOM   2707 C CE  . LYS C 1 110 ? -82.953  13.686 69.169 1.00 31.72 ? 760 LYS C CE  1 
ATOM   2708 N NZ  . LYS C 1 110 ? -82.274  12.866 68.124 1.00 34.02 ? 760 LYS C NZ  1 
ATOM   2709 N N   . ILE C 1 111 ? -87.626  16.723 70.447 1.00 24.99 ? 761 ILE C N   1 
ATOM   2710 C CA  . ILE C 1 111 ? -88.490  16.002 71.374 1.00 25.89 ? 761 ILE C CA  1 
ATOM   2711 C C   . ILE C 1 111 ? -89.947  16.031 70.946 1.00 23.43 ? 761 ILE C C   1 
ATOM   2712 O O   . ILE C 1 111 ? -90.719  15.138 71.275 1.00 23.32 ? 761 ILE C O   1 
ATOM   2713 C CB  . ILE C 1 111 ? -88.328  16.529 72.824 1.00 28.76 ? 761 ILE C CB  1 
ATOM   2714 C CG1 . ILE C 1 111 ? -88.520  18.043 72.879 1.00 30.55 ? 761 ILE C CG1 1 
ATOM   2715 C CG2 . ILE C 1 111 ? -86.934  16.153 73.348 1.00 29.06 ? 761 ILE C CG2 1 
ATOM   2716 C CD1 . ILE C 1 111 ? -88.050  18.669 74.196 1.00 31.75 ? 761 ILE C CD1 1 
ATOM   2717 N N   . THR C 1 112 ? -90.304  17.052 70.182 1.00 21.25 ? 762 THR C N   1 
ATOM   2718 C CA  . THR C 1 112 ? -91.653  17.207 69.665 1.00 22.05 ? 762 THR C CA  1 
ATOM   2719 C C   . THR C 1 112 ? -91.944  16.153 68.590 1.00 20.91 ? 762 THR C C   1 
ATOM   2720 O O   . THR C 1 112 ? -93.061  15.639 68.503 1.00 21.48 ? 762 THR C O   1 
ATOM   2721 C CB  . THR C 1 112 ? -91.831  18.626 69.063 1.00 20.80 ? 762 THR C CB  1 
ATOM   2722 O OG1 . THR C 1 112 ? -92.195  19.539 70.106 1.00 25.18 ? 762 THR C OG1 1 
ATOM   2723 C CG2 . THR C 1 112 ? -92.888  18.635 67.984 1.00 23.58 ? 762 THR C CG2 1 
ATOM   2724 N N   . ASN C 1 113 ? -90.938  15.831 67.780 1.00 21.11 ? 763 ASN C N   1 
ATOM   2725 C CA  . ASN C 1 113 ? -91.101  14.847 66.708 1.00 22.03 ? 763 ASN C CA  1 
ATOM   2726 C C   . ASN C 1 113 ? -91.572  13.482 67.195 1.00 21.24 ? 763 ASN C C   1 
ATOM   2727 O O   . ASN C 1 113 ? -92.309  12.795 66.496 1.00 22.00 ? 763 ASN C O   1 
ATOM   2728 C CB  . ASN C 1 113 ? -89.796  14.661 65.915 1.00 21.12 ? 763 ASN C CB  1 
ATOM   2729 C CG  . ASN C 1 113 ? -89.534  15.792 64.935 1.00 23.11 ? 763 ASN C CG  1 
ATOM   2730 O OD1 . ASN C 1 113 ? -90.446  16.528 64.555 1.00 22.88 ? 763 ASN C OD1 1 
ATOM   2731 N ND2 . ASN C 1 113 ? -88.280  15.923 64.504 1.00 23.22 ? 763 ASN C ND2 1 
ATOM   2732 N N   . PHE C 1 114 ? -91.137  13.084 68.385 1.00 21.88 ? 764 PHE C N   1 
ATOM   2733 C CA  . PHE C 1 114 ? -91.526  11.790 68.937 1.00 22.15 ? 764 PHE C CA  1 
ATOM   2734 C C   . PHE C 1 114 ? -93.038  11.605 68.977 1.00 22.57 ? 764 PHE C C   1 
ATOM   2735 O O   . PHE C 1 114 ? -93.539  10.484 68.935 1.00 23.35 ? 764 PHE C O   1 
ATOM   2736 C CB  . PHE C 1 114 ? -90.984  11.625 70.366 1.00 22.00 ? 764 PHE C CB  1 
ATOM   2737 C CG  . PHE C 1 114 ? -89.492  11.471 70.443 1.00 23.47 ? 764 PHE C CG  1 
ATOM   2738 C CD1 . PHE C 1 114 ? -88.850  10.434 69.772 1.00 24.05 ? 764 PHE C CD1 1 
ATOM   2739 C CD2 . PHE C 1 114 ? -88.726  12.359 71.193 1.00 23.22 ? 764 PHE C CD2 1 
ATOM   2740 C CE1 . PHE C 1 114 ? -87.468  10.288 69.849 1.00 23.97 ? 764 PHE C CE1 1 
ATOM   2741 C CE2 . PHE C 1 114 ? -87.344  12.221 71.275 1.00 22.14 ? 764 PHE C CE2 1 
ATOM   2742 C CZ  . PHE C 1 114 ? -86.715  11.187 70.604 1.00 23.39 ? 764 PHE C CZ  1 
ATOM   2743 N N   . PHE C 1 115 ? -93.765  12.709 69.052 1.00 22.99 ? 765 PHE C N   1 
ATOM   2744 C CA  . PHE C 1 115 ? -95.216  12.646 69.155 1.00 26.28 ? 765 PHE C CA  1 
ATOM   2745 C C   . PHE C 1 115 ? -95.975  13.035 67.895 1.00 27.74 ? 765 PHE C C   1 
ATOM   2746 O O   . PHE C 1 115 ? -97.195  13.198 67.937 1.00 29.76 ? 765 PHE C O   1 
ATOM   2747 C CB  . PHE C 1 115 ? -95.676  13.545 70.310 1.00 25.47 ? 765 PHE C CB  1 
ATOM   2748 C CG  . PHE C 1 115 ? -94.958  13.288 71.602 1.00 23.90 ? 765 PHE C CG  1 
ATOM   2749 C CD1 . PHE C 1 115 ? -95.452  12.364 72.518 1.00 24.88 ? 765 PHE C CD1 1 
ATOM   2750 C CD2 . PHE C 1 115 ? -93.772  13.955 71.894 1.00 23.76 ? 765 PHE C CD2 1 
ATOM   2751 C CE1 . PHE C 1 115 ? -94.778  12.105 73.712 1.00 23.36 ? 765 PHE C CE1 1 
ATOM   2752 C CE2 . PHE C 1 115 ? -93.087  13.708 73.082 1.00 22.65 ? 765 PHE C CE2 1 
ATOM   2753 C CZ  . PHE C 1 115 ? -93.590  12.778 73.996 1.00 24.20 ? 765 PHE C CZ  1 
ATOM   2754 N N   . ARG C 1 116 ? -95.285  13.179 66.771 1.00 29.50 ? 766 ARG C N   1 
ATOM   2755 C CA  . ARG C 1 116 ? -95.995  13.574 65.567 1.00 33.70 ? 766 ARG C CA  1 
ATOM   2756 C C   . ARG C 1 116 ? -96.811  12.463 64.904 1.00 35.91 ? 766 ARG C C   1 
ATOM   2757 O O   . ARG C 1 116 ? -96.333  11.355 64.696 1.00 38.92 ? 766 ARG C O   1 
ATOM   2758 C CB  . ARG C 1 116 ? -95.042  14.246 64.569 1.00 35.10 ? 766 ARG C CB  1 
ATOM   2759 C CG  . ARG C 1 116 ? -93.980  13.398 63.913 1.00 40.42 ? 766 ARG C CG  1 
ATOM   2760 C CD  . ARG C 1 116 ? -93.041  14.326 63.142 1.00 42.05 ? 766 ARG C CD  1 
ATOM   2761 N NE  . ARG C 1 116 ? -92.331  13.666 62.051 1.00 46.77 ? 766 ARG C NE  1 
ATOM   2762 C CZ  . ARG C 1 116 ? -92.926  13.150 60.982 1.00 47.50 ? 766 ARG C CZ  1 
ATOM   2763 N NH1 . ARG C 1 116 ? -94.242  13.216 60.862 1.00 50.44 ? 766 ARG C NH1 1 
ATOM   2764 N NH2 . ARG C 1 116 ? -92.210  12.577 60.027 1.00 49.79 ? 766 ARG C NH2 1 
ATOM   2765 N N   . GLY C 1 117 ? -98.070  12.792 64.615 1.00 36.62 ? 767 GLY C N   1 
ATOM   2766 C CA  . GLY C 1 117 ? -99.027  11.890 63.991 1.00 35.60 ? 767 GLY C CA  1 
ATOM   2767 C C   . GLY C 1 117 ? -98.662  10.453 63.669 1.00 36.58 ? 767 GLY C C   1 
ATOM   2768 O O   . GLY C 1 117 ? -99.259  9.516  64.211 1.00 36.38 ? 767 GLY C O   1 
ATOM   2769 N N   . ASP C 1 118 ? -97.692  10.283 62.775 1.00 35.75 ? 768 ASP C N   1 
ATOM   2770 C CA  . ASP C 1 118 ? -97.238  8.966  62.333 1.00 37.21 ? 768 ASP C CA  1 
ATOM   2771 C C   . ASP C 1 118 ? -96.221  8.316  63.268 1.00 36.31 ? 768 ASP C C   1 
ATOM   2772 O O   . ASP C 1 118 ? -95.877  7.146  63.103 1.00 35.33 ? 768 ASP C O   1 
ATOM   2773 C CB  . ASP C 1 118 ? -96.638  9.091  60.928 1.00 37.85 ? 768 ASP C CB  1 
ATOM   2774 C CG  . ASP C 1 118 ? -95.455  10.047 60.881 1.00 39.15 ? 768 ASP C CG  1 
ATOM   2775 O OD1 . ASP C 1 118 ? -95.461  11.051 61.627 1.00 39.62 ? 768 ASP C OD1 1 
ATOM   2776 O OD2 . ASP C 1 118 ? -94.525  9.805  60.088 1.00 40.01 ? 768 ASP C OD2 1 
ATOM   2777 N N   . ARG C 1 119 ? -95.760  9.078  64.254 1.00 36.67 ? 769 ARG C N   1 
ATOM   2778 C CA  . ARG C 1 119 ? -94.763  8.613  65.215 1.00 35.25 ? 769 ARG C CA  1 
ATOM   2779 C C   . ARG C 1 119 ? -95.348  8.015  66.496 1.00 33.60 ? 769 ARG C C   1 
ATOM   2780 O O   . ARG C 1 119 ? -94.828  7.030  67.019 1.00 33.48 ? 769 ARG C O   1 
ATOM   2781 C CB  . ARG C 1 119 ? -93.844  9.770  65.592 1.00 37.97 ? 769 ARG C CB  1 
ATOM   2782 C CG  . ARG C 1 119 ? -92.385  9.569  65.248 1.00 40.37 ? 769 ARG C CG  1 
ATOM   2783 C CD  . ARG C 1 119 ? -92.020  10.173 63.902 1.00 41.52 ? 769 ARG C CD  1 
ATOM   2784 N NE  . ARG C 1 119 ? -90.663  10.712 63.945 1.00 45.92 ? 769 ARG C NE  1 
ATOM   2785 C CZ  . ARG C 1 119 ? -90.024  11.256 62.914 1.00 46.41 ? 769 ARG C CZ  1 
ATOM   2786 N NH1 . ARG C 1 119 ? -90.608  11.342 61.730 1.00 47.68 ? 769 ARG C NH1 1 
ATOM   2787 N NH2 . ARG C 1 119 ? -88.795  11.725 63.072 1.00 48.37 ? 769 ARG C NH2 1 
ATOM   2788 N N   . CYS C 1 120 ? -96.404  8.630  67.019 1.00 30.87 ? 770 CYS C N   1 
ATOM   2789 C CA  . CYS C 1 120 ? -97.039  8.141  68.239 1.00 29.04 ? 770 CYS C CA  1 
ATOM   2790 C C   . CYS C 1 120 ? -98.497  7.821  67.942 1.00 28.80 ? 770 CYS C C   1 
ATOM   2791 O O   . CYS C 1 120 ? -99.405  8.582  68.279 1.00 26.61 ? 770 CYS C O   1 
ATOM   2792 C CB  . CYS C 1 120 ? -96.949  9.186  69.355 1.00 27.16 ? 770 CYS C CB  1 
ATOM   2793 S SG  . CYS C 1 120 ? -97.583  8.610  70.947 1.00 24.02 ? 770 CYS C SG  1 
ATOM   2794 N N   . ARG C 1 121 ? -98.698  6.671  67.311 1.00 29.75 ? 771 ARG C N   1 
ATOM   2795 C CA  . ARG C 1 121 ? -100.013 6.198  66.905 1.00 29.54 ? 771 ARG C CA  1 
ATOM   2796 C C   . ARG C 1 121 ? -101.110 6.254  67.972 1.00 26.62 ? 771 ARG C C   1 
ATOM   2797 O O   . ARG C 1 121 ? -102.252 6.583  67.657 1.00 26.41 ? 771 ARG C O   1 
ATOM   2798 C CB  . ARG C 1 121 ? -99.883  4.771  66.371 1.00 33.24 ? 771 ARG C CB  1 
ATOM   2799 C CG  . ARG C 1 121 ? -100.758 4.477  65.175 1.00 40.80 ? 771 ARG C CG  1 
ATOM   2800 C CD  . ARG C 1 121 ? -100.269 5.201  63.927 1.00 44.04 ? 771 ARG C CD  1 
ATOM   2801 N NE  . ARG C 1 121 ? -101.157 4.953  62.794 1.00 47.78 ? 771 ARG C NE  1 
ATOM   2802 C CZ  . ARG C 1 121 ? -102.406 5.405  62.712 1.00 50.24 ? 771 ARG C CZ  1 
ATOM   2803 N NH1 . ARG C 1 121 ? -102.915 6.136  63.696 1.00 50.83 ? 771 ARG C NH1 1 
ATOM   2804 N NH2 . ARG C 1 121 ? -103.151 5.117  61.652 1.00 52.22 ? 771 ARG C NH2 1 
ATOM   2805 N N   . SER C 1 122 ? -100.784 5.937  69.223 1.00 23.60 ? 772 SER C N   1 
ATOM   2806 C CA  . SER C 1 122 ? -101.801 5.961  70.279 1.00 22.58 ? 772 SER C CA  1 
ATOM   2807 C C   . SER C 1 122 ? -102.252 7.371  70.660 1.00 19.97 ? 772 SER C C   1 
ATOM   2808 O O   . SER C 1 122 ? -103.181 7.534  71.443 1.00 19.96 ? 772 SER C O   1 
ATOM   2809 C CB  . SER C 1 122 ? -101.317 5.209  71.531 1.00 22.67 ? 772 SER C CB  1 
ATOM   2810 O OG  . SER C 1 122 ? -100.227 5.859  72.162 1.00 24.16 ? 772 SER C OG  1 
ATOM   2811 N N   . LEU C 1 123 ? -101.596 8.388  70.113 1.00 19.90 ? 773 LEU C N   1 
ATOM   2812 C CA  . LEU C 1 123 ? -101.974 9.774  70.398 1.00 19.52 ? 773 LEU C CA  1 
ATOM   2813 C C   . LEU C 1 123 ? -102.455 10.482 69.129 1.00 19.76 ? 773 LEU C C   1 
ATOM   2814 O O   . LEU C 1 123 ? -102.822 11.661 69.163 1.00 19.88 ? 773 LEU C O   1 
ATOM   2815 C CB  . LEU C 1 123 ? -100.800 10.556 71.014 1.00 18.35 ? 773 LEU C CB  1 
ATOM   2816 C CG  . LEU C 1 123 ? -100.523 10.340 72.509 1.00 16.78 ? 773 LEU C CG  1 
ATOM   2817 C CD1 . LEU C 1 123 ? -99.290  11.117 72.933 1.00 17.21 ? 773 LEU C CD1 1 
ATOM   2818 C CD2 . LEU C 1 123 ? -101.728 10.785 73.318 1.00 14.74 ? 773 LEU C CD2 1 
ATOM   2819 N N   . THR C 1 124 ? -102.461 9.760  68.013 1.00 18.15 ? 774 THR C N   1 
ATOM   2820 C CA  . THR C 1 124 ? -102.906 10.337 66.750 1.00 18.46 ? 774 THR C CA  1 
ATOM   2821 C C   . THR C 1 124 ? -104.340 10.830 66.927 1.00 17.96 ? 774 THR C C   1 
ATOM   2822 O O   . THR C 1 124 ? -105.190 10.115 67.462 1.00 17.41 ? 774 THR C O   1 
ATOM   2823 C CB  . THR C 1 124 ? -102.872 9.298  65.614 1.00 18.49 ? 774 THR C CB  1 
ATOM   2824 O OG1 . THR C 1 124 ? -101.541 8.787  65.470 1.00 23.13 ? 774 THR C OG1 1 
ATOM   2825 C CG2 . THR C 1 124 ? -103.297 9.935  64.292 1.00 19.95 ? 774 THR C CG2 1 
ATOM   2826 N N   . GLY C 1 125 ? -104.598 12.058 66.492 1.00 15.72 ? 775 GLY C N   1 
ATOM   2827 C CA  . GLY C 1 125 ? -105.929 12.618 66.623 1.00 15.59 ? 775 GLY C CA  1 
ATOM   2828 C C   . GLY C 1 125 ? -106.224 13.143 68.019 1.00 14.64 ? 775 GLY C C   1 
ATOM   2829 O O   . GLY C 1 125 ? -107.347 13.553 68.305 1.00 13.54 ? 775 GLY C O   1 
ATOM   2830 N N   . LYS C 1 126 ? -105.225 13.126 68.894 1.00 13.44 ? 776 LYS C N   1 
ATOM   2831 C CA  . LYS C 1 126 ? -105.417 13.615 70.250 1.00 14.64 ? 776 LYS C CA  1 
ATOM   2832 C C   . LYS C 1 126 ? -104.563 14.857 70.495 1.00 13.97 ? 776 LYS C C   1 
ATOM   2833 O O   . LYS C 1 126 ? -103.443 14.969 69.988 1.00 13.57 ? 776 LYS C O   1 
ATOM   2834 C CB  . LYS C 1 126 ? -105.052 12.530 71.268 1.00 14.83 ? 776 LYS C CB  1 
ATOM   2835 C CG  . LYS C 1 126 ? -105.938 11.297 71.228 1.00 14.66 ? 776 LYS C CG  1 
ATOM   2836 C CD  . LYS C 1 126 ? -105.402 10.221 72.162 1.00 16.38 ? 776 LYS C CD  1 
ATOM   2837 C CE  . LYS C 1 126 ? -106.268 8.970  72.141 1.00 16.18 ? 776 LYS C CE  1 
ATOM   2838 N NZ  . LYS C 1 126 ? -105.703 7.909  73.015 1.00 18.07 ? 776 LYS C NZ  1 
ATOM   2839 N N   . PRO C 1 127 ? -105.088 15.807 71.281 1.00 13.56 ? 777 PRO C N   1 
ATOM   2840 C CA  . PRO C 1 127 ? -104.344 17.034 71.572 1.00 14.15 ? 777 PRO C CA  1 
ATOM   2841 C C   . PRO C 1 127 ? -103.041 16.790 72.326 1.00 13.66 ? 777 PRO C C   1 
ATOM   2842 O O   . PRO C 1 127 ? -103.017 16.111 73.348 1.00 13.78 ? 777 PRO C O   1 
ATOM   2843 C CB  . PRO C 1 127 ? -105.351 17.875 72.363 1.00 14.05 ? 777 PRO C CB  1 
ATOM   2844 C CG  . PRO C 1 127 ? -106.215 16.840 73.035 1.00 14.87 ? 777 PRO C CG  1 
ATOM   2845 C CD  . PRO C 1 127 ? -106.396 15.799 71.962 1.00 13.44 ? 777 PRO C CD  1 
ATOM   2846 N N   . LYS C 1 128 ? -101.961 17.344 71.787 1.00 14.33 ? 778 LYS C N   1 
ATOM   2847 C CA  . LYS C 1 128 ? -100.629 17.225 72.364 1.00 13.03 ? 778 LYS C CA  1 
ATOM   2848 C C   . LYS C 1 128 ? -100.161 18.637 72.735 1.00 13.60 ? 778 LYS C C   1 
ATOM   2849 O O   . LYS C 1 128 ? -99.856  19.451 71.861 1.00 12.45 ? 778 LYS C O   1 
ATOM   2850 C CB  . LYS C 1 128 ? -99.696  16.579 71.333 1.00 12.67 ? 778 LYS C CB  1 
ATOM   2851 C CG  . LYS C 1 128 ? -100.073 15.122 71.010 1.00 15.11 ? 778 LYS C CG  1 
ATOM   2852 C CD  . LYS C 1 128 ? -99.318  14.557 69.806 1.00 14.63 ? 778 LYS C CD  1 
ATOM   2853 C CE  . LYS C 1 128 ? -100.044 14.837 68.496 1.00 13.46 ? 778 LYS C CE  1 
ATOM   2854 N NZ  . LYS C 1 128 ? -101.328 14.078 68.425 1.00 13.42 ? 778 LYS C NZ  1 
ATOM   2855 N N   . LEU C 1 129 ? -100.094 18.912 74.035 1.00 12.24 ? 779 LEU C N   1 
ATOM   2856 C CA  . LEU C 1 129 ? -99.722  20.235 74.520 1.00 13.23 ? 779 LEU C CA  1 
ATOM   2857 C C   . LEU C 1 129 ? -98.301  20.401 75.050 1.00 12.97 ? 779 LEU C C   1 
ATOM   2858 O O   . LEU C 1 129 ? -97.856  19.645 75.909 1.00 13.33 ? 779 LEU C O   1 
ATOM   2859 C CB  . LEU C 1 129 ? -100.702 20.664 75.616 1.00 12.95 ? 779 LEU C CB  1 
ATOM   2860 C CG  . LEU C 1 129 ? -102.181 20.308 75.392 1.00 19.17 ? 779 LEU C CG  1 
ATOM   2861 C CD1 . LEU C 1 129 ? -103.016 20.846 76.539 1.00 17.25 ? 779 LEU C CD1 1 
ATOM   2862 C CD2 . LEU C 1 129 ? -102.669 20.873 74.075 1.00 17.98 ? 779 LEU C CD2 1 
ATOM   2863 N N   . PHE C 1 130 ? -97.590  21.396 74.536 1.00 12.85 ? 780 PHE C N   1 
ATOM   2864 C CA  . PHE C 1 130 ? -96.245  21.675 75.021 1.00 13.75 ? 780 PHE C CA  1 
ATOM   2865 C C   . PHE C 1 130 ? -96.205  23.093 75.595 1.00 13.87 ? 780 PHE C C   1 
ATOM   2866 O O   . PHE C 1 130 ? -96.276  24.079 74.864 1.00 13.93 ? 780 PHE C O   1 
ATOM   2867 C CB  . PHE C 1 130 ? -95.222  21.509 73.902 1.00 12.37 ? 780 PHE C CB  1 
ATOM   2868 C CG  . PHE C 1 130 ? -95.070  20.084 73.438 1.00 13.42 ? 780 PHE C CG  1 
ATOM   2869 C CD1 . PHE C 1 130 ? -95.994  19.517 72.567 1.00 13.13 ? 780 PHE C CD1 1 
ATOM   2870 C CD2 . PHE C 1 130 ? -94.027  19.295 73.912 1.00 11.73 ? 780 PHE C CD2 1 
ATOM   2871 C CE1 . PHE C 1 130 ? -95.886  18.183 72.173 1.00 13.65 ? 780 PHE C CE1 1 
ATOM   2872 C CE2 . PHE C 1 130 ? -93.906  17.959 73.528 1.00 12.16 ? 780 PHE C CE2 1 
ATOM   2873 C CZ  . PHE C 1 130 ? -94.839  17.400 72.654 1.00 13.59 ? 780 PHE C CZ  1 
ATOM   2874 N N   . ILE C 1 131 ? -96.110  23.170 76.920 1.00 13.22 ? 781 ILE C N   1 
ATOM   2875 C CA  . ILE C 1 131 ? -96.062  24.431 77.653 1.00 11.98 ? 781 ILE C CA  1 
ATOM   2876 C C   . ILE C 1 131 ? -94.587  24.740 77.918 1.00 14.20 ? 781 ILE C C   1 
ATOM   2877 O O   . ILE C 1 131 ? -93.896  24.001 78.626 1.00 14.94 ? 781 ILE C O   1 
ATOM   2878 C CB  . ILE C 1 131 ? -96.866  24.298 78.966 1.00 13.57 ? 781 ILE C CB  1 
ATOM   2879 C CG1 . ILE C 1 131 ? -98.314  23.911 78.622 1.00 11.32 ? 781 ILE C CG1 1 
ATOM   2880 C CG2 . ILE C 1 131 ? -96.825  25.601 79.763 1.00 9.12  ? 781 ILE C CG2 1 
ATOM   2881 C CD1 . ILE C 1 131 ? -99.156  23.522 79.816 1.00 13.98 ? 781 ILE C CD1 1 
ATOM   2882 N N   . ILE C 1 132 ? -94.111  25.841 77.349 1.00 14.19 ? 782 ILE C N   1 
ATOM   2883 C CA  . ILE C 1 132 ? -92.706  26.189 77.451 1.00 12.26 ? 782 ILE C CA  1 
ATOM   2884 C C   . ILE C 1 132 ? -92.320  27.507 78.108 1.00 12.05 ? 782 ILE C C   1 
ATOM   2885 O O   . ILE C 1 132 ? -92.576  28.586 77.575 1.00 13.31 ? 782 ILE C O   1 
ATOM   2886 C CB  . ILE C 1 132 ? -92.088  26.141 76.044 1.00 12.30 ? 782 ILE C CB  1 
ATOM   2887 C CG1 . ILE C 1 132 ? -92.469  24.807 75.390 1.00 13.45 ? 782 ILE C CG1 1 
ATOM   2888 C CG2 . ILE C 1 132 ? -90.574  26.301 76.118 1.00 12.16 ? 782 ILE C CG2 1 
ATOM   2889 C CD1 . ILE C 1 132 ? -92.301  24.780 73.912 1.00 14.25 ? 782 ILE C CD1 1 
ATOM   2890 N N   . GLN C 1 133 ? -91.694  27.402 79.274 1.00 13.03 ? 783 GLN C N   1 
ATOM   2891 C CA  . GLN C 1 133 ? -91.204  28.562 80.007 1.00 12.02 ? 783 GLN C CA  1 
ATOM   2892 C C   . GLN C 1 133 ? -89.698  28.584 79.740 1.00 12.43 ? 783 GLN C C   1 
ATOM   2893 O O   . GLN C 1 133 ? -88.946  27.807 80.331 1.00 13.18 ? 783 GLN C O   1 
ATOM   2894 C CB  . GLN C 1 133 ? -91.482  28.412 81.508 1.00 11.55 ? 783 GLN C CB  1 
ATOM   2895 C CG  . GLN C 1 133 ? -90.761  29.441 82.406 1.00 12.81 ? 783 GLN C CG  1 
ATOM   2896 C CD  . GLN C 1 133 ? -91.015  30.873 81.973 1.00 13.84 ? 783 GLN C CD  1 
ATOM   2897 O OE1 . GLN C 1 133 ? -92.153  31.250 81.697 1.00 13.20 ? 783 GLN C OE1 1 
ATOM   2898 N NE2 . GLN C 1 133 ? -89.956  31.680 81.913 1.00 12.44 ? 783 GLN C NE2 1 
ATOM   2899 N N   . ALA C 1 134 ? -89.279  29.449 78.820 1.00 13.40 ? 784 ALA C N   1 
ATOM   2900 C CA  . ALA C 1 134 ? -87.874  29.591 78.441 1.00 13.44 ? 784 ALA C CA  1 
ATOM   2901 C C   . ALA C 1 134 ? -87.758  30.757 77.465 1.00 15.50 ? 784 ALA C C   1 
ATOM   2902 O O   . ALA C 1 134 ? -88.729  31.100 76.791 1.00 15.53 ? 784 ALA C O   1 
ATOM   2903 C CB  . ALA C 1 134 ? -87.359  28.305 77.784 1.00 8.74  ? 784 ALA C CB  1 
ATOM   2904 N N   . CYS C 1 135 ? -86.579  31.371 77.390 1.00 14.75 ? 785 CYS C N   1 
ATOM   2905 C CA  . CYS C 1 135 ? -86.388  32.499 76.485 1.00 15.78 ? 785 CYS C CA  1 
ATOM   2906 C C   . CYS C 1 135 ? -86.358  32.006 75.052 1.00 15.00 ? 785 CYS C C   1 
ATOM   2907 O O   . CYS C 1 135 ? -86.065  30.840 74.803 1.00 14.31 ? 785 CYS C O   1 
ATOM   2908 C CB  . CYS C 1 135 ? -85.100  33.266 76.859 1.00 16.18 ? 785 CYS C CB  1 
ATOM   2909 S SG  . CYS C 1 135 ? -85.087  33.876 78.547 1.00 20.58 ? 785 CYS C SG  1 
ATOM   2910 N N   . ARG C 1 136 ? -86.693  32.897 74.122 1.00 13.40 ? 786 ARG C N   1 
ATOM   2911 C CA  . ARG C 1 136 ? -86.718  32.577 72.699 1.00 13.60 ? 786 ARG C CA  1 
ATOM   2912 C C   . ARG C 1 136 ? -85.836  33.574 71.945 1.00 13.59 ? 786 ARG C C   1 
ATOM   2913 O O   . ARG C 1 136 ? -86.001  33.814 70.747 1.00 12.01 ? 786 ARG C O   1 
ATOM   2914 C CB  . ARG C 1 136 ? -88.161  32.626 72.186 1.00 10.37 ? 786 ARG C CB  1 
ATOM   2915 C CG  . ARG C 1 136 ? -89.078  31.615 72.888 1.00 12.35 ? 786 ARG C CG  1 
ATOM   2916 C CD  . ARG C 1 136 ? -90.499  31.627 72.325 1.00 13.28 ? 786 ARG C CD  1 
ATOM   2917 N NE  . ARG C 1 136 ? -90.534  31.178 70.933 1.00 14.52 ? 786 ARG C NE  1 
ATOM   2918 C CZ  . ARG C 1 136 ? -91.599  31.276 70.143 1.00 14.05 ? 786 ARG C CZ  1 
ATOM   2919 N NH1 . ARG C 1 136 ? -92.726  31.807 70.601 1.00 12.84 ? 786 ARG C NH1 1 
ATOM   2920 N NH2 . ARG C 1 136 ? -91.532  30.849 68.889 1.00 15.82 ? 786 ARG C NH2 1 
ATOM   2921 N N   . GLY C 1 137 ? -84.884  34.141 72.676 1.00 14.85 ? 787 GLY C N   1 
ATOM   2922 C CA  . GLY C 1 137 ? -83.976  35.111 72.103 1.00 16.45 ? 787 GLY C CA  1 
ATOM   2923 C C   . GLY C 1 137 ? -83.538  36.099 73.164 1.00 17.25 ? 787 GLY C C   1 
ATOM   2924 O O   . GLY C 1 137 ? -83.782  35.895 74.354 1.00 15.65 ? 787 GLY C O   1 
ATOM   2925 N N   . THR C 1 138 ? -82.898  37.179 72.732 1.00 18.60 ? 788 THR C N   1 
ATOM   2926 C CA  . THR C 1 138 ? -82.411  38.188 73.657 1.00 20.55 ? 788 THR C CA  1 
ATOM   2927 C C   . THR C 1 138 ? -83.037  39.560 73.442 1.00 20.66 ? 788 THR C C   1 
ATOM   2928 O O   . THR C 1 138 ? -82.441  40.568 73.794 1.00 22.69 ? 788 THR C O   1 
ATOM   2929 C CB  . THR C 1 138 ? -80.879  38.326 73.555 1.00 19.58 ? 788 THR C CB  1 
ATOM   2930 O OG1 . THR C 1 138 ? -80.516  38.580 72.194 1.00 21.40 ? 788 THR C OG1 1 
ATOM   2931 C CG2 . THR C 1 138 ? -80.195  37.051 74.029 1.00 20.54 ? 788 THR C CG2 1 
ATOM   2932 N N   . GLU C 1 139 ? -84.225  39.608 72.849 1.00 21.49 ? 789 GLU C N   1 
ATOM   2933 C CA  . GLU C 1 139 ? -84.898  40.888 72.637 1.00 22.15 ? 789 GLU C CA  1 
ATOM   2934 C C   . GLU C 1 139 ? -85.709  41.268 73.876 1.00 21.32 ? 789 GLU C C   1 
ATOM   2935 O O   . GLU C 1 139 ? -86.330  40.419 74.511 1.00 21.33 ? 789 GLU C O   1 
ATOM   2936 C CB  . GLU C 1 139 ? -85.834  40.822 71.430 1.00 24.43 ? 789 GLU C CB  1 
ATOM   2937 C CG  . GLU C 1 139 ? -85.132  40.795 70.085 1.00 27.39 ? 789 GLU C CG  1 
ATOM   2938 C CD  . GLU C 1 139 ? -86.118  40.856 68.928 1.00 27.37 ? 789 GLU C CD  1 
ATOM   2939 O OE1 . GLU C 1 139 ? -86.916  41.812 68.886 1.00 29.23 ? 789 GLU C OE1 1 
ATOM   2940 O OE2 . GLU C 1 139 ? -86.094  39.952 68.066 1.00 27.97 ? 789 GLU C OE2 1 
ATOM   2941 N N   . LEU C 1 140 ? -85.694  42.548 74.219 1.00 21.37 ? 790 LEU C N   1 
ATOM   2942 C CA  . LEU C 1 140 ? -86.433  43.036 75.373 1.00 20.29 ? 790 LEU C CA  1 
ATOM   2943 C C   . LEU C 1 140 ? -87.622  43.864 74.908 1.00 19.77 ? 790 LEU C C   1 
ATOM   2944 O O   . LEU C 1 140 ? -87.541  44.585 73.906 1.00 18.37 ? 790 LEU C O   1 
ATOM   2945 C CB  . LEU C 1 140 ? -85.522  43.886 76.268 1.00 21.34 ? 790 LEU C CB  1 
ATOM   2946 C CG  . LEU C 1 140 ? -84.459  43.137 77.077 1.00 22.74 ? 790 LEU C CG  1 
ATOM   2947 C CD1 . LEU C 1 140 ? -83.444  44.116 77.641 1.00 24.14 ? 790 LEU C CD1 1 
ATOM   2948 C CD2 . LEU C 1 140 ? -85.130  42.355 78.193 1.00 20.92 ? 790 LEU C CD2 1 
ATOM   2949 N N   . ASP C 1 141 ? -88.727  43.751 75.637 1.00 18.84 ? 791 ASP C N   1 
ATOM   2950 C CA  . ASP C 1 141 ? -89.935  44.491 75.309 1.00 19.33 ? 791 ASP C CA  1 
ATOM   2951 C C   . ASP C 1 141 ? -90.051  45.623 76.330 1.00 21.29 ? 791 ASP C C   1 
ATOM   2952 O O   . ASP C 1 141 ? -90.277  45.376 77.518 1.00 17.87 ? 791 ASP C O   1 
ATOM   2953 C CB  . ASP C 1 141 ? -91.150  43.567 75.388 1.00 16.87 ? 791 ASP C CB  1 
ATOM   2954 C CG  . ASP C 1 141 ? -92.370  44.149 74.709 1.00 16.73 ? 791 ASP C CG  1 
ATOM   2955 O OD1 . ASP C 1 141 ? -92.672  45.336 74.946 1.00 15.63 ? 791 ASP C OD1 1 
ATOM   2956 O OD2 . ASP C 1 141 ? -93.032  43.414 73.948 1.00 13.65 ? 791 ASP C OD2 1 
ATOM   2957 N N   . CYS C 1 142 ? -89.887  46.859 75.865 1.00 24.69 ? 792 CYS C N   1 
ATOM   2958 C CA  . CYS C 1 142 ? -89.945  48.022 76.746 1.00 29.46 ? 792 CYS C CA  1 
ATOM   2959 C C   . CYS C 1 142 ? -91.352  48.520 77.046 1.00 30.12 ? 792 CYS C C   1 
ATOM   2960 O O   . CYS C 1 142 ? -91.534  49.410 77.874 1.00 31.74 ? 792 CYS C O   1 
ATOM   2961 C CB  . CYS C 1 142 ? -89.101  49.160 76.159 1.00 31.34 ? 792 CYS C CB  1 
ATOM   2962 S SG  . CYS C 1 142 ? -87.345  48.734 75.965 1.00 38.55 ? 792 CYS C SG  1 
ATOM   2963 N N   . GLY C 1 143 ? -92.344  47.940 76.378 1.00 30.77 ? 793 GLY C N   1 
ATOM   2964 C CA  . GLY C 1 143 ? -93.719  48.341 76.601 1.00 31.16 ? 793 GLY C CA  1 
ATOM   2965 C C   . GLY C 1 143 ? -94.068  49.676 75.976 1.00 33.39 ? 793 GLY C C   1 
ATOM   2966 O O   . GLY C 1 143 ? -93.216  50.345 75.391 1.00 32.42 ? 793 GLY C O   1 
ATOM   2967 N N   . ILE C 1 144 ? -95.334  50.061 76.097 1.00 35.30 ? 794 ILE C N   1 
ATOM   2968 C CA  . ILE C 1 144 ? -95.811  51.322 75.551 1.00 39.14 ? 794 ILE C CA  1 
ATOM   2969 C C   . ILE C 1 144 ? -96.887  51.895 76.468 1.00 42.81 ? 794 ILE C C   1 
ATOM   2970 O O   . ILE C 1 144 ? -97.573  51.151 77.173 1.00 42.19 ? 794 ILE C O   1 
ATOM   2971 C CB  . ILE C 1 144 ? -96.387  51.136 74.123 1.00 37.70 ? 794 ILE C CB  1 
ATOM   2972 C CG1 . ILE C 1 144 ? -96.940  52.462 73.598 1.00 38.59 ? 794 ILE C CG1 1 
ATOM   2973 C CG2 . ILE C 1 144 ? -97.482  50.090 74.133 1.00 37.16 ? 794 ILE C CG2 1 
ATOM   2974 C CD1 . ILE C 1 144 ? -95.924  53.585 73.561 1.00 40.27 ? 794 ILE C CD1 1 
ATOM   2975 N N   . GLU C 1 145 ? -97.020  53.218 76.454 1.00 46.87 ? 795 GLU C N   1 
ATOM   2976 C CA  . GLU C 1 145 ? -97.999  53.911 77.283 1.00 51.17 ? 795 GLU C CA  1 
ATOM   2977 C C   . GLU C 1 145 ? -97.793  53.545 78.748 1.00 52.29 ? 795 GLU C C   1 
ATOM   2978 O O   . GLU C 1 145 ? -98.591  52.739 79.271 1.00 53.59 ? 795 GLU C O   1 
ATOM   2979 C CB  . GLU C 1 145 ? -99.428  53.551 76.867 1.00 52.42 ? 795 GLU C CB  1 
ATOM   2980 C CG  . GLU C 1 145 ? -100.480 54.298 77.672 1.00 56.30 ? 795 GLU C CG  1 
ATOM   2981 C CD  . GLU C 1 145 ? -101.678 53.439 78.009 1.00 57.69 ? 795 GLU C CD  1 
ATOM   2982 O OE1 . GLU C 1 145 ? -101.471 52.289 78.448 1.00 59.39 ? 795 GLU C OE1 1 
ATOM   2983 O OE2 . GLU C 1 145 ? -102.823 53.915 77.850 1.00 58.91 ? 795 GLU C OE2 1 
ATOM   2984 N N   . LYS D 2 11  ? -107.050 10.498 56.860 1.00 34.32 ? 820 LYS D N   1 
ATOM   2985 C CA  . LYS D 2 11  ? -105.636 10.944 56.688 1.00 33.23 ? 820 LYS D CA  1 
ATOM   2986 C C   . LYS D 2 11  ? -105.477 12.403 57.128 1.00 31.52 ? 820 LYS D C   1 
ATOM   2987 O O   . LYS D 2 11  ? -106.089 13.312 56.557 1.00 30.90 ? 820 LYS D O   1 
ATOM   2988 C CB  . LYS D 2 11  ? -105.229 10.779 55.223 1.00 35.55 ? 820 LYS D CB  1 
ATOM   2989 C CG  . LYS D 2 11  ? -103.737 10.864 54.949 1.00 37.51 ? 820 LYS D CG  1 
ATOM   2990 C CD  . LYS D 2 11  ? -103.391 9.999  53.736 1.00 38.72 ? 820 LYS D CD  1 
ATOM   2991 C CE  . LYS D 2 11  ? -101.926 10.107 53.342 1.00 38.97 ? 820 LYS D CE  1 
ATOM   2992 N NZ  . LYS D 2 11  ? -101.626 11.401 52.678 1.00 38.55 ? 820 LYS D NZ  1 
ATOM   2993 N N   . ILE D 2 12  ? -104.668 12.619 58.159 1.00 28.06 ? 821 ILE D N   1 
ATOM   2994 C CA  . ILE D 2 12  ? -104.440 13.965 58.667 1.00 26.56 ? 821 ILE D CA  1 
ATOM   2995 C C   . ILE D 2 12  ? -102.956 14.309 58.715 1.00 23.98 ? 821 ILE D C   1 
ATOM   2996 O O   . ILE D 2 12  ? -102.100 13.427 58.697 1.00 24.08 ? 821 ILE D O   1 
ATOM   2997 C CB  . ILE D 2 12  ? -105.019 14.141 60.089 1.00 27.07 ? 821 ILE D CB  1 
ATOM   2998 C CG1 . ILE D 2 12  ? -104.341 13.164 61.054 1.00 24.49 ? 821 ILE D CG1 1 
ATOM   2999 C CG2 . ILE D 2 12  ? -106.529 13.935 60.061 1.00 26.86 ? 821 ILE D CG2 1 
ATOM   3000 C CD1 . ILE D 2 12  ? -104.630 13.449 62.511 1.00 24.32 ? 821 ILE D CD1 1 
ATOM   3001 N N   . PRO D 2 13  ? -102.635 15.608 58.774 1.00 22.59 ? 822 PRO D N   1 
ATOM   3002 C CA  . PRO D 2 13  ? -101.231 16.031 58.828 1.00 20.34 ? 822 PRO D CA  1 
ATOM   3003 C C   . PRO D 2 13  ? -100.556 15.439 60.061 1.00 21.21 ? 822 PRO D C   1 
ATOM   3004 O O   . PRO D 2 13  ? -101.195 15.258 61.098 1.00 22.09 ? 822 PRO D O   1 
ATOM   3005 C CB  . PRO D 2 13  ? -101.334 17.553 58.909 1.00 19.38 ? 822 PRO D CB  1 
ATOM   3006 C CG  . PRO D 2 13  ? -102.638 17.849 58.197 1.00 21.05 ? 822 PRO D CG  1 
ATOM   3007 C CD  . PRO D 2 13  ? -103.541 16.771 58.723 1.00 19.76 ? 822 PRO D CD  1 
ATOM   3008 N N   . VAL D 2 14  ? -99.269  15.131 59.956 1.00 21.55 ? 823 VAL D N   1 
ATOM   3009 C CA  . VAL D 2 14  ? -98.549  14.578 61.095 1.00 22.17 ? 823 VAL D CA  1 
ATOM   3010 C C   . VAL D 2 14  ? -98.278  15.678 62.117 1.00 21.29 ? 823 VAL D C   1 
ATOM   3011 O O   . VAL D 2 14  ? -98.037  15.395 63.291 1.00 22.11 ? 823 VAL D O   1 
ATOM   3012 C CB  . VAL D 2 14  ? -97.200  13.942 60.672 1.00 22.22 ? 823 VAL D CB  1 
ATOM   3013 C CG1 . VAL D 2 14  ? -97.449  12.735 59.767 1.00 22.22 ? 823 VAL D CG1 1 
ATOM   3014 C CG2 . VAL D 2 14  ? -96.341  14.973 59.958 1.00 23.23 ? 823 VAL D CG2 1 
ATOM   3015 N N   . GLU D 2 15  ? -98.336  16.930 61.668 1.00 20.14 ? 824 GLU D N   1 
ATOM   3016 C CA  . GLU D 2 15  ? -98.089  18.080 62.537 1.00 20.37 ? 824 GLU D CA  1 
ATOM   3017 C C   . GLU D 2 15  ? -99.371  18.621 63.169 1.00 19.22 ? 824 GLU D C   1 
ATOM   3018 O O   . GLU D 2 15  ? -99.343  19.630 63.868 1.00 19.77 ? 824 GLU D O   1 
ATOM   3019 C CB  . GLU D 2 15  ? -97.413  19.207 61.741 1.00 22.26 ? 824 GLU D CB  1 
ATOM   3020 C CG  . GLU D 2 15  ? -96.089  18.837 61.083 1.00 25.34 ? 824 GLU D CG  1 
ATOM   3021 C CD  . GLU D 2 15  ? -94.930  18.793 62.068 1.00 29.58 ? 824 GLU D CD  1 
ATOM   3022 O OE1 . GLU D 2 15  ? -94.687  19.804 62.757 1.00 30.44 ? 824 GLU D OE1 1 
ATOM   3023 O OE2 . GLU D 2 15  ? -94.252  17.753 62.150 1.00 33.83 ? 824 GLU D OE2 1 
ATOM   3024 N N   . ALA D 2 16  ? -100.492 17.950 62.927 1.00 18.33 ? 825 ALA D N   1 
ATOM   3025 C CA  . ALA D 2 16  ? -101.775 18.392 63.464 1.00 15.60 ? 825 ALA D CA  1 
ATOM   3026 C C   . ALA D 2 16  ? -102.016 17.920 64.896 1.00 15.06 ? 825 ALA D C   1 
ATOM   3027 O O   . ALA D 2 16  ? -101.494 16.889 65.323 1.00 12.20 ? 825 ALA D O   1 
ATOM   3028 C CB  . ALA D 2 16  ? -102.916 17.910 62.553 1.00 16.80 ? 825 ALA D CB  1 
ATOM   3029 N N   . ASP D 2 17  ? -102.814 18.696 65.624 1.00 14.31 ? 826 ASP D N   1 
ATOM   3030 C CA  . ASP D 2 17  ? -103.180 18.407 67.005 1.00 13.58 ? 826 ASP D CA  1 
ATOM   3031 C C   . ASP D 2 17  ? -102.074 18.659 68.015 1.00 14.86 ? 826 ASP D C   1 
ATOM   3032 O O   . ASP D 2 17  ? -101.967 17.967 69.035 1.00 11.88 ? 826 ASP D O   1 
ATOM   3033 C CB  . ASP D 2 17  ? -103.697 16.974 67.134 1.00 12.79 ? 826 ASP D CB  1 
ATOM   3034 C CG  . ASP D 2 17  ? -104.790 16.673 66.136 1.00 12.53 ? 826 ASP D CG  1 
ATOM   3035 O OD1 . ASP D 2 17  ? -105.722 17.499 65.994 1.00 12.29 ? 826 ASP D OD1 1 
ATOM   3036 O OD2 . ASP D 2 17  ? -104.710 15.617 65.491 1.00 13.13 ? 826 ASP D OD2 1 
ATOM   3037 N N   . PHE D 2 18  ? -101.264 19.667 67.710 1.00 15.16 ? 827 PHE D N   1 
ATOM   3038 C CA  . PHE D 2 18  ? -100.181 20.103 68.577 1.00 15.32 ? 827 PHE D CA  1 
ATOM   3039 C C   . PHE D 2 18  ? -100.534 21.514 69.012 1.00 16.44 ? 827 PHE D C   1 
ATOM   3040 O O   . PHE D 2 18  ? -101.145 22.278 68.258 1.00 15.97 ? 827 PHE D O   1 
ATOM   3041 C CB  . PHE D 2 18  ? -98.848  20.155 67.830 1.00 14.38 ? 827 PHE D CB  1 
ATOM   3042 C CG  . PHE D 2 18  ? -98.098  18.863 67.830 1.00 17.02 ? 827 PHE D CG  1 
ATOM   3043 C CD1 . PHE D 2 18  ? -97.192  18.571 68.849 1.00 15.88 ? 827 PHE D CD1 1 
ATOM   3044 C CD2 . PHE D 2 18  ? -98.287  17.935 66.807 1.00 14.59 ? 827 PHE D CD2 1 
ATOM   3045 C CE1 . PHE D 2 18  ? -96.482  17.378 68.842 1.00 17.81 ? 827 PHE D CE1 1 
ATOM   3046 C CE2 . PHE D 2 18  ? -97.582  16.743 66.797 1.00 15.80 ? 827 PHE D CE2 1 
ATOM   3047 C CZ  . PHE D 2 18  ? -96.679  16.462 67.815 1.00 15.10 ? 827 PHE D CZ  1 
ATOM   3048 N N   . LEU D 2 19  ? -100.150 21.857 70.231 1.00 16.07 ? 828 LEU D N   1 
ATOM   3049 C CA  . LEU D 2 19  ? -100.400 23.184 70.746 1.00 15.90 ? 828 LEU D CA  1 
ATOM   3050 C C   . LEU D 2 19  ? -99.168  23.588 71.536 1.00 14.90 ? 828 LEU D C   1 
ATOM   3051 O O   . LEU D 2 19  ? -98.746  22.887 72.453 1.00 14.17 ? 828 LEU D O   1 
ATOM   3052 C CB  . LEU D 2 19  ? -101.639 23.192 71.642 1.00 19.59 ? 828 LEU D CB  1 
ATOM   3053 C CG  . LEU D 2 19  ? -101.929 24.513 72.361 1.00 23.26 ? 828 LEU D CG  1 
ATOM   3054 C CD1 . LEU D 2 19  ? -102.113 25.655 71.383 1.00 23.48 ? 828 LEU D CD1 1 
ATOM   3055 C CD2 . LEU D 2 19  ? -103.175 24.335 73.174 1.00 28.41 ? 828 LEU D CD2 1 
ATOM   3056 N N   . TYR D 2 20  ? -98.577  24.708 71.159 1.00 14.28 ? 829 TYR D N   1 
ATOM   3057 C CA  . TYR D 2 20  ? -97.397  25.181 71.850 1.00 15.64 ? 829 TYR D CA  1 
ATOM   3058 C C   . TYR D 2 20  ? -97.719  26.462 72.600 1.00 14.19 ? 829 TYR D C   1 
ATOM   3059 O O   . TYR D 2 20  ? -97.938  27.513 71.994 1.00 15.86 ? 829 TYR D O   1 
ATOM   3060 C CB  . TYR D 2 20  ? -96.266  25.423 70.852 1.00 16.44 ? 829 TYR D CB  1 
ATOM   3061 C CG  . TYR D 2 20  ? -95.968  24.227 69.980 1.00 19.11 ? 829 TYR D CG  1 
ATOM   3062 C CD1 . TYR D 2 20  ? -96.715  23.976 68.833 1.00 21.04 ? 829 TYR D CD1 1 
ATOM   3063 C CD2 . TYR D 2 20  ? -94.934  23.344 70.298 1.00 21.34 ? 829 TYR D CD2 1 
ATOM   3064 C CE1 . TYR D 2 20  ? -96.438  22.878 68.013 1.00 21.44 ? 829 TYR D CE1 1 
ATOM   3065 C CE2 . TYR D 2 20  ? -94.654  22.239 69.486 1.00 22.44 ? 829 TYR D CE2 1 
ATOM   3066 C CZ  . TYR D 2 20  ? -95.410  22.017 68.345 1.00 22.82 ? 829 TYR D CZ  1 
ATOM   3067 O OH  . TYR D 2 20  ? -95.139  20.933 67.533 1.00 27.32 ? 829 TYR D OH  1 
ATOM   3068 N N   . ALA D 2 21  ? -97.771  26.359 73.921 1.00 13.17 ? 830 ALA D N   1 
ATOM   3069 C CA  . ALA D 2 21  ? -98.050  27.511 74.762 1.00 12.26 ? 830 ALA D CA  1 
ATOM   3070 C C   . ALA D 2 21  ? -96.709  28.118 75.178 1.00 11.76 ? 830 ALA D C   1 
ATOM   3071 O O   . ALA D 2 21  ? -96.133  27.741 76.205 1.00 11.43 ? 830 ALA D O   1 
ATOM   3072 C CB  . ALA D 2 21  ? -98.843  27.074 75.988 1.00 10.94 ? 830 ALA D CB  1 
ATOM   3073 N N   . TYR D 2 22  ? -96.198  29.041 74.372 1.00 12.36 ? 831 TYR D N   1 
ATOM   3074 C CA  . TYR D 2 22  ? -94.918  29.671 74.683 1.00 12.25 ? 831 TYR D CA  1 
ATOM   3075 C C   . TYR D 2 22  ? -95.109  30.779 75.699 1.00 11.86 ? 831 TYR D C   1 
ATOM   3076 O O   . TYR D 2 22  ? -96.095  31.515 75.645 1.00 11.88 ? 831 TYR D O   1 
ATOM   3077 C CB  . TYR D 2 22  ? -94.289  30.264 73.424 1.00 9.91  ? 831 TYR D CB  1 
ATOM   3078 C CG  . TYR D 2 22  ? -93.797  29.247 72.439 1.00 12.53 ? 831 TYR D CG  1 
ATOM   3079 C CD1 . TYR D 2 22  ? -92.669  28.465 72.708 1.00 13.14 ? 831 TYR D CD1 1 
ATOM   3080 C CD2 . TYR D 2 22  ? -94.460  29.056 71.232 1.00 12.58 ? 831 TYR D CD2 1 
ATOM   3081 C CE1 . TYR D 2 22  ? -92.217  27.518 71.786 1.00 14.62 ? 831 TYR D CE1 1 
ATOM   3082 C CE2 . TYR D 2 22  ? -94.022  28.118 70.316 1.00 14.54 ? 831 TYR D CE2 1 
ATOM   3083 C CZ  . TYR D 2 22  ? -92.901  27.354 70.596 1.00 15.09 ? 831 TYR D CZ  1 
ATOM   3084 O OH  . TYR D 2 22  ? -92.479  26.427 69.671 1.00 20.35 ? 831 TYR D OH  1 
ATOM   3085 N N   . SER D 2 23  ? -94.152  30.907 76.613 1.00 11.18 ? 832 SER D N   1 
ATOM   3086 C CA  . SER D 2 23  ? -94.221  31.938 77.635 1.00 11.00 ? 832 SER D CA  1 
ATOM   3087 C C   . SER D 2 23  ? -93.960  33.322 77.061 1.00 10.28 ? 832 SER D C   1 
ATOM   3088 O O   . SER D 2 23  ? -94.302  34.330 77.679 1.00 9.84  ? 832 SER D O   1 
ATOM   3089 C CB  . SER D 2 23  ? -93.187  31.668 78.734 1.00 11.50 ? 832 SER D CB  1 
ATOM   3090 O OG  . SER D 2 23  ? -91.856  31.773 78.241 1.00 11.40 ? 832 SER D OG  1 
ATOM   3091 N N   . THR D 2 24  ? -93.363  33.380 75.877 1.00 10.53 ? 833 THR D N   1 
ATOM   3092 C CA  . THR D 2 24  ? -93.026  34.670 75.298 1.00 11.68 ? 833 THR D CA  1 
ATOM   3093 C C   . THR D 2 24  ? -92.940  34.654 73.770 1.00 13.49 ? 833 THR D C   1 
ATOM   3094 O O   . THR D 2 24  ? -92.821  33.595 73.144 1.00 13.04 ? 833 THR D O   1 
ATOM   3095 C CB  . THR D 2 24  ? -91.673  35.167 75.913 1.00 11.93 ? 833 THR D CB  1 
ATOM   3096 O OG1 . THR D 2 24  ? -91.447  36.533 75.560 1.00 13.03 ? 833 THR D OG1 1 
ATOM   3097 C CG2 . THR D 2 24  ? -90.499  34.313 75.406 1.00 9.73  ? 833 THR D CG2 1 
ATOM   3098 N N   . ALA D 2 25  ? -93.006  35.843 73.180 1.00 13.92 ? 834 ALA D N   1 
ATOM   3099 C CA  . ALA D 2 25  ? -92.948  36.007 71.732 1.00 12.91 ? 834 ALA D CA  1 
ATOM   3100 C C   . ALA D 2 25  ? -91.624  35.535 71.145 1.00 13.46 ? 834 ALA D C   1 
ATOM   3101 O O   . ALA D 2 25  ? -90.610  35.481 71.835 1.00 11.45 ? 834 ALA D O   1 
ATOM   3102 C CB  . ALA D 2 25  ? -93.160  37.473 71.374 1.00 12.86 ? 834 ALA D CB  1 
ATOM   3103 N N   . PRO D 2 26  ? -91.623  35.193 69.848 1.00 14.62 ? 835 PRO D N   1 
ATOM   3104 C CA  . PRO D 2 26  ? -90.421  34.730 69.146 1.00 14.92 ? 835 PRO D CA  1 
ATOM   3105 C C   . PRO D 2 26  ? -89.291  35.749 69.272 1.00 15.28 ? 835 PRO D C   1 
ATOM   3106 O O   . PRO D 2 26  ? -89.499  36.945 69.076 1.00 13.29 ? 835 PRO D O   1 
ATOM   3107 C CB  . PRO D 2 26  ? -90.899  34.600 67.703 1.00 15.55 ? 835 PRO D CB  1 
ATOM   3108 C CG  . PRO D 2 26  ? -92.348  34.221 67.863 1.00 15.50 ? 835 PRO D CG  1 
ATOM   3109 C CD  . PRO D 2 26  ? -92.803  35.138 68.967 1.00 13.81 ? 835 PRO D CD  1 
ATOM   3110 N N   . GLY D 2 27  ? -88.105  35.272 69.623 1.00 15.09 ? 836 GLY D N   1 
ATOM   3111 C CA  . GLY D 2 27  ? -86.958  36.155 69.738 1.00 18.21 ? 836 GLY D CA  1 
ATOM   3112 C C   . GLY D 2 27  ? -86.832  36.960 71.016 1.00 18.34 ? 836 GLY D C   1 
ATOM   3113 O O   . GLY D 2 27  ? -85.870  37.715 71.168 1.00 17.41 ? 836 GLY D O   1 
ATOM   3114 N N   . TYR D 2 28  ? -87.775  36.799 71.941 1.00 16.85 ? 837 TYR D N   1 
ATOM   3115 C CA  . TYR D 2 28  ? -87.724  37.556 73.188 1.00 16.48 ? 837 TYR D CA  1 
ATOM   3116 C C   . TYR D 2 28  ? -87.343  36.776 74.431 1.00 15.83 ? 837 TYR D C   1 
ATOM   3117 O O   . TYR D 2 28  ? -87.428  35.546 74.481 1.00 15.66 ? 837 TYR D O   1 
ATOM   3118 C CB  . TYR D 2 28  ? -89.068  38.236 73.464 1.00 16.40 ? 837 TYR D CB  1 
ATOM   3119 C CG  . TYR D 2 28  ? -89.328  39.480 72.646 1.00 15.49 ? 837 TYR D CG  1 
ATOM   3120 C CD1 . TYR D 2 28  ? -89.772  39.393 71.329 1.00 14.80 ? 837 TYR D CD1 1 
ATOM   3121 C CD2 . TYR D 2 28  ? -89.132  40.752 73.199 1.00 14.57 ? 837 TYR D CD2 1 
ATOM   3122 C CE1 . TYR D 2 28  ? -90.023  40.546 70.576 1.00 16.81 ? 837 TYR D CE1 1 
ATOM   3123 C CE2 . TYR D 2 28  ? -89.376  41.909 72.457 1.00 15.82 ? 837 TYR D CE2 1 
ATOM   3124 C CZ  . TYR D 2 28  ? -89.823  41.800 71.147 1.00 16.04 ? 837 TYR D CZ  1 
ATOM   3125 O OH  . TYR D 2 28  ? -90.068  42.939 70.409 1.00 16.97 ? 837 TYR D OH  1 
ATOM   3126 N N   . TYR D 2 29  ? -86.932  37.530 75.445 1.00 14.32 ? 838 TYR D N   1 
ATOM   3127 C CA  . TYR D 2 29  ? -86.578  36.980 76.743 1.00 12.76 ? 838 TYR D CA  1 
ATOM   3128 C C   . TYR D 2 29  ? -87.881  36.605 77.461 1.00 12.64 ? 838 TYR D C   1 
ATOM   3129 O O   . TYR D 2 29  ? -88.954  37.114 77.132 1.00 10.54 ? 838 TYR D O   1 
ATOM   3130 C CB  . TYR D 2 29  ? -85.901  38.040 77.612 1.00 13.33 ? 838 TYR D CB  1 
ATOM   3131 C CG  . TYR D 2 29  ? -84.442  38.328 77.358 1.00 16.03 ? 838 TYR D CG  1 
ATOM   3132 C CD1 . TYR D 2 29  ? -83.460  37.393 77.675 1.00 15.92 ? 838 TYR D CD1 1 
ATOM   3133 C CD2 . TYR D 2 29  ? -84.037  39.581 76.906 1.00 16.38 ? 838 TYR D CD2 1 
ATOM   3134 C CE1 . TYR D 2 29  ? -82.110  37.702 77.559 1.00 17.18 ? 838 TYR D CE1 1 
ATOM   3135 C CE2 . TYR D 2 29  ? -82.695  39.904 76.786 1.00 18.31 ? 838 TYR D CE2 1 
ATOM   3136 C CZ  . TYR D 2 29  ? -81.733  38.962 77.116 1.00 18.64 ? 838 TYR D CZ  1 
ATOM   3137 O OH  . TYR D 2 29  ? -80.401  39.285 77.009 1.00 20.57 ? 838 TYR D OH  1 
ATOM   3138 N N   . SER D 2 30  ? -87.777  35.733 78.458 1.00 13.42 ? 839 SER D N   1 
ATOM   3139 C CA  . SER D 2 30  ? -88.935  35.345 79.259 1.00 13.37 ? 839 SER D CA  1 
ATOM   3140 C C   . SER D 2 30  ? -88.548  35.660 80.700 1.00 12.90 ? 839 SER D C   1 
ATOM   3141 O O   . SER D 2 30  ? -87.413  35.398 81.110 1.00 13.04 ? 839 SER D O   1 
ATOM   3142 C CB  . SER D 2 30  ? -89.229  33.857 79.108 1.00 12.63 ? 839 SER D CB  1 
ATOM   3143 O OG  . SER D 2 30  ? -90.438  33.521 79.761 1.00 15.97 ? 839 SER D OG  1 
ATOM   3144 N N   . TRP D 2 31  ? -89.482  36.215 81.466 1.00 13.49 ? 840 TRP D N   1 
ATOM   3145 C CA  . TRP D 2 31  ? -89.187  36.598 82.845 1.00 12.63 ? 840 TRP D CA  1 
ATOM   3146 C C   . TRP D 2 31  ? -89.612  35.653 83.957 1.00 13.86 ? 840 TRP D C   1 
ATOM   3147 O O   . TRP D 2 31  ? -90.673  35.019 83.902 1.00 12.12 ? 840 TRP D O   1 
ATOM   3148 C CB  . TRP D 2 31  ? -89.744  37.992 83.123 1.00 11.62 ? 840 TRP D CB  1 
ATOM   3149 C CG  . TRP D 2 31  ? -89.014  39.054 82.370 1.00 12.05 ? 840 TRP D CG  1 
ATOM   3150 C CD1 . TRP D 2 31  ? -89.326  39.554 81.136 1.00 14.36 ? 840 TRP D CD1 1 
ATOM   3151 C CD2 . TRP D 2 31  ? -87.824  39.733 82.788 1.00 10.97 ? 840 TRP D CD2 1 
ATOM   3152 N NE1 . TRP D 2 31  ? -88.402  40.506 80.762 1.00 14.22 ? 840 TRP D NE1 1 
ATOM   3153 C CE2 . TRP D 2 31  ? -87.469  40.631 81.758 1.00 10.93 ? 840 TRP D CE2 1 
ATOM   3154 C CE3 . TRP D 2 31  ? -87.018  39.667 83.934 1.00 12.91 ? 840 TRP D CE3 1 
ATOM   3155 C CZ2 . TRP D 2 31  ? -86.346  41.460 81.839 1.00 11.48 ? 840 TRP D CZ2 1 
ATOM   3156 C CZ3 . TRP D 2 31  ? -85.894  40.500 84.011 1.00 10.88 ? 840 TRP D CZ3 1 
ATOM   3157 C CH2 . TRP D 2 31  ? -85.573  41.378 82.969 1.00 10.61 ? 840 TRP D CH2 1 
ATOM   3158 N N   . ARG D 2 32  ? -88.768  35.598 84.984 1.00 12.33 ? 841 ARG D N   1 
ATOM   3159 C CA  . ARG D 2 32  ? -88.980  34.737 86.137 1.00 14.86 ? 841 ARG D CA  1 
ATOM   3160 C C   . ARG D 2 32  ? -88.721  35.508 87.437 1.00 16.39 ? 841 ARG D C   1 
ATOM   3161 O O   . ARG D 2 32  ? -87.778  36.301 87.521 1.00 16.40 ? 841 ARG D O   1 
ATOM   3162 C CB  . ARG D 2 32  ? -88.021  33.540 86.051 1.00 13.94 ? 841 ARG D CB  1 
ATOM   3163 C CG  . ARG D 2 32  ? -88.212  32.458 87.096 1.00 14.92 ? 841 ARG D CG  1 
ATOM   3164 C CD  . ARG D 2 32  ? -87.120  31.401 86.970 1.00 14.10 ? 841 ARG D CD  1 
ATOM   3165 N NE  . ARG D 2 32  ? -85.885  31.855 87.601 1.00 25.73 ? 841 ARG D NE  1 
ATOM   3166 C CZ  . ARG D 2 32  ? -84.803  32.278 86.958 1.00 23.26 ? 841 ARG D CZ  1 
ATOM   3167 N NH1 . ARG D 2 32  ? -84.766  32.309 85.637 1.00 28.33 ? 841 ARG D NH1 1 
ATOM   3168 N NH2 . ARG D 2 32  ? -83.756  32.696 87.648 1.00 31.31 ? 841 ARG D NH2 1 
ATOM   3169 N N   . ASN D 2 33  ? -89.562  35.273 88.440 1.00 16.35 ? 842 ASN D N   1 
ATOM   3170 C CA  . ASN D 2 33  ? -89.416  35.910 89.745 1.00 16.04 ? 842 ASN D CA  1 
ATOM   3171 C C   . ASN D 2 33  ? -88.836  34.864 90.689 1.00 16.85 ? 842 ASN D C   1 
ATOM   3172 O O   . ASN D 2 33  ? -89.349  33.748 90.791 1.00 15.50 ? 842 ASN D O   1 
ATOM   3173 C CB  . ASN D 2 33  ? -90.770  36.409 90.259 1.00 17.04 ? 842 ASN D CB  1 
ATOM   3174 C CG  . ASN D 2 33  ? -90.672  37.041 91.641 1.00 17.37 ? 842 ASN D CG  1 
ATOM   3175 O OD1 . ASN D 2 33  ? -90.621  36.342 92.651 1.00 17.26 ? 842 ASN D OD1 1 
ATOM   3176 N ND2 . ASN D 2 33  ? -90.633  38.370 91.686 1.00 14.87 ? 842 ASN D ND2 1 
ATOM   3177 N N   . SER D 2 34  ? -87.759  35.233 91.371 1.00 18.31 ? 843 SER D N   1 
ATOM   3178 C CA  . SER D 2 34  ? -87.048  34.335 92.284 1.00 20.44 ? 843 SER D CA  1 
ATOM   3179 C C   . SER D 2 34  ? -87.873  33.654 93.357 1.00 20.45 ? 843 SER D C   1 
ATOM   3180 O O   . SER D 2 34  ? -87.533  32.559 93.798 1.00 20.32 ? 843 SER D O   1 
ATOM   3181 C CB  . SER D 2 34  ? -85.901  35.089 92.960 1.00 21.32 ? 843 SER D CB  1 
ATOM   3182 O OG  . SER D 2 34  ? -85.028  35.626 91.983 1.00 27.24 ? 843 SER D OG  1 
ATOM   3183 N N   . LYS D 2 35  ? -88.950  34.291 93.794 1.00 21.83 ? 844 LYS D N   1 
ATOM   3184 C CA  . LYS D 2 35  ? -89.757  33.691 94.842 1.00 23.29 ? 844 LYS D CA  1 
ATOM   3185 C C   . LYS D 2 35  ? -91.131  33.217 94.395 1.00 23.32 ? 844 LYS D C   1 
ATOM   3186 O O   . LYS D 2 35  ? -91.671  32.271 94.971 1.00 22.56 ? 844 LYS D O   1 
ATOM   3187 C CB  . LYS D 2 35  ? -89.913  34.668 96.014 1.00 25.47 ? 844 LYS D CB  1 
ATOM   3188 C CG  . LYS D 2 35  ? -90.980  35.724 95.822 1.00 30.96 ? 844 LYS D CG  1 
ATOM   3189 C CD  . LYS D 2 35  ? -91.289  36.454 97.131 1.00 33.56 ? 844 LYS D CD  1 
ATOM   3190 C CE  . LYS D 2 35  ? -92.455  37.427 96.950 1.00 36.62 ? 844 LYS D CE  1 
ATOM   3191 N NZ  . LYS D 2 35  ? -92.830  38.141 98.207 1.00 37.86 ? 844 LYS D NZ  1 
ATOM   3192 N N   . ASP D 2 36  ? -91.689  33.861 93.369 1.00 22.23 ? 845 ASP D N   1 
ATOM   3193 C CA  . ASP D 2 36  ? -93.022  33.507 92.877 1.00 22.69 ? 845 ASP D CA  1 
ATOM   3194 C C   . ASP D 2 36  ? -93.041  32.590 91.655 1.00 21.52 ? 845 ASP D C   1 
ATOM   3195 O O   . ASP D 2 36  ? -94.078  32.001 91.334 1.00 21.51 ? 845 ASP D O   1 
ATOM   3196 C CB  . ASP D 2 36  ? -93.821  34.772 92.535 1.00 24.53 ? 845 ASP D CB  1 
ATOM   3197 C CG  . ASP D 2 36  ? -93.873  35.766 93.683 1.00 27.94 ? 845 ASP D CG  1 
ATOM   3198 O OD1 . ASP D 2 36  ? -94.086  35.347 94.844 1.00 29.63 ? 845 ASP D OD1 1 
ATOM   3199 O OD2 . ASP D 2 36  ? -93.713  36.974 93.414 1.00 30.12 ? 845 ASP D OD2 1 
ATOM   3200 N N   . GLY D 2 37  ? -91.907  32.474 90.972 1.00 18.27 ? 846 GLY D N   1 
ATOM   3201 C CA  . GLY D 2 37  ? -91.855  31.641 89.786 1.00 15.69 ? 846 GLY D CA  1 
ATOM   3202 C C   . GLY D 2 37  ? -91.981  32.529 88.566 1.00 14.83 ? 846 GLY D C   1 
ATOM   3203 O O   . GLY D 2 37  ? -92.065  33.751 88.698 1.00 13.15 ? 846 GLY D O   1 
ATOM   3204 N N   . SER D 2 38  ? -92.015  31.934 87.378 1.00 13.39 ? 847 SER D N   1 
ATOM   3205 C CA  . SER D 2 38  ? -92.118  32.725 86.153 1.00 12.55 ? 847 SER D CA  1 
ATOM   3206 C C   . SER D 2 38  ? -93.486  33.381 86.025 1.00 11.60 ? 847 SER D C   1 
ATOM   3207 O O   . SER D 2 38  ? -94.485  32.859 86.518 1.00 14.70 ? 847 SER D O   1 
ATOM   3208 C CB  . SER D 2 38  ? -91.853  31.850 84.924 1.00 11.90 ? 847 SER D CB  1 
ATOM   3209 O OG  . SER D 2 38  ? -92.808  30.808 84.814 1.00 11.90 ? 847 SER D OG  1 
ATOM   3210 N N   . TRP D 2 39  ? -93.522  34.530 85.363 1.00 11.92 ? 848 TRP D N   1 
ATOM   3211 C CA  . TRP D 2 39  ? -94.768  35.261 85.159 1.00 11.45 ? 848 TRP D CA  1 
ATOM   3212 C C   . TRP D 2 39  ? -95.770  34.399 84.400 1.00 14.04 ? 848 TRP D C   1 
ATOM   3213 O O   . TRP D 2 39  ? -96.963  34.364 84.724 1.00 14.97 ? 848 TRP D O   1 
ATOM   3214 C CB  . TRP D 2 39  ? -94.513  36.525 84.342 1.00 11.29 ? 848 TRP D CB  1 
ATOM   3215 C CG  . TRP D 2 39  ? -93.516  37.483 84.918 1.00 10.38 ? 848 TRP D CG  1 
ATOM   3216 C CD1 . TRP D 2 39  ? -92.937  37.441 86.164 1.00 10.51 ? 848 TRP D CD1 1 
ATOM   3217 C CD2 . TRP D 2 39  ? -93.014  38.665 84.283 1.00 9.76  ? 848 TRP D CD2 1 
ATOM   3218 N NE1 . TRP D 2 39  ? -92.110  38.529 86.335 1.00 8.11  ? 848 TRP D NE1 1 
ATOM   3219 C CE2 . TRP D 2 39  ? -92.139  39.295 85.198 1.00 8.60  ? 848 TRP D CE2 1 
ATOM   3220 C CE3 . TRP D 2 39  ? -93.221  39.255 83.024 1.00 9.59  ? 848 TRP D CE3 1 
ATOM   3221 C CZ2 . TRP D 2 39  ? -91.473  40.489 84.896 1.00 10.24 ? 848 TRP D CZ2 1 
ATOM   3222 C CZ3 . TRP D 2 39  ? -92.561  40.440 82.721 1.00 9.05  ? 848 TRP D CZ3 1 
ATOM   3223 C CH2 . TRP D 2 39  ? -91.694  41.045 83.658 1.00 12.72 ? 848 TRP D CH2 1 
ATOM   3224 N N   . PHE D 2 40  ? -95.274  33.709 83.377 1.00 11.94 ? 849 PHE D N   1 
ATOM   3225 C CA  . PHE D 2 40  ? -96.118  32.852 82.560 1.00 11.33 ? 849 PHE D CA  1 
ATOM   3226 C C   . PHE D 2 40  ? -96.726  31.687 83.339 1.00 11.89 ? 849 PHE D C   1 
ATOM   3227 O O   . PHE D 2 40  ? -97.945  31.532 83.373 1.00 11.18 ? 849 PHE D O   1 
ATOM   3228 C CB  . PHE D 2 40  ? -95.326  32.301 81.371 1.00 10.32 ? 849 PHE D CB  1 
ATOM   3229 C CG  . PHE D 2 40  ? -96.149  31.455 80.427 1.00 10.06 ? 849 PHE D CG  1 
ATOM   3230 C CD1 . PHE D 2 40  ? -97.272  31.987 79.795 1.00 10.33 ? 849 PHE D CD1 1 
ATOM   3231 C CD2 . PHE D 2 40  ? -95.771  30.150 80.131 1.00 7.90  ? 849 PHE D CD2 1 
ATOM   3232 C CE1 . PHE D 2 40  ? -98.009  31.235 78.870 1.00 9.16  ? 849 PHE D CE1 1 
ATOM   3233 C CE2 . PHE D 2 40  ? -96.496  29.388 79.209 1.00 11.61 ? 849 PHE D CE2 1 
ATOM   3234 C CZ  . PHE D 2 40  ? -97.616  29.931 78.576 1.00 10.83 ? 849 PHE D CZ  1 
ATOM   3235 N N   . ILE D 2 41  ? -95.886  30.873 83.971 1.00 11.22 ? 850 ILE D N   1 
ATOM   3236 C CA  . ILE D 2 41  ? -96.407  29.723 84.690 1.00 11.63 ? 850 ILE D CA  1 
ATOM   3237 C C   . ILE D 2 41  ? -97.377  30.070 85.803 1.00 11.78 ? 850 ILE D C   1 
ATOM   3238 O O   . ILE D 2 41  ? -98.426  29.451 85.906 1.00 12.50 ? 850 ILE D O   1 
ATOM   3239 C CB  . ILE D 2 41  ? -95.292  28.840 85.260 1.00 11.82 ? 850 ILE D CB  1 
ATOM   3240 C CG1 . ILE D 2 41  ? -94.417  28.305 84.116 1.00 10.82 ? 850 ILE D CG1 1 
ATOM   3241 C CG2 . ILE D 2 41  ? -95.910  27.677 86.026 1.00 9.67  ? 850 ILE D CG2 1 
ATOM   3242 C CD1 . ILE D 2 41  ? -95.192  27.527 83.046 1.00 13.20 ? 850 ILE D CD1 1 
ATOM   3243 N N   . GLN D 2 42  ? -97.052  31.055 86.631 1.00 12.80 ? 851 GLN D N   1 
ATOM   3244 C CA  . GLN D 2 42  ? -97.975  31.395 87.699 1.00 15.38 ? 851 GLN D CA  1 
ATOM   3245 C C   . GLN D 2 42  ? -99.298  31.937 87.135 1.00 14.12 ? 851 GLN D C   1 
ATOM   3246 O O   . GLN D 2 42  ? -100.361 31.660 87.680 1.00 13.57 ? 851 GLN D O   1 
ATOM   3247 C CB  . GLN D 2 42  ? -97.328  32.369 88.717 1.00 19.02 ? 851 GLN D CB  1 
ATOM   3248 C CG  . GLN D 2 42  ? -97.080  33.801 88.283 1.00 22.26 ? 851 GLN D CG  1 
ATOM   3249 C CD  . GLN D 2 42  ? -96.272  34.587 89.336 1.00 25.30 ? 851 GLN D CD  1 
ATOM   3250 O OE1 . GLN D 2 42  ? -95.039  34.681 89.260 1.00 27.23 ? 851 GLN D OE1 1 
ATOM   3251 N NE2 . GLN D 2 42  ? -96.968  35.140 90.322 1.00 22.52 ? 851 GLN D NE2 1 
ATOM   3252 N N   . SER D 2 43  ? -99.240  32.686 86.036 1.00 13.98 ? 852 SER D N   1 
ATOM   3253 C CA  . SER D 2 43  ? -100.459 33.212 85.416 1.00 12.98 ? 852 SER D CA  1 
ATOM   3254 C C   . SER D 2 43  ? -101.264 32.065 84.806 1.00 12.45 ? 852 SER D C   1 
ATOM   3255 O O   . SER D 2 43  ? -102.488 32.027 84.917 1.00 11.90 ? 852 SER D O   1 
ATOM   3256 C CB  . SER D 2 43  ? -100.116 34.235 84.331 1.00 13.78 ? 852 SER D CB  1 
ATOM   3257 O OG  . SER D 2 43  ? -99.474  35.358 84.907 1.00 15.77 ? 852 SER D OG  1 
ATOM   3258 N N   . LEU D 2 44  ? -100.566 31.128 84.170 1.00 8.97  ? 853 LEU D N   1 
ATOM   3259 C CA  . LEU D 2 44  ? -101.216 29.969 83.574 1.00 8.91  ? 853 LEU D CA  1 
ATOM   3260 C C   . LEU D 2 44  ? -101.937 29.136 84.642 1.00 12.09 ? 853 LEU D C   1 
ATOM   3261 O O   . LEU D 2 44  ? -103.095 28.753 84.467 1.00 9.60  ? 853 LEU D O   1 
ATOM   3262 C CB  . LEU D 2 44  ? -100.189 29.088 82.854 1.00 8.89  ? 853 LEU D CB  1 
ATOM   3263 C CG  . LEU D 2 44  ? -100.641 27.692 82.403 1.00 7.77  ? 853 LEU D CG  1 
ATOM   3264 C CD1 . LEU D 2 44  ? -101.755 27.808 81.384 1.00 5.90  ? 853 LEU D CD1 1 
ATOM   3265 C CD2 . LEU D 2 44  ? -99.458  26.934 81.813 1.00 9.14  ? 853 LEU D CD2 1 
ATOM   3266 N N   . CYS D 2 45  ? -101.249 28.852 85.744 1.00 13.38 ? 854 CYS D N   1 
ATOM   3267 C CA  . CYS D 2 45  ? -101.855 28.062 86.801 1.00 15.44 ? 854 CYS D CA  1 
ATOM   3268 C C   . CYS D 2 45  ? -103.059 28.773 87.395 1.00 14.26 ? 854 CYS D C   1 
ATOM   3269 O O   . CYS D 2 45  ? -104.076 28.145 87.678 1.00 9.74  ? 854 CYS D O   1 
ATOM   3270 C CB  . CYS D 2 45  ? -100.823 27.739 87.887 1.00 18.20 ? 854 CYS D CB  1 
ATOM   3271 S SG  . CYS D 2 45  ? -99.670  26.403 87.396 1.00 22.59 ? 854 CYS D SG  1 
ATOM   3272 N N   . ALA D 2 46  ? -102.947 30.086 87.568 1.00 13.46 ? 855 ALA D N   1 
ATOM   3273 C CA  . ALA D 2 46  ? -104.048 30.865 88.120 1.00 12.87 ? 855 ALA D CA  1 
ATOM   3274 C C   . ALA D 2 46  ? -105.277 30.789 87.222 1.00 11.53 ? 855 ALA D C   1 
ATOM   3275 O O   . ALA D 2 46  ? -106.379 30.566 87.701 1.00 13.17 ? 855 ALA D O   1 
ATOM   3276 C CB  . ALA D 2 46  ? -103.631 32.322 88.306 1.00 11.10 ? 855 ALA D CB  1 
ATOM   3277 N N   . MET D 2 47  ? -105.086 30.975 85.920 1.00 13.00 ? 856 MET D N   1 
ATOM   3278 C CA  . MET D 2 47  ? -106.203 30.938 84.987 1.00 12.68 ? 856 MET D CA  1 
ATOM   3279 C C   . MET D 2 47  ? -106.810 29.545 84.855 1.00 13.86 ? 856 MET D C   1 
ATOM   3280 O O   . MET D 2 47  ? -108.032 29.402 84.730 1.00 13.89 ? 856 MET D O   1 
ATOM   3281 C CB  . MET D 2 47  ? -105.780 31.477 83.615 1.00 13.92 ? 856 MET D CB  1 
ATOM   3282 C CG  . MET D 2 47  ? -105.446 32.969 83.617 1.00 13.08 ? 856 MET D CG  1 
ATOM   3283 S SD  . MET D 2 47  ? -106.801 34.017 84.225 1.00 15.15 ? 856 MET D SD  1 
ATOM   3284 C CE  . MET D 2 47  ? -106.373 34.188 85.982 1.00 11.55 ? 856 MET D CE  1 
ATOM   3285 N N   . LEU D 2 48  ? -105.976 28.513 84.886 1.00 12.28 ? 857 LEU D N   1 
ATOM   3286 C CA  . LEU D 2 48  ? -106.505 27.157 84.798 1.00 13.71 ? 857 LEU D CA  1 
ATOM   3287 C C   . LEU D 2 48  ? -107.324 26.859 86.055 1.00 14.01 ? 857 LEU D C   1 
ATOM   3288 O O   . LEU D 2 48  ? -108.408 26.280 85.973 1.00 11.29 ? 857 LEU D O   1 
ATOM   3289 C CB  . LEU D 2 48  ? -105.376 26.125 84.652 1.00 13.28 ? 857 LEU D CB  1 
ATOM   3290 C CG  . LEU D 2 48  ? -104.730 26.020 83.265 1.00 12.76 ? 857 LEU D CG  1 
ATOM   3291 C CD1 . LEU D 2 48  ? -103.623 24.988 83.287 1.00 10.09 ? 857 LEU D CD1 1 
ATOM   3292 C CD2 . LEU D 2 48  ? -105.791 25.649 82.237 1.00 13.50 ? 857 LEU D CD2 1 
ATOM   3293 N N   . LYS D 2 49  ? -106.814 27.270 87.216 1.00 16.49 ? 858 LYS D N   1 
ATOM   3294 C CA  . LYS D 2 49  ? -107.524 27.032 88.470 1.00 18.35 ? 858 LYS D CA  1 
ATOM   3295 C C   . LYS D 2 49  ? -108.906 27.687 88.451 1.00 18.38 ? 858 LYS D C   1 
ATOM   3296 O O   . LYS D 2 49  ? -109.890 27.088 88.886 1.00 17.79 ? 858 LYS D O   1 
ATOM   3297 C CB  . LYS D 2 49  ? -106.734 27.577 89.672 1.00 21.08 ? 858 LYS D CB  1 
ATOM   3298 C CG  . LYS D 2 49  ? -105.354 26.946 89.891 1.00 29.77 ? 858 LYS D CG  1 
ATOM   3299 C CD  . LYS D 2 49  ? -104.734 27.395 91.223 1.00 28.51 ? 858 LYS D CD  1 
ATOM   3300 C CE  . LYS D 2 49  ? -103.240 27.076 91.308 1.00 30.91 ? 858 LYS D CE  1 
ATOM   3301 N NZ  . LYS D 2 49  ? -102.375 28.084 90.597 1.00 27.21 ? 858 LYS D NZ  1 
ATOM   3302 N N   . GLN D 2 50  ? -108.981 28.911 87.939 1.00 18.04 ? 859 GLN D N   1 
ATOM   3303 C CA  . GLN D 2 50  ? -110.248 29.639 87.906 1.00 19.47 ? 859 GLN D CA  1 
ATOM   3304 C C   . GLN D 2 50  ? -111.173 29.327 86.743 1.00 17.60 ? 859 GLN D C   1 
ATOM   3305 O O   . GLN D 2 50  ? -112.390 29.365 86.899 1.00 18.39 ? 859 GLN D O   1 
ATOM   3306 C CB  . GLN D 2 50  ? -109.997 31.147 87.901 1.00 20.70 ? 859 GLN D CB  1 
ATOM   3307 C CG  . GLN D 2 50  ? -108.963 31.596 88.907 1.00 28.56 ? 859 GLN D CG  1 
ATOM   3308 C CD  . GLN D 2 50  ? -108.763 33.104 88.925 1.00 32.81 ? 859 GLN D CD  1 
ATOM   3309 O OE1 . GLN D 2 50  ? -107.815 33.609 89.541 1.00 33.57 ? 859 GLN D OE1 1 
ATOM   3310 N NE2 . GLN D 2 50  ? -109.655 33.832 88.256 1.00 31.52 ? 859 GLN D NE2 1 
ATOM   3311 N N   . TYR D 2 51  ? -110.612 29.000 85.585 1.00 15.67 ? 860 TYR D N   1 
ATOM   3312 C CA  . TYR D 2 51  ? -111.440 28.781 84.408 1.00 15.40 ? 860 TYR D CA  1 
ATOM   3313 C C   . TYR D 2 51  ? -111.467 27.418 83.722 1.00 14.63 ? 860 TYR D C   1 
ATOM   3314 O O   . TYR D 2 51  ? -112.286 27.207 82.824 1.00 12.96 ? 860 TYR D O   1 
ATOM   3315 C CB  . TYR D 2 51  ? -111.093 29.844 83.365 1.00 14.55 ? 860 TYR D CB  1 
ATOM   3316 C CG  . TYR D 2 51  ? -111.342 31.268 83.815 1.00 17.25 ? 860 TYR D CG  1 
ATOM   3317 C CD1 . TYR D 2 51  ? -112.641 31.740 84.023 1.00 18.03 ? 860 TYR D CD1 1 
ATOM   3318 C CD2 . TYR D 2 51  ? -110.282 32.156 83.991 1.00 16.89 ? 860 TYR D CD2 1 
ATOM   3319 C CE1 . TYR D 2 51  ? -112.874 33.062 84.386 1.00 16.76 ? 860 TYR D CE1 1 
ATOM   3320 C CE2 . TYR D 2 51  ? -110.504 33.478 84.353 1.00 16.04 ? 860 TYR D CE2 1 
ATOM   3321 C CZ  . TYR D 2 51  ? -111.799 33.924 84.547 1.00 16.80 ? 860 TYR D CZ  1 
ATOM   3322 O OH  . TYR D 2 51  ? -112.017 35.237 84.897 1.00 13.88 ? 860 TYR D OH  1 
ATOM   3323 N N   . ALA D 2 52  ? -110.591 26.501 84.121 1.00 14.73 ? 861 ALA D N   1 
ATOM   3324 C CA  . ALA D 2 52  ? -110.556 25.180 83.496 1.00 16.16 ? 861 ALA D CA  1 
ATOM   3325 C C   . ALA D 2 52  ? -111.897 24.440 83.529 1.00 16.84 ? 861 ALA D C   1 
ATOM   3326 O O   . ALA D 2 52  ? -112.135 23.554 82.715 1.00 18.07 ? 861 ALA D O   1 
ATOM   3327 C CB  . ALA D 2 52  ? -109.471 24.320 84.139 1.00 15.60 ? 861 ALA D CB  1 
ATOM   3328 N N   . ASP D 2 53  ? -112.780 24.803 84.453 1.00 18.12 ? 862 ASP D N   1 
ATOM   3329 C CA  . ASP D 2 53  ? -114.075 24.130 84.549 1.00 19.14 ? 862 ASP D CA  1 
ATOM   3330 C C   . ASP D 2 53  ? -115.169 24.706 83.638 1.00 20.49 ? 862 ASP D C   1 
ATOM   3331 O O   . ASP D 2 53  ? -116.308 24.247 83.672 1.00 20.07 ? 862 ASP D O   1 
ATOM   3332 C CB  . ASP D 2 53  ? -114.562 24.135 86.002 1.00 19.34 ? 862 ASP D CB  1 
ATOM   3333 C CG  . ASP D 2 53  ? -114.821 25.531 86.526 1.00 20.41 ? 862 ASP D CG  1 
ATOM   3334 O OD1 . ASP D 2 53  ? -114.669 26.503 85.757 1.00 22.78 ? 862 ASP D OD1 1 
ATOM   3335 O OD2 . ASP D 2 53  ? -115.183 25.657 87.710 1.00 23.32 ? 862 ASP D OD2 1 
ATOM   3336 N N   . LYS D 2 54  ? -114.833 25.706 82.829 1.00 21.77 ? 863 LYS D N   1 
ATOM   3337 C CA  . LYS D 2 54  ? -115.815 26.288 81.913 1.00 24.58 ? 863 LYS D CA  1 
ATOM   3338 C C   . LYS D 2 54  ? -115.253 26.746 80.574 1.00 23.04 ? 863 LYS D C   1 
ATOM   3339 O O   . LYS D 2 54  ? -115.826 26.432 79.535 1.00 26.37 ? 863 LYS D O   1 
ATOM   3340 C CB  . LYS D 2 54  ? -116.554 27.460 82.570 1.00 25.80 ? 863 LYS D CB  1 
ATOM   3341 C CG  . LYS D 2 54  ? -115.652 28.465 83.269 1.00 30.82 ? 863 LYS D CG  1 
ATOM   3342 C CD  . LYS D 2 54  ? -116.477 29.580 83.913 1.00 35.40 ? 863 LYS D CD  1 
ATOM   3343 C CE  . LYS D 2 54  ? -115.636 30.430 84.861 1.00 37.87 ? 863 LYS D CE  1 
ATOM   3344 N NZ  . LYS D 2 54  ? -116.386 31.600 85.413 1.00 36.63 ? 863 LYS D NZ  1 
ATOM   3345 N N   . LEU D 2 55  ? -114.133 27.467 80.589 1.00 20.81 ? 864 LEU D N   1 
ATOM   3346 C CA  . LEU D 2 55  ? -113.546 27.986 79.355 1.00 19.58 ? 864 LEU D CA  1 
ATOM   3347 C C   . LEU D 2 55  ? -112.771 27.010 78.489 1.00 19.08 ? 864 LEU D C   1 
ATOM   3348 O O   . LEU D 2 55  ? -112.115 26.091 78.980 1.00 18.27 ? 864 LEU D O   1 
ATOM   3349 C CB  . LEU D 2 55  ? -112.633 29.183 79.656 1.00 20.57 ? 864 LEU D CB  1 
ATOM   3350 C CG  . LEU D 2 55  ? -113.263 30.471 80.191 1.00 22.68 ? 864 LEU D CG  1 
ATOM   3351 C CD1 . LEU D 2 55  ? -112.199 31.557 80.311 1.00 23.52 ? 864 LEU D CD1 1 
ATOM   3352 C CD2 . LEU D 2 55  ? -114.368 30.923 79.245 1.00 25.63 ? 864 LEU D CD2 1 
ATOM   3353 N N   . GLU D 2 56  ? -112.847 27.243 77.181 1.00 18.29 ? 865 GLU D N   1 
ATOM   3354 C CA  . GLU D 2 56  ? -112.132 26.439 76.195 1.00 16.13 ? 865 GLU D CA  1 
ATOM   3355 C C   . GLU D 2 56  ? -110.670 26.816 76.407 1.00 14.96 ? 865 GLU D C   1 
ATOM   3356 O O   . GLU D 2 56  ? -110.371 27.933 76.846 1.00 14.14 ? 865 GLU D O   1 
ATOM   3357 C CB  . GLU D 2 56  ? -112.599 26.812 74.782 1.00 14.47 ? 865 GLU D CB  1 
ATOM   3358 C CG  . GLU D 2 56  ? -112.204 25.842 73.684 1.00 14.00 ? 865 GLU D CG  1 
ATOM   3359 C CD  . GLU D 2 56  ? -110.816 26.099 73.142 1.00 14.22 ? 865 GLU D CD  1 
ATOM   3360 O OE1 . GLU D 2 56  ? -110.463 27.280 72.968 1.00 13.03 ? 865 GLU D OE1 1 
ATOM   3361 O OE2 . GLU D 2 56  ? -110.083 25.127 72.872 1.00 15.58 ? 865 GLU D OE2 1 
ATOM   3362 N N   . PHE D 2 57  ? -109.754 25.910 76.093 1.00 15.49 ? 866 PHE D N   1 
ATOM   3363 C CA  . PHE D 2 57  ? -108.345 26.197 76.331 1.00 15.30 ? 866 PHE D CA  1 
ATOM   3364 C C   . PHE D 2 57  ? -107.762 27.465 75.704 1.00 15.26 ? 866 PHE D C   1 
ATOM   3365 O O   . PHE D 2 57  ? -107.047 28.207 76.380 1.00 15.40 ? 866 PHE D O   1 
ATOM   3366 C CB  . PHE D 2 57  ? -107.485 24.986 75.956 1.00 15.90 ? 866 PHE D CB  1 
ATOM   3367 C CG  . PHE D 2 57  ? -106.088 25.041 76.517 1.00 14.38 ? 866 PHE D CG  1 
ATOM   3368 C CD1 . PHE D 2 57  ? -105.853 25.562 77.787 1.00 15.80 ? 866 PHE D CD1 1 
ATOM   3369 C CD2 . PHE D 2 57  ? -105.012 24.548 75.790 1.00 15.59 ? 866 PHE D CD2 1 
ATOM   3370 C CE1 . PHE D 2 57  ? -104.559 25.591 78.324 1.00 14.57 ? 866 PHE D CE1 1 
ATOM   3371 C CE2 . PHE D 2 57  ? -103.714 24.573 76.317 1.00 15.06 ? 866 PHE D CE2 1 
ATOM   3372 C CZ  . PHE D 2 57  ? -103.489 25.094 77.583 1.00 12.43 ? 866 PHE D CZ  1 
ATOM   3373 N N   . MET D 2 58  ? -108.050 27.725 74.431 1.00 15.03 ? 867 MET D N   1 
ATOM   3374 C CA  . MET D 2 58  ? -107.514 28.925 73.782 1.00 14.66 ? 867 MET D CA  1 
ATOM   3375 C C   . MET D 2 58  ? -107.937 30.184 74.540 1.00 14.86 ? 867 MET D C   1 
ATOM   3376 O O   . MET D 2 58  ? -107.165 31.138 74.665 1.00 15.19 ? 867 MET D O   1 
ATOM   3377 C CB  . MET D 2 58  ? -107.983 29.017 72.320 1.00 15.55 ? 867 MET D CB  1 
ATOM   3378 C CG  . MET D 2 58  ? -107.450 27.922 71.410 1.00 16.57 ? 867 MET D CG  1 
ATOM   3379 S SD  . MET D 2 58  ? -105.639 27.835 71.421 1.00 20.21 ? 867 MET D SD  1 
ATOM   3380 C CE  . MET D 2 58  ? -105.400 26.529 72.653 1.00 23.09 ? 867 MET D CE  1 
ATOM   3381 N N   . HIS D 2 59  ? -109.163 30.187 75.046 1.00 13.61 ? 868 HIS D N   1 
ATOM   3382 C CA  . HIS D 2 59  ? -109.646 31.338 75.793 1.00 16.05 ? 868 HIS D CA  1 
ATOM   3383 C C   . HIS D 2 59  ? -108.906 31.479 77.117 1.00 14.56 ? 868 HIS D C   1 
ATOM   3384 O O   . HIS D 2 59  ? -108.610 32.589 77.555 1.00 13.58 ? 868 HIS D O   1 
ATOM   3385 C CB  . HIS D 2 59  ? -111.152 31.229 76.031 1.00 19.98 ? 868 HIS D CB  1 
ATOM   3386 C CG  . HIS D 2 59  ? -111.967 31.492 74.805 1.00 26.41 ? 868 HIS D CG  1 
ATOM   3387 N ND1 . HIS D 2 59  ? -113.343 31.424 74.796 1.00 30.58 ? 868 HIS D ND1 1 
ATOM   3388 C CD2 . HIS D 2 59  ? -111.598 31.829 73.544 1.00 27.42 ? 868 HIS D CD2 1 
ATOM   3389 C CE1 . HIS D 2 59  ? -113.788 31.706 73.585 1.00 31.38 ? 868 HIS D CE1 1 
ATOM   3390 N NE2 . HIS D 2 59  ? -112.751 31.956 72.806 1.00 31.81 ? 868 HIS D NE2 1 
ATOM   3391 N N   . ILE D 2 60  ? -108.600 30.357 77.754 1.00 13.19 ? 869 ILE D N   1 
ATOM   3392 C CA  . ILE D 2 60  ? -107.871 30.417 79.009 1.00 11.94 ? 869 ILE D CA  1 
ATOM   3393 C C   . ILE D 2 60  ? -106.490 31.011 78.729 1.00 12.58 ? 869 ILE D C   1 
ATOM   3394 O O   . ILE D 2 60  ? -106.040 31.899 79.454 1.00 11.26 ? 869 ILE D O   1 
ATOM   3395 C CB  . ILE D 2 60  ? -107.724 29.022 79.651 1.00 11.01 ? 869 ILE D CB  1 
ATOM   3396 C CG1 . ILE D 2 60  ? -109.108 28.493 80.044 1.00 9.18  ? 869 ILE D CG1 1 
ATOM   3397 C CG2 . ILE D 2 60  ? -106.807 29.107 80.883 1.00 11.08 ? 869 ILE D CG2 1 
ATOM   3398 C CD1 . ILE D 2 60  ? -109.098 27.091 80.653 1.00 9.14  ? 869 ILE D CD1 1 
ATOM   3399 N N   . LEU D 2 61  ? -105.842 30.538 77.661 1.00 10.86 ? 870 LEU D N   1 
ATOM   3400 C CA  . LEU D 2 61  ? -104.519 31.027 77.287 1.00 12.52 ? 870 LEU D CA  1 
ATOM   3401 C C   . LEU D 2 61  ? -104.539 32.515 76.933 1.00 14.28 ? 870 LEU D C   1 
ATOM   3402 O O   . LEU D 2 61  ? -103.562 33.230 77.181 1.00 13.47 ? 870 LEU D O   1 
ATOM   3403 C CB  . LEU D 2 61  ? -103.957 30.212 76.117 1.00 10.28 ? 870 LEU D CB  1 
ATOM   3404 C CG  . LEU D 2 61  ? -103.514 28.788 76.492 1.00 9.86  ? 870 LEU D CG  1 
ATOM   3405 C CD1 . LEU D 2 61  ? -102.987 28.059 75.271 1.00 6.89  ? 870 LEU D CD1 1 
ATOM   3406 C CD2 . LEU D 2 61  ? -102.440 28.855 77.583 1.00 7.06  ? 870 LEU D CD2 1 
ATOM   3407 N N   . THR D 2 62  ? -105.652 32.981 76.364 1.00 15.12 ? 871 THR D N   1 
ATOM   3408 C CA  . THR D 2 62  ? -105.781 34.393 76.014 1.00 15.02 ? 871 THR D CA  1 
ATOM   3409 C C   . THR D 2 62  ? -105.869 35.193 77.313 1.00 14.94 ? 871 THR D C   1 
ATOM   3410 O O   . THR D 2 62  ? -105.392 36.326 77.382 1.00 14.60 ? 871 THR D O   1 
ATOM   3411 C CB  . THR D 2 62  ? -107.046 34.659 75.168 1.00 16.31 ? 871 THR D CB  1 
ATOM   3412 O OG1 . THR D 2 62  ? -106.969 33.907 73.950 1.00 17.35 ? 871 THR D OG1 1 
ATOM   3413 C CG2 . THR D 2 62  ? -107.163 36.146 74.833 1.00 15.67 ? 871 THR D CG2 1 
ATOM   3414 N N   . ARG D 2 63  ? -106.477 34.596 78.337 1.00 14.21 ? 872 ARG D N   1 
ATOM   3415 C CA  . ARG D 2 63  ? -106.597 35.249 79.637 1.00 14.88 ? 872 ARG D CA  1 
ATOM   3416 C C   . ARG D 2 63  ? -105.194 35.322 80.233 1.00 13.69 ? 872 ARG D C   1 
ATOM   3417 O O   . ARG D 2 63  ? -104.841 36.292 80.900 1.00 13.47 ? 872 ARG D O   1 
ATOM   3418 C CB  . ARG D 2 63  ? -107.500 34.441 80.568 1.00 16.49 ? 872 ARG D CB  1 
ATOM   3419 C CG  . ARG D 2 63  ? -108.955 34.326 80.125 1.00 21.49 ? 872 ARG D CG  1 
ATOM   3420 C CD  . ARG D 2 63  ? -109.722 35.619 80.325 1.00 25.03 ? 872 ARG D CD  1 
ATOM   3421 N NE  . ARG D 2 63  ? -111.163 35.438 80.120 1.00 29.57 ? 872 ARG D NE  1 
ATOM   3422 C CZ  . ARG D 2 63  ? -112.082 35.618 81.068 1.00 29.22 ? 872 ARG D CZ  1 
ATOM   3423 N NH1 . ARG D 2 63  ? -111.716 35.982 82.291 1.00 29.93 ? 872 ARG D NH1 1 
ATOM   3424 N NH2 . ARG D 2 63  ? -113.367 35.450 80.793 1.00 24.99 ? 872 ARG D NH2 1 
ATOM   3425 N N   . VAL D 2 64  ? -104.401 34.278 80.000 1.00 13.33 ? 873 VAL D N   1 
ATOM   3426 C CA  . VAL D 2 64  ? -103.029 34.254 80.496 1.00 12.20 ? 873 VAL D CA  1 
ATOM   3427 C C   . VAL D 2 64  ? -102.261 35.383 79.809 1.00 12.71 ? 873 VAL D C   1 
ATOM   3428 O O   . VAL D 2 64  ? -101.555 36.152 80.462 1.00 12.66 ? 873 VAL D O   1 
ATOM   3429 C CB  . VAL D 2 64  ? -102.346 32.904 80.203 1.00 12.27 ? 873 VAL D CB  1 
ATOM   3430 C CG1 . VAL D 2 64  ? -100.890 32.936 80.675 1.00 8.06  ? 873 VAL D CG1 1 
ATOM   3431 C CG2 . VAL D 2 64  ? -103.104 31.789 80.896 1.00 8.83  ? 873 VAL D CG2 1 
ATOM   3432 N N   . ASN D 2 65  ? -102.424 35.493 78.492 1.00 13.66 ? 874 ASN D N   1 
ATOM   3433 C CA  . ASN D 2 65  ? -101.769 36.554 77.716 1.00 11.53 ? 874 ASN D CA  1 
ATOM   3434 C C   . ASN D 2 65  ? -102.020 37.921 78.357 1.00 14.14 ? 874 ASN D C   1 
ATOM   3435 O O   . ASN D 2 65  ? -101.083 38.688 78.604 1.00 12.82 ? 874 ASN D O   1 
ATOM   3436 C CB  . ASN D 2 65  ? -102.315 36.579 76.279 1.00 12.93 ? 874 ASN D CB  1 
ATOM   3437 C CG  . ASN D 2 65  ? -101.567 35.644 75.346 1.00 12.74 ? 874 ASN D CG  1 
ATOM   3438 O OD1 . ASN D 2 65  ? -100.758 34.827 75.784 1.00 16.69 ? 874 ASN D OD1 1 
ATOM   3439 N ND2 . ASN D 2 65  ? -101.831 35.766 74.049 1.00 13.75 ? 874 ASN D ND2 1 
ATOM   3440 N N   . ARG D 2 66  ? -103.295 38.226 78.603 1.00 14.30 ? 875 ARG D N   1 
ATOM   3441 C CA  . ARG D 2 66  ? -103.672 39.502 79.198 1.00 15.08 ? 875 ARG D CA  1 
ATOM   3442 C C   . ARG D 2 66  ? -103.066 39.698 80.587 1.00 15.55 ? 875 ARG D C   1 
ATOM   3443 O O   . ARG D 2 66  ? -102.524 40.762 80.880 1.00 14.11 ? 875 ARG D O   1 
ATOM   3444 C CB  . ARG D 2 66  ? -105.205 39.642 79.287 1.00 15.27 ? 875 ARG D CB  1 
ATOM   3445 C CG  . ARG D 2 66  ? -105.662 40.950 79.951 1.00 16.66 ? 875 ARG D CG  1 
ATOM   3446 C CD  . ARG D 2 66  ? -107.084 41.373 79.580 1.00 20.74 ? 875 ARG D CD  1 
ATOM   3447 N NE  . ARG D 2 66  ? -108.137 40.658 80.303 1.00 25.69 ? 875 ARG D NE  1 
ATOM   3448 C CZ  . ARG D 2 66  ? -108.792 39.590 79.847 1.00 29.50 ? 875 ARG D CZ  1 
ATOM   3449 N NH1 . ARG D 2 66  ? -108.516 39.081 78.649 1.00 30.23 ? 875 ARG D NH1 1 
ATOM   3450 N NH2 . ARG D 2 66  ? -109.745 39.036 80.589 1.00 28.85 ? 875 ARG D NH2 1 
ATOM   3451 N N   . LYS D 2 67  ? -103.153 38.674 81.433 1.00 14.50 ? 876 LYS D N   1 
ATOM   3452 C CA  . LYS D 2 67  ? -102.619 38.778 82.781 1.00 14.16 ? 876 LYS D CA  1 
ATOM   3453 C C   . LYS D 2 67  ? -101.113 39.013 82.792 1.00 13.75 ? 876 LYS D C   1 
ATOM   3454 O O   . LYS D 2 67  ? -100.611 39.814 83.579 1.00 12.47 ? 876 LYS D O   1 
ATOM   3455 C CB  . LYS D 2 67  ? -102.947 37.526 83.597 1.00 17.25 ? 876 LYS D CB  1 
ATOM   3456 C CG  . LYS D 2 67  ? -102.553 37.683 85.056 1.00 18.61 ? 876 LYS D CG  1 
ATOM   3457 C CD  . LYS D 2 67  ? -103.070 36.573 85.944 1.00 22.89 ? 876 LYS D CD  1 
ATOM   3458 C CE  . LYS D 2 67  ? -102.823 36.959 87.402 1.00 26.02 ? 876 LYS D CE  1 
ATOM   3459 N NZ  . LYS D 2 67  ? -103.316 35.947 88.359 1.00 31.41 ? 876 LYS D NZ  1 
ATOM   3460 N N   . VAL D 2 68  ? -100.394 38.314 81.920 1.00 13.93 ? 877 VAL D N   1 
ATOM   3461 C CA  . VAL D 2 68  ? -98.940  38.467 81.838 1.00 11.48 ? 877 VAL D CA  1 
ATOM   3462 C C   . VAL D 2 68  ? -98.557  39.850 81.326 1.00 12.23 ? 877 VAL D C   1 
ATOM   3463 O O   . VAL D 2 68  ? -97.680  40.501 81.874 1.00 13.34 ? 877 VAL D O   1 
ATOM   3464 C CB  . VAL D 2 68  ? -98.316  37.410 80.900 1.00 10.83 ? 877 VAL D CB  1 
ATOM   3465 C CG1 . VAL D 2 68  ? -96.864  37.790 80.540 1.00 10.69 ? 877 VAL D CG1 1 
ATOM   3466 C CG2 . VAL D 2 68  ? -98.343  36.048 81.576 1.00 7.37  ? 877 VAL D CG2 1 
ATOM   3467 N N   . ALA D 2 69  ? -99.224  40.301 80.273 1.00 13.44 ? 878 ALA D N   1 
ATOM   3468 C CA  . ALA D 2 69  ? -98.916  41.599 79.690 1.00 14.72 ? 878 ALA D CA  1 
ATOM   3469 C C   . ALA D 2 69  ? -99.349  42.775 80.566 1.00 15.45 ? 878 ALA D C   1 
ATOM   3470 O O   . ALA D 2 69  ? -98.758  43.850 80.516 1.00 14.71 ? 878 ALA D O   1 
ATOM   3471 C CB  . ALA D 2 69  ? -99.565  41.708 78.306 1.00 15.64 ? 878 ALA D CB  1 
ATOM   3472 N N   . THR D 2 70  ? -100.368 42.550 81.382 1.00 16.14 ? 879 THR D N   1 
ATOM   3473 C CA  . THR D 2 70  ? -100.921 43.584 82.239 1.00 17.71 ? 879 THR D CA  1 
ATOM   3474 C C   . THR D 2 70  ? -100.325 43.731 83.635 1.00 18.14 ? 879 THR D C   1 
ATOM   3475 O O   . THR D 2 70  ? -99.967  44.828 84.051 1.00 16.00 ? 879 THR D O   1 
ATOM   3476 C CB  . THR D 2 70  ? -102.443 43.365 82.433 1.00 19.75 ? 879 THR D CB  1 
ATOM   3477 O OG1 . THR D 2 70  ? -103.108 43.424 81.167 1.00 23.82 ? 879 THR D OG1 1 
ATOM   3478 C CG2 . THR D 2 70  ? -103.020 44.429 83.351 1.00 25.48 ? 879 THR D CG2 1 
ATOM   3479 N N   . GLU D 2 71  A -100.232 42.619 84.355 1.00 16.77 ? 879 GLU D N   1 
ATOM   3480 C CA  . GLU D 2 71  A -99.767  42.627 85.734 1.00 16.28 ? 879 GLU D CA  1 
ATOM   3481 C C   . GLU D 2 71  A -98.284  42.460 86.024 1.00 16.49 ? 879 GLU D C   1 
ATOM   3482 O O   . GLU D 2 71  A -97.869  42.508 87.181 1.00 14.68 ? 879 GLU D O   1 
ATOM   3483 C CB  . GLU D 2 71  A -100.559 41.571 86.505 1.00 17.56 ? 879 GLU D CB  1 
ATOM   3484 C CG  . GLU D 2 71  A -102.052 41.892 86.570 1.00 21.38 ? 879 GLU D CG  1 
ATOM   3485 C CD  . GLU D 2 71  A -102.911 40.698 86.941 1.00 23.56 ? 879 GLU D CD  1 
ATOM   3486 O OE1 . GLU D 2 71  A -102.482 39.876 87.780 1.00 23.00 ? 879 GLU D OE1 1 
ATOM   3487 O OE2 . GLU D 2 71  A -104.030 40.593 86.392 1.00 27.29 ? 879 GLU D OE2 1 
ATOM   3488 N N   . PHE D 2 72  ? -97.471  42.285 84.995 1.00 15.27 ? 880 PHE D N   1 
ATOM   3489 C CA  . PHE D 2 72  ? -96.057  42.095 85.250 1.00 15.18 ? 880 PHE D CA  1 
ATOM   3490 C C   . PHE D 2 72  ? -95.126  43.083 84.565 1.00 13.32 ? 880 PHE D C   1 
ATOM   3491 O O   . PHE D 2 72  ? -95.342  43.475 83.419 1.00 13.65 ? 880 PHE D O   1 
ATOM   3492 C CB  . PHE D 2 72  ? -95.664  40.672 84.865 1.00 13.40 ? 880 PHE D CB  1 
ATOM   3493 C CG  . PHE D 2 72  ? -96.363  39.610 85.668 1.00 13.73 ? 880 PHE D CG  1 
ATOM   3494 C CD1 . PHE D 2 72  ? -95.749  39.047 86.783 1.00 12.31 ? 880 PHE D CD1 1 
ATOM   3495 C CD2 . PHE D 2 72  ? -97.617  39.136 85.279 1.00 14.47 ? 880 PHE D CD2 1 
ATOM   3496 C CE1 . PHE D 2 72  ? -96.362  38.022 87.496 1.00 9.36  ? 880 PHE D CE1 1 
ATOM   3497 C CE2 . PHE D 2 72  ? -98.243  38.112 85.985 1.00 12.08 ? 880 PHE D CE2 1 
ATOM   3498 C CZ  . PHE D 2 72  ? -97.610  37.550 87.097 1.00 10.93 ? 880 PHE D CZ  1 
ATOM   3499 N N   . GLU D 2 73  ? -94.097  43.485 85.301 1.00 11.89 ? 881 GLU D N   1 
ATOM   3500 C CA  . GLU D 2 73  ? -93.073  44.389 84.805 1.00 14.60 ? 881 GLU D CA  1 
ATOM   3501 C C   . GLU D 2 73  ? -91.800  44.073 85.580 1.00 13.32 ? 881 GLU D C   1 
ATOM   3502 O O   . GLU D 2 73  ? -91.856  43.826 86.779 1.00 12.61 ? 881 GLU D O   1 
ATOM   3503 C CB  . GLU D 2 73  ? -93.470  45.851 85.026 1.00 15.50 ? 881 GLU D CB  1 
ATOM   3504 C CG  . GLU D 2 73  ? -92.512  46.826 84.370 1.00 18.66 ? 881 GLU D CG  1 
ATOM   3505 C CD  . GLU D 2 73  ? -92.934  48.271 84.550 1.00 23.24 ? 881 GLU D CD  1 
ATOM   3506 O OE1 . GLU D 2 73  ? -94.057  48.630 84.126 1.00 25.07 ? 881 GLU D OE1 1 
ATOM   3507 O OE2 . GLU D 2 73  ? -92.138  49.043 85.119 1.00 24.87 ? 881 GLU D OE2 1 
ATOM   3508 N N   . SER D 2 74  A -90.653  44.076 84.911 1.00 13.38 ? 881 SER D N   1 
ATOM   3509 C CA  . SER D 2 74  A -89.414  43.758 85.614 1.00 13.88 ? 881 SER D CA  1 
ATOM   3510 C C   . SER D 2 74  A -88.914  44.918 86.455 1.00 13.37 ? 881 SER D C   1 
ATOM   3511 O O   . SER D 2 74  A -89.195  46.080 86.174 1.00 12.16 ? 881 SER D O   1 
ATOM   3512 C CB  . SER D 2 74  A -88.310  43.333 84.633 1.00 11.75 ? 881 SER D CB  1 
ATOM   3513 O OG  . SER D 2 74  A -87.856  44.430 83.864 1.00 10.07 ? 881 SER D OG  1 
ATOM   3514 N N   . PHE D 2 75  B -88.178  44.576 87.504 1.00 14.06 ? 881 PHE D N   1 
ATOM   3515 C CA  . PHE D 2 75  B -87.590  45.561 88.399 1.00 14.02 ? 881 PHE D CA  1 
ATOM   3516 C C   . PHE D 2 75  B -86.167  45.088 88.646 1.00 13.91 ? 881 PHE D C   1 
ATOM   3517 O O   . PHE D 2 75  B -85.950  44.091 89.337 1.00 13.77 ? 881 PHE D O   1 
ATOM   3518 C CB  . PHE D 2 75  B -88.365  45.638 89.715 1.00 10.86 ? 881 PHE D CB  1 
ATOM   3519 C CG  . PHE D 2 75  B -87.734  46.553 90.725 1.00 12.88 ? 881 PHE D CG  1 
ATOM   3520 C CD1 . PHE D 2 75  B -86.853  46.051 91.677 1.00 8.89  ? 881 PHE D CD1 1 
ATOM   3521 C CD2 . PHE D 2 75  B -87.975  47.929 90.688 1.00 13.17 ? 881 PHE D CD2 1 
ATOM   3522 C CE1 . PHE D 2 75  B -86.213  46.902 92.583 1.00 11.19 ? 881 PHE D CE1 1 
ATOM   3523 C CE2 . PHE D 2 75  B -87.339  48.790 91.590 1.00 12.30 ? 881 PHE D CE2 1 
ATOM   3524 C CZ  . PHE D 2 75  B -86.454  48.273 92.538 1.00 11.20 ? 881 PHE D CZ  1 
ATOM   3525 N N   . SER D 2 76  C -85.202  45.807 88.081 1.00 14.69 ? 881 SER D N   1 
ATOM   3526 C CA  . SER D 2 76  C -83.799  45.423 88.194 1.00 15.46 ? 881 SER D CA  1 
ATOM   3527 C C   . SER D 2 76  C -82.859  46.582 88.507 1.00 16.49 ? 881 SER D C   1 
ATOM   3528 O O   . SER D 2 76  C -83.063  47.706 88.040 1.00 17.16 ? 881 SER D O   1 
ATOM   3529 C CB  . SER D 2 76  C -83.360  44.759 86.881 1.00 15.88 ? 881 SER D CB  1 
ATOM   3530 O OG  . SER D 2 76  C -82.006  44.346 86.922 1.00 15.88 ? 881 SER D OG  1 
ATOM   3531 N N   . PHE D 2 77  D -81.825  46.303 89.300 1.00 18.12 ? 881 PHE D N   1 
ATOM   3532 C CA  . PHE D 2 77  D -80.845  47.327 89.634 1.00 18.48 ? 881 PHE D CA  1 
ATOM   3533 C C   . PHE D 2 77  D -80.083  47.633 88.350 1.00 20.41 ? 881 PHE D C   1 
ATOM   3534 O O   . PHE D 2 77  D -79.455  48.690 88.208 1.00 21.97 ? 881 PHE D O   1 
ATOM   3535 C CB  . PHE D 2 77  D -79.878  46.828 90.704 1.00 17.53 ? 881 PHE D CB  1 
ATOM   3536 C CG  . PHE D 2 77  D -80.541  46.454 91.995 1.00 17.95 ? 881 PHE D CG  1 
ATOM   3537 C CD1 . PHE D 2 77  D -81.635  47.175 92.467 1.00 17.75 ? 881 PHE D CD1 1 
ATOM   3538 C CD2 . PHE D 2 77  D -80.055  45.401 92.762 1.00 17.72 ? 881 PHE D CD2 1 
ATOM   3539 C CE1 . PHE D 2 77  D -82.235  46.855 93.684 1.00 17.78 ? 881 PHE D CE1 1 
ATOM   3540 C CE2 . PHE D 2 77  D -80.650  45.072 93.986 1.00 17.89 ? 881 PHE D CE2 1 
ATOM   3541 C CZ  . PHE D 2 77  D -81.742  45.802 94.444 1.00 17.53 ? 881 PHE D CZ  1 
ATOM   3542 N N   . ASP D 2 78  E -80.154  46.690 87.413 1.00 21.14 ? 881 ASP D N   1 
ATOM   3543 C CA  . ASP D 2 78  E -79.506  46.827 86.117 1.00 21.26 ? 881 ASP D CA  1 
ATOM   3544 C C   . ASP D 2 78  E -80.473  47.511 85.143 1.00 21.99 ? 881 ASP D C   1 
ATOM   3545 O O   . ASP D 2 78  E -81.387  46.873 84.618 1.00 20.34 ? 881 ASP D O   1 
ATOM   3546 C CB  . ASP D 2 78  E -79.127  45.451 85.570 1.00 22.15 ? 881 ASP D CB  1 
ATOM   3547 C CG  . ASP D 2 78  E -78.295  45.541 84.304 1.00 22.96 ? 881 ASP D CG  1 
ATOM   3548 O OD1 . ASP D 2 78  E -78.409  46.560 83.587 1.00 25.16 ? 881 ASP D OD1 1 
ATOM   3549 O OD2 . ASP D 2 78  E -77.539  44.592 84.021 1.00 24.69 ? 881 ASP D OD2 1 
ATOM   3550 N N   . ALA D 2 79  F -80.254  48.801 84.907 1.00 21.39 ? 881 ALA D N   1 
ATOM   3551 C CA  . ALA D 2 79  F -81.088  49.602 84.016 1.00 20.64 ? 881 ALA D CA  1 
ATOM   3552 C C   . ALA D 2 79  F -81.454  48.908 82.711 1.00 21.01 ? 881 ALA D C   1 
ATOM   3553 O O   . ALA D 2 79  F -82.586  49.027 82.237 1.00 19.93 ? 881 ALA D O   1 
ATOM   3554 C CB  . ALA D 2 79  F -80.392  50.936 83.715 1.00 20.24 ? 881 ALA D CB  1 
ATOM   3555 N N   . THR D 2 80  G -80.499  48.192 82.124 1.00 20.93 ? 881 THR D N   1 
ATOM   3556 C CA  . THR D 2 80  G -80.753  47.495 80.867 1.00 22.57 ? 881 THR D CA  1 
ATOM   3557 C C   . THR D 2 80  G -81.928  46.531 80.957 1.00 19.96 ? 881 THR D C   1 
ATOM   3558 O O   . THR D 2 80  G -82.685  46.383 80.005 1.00 19.56 ? 881 THR D O   1 
ATOM   3559 C CB  . THR D 2 80  G -79.535  46.673 80.401 1.00 24.57 ? 881 THR D CB  1 
ATOM   3560 O OG1 . THR D 2 80  G -78.417  47.543 80.187 1.00 29.57 ? 881 THR D OG1 1 
ATOM   3561 C CG2 . THR D 2 80  G -79.862  45.940 79.092 1.00 27.32 ? 881 THR D CG2 1 
ATOM   3562 N N   . PHE D 2 81  H -82.072  45.870 82.099 1.00 19.69 ? 881 PHE D N   1 
ATOM   3563 C CA  . PHE D 2 81  H -83.154  44.911 82.276 1.00 18.39 ? 881 PHE D CA  1 
ATOM   3564 C C   . PHE D 2 81  H -84.308  45.426 83.129 1.00 16.57 ? 881 PHE D C   1 
ATOM   3565 O O   . PHE D 2 81  H -85.204  44.662 83.494 1.00 16.42 ? 881 PHE D O   1 
ATOM   3566 C CB  . PHE D 2 81  H -82.608  43.615 82.880 1.00 16.75 ? 881 PHE D CB  1 
ATOM   3567 C CG  . PHE D 2 81  H -81.754  42.820 81.932 1.00 20.49 ? 881 PHE D CG  1 
ATOM   3568 C CD1 . PHE D 2 81  H -80.386  43.065 81.816 1.00 20.95 ? 881 PHE D CD1 1 
ATOM   3569 C CD2 . PHE D 2 81  H -82.327  41.838 81.129 1.00 20.72 ? 881 PHE D CD2 1 
ATOM   3570 C CE1 . PHE D 2 81  H -79.609  42.345 80.918 1.00 21.88 ? 881 PHE D CE1 1 
ATOM   3571 C CE2 . PHE D 2 81  H -81.557  41.111 80.224 1.00 19.87 ? 881 PHE D CE2 1 
ATOM   3572 C CZ  . PHE D 2 81  H -80.200  41.362 80.116 1.00 22.08 ? 881 PHE D CZ  1 
ATOM   3573 N N   . HIS D 2 82  I -84.299  46.721 83.431 1.00 15.56 ? 881 HIS D N   1 
ATOM   3574 C CA  . HIS D 2 82  I -85.341  47.306 84.268 1.00 14.75 ? 881 HIS D CA  1 
ATOM   3575 C C   . HIS D 2 82  I -86.585  47.798 83.526 1.00 13.17 ? 881 HIS D C   1 
ATOM   3576 O O   . HIS D 2 82  I -86.498  48.302 82.408 1.00 14.37 ? 881 HIS D O   1 
ATOM   3577 C CB  . HIS D 2 82  I -84.764  48.467 85.092 1.00 13.92 ? 881 HIS D CB  1 
ATOM   3578 C CG  . HIS D 2 82  I -85.785  49.156 85.938 1.00 12.50 ? 881 HIS D CG  1 
ATOM   3579 N ND1 . HIS D 2 82  I -86.409  48.540 87.000 1.00 10.90 ? 881 HIS D ND1 1 
ATOM   3580 C CD2 . HIS D 2 82  I -86.350  50.385 85.833 1.00 11.92 ? 881 HIS D CD2 1 
ATOM   3581 C CE1 . HIS D 2 82  I -87.315  49.354 87.511 1.00 11.96 ? 881 HIS D CE1 1 
ATOM   3582 N NE2 . HIS D 2 82  I -87.297  50.480 86.820 1.00 13.01 ? 881 HIS D NE2 1 
ATOM   3583 N N   . ALA D 2 83  ? -87.740  47.655 84.171 1.00 11.12 ? 882 ALA D N   1 
ATOM   3584 C CA  . ALA D 2 83  ? -89.018  48.099 83.618 1.00 10.66 ? 882 ALA D CA  1 
ATOM   3585 C C   . ALA D 2 83  ? -89.411  47.461 82.285 1.00 10.74 ? 882 ALA D C   1 
ATOM   3586 O O   . ALA D 2 83  ? -89.954  48.133 81.406 1.00 9.39  ? 882 ALA D O   1 
ATOM   3587 C CB  . ALA D 2 83  ? -89.020  49.641 83.478 1.00 10.03 ? 882 ALA D CB  1 
ATOM   3588 N N   . LYS D 2 84  ? -89.149  46.169 82.130 1.00 12.31 ? 883 LYS D N   1 
ATOM   3589 C CA  . LYS D 2 84  ? -89.499  45.491 80.882 1.00 12.89 ? 883 LYS D CA  1 
ATOM   3590 C C   . LYS D 2 84  ? -90.804  44.704 81.009 1.00 12.86 ? 883 LYS D C   1 
ATOM   3591 O O   . LYS D 2 84  ? -91.212  44.332 82.104 1.00 12.26 ? 883 LYS D O   1 
ATOM   3592 C CB  . LYS D 2 84  ? -88.368  44.564 80.446 1.00 12.76 ? 883 LYS D CB  1 
ATOM   3593 C CG  . LYS D 2 84  ? -87.024  45.248 80.389 1.00 14.47 ? 883 LYS D CG  1 
ATOM   3594 C CD  . LYS D 2 84  ? -86.995  46.400 79.392 1.00 15.73 ? 883 LYS D CD  1 
ATOM   3595 C CE  . LYS D 2 84  ? -85.658  47.151 79.500 1.00 18.65 ? 883 LYS D CE  1 
ATOM   3596 N NZ  . LYS D 2 84  ? -85.568  48.337 78.604 1.00 21.39 ? 883 LYS D NZ  1 
ATOM   3597 N N   . LYS D 2 85  ? -91.446  44.466 79.873 1.00 13.08 ? 884 LYS D N   1 
ATOM   3598 C CA  . LYS D 2 85  ? -92.711  43.755 79.817 1.00 12.88 ? 884 LYS D CA  1 
ATOM   3599 C C   . LYS D 2 85  ? -92.605  42.448 79.033 1.00 13.53 ? 884 LYS D C   1 
ATOM   3600 O O   . LYS D 2 85  ? -91.582  42.161 78.389 1.00 10.99 ? 884 LYS D O   1 
ATOM   3601 C CB  . LYS D 2 85  ? -93.771  44.652 79.185 1.00 13.58 ? 884 LYS D CB  1 
ATOM   3602 C CG  . LYS D 2 85  ? -93.981  45.958 79.940 1.00 16.53 ? 884 LYS D CG  1 
ATOM   3603 C CD  . LYS D 2 85  ? -94.769  45.744 81.226 1.00 15.11 ? 884 LYS D CD  1 
ATOM   3604 C CE  . LYS D 2 85  ? -96.235  45.481 80.923 1.00 15.84 ? 884 LYS D CE  1 
ATOM   3605 N NZ  . LYS D 2 85  ? -97.067  45.303 82.150 1.00 16.79 ? 884 LYS D NZ  1 
ATOM   3606 N N   . GLN D 2 86  ? -93.686  41.675 79.069 1.00 12.36 ? 885 GLN D N   1 
ATOM   3607 C CA  . GLN D 2 86  ? -93.716  40.384 78.403 1.00 11.43 ? 885 GLN D CA  1 
ATOM   3608 C C   . GLN D 2 86  ? -95.096  40.007 77.885 1.00 11.48 ? 885 GLN D C   1 
ATOM   3609 O O   . GLN D 2 86  ? -96.108  40.289 78.523 1.00 11.29 ? 885 GLN D O   1 
ATOM   3610 C CB  . GLN D 2 86  ? -93.252  39.312 79.387 1.00 11.17 ? 885 GLN D CB  1 
ATOM   3611 C CG  . GLN D 2 86  ? -93.060  37.931 78.795 1.00 12.85 ? 885 GLN D CG  1 
ATOM   3612 C CD  . GLN D 2 86  ? -92.613  36.938 79.847 1.00 15.09 ? 885 GLN D CD  1 
ATOM   3613 O OE1 . GLN D 2 86  ? -91.832  37.280 80.737 1.00 14.50 ? 885 GLN D OE1 1 
ATOM   3614 N NE2 . GLN D 2 86  ? -93.095  35.698 79.750 1.00 16.34 ? 885 GLN D NE2 1 
ATOM   3615 N N   . ILE D 2 87  ? -95.126  39.373 76.717 1.00 11.78 ? 886 ILE D N   1 
ATOM   3616 C CA  . ILE D 2 87  ? -96.371  38.886 76.137 1.00 11.53 ? 886 ILE D CA  1 
ATOM   3617 C C   . ILE D 2 87  ? -96.113  37.435 75.756 1.00 10.92 ? 886 ILE D C   1 
ATOM   3618 O O   . ILE D 2 87  ? -95.117  37.130 75.102 1.00 13.12 ? 886 ILE D O   1 
ATOM   3619 C CB  . ILE D 2 87  ? -96.789  39.656 74.859 1.00 12.69 ? 886 ILE D CB  1 
ATOM   3620 C CG1 . ILE D 2 87  ? -98.110  39.096 74.331 1.00 12.67 ? 886 ILE D CG1 1 
ATOM   3621 C CG2 . ILE D 2 87  ? -95.739  39.503 73.758 1.00 13.88 ? 886 ILE D CG2 1 
ATOM   3622 C CD1 . ILE D 2 87  ? -99.274  39.308 75.271 1.00 12.75 ? 886 ILE D CD1 1 
ATOM   3623 N N   . PRO D 2 88  ? -96.981  36.515 76.200 1.00 10.32 ? 887 PRO D N   1 
ATOM   3624 C CA  . PRO D 2 88  ? -96.815  35.091 75.872 1.00 10.09 ? 887 PRO D CA  1 
ATOM   3625 C C   . PRO D 2 88  ? -97.189  34.874 74.401 1.00 12.50 ? 887 PRO D C   1 
ATOM   3626 O O   . PRO D 2 88  ? -97.679  35.793 73.745 1.00 13.79 ? 887 PRO D O   1 
ATOM   3627 C CB  . PRO D 2 88  ? -97.788  34.395 76.824 1.00 8.90  ? 887 PRO D CB  1 
ATOM   3628 C CG  . PRO D 2 88  ? -97.950  35.397 77.949 1.00 6.23  ? 887 PRO D CG  1 
ATOM   3629 C CD  . PRO D 2 88  ? -98.015  36.700 77.227 1.00 7.75  ? 887 PRO D CD  1 
ATOM   3630 N N   . CYS D 2 89  ? -96.988  33.661 73.895 1.00 14.26 ? 888 CYS D N   1 
ATOM   3631 C CA  . CYS D 2 89  ? -97.275  33.361 72.492 1.00 12.71 ? 888 CYS D CA  1 
ATOM   3632 C C   . CYS D 2 89  ? -97.954  31.998 72.281 1.00 13.09 ? 888 CYS D C   1 
ATOM   3633 O O   . CYS D 2 89  ? -97.319  30.944 72.389 1.00 11.37 ? 888 CYS D O   1 
ATOM   3634 C CB  . CYS D 2 89  ? -95.960  33.431 71.705 1.00 13.86 ? 888 CYS D CB  1 
ATOM   3635 S SG  . CYS D 2 89  ? -96.052  33.105 69.930 1.00 16.06 ? 888 CYS D SG  1 
ATOM   3636 N N   . ILE D 2 90  ? -99.247  32.027 71.973 1.00 12.27 ? 889 ILE D N   1 
ATOM   3637 C CA  . ILE D 2 90  ? -100.009 30.798 71.754 1.00 12.06 ? 889 ILE D CA  1 
ATOM   3638 C C   . ILE D 2 90  ? -99.879  30.335 70.306 1.00 11.23 ? 889 ILE D C   1 
ATOM   3639 O O   . ILE D 2 90  ? -100.248 31.057 69.379 1.00 12.96 ? 889 ILE D O   1 
ATOM   3640 C CB  . ILE D 2 90  ? -101.507 31.008 72.044 1.00 10.53 ? 889 ILE D CB  1 
ATOM   3641 C CG1 . ILE D 2 90  ? -101.703 31.614 73.434 1.00 9.44  ? 889 ILE D CG1 1 
ATOM   3642 C CG2 . ILE D 2 90  ? -102.239 29.681 71.924 1.00 9.73  ? 889 ILE D CG2 1 
ATOM   3643 C CD1 . ILE D 2 90  ? -103.071 32.267 73.602 1.00 12.27 ? 889 ILE D CD1 1 
ATOM   3644 N N   . VAL D 2 91  ? -99.357  29.129 70.116 1.00 11.53 ? 890 VAL D N   1 
ATOM   3645 C CA  . VAL D 2 91  ? -99.183  28.560 68.782 1.00 10.61 ? 890 VAL D CA  1 
ATOM   3646 C C   . VAL D 2 91  ? -100.063 27.310 68.650 1.00 12.61 ? 890 VAL D C   1 
ATOM   3647 O O   . VAL D 2 91  ? -99.782  26.259 69.242 1.00 10.47 ? 890 VAL D O   1 
ATOM   3648 C CB  . VAL D 2 91  ? -97.709  28.192 68.541 1.00 12.20 ? 890 VAL D CB  1 
ATOM   3649 C CG1 . VAL D 2 91  ? -97.541  27.595 67.142 1.00 13.73 ? 890 VAL D CG1 1 
ATOM   3650 C CG2 . VAL D 2 91  ? -96.830  29.443 68.710 1.00 11.79 ? 890 VAL D CG2 1 
ATOM   3651 N N   . SER D 2 92  ? -101.132 27.420 67.873 1.00 11.27 ? 892 SER D N   1 
ATOM   3652 C CA  . SER D 2 92  ? -102.040 26.295 67.746 1.00 13.42 ? 892 SER D CA  1 
ATOM   3653 C C   . SER D 2 92  ? -102.198 25.619 66.399 1.00 12.58 ? 892 SER D C   1 
ATOM   3654 O O   . SER D 2 92  ? -102.491 26.259 65.386 1.00 12.11 ? 892 SER D O   1 
ATOM   3655 C CB  . SER D 2 92  ? -103.428 26.702 68.241 1.00 13.37 ? 892 SER D CB  1 
ATOM   3656 O OG  . SER D 2 92  ? -104.362 25.666 68.005 1.00 14.99 ? 892 SER D OG  1 
ATOM   3657 N N   . MET D 2 93  ? -101.996 24.308 66.413 1.00 12.48 ? 893 MET D N   1 
ATOM   3658 C CA  . MET D 2 93  ? -102.192 23.483 65.239 1.00 13.96 ? 893 MET D CA  1 
ATOM   3659 C C   . MET D 2 93  ? -103.275 22.515 65.670 1.00 14.50 ? 893 MET D C   1 
ATOM   3660 O O   . MET D 2 93  ? -103.321 21.372 65.233 1.00 14.62 ? 893 MET D O   1 
ATOM   3661 C CB  . MET D 2 93  ? -100.916 22.728 64.854 1.00 16.97 ? 893 MET D CB  1 
ATOM   3662 C CG  . MET D 2 93  ? -100.010 23.518 63.922 1.00 19.59 ? 893 MET D CG  1 
ATOM   3663 S SD  . MET D 2 93  ? -98.492  24.131 64.688 1.00 27.18 ? 893 MET D SD  1 
ATOM   3664 C CE  . MET D 2 93  ? -99.148  24.852 66.129 1.00 26.86 ? 893 MET D CE  1 
ATOM   3665 N N   . LEU D 2 94  ? -104.133 22.983 66.575 1.00 15.32 ? 894 LEU D N   1 
ATOM   3666 C CA  . LEU D 2 94  ? -105.222 22.152 67.055 1.00 15.95 ? 894 LEU D CA  1 
ATOM   3667 C C   . LEU D 2 94  ? -106.316 22.120 66.003 1.00 17.19 ? 894 LEU D C   1 
ATOM   3668 O O   . LEU D 2 94  ? -106.477 23.060 65.223 1.00 15.83 ? 894 LEU D O   1 
ATOM   3669 C CB  . LEU D 2 94  ? -105.776 22.675 68.379 1.00 12.62 ? 894 LEU D CB  1 
ATOM   3670 C CG  . LEU D 2 94  ? -104.813 22.628 69.571 1.00 11.87 ? 894 LEU D CG  1 
ATOM   3671 C CD1 . LEU D 2 94  ? -105.566 23.002 70.855 1.00 10.78 ? 894 LEU D CD1 1 
ATOM   3672 C CD2 . LEU D 2 94  ? -104.205 21.235 69.681 1.00 9.90  ? 894 LEU D CD2 1 
ATOM   3673 N N   . THR D 2 95  ? -107.061 21.023 66.002 1.00 17.09 ? 895 THR D N   1 
ATOM   3674 C CA  . THR D 2 95  ? -108.129 20.786 65.050 1.00 18.86 ? 895 THR D CA  1 
ATOM   3675 C C   . THR D 2 95  ? -109.511 20.899 65.683 1.00 17.64 ? 895 THR D C   1 
ATOM   3676 O O   . THR D 2 95  ? -110.523 20.968 64.985 1.00 15.75 ? 895 THR D O   1 
ATOM   3677 C CB  . THR D 2 95  ? -107.953 19.392 64.439 1.00 18.98 ? 895 THR D CB  1 
ATOM   3678 O OG1 . THR D 2 95  ? -106.830 19.410 63.549 1.00 23.57 ? 895 THR D OG1 1 
ATOM   3679 C CG2 . THR D 2 95  ? -109.178 18.979 63.685 1.00 27.44 ? 895 THR D CG2 1 
ATOM   3680 N N   . LYS D 2 96  ? -109.542 20.911 67.009 1.00 15.92 ? 896 LYS D N   1 
ATOM   3681 C CA  . LYS D 2 96  ? -110.788 21.011 67.742 1.00 15.23 ? 896 LYS D CA  1 
ATOM   3682 C C   . LYS D 2 96  ? -110.584 21.825 69.009 1.00 16.60 ? 896 LYS D C   1 
ATOM   3683 O O   . LYS D 2 96  ? -109.450 22.119 69.402 1.00 15.17 ? 896 LYS D O   1 
ATOM   3684 C CB  . LYS D 2 96  ? -111.290 19.619 68.116 1.00 17.54 ? 896 LYS D CB  1 
ATOM   3685 C CG  . LYS D 2 96  ? -111.509 18.703 66.924 1.00 18.88 ? 896 LYS D CG  1 
ATOM   3686 C CD  . LYS D 2 96  ? -111.921 17.309 67.363 1.00 21.05 ? 896 LYS D CD  1 
ATOM   3687 C CE  . LYS D 2 96  ? -112.057 16.377 66.176 1.00 19.99 ? 896 LYS D CE  1 
ATOM   3688 N NZ  . LYS D 2 96  ? -112.287 14.981 66.626 1.00 22.61 ? 896 LYS D NZ  1 
ATOM   3689 N N   . GLU D 2 97  ? -111.694 22.190 69.639 1.00 16.48 ? 897 GLU D N   1 
ATOM   3690 C CA  . GLU D 2 97  ? -111.667 22.951 70.876 1.00 18.25 ? 897 GLU D CA  1 
ATOM   3691 C C   . GLU D 2 97  ? -111.287 22.006 72.004 1.00 17.59 ? 897 GLU D C   1 
ATOM   3692 O O   . GLU D 2 97  ? -111.649 20.829 71.987 1.00 15.28 ? 897 GLU D O   1 
ATOM   3693 C CB  . GLU D 2 97  ? -113.040 23.559 71.146 1.00 18.94 ? 897 GLU D CB  1 
ATOM   3694 C CG  . GLU D 2 97  ? -113.437 24.601 70.139 1.00 22.58 ? 897 GLU D CG  1 
ATOM   3695 C CD  . GLU D 2 97  ? -114.912 24.916 70.198 1.00 28.57 ? 897 GLU D CD  1 
ATOM   3696 O OE1 . GLU D 2 97  ? -115.475 24.945 71.316 1.00 29.66 ? 897 GLU D OE1 1 
ATOM   3697 O OE2 . GLU D 2 97  ? -115.510 25.145 69.127 1.00 30.91 ? 897 GLU D OE2 1 
ATOM   3698 N N   . LEU D 2 98  ? -110.555 22.527 72.981 1.00 17.56 ? 898 LEU D N   1 
ATOM   3699 C CA  . LEU D 2 98  ? -110.104 21.727 74.107 1.00 16.09 ? 898 LEU D CA  1 
ATOM   3700 C C   . LEU D 2 98  ? -110.707 22.181 75.426 1.00 16.85 ? 898 LEU D C   1 
ATOM   3701 O O   . LEU D 2 98  ? -110.552 23.336 75.838 1.00 15.63 ? 898 LEU D O   1 
ATOM   3702 C CB  . LEU D 2 98  ? -108.580 21.775 74.211 1.00 16.10 ? 898 LEU D CB  1 
ATOM   3703 C CG  . LEU D 2 98  ? -107.955 20.939 75.338 1.00 17.58 ? 898 LEU D CG  1 
ATOM   3704 C CD1 . LEU D 2 98  ? -108.402 19.479 75.215 1.00 12.91 ? 898 LEU D CD1 1 
ATOM   3705 C CD2 . LEU D 2 98  ? -106.424 21.039 75.254 1.00 17.07 ? 898 LEU D CD2 1 
ATOM   3706 N N   . TYR D 2 99  ? -111.393 21.247 76.078 1.00 15.42 ? 899 TYR D N   1 
ATOM   3707 C CA  . TYR D 2 99  ? -112.027 21.482 77.369 1.00 17.35 ? 899 TYR D CA  1 
ATOM   3708 C C   . TYR D 2 99  ? -111.469 20.438 78.324 1.00 16.79 ? 899 TYR D C   1 
ATOM   3709 O O   . TYR D 2 99  ? -111.420 19.253 77.996 1.00 16.87 ? 899 TYR D O   1 
ATOM   3710 C CB  . TYR D 2 99  ? -113.550 21.326 77.250 1.00 16.52 ? 899 TYR D CB  1 
ATOM   3711 C CG  . TYR D 2 99  ? -114.206 22.386 76.390 1.00 16.00 ? 899 TYR D CG  1 
ATOM   3712 C CD1 . TYR D 2 99  ? -114.455 23.662 76.894 1.00 16.58 ? 899 TYR D CD1 1 
ATOM   3713 C CD2 . TYR D 2 99  ? -114.562 22.119 75.071 1.00 16.58 ? 899 TYR D CD2 1 
ATOM   3714 C CE1 . TYR D 2 99  ? -115.040 24.644 76.112 1.00 18.36 ? 899 TYR D CE1 1 
ATOM   3715 C CE2 . TYR D 2 99  ? -115.155 23.101 74.269 1.00 17.72 ? 899 TYR D CE2 1 
ATOM   3716 C CZ  . TYR D 2 99  ? -115.390 24.360 74.796 1.00 19.55 ? 899 TYR D CZ  1 
ATOM   3717 O OH  . TYR D 2 99  ? -115.967 25.337 74.010 1.00 19.99 ? 899 TYR D OH  1 
ATOM   3718 N N   . PHE D 2 100 ? -111.054 20.875 79.506 1.00 18.75 ? 900 PHE D N   1 
ATOM   3719 C CA  . PHE D 2 100 ? -110.485 19.959 80.490 1.00 20.95 ? 900 PHE D CA  1 
ATOM   3720 C C   . PHE D 2 100 ? -111.523 19.245 81.362 1.00 23.55 ? 900 PHE D C   1 
ATOM   3721 O O   . PHE D 2 100 ? -111.246 18.893 82.506 1.00 25.97 ? 900 PHE D O   1 
ATOM   3722 C CB  . PHE D 2 100 ? -109.478 20.720 81.354 1.00 17.09 ? 900 PHE D CB  1 
ATOM   3723 C CG  . PHE D 2 100 ? -108.251 21.154 80.597 1.00 15.73 ? 900 PHE D CG  1 
ATOM   3724 C CD1 . PHE D 2 100 ? -107.323 20.212 80.151 1.00 13.64 ? 900 PHE D CD1 1 
ATOM   3725 C CD2 . PHE D 2 100 ? -108.044 22.497 80.287 1.00 14.06 ? 900 PHE D CD2 1 
ATOM   3726 C CE1 . PHE D 2 100 ? -106.214 20.606 79.404 1.00 11.78 ? 900 PHE D CE1 1 
ATOM   3727 C CE2 . PHE D 2 100 ? -106.940 22.900 79.540 1.00 11.17 ? 900 PHE D CE2 1 
ATOM   3728 C CZ  . PHE D 2 100 ? -106.025 21.954 79.099 1.00 11.93 ? 900 PHE D CZ  1 
ATOM   3729 N N   . TYR D 2 101 ? -112.709 19.016 80.808 1.00 27.27 ? 901 TYR D N   1 
ATOM   3730 C CA  . TYR D 2 101 ? -113.786 18.344 81.535 1.00 29.90 ? 901 TYR D CA  1 
ATOM   3731 C C   . TYR D 2 101 ? -114.701 17.558 80.594 1.00 31.88 ? 901 TYR D C   1 
ATOM   3732 O O   . TYR D 2 101 ? -114.469 17.631 79.368 1.00 31.84 ? 901 TYR D O   1 
ATOM   3733 C CB  . TYR D 2 101 ? -114.607 19.370 82.323 1.00 28.43 ? 901 TYR D CB  1 
ATOM   3734 C CG  . TYR D 2 101 ? -115.193 20.489 81.492 1.00 27.70 ? 901 TYR D CG  1 
ATOM   3735 C CD1 . TYR D 2 101 ? -116.282 20.269 80.647 1.00 28.58 ? 901 TYR D CD1 1 
ATOM   3736 C CD2 . TYR D 2 101 ? -114.671 21.778 81.563 1.00 27.95 ? 901 TYR D CD2 1 
ATOM   3737 C CE1 . TYR D 2 101 ? -116.839 21.313 79.896 1.00 25.36 ? 901 TYR D CE1 1 
ATOM   3738 C CE2 . TYR D 2 101 ? -115.220 22.826 80.818 1.00 23.87 ? 901 TYR D CE2 1 
ATOM   3739 C CZ  . TYR D 2 101 ? -116.301 22.585 79.990 1.00 24.86 ? 901 TYR D CZ  1 
ATOM   3740 O OH  . TYR D 2 101 ? -116.849 23.617 79.262 1.00 24.50 ? 901 TYR D OH  1 
HETATM 3741 C C1  . PZN E 3 .   ? -85.957  27.124 47.513 1.00 50.58 ? 501 PZN A C1  1 
HETATM 3742 C C2  . PZN E 3 .   ? -87.092  27.532 48.460 1.00 51.65 ? 501 PZN A C2  1 
HETATM 3743 C C3  . PZN E 3 .   ? -87.782  28.847 48.052 1.00 52.52 ? 501 PZN A C3  1 
HETATM 3744 C C4  . PZN E 3 .   ? -89.145  29.023 48.745 1.00 52.29 ? 501 PZN A C4  1 
HETATM 3745 C C5  . PZN E 3 .   ? -90.320  28.785 47.778 1.00 50.61 ? 501 PZN A C5  1 
HETATM 3746 C C6  . PZN E 3 .   ? -91.354  27.770 48.337 1.00 48.31 ? 501 PZN A C6  1 
HETATM 3747 N N1  . PZN E 3 .   ? -92.768  27.768 47.850 1.00 45.80 ? 501 PZN A N1  1 
HETATM 3748 C C7  . PZN E 3 .   ? -92.838  27.576 46.375 1.00 46.18 ? 501 PZN A C7  1 
HETATM 3749 C C8  . PZN E 3 .   ? -93.516  28.998 48.249 1.00 37.17 ? 501 PZN A C8  1 
HETATM 3750 C C9  . PZN E 3 .   ? -94.956  28.869 48.847 1.00 32.00 ? 501 PZN A C9  1 
HETATM 3751 O O1  . PZN E 3 .   ? -94.793  29.946 49.412 1.00 32.13 ? 501 PZN A O1  1 
HETATM 3752 C C10 . PZN E 3 .   ? -96.050  28.597 47.821 1.00 27.98 ? 501 PZN A C10 1 
HETATM 3753 N N2  . PZN E 3 .   ? -96.058  27.155 47.637 1.00 28.20 ? 501 PZN A N2  1 
HETATM 3754 C C11 . PZN E 3 .   ? -97.453  29.031 48.312 1.00 28.02 ? 501 PZN A C11 1 
HETATM 3755 C C12 . PZN E 3 .   ? -98.293  29.851 47.321 1.00 27.82 ? 501 PZN A C12 1 
HETATM 3756 O O2  . PZN E 3 .   ? -99.446  30.206 47.705 1.00 26.83 ? 501 PZN A O2  1 
HETATM 3757 O O3  . PZN E 3 .   ? -97.810  30.134 46.181 1.00 26.36 ? 501 PZN A O3  1 
HETATM 3758 C C13 . PZN E 3 .   ? -96.304  26.522 46.474 1.00 26.13 ? 501 PZN A C13 1 
HETATM 3759 C C14 . PZN E 3 .   ? -96.813  25.066 46.611 1.00 25.21 ? 501 PZN A C14 1 
HETATM 3760 O O4  . PZN E 3 .   ? -96.119  27.032 45.368 1.00 27.20 ? 501 PZN A O4  1 
HETATM 3761 C C15 . PZN E 3 .   ? -95.701  24.248 47.326 1.00 22.71 ? 501 PZN A C15 1 
HETATM 3762 C C16 . PZN E 3 .   ? -96.216  23.022 48.087 1.00 23.27 ? 501 PZN A C16 1 
HETATM 3763 N N3  . PZN E 3 .   ? -97.263  24.325 45.368 1.00 24.11 ? 501 PZN A N3  1 
HETATM 3764 C C18 . PZN E 3 .   ? -98.954  23.526 43.752 1.00 24.23 ? 501 PZN A C18 1 
HETATM 3765 N N4  . PZN E 3 .   ? -97.936  22.857 43.035 1.00 23.82 ? 501 PZN A N4  1 
HETATM 3766 C C19 . PZN E 3 .   ? -96.572  22.878 43.426 1.00 23.79 ? 501 PZN A C19 1 
HETATM 3767 C C24 . PZN E 3 .   ? -96.225  23.589 44.549 1.00 25.14 ? 501 PZN A C24 1 
HETATM 3768 C C17 . PZN E 3 .   ? -98.603  24.322 45.020 1.00 25.08 ? 501 PZN A C17 1 
HETATM 3769 O O5  . PZN E 3 .   ? -99.501  24.881 45.638 1.00 27.55 ? 501 PZN A O5  1 
HETATM 3770 C C20 . PZN E 3 .   ? -95.624  22.034 42.572 1.00 25.43 ? 501 PZN A C20 1 
HETATM 3771 C C23 . PZN E 3 .   ? -94.139  22.254 42.957 1.00 23.96 ? 501 PZN A C23 1 
HETATM 3772 C C21 . PZN E 3 .   ? -95.802  22.386 41.079 1.00 25.86 ? 501 PZN A C21 1 
HETATM 3773 C C22 . PZN E 3 .   ? -95.970  20.548 42.779 1.00 22.50 ? 501 PZN A C22 1 
HETATM 3774 N N5  . PZN E 3 .   ? -100.205 23.400 43.245 1.00 23.92 ? 501 PZN A N5  1 
HETATM 3775 C C25 . PZN E 3 .   ? -100.653 22.374 42.284 1.00 23.59 ? 501 PZN A C25 1 
HETATM 3776 C C26 . PZN E 3 .   ? -100.920 21.061 43.027 1.00 23.27 ? 501 PZN A C26 1 
HETATM 3777 C C27 . PZN E 3 .   ? -101.938 20.702 44.053 1.00 23.61 ? 501 PZN A C27 1 
HETATM 3778 N N7  . PZN E 3 .   ? -101.739 19.416 44.382 1.00 23.62 ? 501 PZN A N7  1 
HETATM 3779 O O6  . PZN E 3 .   ? -100.649 18.925 43.625 1.00 21.81 ? 501 PZN A O6  1 
HETATM 3780 N N6  . PZN E 3 .   ? -100.172 19.974 42.802 1.00 23.08 ? 501 PZN A N6  1 
HETATM 3781 C C28 . PZN E 3 .   ? -103.043 21.556 44.679 1.00 22.67 ? 501 PZN A C28 1 
HETATM 3782 C C1  . PZN F 3 .   ? -76.366  37.319 79.568 1.00 56.80 ? 502 PZN C C1  1 
HETATM 3783 C C2  . PZN F 3 .   ? -77.822  36.990 79.948 1.00 54.81 ? 502 PZN C C2  1 
HETATM 3784 C C3  . PZN F 3 .   ? -78.583  36.235 78.841 1.00 54.53 ? 502 PZN C C3  1 
HETATM 3785 C C4  . PZN F 3 .   ? -79.746  35.398 79.407 1.00 50.39 ? 502 PZN C C4  1 
HETATM 3786 C C5  . PZN F 3 .   ? -79.808  33.989 78.784 1.00 48.15 ? 502 PZN C C5  1 
HETATM 3787 C C6  . PZN F 3 .   ? -80.481  32.951 79.732 1.00 44.19 ? 502 PZN C C6  1 
HETATM 3788 N N1  . PZN F 3 .   ? -81.644  32.123 79.276 1.00 41.38 ? 502 PZN C N1  1 
HETATM 3789 C C7  . PZN F 3 .   ? -81.265  31.251 78.123 1.00 40.42 ? 502 PZN C C7  1 
HETATM 3790 C C8  . PZN F 3 .   ? -82.856  32.941 78.931 1.00 30.18 ? 502 PZN C C8  1 
HETATM 3791 C C9  . PZN F 3 .   ? -84.274  32.433 79.375 1.00 24.23 ? 502 PZN C C9  1 
HETATM 3792 O O1  . PZN F 3 .   ? -84.173  31.395 78.734 1.00 23.60 ? 502 PZN C O1  1 
HETATM 3793 C C10 . PZN F 3 .   ? -84.552  32.456 80.881 1.00 19.66 ? 502 PZN C C10 1 
HETATM 3794 N N2  . PZN F 3 .   ? -84.869  33.833 81.252 1.00 17.28 ? 502 PZN C N2  1 
HETATM 3795 C C11 . PZN F 3 .   ? -85.780  31.545 81.219 1.00 18.51 ? 502 PZN C C11 1 
HETATM 3796 C C12 . PZN F 3 .   ? -86.007  31.161 82.688 1.00 20.05 ? 502 PZN C C12 1 
HETATM 3797 O O2  . PZN F 3 .   ? -87.205  31.105 83.098 1.00 19.73 ? 502 PZN C O2  1 
HETATM 3798 O O3  . PZN F 3 .   ? -85.010  30.891 83.412 1.00 19.71 ? 502 PZN C O3  1 
HETATM 3799 C C13 . PZN F 3 .   ? -84.170  34.554 82.145 1.00 17.55 ? 502 PZN C C13 1 
HETATM 3800 C C14 . PZN F 3 .   ? -84.606  36.028 82.316 1.00 17.03 ? 502 PZN C C14 1 
HETATM 3801 O O4  . PZN F 3 .   ? -83.240  34.100 82.808 1.00 17.27 ? 502 PZN C O4  1 
HETATM 3802 C C15 . PZN F 3 .   ? -84.084  36.843 81.104 1.00 15.16 ? 502 PZN C C15 1 
HETATM 3803 C C16 . PZN F 3 .   ? -84.850  38.159 80.870 1.00 15.55 ? 502 PZN C C16 1 
HETATM 3804 N N3  . PZN F 3 .   ? -84.229  36.731 83.601 1.00 17.64 ? 502 PZN C N3  1 
HETATM 3805 C C18 . PZN F 3 .   ? -84.599  37.416 85.936 1.00 17.36 ? 502 PZN C C18 1 
HETATM 3806 N N4  . PZN F 3 .   ? -83.366  38.129 85.905 1.00 17.26 ? 502 PZN C N4  1 
HETATM 3807 C C19 . PZN F 3 .   ? -82.531  38.177 84.753 1.00 17.90 ? 502 PZN C C19 1 
HETATM 3808 C C24 . PZN F 3 .   ? -82.930  37.503 83.643 1.00 18.51 ? 502 PZN C C24 1 
HETATM 3809 C C17 . PZN F 3 .   ? -85.077  36.659 84.689 1.00 18.67 ? 502 PZN C C17 1 
HETATM 3810 O O5  . PZN F 3 .   ? -86.150  36.058 84.726 1.00 19.12 ? 502 PZN C O5  1 
HETATM 3811 C C20 . PZN F 3 .   ? -81.270  39.045 84.849 1.00 20.06 ? 502 PZN C C20 1 
HETATM 3812 C C23 . PZN F 3 .   ? -80.321  38.812 83.640 1.00 17.06 ? 502 PZN C C23 1 
HETATM 3813 C C21 . PZN F 3 .   ? -80.501  38.727 86.148 1.00 17.29 ? 502 PZN C C21 1 
HETATM 3814 C C22 . PZN F 3 .   ? -81.683  40.530 84.873 1.00 17.17 ? 502 PZN C C22 1 
HETATM 3815 N N5  . PZN F 3 .   ? -85.286  37.462 87.099 1.00 15.58 ? 502 PZN C N5  1 
HETATM 3816 C C25 . PZN F 3 .   ? -85.120  38.433 88.182 1.00 15.04 ? 502 PZN C C25 1 
HETATM 3817 C C26 . PZN F 3 .   ? -85.724  39.779 87.759 1.00 16.04 ? 502 PZN C C26 1 
HETATM 3818 C C27 . PZN F 3 .   ? -87.137  40.225 87.554 1.00 15.81 ? 502 PZN C C27 1 
HETATM 3819 N N7  . PZN F 3 .   ? -87.101  41.503 87.188 1.00 16.37 ? 502 PZN C N7  1 
HETATM 3820 O O6  . PZN F 3 .   ? -85.743  41.914 87.144 1.00 18.28 ? 502 PZN C O6  1 
HETATM 3821 N N6  . PZN F 3 .   ? -84.935  40.819 87.503 1.00 15.63 ? 502 PZN C N6  1 
HETATM 3822 C C28 . PZN F 3 .   ? -88.445  39.456 87.701 1.00 15.26 ? 502 PZN C C28 1 
HETATM 3823 O O   . HOH G 4 .   ? -95.129  29.986 64.188 1.00 12.62 ? 502 HOH A O   1 
HETATM 3824 O O   . HOH G 4 .   ? -89.566  37.968 59.690 1.00 16.48 ? 503 HOH A O   1 
HETATM 3825 O O   . HOH G 4 .   ? -91.163  33.102 61.444 1.00 20.75 ? 504 HOH A O   1 
HETATM 3826 O O   . HOH G 4 .   ? -117.077 49.370 59.733 1.00 24.14 ? 505 HOH A O   1 
HETATM 3827 O O   . HOH G 4 .   ? -107.574 49.852 60.594 1.00 21.51 ? 506 HOH A O   1 
HETATM 3828 O O   . HOH G 4 .   ? -100.386 49.273 67.646 1.00 15.78 ? 507 HOH A O   1 
HETATM 3829 O O   . HOH G 4 .   ? -93.967  32.945 55.018 1.00 23.54 ? 508 HOH A O   1 
HETATM 3830 O O   . HOH G 4 .   ? -109.078 48.493 46.424 1.00 32.65 ? 509 HOH A O   1 
HETATM 3831 O O   . HOH G 4 .   ? -97.270  20.239 58.518 1.00 18.00 ? 510 HOH A O   1 
HETATM 3832 O O   . HOH G 4 .   ? -105.280 33.361 39.724 1.00 25.93 ? 511 HOH A O   1 
HETATM 3833 O O   . HOH G 4 .   ? -87.612  24.055 55.220 1.00 24.77 ? 512 HOH A O   1 
HETATM 3834 O O   . HOH G 4 .   ? -110.521 30.786 47.915 1.00 22.42 ? 513 HOH A O   1 
HETATM 3835 O O   . HOH G 4 .   ? -103.246 33.074 47.351 1.00 23.66 ? 514 HOH A O   1 
HETATM 3836 O O   . HOH G 4 .   ? -111.047 46.669 73.817 1.00 19.91 ? 515 HOH A O   1 
HETATM 3837 O O   . HOH G 4 .   ? -93.038  32.541 57.830 1.00 25.87 ? 516 HOH A O   1 
HETATM 3838 O O   . HOH G 4 .   ? -118.349 36.471 54.149 1.00 31.50 ? 517 HOH A O   1 
HETATM 3839 O O   . HOH G 4 .   ? -120.211 45.758 67.384 1.00 33.68 ? 518 HOH A O   1 
HETATM 3840 O O   . HOH G 4 .   ? -98.465  19.043 40.790 1.00 27.70 ? 519 HOH A O   1 
HETATM 3841 O O   . HOH G 4 .   ? -87.612  28.849 55.132 1.00 24.18 ? 520 HOH A O   1 
HETATM 3842 O O   . HOH G 4 .   ? -94.949  13.262 56.731 1.00 22.07 ? 521 HOH A O   1 
HETATM 3843 O O   . HOH G 4 .   ? -111.929 51.491 57.879 1.00 24.55 ? 522 HOH A O   1 
HETATM 3844 O O   . HOH G 4 .   ? -114.575 53.063 55.265 1.00 30.91 ? 523 HOH A O   1 
HETATM 3845 O O   . HOH G 4 .   ? -90.819  31.738 48.213 1.00 57.95 ? 524 HOH A O   1 
HETATM 3846 O O   . HOH G 4 .   ? -116.194 49.075 64.602 1.00 23.13 ? 525 HOH A O   1 
HETATM 3847 O O   . HOH G 4 .   ? -109.453 47.721 71.985 1.00 33.09 ? 526 HOH A O   1 
HETATM 3848 O O   . HOH G 4 .   ? -109.366 56.611 62.427 1.00 30.07 ? 527 HOH A O   1 
HETATM 3849 O O   . HOH G 4 .   ? -90.551  22.242 61.027 1.00 26.53 ? 528 HOH A O   1 
HETATM 3850 O O   . HOH G 4 .   ? -98.022  30.617 55.909 1.00 18.64 ? 529 HOH A O   1 
HETATM 3851 O O   . HOH G 4 .   ? -110.618 47.139 69.627 1.00 22.30 ? 530 HOH A O   1 
HETATM 3852 O O   . HOH G 4 .   ? -114.720 47.147 44.620 1.00 31.93 ? 531 HOH A O   1 
HETATM 3853 O O   . HOH G 4 .   ? -116.091 44.695 75.173 1.00 36.64 ? 532 HOH A O   1 
HETATM 3854 O O   . HOH G 4 .   ? -116.185 51.822 75.381 1.00 31.53 ? 533 HOH A O   1 
HETATM 3855 O O   . HOH G 4 .   ? -109.675 6.671  61.804 1.00 45.63 ? 534 HOH A O   1 
HETATM 3856 O O   . HOH G 4 .   ? -107.237 46.510 74.725 1.00 38.50 ? 535 HOH A O   1 
HETATM 3857 O O   . HOH G 4 .   ? -114.334 41.414 70.403 1.00 30.54 ? 536 HOH A O   1 
HETATM 3858 O O   . HOH G 4 .   ? -89.302  52.619 56.896 1.00 54.29 ? 537 HOH A O   1 
HETATM 3859 O O   . HOH G 4 .   ? -94.048  34.540 38.047 1.00 31.83 ? 538 HOH A O   1 
HETATM 3860 O O   . HOH G 4 .   ? -123.546 43.802 50.940 1.00 38.85 ? 539 HOH A O   1 
HETATM 3861 O O   . HOH G 4 .   ? -120.390 41.475 46.270 1.00 36.17 ? 540 HOH A O   1 
HETATM 3862 O O   . HOH G 4 .   ? -101.132 56.331 65.263 1.00 26.07 ? 541 HOH A O   1 
HETATM 3863 O O   . HOH G 4 .   ? -101.881 54.856 53.387 1.00 34.53 ? 542 HOH A O   1 
HETATM 3864 O O   . HOH G 4 .   ? -111.283 55.428 56.896 1.00 37.24 ? 543 HOH A O   1 
HETATM 3865 O O   . HOH G 4 .   ? -110.248 52.678 50.952 1.00 32.24 ? 544 HOH A O   1 
HETATM 3866 O O   . HOH G 4 .   ? -114.915 40.345 45.702 1.00 30.17 ? 545 HOH A O   1 
HETATM 3867 O O   . HOH G 4 .   ? -88.330  18.593 50.883 1.00 37.06 ? 546 HOH A O   1 
HETATM 3868 O O   . HOH G 4 .   ? -105.547 56.700 68.901 1.00 44.33 ? 547 HOH A O   1 
HETATM 3869 O O   . HOH G 4 .   ? -117.151 45.192 70.881 1.00 33.40 ? 548 HOH A O   1 
HETATM 3870 O O   . HOH G 4 .   ? -90.203  16.842 57.673 1.00 48.37 ? 549 HOH A O   1 
HETATM 3871 O O   . HOH G 4 .   ? -97.717  56.682 66.533 1.00 32.18 ? 550 HOH A O   1 
HETATM 3872 O O   . HOH G 4 .   ? -105.048 53.184 70.070 1.00 43.01 ? 551 HOH A O   1 
HETATM 3873 O O   . HOH G 4 .   ? -91.042  51.218 73.681 1.00 41.67 ? 552 HOH A O   1 
HETATM 3874 O O   . HOH G 4 .   ? -115.958 40.995 79.053 1.00 48.72 ? 553 HOH A O   1 
HETATM 3875 O O   . HOH G 4 .   ? -120.362 53.336 61.806 1.00 38.68 ? 554 HOH A O   1 
HETATM 3876 O O   . HOH G 4 .   ? -109.257 50.233 72.486 1.00 32.41 ? 555 HOH A O   1 
HETATM 3877 O O   . HOH G 4 .   ? -100.132 51.956 48.005 1.00 41.84 ? 556 HOH A O   1 
HETATM 3878 O O   . HOH G 4 .   ? -95.557  53.019 62.315 1.00 32.12 ? 557 HOH A O   1 
HETATM 3879 O O   . HOH G 4 .   ? -111.120 56.584 60.481 1.00 35.20 ? 558 HOH A O   1 
HETATM 3880 O O   . HOH G 4 .   ? -85.729  31.042 49.227 1.00 55.43 ? 559 HOH A O   1 
HETATM 3881 O O   . HOH G 4 .   ? -103.226 39.576 39.766 1.00 30.50 ? 560 HOH A O   1 
HETATM 3882 O O   . HOH G 4 .   ? -86.543  44.417 59.738 1.00 42.48 ? 561 HOH A O   1 
HETATM 3883 O O   . HOH G 4 .   ? -85.201  43.761 44.645 1.00 55.26 ? 562 HOH A O   1 
HETATM 3884 O O   . HOH G 4 .   ? -86.278  48.216 65.319 1.00 32.29 ? 563 HOH A O   1 
HETATM 3885 O O   . HOH G 4 .   ? -86.771  20.246 53.677 1.00 43.80 ? 564 HOH A O   1 
HETATM 3886 O O   . HOH H 4 .   ? -103.095 26.918 51.780 1.00 11.98 ? 4   HOH B O   1 
HETATM 3887 O O   . HOH H 4 .   ? -104.310 18.619 54.442 1.00 18.99 ? 9   HOH B O   1 
HETATM 3888 O O   . HOH H 4 .   ? -106.448 28.224 61.004 1.00 14.71 ? 14  HOH B O   1 
HETATM 3889 O O   . HOH H 4 .   ? -103.959 30.305 61.039 1.00 18.79 ? 17  HOH B O   1 
HETATM 3890 O O   . HOH H 4 .   ? -92.985  34.785 60.219 1.00 17.15 ? 24  HOH B O   1 
HETATM 3891 O O   . HOH H 4 .   ? -108.566 35.833 71.063 1.00 16.51 ? 31  HOH B O   1 
HETATM 3892 O O   . HOH H 4 .   ? -101.491 46.707 71.275 1.00 21.20 ? 57  HOH B O   1 
HETATM 3893 O O   . HOH H 4 .   ? -98.787  46.277 71.582 1.00 21.00 ? 58  HOH B O   1 
HETATM 3894 O O   . HOH H 4 .   ? -95.443  35.189 64.380 1.00 22.15 ? 65  HOH B O   1 
HETATM 3895 O O   . HOH H 4 .   ? -116.838 36.793 65.433 1.00 24.40 ? 66  HOH B O   1 
HETATM 3896 O O   . HOH H 4 .   ? -98.500  21.753 56.668 1.00 23.21 ? 70  HOH B O   1 
HETATM 3897 O O   . HOH H 4 .   ? -94.037  43.465 65.795 1.00 35.20 ? 71  HOH B O   1 
HETATM 3898 O O   . HOH H 4 .   ? -103.718 45.399 75.413 1.00 28.66 ? 77  HOH B O   1 
HETATM 3899 O O   . HOH H 4 .   ? -96.382  40.154 68.220 1.00 23.73 ? 79  HOH B O   1 
HETATM 3900 O O   . HOH H 4 .   ? -114.523 29.816 50.182 1.00 41.75 ? 82  HOH B O   1 
HETATM 3901 O O   . HOH H 4 .   ? -103.145 18.958 41.351 1.00 37.22 ? 86  HOH B O   1 
HETATM 3902 O O   . HOH H 4 .   ? -97.205  21.508 54.207 1.00 19.36 ? 89  HOH B O   1 
HETATM 3903 O O   . HOH H 4 .   ? -116.726 30.758 69.740 1.00 31.02 ? 109 HOH B O   1 
HETATM 3904 O O   . HOH H 4 .   ? -98.388  50.497 84.248 1.00 39.62 ? 115 HOH B O   1 
HETATM 3905 O O   . HOH H 4 .   ? -106.280 21.177 45.681 1.00 28.80 ? 122 HOH B O   1 
HETATM 3906 O O   . HOH H 4 .   ? -98.654  26.582 40.526 1.00 39.62 ? 128 HOH B O   1 
HETATM 3907 O O   . HOH H 4 .   ? -121.223 34.807 59.443 1.00 33.62 ? 136 HOH B O   1 
HETATM 3908 O O   . HOH H 4 .   ? -106.676 13.435 52.962 1.00 29.79 ? 137 HOH B O   1 
HETATM 3909 O O   . HOH H 4 .   ? -109.039 23.081 46.028 1.00 24.56 ? 138 HOH B O   1 
HETATM 3910 O O   . HOH H 4 .   ? -97.289  18.995 52.710 1.00 28.90 ? 139 HOH B O   1 
HETATM 3911 O O   . HOH H 4 .   ? -104.017 22.651 40.824 1.00 40.84 ? 142 HOH B O   1 
HETATM 3912 O O   . HOH H 4 .   ? -112.674 18.717 57.828 1.00 65.78 ? 179 HOH B O   1 
HETATM 3913 O O   . HOH H 4 .   ? -118.795 43.191 61.497 1.00 27.40 ? 181 HOH B O   1 
HETATM 3914 O O   . HOH H 4 .   ? -106.079 9.804  51.381 1.00 41.98 ? 201 HOH B O   1 
HETATM 3915 O O   . HOH H 4 .   ? -117.577 20.023 61.657 1.00 27.17 ? 202 HOH B O   1 
HETATM 3916 O O   . HOH H 4 .   ? -92.016  13.378 49.103 1.00 34.66 ? 206 HOH B O   1 
HETATM 3917 O O   . HOH H 4 .   ? -112.698 16.317 50.422 1.00 33.53 ? 209 HOH B O   1 
HETATM 3918 O O   . HOH H 4 .   ? -113.428 23.157 66.092 1.00 38.25 ? 211 HOH B O   1 
HETATM 3919 O O   . HOH H 4 .   ? -114.003 24.315 50.201 1.00 35.45 ? 218 HOH B O   1 
HETATM 3920 O O   . HOH H 4 .   ? -112.878 46.738 76.934 1.00 34.62 ? 225 HOH B O   1 
HETATM 3921 O O   . HOH H 4 .   ? -107.792 18.576 48.071 1.00 33.37 ? 227 HOH B O   1 
HETATM 3922 O O   . HOH I 4 .   ? -92.603  33.771 82.228 1.00 10.93 ? 2   HOH C O   1 
HETATM 3923 O O   . HOH I 4 .   ? -92.587  40.760 73.304 1.00 14.20 ? 5   HOH C O   1 
HETATM 3924 O O   . HOH I 4 .   ? -86.669  27.398 93.094 1.00 13.11 ? 8   HOH C O   1 
HETATM 3925 O O   . HOH I 4 .   ? -83.046  37.307 69.979 1.00 20.11 ? 10  HOH C O   1 
HETATM 3926 O O   . HOH I 4 .   ? -89.850  27.740 85.796 1.00 10.44 ? 11  HOH C O   1 
HETATM 3927 O O   . HOH I 4 .   ? -91.162  30.306 75.803 1.00 8.93  ? 12  HOH C O   1 
HETATM 3928 O O   . HOH I 4 .   ? -94.103  31.217 67.482 1.00 14.32 ? 15  HOH C O   1 
HETATM 3929 O O   . HOH I 4 .   ? -99.778  11.627 67.922 1.00 15.16 ? 16  HOH C O   1 
HETATM 3930 O O   . HOH I 4 .   ? -70.015  21.078 83.601 1.00 26.80 ? 19  HOH C O   1 
HETATM 3931 O O   . HOH I 4 .   ? -100.793 10.934 77.530 1.00 17.35 ? 21  HOH C O   1 
HETATM 3932 O O   . HOH I 4 .   ? -95.851  29.895 89.787 1.00 19.79 ? 25  HOH C O   1 
HETATM 3933 O O   . HOH I 4 .   ? -107.799 11.149 84.391 1.00 11.30 ? 26  HOH C O   1 
HETATM 3934 O O   . HOH I 4 .   ? -83.596  8.512  71.099 1.00 27.51 ? 29  HOH C O   1 
HETATM 3935 O O   . HOH I 4 .   ? -101.291 5.502  82.905 1.00 22.41 ? 33  HOH C O   1 
HETATM 3936 O O   . HOH I 4 .   ? -87.385  28.413 73.988 1.00 16.49 ? 45  HOH C O   1 
HETATM 3937 O O   . HOH I 4 .   ? -88.993  10.996 66.265 1.00 31.23 ? 52  HOH C O   1 
HETATM 3938 O O   . HOH I 4 .   ? -89.193  28.174 67.296 1.00 18.49 ? 53  HOH C O   1 
HETATM 3939 O O   . HOH I 4 .   ? -111.665 13.886 69.588 1.00 20.94 ? 54  HOH C O   1 
HETATM 3940 O O   . HOH I 4 .   ? -76.516  12.114 80.535 1.00 26.98 ? 55  HOH C O   1 
HETATM 3941 O O   . HOH I 4 .   ? -110.071 11.222 80.203 1.00 16.68 ? 59  HOH C O   1 
HETATM 3942 O O   . HOH I 4 .   ? -86.527  23.399 67.379 1.00 20.23 ? 61  HOH C O   1 
HETATM 3943 O O   . HOH I 4 .   ? -98.752  4.345  69.975 1.00 25.35 ? 62  HOH C O   1 
HETATM 3944 O O   . HOH I 4 .   ? -112.555 19.111 74.378 1.00 16.64 ? 63  HOH C O   1 
HETATM 3945 O O   . HOH I 4 .   ? -106.240 5.893  70.854 1.00 30.15 ? 64  HOH C O   1 
HETATM 3946 O O   . HOH I 4 .   ? -104.848 10.762 83.661 1.00 19.61 ? 69  HOH C O   1 
HETATM 3947 O O   . HOH I 4 .   ? -103.215 3.859  77.429 1.00 27.03 ? 73  HOH C O   1 
HETATM 3948 O O   . HOH I 4 .   ? -84.716  20.786 89.383 1.00 27.08 ? 75  HOH C O   1 
HETATM 3949 O O   . HOH I 4 .   ? -89.442  47.684 73.051 1.00 24.23 ? 78  HOH C O   1 
HETATM 3950 O O   . HOH I 4 .   ? -103.077 9.131  82.748 1.00 20.45 ? 84  HOH C O   1 
HETATM 3951 O O   . HOH I 4 .   ? -88.712  28.618 70.985 1.00 24.84 ? 88  HOH C O   1 
HETATM 3952 O O   . HOH I 4 .   ? -96.991  7.996  87.171 1.00 25.08 ? 90  HOH C O   1 
HETATM 3953 O O   . HOH I 4 .   ? -92.005  8.859  82.489 1.00 27.77 ? 91  HOH C O   1 
HETATM 3954 O O   . HOH I 4 .   ? -109.301 12.812 69.999 1.00 21.79 ? 92  HOH C O   1 
HETATM 3955 O O   . HOH I 4 .   ? -108.912 13.400 72.497 1.00 17.78 ? 95  HOH C O   1 
HETATM 3956 O O   . HOH I 4 .   ? -70.633  23.546 78.870 1.00 47.66 ? 96  HOH C O   1 
HETATM 3957 O O   . HOH I 4 .   ? -112.725 15.070 81.237 1.00 31.86 ? 100 HOH C O   1 
HETATM 3958 O O   . HOH I 4 .   ? -107.230 3.372  82.391 1.00 24.97 ? 101 HOH C O   1 
HETATM 3959 O O   . HOH I 4 .   ? -77.221  20.015 87.173 1.00 28.10 ? 105 HOH C O   1 
HETATM 3960 O O   . HOH I 4 .   ? -78.179  16.503 85.253 1.00 32.29 ? 107 HOH C O   1 
HETATM 3961 O O   . HOH I 4 .   ? -79.723  8.380  76.781 1.00 44.38 ? 112 HOH C O   1 
HETATM 3962 O O   . HOH I 4 .   ? -86.305  14.020 65.280 1.00 28.11 ? 113 HOH C O   1 
HETATM 3963 O O   . HOH I 4 .   ? -84.412  44.367 72.558 1.00 28.93 ? 114 HOH C O   1 
HETATM 3964 O O   . HOH I 4 .   ? -91.836  17.668 80.370 1.00 62.85 ? 116 HOH C O   1 
HETATM 3965 O O   . HOH I 4 .   ? -101.124 25.488 93.002 1.00 26.96 ? 117 HOH C O   1 
HETATM 3966 O O   . HOH I 4 .   ? -82.286  32.564 69.699 1.00 20.19 ? 119 HOH C O   1 
HETATM 3967 O O   . HOH I 4 .   ? -106.296 23.636 90.349 1.00 42.14 ? 120 HOH C O   1 
HETATM 3968 O O   . HOH I 4 .   ? -107.969 15.926 91.805 1.00 30.90 ? 125 HOH C O   1 
HETATM 3969 O O   . HOH I 4 .   ? -90.960  13.159 57.399 1.00 36.64 ? 126 HOH C O   1 
HETATM 3970 O O   . HOH I 4 .   ? -97.589  20.296 94.069 1.00 21.86 ? 129 HOH C O   1 
HETATM 3971 O O   . HOH I 4 .   ? -91.558  21.541 93.397 1.00 38.33 ? 133 HOH C O   1 
HETATM 3972 O O   . HOH I 4 .   ? -96.840  13.892 94.862 1.00 27.03 ? 134 HOH C O   1 
HETATM 3973 O O   . HOH I 4 .   ? -79.106  20.858 66.251 1.00 23.49 ? 140 HOH C O   1 
HETATM 3974 O O   . HOH I 4 .   ? -85.341  21.534 91.737 1.00 27.92 ? 144 HOH C O   1 
HETATM 3975 O O   . HOH I 4 .   ? -96.640  4.739  67.766 1.00 29.56 ? 146 HOH C O   1 
HETATM 3976 O O   . HOH I 4 .   ? -97.418  1.893  77.825 1.00 28.45 ? 150 HOH C O   1 
HETATM 3977 O O   . HOH I 4 .   ? -115.388 14.085 80.266 1.00 34.29 ? 151 HOH C O   1 
HETATM 3978 O O   . HOH I 4 .   ? -96.907  16.457 95.399 1.00 29.73 ? 152 HOH C O   1 
HETATM 3979 O O   . HOH I 4 .   ? -77.216  26.808 87.550 1.00 25.96 ? 153 HOH C O   1 
HETATM 3980 O O   . HOH I 4 .   ? -87.448  34.501 66.544 1.00 26.85 ? 156 HOH C O   1 
HETATM 3981 O O   . HOH I 4 .   ? -84.373  10.335 81.085 1.00 28.36 ? 159 HOH C O   1 
HETATM 3982 O O   . HOH I 4 .   ? -110.959 19.427 87.078 1.00 28.30 ? 163 HOH C O   1 
HETATM 3983 O O   . HOH I 4 .   ? -104.814 7.419  68.783 1.00 29.33 ? 166 HOH C O   1 
HETATM 3984 O O   . HOH I 4 .   ? -115.104 14.918 75.718 1.00 28.67 ? 167 HOH C O   1 
HETATM 3985 O O   . HOH I 4 .   ? -82.230  8.578  81.233 1.00 33.19 ? 169 HOH C O   1 
HETATM 3986 O O   . HOH I 4 .   ? -91.507  3.211  76.661 1.00 36.44 ? 171 HOH C O   1 
HETATM 3987 O O   . HOH I 4 .   ? -87.458  16.411 61.292 1.00 49.86 ? 172 HOH C O   1 
HETATM 3988 O O   . HOH I 4 .   ? -70.924  21.644 87.080 1.00 40.19 ? 180 HOH C O   1 
HETATM 3989 O O   . HOH I 4 .   ? -86.919  12.882 67.604 1.00 34.11 ? 182 HOH C O   1 
HETATM 3990 O O   . HOH I 4 .   ? -120.028 19.392 67.986 1.00 32.57 ? 183 HOH C O   1 
HETATM 3991 O O   . HOH I 4 .   ? -91.310  18.758 65.759 1.00 45.78 ? 187 HOH C O   1 
HETATM 3992 O O   . HOH I 4 .   ? -109.822 10.292 69.950 1.00 26.28 ? 188 HOH C O   1 
HETATM 3993 O O   . HOH I 4 .   ? -81.367  34.874 85.113 1.00 39.99 ? 190 HOH C O   1 
HETATM 3994 O O   . HOH I 4 .   ? -81.942  34.195 75.916 1.00 27.57 ? 191 HOH C O   1 
HETATM 3995 O O   . HOH I 4 .   ? -103.055 7.309  85.744 1.00 33.15 ? 193 HOH C O   1 
HETATM 3996 O O   . HOH I 4 .   ? -98.383  56.079 79.897 1.00 61.41 ? 195 HOH C O   1 
HETATM 3997 O O   . HOH I 4 .   ? -116.031 15.968 72.557 1.00 41.56 ? 196 HOH C O   1 
HETATM 3998 O O   . HOH I 4 .   ? -92.021  5.776  79.369 1.00 31.06 ? 198 HOH C O   1 
HETATM 3999 O O   . HOH I 4 .   ? -102.247 19.530 97.536 1.00 43.60 ? 204 HOH C O   1 
HETATM 4000 O O   . HOH I 4 .   ? -104.763 3.748  70.326 1.00 40.33 ? 208 HOH C O   1 
HETATM 4001 O O   . HOH I 4 .   ? -91.836  8.153  69.066 1.00 32.48 ? 210 HOH C O   1 
HETATM 4002 O O   . HOH I 4 .   ? -104.243 -0.437 74.418 1.00 43.62 ? 214 HOH C O   1 
HETATM 4003 O O   . HOH I 4 .   ? -66.564  21.767 84.681 1.00 33.04 ? 222 HOH C O   1 
HETATM 4004 O O   . HOH I 4 .   ? -86.570  14.002 89.119 1.00 37.08 ? 223 HOH C O   1 
HETATM 4005 O O   . HOH I 4 .   ? -81.762  29.860 68.528 1.00 33.42 ? 230 HOH C O   1 
HETATM 4006 O O   . HOH I 4 .   ? -111.219 12.521 91.146 1.00 34.74 ? 231 HOH C O   1 
HETATM 4007 O O   . HOH I 4 .   ? -99.062  4.672  85.367 1.00 34.57 ? 233 HOH C O   1 
HETATM 4008 O O   . HOH J 4 .   ? -95.664  42.229 81.075 1.00 11.13 ? 3   HOH D O   1 
HETATM 4009 O O   . HOH J 4 .   ? -89.659  39.546 76.724 1.00 10.78 ? 6   HOH D O   1 
HETATM 4010 O O   . HOH J 4 .   ? -99.090  30.473 75.441 1.00 17.05 ? 7   HOH D O   1 
HETATM 4011 O O   . HOH J 4 .   ? -100.796 32.358 76.986 1.00 9.34  ? 13  HOH D O   1 
HETATM 4012 O O   . HOH J 4 .   ? -94.203  25.757 67.245 1.00 20.40 ? 18  HOH D O   1 
HETATM 4013 O O   . HOH J 4 .   ? -111.447 23.528 80.229 1.00 15.10 ? 20  HOH D O   1 
HETATM 4014 O O   . HOH J 4 .   ? -101.009 14.518 63.824 1.00 15.13 ? 27  HOH D O   1 
HETATM 4015 O O   . HOH J 4 .   ? -92.354  39.046 75.402 1.00 15.96 ? 28  HOH D O   1 
HETATM 4016 O O   . HOH J 4 .   ? -88.878  41.974 77.943 1.00 16.05 ? 35  HOH D O   1 
HETATM 4017 O O   . HOH J 4 .   ? -102.805 14.053 65.637 1.00 13.94 ? 36  HOH D O   1 
HETATM 4018 O O   . HOH J 4 .   ? -106.887 26.049 68.658 1.00 16.88 ? 37  HOH D O   1 
HETATM 4019 O O   . HOH J 4 .   ? -81.982  41.940 88.249 1.00 17.50 ? 38  HOH D O   1 
HETATM 4020 O O   . HOH J 4 .   ? -91.454  39.878 89.135 1.00 15.66 ? 39  HOH D O   1 
HETATM 4021 O O   . HOH J 4 .   ? -108.657 24.735 70.313 1.00 16.36 ? 42  HOH D O   1 
HETATM 4022 O O   . HOH J 4 .   ? -106.273 34.630 71.447 1.00 15.37 ? 43  HOH D O   1 
HETATM 4023 O O   . HOH J 4 .   ? -89.973  26.187 69.130 1.00 24.16 ? 46  HOH D O   1 
HETATM 4024 O O   . HOH J 4 .   ? -82.712  34.982 88.985 1.00 34.06 ? 47  HOH D O   1 
HETATM 4025 O O   . HOH J 4 .   ? -115.505 26.945 67.563 1.00 55.32 ? 49  HOH D O   1 
HETATM 4026 O O   . HOH J 4 .   ? -111.515 25.371 87.232 1.00 18.93 ? 51  HOH D O   1 
HETATM 4027 O O   . HOH J 4 .   ? -96.727  47.683 83.972 1.00 22.73 ? 60  HOH D O   1 
HETATM 4028 O O   . HOH J 4 .   ? -82.528  47.269 77.465 1.00 29.03 ? 67  HOH D O   1 
HETATM 4029 O O   . HOH J 4 .   ? -114.445 29.319 76.305 1.00 19.70 ? 68  HOH D O   1 
HETATM 4030 O O   . HOH J 4 .   ? -115.261 28.634 87.141 1.00 46.38 ? 80  HOH D O   1 
HETATM 4031 O O   . HOH J 4 .   ? -86.875  37.894 91.093 1.00 20.36 ? 85  HOH D O   1 
HETATM 4032 O O   . HOH J 4 .   ? -82.042  43.787 90.599 1.00 27.85 ? 87  HOH D O   1 
HETATM 4033 O O   . HOH J 4 .   ? -106.601 31.419 90.346 1.00 27.60 ? 93  HOH D O   1 
HETATM 4034 O O   . HOH J 4 .   ? -94.745  51.294 84.701 1.00 36.76 ? 98  HOH D O   1 
HETATM 4035 O O   . HOH J 4 .   ? -97.391  20.854 64.938 1.00 26.16 ? 103 HOH D O   1 
HETATM 4036 O O   . HOH J 4 .   ? -87.904  53.064 88.034 1.00 23.84 ? 104 HOH D O   1 
HETATM 4037 O O   . HOH J 4 .   ? -77.211  49.911 88.982 1.00 34.78 ? 143 HOH D O   1 
HETATM 4038 O O   . HOH J 4 .   ? -112.055 21.107 84.925 1.00 29.67 ? 145 HOH D O   1 
HETATM 4039 O O   . HOH J 4 .   ? -93.831  37.644 90.450 1.00 26.88 ? 147 HOH D O   1 
HETATM 4040 O O   . HOH J 4 .   ? -93.319  22.534 62.525 1.00 28.39 ? 148 HOH D O   1 
HETATM 4041 O O   . HOH J 4 .   ? -107.105 15.318 63.968 1.00 25.45 ? 149 HOH D O   1 
HETATM 4042 O O   . HOH J 4 .   ? -87.941  49.858 79.734 1.00 20.49 ? 154 HOH D O   1 
HETATM 4043 O O   . HOH J 4 .   ? -83.364  49.881 79.133 1.00 35.62 ? 157 HOH D O   1 
HETATM 4044 O O   . HOH J 4 .   ? -88.952  45.323 71.472 1.00 33.90 ? 160 HOH D O   1 
HETATM 4045 O O   . HOH J 4 .   ? -113.418 27.427 90.030 1.00 27.78 ? 165 HOH D O   1 
HETATM 4046 O O   . HOH J 4 .   ? -109.655 14.244 66.644 1.00 34.67 ? 174 HOH D O   1 
HETATM 4047 O O   . HOH J 4 .   ? -113.328 13.605 63.940 1.00 36.75 ? 184 HOH D O   1 
HETATM 4048 O O   . HOH J 4 .   ? -109.118 36.256 86.819 1.00 38.71 ? 185 HOH D O   1 
HETATM 4049 O O   . HOH J 4 .   ? -84.854  43.445 80.830 1.00 63.04 ? 186 HOH D O   1 
HETATM 4050 O O   . HOH J 4 .   ? -110.595 16.925 84.188 1.00 27.05 ? 192 HOH D O   1 
HETATM 4051 O O   . HOH J 4 .   ? -114.811 36.171 85.652 1.00 43.08 ? 194 HOH D O   1 
HETATM 4052 O O   . HOH J 4 .   ? -112.076 33.565 88.106 1.00 47.83 ? 200 HOH D O   1 
HETATM 4053 O O   . HOH J 4 .   ? -93.663  31.373 96.565 1.00 28.65 ? 207 HOH D O   1 
HETATM 4054 O O   . HOH J 4 .   ? -95.514  15.814 62.400 1.00 54.25 ? 215 HOH D O   1 
HETATM 4055 O O   . HOH J 4 .   ? -85.714  30.768 95.552 1.00 41.43 ? 226 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   145 ?   ?   ?   A . n 
A 1 2   GLY 2   146 ?   ?   ?   A . n 
A 1 3   ILE 3   147 ?   ?   ?   A . n 
A 1 4   SER 4   148 ?   ?   ?   A . n 
A 1 5   LEU 5   149 ?   ?   ?   A . n 
A 1 6   ASP 6   150 150 ASP ASP A . n 
A 1 7   ASN 7   151 151 ASN ASN A . n 
A 1 8   SER 8   152 152 SER SER A . n 
A 1 9   TYR 9   153 153 TYR TYR A . n 
A 1 10  LYS 10  154 154 LYS LYS A . n 
A 1 11  MET 11  155 155 MET MET A . n 
A 1 12  ASP 12  156 156 ASP ASP A . n 
A 1 13  TYR 13  156 156 TYR TYR A A n 
A 1 14  PRO 14  161 161 PRO PRO A . n 
A 1 15  GLU 15  162 162 GLU GLU A . n 
A 1 16  MET 16  162 162 MET MET A A n 
A 1 17  GLY 17  163 163 GLY GLY A . n 
A 1 18  LEU 18  164 164 LEU LEU A . n 
A 1 19  CYS 19  165 165 CYS CYS A . n 
A 1 20  ILE 20  166 166 ILE ILE A . n 
A 1 21  ILE 21  167 167 ILE ILE A . n 
A 1 22  ILE 22  168 168 ILE ILE A . n 
A 1 23  ASN 23  169 169 ASN ASN A . n 
A 1 24  ASN 24  170 170 ASN ASN A . n 
A 1 25  LYS 25  171 171 LYS LYS A . n 
A 1 26  ASN 26  172 172 ASN ASN A . n 
A 1 27  PHE 27  173 173 PHE PHE A . n 
A 1 28  HIS 28  174 174 HIS HIS A . n 
A 1 29  LYS 29  175 175 LYS LYS A . n 
A 1 30  SER 30  175 175 SER SER A A n 
A 1 31  THR 31  175 175 THR THR A B n 
A 1 32  GLY 32  175 175 GLY GLY A C n 
A 1 33  MET 33  176 176 MET MET A . n 
A 1 34  THR 34  177 177 THR THR A . n 
A 1 35  SER 35  178 178 SER SER A . n 
A 1 36  ARG 36  179 179 ARG ARG A . n 
A 1 37  SER 37  180 180 SER SER A . n 
A 1 38  GLY 38  181 181 GLY GLY A . n 
A 1 39  THR 39  182 182 THR THR A . n 
A 1 40  ASP 40  183 183 ASP ASP A . n 
A 1 41  VAL 41  184 184 VAL VAL A . n 
A 1 42  ASP 42  185 185 ASP ASP A . n 
A 1 43  ALA 43  186 186 ALA ALA A . n 
A 1 44  ALA 44  187 187 ALA ALA A . n 
A 1 45  ASN 45  188 188 ASN ASN A . n 
A 1 46  LEU 46  189 189 LEU LEU A . n 
A 1 47  ARG 47  190 190 ARG ARG A . n 
A 1 48  GLU 48  191 191 GLU GLU A . n 
A 1 49  THR 49  192 192 THR THR A . n 
A 1 50  PHE 50  193 193 PHE PHE A . n 
A 1 51  ARG 51  194 194 ARG ARG A . n 
A 1 52  ASN 52  195 195 ASN ASN A . n 
A 1 53  LEU 53  196 196 LEU LEU A . n 
A 1 54  LYS 54  197 197 LYS LYS A . n 
A 1 55  TYR 55  198 198 TYR TYR A . n 
A 1 56  GLU 56  199 199 GLU GLU A . n 
A 1 57  VAL 57  200 200 VAL VAL A . n 
A 1 58  ARG 58  201 201 ARG ARG A . n 
A 1 59  ASN 59  202 202 ASN ASN A . n 
A 1 60  LYS 60  203 203 LYS LYS A . n 
A 1 61  ASN 61  204 204 ASN ASN A . n 
A 1 62  ASP 62  205 205 ASP ASP A . n 
A 1 63  LEU 63  206 206 LEU LEU A . n 
A 1 64  THR 64  207 207 THR THR A . n 
A 1 65  ARG 65  208 208 ARG ARG A . n 
A 1 66  GLU 66  209 209 GLU GLU A . n 
A 1 67  GLU 67  210 210 GLU GLU A . n 
A 1 68  ILE 68  211 211 ILE ILE A . n 
A 1 69  VAL 69  212 212 VAL VAL A . n 
A 1 70  GLU 70  213 213 GLU GLU A . n 
A 1 71  LEU 71  214 214 LEU LEU A . n 
A 1 72  MET 72  215 215 MET MET A . n 
A 1 73  ARG 73  216 216 ARG ARG A . n 
A 1 74  ASP 74  217 217 ASP ASP A . n 
A 1 75  VAL 75  218 218 VAL VAL A . n 
A 1 76  SER 76  219 219 SER SER A . n 
A 1 77  LYS 77  220 220 LYS LYS A . n 
A 1 78  GLU 78  221 221 GLU GLU A . n 
A 1 79  ASP 79  222 222 ASP ASP A . n 
A 1 80  HIS 80  224 224 HIS HIS A . n 
A 1 81  SER 81  225 225 SER SER A . n 
A 1 82  LYS 82  226 226 LYS LYS A . n 
A 1 83  ARG 83  227 227 ARG ARG A . n 
A 1 84  SER 84  228 228 SER SER A . n 
A 1 85  SER 85  229 229 SER SER A . n 
A 1 86  PHE 86  230 230 PHE PHE A . n 
A 1 87  VAL 87  231 231 VAL VAL A . n 
A 1 88  CYS 88  232 232 CYS CYS A . n 
A 1 89  VAL 89  233 233 VAL VAL A . n 
A 1 90  LEU 90  234 234 LEU LEU A . n 
A 1 91  LEU 91  235 235 LEU LEU A . n 
A 1 92  SER 92  236 236 SER SER A . n 
A 1 93  HIS 93  237 237 HIS HIS A . n 
A 1 94  GLY 94  238 238 GLY GLY A . n 
A 1 95  GLU 95  239 239 GLU GLU A . n 
A 1 96  GLU 96  240 240 GLU GLU A . n 
A 1 97  GLY 97  241 241 GLY GLY A . n 
A 1 98  ILE 98  242 242 ILE ILE A . n 
A 1 99  ILE 99  243 243 ILE ILE A . n 
A 1 100 PHE 100 244 244 PHE PHE A . n 
A 1 101 GLY 101 245 245 GLY GLY A . n 
A 1 102 THR 102 246 246 THR THR A . n 
A 1 103 ASN 103 247 247 ASN ASN A . n 
A 1 104 GLY 104 254 254 GLY GLY A . n 
A 1 105 PRO 105 255 255 PRO PRO A . n 
A 1 106 VAL 106 256 256 VAL VAL A . n 
A 1 107 ASP 107 257 257 ASP ASP A . n 
A 1 108 LEU 108 258 258 LEU LEU A . n 
A 1 109 LYS 109 259 259 LYS LYS A . n 
A 1 110 LYS 110 260 260 LYS LYS A . n 
A 1 111 ILE 111 261 261 ILE ILE A . n 
A 1 112 THR 112 262 262 THR THR A . n 
A 1 113 ASN 113 263 263 ASN ASN A . n 
A 1 114 PHE 114 264 264 PHE PHE A . n 
A 1 115 PHE 115 265 265 PHE PHE A . n 
A 1 116 ARG 116 266 266 ARG ARG A . n 
A 1 117 GLY 117 267 267 GLY GLY A . n 
A 1 118 ASP 118 268 268 ASP ASP A . n 
A 1 119 ARG 119 269 269 ARG ARG A . n 
A 1 120 CYS 120 270 270 CYS CYS A . n 
A 1 121 ARG 121 271 271 ARG ARG A . n 
A 1 122 SER 122 272 272 SER SER A . n 
A 1 123 LEU 123 273 273 LEU LEU A . n 
A 1 124 THR 124 274 274 THR THR A . n 
A 1 125 GLY 125 275 275 GLY GLY A . n 
A 1 126 LYS 126 276 276 LYS LYS A . n 
A 1 127 PRO 127 277 277 PRO PRO A . n 
A 1 128 LYS 128 278 278 LYS LYS A . n 
A 1 129 LEU 129 279 279 LEU LEU A . n 
A 1 130 PHE 130 280 280 PHE PHE A . n 
A 1 131 ILE 131 281 281 ILE ILE A . n 
A 1 132 ILE 132 282 282 ILE ILE A . n 
A 1 133 GLN 133 283 283 GLN GLN A . n 
A 1 134 ALA 134 284 284 ALA ALA A . n 
A 1 135 CYS 135 285 285 CYS CYS A . n 
A 1 136 ARG 136 286 286 ARG ARG A . n 
A 1 137 GLY 137 287 287 GLY GLY A . n 
A 1 138 THR 138 288 288 THR THR A . n 
A 1 139 GLU 139 289 289 GLU GLU A . n 
A 1 140 LEU 140 290 290 LEU LEU A . n 
A 1 141 ASP 141 291 291 ASP ASP A . n 
A 1 142 CYS 142 292 292 CYS CYS A . n 
A 1 143 GLY 143 293 293 GLY GLY A . n 
A 1 144 ILE 144 294 294 ILE ILE A . n 
A 1 145 GLU 145 295 295 GLU GLU A . n 
A 1 146 THR 146 296 ?   ?   ?   A . n 
A 1 147 ASP 147 297 ?   ?   ?   A . n 
B 2 1   SER 1   310 ?   ?   ?   B . n 
B 2 2   GLY 2   311 ?   ?   ?   B . n 
B 2 3   VAL 3   312 ?   ?   ?   B . n 
B 2 4   ASP 4   313 ?   ?   ?   B . n 
B 2 5   ASP 5   314 ?   ?   ?   B . n 
B 2 6   ASP 6   315 ?   ?   ?   B . n 
B 2 7   MET 7   316 ?   ?   ?   B . n 
B 2 8   ALA 8   317 ?   ?   ?   B . n 
B 2 9   CYS 9   318 ?   ?   ?   B . n 
B 2 10  HIS 10  319 ?   ?   ?   B . n 
B 2 11  LYS 11  320 320 LYS LYS B . n 
B 2 12  ILE 12  321 321 ILE ILE B . n 
B 2 13  PRO 13  322 322 PRO PRO B . n 
B 2 14  VAL 14  323 323 VAL VAL B . n 
B 2 15  GLU 15  324 324 GLU GLU B . n 
B 2 16  ALA 16  325 325 ALA ALA B . n 
B 2 17  ASP 17  326 326 ASP ASP B . n 
B 2 18  PHE 18  327 327 PHE PHE B . n 
B 2 19  LEU 19  328 328 LEU LEU B . n 
B 2 20  TYR 20  329 329 TYR TYR B . n 
B 2 21  ALA 21  330 330 ALA ALA B . n 
B 2 22  TYR 22  331 331 TYR TYR B . n 
B 2 23  SER 23  332 332 SER SER B . n 
B 2 24  THR 24  333 333 THR THR B . n 
B 2 25  ALA 25  334 334 ALA ALA B . n 
B 2 26  PRO 26  335 335 PRO PRO B . n 
B 2 27  GLY 27  336 336 GLY GLY B . n 
B 2 28  TYR 28  337 337 TYR TYR B . n 
B 2 29  TYR 29  338 338 TYR TYR B . n 
B 2 30  SER 30  339 339 SER SER B . n 
B 2 31  TRP 31  340 340 TRP TRP B . n 
B 2 32  ARG 32  341 341 ARG ARG B . n 
B 2 33  ASN 33  342 342 ASN ASN B . n 
B 2 34  SER 34  343 343 SER SER B . n 
B 2 35  LYS 35  344 344 LYS LYS B . n 
B 2 36  ASP 36  345 345 ASP ASP B . n 
B 2 37  GLY 37  346 346 GLY GLY B . n 
B 2 38  SER 38  347 347 SER SER B . n 
B 2 39  TRP 39  348 348 TRP TRP B . n 
B 2 40  PHE 40  349 349 PHE PHE B . n 
B 2 41  ILE 41  350 350 ILE ILE B . n 
B 2 42  GLN 42  351 351 GLN GLN B . n 
B 2 43  SER 43  352 352 SER SER B . n 
B 2 44  LEU 44  353 353 LEU LEU B . n 
B 2 45  CYS 45  354 354 CYS CYS B . n 
B 2 46  ALA 46  355 355 ALA ALA B . n 
B 2 47  MET 47  356 356 MET MET B . n 
B 2 48  LEU 48  357 357 LEU LEU B . n 
B 2 49  LYS 49  358 358 LYS LYS B . n 
B 2 50  GLN 50  359 359 GLN GLN B . n 
B 2 51  TYR 51  360 360 TYR TYR B . n 
B 2 52  ALA 52  361 361 ALA ALA B . n 
B 2 53  ASP 53  362 362 ASP ASP B . n 
B 2 54  LYS 54  363 363 LYS LYS B . n 
B 2 55  LEU 55  364 364 LEU LEU B . n 
B 2 56  GLU 56  365 365 GLU GLU B . n 
B 2 57  PHE 57  366 366 PHE PHE B . n 
B 2 58  MET 58  367 367 MET MET B . n 
B 2 59  HIS 59  368 368 HIS HIS B . n 
B 2 60  ILE 60  369 369 ILE ILE B . n 
B 2 61  LEU 61  370 370 LEU LEU B . n 
B 2 62  THR 62  371 371 THR THR B . n 
B 2 63  ARG 63  372 372 ARG ARG B . n 
B 2 64  VAL 64  373 373 VAL VAL B . n 
B 2 65  ASN 65  374 374 ASN ASN B . n 
B 2 66  ARG 66  375 375 ARG ARG B . n 
B 2 67  LYS 67  376 376 LYS LYS B . n 
B 2 68  VAL 68  377 377 VAL VAL B . n 
B 2 69  ALA 69  378 378 ALA ALA B . n 
B 2 70  THR 70  379 379 THR THR B . n 
B 2 71  GLU 71  379 379 GLU GLU B A n 
B 2 72  PHE 72  380 380 PHE PHE B . n 
B 2 73  GLU 73  381 381 GLU GLU B . n 
B 2 74  SER 74  381 381 SER SER B A n 
B 2 75  PHE 75  381 381 PHE PHE B B n 
B 2 76  SER 76  381 381 SER SER B C n 
B 2 77  PHE 77  381 381 PHE PHE B D n 
B 2 78  ASP 78  381 381 ASP ASP B E n 
B 2 79  ALA 79  381 381 ALA ALA B F n 
B 2 80  THR 80  381 381 THR THR B G n 
B 2 81  PHE 81  381 381 PHE PHE B H n 
B 2 82  HIS 82  381 381 HIS HIS B I n 
B 2 83  ALA 83  382 382 ALA ALA B . n 
B 2 84  LYS 84  383 383 LYS LYS B . n 
B 2 85  LYS 85  384 384 LYS LYS B . n 
B 2 86  GLN 86  385 385 GLN GLN B . n 
B 2 87  ILE 87  386 386 ILE ILE B . n 
B 2 88  PRO 88  387 387 PRO PRO B . n 
B 2 89  CYS 89  388 388 CYS CYS B . n 
B 2 90  ILE 90  389 389 ILE ILE B . n 
B 2 91  VAL 91  390 390 VAL VAL B . n 
B 2 92  SER 92  392 392 SER SER B . n 
B 2 93  MET 93  393 393 MET MET B . n 
B 2 94  LEU 94  394 394 LEU LEU B . n 
B 2 95  THR 95  395 395 THR THR B . n 
B 2 96  LYS 96  396 396 LYS LYS B . n 
B 2 97  GLU 97  397 397 GLU GLU B . n 
B 2 98  LEU 98  398 398 LEU LEU B . n 
B 2 99  TYR 99  399 399 TYR TYR B . n 
B 2 100 PHE 100 400 400 PHE PHE B . n 
B 2 101 TYR 101 401 401 TYR TYR B . n 
B 2 102 HIS 102 402 ?   ?   ?   B . n 
B 2 103 LEU 103 403 ?   ?   ?   B . n 
B 2 104 GLU 104 404 ?   ?   ?   B . n 
B 2 105 HIS 105 405 ?   ?   ?   B . n 
B 2 106 HIS 106 406 ?   ?   ?   B . n 
B 2 107 HIS 107 407 ?   ?   ?   B . n 
B 2 108 HIS 108 408 ?   ?   ?   B . n 
B 2 109 HIS 109 409 ?   ?   ?   B . n 
B 2 110 HIS 110 410 ?   ?   ?   B . n 
C 1 1   SER 1   645 ?   ?   ?   C . n 
C 1 2   GLY 2   646 ?   ?   ?   C . n 
C 1 3   ILE 3   647 ?   ?   ?   C . n 
C 1 4   SER 4   648 ?   ?   ?   C . n 
C 1 5   LEU 5   649 ?   ?   ?   C . n 
C 1 6   ASP 6   650 650 ASP ASP C . n 
C 1 7   ASN 7   651 651 ASN ASN C . n 
C 1 8   SER 8   652 652 SER SER C . n 
C 1 9   TYR 9   653 653 TYR TYR C . n 
C 1 10  LYS 10  654 654 LYS LYS C . n 
C 1 11  MET 11  655 655 MET MET C . n 
C 1 12  ASP 12  656 656 ASP ASP C . n 
C 1 13  TYR 13  656 656 TYR TYR C A n 
C 1 14  PRO 14  661 661 PRO PRO C . n 
C 1 15  GLU 15  662 662 GLU GLU C . n 
C 1 16  MET 16  662 662 MET MET C A n 
C 1 17  GLY 17  663 663 GLY GLY C . n 
C 1 18  LEU 18  664 664 LEU LEU C . n 
C 1 19  CYS 19  665 665 CYS CYS C . n 
C 1 20  ILE 20  666 666 ILE ILE C . n 
C 1 21  ILE 21  667 667 ILE ILE C . n 
C 1 22  ILE 22  668 668 ILE ILE C . n 
C 1 23  ASN 23  669 669 ASN ASN C . n 
C 1 24  ASN 24  670 670 ASN ASN C . n 
C 1 25  LYS 25  671 671 LYS LYS C . n 
C 1 26  ASN 26  672 672 ASN ASN C . n 
C 1 27  PHE 27  673 673 PHE PHE C . n 
C 1 28  HIS 28  674 674 HIS HIS C . n 
C 1 29  LYS 29  675 675 LYS LYS C . n 
C 1 30  SER 30  675 675 SER SER C A n 
C 1 31  THR 31  675 675 THR THR C B n 
C 1 32  GLY 32  675 675 GLY GLY C C n 
C 1 33  MET 33  676 676 MET MET C . n 
C 1 34  THR 34  677 677 THR THR C . n 
C 1 35  SER 35  678 678 SER SER C . n 
C 1 36  ARG 36  679 679 ARG ARG C . n 
C 1 37  SER 37  680 680 SER SER C . n 
C 1 38  GLY 38  681 681 GLY GLY C . n 
C 1 39  THR 39  682 682 THR THR C . n 
C 1 40  ASP 40  683 683 ASP ASP C . n 
C 1 41  VAL 41  684 684 VAL VAL C . n 
C 1 42  ASP 42  685 685 ASP ASP C . n 
C 1 43  ALA 43  686 686 ALA ALA C . n 
C 1 44  ALA 44  687 687 ALA ALA C . n 
C 1 45  ASN 45  688 688 ASN ASN C . n 
C 1 46  LEU 46  689 689 LEU LEU C . n 
C 1 47  ARG 47  690 690 ARG ARG C . n 
C 1 48  GLU 48  691 691 GLU GLU C . n 
C 1 49  THR 49  692 692 THR THR C . n 
C 1 50  PHE 50  693 693 PHE PHE C . n 
C 1 51  ARG 51  694 694 ARG ARG C . n 
C 1 52  ASN 52  695 695 ASN ASN C . n 
C 1 53  LEU 53  696 696 LEU LEU C . n 
C 1 54  LYS 54  697 697 LYS LYS C . n 
C 1 55  TYR 55  698 698 TYR TYR C . n 
C 1 56  GLU 56  699 699 GLU GLU C . n 
C 1 57  VAL 57  700 700 VAL VAL C . n 
C 1 58  ARG 58  701 701 ARG ARG C . n 
C 1 59  ASN 59  702 702 ASN ASN C . n 
C 1 60  LYS 60  703 703 LYS LYS C . n 
C 1 61  ASN 61  704 704 ASN ASN C . n 
C 1 62  ASP 62  705 705 ASP ASP C . n 
C 1 63  LEU 63  706 706 LEU LEU C . n 
C 1 64  THR 64  707 707 THR THR C . n 
C 1 65  ARG 65  708 708 ARG ARG C . n 
C 1 66  GLU 66  709 709 GLU GLU C . n 
C 1 67  GLU 67  710 710 GLU GLU C . n 
C 1 68  ILE 68  711 711 ILE ILE C . n 
C 1 69  VAL 69  712 712 VAL VAL C . n 
C 1 70  GLU 70  713 713 GLU GLU C . n 
C 1 71  LEU 71  714 714 LEU LEU C . n 
C 1 72  MET 72  715 715 MET MET C . n 
C 1 73  ARG 73  716 716 ARG ARG C . n 
C 1 74  ASP 74  717 717 ASP ASP C . n 
C 1 75  VAL 75  718 718 VAL VAL C . n 
C 1 76  SER 76  719 719 SER SER C . n 
C 1 77  LYS 77  720 720 LYS LYS C . n 
C 1 78  GLU 78  721 721 GLU GLU C . n 
C 1 79  ASP 79  722 722 ASP ASP C . n 
C 1 80  HIS 80  724 724 HIS HIS C . n 
C 1 81  SER 81  725 725 SER SER C . n 
C 1 82  LYS 82  726 726 LYS LYS C . n 
C 1 83  ARG 83  727 727 ARG ARG C . n 
C 1 84  SER 84  728 728 SER SER C . n 
C 1 85  SER 85  729 729 SER SER C . n 
C 1 86  PHE 86  730 730 PHE PHE C . n 
C 1 87  VAL 87  731 731 VAL VAL C . n 
C 1 88  CYS 88  732 732 CYS CYS C . n 
C 1 89  VAL 89  733 733 VAL VAL C . n 
C 1 90  LEU 90  734 734 LEU LEU C . n 
C 1 91  LEU 91  735 735 LEU LEU C . n 
C 1 92  SER 92  736 736 SER SER C . n 
C 1 93  HIS 93  737 737 HIS HIS C . n 
C 1 94  GLY 94  738 738 GLY GLY C . n 
C 1 95  GLU 95  739 739 GLU GLU C . n 
C 1 96  GLU 96  740 740 GLU GLU C . n 
C 1 97  GLY 97  741 741 GLY GLY C . n 
C 1 98  ILE 98  742 742 ILE ILE C . n 
C 1 99  ILE 99  743 743 ILE ILE C . n 
C 1 100 PHE 100 744 744 PHE PHE C . n 
C 1 101 GLY 101 745 745 GLY GLY C . n 
C 1 102 THR 102 746 746 THR THR C . n 
C 1 103 ASN 103 747 747 ASN ASN C . n 
C 1 104 GLY 104 754 754 GLY GLY C . n 
C 1 105 PRO 105 755 755 PRO PRO C . n 
C 1 106 VAL 106 756 756 VAL VAL C . n 
C 1 107 ASP 107 757 757 ASP ASP C . n 
C 1 108 LEU 108 758 758 LEU LEU C . n 
C 1 109 LYS 109 759 759 LYS LYS C . n 
C 1 110 LYS 110 760 760 LYS LYS C . n 
C 1 111 ILE 111 761 761 ILE ILE C . n 
C 1 112 THR 112 762 762 THR THR C . n 
C 1 113 ASN 113 763 763 ASN ASN C . n 
C 1 114 PHE 114 764 764 PHE PHE C . n 
C 1 115 PHE 115 765 765 PHE PHE C . n 
C 1 116 ARG 116 766 766 ARG ARG C . n 
C 1 117 GLY 117 767 767 GLY GLY C . n 
C 1 118 ASP 118 768 768 ASP ASP C . n 
C 1 119 ARG 119 769 769 ARG ARG C . n 
C 1 120 CYS 120 770 770 CYS CYS C . n 
C 1 121 ARG 121 771 771 ARG ARG C . n 
C 1 122 SER 122 772 772 SER SER C . n 
C 1 123 LEU 123 773 773 LEU LEU C . n 
C 1 124 THR 124 774 774 THR THR C . n 
C 1 125 GLY 125 775 775 GLY GLY C . n 
C 1 126 LYS 126 776 776 LYS LYS C . n 
C 1 127 PRO 127 777 777 PRO PRO C . n 
C 1 128 LYS 128 778 778 LYS LYS C . n 
C 1 129 LEU 129 779 779 LEU LEU C . n 
C 1 130 PHE 130 780 780 PHE PHE C . n 
C 1 131 ILE 131 781 781 ILE ILE C . n 
C 1 132 ILE 132 782 782 ILE ILE C . n 
C 1 133 GLN 133 783 783 GLN GLN C . n 
C 1 134 ALA 134 784 784 ALA ALA C . n 
C 1 135 CYS 135 785 785 CYS CYS C . n 
C 1 136 ARG 136 786 786 ARG ARG C . n 
C 1 137 GLY 137 787 787 GLY GLY C . n 
C 1 138 THR 138 788 788 THR THR C . n 
C 1 139 GLU 139 789 789 GLU GLU C . n 
C 1 140 LEU 140 790 790 LEU LEU C . n 
C 1 141 ASP 141 791 791 ASP ASP C . n 
C 1 142 CYS 142 792 792 CYS CYS C . n 
C 1 143 GLY 143 793 793 GLY GLY C . n 
C 1 144 ILE 144 794 794 ILE ILE C . n 
C 1 145 GLU 145 795 795 GLU GLU C . n 
C 1 146 THR 146 796 ?   ?   ?   C . n 
C 1 147 ASP 147 797 ?   ?   ?   C . n 
D 2 1   SER 1   810 ?   ?   ?   D . n 
D 2 2   GLY 2   811 ?   ?   ?   D . n 
D 2 3   VAL 3   812 ?   ?   ?   D . n 
D 2 4   ASP 4   813 ?   ?   ?   D . n 
D 2 5   ASP 5   814 ?   ?   ?   D . n 
D 2 6   ASP 6   815 ?   ?   ?   D . n 
D 2 7   MET 7   816 ?   ?   ?   D . n 
D 2 8   ALA 8   817 ?   ?   ?   D . n 
D 2 9   CYS 9   818 ?   ?   ?   D . n 
D 2 10  HIS 10  819 ?   ?   ?   D . n 
D 2 11  LYS 11  820 820 LYS LYS D . n 
D 2 12  ILE 12  821 821 ILE ILE D . n 
D 2 13  PRO 13  822 822 PRO PRO D . n 
D 2 14  VAL 14  823 823 VAL VAL D . n 
D 2 15  GLU 15  824 824 GLU GLU D . n 
D 2 16  ALA 16  825 825 ALA ALA D . n 
D 2 17  ASP 17  826 826 ASP ASP D . n 
D 2 18  PHE 18  827 827 PHE PHE D . n 
D 2 19  LEU 19  828 828 LEU LEU D . n 
D 2 20  TYR 20  829 829 TYR TYR D . n 
D 2 21  ALA 21  830 830 ALA ALA D . n 
D 2 22  TYR 22  831 831 TYR TYR D . n 
D 2 23  SER 23  832 832 SER SER D . n 
D 2 24  THR 24  833 833 THR THR D . n 
D 2 25  ALA 25  834 834 ALA ALA D . n 
D 2 26  PRO 26  835 835 PRO PRO D . n 
D 2 27  GLY 27  836 836 GLY GLY D . n 
D 2 28  TYR 28  837 837 TYR TYR D . n 
D 2 29  TYR 29  838 838 TYR TYR D . n 
D 2 30  SER 30  839 839 SER SER D . n 
D 2 31  TRP 31  840 840 TRP TRP D . n 
D 2 32  ARG 32  841 841 ARG ARG D . n 
D 2 33  ASN 33  842 842 ASN ASN D . n 
D 2 34  SER 34  843 843 SER SER D . n 
D 2 35  LYS 35  844 844 LYS LYS D . n 
D 2 36  ASP 36  845 845 ASP ASP D . n 
D 2 37  GLY 37  846 846 GLY GLY D . n 
D 2 38  SER 38  847 847 SER SER D . n 
D 2 39  TRP 39  848 848 TRP TRP D . n 
D 2 40  PHE 40  849 849 PHE PHE D . n 
D 2 41  ILE 41  850 850 ILE ILE D . n 
D 2 42  GLN 42  851 851 GLN GLN D . n 
D 2 43  SER 43  852 852 SER SER D . n 
D 2 44  LEU 44  853 853 LEU LEU D . n 
D 2 45  CYS 45  854 854 CYS CYS D . n 
D 2 46  ALA 46  855 855 ALA ALA D . n 
D 2 47  MET 47  856 856 MET MET D . n 
D 2 48  LEU 48  857 857 LEU LEU D . n 
D 2 49  LYS 49  858 858 LYS LYS D . n 
D 2 50  GLN 50  859 859 GLN GLN D . n 
D 2 51  TYR 51  860 860 TYR TYR D . n 
D 2 52  ALA 52  861 861 ALA ALA D . n 
D 2 53  ASP 53  862 862 ASP ASP D . n 
D 2 54  LYS 54  863 863 LYS LYS D . n 
D 2 55  LEU 55  864 864 LEU LEU D . n 
D 2 56  GLU 56  865 865 GLU GLU D . n 
D 2 57  PHE 57  866 866 PHE PHE D . n 
D 2 58  MET 58  867 867 MET MET D . n 
D 2 59  HIS 59  868 868 HIS HIS D . n 
D 2 60  ILE 60  869 869 ILE ILE D . n 
D 2 61  LEU 61  870 870 LEU LEU D . n 
D 2 62  THR 62  871 871 THR THR D . n 
D 2 63  ARG 63  872 872 ARG ARG D . n 
D 2 64  VAL 64  873 873 VAL VAL D . n 
D 2 65  ASN 65  874 874 ASN ASN D . n 
D 2 66  ARG 66  875 875 ARG ARG D . n 
D 2 67  LYS 67  876 876 LYS LYS D . n 
D 2 68  VAL 68  877 877 VAL VAL D . n 
D 2 69  ALA 69  878 878 ALA ALA D . n 
D 2 70  THR 70  879 879 THR THR D . n 
D 2 71  GLU 71  879 879 GLU GLU D A n 
D 2 72  PHE 72  880 880 PHE PHE D . n 
D 2 73  GLU 73  881 881 GLU GLU D . n 
D 2 74  SER 74  881 881 SER SER D A n 
D 2 75  PHE 75  881 881 PHE PHE D B n 
D 2 76  SER 76  881 881 SER SER D C n 
D 2 77  PHE 77  881 881 PHE PHE D D n 
D 2 78  ASP 78  881 881 ASP ASP D E n 
D 2 79  ALA 79  881 881 ALA ALA D F n 
D 2 80  THR 80  881 881 THR THR D G n 
D 2 81  PHE 81  881 881 PHE PHE D H n 
D 2 82  HIS 82  881 881 HIS HIS D I n 
D 2 83  ALA 83  882 882 ALA ALA D . n 
D 2 84  LYS 84  883 883 LYS LYS D . n 
D 2 85  LYS 85  884 884 LYS LYS D . n 
D 2 86  GLN 86  885 885 GLN GLN D . n 
D 2 87  ILE 87  886 886 ILE ILE D . n 
D 2 88  PRO 88  887 887 PRO PRO D . n 
D 2 89  CYS 89  888 888 CYS CYS D . n 
D 2 90  ILE 90  889 889 ILE ILE D . n 
D 2 91  VAL 91  890 890 VAL VAL D . n 
D 2 92  SER 92  892 892 SER SER D . n 
D 2 93  MET 93  893 893 MET MET D . n 
D 2 94  LEU 94  894 894 LEU LEU D . n 
D 2 95  THR 95  895 895 THR THR D . n 
D 2 96  LYS 96  896 896 LYS LYS D . n 
D 2 97  GLU 97  897 897 GLU GLU D . n 
D 2 98  LEU 98  898 898 LEU LEU D . n 
D 2 99  TYR 99  899 899 TYR TYR D . n 
D 2 100 PHE 100 900 900 PHE PHE D . n 
D 2 101 TYR 101 901 901 TYR TYR D . n 
D 2 102 HIS 102 902 ?   ?   ?   D . n 
D 2 103 LEU 103 903 ?   ?   ?   D . n 
D 2 104 GLU 104 904 ?   ?   ?   D . n 
D 2 105 HIS 105 905 ?   ?   ?   D . n 
D 2 106 HIS 106 906 ?   ?   ?   D . n 
D 2 107 HIS 107 907 ?   ?   ?   D . n 
D 2 108 HIS 108 908 ?   ?   ?   D . n 
D 2 109 HIS 109 909 ?   ?   ?   D . n 
D 2 110 HIS 110 910 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 PZN 1  501 501 PZN PZN A . 
F 3 PZN 1  502 502 PZN PZN C . 
G 4 HOH 1  502 1   HOH HOH A . 
G 4 HOH 2  503 22  HOH HOH A . 
G 4 HOH 3  504 23  HOH HOH A . 
G 4 HOH 4  505 30  HOH HOH A . 
G 4 HOH 5  506 32  HOH HOH A . 
G 4 HOH 6  507 34  HOH HOH A . 
G 4 HOH 7  508 40  HOH HOH A . 
G 4 HOH 8  509 41  HOH HOH A . 
G 4 HOH 9  510 44  HOH HOH A . 
G 4 HOH 10 511 48  HOH HOH A . 
G 4 HOH 11 512 50  HOH HOH A . 
G 4 HOH 12 513 56  HOH HOH A . 
G 4 HOH 13 514 72  HOH HOH A . 
G 4 HOH 14 515 74  HOH HOH A . 
G 4 HOH 15 516 76  HOH HOH A . 
G 4 HOH 16 517 81  HOH HOH A . 
G 4 HOH 17 518 83  HOH HOH A . 
G 4 HOH 18 519 94  HOH HOH A . 
G 4 HOH 19 520 97  HOH HOH A . 
G 4 HOH 20 521 99  HOH HOH A . 
G 4 HOH 21 522 102 HOH HOH A . 
G 4 HOH 22 523 106 HOH HOH A . 
G 4 HOH 23 524 108 HOH HOH A . 
G 4 HOH 24 525 110 HOH HOH A . 
G 4 HOH 25 526 111 HOH HOH A . 
G 4 HOH 26 527 118 HOH HOH A . 
G 4 HOH 27 528 121 HOH HOH A . 
G 4 HOH 28 529 123 HOH HOH A . 
G 4 HOH 29 530 124 HOH HOH A . 
G 4 HOH 30 531 127 HOH HOH A . 
G 4 HOH 31 532 130 HOH HOH A . 
G 4 HOH 32 533 131 HOH HOH A . 
G 4 HOH 33 534 132 HOH HOH A . 
G 4 HOH 34 535 135 HOH HOH A . 
G 4 HOH 35 536 141 HOH HOH A . 
G 4 HOH 36 537 155 HOH HOH A . 
G 4 HOH 37 538 158 HOH HOH A . 
G 4 HOH 38 539 161 HOH HOH A . 
G 4 HOH 39 540 162 HOH HOH A . 
G 4 HOH 40 541 164 HOH HOH A . 
G 4 HOH 41 542 168 HOH HOH A . 
G 4 HOH 42 543 170 HOH HOH A . 
G 4 HOH 43 544 173 HOH HOH A . 
G 4 HOH 44 545 175 HOH HOH A . 
G 4 HOH 45 546 176 HOH HOH A . 
G 4 HOH 46 547 177 HOH HOH A . 
G 4 HOH 47 548 178 HOH HOH A . 
G 4 HOH 48 549 189 HOH HOH A . 
G 4 HOH 49 550 197 HOH HOH A . 
G 4 HOH 50 551 199 HOH HOH A . 
G 4 HOH 51 552 203 HOH HOH A . 
G 4 HOH 52 553 205 HOH HOH A . 
G 4 HOH 53 554 212 HOH HOH A . 
G 4 HOH 54 555 213 HOH HOH A . 
G 4 HOH 55 556 216 HOH HOH A . 
G 4 HOH 56 557 217 HOH HOH A . 
G 4 HOH 57 558 219 HOH HOH A . 
G 4 HOH 58 559 220 HOH HOH A . 
G 4 HOH 59 560 221 HOH HOH A . 
G 4 HOH 60 561 224 HOH HOH A . 
G 4 HOH 61 562 228 HOH HOH A . 
G 4 HOH 62 563 229 HOH HOH A . 
G 4 HOH 63 564 232 HOH HOH A . 
H 4 HOH 1  4   4   HOH HOH B . 
H 4 HOH 2  9   9   HOH HOH B . 
H 4 HOH 3  14  14  HOH HOH B . 
H 4 HOH 4  17  17  HOH HOH B . 
H 4 HOH 5  24  24  HOH HOH B . 
H 4 HOH 6  31  31  HOH HOH B . 
H 4 HOH 7  57  57  HOH HOH B . 
H 4 HOH 8  58  58  HOH HOH B . 
H 4 HOH 9  65  65  HOH HOH B . 
H 4 HOH 10 66  66  HOH HOH B . 
H 4 HOH 11 70  70  HOH HOH B . 
H 4 HOH 12 71  71  HOH HOH B . 
H 4 HOH 13 77  77  HOH HOH B . 
H 4 HOH 14 79  79  HOH HOH B . 
H 4 HOH 15 82  82  HOH HOH B . 
H 4 HOH 16 86  86  HOH HOH B . 
H 4 HOH 17 89  89  HOH HOH B . 
H 4 HOH 18 109 109 HOH HOH B . 
H 4 HOH 19 115 115 HOH HOH B . 
H 4 HOH 20 122 122 HOH HOH B . 
H 4 HOH 21 128 128 HOH HOH B . 
H 4 HOH 22 136 136 HOH HOH B . 
H 4 HOH 23 137 137 HOH HOH B . 
H 4 HOH 24 138 138 HOH HOH B . 
H 4 HOH 25 139 139 HOH HOH B . 
H 4 HOH 26 142 142 HOH HOH B . 
H 4 HOH 27 179 179 HOH HOH B . 
H 4 HOH 28 181 181 HOH HOH B . 
H 4 HOH 29 201 201 HOH HOH B . 
H 4 HOH 30 202 202 HOH HOH B . 
H 4 HOH 31 206 206 HOH HOH B . 
H 4 HOH 32 209 209 HOH HOH B . 
H 4 HOH 33 211 211 HOH HOH B . 
H 4 HOH 34 218 218 HOH HOH B . 
H 4 HOH 35 225 225 HOH HOH B . 
H 4 HOH 36 227 227 HOH HOH B . 
I 4 HOH 1  2   2   HOH HOH C . 
I 4 HOH 2  5   5   HOH HOH C . 
I 4 HOH 3  8   8   HOH HOH C . 
I 4 HOH 4  10  10  HOH HOH C . 
I 4 HOH 5  11  11  HOH HOH C . 
I 4 HOH 6  12  12  HOH HOH C . 
I 4 HOH 7  15  15  HOH HOH C . 
I 4 HOH 8  16  16  HOH HOH C . 
I 4 HOH 9  19  19  HOH HOH C . 
I 4 HOH 10 21  21  HOH HOH C . 
I 4 HOH 11 25  25  HOH HOH C . 
I 4 HOH 12 26  26  HOH HOH C . 
I 4 HOH 13 29  29  HOH HOH C . 
I 4 HOH 14 33  33  HOH HOH C . 
I 4 HOH 15 45  45  HOH HOH C . 
I 4 HOH 16 52  52  HOH HOH C . 
I 4 HOH 17 53  53  HOH HOH C . 
I 4 HOH 18 54  54  HOH HOH C . 
I 4 HOH 19 55  55  HOH HOH C . 
I 4 HOH 20 59  59  HOH HOH C . 
I 4 HOH 21 61  61  HOH HOH C . 
I 4 HOH 22 62  62  HOH HOH C . 
I 4 HOH 23 63  63  HOH HOH C . 
I 4 HOH 24 64  64  HOH HOH C . 
I 4 HOH 25 69  69  HOH HOH C . 
I 4 HOH 26 73  73  HOH HOH C . 
I 4 HOH 27 75  75  HOH HOH C . 
I 4 HOH 28 78  78  HOH HOH C . 
I 4 HOH 29 84  84  HOH HOH C . 
I 4 HOH 30 88  88  HOH HOH C . 
I 4 HOH 31 90  90  HOH HOH C . 
I 4 HOH 32 91  91  HOH HOH C . 
I 4 HOH 33 92  92  HOH HOH C . 
I 4 HOH 34 95  95  HOH HOH C . 
I 4 HOH 35 96  96  HOH HOH C . 
I 4 HOH 36 100 100 HOH HOH C . 
I 4 HOH 37 101 101 HOH HOH C . 
I 4 HOH 38 105 105 HOH HOH C . 
I 4 HOH 39 107 107 HOH HOH C . 
I 4 HOH 40 112 112 HOH HOH C . 
I 4 HOH 41 113 113 HOH HOH C . 
I 4 HOH 42 114 114 HOH HOH C . 
I 4 HOH 43 116 116 HOH HOH C . 
I 4 HOH 44 117 117 HOH HOH C . 
I 4 HOH 45 119 119 HOH HOH C . 
I 4 HOH 46 120 120 HOH HOH C . 
I 4 HOH 47 125 125 HOH HOH C . 
I 4 HOH 48 126 126 HOH HOH C . 
I 4 HOH 49 129 129 HOH HOH C . 
I 4 HOH 50 133 133 HOH HOH C . 
I 4 HOH 51 134 134 HOH HOH C . 
I 4 HOH 52 140 140 HOH HOH C . 
I 4 HOH 53 144 144 HOH HOH C . 
I 4 HOH 54 146 146 HOH HOH C . 
I 4 HOH 55 150 150 HOH HOH C . 
I 4 HOH 56 151 151 HOH HOH C . 
I 4 HOH 57 152 152 HOH HOH C . 
I 4 HOH 58 153 153 HOH HOH C . 
I 4 HOH 59 156 156 HOH HOH C . 
I 4 HOH 60 159 159 HOH HOH C . 
I 4 HOH 61 163 163 HOH HOH C . 
I 4 HOH 62 166 166 HOH HOH C . 
I 4 HOH 63 167 167 HOH HOH C . 
I 4 HOH 64 169 169 HOH HOH C . 
I 4 HOH 65 171 171 HOH HOH C . 
I 4 HOH 66 172 172 HOH HOH C . 
I 4 HOH 67 180 180 HOH HOH C . 
I 4 HOH 68 182 182 HOH HOH C . 
I 4 HOH 69 183 183 HOH HOH C . 
I 4 HOH 70 187 187 HOH HOH C . 
I 4 HOH 71 188 188 HOH HOH C . 
I 4 HOH 72 190 190 HOH HOH C . 
I 4 HOH 73 191 191 HOH HOH C . 
I 4 HOH 74 193 193 HOH HOH C . 
I 4 HOH 75 195 195 HOH HOH C . 
I 4 HOH 76 196 196 HOH HOH C . 
I 4 HOH 77 198 198 HOH HOH C . 
I 4 HOH 78 204 204 HOH HOH C . 
I 4 HOH 79 208 208 HOH HOH C . 
I 4 HOH 80 210 210 HOH HOH C . 
I 4 HOH 81 214 214 HOH HOH C . 
I 4 HOH 82 222 222 HOH HOH C . 
I 4 HOH 83 223 223 HOH HOH C . 
I 4 HOH 84 230 230 HOH HOH C . 
I 4 HOH 85 231 231 HOH HOH C . 
I 4 HOH 86 233 233 HOH HOH C . 
J 4 HOH 1  3   3   HOH HOH D . 
J 4 HOH 2  6   6   HOH HOH D . 
J 4 HOH 3  7   7   HOH HOH D . 
J 4 HOH 4  13  13  HOH HOH D . 
J 4 HOH 5  18  18  HOH HOH D . 
J 4 HOH 6  20  20  HOH HOH D . 
J 4 HOH 7  27  27  HOH HOH D . 
J 4 HOH 8  28  28  HOH HOH D . 
J 4 HOH 9  35  35  HOH HOH D . 
J 4 HOH 10 36  36  HOH HOH D . 
J 4 HOH 11 37  37  HOH HOH D . 
J 4 HOH 12 38  38  HOH HOH D . 
J 4 HOH 13 39  39  HOH HOH D . 
J 4 HOH 14 42  42  HOH HOH D . 
J 4 HOH 15 43  43  HOH HOH D . 
J 4 HOH 16 46  46  HOH HOH D . 
J 4 HOH 17 47  47  HOH HOH D . 
J 4 HOH 18 49  49  HOH HOH D . 
J 4 HOH 19 51  51  HOH HOH D . 
J 4 HOH 20 60  60  HOH HOH D . 
J 4 HOH 21 67  67  HOH HOH D . 
J 4 HOH 22 68  68  HOH HOH D . 
J 4 HOH 23 80  80  HOH HOH D . 
J 4 HOH 24 85  85  HOH HOH D . 
J 4 HOH 25 87  87  HOH HOH D . 
J 4 HOH 26 93  93  HOH HOH D . 
J 4 HOH 27 98  98  HOH HOH D . 
J 4 HOH 28 103 103 HOH HOH D . 
J 4 HOH 29 104 104 HOH HOH D . 
J 4 HOH 30 143 143 HOH HOH D . 
J 4 HOH 31 145 145 HOH HOH D . 
J 4 HOH 32 147 147 HOH HOH D . 
J 4 HOH 33 148 148 HOH HOH D . 
J 4 HOH 34 149 149 HOH HOH D . 
J 4 HOH 35 154 154 HOH HOH D . 
J 4 HOH 36 157 157 HOH HOH D . 
J 4 HOH 37 160 160 HOH HOH D . 
J 4 HOH 38 165 165 HOH HOH D . 
J 4 HOH 39 174 174 HOH HOH D . 
J 4 HOH 40 184 184 HOH HOH D . 
J 4 HOH 41 185 185 HOH HOH D . 
J 4 HOH 42 186 186 HOH HOH D . 
J 4 HOH 43 192 192 HOH HOH D . 
J 4 HOH 44 194 194 HOH HOH D . 
J 4 HOH 45 200 200 HOH HOH D . 
J 4 HOH 46 207 207 HOH HOH D . 
J 4 HOH 47 215 215 HOH HOH D . 
J 4 HOH 48 226 226 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15170 ? 
1 MORE         -71   ? 
1 'SSA (A^2)'  17050 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2022-12-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' database_2         
3 5 'Structure model' struct_conn        
4 5 'Structure model' struct_ref_seq_dif 
5 5 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.classification'            
2  4 'Structure model' '_software.name'                      
3  5 'Structure model' '_database_2.pdbx_DOI'                
4  5 'Structure model' '_database_2.pdbx_database_accession' 
5  5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
7  5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
8  5 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
9  5 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
10 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
11 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
12 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
13 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
14 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
15 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
16 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
17 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
18 5 'Structure model' '_struct_ref_seq_dif.details'         
19 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
20 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
21 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX       refinement        2002 ? 1 
MAR345    'data collection' .    ? 2 
SCALEPACK 'data scaling'    .    ? 3 
CNX       phasing           .    ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
THE HIS TAGS ON CHAINS B AND D WERE NOT 
CLEAVED FOR THIS ENTRY.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 175 A ? -58.09  -1.66   
2  1 LYS A 197 ? ? 78.59   30.85   
3  1 ASP A 205 ? ? 35.98   73.49   
4  1 SER A 236 ? ? -175.07 -170.27 
5  1 CYS A 270 ? ? -119.97 79.46   
6  1 LYS B 363 ? ? -130.85 -58.21  
7  1 PHE B 400 ? ? -84.23  30.87   
8  1 LYS C 697 ? ? 72.22   32.34   
9  1 ASP C 705 ? ? 42.63   75.67   
10 1 SER C 736 ? ? -178.38 -170.78 
11 1 ASP D 826 ? ? 74.27   32.98   
12 1 LYS D 863 ? ? -145.08 -46.64  
13 1 PHE D 900 ? ? -84.79  30.07   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 145 ? A SER 1   
2  1 Y 1 A GLY 146 ? A GLY 2   
3  1 Y 1 A ILE 147 ? A ILE 3   
4  1 Y 1 A SER 148 ? A SER 4   
5  1 Y 1 A LEU 149 ? A LEU 5   
6  1 Y 1 A THR 296 ? A THR 146 
7  1 Y 1 A ASP 297 ? A ASP 147 
8  1 Y 1 B SER 310 ? B SER 1   
9  1 Y 1 B GLY 311 ? B GLY 2   
10 1 Y 1 B VAL 312 ? B VAL 3   
11 1 Y 1 B ASP 313 ? B ASP 4   
12 1 Y 1 B ASP 314 ? B ASP 5   
13 1 Y 1 B ASP 315 ? B ASP 6   
14 1 Y 1 B MET 316 ? B MET 7   
15 1 Y 1 B ALA 317 ? B ALA 8   
16 1 Y 1 B CYS 318 ? B CYS 9   
17 1 Y 1 B HIS 319 ? B HIS 10  
18 1 Y 1 B HIS 402 ? B HIS 102 
19 1 Y 1 B LEU 403 ? B LEU 103 
20 1 Y 1 B GLU 404 ? B GLU 104 
21 1 Y 1 B HIS 405 ? B HIS 105 
22 1 Y 1 B HIS 406 ? B HIS 106 
23 1 Y 1 B HIS 407 ? B HIS 107 
24 1 Y 1 B HIS 408 ? B HIS 108 
25 1 Y 1 B HIS 409 ? B HIS 109 
26 1 Y 1 B HIS 410 ? B HIS 110 
27 1 Y 1 C SER 645 ? C SER 1   
28 1 Y 1 C GLY 646 ? C GLY 2   
29 1 Y 1 C ILE 647 ? C ILE 3   
30 1 Y 1 C SER 648 ? C SER 4   
31 1 Y 1 C LEU 649 ? C LEU 5   
32 1 Y 1 C THR 796 ? C THR 146 
33 1 Y 1 C ASP 797 ? C ASP 147 
34 1 Y 1 D SER 810 ? D SER 1   
35 1 Y 1 D GLY 811 ? D GLY 2   
36 1 Y 1 D VAL 812 ? D VAL 3   
37 1 Y 1 D ASP 813 ? D ASP 4   
38 1 Y 1 D ASP 814 ? D ASP 5   
39 1 Y 1 D ASP 815 ? D ASP 6   
40 1 Y 1 D MET 816 ? D MET 7   
41 1 Y 1 D ALA 817 ? D ALA 8   
42 1 Y 1 D CYS 818 ? D CYS 9   
43 1 Y 1 D HIS 819 ? D HIS 10  
44 1 Y 1 D HIS 902 ? D HIS 102 
45 1 Y 1 D LEU 903 ? D LEU 103 
46 1 Y 1 D GLU 904 ? D GLU 104 
47 1 Y 1 D HIS 905 ? D HIS 105 
48 1 Y 1 D HIS 906 ? D HIS 106 
49 1 Y 1 D HIS 907 ? D HIS 107 
50 1 Y 1 D HIS 908 ? D HIS 108 
51 1 Y 1 D HIS 909 ? D HIS 109 
52 1 Y 1 D HIS 910 ? D HIS 110 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;3-(2-{5-TERT-BUTYL-3-[(4-METHYL-FURAZAN-3-YLMETHYL)-AMINO]-2-OXO-2H-PYRAZIN-1-YL}-BUTYRYLAMINO)-5-(HEXYL-METHYL-AMINO)-4-OXO-PENTANOIC ACID ANION
;
PZN 
4 water HOH 
#