data_1RHK
# 
_entry.id   1RHK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.362 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RHK         pdb_00001rhk 10.2210/pdb1rhk/pdb 
RCSB  RCSB020750   ?            ?                   
WWPDB D_1000020750 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PAU 'Caspase-3 complex with Acetyl-Asp-Glu-Val-Asp-aldehyde' unspecified 
PDB 1RHJ .                                                        unspecified 
PDB 1RHM .                                                        unspecified 
PDB 1RHQ .                                                        unspecified 
PDB 1RHR .                                                        unspecified 
PDB 1RHU .                                                        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RHK 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, J.W.'  1 
'Rotonda, J.'   2 
'Soisson, S.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            47 
_citation.page_first                2466 
_citation.page_last                 2474 
_citation.year                      2004 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15115390 
_citation.pdbx_database_id_DOI      10.1021/jm0305523 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, J.W.'     1  ? 
primary 'Rotonda, J.'      2  ? 
primary 'Soisson, S.M.'    3  ? 
primary 'Aspiotis, R.'     4  ? 
primary 'Bayly, C.'        5  ? 
primary 'Francoeur, S.'    6  ? 
primary 'Gallant, M.'      7  ? 
primary 'Garcia-Calvo, M.' 8  ? 
primary 'Giroux, A.'       9  ? 
primary 'Grimm, E.'        10 ? 
primary 'Han, Y.'          11 ? 
primary 'McKay, D.'        12 ? 
primary 'Nicholson, D.W.'  13 ? 
primary 'Peterson, E.'     14 ? 
primary 'Renaud, J.'       15 ? 
primary 'Roy, S.'          16 ? 
primary 'Thornberry, N.'   17 ? 
primary 'Zamboni, R.'      18 ? 
# 
_cell.entry_id           1RHK 
_cell.length_a           69.940 
_cell.length_b           84.660 
_cell.length_c           96.820 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1RHK 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Caspase-3              16639.902 1  3.4.22.- ? 'P17 SUBUNIT' ?                                                     
2 polymer man Caspase-3              11910.604 1  3.4.22.- ? 'P12 SUBUNIT' ?                                                     
3 polymer syn acetyl-asp-glu-val-fpr 604.649   1  ?        ? ?             'propylbenzene is covalently bound to the C-terminus' 
4 water   nat water                  18.015    14 ?        ? ?             ?                                                     
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
2 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A ? 
2 'polypeptide(L)' no no  
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
B ? 
3 'polypeptide(L)' no yes '(ACE)DEV(FPR)' XDEVX C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   SER n 
2 2   GLY n 
2 3   VAL n 
2 4   ASP n 
2 5   ASP n 
2 6   ASP n 
2 7   MET n 
2 8   ALA n 
2 9   CYS n 
2 10  HIS n 
2 11  LYS n 
2 12  ILE n 
2 13  PRO n 
2 14  VAL n 
2 15  GLU n 
2 16  ALA n 
2 17  ASP n 
2 18  PHE n 
2 19  LEU n 
2 20  TYR n 
2 21  ALA n 
2 22  TYR n 
2 23  SER n 
2 24  THR n 
2 25  ALA n 
2 26  PRO n 
2 27  GLY n 
2 28  TYR n 
2 29  TYR n 
2 30  SER n 
2 31  TRP n 
2 32  ARG n 
2 33  ASN n 
2 34  SER n 
2 35  LYS n 
2 36  ASP n 
2 37  GLY n 
2 38  SER n 
2 39  TRP n 
2 40  PHE n 
2 41  ILE n 
2 42  GLN n 
2 43  SER n 
2 44  LEU n 
2 45  CYS n 
2 46  ALA n 
2 47  MET n 
2 48  LEU n 
2 49  LYS n 
2 50  GLN n 
2 51  TYR n 
2 52  ALA n 
2 53  ASP n 
2 54  LYS n 
2 55  LEU n 
2 56  GLU n 
2 57  PHE n 
2 58  MET n 
2 59  HIS n 
2 60  ILE n 
2 61  LEU n 
2 62  THR n 
2 63  ARG n 
2 64  VAL n 
2 65  ASN n 
2 66  ARG n 
2 67  LYS n 
2 68  VAL n 
2 69  ALA n 
2 70  THR n 
2 71  GLU n 
2 72  PHE n 
2 73  GLU n 
2 74  SER n 
2 75  PHE n 
2 76  SER n 
2 77  PHE n 
2 78  ASP n 
2 79  ALA n 
2 80  THR n 
2 81  PHE n 
2 82  HIS n 
2 83  ALA n 
2 84  LYS n 
2 85  LYS n 
2 86  GLN n 
2 87  ILE n 
2 88  PRO n 
2 89  CYS n 
2 90  ILE n 
2 91  VAL n 
2 92  SER n 
2 93  MET n 
2 94  LEU n 
2 95  THR n 
2 96  LYS n 
2 97  GLU n 
2 98  LEU n 
2 99  TYR n 
2 100 PHE n 
2 101 TYR n 
2 102 HIS n 
3 1   ACE n 
3 2   ASP n 
3 3   GLU n 
3 4   VAL n 
3 5   FPR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The inhibitor is chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ICE3_HUMAN P42574 1 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
29  ? 
2 UNP ICE3_HUMAN P42574 2 
;SGVDDDMACHKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
176 ? 
3 PDB 1RHK       1RHK   3 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RHK A 1 ? 147 ? P42574 29  ? 175 ? 145 297 
2 2 1RHK B 1 ? 102 ? P42574 176 ? 277 ? 310 402 
3 3 1RHK C 1 ? 5   ? 1RHK   501 ? 505 ? 501 505 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1RHK 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      15 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P42574 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          190 
_struct_ref_seq_dif.details                      variant 
_struct_ref_seq_dif.pdbx_auth_seq_num            324 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'                              ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE                                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ? 'C3 H7 N O2 S'   121.158 
FPR 'L-peptide linking' . '(3S)-3-amino-4-oxo-7-phenylheptanoic acid' ? 'C13 H17 N O3'   235.279 
GLN 'L-peptide linking' y GLUTAMINE                                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RHK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.12 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.3 
_exptl_crystal_grow.pdbx_details    
'12% PEG-5000, 100 mM Citrate, 10 mM DTT, 3 mM NaN(3), pH 5.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1996-04-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RHK 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   8371 
_reflns.number_all                   10263 
_reflns.percent_possible_obs         81.6 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.93 
_reflns.B_iso_Wilson_estimate        10.9 
_reflns.pdbx_redundancy              2.10 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.589 
_reflns_shell.percent_possible_all   33.3 
_reflns_shell.Rmerge_I_obs           0.362 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.30 
_reflns_shell.pdbx_redundancy        1.38 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      333 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1RHK 
_refine.ls_number_reflns_obs                     7965 
_refine.ls_number_reflns_all                     10270 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               26033.70 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.98 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    77.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.6 
_refine.ls_number_reflns_R_free                  845 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               19.5 
_refine.aniso_B[1][1]                            3.19 
_refine.aniso_B[2][2]                            2.33 
_refine.aniso_B[3][3]                            -5.53 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.299302 
_refine.solvent_model_param_bsol                 12.987 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'Protein part of 1pau.pdb' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RHK 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.44 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1914 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               1928 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        19.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.67  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.05  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.69  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.90  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.82  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             601 
_refine_ls_shell.R_factor_R_work                  0.28 
_refine_ls_shell.percent_reflns_obs               40.7 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            0.039 
_refine_ls_shell.percent_reflns_R_free            11.2 
_refine_ls_shell.number_reflns_R_free             76 
_refine_ls_shell.number_reflns_obs                889 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.P PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PAR WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM     ION.TOP     'X-RAY DIFFRACTION' 
4 PARAM.ICE     TOP.ICE     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RHK 
_struct.title                     'Crystal structure of the complex of caspase-3 with a phenyl-propyl-ketone inhibitor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RHK 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'CYSTEINE PROTEASE, CASPASE-3, APOPAIN, CPP32, YAMA, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The second part of the biological 
assembly is generated by the 
two-fold axis: 1-x, y, -z
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 28  ? GLY A 32  C HIS A 174 GLY A 175 5 ? 5  
HELX_P HELX_P2 2 GLY A 38  ? ASN A 52  ? GLY A 181 ASN A 195 1 ? 15 
HELX_P HELX_P3 3 THR A 64  ? GLU A 78  ? THR A 207 GLU A 221 1 ? 15 
HELX_P HELX_P4 4 LEU A 108 ? ASN A 113 ? LEU A 258 ASN A 263 1 ? 6  
HELX_P HELX_P5 5 PHE A 114 ? ARG A 116 ? PHE A 264 ARG A 266 5 ? 3  
HELX_P HELX_P6 6 TRP B 39  ? ALA B 52  ? TRP B 348 ALA B 361 1 ? 14 
HELX_P HELX_P7 7 GLU B 56  ? PHE B 72  ? GLU B 365 PHE B 380 1 ? 17 
HELX_P HELX_P8 8 ASP B 78  E HIS B 82  I ASP B 381 HIS B 381 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale none ? A CYS 135 SG ? ? ? 1_555 C FPR 5 C ? ? A CYS 285 C FPR 505 1_555 ? ? ? ? ? ? ? 1.778 ? ? 
covale2 covale both ? C ACE 1   C  ? ? ? 1_555 C ASP 2 N ? ? C ACE 501 C ASP 502 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale3 covale one  ? C VAL 4   C  ? ? ? 1_555 C FPR 5 N ? ? C VAL 504 C FPR 505 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 56  ? ASN A 61  ? GLU A 199 ASN A 204 
A 2 GLU A 15  ? ASN A 23  ? GLU A 162 ASN A 169 
A 3 ARG A 83  ? LEU A 91  ? ARG A 227 LEU A 235 
A 4 LYS A 128 ? GLN A 133 ? LYS A 278 GLN A 283 
A 5 PHE B 18  ? TYR B 22  ? PHE B 327 TYR B 331 
A 6 CYS B 89  ? SER B 92  ? CYS B 388 SER B 392 
B 1 GLY A 94  ? GLU A 95  ? GLY A 238 GLU A 239 
B 2 ILE A 98  ? GLY A 101 ? ILE A 242 GLY A 245 
B 3 GLY A 104 ? ASP A 107 ? GLY A 254 ASP A 257 
C 1 GLY B 37  ? SER B 38  ? GLY B 346 SER B 347 
C 2 TRP B 31  ? ASN B 33  ? TRP B 340 ASN B 342 
C 3 GLU C 3   ? VAL C 4   ? GLU C 503 VAL C 504 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 60  ? O LYS A 203 N ASN A 23  ? N ASN A 169 
A 2 3 N ILE A 20  ? N ILE A 166 O VAL A 89  ? O VAL A 233 
A 3 4 N LEU A 90  ? N LEU A 234 O GLN A 133 ? O GLN A 283 
A 4 5 N PHE A 130 ? N PHE A 280 O LEU B 19  ? O LEU B 328 
A 5 6 N TYR B 20  ? N TYR B 329 O VAL B 91  ? O VAL B 390 
B 1 2 N GLU A 95  ? N GLU A 239 O ILE A 98  ? O ILE A 242 
B 2 3 N GLY A 101 ? N GLY A 245 O GLY A 104 ? O GLY A 254 
C 1 2 O GLY B 37  ? O GLY B 346 N ASN B 33  ? N ASN B 342 
C 2 3 N ARG B 32  ? N ARG B 341 O GLU C 3   ? O GLU C 503 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'BINDING SITE FOR CHAIN C OF ACETYL-ASP-GLU-VAL-FPR' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 SER A 30  A SER A 175 . ? 2_675 ? 
2  AC1 15 ARG A 36  ? ARG A 179 . ? 1_555 ? 
3  AC1 15 HIS A 93  ? HIS A 237 . ? 1_555 ? 
4  AC1 15 GLY A 94  ? GLY A 238 . ? 1_555 ? 
5  AC1 15 GLU A 95  ? GLU A 239 . ? 1_555 ? 
6  AC1 15 PHE A 100 ? PHE A 244 . ? 2_675 ? 
7  AC1 15 GLN A 133 ? GLN A 283 . ? 1_555 ? 
8  AC1 15 CYS A 135 ? CYS A 285 . ? 1_555 ? 
9  AC1 15 SER B 30  ? SER B 339 . ? 1_555 ? 
10 AC1 15 TRP B 31  ? TRP B 340 . ? 1_555 ? 
11 AC1 15 ARG B 32  ? ARG B 341 . ? 1_555 ? 
12 AC1 15 ASN B 33  ? ASN B 342 . ? 1_555 ? 
13 AC1 15 SER B 34  ? SER B 343 . ? 1_555 ? 
14 AC1 15 SER B 74  A SER B 381 . ? 1_555 ? 
15 AC1 15 PHE B 75  B PHE B 381 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RHK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RHK 
_atom_sites.fract_transf_matrix[1][1]   0.014298 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011812 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010328 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 6   ? 22.041 122.020 -9.201  1.00 34.19 ? 150 ASP A N   1 
ATOM   2    C CA  . ASP A 1 6   ? 22.177 121.561 -7.789  1.00 35.98 ? 150 ASP A CA  1 
ATOM   3    C C   . ASP A 1 6   ? 23.190 120.427 -7.661  1.00 35.76 ? 150 ASP A C   1 
ATOM   4    O O   . ASP A 1 6   ? 23.171 119.470 -8.448  1.00 36.99 ? 150 ASP A O   1 
ATOM   5    C CB  . ASP A 1 6   ? 20.825 121.093 -7.251  1.00 37.14 ? 150 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 6   ? 20.922 120.574 -5.830  1.00 39.08 ? 150 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 6   ? 21.363 121.349 -4.952  1.00 38.49 ? 150 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 6   ? 20.566 119.394 -5.597  1.00 40.08 ? 150 ASP A OD2 1 
ATOM   9    N N   . ASN A 1 7   ? 24.059 120.526 -6.656  1.00 34.13 ? 151 ASN A N   1 
ATOM   10   C CA  . ASN A 1 7   ? 25.092 119.516 -6.448  1.00 31.89 ? 151 ASN A CA  1 
ATOM   11   C C   . ASN A 1 7   ? 25.220 119.029 -5.002  1.00 29.50 ? 151 ASN A C   1 
ATOM   12   O O   . ASN A 1 7   ? 26.165 118.314 -4.657  1.00 28.12 ? 151 ASN A O   1 
ATOM   13   C CB  . ASN A 1 7   ? 26.436 120.060 -6.950  1.00 32.96 ? 151 ASN A CB  1 
ATOM   14   C CG  . ASN A 1 7   ? 26.758 121.431 -6.382  1.00 34.76 ? 151 ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 7   ? 25.938 122.040 -5.686  1.00 36.43 ? 151 ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 7   ? 27.954 121.927 -6.680  1.00 33.54 ? 151 ASN A ND2 1 
ATOM   17   N N   . SER A 1 8   ? 24.271 119.417 -4.159  1.00 27.19 ? 152 SER A N   1 
ATOM   18   C CA  . SER A 1 8   ? 24.288 118.989 -2.766  1.00 26.68 ? 152 SER A CA  1 
ATOM   19   C C   . SER A 1 8   ? 22.913 118.442 -2.378  1.00 24.92 ? 152 SER A C   1 
ATOM   20   O O   . SER A 1 8   ? 21.890 118.873 -2.905  1.00 26.18 ? 152 SER A O   1 
ATOM   21   C CB  . SER A 1 8   ? 24.665 120.152 -1.853  1.00 27.60 ? 152 SER A CB  1 
ATOM   22   O OG  . SER A 1 8   ? 23.678 121.163 -1.910  1.00 31.53 ? 152 SER A OG  1 
ATOM   23   N N   . TYR A 1 9   ? 22.898 117.485 -1.459  1.00 22.82 ? 153 TYR A N   1 
ATOM   24   C CA  . TYR A 1 9   ? 21.655 116.869 -1.009  1.00 20.67 ? 153 TYR A CA  1 
ATOM   25   C C   . TYR A 1 9   ? 20.709 117.833 -0.305  1.00 19.41 ? 153 TYR A C   1 
ATOM   26   O O   . TYR A 1 9   ? 21.121 118.585 0.570   1.00 19.51 ? 153 TYR A O   1 
ATOM   27   C CB  . TYR A 1 9   ? 21.965 115.707 -0.071  1.00 18.88 ? 153 TYR A CB  1 
ATOM   28   C CG  . TYR A 1 9   ? 22.422 114.458 -0.770  1.00 17.79 ? 153 TYR A CG  1 
ATOM   29   C CD1 . TYR A 1 9   ? 21.527 113.678 -1.496  1.00 18.48 ? 153 TYR A CD1 1 
ATOM   30   C CD2 . TYR A 1 9   ? 23.744 114.035 -0.682  1.00 18.09 ? 153 TYR A CD2 1 
ATOM   31   C CE1 . TYR A 1 9   ? 21.937 112.501 -2.110  1.00 16.88 ? 153 TYR A CE1 1 
ATOM   32   C CE2 . TYR A 1 9   ? 24.164 112.867 -1.292  1.00 16.68 ? 153 TYR A CE2 1 
ATOM   33   C CZ  . TYR A 1 9   ? 23.256 112.103 -2.000  1.00 16.73 ? 153 TYR A CZ  1 
ATOM   34   O OH  . TYR A 1 9   ? 23.666 110.926 -2.579  1.00 15.40 ? 153 TYR A OH  1 
ATOM   35   N N   . LYS A 1 10  ? 19.436 117.788 -0.685  1.00 19.25 ? 154 LYS A N   1 
ATOM   36   C CA  . LYS A 1 10  ? 18.413 118.638 -0.092  1.00 20.40 ? 154 LYS A CA  1 
ATOM   37   C C   . LYS A 1 10  ? 18.212 118.244 1.361   1.00 19.41 ? 154 LYS A C   1 
ATOM   38   O O   . LYS A 1 10  ? 17.678 117.175 1.644   1.00 20.31 ? 154 LYS A O   1 
ATOM   39   C CB  . LYS A 1 10  ? 17.098 118.471 -0.852  1.00 22.56 ? 154 LYS A CB  1 
ATOM   40   C CG  . LYS A 1 10  ? 15.949 119.299 -0.309  1.00 25.41 ? 154 LYS A CG  1 
ATOM   41   C CD  . LYS A 1 10  ? 14.713 119.170 -1.190  1.00 27.93 ? 154 LYS A CD  1 
ATOM   42   C CE  . LYS A 1 10  ? 13.659 120.193 -0.796  1.00 28.57 ? 154 LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 10  ? 12.456 120.140 -1.666  1.00 32.29 ? 154 LYS A NZ  1 
ATOM   44   N N   . MET A 1 11  ? 18.633 119.107 2.278   1.00 19.21 ? 155 MET A N   1 
ATOM   45   C CA  . MET A 1 11  ? 18.500 118.824 3.704   1.00 20.10 ? 155 MET A CA  1 
ATOM   46   C C   . MET A 1 11  ? 17.492 119.742 4.379   1.00 22.47 ? 155 MET A C   1 
ATOM   47   O O   . MET A 1 11  ? 17.540 119.927 5.597   1.00 23.37 ? 155 MET A O   1 
ATOM   48   C CB  . MET A 1 11  ? 19.847 118.982 4.406   1.00 18.93 ? 155 MET A CB  1 
ATOM   49   C CG  . MET A 1 11  ? 20.950 118.087 3.876   1.00 17.69 ? 155 MET A CG  1 
ATOM   50   S SD  . MET A 1 11  ? 20.554 116.335 3.989   1.00 18.35 ? 155 MET A SD  1 
ATOM   51   C CE  . MET A 1 11  ? 21.006 116.005 5.689   1.00 16.39 ? 155 MET A CE  1 
ATOM   52   N N   . ASP A 1 12  ? 16.577 120.310 3.598   1.00 22.65 ? 156 ASP A N   1 
ATOM   53   C CA  . ASP A 1 12  ? 15.590 121.215 4.160   1.00 23.14 ? 156 ASP A CA  1 
ATOM   54   C C   . ASP A 1 12  ? 14.231 120.579 4.404   1.00 22.50 ? 156 ASP A C   1 
ATOM   55   O O   . ASP A 1 12  ? 13.264 121.279 4.705   1.00 23.20 ? 156 ASP A O   1 
ATOM   56   C CB  . ASP A 1 12  ? 15.446 122.464 3.276   1.00 26.73 ? 156 ASP A CB  1 
ATOM   57   C CG  . ASP A 1 12  ? 15.056 122.135 1.844   1.00 30.08 ? 156 ASP A CG  1 
ATOM   58   O OD1 . ASP A 1 12  ? 13.917 121.661 1.626   1.00 30.36 ? 156 ASP A OD1 1 
ATOM   59   O OD2 . ASP A 1 12  ? 15.892 122.354 0.941   1.00 30.93 ? 156 ASP A OD2 1 
ATOM   60   N N   . TYR A 1 13  A 14.160 119.256 4.277   1.00 20.73 ? 156 TYR A N   1 
ATOM   61   C CA  . TYR A 1 13  A 12.921 118.530 4.524   1.00 18.31 ? 156 TYR A CA  1 
ATOM   62   C C   . TYR A 1 13  A 12.484 118.839 5.947   1.00 17.74 ? 156 TYR A C   1 
ATOM   63   O O   . TYR A 1 13  A 13.304 119.205 6.789   1.00 15.93 ? 156 TYR A O   1 
ATOM   64   C CB  . TYR A 1 13  A 13.139 117.023 4.369   1.00 18.00 ? 156 TYR A CB  1 
ATOM   65   C CG  . TYR A 1 13  A 13.124 116.543 2.934   1.00 21.09 ? 156 TYR A CG  1 
ATOM   66   C CD1 . TYR A 1 13  A 11.933 116.128 2.326   1.00 19.82 ? 156 TYR A CD1 1 
ATOM   67   C CD2 . TYR A 1 13  A 14.296 116.535 2.167   1.00 21.99 ? 156 TYR A CD2 1 
ATOM   68   C CE1 . TYR A 1 13  A 11.905 115.716 0.988   1.00 20.33 ? 156 TYR A CE1 1 
ATOM   69   C CE2 . TYR A 1 13  A 14.282 116.128 0.826   1.00 22.76 ? 156 TYR A CE2 1 
ATOM   70   C CZ  . TYR A 1 13  A 13.082 115.720 0.241   1.00 23.14 ? 156 TYR A CZ  1 
ATOM   71   O OH  . TYR A 1 13  A 13.063 115.329 -1.088  1.00 21.12 ? 156 TYR A OH  1 
ATOM   72   N N   . PRO A 1 14  ? 11.180 118.710 6.234   1.00 17.46 ? 161 PRO A N   1 
ATOM   73   C CA  . PRO A 1 14  ? 10.672 118.988 7.578   1.00 18.17 ? 161 PRO A CA  1 
ATOM   74   C C   . PRO A 1 14  ? 11.581 118.455 8.699   1.00 18.53 ? 161 PRO A C   1 
ATOM   75   O O   . PRO A 1 14  ? 11.786 119.128 9.716   1.00 17.99 ? 161 PRO A O   1 
ATOM   76   C CB  . PRO A 1 14  ? 9.297  118.334 7.553   1.00 18.37 ? 161 PRO A CB  1 
ATOM   77   C CG  . PRO A 1 14  ? 8.853  118.606 6.157   1.00 17.38 ? 161 PRO A CG  1 
ATOM   78   C CD  . PRO A 1 14  ? 10.087 118.288 5.340   1.00 17.15 ? 161 PRO A CD  1 
ATOM   79   N N   . GLU A 1 15  ? 12.131 117.259 8.520   1.00 18.51 ? 162 GLU A N   1 
ATOM   80   C CA  . GLU A 1 15  ? 13.020 116.717 9.538   1.00 21.40 ? 162 GLU A CA  1 
ATOM   81   C C   . GLU A 1 15  ? 14.279 116.084 8.963   1.00 20.97 ? 162 GLU A C   1 
ATOM   82   O O   . GLU A 1 15  ? 14.258 115.503 7.880   1.00 22.47 ? 162 GLU A O   1 
ATOM   83   C CB  . GLU A 1 15  ? 12.274 115.717 10.427  1.00 23.93 ? 162 GLU A CB  1 
ATOM   84   C CG  . GLU A 1 15  ? 11.486 114.661 9.689   1.00 27.54 ? 162 GLU A CG  1 
ATOM   85   C CD  . GLU A 1 15  ? 10.722 113.754 10.641  1.00 30.26 ? 162 GLU A CD  1 
ATOM   86   O OE1 . GLU A 1 15  ? 11.380 113.017 11.416  1.00 31.34 ? 162 GLU A OE1 1 
ATOM   87   O OE2 . GLU A 1 15  ? 9.469  113.787 10.617  1.00 28.86 ? 162 GLU A OE2 1 
ATOM   88   N N   . MET A 1 16  A 15.382 116.213 9.691   1.00 20.79 ? 162 MET A N   1 
ATOM   89   C CA  . MET A 1 16  A 16.656 115.659 9.250   1.00 21.01 ? 162 MET A CA  1 
ATOM   90   C C   . MET A 1 16  A 16.574 114.162 9.001   1.00 20.79 ? 162 MET A C   1 
ATOM   91   O O   . MET A 1 16  A 17.280 113.631 8.143   1.00 21.86 ? 162 MET A O   1 
ATOM   92   C CB  . MET A 1 16  A 17.746 115.945 10.277  1.00 20.64 ? 162 MET A CB  1 
ATOM   93   C CG  . MET A 1 16  A 18.293 117.354 10.214  1.00 22.15 ? 162 MET A CG  1 
ATOM   94   S SD  . MET A 1 16  A 19.208 117.666 8.703   1.00 25.63 ? 162 MET A SD  1 
ATOM   95   C CE  . MET A 1 16  A 18.506 119.235 8.210   1.00 26.90 ? 162 MET A CE  1 
ATOM   96   N N   . GLY A 1 17  ? 15.712 113.486 9.754   1.00 19.66 ? 163 GLY A N   1 
ATOM   97   C CA  . GLY A 1 17  ? 15.553 112.056 9.584   1.00 18.33 ? 163 GLY A CA  1 
ATOM   98   C C   . GLY A 1 17  ? 15.771 111.224 10.835  1.00 17.32 ? 163 GLY A C   1 
ATOM   99   O O   . GLY A 1 17  ? 15.946 111.748 11.941  1.00 16.72 ? 163 GLY A O   1 
ATOM   100  N N   . LEU A 1 18  ? 15.761 109.909 10.642  1.00 16.34 ? 164 LEU A N   1 
ATOM   101  C CA  . LEU A 1 18  ? 15.955 108.944 11.720  1.00 15.92 ? 164 LEU A CA  1 
ATOM   102  C C   . LEU A 1 18  ? 17.422 108.557 11.904  1.00 15.50 ? 164 LEU A C   1 
ATOM   103  O O   . LEU A 1 18  ? 18.211 108.589 10.963  1.00 16.32 ? 164 LEU A O   1 
ATOM   104  C CB  . LEU A 1 18  ? 15.161 107.669 11.416  1.00 16.58 ? 164 LEU A CB  1 
ATOM   105  C CG  . LEU A 1 18  ? 13.964 107.283 12.289  1.00 17.06 ? 164 LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 18  ? 13.001 108.458 12.403  1.00 17.58 ? 164 LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 18  ? 13.276 106.066 11.681  1.00 15.05 ? 164 LEU A CD2 1 
ATOM   108  N N   . CYS A 1 19  ? 17.781 108.194 13.127  1.00 13.95 ? 165 CYS A N   1 
ATOM   109  C CA  . CYS A 1 19  ? 19.126 107.740 13.413  1.00 13.61 ? 165 CYS A CA  1 
ATOM   110  C C   . CYS A 1 19  ? 19.016 106.523 14.300  1.00 13.28 ? 165 CYS A C   1 
ATOM   111  O O   . CYS A 1 19  ? 18.804 106.656 15.501  1.00 13.73 ? 165 CYS A O   1 
ATOM   112  C CB  . CYS A 1 19  ? 19.943 108.800 14.129  1.00 14.36 ? 165 CYS A CB  1 
ATOM   113  S SG  . CYS A 1 19  ? 21.604 108.209 14.548  1.00 15.61 ? 165 CYS A SG  1 
ATOM   114  N N   . ILE A 1 20  ? 19.154 105.339 13.706  1.00 12.97 ? 166 ILE A N   1 
ATOM   115  C CA  . ILE A 1 20  ? 19.064 104.090 14.454  1.00 12.43 ? 166 ILE A CA  1 
ATOM   116  C C   . ILE A 1 20  ? 20.435 103.623 14.911  1.00 12.32 ? 166 ILE A C   1 
ATOM   117  O O   . ILE A 1 20  ? 21.320 103.398 14.099  1.00 13.60 ? 166 ILE A O   1 
ATOM   118  C CB  . ILE A 1 20  ? 18.436 102.961 13.609  1.00 13.67 ? 166 ILE A CB  1 
ATOM   119  C CG1 . ILE A 1 20  ? 17.103 103.423 13.009  1.00 14.98 ? 166 ILE A CG1 1 
ATOM   120  C CG2 . ILE A 1 20  ? 18.216 101.728 14.473  1.00 13.19 ? 166 ILE A CG2 1 
ATOM   121  C CD1 . ILE A 1 20  ? 16.046 103.751 14.030  1.00 15.74 ? 166 ILE A CD1 1 
ATOM   122  N N   . ILE A 1 21  ? 20.606 103.485 16.220  1.00 11.81 ? 167 ILE A N   1 
ATOM   123  C CA  . ILE A 1 21  ? 21.861 103.026 16.790  1.00 10.34 ? 167 ILE A CA  1 
ATOM   124  C C   . ILE A 1 21  ? 21.621 101.665 17.401  1.00 12.55 ? 167 ILE A C   1 
ATOM   125  O O   . ILE A 1 21  ? 20.857 101.537 18.356  1.00 14.37 ? 167 ILE A O   1 
ATOM   126  C CB  . ILE A 1 21  ? 22.357 103.931 17.926  1.00 7.74  ? 167 ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 21  ? 22.618 105.345 17.403  1.00 6.00  ? 167 ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 21  ? 23.604 103.329 18.546  1.00 7.58  ? 167 ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 21  ? 23.106 106.304 18.457  1.00 1.58  ? 167 ILE A CD1 1 
ATOM   130  N N   . ILE A 1 22  ? 22.257 100.644 16.850  1.00 13.63 ? 168 ILE A N   1 
ATOM   131  C CA  . ILE A 1 22  ? 22.109 99.315  17.408  1.00 14.22 ? 168 ILE A CA  1 
ATOM   132  C C   . ILE A 1 22  ? 23.384 99.076  18.195  1.00 14.08 ? 168 ILE A C   1 
ATOM   133  O O   . ILE A 1 22  ? 24.465 98.962  17.634  1.00 14.70 ? 168 ILE A O   1 
ATOM   134  C CB  . ILE A 1 22  ? 21.945 98.257  16.313  1.00 14.78 ? 168 ILE A CB  1 
ATOM   135  C CG1 . ILE A 1 22  ? 20.734 98.611  15.442  1.00 14.65 ? 168 ILE A CG1 1 
ATOM   136  C CG2 . ILE A 1 22  ? 21.787 96.879  16.951  1.00 16.02 ? 168 ILE A CG2 1 
ATOM   137  C CD1 . ILE A 1 22  ? 20.524 97.696  14.253  1.00 14.61 ? 168 ILE A CD1 1 
ATOM   138  N N   . ASN A 1 23  ? 23.243 99.023  19.511  1.00 13.57 ? 169 ASN A N   1 
ATOM   139  C CA  . ASN A 1 23  ? 24.370 98.840  20.395  1.00 12.35 ? 169 ASN A CA  1 
ATOM   140  C C   . ASN A 1 23  ? 24.351 97.478  21.086  1.00 13.61 ? 169 ASN A C   1 
ATOM   141  O O   . ASN A 1 23  ? 23.573 97.248  22.009  1.00 14.10 ? 169 ASN A O   1 
ATOM   142  C CB  . ASN A 1 23  ? 24.362 99.976  21.423  1.00 11.48 ? 169 ASN A CB  1 
ATOM   143  C CG  . ASN A 1 23  ? 25.490 99.872  22.423  1.00 12.31 ? 169 ASN A CG  1 
ATOM   144  O OD1 . ASN A 1 23  ? 25.255 99.806  23.628  1.00 12.30 ? 169 ASN A OD1 1 
ATOM   145  N ND2 . ASN A 1 23  ? 26.719 99.859  21.932  1.00 9.89  ? 169 ASN A ND2 1 
ATOM   146  N N   . ASN A 1 24  ? 25.216 96.579  20.627  1.00 14.07 ? 170 ASN A N   1 
ATOM   147  C CA  . ASN A 1 24  ? 25.325 95.243  21.197  1.00 15.36 ? 170 ASN A CA  1 
ATOM   148  C C   . ASN A 1 24  ? 26.555 95.152  22.110  1.00 17.76 ? 170 ASN A C   1 
ATOM   149  O O   . ASN A 1 24  ? 27.693 95.352  21.667  1.00 16.80 ? 170 ASN A O   1 
ATOM   150  C CB  . ASN A 1 24  ? 25.411 94.200  20.076  1.00 15.88 ? 170 ASN A CB  1 
ATOM   151  C CG  . ASN A 1 24  ? 24.072 93.975  19.371  1.00 17.87 ? 170 ASN A CG  1 
ATOM   152  O OD1 . ASN A 1 24  ? 24.000 93.285  18.351  1.00 17.12 ? 170 ASN A OD1 1 
ATOM   153  N ND2 . ASN A 1 24  ? 23.008 94.550  19.920  1.00 18.22 ? 170 ASN A ND2 1 
ATOM   154  N N   . LYS A 1 25  ? 26.312 94.847  23.385  1.00 19.90 ? 171 LYS A N   1 
ATOM   155  C CA  . LYS A 1 25  ? 27.372 94.737  24.383  1.00 21.32 ? 171 LYS A CA  1 
ATOM   156  C C   . LYS A 1 25  ? 27.513 93.325  24.960  1.00 22.98 ? 171 LYS A C   1 
ATOM   157  O O   . LYS A 1 25  ? 28.629 92.870  25.242  1.00 23.50 ? 171 LYS A O   1 
ATOM   158  C CB  . LYS A 1 25  ? 27.111 95.721  25.529  1.00 22.18 ? 171 LYS A CB  1 
ATOM   159  C CG  . LYS A 1 25  ? 28.144 95.666  26.647  1.00 23.86 ? 171 LYS A CG  1 
ATOM   160  C CD  . LYS A 1 25  ? 27.777 96.583  27.809  1.00 25.79 ? 171 LYS A CD  1 
ATOM   161  C CE  . LYS A 1 25  ? 28.857 96.548  28.885  1.00 28.78 ? 171 LYS A CE  1 
ATOM   162  N NZ  . LYS A 1 25  ? 28.612 97.518  29.994  1.00 30.36 ? 171 LYS A NZ  1 
ATOM   163  N N   . ASN A 1 26  ? 26.384 92.638  25.131  1.00 23.07 ? 172 ASN A N   1 
ATOM   164  C CA  . ASN A 1 26  ? 26.373 91.291  25.701  1.00 21.72 ? 172 ASN A CA  1 
ATOM   165  C C   . ASN A 1 26  ? 25.829 90.215  24.779  1.00 22.16 ? 172 ASN A C   1 
ATOM   166  O O   . ASN A 1 26  ? 24.661 90.237  24.392  1.00 23.15 ? 172 ASN A O   1 
ATOM   167  C CB  . ASN A 1 26  ? 25.562 91.299  26.982  1.00 22.11 ? 172 ASN A CB  1 
ATOM   168  C CG  . ASN A 1 26  ? 26.052 92.334  27.953  1.00 24.43 ? 172 ASN A CG  1 
ATOM   169  O OD1 . ASN A 1 26  ? 27.191 92.264  28.425  1.00 26.27 ? 172 ASN A OD1 1 
ATOM   170  N ND2 . ASN A 1 26  ? 25.206 93.317  28.251  1.00 24.89 ? 172 ASN A ND2 1 
ATOM   171  N N   . PHE A 1 27  ? 26.679 89.249  24.456  1.00 22.57 ? 173 PHE A N   1 
ATOM   172  C CA  . PHE A 1 27  ? 26.299 88.154  23.568  1.00 21.99 ? 173 PHE A CA  1 
ATOM   173  C C   . PHE A 1 27  ? 26.003 86.861  24.334  1.00 22.10 ? 173 PHE A C   1 
ATOM   174  O O   . PHE A 1 27  ? 26.440 86.689  25.476  1.00 23.03 ? 173 PHE A O   1 
ATOM   175  C CB  . PHE A 1 27  ? 27.421 87.912  22.546  1.00 20.39 ? 173 PHE A CB  1 
ATOM   176  C CG  . PHE A 1 27  ? 27.753 89.121  21.727  1.00 17.03 ? 173 PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 27  ? 28.387 90.215  22.304  1.00 16.08 ? 173 PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 27  ? 27.377 89.190  20.396  1.00 16.64 ? 173 PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 27  ? 28.635 91.359  21.575  1.00 15.34 ? 173 PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 27  ? 27.620 90.329  19.656  1.00 17.22 ? 173 PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 27  ? 28.252 91.421  20.248  1.00 16.94 ? 173 PHE A CZ  1 
ATOM   182  N N   . HIS A 1 28  ? 25.259 85.958  23.703  1.00 21.35 ? 174 HIS A N   1 
ATOM   183  C CA  . HIS A 1 28  ? 24.923 84.689  24.326  1.00 22.66 ? 174 HIS A CA  1 
ATOM   184  C C   . HIS A 1 28  ? 26.208 83.903  24.544  1.00 24.25 ? 174 HIS A C   1 
ATOM   185  O O   . HIS A 1 28  ? 27.055 83.831  23.655  1.00 24.23 ? 174 HIS A O   1 
ATOM   186  C CB  . HIS A 1 28  ? 23.979 83.885  23.430  1.00 23.42 ? 174 HIS A CB  1 
ATOM   187  C CG  . HIS A 1 28  ? 22.597 84.456  23.328  1.00 24.22 ? 174 HIS A CG  1 
ATOM   188  N ND1 . HIS A 1 28  ? 22.295 85.753  23.686  1.00 25.43 ? 174 HIS A ND1 1 
ATOM   189  C CD2 . HIS A 1 28  ? 21.441 83.913  22.879  1.00 22.34 ? 174 HIS A CD2 1 
ATOM   190  C CE1 . HIS A 1 28  ? 21.014 85.984  23.463  1.00 22.96 ? 174 HIS A CE1 1 
ATOM   191  N NE2 . HIS A 1 28  ? 20.473 84.883  22.973  1.00 23.48 ? 174 HIS A NE2 1 
ATOM   192  N N   . LYS A 1 29  ? 26.340 83.313  25.728  1.00 24.92 ? 175 LYS A N   1 
ATOM   193  C CA  . LYS A 1 29  ? 27.516 82.527  26.090  1.00 25.89 ? 175 LYS A CA  1 
ATOM   194  C C   . LYS A 1 29  ? 27.911 81.558  24.976  1.00 25.11 ? 175 LYS A C   1 
ATOM   195  O O   . LYS A 1 29  ? 29.088 81.451  24.619  1.00 25.72 ? 175 LYS A O   1 
ATOM   196  C CB  . LYS A 1 29  ? 27.227 81.720  27.355  1.00 29.58 ? 175 LYS A CB  1 
ATOM   197  C CG  . LYS A 1 29  ? 26.200 82.362  28.278  1.00 34.97 ? 175 LYS A CG  1 
ATOM   198  C CD  . LYS A 1 29  ? 25.521 81.318  29.175  1.00 38.43 ? 175 LYS A CD  1 
ATOM   199  C CE  . LYS A 1 29  ? 24.693 80.314  28.366  1.00 39.63 ? 175 LYS A CE  1 
ATOM   200  N NZ  . LYS A 1 29  ? 23.900 79.393  29.236  1.00 41.45 ? 175 LYS A NZ  1 
ATOM   201  N N   . SER A 1 30  A 26.917 80.861  24.434  1.00 22.84 ? 175 SER A N   1 
ATOM   202  C CA  . SER A 1 30  A 27.133 79.872  23.386  1.00 21.68 ? 175 SER A CA  1 
ATOM   203  C C   . SER A 1 30  A 27.704 80.383  22.062  1.00 20.59 ? 175 SER A C   1 
ATOM   204  O O   . SER A 1 30  A 28.125 79.589  21.223  1.00 19.82 ? 175 SER A O   1 
ATOM   205  C CB  . SER A 1 30  A 25.826 79.103  23.143  1.00 22.84 ? 175 SER A CB  1 
ATOM   206  O OG  . SER A 1 30  A 24.699 79.962  23.258  1.00 24.87 ? 175 SER A OG  1 
ATOM   207  N N   . THR A 1 31  B 27.722 81.697  21.864  1.00 20.60 ? 175 THR A N   1 
ATOM   208  C CA  . THR A 1 31  B 28.271 82.254  20.630  1.00 20.55 ? 175 THR A CA  1 
ATOM   209  C C   . THR A 1 31  B 29.785 82.350  20.760  1.00 20.96 ? 175 THR A C   1 
ATOM   210  O O   . THR A 1 31  B 30.499 82.442  19.768  1.00 22.00 ? 175 THR A O   1 
ATOM   211  C CB  . THR A 1 31  B 27.723 83.682  20.322  1.00 19.90 ? 175 THR A CB  1 
ATOM   212  O OG1 . THR A 1 31  B 28.242 84.621  21.273  1.00 17.49 ? 175 THR A OG1 1 
ATOM   213  C CG2 . THR A 1 31  B 26.196 83.695  20.365  1.00 19.86 ? 175 THR A CG2 1 
ATOM   214  N N   . GLY A 1 32  C 30.265 82.323  21.996  1.00 21.67 ? 175 GLY A N   1 
ATOM   215  C CA  . GLY A 1 32  C 31.690 82.418  22.236  1.00 22.92 ? 175 GLY A CA  1 
ATOM   216  C C   . GLY A 1 32  C 32.208 83.838  22.096  1.00 23.92 ? 175 GLY A C   1 
ATOM   217  O O   . GLY A 1 32  C 33.400 84.082  22.259  1.00 24.74 ? 175 GLY A O   1 
ATOM   218  N N   . MET A 1 33  ? 31.314 84.778  21.803  1.00 25.09 ? 176 MET A N   1 
ATOM   219  C CA  . MET A 1 33  ? 31.691 86.180  21.624  1.00 26.78 ? 176 MET A CA  1 
ATOM   220  C C   . MET A 1 33  ? 31.846 86.923  22.959  1.00 26.33 ? 176 MET A C   1 
ATOM   221  O O   . MET A 1 33  ? 30.952 86.873  23.812  1.00 28.48 ? 176 MET A O   1 
ATOM   222  C CB  . MET A 1 33  ? 30.642 86.878  20.747  1.00 28.77 ? 176 MET A CB  1 
ATOM   223  C CG  . MET A 1 33  ? 30.505 86.285  19.346  1.00 30.02 ? 176 MET A CG  1 
ATOM   224  S SD  . MET A 1 33  ? 31.948 86.635  18.319  1.00 36.06 ? 176 MET A SD  1 
ATOM   225  C CE  . MET A 1 33  ? 33.000 85.280  18.757  1.00 34.64 ? 176 MET A CE  1 
ATOM   226  N N   . THR A 1 34  ? 32.970 87.616  23.137  1.00 23.91 ? 177 THR A N   1 
ATOM   227  C CA  . THR A 1 34  ? 33.214 88.351  24.380  1.00 22.59 ? 177 THR A CA  1 
ATOM   228  C C   . THR A 1 34  ? 32.473 89.683  24.446  1.00 22.54 ? 177 THR A C   1 
ATOM   229  O O   . THR A 1 34  ? 32.118 90.258  23.424  1.00 23.14 ? 177 THR A O   1 
ATOM   230  C CB  . THR A 1 34  ? 34.713 88.632  24.582  1.00 22.54 ? 177 THR A CB  1 
ATOM   231  O OG1 . THR A 1 34  ? 35.168 89.565  23.593  1.00 21.40 ? 177 THR A OG1 1 
ATOM   232  C CG2 . THR A 1 34  ? 35.510 87.339  24.467  1.00 22.44 ? 177 THR A CG2 1 
ATOM   233  N N   . SER A 1 35  ? 32.247 90.169  25.662  1.00 21.79 ? 178 SER A N   1 
ATOM   234  C CA  . SER A 1 35  ? 31.552 91.431  25.866  1.00 21.45 ? 178 SER A CA  1 
ATOM   235  C C   . SER A 1 35  ? 32.337 92.621  25.343  1.00 21.78 ? 178 SER A C   1 
ATOM   236  O O   . SER A 1 35  ? 33.556 92.713  25.511  1.00 22.19 ? 178 SER A O   1 
ATOM   237  C CB  . SER A 1 35  ? 31.246 91.639  27.347  1.00 21.07 ? 178 SER A CB  1 
ATOM   238  O OG  . SER A 1 35  ? 30.252 90.734  27.781  1.00 24.96 ? 178 SER A OG  1 
ATOM   239  N N   . ARG A 1 36  ? 31.612 93.540  24.717  1.00 22.36 ? 179 ARG A N   1 
ATOM   240  C CA  . ARG A 1 36  ? 32.197 94.737  24.138  1.00 20.97 ? 179 ARG A CA  1 
ATOM   241  C C   . ARG A 1 36  ? 32.119 95.916  25.104  1.00 21.72 ? 179 ARG A C   1 
ATOM   242  O O   . ARG A 1 36  ? 31.279 96.803  24.955  1.00 22.08 ? 179 ARG A O   1 
ATOM   243  C CB  . ARG A 1 36  ? 31.483 95.062  22.823  1.00 18.50 ? 179 ARG A CB  1 
ATOM   244  C CG  . ARG A 1 36  ? 31.653 93.980  21.775  1.00 13.39 ? 179 ARG A CG  1 
ATOM   245  C CD  . ARG A 1 36  ? 30.976 94.339  20.470  1.00 14.40 ? 179 ARG A CD  1 
ATOM   246  N NE  . ARG A 1 36  ? 31.483 95.586  19.908  1.00 13.40 ? 179 ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 36  ? 30.896 96.774  20.037  1.00 14.00 ? 179 ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 36  ? 29.756 96.901  20.709  1.00 12.61 ? 179 ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 36  ? 31.466 97.843  19.502  1.00 13.61 ? 179 ARG A NH2 1 
ATOM   250  N N   . SER A 1 37  ? 33.011 95.913  26.093  1.00 22.45 ? 180 SER A N   1 
ATOM   251  C CA  . SER A 1 37  ? 33.064 96.964  27.105  1.00 21.83 ? 180 SER A CA  1 
ATOM   252  C C   . SER A 1 37  ? 33.301 98.351  26.529  1.00 20.43 ? 180 SER A C   1 
ATOM   253  O O   . SER A 1 37  ? 33.969 98.509  25.510  1.00 20.72 ? 180 SER A O   1 
ATOM   254  C CB  . SER A 1 37  ? 34.159 96.662  28.138  1.00 22.61 ? 180 SER A CB  1 
ATOM   255  O OG  . SER A 1 37  ? 33.797 95.576  28.969  1.00 23.93 ? 180 SER A OG  1 
ATOM   256  N N   . GLY A 1 38  ? 32.752 99.354  27.207  1.00 19.61 ? 181 GLY A N   1 
ATOM   257  C CA  . GLY A 1 38  ? 32.907 100.725 26.769  1.00 18.13 ? 181 GLY A CA  1 
ATOM   258  C C   . GLY A 1 38  ? 32.069 101.107 25.565  1.00 17.98 ? 181 GLY A C   1 
ATOM   259  O O   . GLY A 1 38  ? 32.120 102.257 25.127  1.00 19.07 ? 181 GLY A O   1 
ATOM   260  N N   . THR A 1 39  ? 31.299 100.167 25.024  1.00 17.09 ? 182 THR A N   1 
ATOM   261  C CA  . THR A 1 39  ? 30.477 100.472 23.860  1.00 17.93 ? 182 THR A CA  1 
ATOM   262  C C   . THR A 1 39  ? 29.313 101.369 24.244  1.00 18.66 ? 182 THR A C   1 
ATOM   263  O O   . THR A 1 39  ? 28.729 102.034 23.390  1.00 18.47 ? 182 THR A O   1 
ATOM   264  C CB  . THR A 1 39  ? 29.900 99.211  23.207  1.00 19.28 ? 182 THR A CB  1 
ATOM   265  O OG1 . THR A 1 39  ? 29.234 99.576  21.991  1.00 18.32 ? 182 THR A OG1 1 
ATOM   266  C CG2 . THR A 1 39  ? 28.905 98.529  24.142  1.00 18.13 ? 182 THR A CG2 1 
ATOM   267  N N   . ASP A 1 40  ? 28.977 101.376 25.530  1.00 18.79 ? 183 ASP A N   1 
ATOM   268  C CA  . ASP A 1 40  ? 27.888 102.203 26.015  1.00 19.69 ? 183 ASP A CA  1 
ATOM   269  C C   . ASP A 1 40  ? 28.275 103.668 25.892  1.00 19.20 ? 183 ASP A C   1 
ATOM   270  O O   . ASP A 1 40  ? 27.432 104.533 25.658  1.00 18.36 ? 183 ASP A O   1 
ATOM   271  C CB  . ASP A 1 40  ? 27.567 101.858 27.469  1.00 21.29 ? 183 ASP A CB  1 
ATOM   272  C CG  . ASP A 1 40  ? 26.807 100.550 27.599  1.00 23.61 ? 183 ASP A CG  1 
ATOM   273  O OD1 . ASP A 1 40  ? 25.786 100.398 26.897  1.00 23.15 ? 183 ASP A OD1 1 
ATOM   274  O OD2 . ASP A 1 40  ? 27.223 99.681  28.396  1.00 25.18 ? 183 ASP A OD2 1 
ATOM   275  N N   . VAL A 1 41  ? 29.565 103.934 26.041  1.00 18.88 ? 184 VAL A N   1 
ATOM   276  C CA  . VAL A 1 41  ? 30.085 105.284 25.940  1.00 18.85 ? 184 VAL A CA  1 
ATOM   277  C C   . VAL A 1 41  ? 29.875 105.775 24.505  1.00 19.94 ? 184 VAL A C   1 
ATOM   278  O O   . VAL A 1 41  ? 29.462 106.917 24.279  1.00 20.03 ? 184 VAL A O   1 
ATOM   279  C CB  . VAL A 1 41  ? 31.578 105.306 26.305  1.00 18.21 ? 184 VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 41  ? 32.094 106.728 26.336  1.00 16.82 ? 184 VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 41  ? 31.772 104.645 27.649  1.00 16.06 ? 184 VAL A CG2 1 
ATOM   282  N N   . ASP A 1 42  ? 30.143 104.905 23.537  1.00 19.28 ? 185 ASP A N   1 
ATOM   283  C CA  . ASP A 1 42  ? 29.952 105.261 22.138  1.00 19.21 ? 185 ASP A CA  1 
ATOM   284  C C   . ASP A 1 42  ? 28.488 105.574 21.838  1.00 19.06 ? 185 ASP A C   1 
ATOM   285  O O   . ASP A 1 42  ? 28.175 106.583 21.205  1.00 19.32 ? 185 ASP A O   1 
ATOM   286  C CB  . ASP A 1 42  ? 30.401 104.121 21.228  1.00 20.38 ? 185 ASP A CB  1 
ATOM   287  C CG  . ASP A 1 42  ? 31.900 103.974 21.170  1.00 20.87 ? 185 ASP A CG  1 
ATOM   288  O OD1 . ASP A 1 42  ? 32.615 104.906 21.594  1.00 20.85 ? 185 ASP A OD1 1 
ATOM   289  O OD2 . ASP A 1 42  ? 32.355 102.925 20.681  1.00 22.24 ? 185 ASP A OD2 1 
ATOM   290  N N   . ALA A 1 43  ? 27.597 104.698 22.294  1.00 18.32 ? 186 ALA A N   1 
ATOM   291  C CA  . ALA A 1 43  ? 26.164 104.858 22.071  1.00 17.32 ? 186 ALA A CA  1 
ATOM   292  C C   . ALA A 1 43  ? 25.602 106.099 22.751  1.00 17.38 ? 186 ALA A C   1 
ATOM   293  O O   . ALA A 1 43  ? 24.669 106.717 22.240  1.00 18.04 ? 186 ALA A O   1 
ATOM   294  C CB  . ALA A 1 43  ? 25.421 103.615 22.547  1.00 16.80 ? 186 ALA A CB  1 
ATOM   295  N N   . ALA A 1 44  ? 26.158 106.459 23.904  1.00 16.44 ? 187 ALA A N   1 
ATOM   296  C CA  . ALA A 1 44  ? 25.697 107.648 24.625  1.00 16.54 ? 187 ALA A CA  1 
ATOM   297  C C   . ALA A 1 44  ? 26.187 108.900 23.897  1.00 17.63 ? 187 ALA A C   1 
ATOM   298  O O   . ALA A 1 44  ? 25.459 109.890 23.777  1.00 18.07 ? 187 ALA A O   1 
ATOM   299  C CB  . ALA A 1 44  ? 26.225 107.639 26.048  1.00 14.10 ? 187 ALA A CB  1 
ATOM   300  N N   . ASN A 1 45  ? 27.428 108.833 23.416  1.00 18.07 ? 188 ASN A N   1 
ATOM   301  C CA  . ASN A 1 45  ? 28.071 109.915 22.686  1.00 17.86 ? 188 ASN A CA  1 
ATOM   302  C C   . ASN A 1 45  ? 27.346 110.166 21.362  1.00 18.90 ? 188 ASN A C   1 
ATOM   303  O O   . ASN A 1 45  ? 26.930 111.289 21.062  1.00 17.09 ? 188 ASN A O   1 
ATOM   304  C CB  . ASN A 1 45  ? 29.520 109.532 22.404  1.00 21.64 ? 188 ASN A CB  1 
ATOM   305  C CG  . ASN A 1 45  ? 30.388 110.727 22.063  1.00 26.62 ? 188 ASN A CG  1 
ATOM   306  O OD1 . ASN A 1 45  ? 29.891 111.783 21.667  1.00 29.25 ? 188 ASN A OD1 1 
ATOM   307  N ND2 . ASN A 1 45  ? 31.702 110.560 22.203  1.00 27.30 ? 188 ASN A ND2 1 
ATOM   308  N N   . LEU A 1 46  ? 27.200 109.106 20.571  1.00 19.07 ? 189 LEU A N   1 
ATOM   309  C CA  . LEU A 1 46  ? 26.536 109.196 19.276  1.00 19.09 ? 189 LEU A CA  1 
ATOM   310  C C   . LEU A 1 46  ? 25.119 109.714 19.438  1.00 19.07 ? 189 LEU A C   1 
ATOM   311  O O   . LEU A 1 46  ? 24.616 110.440 18.582  1.00 20.16 ? 189 LEU A O   1 
ATOM   312  C CB  . LEU A 1 46  ? 26.496 107.821 18.599  1.00 20.34 ? 189 LEU A CB  1 
ATOM   313  C CG  . LEU A 1 46  ? 27.808 107.184 18.128  1.00 21.56 ? 189 LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 46  ? 27.603 105.682 17.958  1.00 21.29 ? 189 LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 46  ? 28.280 107.831 16.824  1.00 18.82 ? 189 LEU A CD2 1 
ATOM   316  N N   . ARG A 1 47  ? 24.479 109.330 20.537  1.00 18.78 ? 190 ARG A N   1 
ATOM   317  C CA  . ARG A 1 47  ? 23.111 109.748 20.812  1.00 19.69 ? 190 ARG A CA  1 
ATOM   318  C C   . ARG A 1 47  ? 23.033 111.257 21.015  1.00 18.47 ? 190 ARG A C   1 
ATOM   319  O O   . ARG A 1 47  ? 22.124 111.914 20.511  1.00 19.14 ? 190 ARG A O   1 
ATOM   320  C CB  . ARG A 1 47  ? 22.591 109.018 22.050  1.00 21.28 ? 190 ARG A CB  1 
ATOM   321  C CG  . ARG A 1 47  ? 21.116 109.224 22.355  1.00 24.61 ? 190 ARG A CG  1 
ATOM   322  C CD  . ARG A 1 47  ? 20.755 108.519 23.659  1.00 27.72 ? 190 ARG A CD  1 
ATOM   323  N NE  . ARG A 1 47  ? 19.496 108.983 24.239  1.00 29.74 ? 190 ARG A NE  1 
ATOM   324  C CZ  . ARG A 1 47  ? 18.293 108.576 23.848  1.00 31.19 ? 190 ARG A CZ  1 
ATOM   325  N NH1 . ARG A 1 47  ? 18.176 107.687 22.873  1.00 31.20 ? 190 ARG A NH1 1 
ATOM   326  N NH2 . ARG A 1 47  ? 17.206 109.062 24.432  1.00 31.95 ? 190 ARG A NH2 1 
ATOM   327  N N   . GLU A 1 48  ? 24.001 111.803 21.742  1.00 17.64 ? 191 GLU A N   1 
ATOM   328  C CA  . GLU A 1 48  ? 24.051 113.235 22.016  1.00 17.51 ? 191 GLU A CA  1 
ATOM   329  C C   . GLU A 1 48  ? 24.465 114.057 20.801  1.00 16.75 ? 191 GLU A C   1 
ATOM   330  O O   . GLU A 1 48  ? 24.027 115.193 20.618  1.00 16.53 ? 191 GLU A O   1 
ATOM   331  C CB  . GLU A 1 48  ? 25.032 113.516 23.151  1.00 17.59 ? 191 GLU A CB  1 
ATOM   332  C CG  . GLU A 1 48  ? 24.385 114.025 24.426  1.00 19.63 ? 191 GLU A CG  1 
ATOM   333  C CD  . GLU A 1 48  ? 23.481 115.221 24.190  1.00 22.57 ? 191 GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 48  ? 23.982 116.289 23.751  1.00 21.06 ? 191 GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 48  ? 22.259 115.088 24.447  1.00 22.41 ? 191 GLU A OE2 1 
ATOM   336  N N   . THR A 1 49  ? 25.319 113.482 19.974  1.00 16.20 ? 192 THR A N   1 
ATOM   337  C CA  . THR A 1 49  ? 25.801 114.185 18.806  1.00 15.79 ? 192 THR A CA  1 
ATOM   338  C C   . THR A 1 49  ? 24.731 114.292 17.745  1.00 16.22 ? 192 THR A C   1 
ATOM   339  O O   . THR A 1 49  ? 24.508 115.362 17.176  1.00 17.06 ? 192 THR A O   1 
ATOM   340  C CB  . THR A 1 49  ? 27.016 113.473 18.223  1.00 15.53 ? 192 THR A CB  1 
ATOM   341  O OG1 . THR A 1 49  ? 28.008 113.332 19.247  1.00 13.29 ? 192 THR A OG1 1 
ATOM   342  C CG2 . THR A 1 49  ? 27.588 114.263 17.055  1.00 15.93 ? 192 THR A CG2 1 
ATOM   343  N N   . PHE A 1 50  ? 24.061 113.182 17.477  1.00 16.44 ? 193 PHE A N   1 
ATOM   344  C CA  . PHE A 1 50  ? 23.025 113.188 16.464  1.00 16.44 ? 193 PHE A CA  1 
ATOM   345  C C   . PHE A 1 50  ? 21.756 113.871 16.957  1.00 16.52 ? 193 PHE A C   1 
ATOM   346  O O   . PHE A 1 50  ? 20.894 114.238 16.165  1.00 17.62 ? 193 PHE A O   1 
ATOM   347  C CB  . PHE A 1 50  ? 22.775 111.759 15.975  1.00 16.58 ? 193 PHE A CB  1 
ATOM   348  C CG  . PHE A 1 50  ? 23.760 111.309 14.917  1.00 17.33 ? 193 PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 50  ? 23.612 111.716 13.593  1.00 16.82 ? 193 PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 50  ? 24.859 110.519 15.246  1.00 18.87 ? 193 PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 50  ? 24.539 111.348 12.614  1.00 15.05 ? 193 PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 50  ? 25.799 110.145 14.262  1.00 18.37 ? 193 PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 50  ? 25.631 110.563 12.948  1.00 15.26 ? 193 PHE A CZ  1 
ATOM   354  N N   . ARG A 1 51  ? 21.653 114.072 18.266  1.00 16.29 ? 194 ARG A N   1 
ATOM   355  C CA  . ARG A 1 51  ? 20.494 114.765 18.800  1.00 15.26 ? 194 ARG A CA  1 
ATOM   356  C C   . ARG A 1 51  ? 20.638 116.227 18.412  1.00 15.92 ? 194 ARG A C   1 
ATOM   357  O O   . ARG A 1 51  ? 19.682 116.855 17.949  1.00 14.65 ? 194 ARG A O   1 
ATOM   358  C CB  . ARG A 1 51  ? 20.423 114.660 20.324  1.00 16.02 ? 194 ARG A CB  1 
ATOM   359  C CG  . ARG A 1 51  ? 19.157 115.303 20.899  1.00 16.35 ? 194 ARG A CG  1 
ATOM   360  C CD  . ARG A 1 51  ? 19.043 115.135 22.410  1.00 16.05 ? 194 ARG A CD  1 
ATOM   361  N NE  . ARG A 1 51  ? 20.003 115.956 23.143  1.00 18.86 ? 194 ARG A NE  1 
ATOM   362  C CZ  . ARG A 1 51  ? 19.906 117.274 23.294  1.00 19.11 ? 194 ARG A CZ  1 
ATOM   363  N NH1 . ARG A 1 51  ? 18.889 117.939 22.766  1.00 19.13 ? 194 ARG A NH1 1 
ATOM   364  N NH2 . ARG A 1 51  ? 20.829 117.928 23.976  1.00 19.91 ? 194 ARG A NH2 1 
ATOM   365  N N   . ASN A 1 52  ? 21.842 116.768 18.587  1.00 15.63 ? 195 ASN A N   1 
ATOM   366  C CA  . ASN A 1 52  ? 22.078 118.164 18.257  1.00 16.38 ? 195 ASN A CA  1 
ATOM   367  C C   . ASN A 1 52  ? 22.128 118.424 16.763  1.00 16.25 ? 195 ASN A C   1 
ATOM   368  O O   . ASN A 1 52  ? 22.161 119.572 16.334  1.00 17.22 ? 195 ASN A O   1 
ATOM   369  C CB  . ASN A 1 52  ? 23.343 118.683 18.954  1.00 17.22 ? 195 ASN A CB  1 
ATOM   370  C CG  . ASN A 1 52  ? 23.159 118.803 20.460  1.00 20.87 ? 195 ASN A CG  1 
ATOM   371  O OD1 . ASN A 1 52  ? 22.189 119.404 20.933  1.00 22.48 ? 195 ASN A OD1 1 
ATOM   372  N ND2 . ASN A 1 52  ? 24.079 118.226 21.221  1.00 21.61 ? 195 ASN A ND2 1 
ATOM   373  N N   . LEU A 1 53  ? 22.131 117.363 15.966  1.00 16.95 ? 196 LEU A N   1 
ATOM   374  C CA  . LEU A 1 53  ? 22.113 117.520 14.516  1.00 17.04 ? 196 LEU A CA  1 
ATOM   375  C C   . LEU A 1 53  ? 20.655 117.452 14.065  1.00 17.29 ? 196 LEU A C   1 
ATOM   376  O O   . LEU A 1 53  ? 20.354 117.540 12.879  1.00 16.93 ? 196 LEU A O   1 
ATOM   377  C CB  . LEU A 1 53  ? 22.925 116.419 13.832  1.00 18.56 ? 196 LEU A CB  1 
ATOM   378  C CG  . LEU A 1 53  ? 24.444 116.487 14.000  1.00 18.52 ? 196 LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 53  ? 25.089 115.397 13.168  1.00 19.41 ? 196 LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 53  ? 24.960 117.840 13.561  1.00 18.25 ? 196 LEU A CD2 1 
ATOM   381  N N   . LYS A 1 54  ? 19.761 117.291 15.040  1.00 17.88 ? 197 LYS A N   1 
ATOM   382  C CA  . LYS A 1 54  ? 18.321 117.218 14.818  1.00 17.37 ? 197 LYS A CA  1 
ATOM   383  C C   . LYS A 1 54  ? 17.785 115.931 14.223  1.00 16.07 ? 197 LYS A C   1 
ATOM   384  O O   . LYS A 1 54  ? 16.816 115.948 13.480  1.00 16.43 ? 197 LYS A O   1 
ATOM   385  C CB  . LYS A 1 54  ? 17.849 118.393 13.963  1.00 19.83 ? 197 LYS A CB  1 
ATOM   386  C CG  . LYS A 1 54  ? 17.473 119.621 14.768  1.00 24.02 ? 197 LYS A CG  1 
ATOM   387  C CD  . LYS A 1 54  ? 18.669 120.220 15.478  1.00 26.97 ? 197 LYS A CD  1 
ATOM   388  C CE  . LYS A 1 54  ? 18.255 121.444 16.272  1.00 29.82 ? 197 LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 54  ? 19.432 122.164 16.820  1.00 33.06 ? 197 LYS A NZ  1 
ATOM   390  N N   . TYR A 1 55  ? 18.411 114.814 14.549  1.00 15.35 ? 198 TYR A N   1 
ATOM   391  C CA  . TYR A 1 55  ? 17.945 113.529 14.060  1.00 15.33 ? 198 TYR A CA  1 
ATOM   392  C C   . TYR A 1 55  ? 17.092 112.904 15.145  1.00 15.46 ? 198 TYR A C   1 
ATOM   393  O O   . TYR A 1 55  ? 17.361 113.106 16.326  1.00 15.47 ? 198 TYR A O   1 
ATOM   394  C CB  . TYR A 1 55  ? 19.124 112.592 13.772  1.00 15.57 ? 198 TYR A CB  1 
ATOM   395  C CG  . TYR A 1 55  ? 19.775 112.811 12.437  1.00 13.76 ? 198 TYR A CG  1 
ATOM   396  C CD1 . TYR A 1 55  ? 20.749 113.788 12.261  1.00 12.06 ? 198 TYR A CD1 1 
ATOM   397  C CD2 . TYR A 1 55  ? 19.378 112.067 11.328  1.00 13.26 ? 198 TYR A CD2 1 
ATOM   398  C CE1 . TYR A 1 55  ? 21.309 114.017 11.004  1.00 10.42 ? 198 TYR A CE1 1 
ATOM   399  C CE2 . TYR A 1 55  ? 19.932 112.292 10.073  1.00 9.82  ? 198 TYR A CE2 1 
ATOM   400  C CZ  . TYR A 1 55  ? 20.891 113.263 9.921   1.00 8.02  ? 198 TYR A CZ  1 
ATOM   401  O OH  . TYR A 1 55  ? 21.428 113.470 8.686   1.00 8.12  ? 198 TYR A OH  1 
ATOM   402  N N   . GLU A 1 56  ? 16.061 112.163 14.754  1.00 16.95 ? 199 GLU A N   1 
ATOM   403  C CA  . GLU A 1 56  ? 15.231 111.478 15.737  1.00 19.83 ? 199 GLU A CA  1 
ATOM   404  C C   . GLU A 1 56  ? 16.046 110.233 16.038  1.00 19.27 ? 199 GLU A C   1 
ATOM   405  O O   . GLU A 1 56  ? 16.156 109.356 15.193  1.00 21.34 ? 199 GLU A O   1 
ATOM   406  C CB  . GLU A 1 56  ? 13.883 111.059 15.144  1.00 23.24 ? 199 GLU A CB  1 
ATOM   407  C CG  . GLU A 1 56  ? 12.865 110.580 16.196  1.00 28.65 ? 199 GLU A CG  1 
ATOM   408  C CD  . GLU A 1 56  ? 11.628 109.904 15.592  1.00 31.42 ? 199 GLU A CD  1 
ATOM   409  O OE1 . GLU A 1 56  ? 10.973 110.498 14.703  1.00 33.14 ? 199 GLU A OE1 1 
ATOM   410  O OE2 . GLU A 1 56  ? 11.305 108.773 16.021  1.00 32.08 ? 199 GLU A OE2 1 
ATOM   411  N N   . VAL A 1 57  ? 16.619 110.153 17.232  1.00 18.46 ? 200 VAL A N   1 
ATOM   412  C CA  . VAL A 1 57  ? 17.453 109.015 17.591  1.00 16.03 ? 200 VAL A CA  1 
ATOM   413  C C   . VAL A 1 57  ? 16.720 107.898 18.322  1.00 15.99 ? 200 VAL A C   1 
ATOM   414  O O   . VAL A 1 57  ? 15.833 108.155 19.132  1.00 15.40 ? 200 VAL A O   1 
ATOM   415  C CB  . VAL A 1 57  ? 18.636 109.479 18.454  1.00 15.03 ? 200 VAL A CB  1 
ATOM   416  C CG1 . VAL A 1 57  ? 19.593 108.326 18.698  1.00 13.76 ? 200 VAL A CG1 1 
ATOM   417  C CG2 . VAL A 1 57  ? 19.340 110.630 17.765  1.00 12.98 ? 200 VAL A CG2 1 
ATOM   418  N N   . ARG A 1 58  ? 17.102 106.659 18.024  1.00 16.21 ? 201 ARG A N   1 
ATOM   419  C CA  . ARG A 1 58  ? 16.511 105.486 18.656  1.00 16.94 ? 201 ARG A CA  1 
ATOM   420  C C   . ARG A 1 58  ? 17.604 104.486 19.038  1.00 18.25 ? 201 ARG A C   1 
ATOM   421  O O   . ARG A 1 58  ? 18.224 103.881 18.167  1.00 18.65 ? 201 ARG A O   1 
ATOM   422  C CB  . ARG A 1 58  ? 15.513 104.809 17.708  1.00 17.47 ? 201 ARG A CB  1 
ATOM   423  C CG  . ARG A 1 58  ? 14.362 105.697 17.251  1.00 19.45 ? 201 ARG A CG  1 
ATOM   424  C CD  . ARG A 1 58  ? 13.398 104.930 16.355  1.00 21.67 ? 201 ARG A CD  1 
ATOM   425  N NE  . ARG A 1 58  ? 12.372 105.782 15.747  1.00 22.31 ? 201 ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 58  ? 11.451 105.345 14.889  1.00 21.91 ? 201 ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 58  ? 11.421 104.063 14.539  1.00 19.93 ? 201 ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 58  ? 10.564 106.186 14.372  1.00 18.97 ? 201 ARG A NH2 1 
ATOM   429  N N   . ASN A 1 59  ? 17.850 104.326 20.337  1.00 19.42 ? 202 ASN A N   1 
ATOM   430  C CA  . ASN A 1 59  ? 18.852 103.379 20.819  1.00 19.28 ? 202 ASN A CA  1 
ATOM   431  C C   . ASN A 1 59  ? 18.194 102.039 21.075  1.00 20.06 ? 202 ASN A C   1 
ATOM   432  O O   . ASN A 1 59  ? 17.161 101.969 21.736  1.00 20.03 ? 202 ASN A O   1 
ATOM   433  C CB  . ASN A 1 59  ? 19.469 103.828 22.144  1.00 20.96 ? 202 ASN A CB  1 
ATOM   434  C CG  . ASN A 1 59  ? 20.338 105.047 22.008  1.00 23.26 ? 202 ASN A CG  1 
ATOM   435  O OD1 . ASN A 1 59  ? 19.850 106.141 21.731  1.00 26.11 ? 202 ASN A OD1 1 
ATOM   436  N ND2 . ASN A 1 59  ? 21.645 104.870 22.208  1.00 21.68 ? 202 ASN A ND2 1 
ATOM   437  N N   . LYS A 1 60  ? 18.797 100.978 20.558  1.00 20.71 ? 203 LYS A N   1 
ATOM   438  C CA  . LYS A 1 60  ? 18.295 99.626  20.768  1.00 19.42 ? 203 LYS A CA  1 
ATOM   439  C C   . LYS A 1 60  ? 19.503 98.863  21.265  1.00 19.22 ? 203 LYS A C   1 
ATOM   440  O O   . LYS A 1 60  ? 20.571 98.946  20.667  1.00 19.34 ? 203 LYS A O   1 
ATOM   441  C CB  . LYS A 1 60  ? 17.793 99.030  19.460  1.00 20.85 ? 203 LYS A CB  1 
ATOM   442  C CG  . LYS A 1 60  ? 16.524 99.683  18.937  1.00 23.56 ? 203 LYS A CG  1 
ATOM   443  C CD  . LYS A 1 60  ? 15.279 99.160  19.641  1.00 24.30 ? 203 LYS A CD  1 
ATOM   444  C CE  . LYS A 1 60  ? 14.014 99.708  18.975  1.00 29.63 ? 203 LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 60  ? 12.745 99.142  19.536  1.00 31.92 ? 203 LYS A NZ  1 
ATOM   446  N N   . ASN A 1 61  ? 19.342 98.135  22.363  1.00 19.37 ? 204 ASN A N   1 
ATOM   447  C CA  . ASN A 1 61  ? 20.450 97.389  22.937  1.00 18.88 ? 204 ASN A CA  1 
ATOM   448  C C   . ASN A 1 61  ? 20.325 95.876  22.932  1.00 18.85 ? 204 ASN A C   1 
ATOM   449  O O   . ASN A 1 61  ? 19.254 95.326  23.176  1.00 18.49 ? 204 ASN A O   1 
ATOM   450  C CB  . ASN A 1 61  ? 20.684 97.841  24.374  1.00 21.05 ? 204 ASN A CB  1 
ATOM   451  C CG  . ASN A 1 61  ? 21.273 99.225  24.458  1.00 21.94 ? 204 ASN A CG  1 
ATOM   452  O OD1 . ASN A 1 61  ? 20.737 100.095 25.129  1.00 23.45 ? 204 ASN A OD1 1 
ATOM   453  N ND2 . ASN A 1 61  ? 22.390 99.434  23.779  1.00 25.78 ? 204 ASN A ND2 1 
ATOM   454  N N   . ASP A 1 62  ? 21.451 95.224  22.661  1.00 18.32 ? 205 ASP A N   1 
ATOM   455  C CA  . ASP A 1 62  ? 21.565 93.773  22.658  1.00 18.57 ? 205 ASP A CA  1 
ATOM   456  C C   . ASP A 1 62  ? 20.455 93.036  21.920  1.00 17.96 ? 205 ASP A C   1 
ATOM   457  O O   . ASP A 1 62  ? 19.740 92.237  22.510  1.00 16.90 ? 205 ASP A O   1 
ATOM   458  C CB  . ASP A 1 62  ? 21.652 93.268  24.110  1.00 20.15 ? 205 ASP A CB  1 
ATOM   459  C CG  . ASP A 1 62  ? 22.899 93.783  24.849  1.00 22.08 ? 205 ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 62  ? 23.604 94.664  24.314  1.00 25.03 ? 205 ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 62  ? 23.173 93.315  25.972  1.00 21.14 ? 205 ASP A OD2 1 
ATOM   462  N N   . LEU A 1 63  ? 20.329 93.294  20.622  1.00 18.10 ? 206 LEU A N   1 
ATOM   463  C CA  . LEU A 1 63  ? 19.313 92.643  19.801  1.00 18.42 ? 206 LEU A CA  1 
ATOM   464  C C   . LEU A 1 63  ? 19.834 91.337  19.182  1.00 18.49 ? 206 LEU A C   1 
ATOM   465  O O   . LEU A 1 63  ? 21.024 91.210  18.888  1.00 19.02 ? 206 LEU A O   1 
ATOM   466  C CB  . LEU A 1 63  ? 18.850 93.585  18.679  1.00 16.86 ? 206 LEU A CB  1 
ATOM   467  C CG  . LEU A 1 63  ? 18.399 94.991  19.068  1.00 17.89 ? 206 LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 63  ? 17.874 95.713  17.845  1.00 19.56 ? 206 LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 63  ? 17.313 94.917  20.116  1.00 18.90 ? 206 LEU A CD2 1 
ATOM   470  N N   . THR A 1 64  ? 18.942 90.369  18.989  1.00 18.14 ? 207 THR A N   1 
ATOM   471  C CA  . THR A 1 64  ? 19.326 89.099  18.384  1.00 19.46 ? 207 THR A CA  1 
ATOM   472  C C   . THR A 1 64  ? 19.393 89.329  16.881  1.00 20.51 ? 207 THR A C   1 
ATOM   473  O O   . THR A 1 64  ? 18.852 90.317  16.385  1.00 21.52 ? 207 THR A O   1 
ATOM   474  C CB  . THR A 1 64  ? 18.284 87.972  18.681  1.00 19.06 ? 207 THR A CB  1 
ATOM   475  O OG1 . THR A 1 64  ? 16.979 88.365  18.225  1.00 17.40 ? 207 THR A OG1 1 
ATOM   476  C CG2 . THR A 1 64  ? 18.228 87.688  20.166  1.00 18.61 ? 207 THR A CG2 1 
ATOM   477  N N   . ARG A 1 65  ? 20.059 88.437  16.154  1.00 20.55 ? 208 ARG A N   1 
ATOM   478  C CA  . ARG A 1 65  ? 20.140 88.597  14.710  1.00 20.63 ? 208 ARG A CA  1 
ATOM   479  C C   . ARG A 1 65  ? 18.731 88.836  14.171  1.00 20.87 ? 208 ARG A C   1 
ATOM   480  O O   . ARG A 1 65  ? 18.509 89.774  13.401  1.00 19.94 ? 208 ARG A O   1 
ATOM   481  C CB  . ARG A 1 65  ? 20.756 87.357  14.047  1.00 21.02 ? 208 ARG A CB  1 
ATOM   482  C CG  . ARG A 1 65  ? 19.870 86.125  14.023  1.00 23.87 ? 208 ARG A CG  1 
ATOM   483  C CD  . ARG A 1 65  ? 20.214 85.258  12.829  1.00 25.68 ? 208 ARG A CD  1 
ATOM   484  N NE  . ARG A 1 65  ? 21.278 84.295  13.093  1.00 28.82 ? 208 ARG A NE  1 
ATOM   485  C CZ  . ARG A 1 65  ? 21.072 83.095  13.631  1.00 31.28 ? 208 ARG A CZ  1 
ATOM   486  N NH1 . ARG A 1 65  ? 19.842 82.712  13.964  1.00 31.01 ? 208 ARG A NH1 1 
ATOM   487  N NH2 . ARG A 1 65  ? 22.091 82.265  13.818  1.00 32.05 ? 208 ARG A NH2 1 
ATOM   488  N N   . GLU A 1 66  ? 17.783 88.002  14.603  1.00 20.65 ? 209 GLU A N   1 
ATOM   489  C CA  . GLU A 1 66  ? 16.388 88.105  14.170  1.00 21.84 ? 209 GLU A CA  1 
ATOM   490  C C   . GLU A 1 66  ? 15.813 89.500  14.368  1.00 21.10 ? 209 GLU A C   1 
ATOM   491  O O   . GLU A 1 66  ? 15.229 90.086  13.450  1.00 20.92 ? 209 GLU A O   1 
ATOM   492  C CB  . GLU A 1 66  ? 15.502 87.114  14.934  1.00 23.85 ? 209 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 66  ? 15.604 85.651  14.517  1.00 26.86 ? 209 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 66  ? 16.920 84.999  14.911  1.00 29.10 ? 209 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 66  ? 17.464 85.335  15.988  1.00 27.63 ? 209 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 66  ? 17.395 84.133  14.145  1.00 30.69 ? 209 GLU A OE2 1 
ATOM   497  N N   . GLU A 1 67  ? 15.963 90.028  15.576  1.00 20.55 ? 210 GLU A N   1 
ATOM   498  C CA  . GLU A 1 67  ? 15.435 91.353  15.872  1.00 18.90 ? 210 GLU A CA  1 
ATOM   499  C C   . GLU A 1 67  ? 16.108 92.432  15.040  1.00 19.44 ? 210 GLU A C   1 
ATOM   500  O O   . GLU A 1 67  ? 15.457 93.388  14.633  1.00 20.53 ? 210 GLU A O   1 
ATOM   501  C CB  . GLU A 1 67  ? 15.591 91.663  17.356  1.00 17.79 ? 210 GLU A CB  1 
ATOM   502  C CG  . GLU A 1 67  ? 14.885 90.676  18.254  1.00 16.91 ? 210 GLU A CG  1 
ATOM   503  C CD  . GLU A 1 67  ? 15.194 90.901  19.710  1.00 17.40 ? 210 GLU A CD  1 
ATOM   504  O OE1 . GLU A 1 67  ? 16.378 90.788  20.095  1.00 16.11 ? 210 GLU A OE1 1 
ATOM   505  O OE2 . GLU A 1 67  ? 14.252 91.197  20.470  1.00 20.70 ? 210 GLU A OE2 1 
ATOM   506  N N   . ILE A 1 68  ? 17.404 92.289  14.778  1.00 19.20 ? 211 ILE A N   1 
ATOM   507  C CA  . ILE A 1 68  ? 18.087 93.292  13.975  1.00 19.78 ? 211 ILE A CA  1 
ATOM   508  C C   . ILE A 1 68  ? 17.388 93.402  12.620  1.00 20.69 ? 211 ILE A C   1 
ATOM   509  O O   . ILE A 1 68  ? 16.994 94.497  12.202  1.00 22.60 ? 211 ILE A O   1 
ATOM   510  C CB  . ILE A 1 68  ? 19.593 92.950  13.777  1.00 20.31 ? 211 ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 68  ? 20.330 93.020  15.123  1.00 20.23 ? 211 ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 68  ? 20.225 93.928  12.799  1.00 17.77 ? 211 ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 68  ? 21.833 92.781  15.042  1.00 20.22 ? 211 ILE A CD1 1 
ATOM   514  N N   . VAL A 1 69  ? 17.213 92.268  11.948  1.00 20.15 ? 212 VAL A N   1 
ATOM   515  C CA  . VAL A 1 69  ? 16.550 92.238  10.643  1.00 20.96 ? 212 VAL A CA  1 
ATOM   516  C C   . VAL A 1 69  ? 15.112 92.756  10.740  1.00 21.19 ? 212 VAL A C   1 
ATOM   517  O O   . VAL A 1 69  ? 14.636 93.483  9.873   1.00 21.28 ? 212 VAL A O   1 
ATOM   518  C CB  . VAL A 1 69  ? 16.530 90.793  10.065  1.00 20.51 ? 212 VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 69  ? 15.600 90.710  8.861   1.00 19.60 ? 212 VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 69  ? 17.929 90.384  9.655   1.00 18.62 ? 212 VAL A CG2 1 
ATOM   521  N N   . GLU A 1 70  ? 14.437 92.352  11.806  1.00 21.58 ? 213 GLU A N   1 
ATOM   522  C CA  . GLU A 1 70  ? 13.061 92.733  12.080  1.00 22.90 ? 213 GLU A CA  1 
ATOM   523  C C   . GLU A 1 70  ? 12.944 94.248  12.210  1.00 21.74 ? 213 GLU A C   1 
ATOM   524  O O   . GLU A 1 70  ? 12.004 94.865  11.719  1.00 20.70 ? 213 GLU A O   1 
ATOM   525  C CB  . GLU A 1 70  ? 12.638 92.036  13.371  1.00 27.18 ? 213 GLU A CB  1 
ATOM   526  C CG  . GLU A 1 70  ? 11.424 92.584  14.089  1.00 33.54 ? 213 GLU A CG  1 
ATOM   527  C CD  . GLU A 1 70  ? 11.428 92.176  15.566  1.00 38.10 ? 213 GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 70  ? 11.539 93.069  16.439  1.00 37.81 ? 213 GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 70  ? 11.339 90.958  15.850  1.00 39.78 ? 213 GLU A OE2 1 
ATOM   530  N N   . LEU A 1 71  ? 13.918 94.842  12.878  1.00 20.63 ? 214 LEU A N   1 
ATOM   531  C CA  . LEU A 1 71  ? 13.942 96.278  13.077  1.00 20.16 ? 214 LEU A CA  1 
ATOM   532  C C   . LEU A 1 71  ? 14.188 97.008  11.757  1.00 20.89 ? 214 LEU A C   1 
ATOM   533  O O   . LEU A 1 71  ? 13.530 98.002  11.462  1.00 22.22 ? 214 LEU A O   1 
ATOM   534  C CB  . LEU A 1 71  ? 15.045 96.635  14.074  1.00 18.23 ? 214 LEU A CB  1 
ATOM   535  C CG  . LEU A 1 71  ? 15.295 98.119  14.330  1.00 17.09 ? 214 LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 71  ? 14.105 98.725  15.025  1.00 15.51 ? 214 LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 71  ? 16.539 98.283  15.177  1.00 16.69 ? 214 LEU A CD2 1 
ATOM   538  N N   . MET A 1 72  ? 15.137 96.513  10.968  1.00 20.90 ? 215 MET A N   1 
ATOM   539  C CA  . MET A 1 72  ? 15.468 97.145  9.697   1.00 21.32 ? 215 MET A CA  1 
ATOM   540  C C   . MET A 1 72  ? 14.306 97.060  8.729   1.00 22.95 ? 215 MET A C   1 
ATOM   541  O O   . MET A 1 72  ? 13.997 98.019  8.016   1.00 24.32 ? 215 MET A O   1 
ATOM   542  C CB  . MET A 1 72  ? 16.709 96.495  9.081   1.00 20.95 ? 215 MET A CB  1 
ATOM   543  C CG  . MET A 1 72  ? 17.988 96.711  9.882   1.00 20.48 ? 215 MET A CG  1 
ATOM   544  S SD  . MET A 1 72  ? 18.387 98.460  10.100  1.00 23.25 ? 215 MET A SD  1 
ATOM   545  C CE  . MET A 1 72  ? 17.898 98.728  11.795  1.00 22.81 ? 215 MET A CE  1 
ATOM   546  N N   . ARG A 1 73  ? 13.661 95.903  8.714   1.00 23.83 ? 216 ARG A N   1 
ATOM   547  C CA  . ARG A 1 73  ? 12.517 95.678  7.851   1.00 24.70 ? 216 ARG A CA  1 
ATOM   548  C C   . ARG A 1 73  ? 11.433 96.712  8.175   1.00 23.61 ? 216 ARG A C   1 
ATOM   549  O O   . ARG A 1 73  ? 10.863 97.336  7.275   1.00 22.77 ? 216 ARG A O   1 
ATOM   550  C CB  . ARG A 1 73  ? 11.974 94.267  8.078   1.00 26.23 ? 216 ARG A CB  1 
ATOM   551  C CG  . ARG A 1 73  ? 10.851 93.863  7.138   1.00 31.56 ? 216 ARG A CG  1 
ATOM   552  C CD  . ARG A 1 73  ? 10.190 92.559  7.595   1.00 35.54 ? 216 ARG A CD  1 
ATOM   553  N NE  . ARG A 1 73  ? 9.463  92.741  8.853   1.00 39.02 ? 216 ARG A NE  1 
ATOM   554  C CZ  . ARG A 1 73  ? 9.676  92.029  9.961   1.00 39.51 ? 216 ARG A CZ  1 
ATOM   555  N NH1 . ARG A 1 73  ? 10.600 91.071  9.978   1.00 38.73 ? 216 ARG A NH1 1 
ATOM   556  N NH2 . ARG A 1 73  ? 8.973  92.288  11.061  1.00 37.69 ? 216 ARG A NH2 1 
ATOM   557  N N   . ASP A 1 74  ? 11.163 96.901  9.463   1.00 22.01 ? 217 ASP A N   1 
ATOM   558  C CA  . ASP A 1 74  ? 10.137 97.840  9.889   1.00 22.31 ? 217 ASP A CA  1 
ATOM   559  C C   . ASP A 1 74  ? 10.515 99.281  9.663   1.00 22.90 ? 217 ASP A C   1 
ATOM   560  O O   . ASP A 1 74  ? 9.684  100.077 9.222   1.00 22.22 ? 217 ASP A O   1 
ATOM   561  C CB  . ASP A 1 74  ? 9.810  97.643  11.357  1.00 21.71 ? 217 ASP A CB  1 
ATOM   562  C CG  . ASP A 1 74  ? 9.267  96.276  11.637  1.00 23.65 ? 217 ASP A CG  1 
ATOM   563  O OD1 . ASP A 1 74  ? 8.500  95.761  10.794  1.00 23.50 ? 217 ASP A OD1 1 
ATOM   564  O OD2 . ASP A 1 74  ? 9.604  95.720  12.702  1.00 26.02 ? 217 ASP A OD2 1 
ATOM   565  N N   . VAL A 1 75  ? 11.766 99.619  9.966   1.00 23.31 ? 218 VAL A N   1 
ATOM   566  C CA  . VAL A 1 75  ? 12.229 100.986 9.780   1.00 24.17 ? 218 VAL A CA  1 
ATOM   567  C C   . VAL A 1 75  ? 12.131 101.396 8.311   1.00 24.66 ? 218 VAL A C   1 
ATOM   568  O O   . VAL A 1 75  ? 11.865 102.558 8.006   1.00 24.37 ? 218 VAL A O   1 
ATOM   569  C CB  . VAL A 1 75  ? 13.682 101.165 10.283  1.00 23.67 ? 218 VAL A CB  1 
ATOM   570  C CG1 . VAL A 1 75  ? 14.193 102.537 9.925   1.00 22.89 ? 218 VAL A CG1 1 
ATOM   571  C CG2 . VAL A 1 75  ? 13.727 100.999 11.794  1.00 25.26 ? 218 VAL A CG2 1 
ATOM   572  N N   . SER A 1 76  ? 12.322 100.440 7.405   1.00 25.93 ? 219 SER A N   1 
ATOM   573  C CA  . SER A 1 76  ? 12.248 100.718 5.969   1.00 27.54 ? 219 SER A CA  1 
ATOM   574  C C   . SER A 1 76  ? 10.811 100.922 5.481   1.00 28.15 ? 219 SER A C   1 
ATOM   575  O O   . SER A 1 76  ? 10.558 101.737 4.584   1.00 30.45 ? 219 SER A O   1 
ATOM   576  C CB  . SER A 1 76  ? 12.895 99.582  5.165   1.00 27.63 ? 219 SER A CB  1 
ATOM   577  O OG  . SER A 1 76  ? 12.206 98.354  5.345   1.00 28.73 ? 219 SER A OG  1 
ATOM   578  N N   . LYS A 1 77  ? 9.869  100.193 6.073   1.00 26.24 ? 220 LYS A N   1 
ATOM   579  C CA  . LYS A 1 77  ? 8.473  100.304 5.670   1.00 25.36 ? 220 LYS A CA  1 
ATOM   580  C C   . LYS A 1 77  ? 7.824  101.619 6.119   1.00 25.23 ? 220 LYS A C   1 
ATOM   581  O O   . LYS A 1 77  ? 6.783  102.022 5.595   1.00 23.70 ? 220 LYS A O   1 
ATOM   582  C CB  . LYS A 1 77  ? 7.699  99.073  6.163   1.00 24.93 ? 220 LYS A CB  1 
ATOM   583  C CG  . LYS A 1 77  ? 8.141  97.804  5.422   1.00 24.64 ? 220 LYS A CG  1 
ATOM   584  C CD  . LYS A 1 77  ? 7.872  96.527  6.186   1.00 26.32 ? 220 LYS A CD  1 
ATOM   585  C CE  . LYS A 1 77  ? 6.415  96.111  6.120   1.00 29.47 ? 220 LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 77  ? 6.195  94.803  6.808   1.00 30.57 ? 220 LYS A NZ  1 
ATOM   587  N N   . GLU A 1 78  ? 8.454  102.297 7.073   1.00 25.84 ? 221 GLU A N   1 
ATOM   588  C CA  . GLU A 1 78  ? 7.957  103.587 7.548   1.00 26.39 ? 221 GLU A CA  1 
ATOM   589  C C   . GLU A 1 78  ? 8.009  104.590 6.387   1.00 26.04 ? 221 GLU A C   1 
ATOM   590  O O   . GLU A 1 78  ? 8.634  104.322 5.360   1.00 26.57 ? 221 GLU A O   1 
ATOM   591  C CB  . GLU A 1 78  ? 8.827  104.097 8.700   1.00 27.06 ? 221 GLU A CB  1 
ATOM   592  C CG  . GLU A 1 78  ? 8.522  103.485 10.054  1.00 28.74 ? 221 GLU A CG  1 
ATOM   593  C CD  . GLU A 1 78  ? 9.469  103.979 11.143  1.00 30.43 ? 221 GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 78  ? 9.793  105.187 11.170  1.00 27.31 ? 221 GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 78  ? 9.879  103.153 11.979  1.00 33.47 ? 221 GLU A OE2 1 
ATOM   596  N N   . ASP A 1 79  ? 7.355  105.739 6.540   1.00 25.36 ? 222 ASP A N   1 
ATOM   597  C CA  . ASP A 1 79  ? 7.372  106.739 5.479   1.00 25.38 ? 222 ASP A CA  1 
ATOM   598  C C   . ASP A 1 79  ? 8.416  107.786 5.792   1.00 24.12 ? 222 ASP A C   1 
ATOM   599  O O   . ASP A 1 79  ? 8.368  108.415 6.845   1.00 24.34 ? 222 ASP A O   1 
ATOM   600  C CB  . ASP A 1 79  ? 6.013  107.420 5.329   1.00 26.87 ? 222 ASP A CB  1 
ATOM   601  C CG  . ASP A 1 79  ? 6.047  108.561 4.317   1.00 30.04 ? 222 ASP A CG  1 
ATOM   602  O OD1 . ASP A 1 79  ? 6.407  108.306 3.146   1.00 31.51 ? 222 ASP A OD1 1 
ATOM   603  O OD2 . ASP A 1 79  ? 5.722  109.712 4.690   1.00 30.93 ? 222 ASP A OD2 1 
ATOM   604  N N   . HIS A 1 80  ? 9.354  107.979 4.874   1.00 23.28 ? 224 HIS A N   1 
ATOM   605  C CA  . HIS A 1 80  ? 10.416 108.951 5.087   1.00 22.70 ? 224 HIS A CA  1 
ATOM   606  C C   . HIS A 1 80  ? 10.265 110.169 4.186   1.00 22.52 ? 224 HIS A C   1 
ATOM   607  O O   . HIS A 1 80  ? 11.231 110.879 3.931   1.00 23.43 ? 224 HIS A O   1 
ATOM   608  C CB  . HIS A 1 80  ? 11.764 108.286 4.839   1.00 21.09 ? 224 HIS A CB  1 
ATOM   609  C CG  . HIS A 1 80  ? 11.972 107.040 5.640   1.00 21.47 ? 224 HIS A CG  1 
ATOM   610  N ND1 . HIS A 1 80  ? 12.657 107.027 6.835   1.00 21.13 ? 224 HIS A ND1 1 
ATOM   611  C CD2 . HIS A 1 80  ? 11.567 105.765 5.421   1.00 21.33 ? 224 HIS A CD2 1 
ATOM   612  C CE1 . HIS A 1 80  ? 12.669 105.795 7.318   1.00 21.68 ? 224 HIS A CE1 1 
ATOM   613  N NE2 . HIS A 1 80  ? 12.015 105.012 6.479   1.00 20.50 ? 224 HIS A NE2 1 
ATOM   614  N N   . SER A 1 81  ? 9.046  110.410 3.715   1.00 23.20 ? 225 SER A N   1 
ATOM   615  C CA  . SER A 1 81  ? 8.757  111.539 2.834   1.00 22.19 ? 225 SER A CA  1 
ATOM   616  C C   . SER A 1 81  ? 9.147  112.899 3.396   1.00 22.00 ? 225 SER A C   1 
ATOM   617  O O   . SER A 1 81  ? 9.639  113.747 2.658   1.00 22.28 ? 225 SER A O   1 
ATOM   618  C CB  . SER A 1 81  ? 7.273  111.556 2.469   1.00 21.47 ? 225 SER A CB  1 
ATOM   619  O OG  . SER A 1 81  ? 6.963  110.498 1.585   1.00 21.02 ? 225 SER A OG  1 
ATOM   620  N N   . LYS A 1 82  ? 8.920  113.116 4.689   1.00 22.41 ? 226 LYS A N   1 
ATOM   621  C CA  . LYS A 1 82  ? 9.268  114.392 5.311   1.00 23.74 ? 226 LYS A CA  1 
ATOM   622  C C   . LYS A 1 82  ? 10.650 114.361 5.958   1.00 22.95 ? 226 LYS A C   1 
ATOM   623  O O   . LYS A 1 82  ? 11.057 115.303 6.642   1.00 23.36 ? 226 LYS A O   1 
ATOM   624  C CB  . LYS A 1 82  ? 8.224  114.786 6.358   1.00 26.99 ? 226 LYS A CB  1 
ATOM   625  C CG  . LYS A 1 82  ? 6.854  115.135 5.792   1.00 31.89 ? 226 LYS A CG  1 
ATOM   626  C CD  . LYS A 1 82  ? 6.182  113.919 5.162   1.00 37.17 ? 226 LYS A CD  1 
ATOM   627  C CE  . LYS A 1 82  ? 4.753  114.235 4.726   1.00 40.90 ? 226 LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 82  ? 4.055  113.023 4.202   1.00 42.71 ? 226 LYS A NZ  1 
ATOM   629  N N   . ARG A 1 83  ? 11.373 113.274 5.739   1.00 21.86 ? 227 ARG A N   1 
ATOM   630  C CA  . ARG A 1 83  ? 12.705 113.139 6.298   1.00 21.44 ? 227 ARG A CA  1 
ATOM   631  C C   . ARG A 1 83  ? 13.763 113.336 5.214   1.00 19.39 ? 227 ARG A C   1 
ATOM   632  O O   . ARG A 1 83  ? 13.640 112.818 4.102   1.00 18.18 ? 227 ARG A O   1 
ATOM   633  C CB  . ARG A 1 83  ? 12.835 111.771 6.963   1.00 22.01 ? 227 ARG A CB  1 
ATOM   634  C CG  . ARG A 1 83  ? 11.868 111.593 8.132   1.00 23.42 ? 227 ARG A CG  1 
ATOM   635  C CD  . ARG A 1 83  ? 11.804 110.144 8.596   1.00 25.52 ? 227 ARG A CD  1 
ATOM   636  N NE  . ARG A 1 83  ? 10.957 109.973 9.773   1.00 26.66 ? 227 ARG A NE  1 
ATOM   637  C CZ  . ARG A 1 83  ? 10.576 108.792 10.255  1.00 27.78 ? 227 ARG A CZ  1 
ATOM   638  N NH1 . ARG A 1 83  ? 10.965 107.672 9.657   1.00 27.27 ? 227 ARG A NH1 1 
ATOM   639  N NH2 . ARG A 1 83  ? 9.814  108.729 11.342  1.00 26.68 ? 227 ARG A NH2 1 
ATOM   640  N N   . SER A 1 84  ? 14.790 114.110 5.548   1.00 17.44 ? 228 SER A N   1 
ATOM   641  C CA  . SER A 1 84  ? 15.887 114.409 4.628   1.00 17.69 ? 228 SER A CA  1 
ATOM   642  C C   . SER A 1 84  ? 16.827 113.218 4.345   1.00 17.20 ? 228 SER A C   1 
ATOM   643  O O   . SER A 1 84  ? 17.196 112.957 3.192   1.00 16.42 ? 228 SER A O   1 
ATOM   644  C CB  . SER A 1 84  ? 16.734 115.573 5.175   1.00 16.94 ? 228 SER A CB  1 
ATOM   645  O OG  . SER A 1 84  ? 16.015 116.796 5.209   1.00 18.75 ? 228 SER A OG  1 
ATOM   646  N N   . SER A 1 85  ? 17.208 112.501 5.399   1.00 14.91 ? 229 SER A N   1 
ATOM   647  C CA  . SER A 1 85  ? 18.131 111.387 5.253   1.00 13.62 ? 229 SER A CA  1 
ATOM   648  C C   . SER A 1 85  ? 17.842 110.261 6.233   1.00 13.29 ? 229 SER A C   1 
ATOM   649  O O   . SER A 1 85  ? 16.867 110.321 6.980   1.00 14.02 ? 229 SER A O   1 
ATOM   650  C CB  . SER A 1 85  ? 19.557 111.896 5.475   1.00 13.30 ? 229 SER A CB  1 
ATOM   651  O OG  . SER A 1 85  ? 19.724 112.361 6.803   1.00 9.36  ? 229 SER A OG  1 
ATOM   652  N N   . PHE A 1 86  ? 18.706 109.243 6.222   1.00 11.11 ? 230 PHE A N   1 
ATOM   653  C CA  . PHE A 1 86  ? 18.598 108.087 7.112   1.00 9.96  ? 230 PHE A CA  1 
ATOM   654  C C   . PHE A 1 86  ? 19.973 107.671 7.625   1.00 9.57  ? 230 PHE A C   1 
ATOM   655  O O   . PHE A 1 86  ? 20.910 107.521 6.848   1.00 10.04 ? 230 PHE A O   1 
ATOM   656  C CB  . PHE A 1 86  ? 17.974 106.898 6.388   1.00 10.00 ? 230 PHE A CB  1 
ATOM   657  C CG  . PHE A 1 86  ? 17.957 105.640 7.207   1.00 12.84 ? 230 PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 86  ? 17.065 105.490 8.261   1.00 13.55 ? 230 PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 86  ? 18.856 104.609 6.942   1.00 13.10 ? 230 PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 86  ? 17.068 104.329 9.035   1.00 14.27 ? 230 PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 86  ? 18.865 103.449 7.710   1.00 11.51 ? 230 PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 86  ? 17.974 103.310 8.756   1.00 12.99 ? 230 PHE A CZ  1 
ATOM   663  N N   . VAL A 1 87  ? 20.102 107.488 8.933   1.00 8.10  ? 231 VAL A N   1 
ATOM   664  C CA  . VAL A 1 87  ? 21.379 107.073 9.500   1.00 6.54  ? 231 VAL A CA  1 
ATOM   665  C C   . VAL A 1 87  ? 21.219 105.823 10.342  1.00 8.23  ? 231 VAL A C   1 
ATOM   666  O O   . VAL A 1 87  ? 20.346 105.750 11.202  1.00 8.88  ? 231 VAL A O   1 
ATOM   667  C CB  . VAL A 1 87  ? 22.009 108.154 10.409  1.00 6.55  ? 231 VAL A CB  1 
ATOM   668  C CG1 . VAL A 1 87  ? 23.294 107.620 11.023  1.00 2.33  ? 231 VAL A CG1 1 
ATOM   669  C CG2 . VAL A 1 87  ? 22.285 109.417 9.621   1.00 5.44  ? 231 VAL A CG2 1 
ATOM   670  N N   . CYS A 1 88  ? 22.066 104.837 10.086  1.00 8.09  ? 232 CYS A N   1 
ATOM   671  C CA  . CYS A 1 88  ? 22.041 103.605 10.845  1.00 9.20  ? 232 CYS A CA  1 
ATOM   672  C C   . CYS A 1 88  ? 23.438 103.370 11.400  1.00 10.54 ? 232 CYS A C   1 
ATOM   673  O O   . CYS A 1 88  ? 24.407 103.353 10.657  1.00 12.05 ? 232 CYS A O   1 
ATOM   674  C CB  . CYS A 1 88  ? 21.625 102.429 9.961   1.00 9.75  ? 232 CYS A CB  1 
ATOM   675  S SG  . CYS A 1 88  ? 21.682 100.855 10.837  1.00 11.43 ? 232 CYS A SG  1 
ATOM   676  N N   . VAL A 1 89  ? 23.533 103.198 12.713  1.00 12.28 ? 233 VAL A N   1 
ATOM   677  C CA  . VAL A 1 89  ? 24.814 102.974 13.376  1.00 12.41 ? 233 VAL A CA  1 
ATOM   678  C C   . VAL A 1 89  ? 24.856 101.586 13.993  1.00 13.34 ? 233 VAL A C   1 
ATOM   679  O O   . VAL A 1 89  ? 24.014 101.229 14.815  1.00 13.99 ? 233 VAL A O   1 
ATOM   680  C CB  . VAL A 1 89  ? 25.065 104.017 14.489  1.00 12.34 ? 233 VAL A CB  1 
ATOM   681  C CG1 . VAL A 1 89  ? 26.399 103.746 15.167  1.00 13.72 ? 233 VAL A CG1 1 
ATOM   682  C CG2 . VAL A 1 89  ? 25.061 105.407 13.906  1.00 11.73 ? 233 VAL A CG2 1 
ATOM   683  N N   . LEU A 1 90  ? 25.855 100.811 13.595  1.00 13.50 ? 234 LEU A N   1 
ATOM   684  C CA  . LEU A 1 90  ? 26.012 99.455  14.092  1.00 13.70 ? 234 LEU A CA  1 
ATOM   685  C C   . LEU A 1 90  ? 27.259 99.320  14.956  1.00 13.81 ? 234 LEU A C   1 
ATOM   686  O O   . LEU A 1 90  ? 28.378 99.502  14.476  1.00 15.25 ? 234 LEU A O   1 
ATOM   687  C CB  . LEU A 1 90  ? 26.075 98.489  12.910  1.00 14.26 ? 234 LEU A CB  1 
ATOM   688  C CG  . LEU A 1 90  ? 24.829 98.586  12.028  1.00 15.56 ? 234 LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 90  ? 25.042 97.881  10.701  1.00 15.77 ? 234 LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 90  ? 23.655 97.994  12.780  1.00 14.64 ? 234 LEU A CD2 1 
ATOM   691  N N   . LEU A 1 91  ? 27.048 99.012  16.233  1.00 12.64 ? 235 LEU A N   1 
ATOM   692  C CA  . LEU A 1 91  ? 28.131 98.834  17.190  1.00 13.13 ? 235 LEU A CA  1 
ATOM   693  C C   . LEU A 1 91  ? 28.104 97.377  17.641  1.00 12.74 ? 235 LEU A C   1 
ATOM   694  O O   . LEU A 1 91  ? 27.197 96.976  18.365  1.00 11.66 ? 235 LEU A O   1 
ATOM   695  C CB  . LEU A 1 91  ? 27.917 99.739  18.399  1.00 12.78 ? 235 LEU A CB  1 
ATOM   696  C CG  . LEU A 1 91  ? 27.631 101.215 18.139  1.00 14.67 ? 235 LEU A CG  1 
ATOM   697  C CD1 . LEU A 1 91  ? 27.359 101.910 19.465  1.00 14.44 ? 235 LEU A CD1 1 
ATOM   698  C CD2 . LEU A 1 91  ? 28.808 101.859 17.421  1.00 12.88 ? 235 LEU A CD2 1 
ATOM   699  N N   . SER A 1 92  ? 29.096 96.588  17.229  1.00 13.06 ? 236 SER A N   1 
ATOM   700  C CA  . SER A 1 92  ? 29.123 95.172  17.590  1.00 13.47 ? 236 SER A CA  1 
ATOM   701  C C   . SER A 1 92  ? 30.342 94.419  17.041  1.00 13.17 ? 236 SER A C   1 
ATOM   702  O O   . SER A 1 92  ? 31.277 95.016  16.532  1.00 14.54 ? 236 SER A O   1 
ATOM   703  C CB  . SER A 1 92  ? 27.833 94.513  17.076  1.00 12.52 ? 236 SER A CB  1 
ATOM   704  O OG  . SER A 1 92  ? 27.767 93.141  17.410  1.00 13.71 ? 236 SER A OG  1 
ATOM   705  N N   . HIS A 1 93  ? 30.333 93.097  17.175  1.00 13.73 ? 237 HIS A N   1 
ATOM   706  C CA  . HIS A 1 93  ? 31.409 92.273  16.639  1.00 13.31 ? 237 HIS A CA  1 
ATOM   707  C C   . HIS A 1 93  ? 31.087 92.016  15.170  1.00 13.41 ? 237 HIS A C   1 
ATOM   708  O O   . HIS A 1 93  ? 29.945 92.173  14.737  1.00 13.90 ? 237 HIS A O   1 
ATOM   709  C CB  . HIS A 1 93  ? 31.481 90.930  17.362  1.00 12.64 ? 237 HIS A CB  1 
ATOM   710  C CG  . HIS A 1 93  ? 32.050 91.010  18.742  1.00 12.58 ? 237 HIS A CG  1 
ATOM   711  N ND1 . HIS A 1 93  ? 33.363 91.344  18.985  1.00 12.74 ? 237 HIS A ND1 1 
ATOM   712  C CD2 . HIS A 1 93  ? 31.487 90.778  19.950  1.00 11.26 ? 237 HIS A CD2 1 
ATOM   713  C CE1 . HIS A 1 93  ? 33.586 91.312  20.288  1.00 13.03 ? 237 HIS A CE1 1 
ATOM   714  N NE2 . HIS A 1 93  ? 32.465 90.971  20.894  1.00 11.45 ? 237 HIS A NE2 1 
ATOM   715  N N   . GLY A 1 94  ? 32.088 91.617  14.399  1.00 14.38 ? 238 GLY A N   1 
ATOM   716  C CA  . GLY A 1 94  ? 31.833 91.336  13.001  1.00 14.94 ? 238 GLY A CA  1 
ATOM   717  C C   . GLY A 1 94  ? 33.021 90.793  12.239  1.00 16.03 ? 238 GLY A C   1 
ATOM   718  O O   . GLY A 1 94  ? 34.083 90.515  12.805  1.00 14.39 ? 238 GLY A O   1 
ATOM   719  N N   . GLU A 1 95  ? 32.811 90.618  10.940  1.00 16.91 ? 239 GLU A N   1 
ATOM   720  C CA  . GLU A 1 95  ? 33.840 90.152  10.030  1.00 18.23 ? 239 GLU A CA  1 
ATOM   721  C C   . GLU A 1 95  ? 33.490 90.815  8.713   1.00 18.45 ? 239 GLU A C   1 
ATOM   722  O O   . GLU A 1 95  ? 32.488 91.514  8.621   1.00 19.65 ? 239 GLU A O   1 
ATOM   723  C CB  . GLU A 1 95  ? 33.798 88.641  9.869   1.00 18.35 ? 239 GLU A CB  1 
ATOM   724  C CG  . GLU A 1 95  ? 33.634 87.906  11.168  1.00 22.68 ? 239 GLU A CG  1 
ATOM   725  C CD  . GLU A 1 95  ? 34.131 86.490  11.088  1.00 23.79 ? 239 GLU A CD  1 
ATOM   726  O OE1 . GLU A 1 95  ? 35.361 86.299  11.180  1.00 25.02 ? 239 GLU A OE1 1 
ATOM   727  O OE2 . GLU A 1 95  ? 33.294 85.581  10.920  1.00 25.59 ? 239 GLU A OE2 1 
ATOM   728  N N   . GLU A 1 96  ? 34.303 90.595  7.694   1.00 18.83 ? 240 GLU A N   1 
ATOM   729  C CA  . GLU A 1 96  ? 34.046 91.205  6.407   1.00 18.61 ? 240 GLU A CA  1 
ATOM   730  C C   . GLU A 1 96  ? 32.604 90.954  5.968   1.00 18.58 ? 240 GLU A C   1 
ATOM   731  O O   . GLU A 1 96  ? 32.195 89.808  5.778   1.00 19.38 ? 240 GLU A O   1 
ATOM   732  C CB  . GLU A 1 96  ? 35.037 90.670  5.372   1.00 18.13 ? 240 GLU A CB  1 
ATOM   733  C CG  . GLU A 1 96  ? 35.100 91.472  4.069   1.00 20.29 ? 240 GLU A CG  1 
ATOM   734  C CD  . GLU A 1 96  ? 35.389 92.949  4.288   1.00 20.47 ? 240 GLU A CD  1 
ATOM   735  O OE1 . GLU A 1 96  ? 36.315 93.265  5.063   1.00 20.94 ? 240 GLU A OE1 1 
ATOM   736  O OE2 . GLU A 1 96  ? 34.698 93.796  3.677   1.00 22.02 ? 240 GLU A OE2 1 
ATOM   737  N N   . GLY A 1 97  ? 31.838 92.039  5.835   1.00 18.64 ? 241 GLY A N   1 
ATOM   738  C CA  . GLY A 1 97  ? 30.448 91.954  5.411   1.00 19.22 ? 241 GLY A CA  1 
ATOM   739  C C   . GLY A 1 97  ? 29.489 91.298  6.391   1.00 19.15 ? 241 GLY A C   1 
ATOM   740  O O   . GLY A 1 97  ? 28.366 90.955  6.027   1.00 18.33 ? 241 GLY A O   1 
ATOM   741  N N   . ILE A 1 98  ? 29.920 91.143  7.638   1.00 19.34 ? 242 ILE A N   1 
ATOM   742  C CA  . ILE A 1 98  ? 29.102 90.500  8.661   1.00 19.03 ? 242 ILE A CA  1 
ATOM   743  C C   . ILE A 1 98  ? 29.083 91.288  9.965   1.00 18.79 ? 242 ILE A C   1 
ATOM   744  O O   . ILE A 1 98  ? 30.111 91.812  10.383  1.00 20.80 ? 242 ILE A O   1 
ATOM   745  C CB  . ILE A 1 98  ? 29.658 89.084  8.996   1.00 19.09 ? 242 ILE A CB  1 
ATOM   746  C CG1 . ILE A 1 98  ? 29.655 88.203  7.750   1.00 18.82 ? 242 ILE A CG1 1 
ATOM   747  C CG2 . ILE A 1 98  ? 28.829 88.431  10.078  1.00 18.35 ? 242 ILE A CG2 1 
ATOM   748  C CD1 . ILE A 1 98  ? 30.305 86.860  7.969   1.00 20.52 ? 242 ILE A CD1 1 
ATOM   749  N N   . ILE A 1 99  ? 27.918 91.393  10.598  1.00 17.11 ? 243 ILE A N   1 
ATOM   750  C CA  . ILE A 1 99  ? 27.845 92.049  11.895  1.00 17.69 ? 243 ILE A CA  1 
ATOM   751  C C   . ILE A 1 99  ? 27.102 91.072  12.798  1.00 17.34 ? 243 ILE A C   1 
ATOM   752  O O   . ILE A 1 99  ? 26.156 90.407  12.364  1.00 16.38 ? 243 ILE A O   1 
ATOM   753  C CB  . ILE A 1 99  ? 27.134 93.440  11.854  1.00 17.68 ? 243 ILE A CB  1 
ATOM   754  C CG1 . ILE A 1 99  ? 25.635 93.283  11.660  1.00 18.55 ? 243 ILE A CG1 1 
ATOM   755  C CG2 . ILE A 1 99  ? 27.739 94.297  10.763  1.00 20.42 ? 243 ILE A CG2 1 
ATOM   756  C CD1 . ILE A 1 99  ? 24.874 93.164  12.963  1.00 19.07 ? 243 ILE A CD1 1 
ATOM   757  N N   . PHE A 1 100 ? 27.556 90.964  14.045  1.00 18.13 ? 244 PHE A N   1 
ATOM   758  C CA  . PHE A 1 100 ? 26.962 90.032  14.998  1.00 16.87 ? 244 PHE A CA  1 
ATOM   759  C C   . PHE A 1 100 ? 25.770 90.483  15.814  1.00 16.39 ? 244 PHE A C   1 
ATOM   760  O O   . PHE A 1 100 ? 25.783 91.548  16.432  1.00 16.62 ? 244 PHE A O   1 
ATOM   761  C CB  . PHE A 1 100 ? 28.021 89.514  15.979  1.00 15.02 ? 244 PHE A CB  1 
ATOM   762  C CG  . PHE A 1 100 ? 28.840 88.388  15.441  1.00 15.28 ? 244 PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 100 ? 29.995 88.639  14.726  1.00 13.03 ? 244 PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 100 ? 28.426 87.067  15.611  1.00 16.48 ? 244 PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 100 ? 30.728 87.597  14.182  1.00 14.89 ? 244 PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 100 ? 29.155 86.016  15.067  1.00 15.18 ? 244 PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 100 ? 30.307 86.282  14.351  1.00 13.73 ? 244 PHE A CZ  1 
ATOM   768  N N   . GLY A 1 101 ? 24.737 89.645  15.797  1.00 15.24 ? 245 GLY A N   1 
ATOM   769  C CA  . GLY A 1 101 ? 23.558 89.884  16.599  1.00 13.46 ? 245 GLY A CA  1 
ATOM   770  C C   . GLY A 1 101 ? 23.992 89.214  17.888  1.00 13.65 ? 245 GLY A C   1 
ATOM   771  O O   . GLY A 1 101 ? 25.011 88.530  17.900  1.00 15.27 ? 245 GLY A O   1 
ATOM   772  N N   . THR A 1 102 ? 23.264 89.386  18.976  1.00 13.02 ? 246 THR A N   1 
ATOM   773  C CA  . THR A 1 102 ? 23.690 88.768  20.216  1.00 12.95 ? 246 THR A CA  1 
ATOM   774  C C   . THR A 1 102 ? 23.749 87.247  20.130  1.00 14.84 ? 246 THR A C   1 
ATOM   775  O O   . THR A 1 102 ? 24.513 86.607  20.852  1.00 14.65 ? 246 THR A O   1 
ATOM   776  C CB  . THR A 1 102 ? 22.754 89.155  21.370  1.00 13.70 ? 246 THR A CB  1 
ATOM   777  O OG1 . THR A 1 102 ? 21.421 88.704  21.083  1.00 15.44 ? 246 THR A OG1 1 
ATOM   778  C CG2 . THR A 1 102 ? 22.750 90.675  21.559  1.00 13.37 ? 246 THR A CG2 1 
ATOM   779  N N   . ASN A 1 103 ? 22.962 86.670  19.229  1.00 15.30 ? 247 ASN A N   1 
ATOM   780  C CA  . ASN A 1 103 ? 22.892 85.222  19.095  1.00 17.40 ? 247 ASN A CA  1 
ATOM   781  C C   . ASN A 1 103 ? 23.506 84.658  17.814  1.00 19.31 ? 247 ASN A C   1 
ATOM   782  O O   . ASN A 1 103 ? 23.458 83.449  17.578  1.00 19.44 ? 247 ASN A O   1 
ATOM   783  C CB  . ASN A 1 103 ? 21.425 84.789  19.191  1.00 15.77 ? 247 ASN A CB  1 
ATOM   784  C CG  . ASN A 1 103 ? 20.599 85.291  18.030  1.00 15.65 ? 247 ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 103 ? 20.919 86.314  17.431  1.00 17.28 ? 247 ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 103 ? 19.529 84.582  17.709  1.00 14.89 ? 247 ASN A ND2 1 
ATOM   787  N N   . GLY A 1 104 ? 24.083 85.522  16.988  1.00 20.44 ? 254 GLY A N   1 
ATOM   788  C CA  . GLY A 1 104 ? 24.670 85.048  15.749  1.00 22.38 ? 254 GLY A CA  1 
ATOM   789  C C   . GLY A 1 104 ? 24.863 86.146  14.718  1.00 23.72 ? 254 GLY A C   1 
ATOM   790  O O   . GLY A 1 104 ? 24.338 87.248  14.873  1.00 22.50 ? 254 GLY A O   1 
ATOM   791  N N   . PRO A 1 105 ? 25.601 85.859  13.634  1.00 24.20 ? 255 PRO A N   1 
ATOM   792  C CA  . PRO A 1 105 ? 25.902 86.786  12.544  1.00 23.74 ? 255 PRO A CA  1 
ATOM   793  C C   . PRO A 1 105 ? 24.759 87.149  11.609  1.00 23.62 ? 255 PRO A C   1 
ATOM   794  O O   . PRO A 1 105 ? 23.830 86.375  11.395  1.00 23.58 ? 255 PRO A O   1 
ATOM   795  C CB  . PRO A 1 105 ? 27.015 86.069  11.803  1.00 23.73 ? 255 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 105 ? 26.584 84.661  11.904  1.00 23.65 ? 255 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 105 ? 26.219 84.549  13.368  1.00 24.68 ? 255 PRO A CD  1 
ATOM   798  N N   . VAL A 1 106 ? 24.860 88.344  11.047  1.00 23.60 ? 256 VAL A N   1 
ATOM   799  C CA  . VAL A 1 106 ? 23.892 88.853  10.097  1.00 25.28 ? 256 VAL A CA  1 
ATOM   800  C C   . VAL A 1 106 ? 24.775 89.427  9.007   1.00 26.01 ? 256 VAL A C   1 
ATOM   801  O O   . VAL A 1 106 ? 25.724 90.147  9.319   1.00 27.76 ? 256 VAL A O   1 
ATOM   802  C CB  . VAL A 1 106 ? 23.063 90.000  10.690  1.00 25.05 ? 256 VAL A CB  1 
ATOM   803  C CG1 . VAL A 1 106 ? 21.929 90.357  9.753   1.00 24.65 ? 256 VAL A CG1 1 
ATOM   804  C CG2 . VAL A 1 106 ? 22.524 89.605  12.039  1.00 25.58 ? 256 VAL A CG2 1 
ATOM   805  N N   . ASP A 1 107 ? 24.507 89.105  7.746   1.00 26.26 ? 257 ASP A N   1 
ATOM   806  C CA  . ASP A 1 107 ? 25.338 89.665  6.690   1.00 28.51 ? 257 ASP A CA  1 
ATOM   807  C C   . ASP A 1 107 ? 24.831 91.064  6.341   1.00 27.43 ? 257 ASP A C   1 
ATOM   808  O O   . ASP A 1 107 ? 23.636 91.280  6.143   1.00 28.57 ? 257 ASP A O   1 
ATOM   809  C CB  . ASP A 1 107 ? 25.365 88.751  5.455   1.00 33.10 ? 257 ASP A CB  1 
ATOM   810  C CG  . ASP A 1 107 ? 23.991 88.508  4.871   1.00 37.76 ? 257 ASP A CG  1 
ATOM   811  O OD1 . ASP A 1 107 ? 23.139 87.943  5.590   1.00 40.60 ? 257 ASP A OD1 1 
ATOM   812  O OD2 . ASP A 1 107 ? 23.771 88.882  3.695   1.00 39.38 ? 257 ASP A OD2 1 
ATOM   813  N N   . LEU A 1 108 ? 25.751 92.019  6.308   1.00 25.87 ? 258 LEU A N   1 
ATOM   814  C CA  . LEU A 1 108 ? 25.419 93.405  6.015   1.00 25.60 ? 258 LEU A CA  1 
ATOM   815  C C   . LEU A 1 108 ? 24.475 93.575  4.845   1.00 26.40 ? 258 LEU A C   1 
ATOM   816  O O   . LEU A 1 108 ? 23.409 94.168  4.981   1.00 26.98 ? 258 LEU A O   1 
ATOM   817  C CB  . LEU A 1 108 ? 26.692 94.211  5.751   1.00 24.74 ? 258 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 108 ? 27.443 94.739  6.977   1.00 23.82 ? 258 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 108 ? 28.675 95.514  6.531   1.00 22.89 ? 258 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 108 ? 26.521 95.643  7.781   1.00 25.07 ? 258 LEU A CD2 1 
ATOM   821  N N   . LYS A 1 109 ? 24.877 93.056  3.694   1.00 27.82 ? 259 LYS A N   1 
ATOM   822  C CA  . LYS A 1 109 ? 24.086 93.151  2.477   1.00 28.71 ? 259 LYS A CA  1 
ATOM   823  C C   . LYS A 1 109 ? 22.591 92.936  2.743   1.00 28.77 ? 259 LYS A C   1 
ATOM   824  O O   . LYS A 1 109 ? 21.744 93.644  2.196   1.00 28.54 ? 259 LYS A O   1 
ATOM   825  C CB  . LYS A 1 109 ? 24.604 92.127  1.461   1.00 30.55 ? 259 LYS A CB  1 
ATOM   826  C CG  . LYS A 1 109 ? 24.072 92.291  0.048   1.00 33.03 ? 259 LYS A CG  1 
ATOM   827  C CD  . LYS A 1 109 ? 24.601 91.177  -0.861  1.00 35.17 ? 259 LYS A CD  1 
ATOM   828  C CE  . LYS A 1 109 ? 23.973 91.235  -2.262  1.00 37.77 ? 259 LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 109 ? 24.492 90.177  -3.192  1.00 37.06 ? 259 LYS A NZ  1 
ATOM   830  N N   . LYS A 1 110 ? 22.275 91.980  3.609   1.00 28.86 ? 260 LYS A N   1 
ATOM   831  C CA  . LYS A 1 110 ? 20.887 91.657  3.927   1.00 29.51 ? 260 LYS A CA  1 
ATOM   832  C C   . LYS A 1 110 ? 20.083 92.828  4.460   1.00 29.21 ? 260 LYS A C   1 
ATOM   833  O O   . LYS A 1 110 ? 18.987 93.111  3.967   1.00 31.02 ? 260 LYS A O   1 
ATOM   834  C CB  . LYS A 1 110 ? 20.822 90.512  4.940   1.00 30.06 ? 260 LYS A CB  1 
ATOM   835  C CG  . LYS A 1 110 ? 19.408 90.101  5.301   1.00 31.69 ? 260 LYS A CG  1 
ATOM   836  C CD  . LYS A 1 110 ? 19.406 88.804  6.099   1.00 35.51 ? 260 LYS A CD  1 
ATOM   837  C CE  . LYS A 1 110 ? 17.985 88.288  6.332   1.00 37.51 ? 260 LYS A CE  1 
ATOM   838  N NZ  . LYS A 1 110 ? 17.967 86.894  6.889   1.00 37.99 ? 260 LYS A NZ  1 
ATOM   839  N N   . ILE A 1 111 ? 20.618 93.501  5.472   1.00 27.81 ? 261 ILE A N   1 
ATOM   840  C CA  . ILE A 1 111 ? 19.919 94.623  6.076   1.00 26.91 ? 261 ILE A CA  1 
ATOM   841  C C   . ILE A 1 111 ? 20.096 95.907  5.277   1.00 26.42 ? 261 ILE A C   1 
ATOM   842  O O   . ILE A 1 111 ? 19.329 96.856  5.424   1.00 27.48 ? 261 ILE A O   1 
ATOM   843  C CB  . ILE A 1 111 ? 20.375 94.830  7.533   1.00 27.59 ? 261 ILE A CB  1 
ATOM   844  C CG1 . ILE A 1 111 ? 21.882 95.064  7.591   1.00 26.23 ? 261 ILE A CG1 1 
ATOM   845  C CG2 . ILE A 1 111 ? 20.006 93.600  8.362   1.00 28.62 ? 261 ILE A CG2 1 
ATOM   846  C CD1 . ILE A 1 111 ? 22.459 94.931  8.989   1.00 25.55 ? 261 ILE A CD1 1 
ATOM   847  N N   . THR A 1 112 ? 21.103 95.928  4.417   1.00 25.20 ? 262 THR A N   1 
ATOM   848  C CA  . THR A 1 112 ? 21.348 97.089  3.586   1.00 23.79 ? 262 THR A CA  1 
ATOM   849  C C   . THR A 1 112 ? 20.293 97.140  2.485   1.00 23.29 ? 262 THR A C   1 
ATOM   850  O O   . THR A 1 112 ? 19.737 98.193  2.200   1.00 23.25 ? 262 THR A O   1 
ATOM   851  C CB  . THR A 1 112 ? 22.747 97.018  2.961   1.00 22.86 ? 262 THR A CB  1 
ATOM   852  O OG1 . THR A 1 112 ? 23.720 97.259  3.977   1.00 21.99 ? 262 THR A OG1 1 
ATOM   853  C CG2 . THR A 1 112 ? 22.901 98.042  1.852   1.00 24.34 ? 262 THR A CG2 1 
ATOM   854  N N   . ASN A 1 113 ? 20.006 95.987  1.888   1.00 23.90 ? 263 ASN A N   1 
ATOM   855  C CA  . ASN A 1 113 ? 19.027 95.895  0.809   1.00 25.13 ? 263 ASN A CA  1 
ATOM   856  C C   . ASN A 1 113 ? 17.646 96.450  1.152   1.00 25.01 ? 263 ASN A C   1 
ATOM   857  O O   . ASN A 1 113 ? 16.925 96.903  0.265   1.00 26.60 ? 263 ASN A O   1 
ATOM   858  C CB  . ASN A 1 113 ? 18.897 94.442  0.337   1.00 26.59 ? 263 ASN A CB  1 
ATOM   859  C CG  . ASN A 1 113 ? 20.174 93.922  -0.298  1.00 29.29 ? 263 ASN A CG  1 
ATOM   860  O OD1 . ASN A 1 113 ? 21.159 94.654  -0.433  1.00 30.45 ? 263 ASN A OD1 1 
ATOM   861  N ND2 . ASN A 1 113 ? 20.166 92.655  -0.691  1.00 29.79 ? 263 ASN A ND2 1 
ATOM   862  N N   . PHE A 1 114 ? 17.271 96.409  2.426   1.00 23.46 ? 264 PHE A N   1 
ATOM   863  C CA  . PHE A 1 114 ? 15.975 96.932  2.839   1.00 21.63 ? 264 PHE A CA  1 
ATOM   864  C C   . PHE A 1 114 ? 15.823 98.403  2.485   1.00 21.46 ? 264 PHE A C   1 
ATOM   865  O O   . PHE A 1 114 ? 14.706 98.909  2.397   1.00 21.44 ? 264 PHE A O   1 
ATOM   866  C CB  . PHE A 1 114 ? 15.794 96.801  4.345   1.00 22.33 ? 264 PHE A CB  1 
ATOM   867  C CG  . PHE A 1 114 ? 15.499 95.413  4.809   1.00 23.17 ? 264 PHE A CG  1 
ATOM   868  C CD1 . PHE A 1 114 ? 14.444 94.693  4.263   1.00 23.65 ? 264 PHE A CD1 1 
ATOM   869  C CD2 . PHE A 1 114 ? 16.238 94.843  5.838   1.00 23.26 ? 264 PHE A CD2 1 
ATOM   870  C CE1 . PHE A 1 114 ? 14.126 93.420  4.743   1.00 25.76 ? 264 PHE A CE1 1 
ATOM   871  C CE2 . PHE A 1 114 ? 15.930 93.575  6.325   1.00 23.74 ? 264 PHE A CE2 1 
ATOM   872  C CZ  . PHE A 1 114 ? 14.872 92.863  5.777   1.00 24.79 ? 264 PHE A CZ  1 
ATOM   873  N N   . PHE A 1 115 ? 16.943 99.090  2.285   1.00 20.30 ? 265 PHE A N   1 
ATOM   874  C CA  . PHE A 1 115 ? 16.905 100.516 1.988   1.00 20.32 ? 265 PHE A CA  1 
ATOM   875  C C   . PHE A 1 115 ? 17.332 100.899 0.576   1.00 20.95 ? 265 PHE A C   1 
ATOM   876  O O   . PHE A 1 115 ? 17.526 102.080 0.290   1.00 20.79 ? 265 PHE A O   1 
ATOM   877  C CB  . PHE A 1 115 ? 17.781 101.276 2.996   1.00 20.41 ? 265 PHE A CB  1 
ATOM   878  C CG  . PHE A 1 115 ? 17.407 101.043 4.435   1.00 18.18 ? 265 PHE A CG  1 
ATOM   879  C CD1 . PHE A 1 115 ? 16.449 101.837 5.058   1.00 17.87 ? 265 PHE A CD1 1 
ATOM   880  C CD2 . PHE A 1 115 ? 18.003 100.014 5.163   1.00 17.71 ? 265 PHE A CD2 1 
ATOM   881  C CE1 . PHE A 1 115 ? 16.086 101.616 6.392   1.00 16.54 ? 265 PHE A CE1 1 
ATOM   882  C CE2 . PHE A 1 115 ? 17.650 99.782  6.492   1.00 17.37 ? 265 PHE A CE2 1 
ATOM   883  C CZ  . PHE A 1 115 ? 16.683 100.589 7.109   1.00 17.36 ? 265 PHE A CZ  1 
ATOM   884  N N   . ARG A 1 116 ? 17.478 99.932  -0.318  1.00 22.89 ? 266 ARG A N   1 
ATOM   885  C CA  . ARG A 1 116 ? 17.903 100.290 -1.662  1.00 25.53 ? 266 ARG A CA  1 
ATOM   886  C C   . ARG A 1 116 ? 16.786 100.653 -2.641  1.00 27.11 ? 266 ARG A C   1 
ATOM   887  O O   . ARG A 1 116 ? 15.737 99.999  -2.692  1.00 28.71 ? 266 ARG A O   1 
ATOM   888  C CB  . ARG A 1 116 ? 18.809 99.202  -2.247  1.00 25.47 ? 266 ARG A CB  1 
ATOM   889  C CG  . ARG A 1 116 ? 18.203 97.839  -2.467  1.00 27.26 ? 266 ARG A CG  1 
ATOM   890  C CD  . ARG A 1 116 ? 19.333 96.916  -2.926  1.00 30.97 ? 266 ARG A CD  1 
ATOM   891  N NE  . ARG A 1 116 ? 18.883 95.662  -3.520  1.00 33.95 ? 266 ARG A NE  1 
ATOM   892  C CZ  . ARG A 1 116 ? 18.048 95.578  -4.553  1.00 35.40 ? 266 ARG A CZ  1 
ATOM   893  N NH1 . ARG A 1 116 ? 17.555 96.678  -5.112  1.00 35.60 ? 266 ARG A NH1 1 
ATOM   894  N NH2 . ARG A 1 116 ? 17.714 94.389  -5.040  1.00 36.07 ? 266 ARG A NH2 1 
ATOM   895  N N   . GLY A 1 117 ? 17.040 101.722 -3.399  1.00 27.41 ? 267 GLY A N   1 
ATOM   896  C CA  . GLY A 1 117 ? 16.118 102.247 -4.395  1.00 27.58 ? 267 GLY A CA  1 
ATOM   897  C C   . GLY A 1 117 ? 14.732 101.640 -4.487  1.00 28.86 ? 267 GLY A C   1 
ATOM   898  O O   . GLY A 1 117 ? 13.764 102.177 -3.937  1.00 28.62 ? 267 GLY A O   1 
ATOM   899  N N   . ASP A 1 118 ? 14.638 100.522 -5.199  1.00 29.70 ? 268 ASP A N   1 
ATOM   900  C CA  . ASP A 1 118 ? 13.372 99.826  -5.393  1.00 30.43 ? 268 ASP A CA  1 
ATOM   901  C C   . ASP A 1 118 ? 12.643 99.412  -4.118  1.00 28.73 ? 268 ASP A C   1 
ATOM   902  O O   . ASP A 1 118 ? 11.415 99.361  -4.113  1.00 28.28 ? 268 ASP A O   1 
ATOM   903  C CB  . ASP A 1 118 ? 13.586 98.597  -6.284  1.00 32.71 ? 268 ASP A CB  1 
ATOM   904  C CG  . ASP A 1 118 ? 14.865 97.842  -5.948  1.00 34.20 ? 268 ASP A CG  1 
ATOM   905  O OD1 . ASP A 1 118 ? 15.537 98.198  -4.955  1.00 36.28 ? 268 ASP A OD1 1 
ATOM   906  O OD2 . ASP A 1 118 ? 15.196 96.893  -6.681  1.00 34.36 ? 268 ASP A OD2 1 
ATOM   907  N N   . ARG A 1 119 ? 13.380 99.117  -3.048  1.00 27.67 ? 269 ARG A N   1 
ATOM   908  C CA  . ARG A 1 119 ? 12.749 98.713  -1.793  1.00 28.04 ? 269 ARG A CA  1 
ATOM   909  C C   . ARG A 1 119 ? 12.182 99.865  -0.962  1.00 25.80 ? 269 ARG A C   1 
ATOM   910  O O   . ARG A 1 119 ? 10.990 99.898  -0.679  1.00 27.53 ? 269 ARG A O   1 
ATOM   911  C CB  . ARG A 1 119 ? 13.719 97.916  -0.921  1.00 29.65 ? 269 ARG A CB  1 
ATOM   912  C CG  . ARG A 1 119 ? 13.860 96.458  -1.289  1.00 33.92 ? 269 ARG A CG  1 
ATOM   913  C CD  . ARG A 1 119 ? 14.898 96.278  -2.378  1.00 37.72 ? 269 ARG A CD  1 
ATOM   914  N NE  . ARG A 1 119 ? 15.340 94.892  -2.497  1.00 39.70 ? 269 ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 119 ? 14.740 93.969  -3.245  1.00 41.54 ? 269 ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 119 ? 13.655 94.275  -3.961  1.00 41.72 ? 269 ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 119 ? 15.230 92.733  -3.281  1.00 40.21 ? 269 ARG A NH2 1 
ATOM   918  N N   . CYS A 1 120 ? 13.028 100.801 -0.556  1.00 23.26 ? 270 CYS A N   1 
ATOM   919  C CA  . CYS A 1 120 ? 12.551 101.913 0.254   1.00 23.59 ? 270 CYS A CA  1 
ATOM   920  C C   . CYS A 1 120 ? 12.390 103.180 -0.588  1.00 24.10 ? 270 CYS A C   1 
ATOM   921  O O   . CYS A 1 120 ? 13.206 104.109 -0.518  1.00 23.69 ? 270 CYS A O   1 
ATOM   922  C CB  . CYS A 1 120 ? 13.518 102.163 1.402   1.00 22.31 ? 270 CYS A CB  1 
ATOM   923  S SG  . CYS A 1 120 ? 12.867 103.299 2.597   1.00 24.23 ? 270 CYS A SG  1 
ATOM   924  N N   . ARG A 1 121 ? 11.319 103.209 -1.373  1.00 23.88 ? 271 ARG A N   1 
ATOM   925  C CA  . ARG A 1 121 ? 11.042 104.321 -2.270  1.00 24.78 ? 271 ARG A CA  1 
ATOM   926  C C   . ARG A 1 121 ? 10.952 105.688 -1.573  1.00 23.27 ? 271 ARG A C   1 
ATOM   927  O O   . ARG A 1 121 ? 11.134 106.723 -2.211  1.00 22.92 ? 271 ARG A O   1 
ATOM   928  C CB  . ARG A 1 121 ? 9.754  104.021 -3.055  1.00 27.62 ? 271 ARG A CB  1 
ATOM   929  C CG  . ARG A 1 121 ? 9.542  104.868 -4.313  1.00 31.45 ? 271 ARG A CG  1 
ATOM   930  C CD  . ARG A 1 121 ? 10.512 104.510 -5.440  1.00 32.64 ? 271 ARG A CD  1 
ATOM   931  N NE  . ARG A 1 121 ? 10.269 105.321 -6.636  1.00 36.56 ? 271 ARG A NE  1 
ATOM   932  C CZ  . ARG A 1 121 ? 10.633 106.599 -6.782  1.00 38.64 ? 271 ARG A CZ  1 
ATOM   933  N NH1 . ARG A 1 121 ? 11.277 107.246 -5.810  1.00 35.87 ? 271 ARG A NH1 1 
ATOM   934  N NH2 . ARG A 1 121 ? 10.338 107.245 -7.908  1.00 39.32 ? 271 ARG A NH2 1 
ATOM   935  N N   . SER A 1 122 ? 10.688 105.698 -0.269  1.00 21.71 ? 272 SER A N   1 
ATOM   936  C CA  . SER A 1 122 ? 10.592 106.960 0.471   1.00 20.84 ? 272 SER A CA  1 
ATOM   937  C C   . SER A 1 122 ? 11.944 107.636 0.647   1.00 19.40 ? 272 SER A C   1 
ATOM   938  O O   . SER A 1 122 ? 12.019 108.844 0.861   1.00 18.65 ? 272 SER A O   1 
ATOM   939  C CB  . SER A 1 122 ? 9.985  106.732 1.852   1.00 21.11 ? 272 SER A CB  1 
ATOM   940  O OG  . SER A 1 122 ? 8.697  106.175 1.737   1.00 26.59 ? 272 SER A OG  1 
ATOM   941  N N   . LEU A 1 123 ? 13.009 106.846 0.573   1.00 17.49 ? 273 LEU A N   1 
ATOM   942  C CA  . LEU A 1 123 ? 14.355 107.371 0.728   1.00 15.57 ? 273 LEU A CA  1 
ATOM   943  C C   . LEU A 1 123 ? 15.076 107.546 -0.598  1.00 16.82 ? 273 LEU A C   1 
ATOM   944  O O   . LEU A 1 123 ? 16.157 108.132 -0.641  1.00 18.25 ? 273 LEU A O   1 
ATOM   945  C CB  . LEU A 1 123 ? 15.171 106.457 1.635   1.00 10.78 ? 273 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 123 ? 14.821 106.584 3.110   1.00 6.92  ? 273 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 123 ? 15.454 105.462 3.895   1.00 6.68  ? 273 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 123 ? 15.284 107.938 3.605   1.00 5.41  ? 273 LEU A CD2 1 
ATOM   949  N N   . THR A 1 124 ? 14.481 107.041 -1.676  1.00 17.12 ? 274 THR A N   1 
ATOM   950  C CA  . THR A 1 124 ? 15.082 107.154 -3.001  1.00 17.90 ? 274 THR A CA  1 
ATOM   951  C C   . THR A 1 124 ? 15.598 108.570 -3.256  1.00 17.28 ? 274 THR A C   1 
ATOM   952  O O   . THR A 1 124 ? 14.869 109.545 -3.098  1.00 16.53 ? 274 THR A O   1 
ATOM   953  C CB  . THR A 1 124 ? 14.074 106.803 -4.098  1.00 19.10 ? 274 THR A CB  1 
ATOM   954  O OG1 . THR A 1 124 ? 13.625 105.458 -3.913  1.00 21.47 ? 274 THR A OG1 1 
ATOM   955  C CG2 . THR A 1 124 ? 14.716 106.934 -5.470  1.00 21.02 ? 274 THR A CG2 1 
ATOM   956  N N   . GLY A 1 125 ? 16.865 108.669 -3.644  1.00 17.35 ? 275 GLY A N   1 
ATOM   957  C CA  . GLY A 1 125 ? 17.463 109.965 -3.916  1.00 17.30 ? 275 GLY A CA  1 
ATOM   958  C C   . GLY A 1 125 ? 17.995 110.677 -2.686  1.00 17.02 ? 275 GLY A C   1 
ATOM   959  O O   . GLY A 1 125 ? 18.651 111.711 -2.800  1.00 17.76 ? 275 GLY A O   1 
ATOM   960  N N   . LYS A 1 126 ? 17.699 110.134 -1.510  1.00 16.88 ? 276 LYS A N   1 
ATOM   961  C CA  . LYS A 1 126 ? 18.161 110.716 -0.256  1.00 15.89 ? 276 LYS A CA  1 
ATOM   962  C C   . LYS A 1 126 ? 19.348 109.907 0.263   1.00 16.23 ? 276 LYS A C   1 
ATOM   963  O O   . LYS A 1 126 ? 19.460 108.705 -0.005  1.00 17.87 ? 276 LYS A O   1 
ATOM   964  C CB  . LYS A 1 126 ? 17.032 110.720 0.774   1.00 14.10 ? 276 LYS A CB  1 
ATOM   965  C CG  . LYS A 1 126 ? 15.861 111.560 0.351   1.00 16.48 ? 276 LYS A CG  1 
ATOM   966  C CD  . LYS A 1 126 ? 14.754 111.533 1.382   1.00 15.43 ? 276 LYS A CD  1 
ATOM   967  C CE  . LYS A 1 126 ? 13.529 112.263 0.878   1.00 11.13 ? 276 LYS A CE  1 
ATOM   968  N NZ  . LYS A 1 126 ? 12.400 112.001 1.781   1.00 10.18 ? 276 LYS A NZ  1 
ATOM   969  N N   . PRO A 1 127 ? 20.249 110.555 1.015   1.00 13.29 ? 277 PRO A N   1 
ATOM   970  C CA  . PRO A 1 127 ? 21.425 109.878 1.557   1.00 11.62 ? 277 PRO A CA  1 
ATOM   971  C C   . PRO A 1 127 ? 21.158 108.877 2.673   1.00 10.53 ? 277 PRO A C   1 
ATOM   972  O O   . PRO A 1 127 ? 20.610 109.230 3.706   1.00 11.05 ? 277 PRO A O   1 
ATOM   973  C CB  . PRO A 1 127 ? 22.297 111.040 2.021   1.00 12.46 ? 277 PRO A CB  1 
ATOM   974  C CG  . PRO A 1 127 ? 21.289 112.040 2.463   1.00 14.48 ? 277 PRO A CG  1 
ATOM   975  C CD  . PRO A 1 127 ? 20.260 111.985 1.364   1.00 12.43 ? 277 PRO A CD  1 
ATOM   976  N N   . LYS A 1 128 ? 21.543 107.627 2.443   1.00 9.48  ? 278 LYS A N   1 
ATOM   977  C CA  . LYS A 1 128 ? 21.407 106.551 3.426   1.00 9.58  ? 278 LYS A CA  1 
ATOM   978  C C   . LYS A 1 128 ? 22.828 106.280 3.948   1.00 10.12 ? 278 LYS A C   1 
ATOM   979  O O   . LYS A 1 128 ? 23.696 105.780 3.225   1.00 7.47  ? 278 LYS A O   1 
ATOM   980  C CB  . LYS A 1 128 ? 20.812 105.308 2.758   1.00 11.63 ? 278 LYS A CB  1 
ATOM   981  C CG  . LYS A 1 128 ? 19.343 105.486 2.358   1.00 13.44 ? 278 LYS A CG  1 
ATOM   982  C CD  . LYS A 1 128 ? 18.938 104.552 1.226   1.00 14.32 ? 278 LYS A CD  1 
ATOM   983  C CE  . LYS A 1 128 ? 19.472 105.031 -0.125  1.00 14.23 ? 278 LYS A CE  1 
ATOM   984  N NZ  . LYS A 1 128 ? 18.802 106.270 -0.606  1.00 11.00 ? 278 LYS A NZ  1 
ATOM   985  N N   . LEU A 1 129 ? 23.057 106.628 5.206   1.00 11.03 ? 279 LEU A N   1 
ATOM   986  C CA  . LEU A 1 129 ? 24.375 106.493 5.805   1.00 12.83 ? 279 LEU A CA  1 
ATOM   987  C C   . LEU A 1 129 ? 24.481 105.368 6.825   1.00 14.18 ? 279 LEU A C   1 
ATOM   988  O O   . LEU A 1 129 ? 23.666 105.262 7.730   1.00 16.11 ? 279 LEU A O   1 
ATOM   989  C CB  . LEU A 1 129 ? 24.756 107.826 6.454   1.00 12.47 ? 279 LEU A CB  1 
ATOM   990  C CG  . LEU A 1 129 ? 24.348 109.100 5.686   1.00 13.02 ? 279 LEU A CG  1 
ATOM   991  C CD1 . LEU A 1 129 ? 24.529 110.317 6.587   1.00 10.54 ? 279 LEU A CD1 1 
ATOM   992  C CD2 . LEU A 1 129 ? 25.162 109.239 4.405   1.00 10.59 ? 279 LEU A CD2 1 
ATOM   993  N N   . PHE A 1 130 ? 25.498 104.528 6.670   1.00 13.98 ? 280 PHE A N   1 
ATOM   994  C CA  . PHE A 1 130 ? 25.721 103.413 7.582   1.00 12.41 ? 280 PHE A CA  1 
ATOM   995  C C   . PHE A 1 130 ? 27.066 103.536 8.262   1.00 12.09 ? 280 PHE A C   1 
ATOM   996  O O   . PHE A 1 130 ? 28.103 103.436 7.629   1.00 13.92 ? 280 PHE A O   1 
ATOM   997  C CB  . PHE A 1 130 ? 25.636 102.081 6.838   1.00 11.44 ? 280 PHE A CB  1 
ATOM   998  C CG  . PHE A 1 130 ? 24.266 101.769 6.340   1.00 11.56 ? 280 PHE A CG  1 
ATOM   999  C CD1 . PHE A 1 130 ? 23.790 102.338 5.166   1.00 12.21 ? 280 PHE A CD1 1 
ATOM   1000 C CD2 . PHE A 1 130 ? 23.419 100.950 7.080   1.00 11.92 ? 280 PHE A CD2 1 
ATOM   1001 C CE1 . PHE A 1 130 ? 22.486 102.101 4.736   1.00 10.92 ? 280 PHE A CE1 1 
ATOM   1002 C CE2 . PHE A 1 130 ? 22.116 100.706 6.663   1.00 10.89 ? 280 PHE A CE2 1 
ATOM   1003 C CZ  . PHE A 1 130 ? 21.649 101.284 5.487   1.00 11.86 ? 280 PHE A CZ  1 
ATOM   1004 N N   . ILE A 1 131 ? 27.037 103.768 9.562   1.00 11.99 ? 281 ILE A N   1 
ATOM   1005 C CA  . ILE A 1 131 ? 28.249 103.908 10.343  1.00 11.43 ? 281 ILE A CA  1 
ATOM   1006 C C   . ILE A 1 131 ? 28.425 102.596 11.099  1.00 12.17 ? 281 ILE A C   1 
ATOM   1007 O O   . ILE A 1 131 ? 27.555 102.193 11.873  1.00 11.60 ? 281 ILE A O   1 
ATOM   1008 C CB  . ILE A 1 131 ? 28.113 105.092 11.317  1.00 10.03 ? 281 ILE A CB  1 
ATOM   1009 C CG1 . ILE A 1 131 ? 27.778 106.355 10.523  1.00 9.12  ? 281 ILE A CG1 1 
ATOM   1010 C CG2 . ILE A 1 131 ? 29.396 105.282 12.099  1.00 11.21 ? 281 ILE A CG2 1 
ATOM   1011 C CD1 . ILE A 1 131 ? 27.344 107.526 11.365  1.00 10.03 ? 281 ILE A CD1 1 
ATOM   1012 N N   . ILE A 1 132 ? 29.551 101.931 10.861  1.00 12.11 ? 282 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 132 ? 29.814 100.648 11.491  1.00 11.11 ? 282 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 132 ? 31.097 100.544 12.317  1.00 12.69 ? 282 ILE A C   1 
ATOM   1015 O O   . ILE A 1 132 ? 32.207 100.752 11.819  1.00 11.06 ? 282 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 132 ? 29.853 99.513  10.441  1.00 10.68 ? 282 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 132 ? 28.544 99.478  9.659   1.00 10.95 ? 282 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 132 ? 30.098 98.175  11.118  1.00 8.11  ? 282 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 132 ? 28.654 100.085 8.294   1.00 12.33 ? 282 ILE A CD1 1 
ATOM   1020 N N   . GLN A 1 133 ? 30.911 100.210 13.589  1.00 12.84 ? 283 GLN A N   1 
ATOM   1021 C CA  . GLN A 1 133 ? 31.994 100.000 14.532  1.00 13.32 ? 283 GLN A CA  1 
ATOM   1022 C C   . GLN A 1 133 ? 31.940 98.494  14.767  1.00 15.59 ? 283 GLN A C   1 
ATOM   1023 O O   . GLN A 1 133 ? 31.094 97.996  15.516  1.00 16.00 ? 283 GLN A O   1 
ATOM   1024 C CB  . GLN A 1 133 ? 31.728 100.761 15.834  1.00 13.81 ? 283 GLN A CB  1 
ATOM   1025 C CG  . GLN A 1 133 ? 32.675 100.433 16.987  1.00 12.07 ? 283 GLN A CG  1 
ATOM   1026 C CD  . GLN A 1 133 ? 34.138 100.520 16.596  1.00 14.59 ? 283 GLN A CD  1 
ATOM   1027 O OE1 . GLN A 1 133 ? 34.523 101.339 15.759  1.00 14.06 ? 283 GLN A OE1 1 
ATOM   1028 N NE2 . GLN A 1 133 ? 34.966 99.683  17.212  1.00 12.25 ? 283 GLN A NE2 1 
ATOM   1029 N N   . ALA A 1 134 ? 32.824 97.776  14.082  1.00 14.93 ? 284 ALA A N   1 
ATOM   1030 C CA  . ALA A 1 134 ? 32.894 96.326  14.176  1.00 13.93 ? 284 ALA A CA  1 
ATOM   1031 C C   . ALA A 1 134 ? 34.110 95.833  13.402  1.00 13.71 ? 284 ALA A C   1 
ATOM   1032 O O   . ALA A 1 134 ? 34.596 96.504  12.488  1.00 13.26 ? 284 ALA A O   1 
ATOM   1033 C CB  . ALA A 1 134 ? 31.620 95.694  13.603  1.00 10.45 ? 284 ALA A CB  1 
ATOM   1034 N N   . CYS A 1 135 ? 34.590 94.653  13.775  1.00 13.04 ? 285 CYS A N   1 
ATOM   1035 C CA  . CYS A 1 135 ? 35.740 94.057  13.127  1.00 12.77 ? 285 CYS A CA  1 
ATOM   1036 C C   . CYS A 1 135 ? 35.387 93.646  11.711  1.00 12.26 ? 285 CYS A C   1 
ATOM   1037 O O   . CYS A 1 135 ? 34.228 93.381  11.411  1.00 11.35 ? 285 CYS A O   1 
ATOM   1038 C CB  . CYS A 1 135 ? 36.222 92.852  13.930  1.00 13.29 ? 285 CYS A CB  1 
ATOM   1039 S SG  . CYS A 1 135 ? 37.079 93.366  15.416  1.00 16.17 ? 285 CYS A SG  1 
ATOM   1040 N N   . ARG A 1 136 ? 36.391 93.618  10.838  1.00 12.29 ? 286 ARG A N   1 
ATOM   1041 C CA  . ARG A 1 136 ? 36.197 93.239  9.443   1.00 12.31 ? 286 ARG A CA  1 
ATOM   1042 C C   . ARG A 1 136 ? 37.166 92.123  9.094   1.00 11.80 ? 286 ARG A C   1 
ATOM   1043 O O   . ARG A 1 136 ? 37.455 91.876  7.933   1.00 10.81 ? 286 ARG A O   1 
ATOM   1044 C CB  . ARG A 1 136 ? 36.448 94.436  8.527   1.00 11.97 ? 286 ARG A CB  1 
ATOM   1045 C CG  . ARG A 1 136 ? 35.597 95.653  8.849   1.00 13.45 ? 286 ARG A CG  1 
ATOM   1046 C CD  . ARG A 1 136 ? 35.823 96.765  7.831   1.00 14.97 ? 286 ARG A CD  1 
ATOM   1047 N NE  . ARG A 1 136 ? 35.195 96.466  6.551   1.00 15.45 ? 286 ARG A NE  1 
ATOM   1048 C CZ  . ARG A 1 136 ? 35.395 97.166  5.441   1.00 16.00 ? 286 ARG A CZ  1 
ATOM   1049 N NH1 . ARG A 1 136 ? 36.213 98.207  5.453   1.00 16.16 ? 286 ARG A NH1 1 
ATOM   1050 N NH2 . ARG A 1 136 ? 34.768 96.832  4.320   1.00 16.67 ? 286 ARG A NH2 1 
ATOM   1051 N N   . GLY A 1 137 ? 37.657 91.447  10.121  1.00 13.15 ? 287 GLY A N   1 
ATOM   1052 C CA  . GLY A 1 137 ? 38.611 90.375  9.920   1.00 13.88 ? 287 GLY A CA  1 
ATOM   1053 C C   . GLY A 1 137 ? 39.555 90.331  11.097  1.00 13.94 ? 287 GLY A C   1 
ATOM   1054 O O   . GLY A 1 137 ? 39.257 90.894  12.147  1.00 13.17 ? 287 GLY A O   1 
ATOM   1055 N N   . THR A 1 138 ? 40.707 89.694  10.925  1.00 15.37 ? 288 THR A N   1 
ATOM   1056 C CA  . THR A 1 138 ? 41.655 89.573  12.024  1.00 15.61 ? 288 THR A CA  1 
ATOM   1057 C C   . THR A 1 138 ? 43.060 90.083  11.745  1.00 16.65 ? 288 THR A C   1 
ATOM   1058 O O   . THR A 1 138 ? 44.000 89.762  12.464  1.00 17.35 ? 288 THR A O   1 
ATOM   1059 C CB  . THR A 1 138 ? 41.746 88.107  12.503  1.00 16.25 ? 288 THR A CB  1 
ATOM   1060 O OG1 . THR A 1 138 ? 42.199 87.271  11.428  1.00 15.65 ? 288 THR A OG1 1 
ATOM   1061 C CG2 . THR A 1 138 ? 40.386 87.626  12.985  1.00 12.95 ? 288 THR A CG2 1 
ATOM   1062 N N   . GLU A 1 139 ? 43.224 90.878  10.704  1.00 19.26 ? 289 GLU A N   1 
ATOM   1063 C CA  . GLU A 1 139 ? 44.550 91.407  10.430  1.00 20.54 ? 289 GLU A CA  1 
ATOM   1064 C C   . GLU A 1 139 ? 44.852 92.557  11.389  1.00 18.87 ? 289 GLU A C   1 
ATOM   1065 O O   . GLU A 1 139 ? 43.948 93.270  11.829  1.00 18.34 ? 289 GLU A O   1 
ATOM   1066 C CB  . GLU A 1 139 ? 44.647 91.910  8.992   1.00 23.59 ? 289 GLU A CB  1 
ATOM   1067 C CG  . GLU A 1 139 ? 44.566 90.829  7.945   1.00 30.27 ? 289 GLU A CG  1 
ATOM   1068 C CD  . GLU A 1 139 ? 44.781 91.381  6.545   1.00 35.00 ? 289 GLU A CD  1 
ATOM   1069 O OE1 . GLU A 1 139 ? 45.873 91.933  6.283   1.00 36.81 ? 289 GLU A OE1 1 
ATOM   1070 O OE2 . GLU A 1 139 ? 43.858 91.267  5.712   1.00 37.02 ? 289 GLU A OE2 1 
ATOM   1071 N N   . LEU A 1 140 ? 46.128 92.722  11.710  1.00 17.47 ? 290 LEU A N   1 
ATOM   1072 C CA  . LEU A 1 140 ? 46.586 93.795  12.579  1.00 16.88 ? 290 LEU A CA  1 
ATOM   1073 C C   . LEU A 1 140 ? 47.522 94.683  11.772  1.00 16.66 ? 290 LEU A C   1 
ATOM   1074 O O   . LEU A 1 140 ? 48.319 94.195  10.976  1.00 15.86 ? 290 LEU A O   1 
ATOM   1075 C CB  . LEU A 1 140 ? 47.316 93.224  13.794  1.00 18.55 ? 290 LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 140 ? 46.414 92.735  14.936  1.00 19.42 ? 290 LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 140 ? 47.218 91.927  15.945  1.00 17.29 ? 290 LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 140 ? 45.762 93.944  15.599  1.00 18.28 ? 290 LEU A CD2 1 
ATOM   1079 N N   . ASP A 1 141 ? 47.400 95.990  11.971  1.00 17.63 ? 291 ASP A N   1 
ATOM   1080 C CA  . ASP A 1 141 ? 48.211 96.981  11.272  1.00 17.71 ? 291 ASP A CA  1 
ATOM   1081 C C   . ASP A 1 141 ? 49.352 97.379  12.212  1.00 19.91 ? 291 ASP A C   1 
ATOM   1082 O O   . ASP A 1 141 ? 49.118 97.969  13.269  1.00 19.10 ? 291 ASP A O   1 
ATOM   1083 C CB  . ASP A 1 141 ? 47.336 98.196  10.941  1.00 17.57 ? 291 ASP A CB  1 
ATOM   1084 C CG  . ASP A 1 141 ? 47.947 99.099  9.894   1.00 17.40 ? 291 ASP A CG  1 
ATOM   1085 O OD1 . ASP A 1 141 ? 49.052 99.635  10.129  1.00 19.66 ? 291 ASP A OD1 1 
ATOM   1086 O OD2 . ASP A 1 141 ? 47.319 99.280  8.832   1.00 15.29 ? 291 ASP A OD2 1 
ATOM   1087 N N   . CYS A 1 142 ? 50.584 97.054  11.824  1.00 21.76 ? 292 CYS A N   1 
ATOM   1088 C CA  . CYS A 1 142 ? 51.760 97.350  12.645  1.00 24.80 ? 292 CYS A CA  1 
ATOM   1089 C C   . CYS A 1 142 ? 52.293 98.771  12.534  1.00 24.58 ? 292 CYS A C   1 
ATOM   1090 O O   . CYS A 1 142 ? 53.199 99.150  13.274  1.00 24.77 ? 292 CYS A O   1 
ATOM   1091 C CB  . CYS A 1 142 ? 52.890 96.365  12.323  1.00 26.63 ? 292 CYS A CB  1 
ATOM   1092 S SG  . CYS A 1 142 ? 52.501 94.646  12.747  1.00 37.46 ? 292 CYS A SG  1 
ATOM   1093 N N   . GLY A 1 143 ? 51.743 99.549  11.610  1.00 24.97 ? 293 GLY A N   1 
ATOM   1094 C CA  . GLY A 1 143 ? 52.190 100.920 11.440  1.00 26.42 ? 293 GLY A CA  1 
ATOM   1095 C C   . GLY A 1 143 ? 53.605 101.089 10.909  1.00 27.56 ? 293 GLY A C   1 
ATOM   1096 O O   . GLY A 1 143 ? 54.303 100.115 10.622  1.00 27.99 ? 293 GLY A O   1 
ATOM   1097 N N   . ILE A 1 144 ? 54.027 102.342 10.771  1.00 28.49 ? 294 ILE A N   1 
ATOM   1098 C CA  . ILE A 1 144 ? 55.363 102.646 10.279  1.00 28.28 ? 294 ILE A CA  1 
ATOM   1099 C C   . ILE A 1 144 ? 55.770 104.080 10.624  1.00 30.18 ? 294 ILE A C   1 
ATOM   1100 O O   . ILE A 1 144 ? 54.916 104.963 10.732  1.00 29.89 ? 294 ILE A O   1 
ATOM   1101 C CB  . ILE A 1 144 ? 55.442 102.465 8.758   1.00 26.39 ? 294 ILE A CB  1 
ATOM   1102 C CG1 . ILE A 1 144 ? 56.872 102.714 8.279   1.00 26.63 ? 294 ILE A CG1 1 
ATOM   1103 C CG2 . ILE A 1 144 ? 54.507 103.441 8.077   1.00 26.94 ? 294 ILE A CG2 1 
ATOM   1104 C CD1 . ILE A 1 144 ? 57.918 101.799 8.908   1.00 26.57 ? 294 ILE A CD1 1 
ATOM   1105 N N   . GLU A 1 145 ? 57.079 104.290 10.791  1.00 31.72 ? 295 GLU A N   1 
ATOM   1106 C CA  . GLU A 1 145 ? 57.643 105.597 11.114  1.00 33.60 ? 295 GLU A CA  1 
ATOM   1107 C C   . GLU A 1 145 ? 57.181 106.054 12.496  1.00 34.92 ? 295 GLU A C   1 
ATOM   1108 O O   . GLU A 1 145 ? 56.701 107.179 12.665  1.00 37.15 ? 295 GLU A O   1 
ATOM   1109 C CB  . GLU A 1 145 ? 57.233 106.635 10.059  1.00 33.79 ? 295 GLU A CB  1 
ATOM   1110 C CG  . GLU A 1 145 ? 57.756 108.038 10.342  1.00 38.78 ? 295 GLU A CG  1 
ATOM   1111 C CD  . GLU A 1 145 ? 57.138 109.087 9.441   1.00 41.64 ? 295 GLU A CD  1 
ATOM   1112 O OE1 . GLU A 1 145 ? 55.895 109.087 9.310   1.00 42.96 ? 295 GLU A OE1 1 
ATOM   1113 O OE2 . GLU A 1 145 ? 57.893 109.911 8.879   1.00 42.43 ? 295 GLU A OE2 1 
ATOM   1114 N N   . LYS B 2 11  ? 15.978 107.630 -14.076 1.00 23.16 ? 320 LYS B N   1 
ATOM   1115 C CA  . LYS B 2 11  ? 16.342 106.331 -13.501 1.00 21.51 ? 320 LYS B CA  1 
ATOM   1116 C C   . LYS B 2 11  ? 17.781 106.308 -12.940 1.00 19.75 ? 320 LYS B C   1 
ATOM   1117 O O   . LYS B 2 11  ? 18.720 106.746 -13.605 1.00 17.85 ? 320 LYS B O   1 
ATOM   1118 C CB  . LYS B 2 11  ? 16.166 105.264 -14.572 1.00 23.43 ? 320 LYS B CB  1 
ATOM   1119 C CG  . LYS B 2 11  ? 16.207 103.839 -14.088 1.00 23.80 ? 320 LYS B CG  1 
ATOM   1120 C CD  . LYS B 2 11  ? 15.443 102.984 -15.074 1.00 25.77 ? 320 LYS B CD  1 
ATOM   1121 C CE  . LYS B 2 11  ? 15.630 101.510 -14.818 1.00 28.02 ? 320 LYS B CE  1 
ATOM   1122 N NZ  . LYS B 2 11  ? 16.891 101.023 -15.431 1.00 30.13 ? 320 LYS B NZ  1 
ATOM   1123 N N   . ILE B 2 12  ? 17.937 105.818 -11.708 1.00 18.00 ? 321 ILE B N   1 
ATOM   1124 C CA  . ILE B 2 12  ? 19.247 105.747 -11.050 1.00 15.58 ? 321 ILE B CA  1 
ATOM   1125 C C   . ILE B 2 12  ? 19.513 104.364 -10.438 1.00 15.55 ? 321 ILE B C   1 
ATOM   1126 O O   . ILE B 2 12  ? 18.585 103.590 -10.196 1.00 16.39 ? 321 ILE B O   1 
ATOM   1127 C CB  . ILE B 2 12  ? 19.391 106.794 -9.903  1.00 14.87 ? 321 ILE B CB  1 
ATOM   1128 C CG1 . ILE B 2 12  ? 18.337 106.537 -8.832  1.00 13.69 ? 321 ILE B CG1 1 
ATOM   1129 C CG2 . ILE B 2 12  ? 19.278 108.208 -10.444 1.00 12.94 ? 321 ILE B CG2 1 
ATOM   1130 C CD1 . ILE B 2 12  ? 18.549 107.332 -7.587  1.00 15.40 ? 321 ILE B CD1 1 
ATOM   1131 N N   . PRO B 2 13  ? 20.789 104.049 -10.157 1.00 14.19 ? 322 PRO B N   1 
ATOM   1132 C CA  . PRO B 2 13  ? 21.154 102.751 -9.573  1.00 13.40 ? 322 PRO B CA  1 
ATOM   1133 C C   . PRO B 2 13  ? 20.468 102.502 -8.231  1.00 13.19 ? 322 PRO B C   1 
ATOM   1134 O O   . PRO B 2 13  ? 20.168 103.440 -7.504  1.00 13.42 ? 322 PRO B O   1 
ATOM   1135 C CB  . PRO B 2 13  ? 22.679 102.855 -9.431  1.00 14.25 ? 322 PRO B CB  1 
ATOM   1136 C CG  . PRO B 2 13  ? 23.065 103.824 -10.513 1.00 12.55 ? 322 PRO B CG  1 
ATOM   1137 C CD  . PRO B 2 13  ? 21.989 104.868 -10.405 1.00 12.45 ? 322 PRO B CD  1 
ATOM   1138 N N   . VAL B 2 14  ? 20.230 101.244 -7.891  1.00 13.24 ? 323 VAL B N   1 
ATOM   1139 C CA  . VAL B 2 14  ? 19.577 100.942 -6.619  1.00 14.74 ? 323 VAL B CA  1 
ATOM   1140 C C   . VAL B 2 14  ? 20.549 101.002 -5.447  1.00 15.55 ? 323 VAL B C   1 
ATOM   1141 O O   . VAL B 2 14  ? 20.138 101.193 -4.302  1.00 15.31 ? 323 VAL B O   1 
ATOM   1142 C CB  . VAL B 2 14  ? 18.890 99.547  -6.633  1.00 14.91 ? 323 VAL B CB  1 
ATOM   1143 C CG1 . VAL B 2 14  ? 17.777 99.534  -7.658  1.00 13.88 ? 323 VAL B CG1 1 
ATOM   1144 C CG2 . VAL B 2 14  ? 19.911 98.450  -6.922  1.00 13.39 ? 323 VAL B CG2 1 
ATOM   1145 N N   . GLU B 2 15  ? 21.838 100.842 -5.745  1.00 17.53 ? 324 GLU B N   1 
ATOM   1146 C CA  . GLU B 2 15  ? 22.895 100.886 -4.733  1.00 16.95 ? 324 GLU B CA  1 
ATOM   1147 C C   . GLU B 2 15  ? 23.435 102.309 -4.535  1.00 16.26 ? 324 GLU B C   1 
ATOM   1148 O O   . GLU B 2 15  ? 24.335 102.529 -3.725  1.00 16.54 ? 324 GLU B O   1 
ATOM   1149 C CB  . GLU B 2 15  ? 24.044 99.966  -5.146  1.00 18.90 ? 324 GLU B CB  1 
ATOM   1150 C CG  . GLU B 2 15  ? 23.647 98.520  -5.330  1.00 22.93 ? 324 GLU B CG  1 
ATOM   1151 C CD  . GLU B 2 15  ? 23.608 97.751  -4.027  1.00 24.58 ? 324 GLU B CD  1 
ATOM   1152 O OE1 . GLU B 2 15  ? 24.374 96.777  -3.899  1.00 26.47 ? 324 GLU B OE1 1 
ATOM   1153 O OE2 . GLU B 2 15  ? 22.819 98.115  -3.133  1.00 28.61 ? 324 GLU B OE2 1 
ATOM   1154 N N   . ALA B 2 16  ? 22.882 103.267 -5.273  1.00 14.60 ? 325 ALA B N   1 
ATOM   1155 C CA  . ALA B 2 16  ? 23.316 104.656 -5.181  1.00 14.21 ? 325 ALA B CA  1 
ATOM   1156 C C   . ALA B 2 16  ? 22.771 105.389 -3.960  1.00 14.56 ? 325 ALA B C   1 
ATOM   1157 O O   . ALA B 2 16  ? 21.720 105.040 -3.422  1.00 14.24 ? 325 ALA B O   1 
ATOM   1158 C CB  . ALA B 2 16  ? 22.919 105.394 -6.431  1.00 13.93 ? 325 ALA B CB  1 
ATOM   1159 N N   . ASP B 2 17  ? 23.499 106.419 -3.540  1.00 14.38 ? 326 ASP B N   1 
ATOM   1160 C CA  . ASP B 2 17  ? 23.128 107.233 -2.386  1.00 13.48 ? 326 ASP B CA  1 
ATOM   1161 C C   . ASP B 2 17  ? 23.314 106.483 -1.076  1.00 13.47 ? 326 ASP B C   1 
ATOM   1162 O O   . ASP B 2 17  ? 22.532 106.625 -0.136  1.00 13.98 ? 326 ASP B O   1 
ATOM   1163 C CB  . ASP B 2 17  ? 21.685 107.736 -2.508  1.00 9.96  ? 326 ASP B CB  1 
ATOM   1164 C CG  . ASP B 2 17  ? 21.475 108.573 -3.739  1.00 9.61  ? 326 ASP B CG  1 
ATOM   1165 O OD1 . ASP B 2 17  ? 22.342 109.431 -4.016  1.00 8.22  ? 326 ASP B OD1 1 
ATOM   1166 O OD2 . ASP B 2 17  ? 20.448 108.382 -4.427  1.00 8.57  ? 326 ASP B OD2 1 
ATOM   1167 N N   . PHE B 2 18  ? 24.365 105.679 -1.031  1.00 12.79 ? 327 PHE B N   1 
ATOM   1168 C CA  . PHE B 2 18  ? 24.712 104.921 0.156   1.00 12.38 ? 327 PHE B CA  1 
ATOM   1169 C C   . PHE B 2 18  ? 26.085 105.393 0.613   1.00 12.70 ? 327 PHE B C   1 
ATOM   1170 O O   . PHE B 2 18  ? 26.908 105.831 -0.192  1.00 11.83 ? 327 PHE B O   1 
ATOM   1171 C CB  . PHE B 2 18  ? 24.773 103.424 -0.165  1.00 14.28 ? 327 PHE B CB  1 
ATOM   1172 C CG  . PHE B 2 18  ? 23.459 102.707 -0.014  1.00 16.63 ? 327 PHE B CG  1 
ATOM   1173 C CD1 . PHE B 2 18  ? 23.098 102.144 1.206   1.00 16.94 ? 327 PHE B CD1 1 
ATOM   1174 C CD2 . PHE B 2 18  ? 22.577 102.606 -1.084  1.00 17.13 ? 327 PHE B CD2 1 
ATOM   1175 C CE1 . PHE B 2 18  ? 21.879 101.491 1.361   1.00 18.76 ? 327 PHE B CE1 1 
ATOM   1176 C CE2 . PHE B 2 18  ? 21.353 101.954 -0.939  1.00 18.65 ? 327 PHE B CE2 1 
ATOM   1177 C CZ  . PHE B 2 18  ? 21.004 101.394 0.289   1.00 18.22 ? 327 PHE B CZ  1 
ATOM   1178 N N   . LEU B 2 19  ? 26.321 105.333 1.913   1.00 12.02 ? 328 LEU B N   1 
ATOM   1179 C CA  . LEU B 2 19  ? 27.616 105.694 2.448   1.00 11.20 ? 328 LEU B CA  1 
ATOM   1180 C C   . LEU B 2 19  ? 27.942 104.764 3.594   1.00 11.75 ? 328 LEU B C   1 
ATOM   1181 O O   . LEU B 2 19  ? 27.194 104.690 4.568   1.00 11.01 ? 328 LEU B O   1 
ATOM   1182 C CB  . LEU B 2 19  ? 27.654 107.124 2.977   1.00 11.18 ? 328 LEU B CB  1 
ATOM   1183 C CG  . LEU B 2 19  ? 29.001 107.379 3.684   1.00 10.92 ? 328 LEU B CG  1 
ATOM   1184 C CD1 . LEU B 2 19  ? 30.111 107.433 2.660   1.00 11.31 ? 328 LEU B CD1 1 
ATOM   1185 C CD2 . LEU B 2 19  ? 28.961 108.662 4.445   1.00 14.35 ? 328 LEU B CD2 1 
ATOM   1186 N N   . TYR B 2 20  ? 29.059 104.060 3.478   1.00 9.65  ? 329 TYR B N   1 
ATOM   1187 C CA  . TYR B 2 20  ? 29.465 103.178 4.536   1.00 10.47 ? 329 TYR B CA  1 
ATOM   1188 C C   . TYR B 2 20  ? 30.737 103.733 5.102   1.00 11.66 ? 329 TYR B C   1 
ATOM   1189 O O   . TYR B 2 20  ? 31.746 103.803 4.411   1.00 12.96 ? 329 TYR B O   1 
ATOM   1190 C CB  . TYR B 2 20  ? 29.722 101.764 4.019   1.00 13.70 ? 329 TYR B CB  1 
ATOM   1191 C CG  . TYR B 2 20  ? 28.597 101.185 3.205   1.00 14.57 ? 329 TYR B CG  1 
ATOM   1192 C CD1 . TYR B 2 20  ? 28.543 101.372 1.831   1.00 15.15 ? 329 TYR B CD1 1 
ATOM   1193 C CD2 . TYR B 2 20  ? 27.573 100.464 3.813   1.00 16.61 ? 329 TYR B CD2 1 
ATOM   1194 C CE1 . TYR B 2 20  ? 27.498 100.854 1.077   1.00 16.78 ? 329 TYR B CE1 1 
ATOM   1195 C CE2 . TYR B 2 20  ? 26.516 99.942  3.066   1.00 16.53 ? 329 TYR B CE2 1 
ATOM   1196 C CZ  . TYR B 2 20  ? 26.489 100.140 1.701   1.00 17.28 ? 329 TYR B CZ  1 
ATOM   1197 O OH  . TYR B 2 20  ? 25.461 99.621  0.951   1.00 19.02 ? 329 TYR B OH  1 
ATOM   1198 N N   . ALA B 2 21  ? 30.678 104.157 6.357   1.00 13.14 ? 330 ALA B N   1 
ATOM   1199 C CA  . ALA B 2 21  ? 31.846 104.682 7.050   1.00 13.54 ? 330 ALA B CA  1 
ATOM   1200 C C   . ALA B 2 21  ? 32.280 103.581 8.005   1.00 14.46 ? 330 ALA B C   1 
ATOM   1201 O O   . ALA B 2 21  ? 31.671 103.382 9.055   1.00 14.37 ? 330 ALA B O   1 
ATOM   1202 C CB  . ALA B 2 21  ? 31.489 105.936 7.821   1.00 13.56 ? 330 ALA B CB  1 
ATOM   1203 N N   . TYR B 2 22  ? 33.317 102.849 7.618   1.00 14.83 ? 331 TYR B N   1 
ATOM   1204 C CA  . TYR B 2 22  ? 33.819 101.767 8.441   1.00 14.97 ? 331 TYR B CA  1 
ATOM   1205 C C   . TYR B 2 22  ? 34.901 102.274 9.374   1.00 14.13 ? 331 TYR B C   1 
ATOM   1206 O O   . TYR B 2 22  ? 35.676 103.162 9.028   1.00 12.85 ? 331 TYR B O   1 
ATOM   1207 C CB  . TYR B 2 22  ? 34.385 100.647 7.572   1.00 17.12 ? 331 TYR B CB  1 
ATOM   1208 C CG  . TYR B 2 22  ? 33.363 99.910  6.750   1.00 18.16 ? 331 TYR B CG  1 
ATOM   1209 C CD1 . TYR B 2 22  ? 32.632 98.853  7.291   1.00 19.46 ? 331 TYR B CD1 1 
ATOM   1210 C CD2 . TYR B 2 22  ? 33.156 100.235 5.412   1.00 18.68 ? 331 TYR B CD2 1 
ATOM   1211 C CE1 . TYR B 2 22  ? 31.728 98.134  6.511   1.00 18.51 ? 331 TYR B CE1 1 
ATOM   1212 C CE2 . TYR B 2 22  ? 32.260 99.526  4.630   1.00 19.45 ? 331 TYR B CE2 1 
ATOM   1213 C CZ  . TYR B 2 22  ? 31.551 98.477  5.182   1.00 19.88 ? 331 TYR B CZ  1 
ATOM   1214 O OH  . TYR B 2 22  ? 30.680 97.761  4.391   1.00 23.27 ? 331 TYR B OH  1 
ATOM   1215 N N   . SER B 2 23  ? 34.935 101.680 10.558  1.00 13.70 ? 332 SER B N   1 
ATOM   1216 C CA  . SER B 2 23  ? 35.880 102.020 11.604  1.00 13.86 ? 332 SER B CA  1 
ATOM   1217 C C   . SER B 2 23  ? 37.288 101.558 11.273  1.00 13.87 ? 332 SER B C   1 
ATOM   1218 O O   . SER B 2 23  ? 38.263 102.109 11.775  1.00 14.20 ? 332 SER B O   1 
ATOM   1219 C CB  . SER B 2 23  ? 35.437 101.358 12.906  1.00 14.64 ? 332 SER B CB  1 
ATOM   1220 O OG  . SER B 2 23  ? 35.429 99.946  12.760  1.00 15.87 ? 332 SER B OG  1 
ATOM   1221 N N   . THR B 2 24  ? 37.393 100.534 10.436  1.00 13.98 ? 333 THR B N   1 
ATOM   1222 C CA  . THR B 2 24  ? 38.694 99.995  10.077  1.00 13.64 ? 333 THR B CA  1 
ATOM   1223 C C   . THR B 2 24  ? 38.720 99.602  8.605   1.00 15.40 ? 333 THR B C   1 
ATOM   1224 O O   . THR B 2 24  ? 37.685 99.584  7.939   1.00 16.39 ? 333 THR B O   1 
ATOM   1225 C CB  . THR B 2 24  ? 39.034 98.759  10.950  1.00 11.82 ? 333 THR B CB  1 
ATOM   1226 O OG1 . THR B 2 24  ? 40.360 98.315  10.664  1.00 9.31  ? 333 THR B OG1 1 
ATOM   1227 C CG2 . THR B 2 24  ? 38.063 97.625  10.678  1.00 11.00 ? 333 THR B CG2 1 
ATOM   1228 N N   . ALA B 2 25  ? 39.913 99.296  8.110   1.00 14.85 ? 334 ALA B N   1 
ATOM   1229 C CA  . ALA B 2 25  ? 40.092 98.899  6.724   1.00 15.02 ? 334 ALA B CA  1 
ATOM   1230 C C   . ALA B 2 25  ? 39.601 97.474  6.496   1.00 14.92 ? 334 ALA B C   1 
ATOM   1231 O O   . ALA B 2 25  ? 39.388 96.717  7.443   1.00 14.68 ? 334 ALA B O   1 
ATOM   1232 C CB  . ALA B 2 25  ? 41.565 99.012  6.336   1.00 16.17 ? 334 ALA B CB  1 
ATOM   1233 N N   . PRO B 2 26  ? 39.432 97.086  5.222   1.00 15.83 ? 335 PRO B N   1 
ATOM   1234 C CA  . PRO B 2 26  ? 38.961 95.747  4.847   1.00 15.24 ? 335 PRO B CA  1 
ATOM   1235 C C   . PRO B 2 26  ? 39.836 94.610  5.351   1.00 14.17 ? 335 PRO B C   1 
ATOM   1236 O O   . PRO B 2 26  ? 41.017 94.555  5.039   1.00 13.71 ? 335 PRO B O   1 
ATOM   1237 C CB  . PRO B 2 26  ? 38.935 95.808  3.326   1.00 15.90 ? 335 PRO B CB  1 
ATOM   1238 C CG  . PRO B 2 26  ? 38.637 97.259  3.048   1.00 16.61 ? 335 PRO B CG  1 
ATOM   1239 C CD  . PRO B 2 26  ? 39.555 97.949  4.032   1.00 15.98 ? 335 PRO B CD  1 
ATOM   1240 N N   . GLY B 2 27  ? 39.247 93.709  6.133   1.00 14.20 ? 336 GLY B N   1 
ATOM   1241 C CA  . GLY B 2 27  ? 39.984 92.566  6.648   1.00 13.77 ? 336 GLY B CA  1 
ATOM   1242 C C   . GLY B 2 27  ? 40.666 92.727  7.995   1.00 14.27 ? 336 GLY B C   1 
ATOM   1243 O O   . GLY B 2 27  ? 41.122 91.751  8.583   1.00 14.47 ? 336 GLY B O   1 
ATOM   1244 N N   . TYR B 2 28  ? 40.727 93.952  8.498   1.00 15.47 ? 337 TYR B N   1 
ATOM   1245 C CA  . TYR B 2 28  ? 41.392 94.206  9.767   1.00 16.25 ? 337 TYR B CA  1 
ATOM   1246 C C   . TYR B 2 28  ? 40.508 94.229  11.007  1.00 15.77 ? 337 TYR B C   1 
ATOM   1247 O O   . TYR B 2 28  ? 39.290 94.301  10.925  1.00 13.91 ? 337 TYR B O   1 
ATOM   1248 C CB  . TYR B 2 28  ? 42.164 95.525  9.695   1.00 16.53 ? 337 TYR B CB  1 
ATOM   1249 C CG  . TYR B 2 28  ? 43.392 95.472  8.818   1.00 19.44 ? 337 TYR B CG  1 
ATOM   1250 C CD1 . TYR B 2 28  ? 43.282 95.414  7.427   1.00 20.19 ? 337 TYR B CD1 1 
ATOM   1251 C CD2 . TYR B 2 28  ? 44.673 95.491  9.379   1.00 19.67 ? 337 TYR B CD2 1 
ATOM   1252 C CE1 . TYR B 2 28  ? 44.420 95.382  6.613   1.00 20.30 ? 337 TYR B CE1 1 
ATOM   1253 C CE2 . TYR B 2 28  ? 45.815 95.455  8.579   1.00 19.85 ? 337 TYR B CE2 1 
ATOM   1254 C CZ  . TYR B 2 28  ? 45.684 95.403  7.198   1.00 20.94 ? 337 TYR B CZ  1 
ATOM   1255 O OH  . TYR B 2 28  ? 46.810 95.386  6.401   1.00 21.04 ? 337 TYR B OH  1 
ATOM   1256 N N   . TYR B 2 29  ? 41.161 94.146  12.162  1.00 16.85 ? 338 TYR B N   1 
ATOM   1257 C CA  . TYR B 2 29  ? 40.491 94.205  13.456  1.00 16.97 ? 338 TYR B CA  1 
ATOM   1258 C C   . TYR B 2 29  ? 40.108 95.675  13.644  1.00 18.53 ? 338 TYR B C   1 
ATOM   1259 O O   . TYR B 2 29  ? 40.519 96.548  12.866  1.00 19.34 ? 338 TYR B O   1 
ATOM   1260 C CB  . TYR B 2 29  ? 41.464 93.846  14.589  1.00 16.57 ? 338 TYR B CB  1 
ATOM   1261 C CG  . TYR B 2 29  ? 41.621 92.391  14.949  1.00 15.41 ? 338 TYR B CG  1 
ATOM   1262 C CD1 . TYR B 2 29  ? 40.525 91.622  15.325  1.00 16.73 ? 338 TYR B CD1 1 
ATOM   1263 C CD2 . TYR B 2 29  ? 42.884 91.805  15.009  1.00 15.56 ? 338 TYR B CD2 1 
ATOM   1264 C CE1 . TYR B 2 29  ? 40.682 90.306  15.758  1.00 15.19 ? 338 TYR B CE1 1 
ATOM   1265 C CE2 . TYR B 2 29  ? 43.053 90.494  15.440  1.00 14.66 ? 338 TYR B CE2 1 
ATOM   1266 C CZ  . TYR B 2 29  ? 41.948 89.750  15.814  1.00 15.69 ? 338 TYR B CZ  1 
ATOM   1267 O OH  . TYR B 2 29  ? 42.109 88.452  16.242  1.00 15.55 ? 338 TYR B OH  1 
ATOM   1268 N N   . SER B 2 30  ? 39.333 95.945  14.687  1.00 18.48 ? 339 SER B N   1 
ATOM   1269 C CA  . SER B 2 30  ? 38.942 97.305  15.021  1.00 17.45 ? 339 SER B CA  1 
ATOM   1270 C C   . SER B 2 30  ? 39.203 97.421  16.512  1.00 17.73 ? 339 SER B C   1 
ATOM   1271 O O   . SER B 2 30  ? 38.972 96.474  17.261  1.00 16.89 ? 339 SER B O   1 
ATOM   1272 C CB  . SER B 2 30  ? 37.465 97.544  14.727  1.00 18.65 ? 339 SER B CB  1 
ATOM   1273 O OG  . SER B 2 30  ? 37.143 98.911  14.914  1.00 21.08 ? 339 SER B OG  1 
ATOM   1274 N N   . TRP B 2 31  ? 39.699 98.573  16.946  1.00 17.78 ? 340 TRP B N   1 
ATOM   1275 C CA  . TRP B 2 31  ? 39.999 98.764  18.354  1.00 15.70 ? 340 TRP B CA  1 
ATOM   1276 C C   . TRP B 2 31  ? 38.924 99.498  19.132  1.00 16.53 ? 340 TRP B C   1 
ATOM   1277 O O   . TRP B 2 31  ? 38.277 100.420 18.635  1.00 16.10 ? 340 TRP B O   1 
ATOM   1278 C CB  . TRP B 2 31  ? 41.343 99.469  18.509  1.00 15.55 ? 340 TRP B CB  1 
ATOM   1279 C CG  . TRP B 2 31  ? 42.465 98.623  18.048  1.00 14.30 ? 340 TRP B CG  1 
ATOM   1280 C CD1 . TRP B 2 31  ? 42.983 98.558  16.789  1.00 13.92 ? 340 TRP B CD1 1 
ATOM   1281 C CD2 . TRP B 2 31  ? 43.162 97.647  18.823  1.00 14.69 ? 340 TRP B CD2 1 
ATOM   1282 N NE1 . TRP B 2 31  ? 43.963 97.597  16.729  1.00 13.50 ? 340 TRP B NE1 1 
ATOM   1283 C CE2 . TRP B 2 31  ? 44.092 97.021  17.966  1.00 14.32 ? 340 TRP B CE2 1 
ATOM   1284 C CE3 . TRP B 2 31  ? 43.089 97.236  20.162  1.00 14.11 ? 340 TRP B CE3 1 
ATOM   1285 C CZ2 . TRP B 2 31  ? 44.948 96.001  18.408  1.00 13.13 ? 340 TRP B CZ2 1 
ATOM   1286 C CZ3 . TRP B 2 31  ? 43.942 96.222  20.601  1.00 12.82 ? 340 TRP B CZ3 1 
ATOM   1287 C CH2 . TRP B 2 31  ? 44.857 95.618  19.724  1.00 11.84 ? 340 TRP B CH2 1 
ATOM   1288 N N   . ARG B 2 32  ? 38.753 99.067  20.373  1.00 17.55 ? 341 ARG B N   1 
ATOM   1289 C CA  . ARG B 2 32  ? 37.766 99.630  21.275  1.00 18.25 ? 341 ARG B CA  1 
ATOM   1290 C C   . ARG B 2 32  ? 38.439 99.707  22.638  1.00 19.07 ? 341 ARG B C   1 
ATOM   1291 O O   . ARG B 2 32  ? 39.167 98.793  23.025  1.00 19.03 ? 341 ARG B O   1 
ATOM   1292 C CB  . ARG B 2 32  ? 36.554 98.698  21.336  1.00 16.64 ? 341 ARG B CB  1 
ATOM   1293 C CG  . ARG B 2 32  ? 35.361 99.242  22.074  1.00 19.78 ? 341 ARG B CG  1 
ATOM   1294 C CD  . ARG B 2 32  ? 34.318 98.155  22.301  1.00 22.10 ? 341 ARG B CD  1 
ATOM   1295 N NE  . ARG B 2 32  ? 34.759 97.208  23.320  1.00 25.16 ? 341 ARG B NE  1 
ATOM   1296 C CZ  . ARG B 2 32  ? 35.332 96.032  23.079  1.00 25.38 ? 341 ARG B CZ  1 
ATOM   1297 N NH1 . ARG B 2 32  ? 35.539 95.620  21.836  1.00 25.18 ? 341 ARG B NH1 1 
ATOM   1298 N NH2 . ARG B 2 32  ? 35.717 95.276  24.097  1.00 25.98 ? 341 ARG B NH2 1 
ATOM   1299 N N   . ASN B 2 33  ? 38.222 100.797 23.362  1.00 20.09 ? 342 ASN B N   1 
ATOM   1300 C CA  . ASN B 2 33  ? 38.816 100.925 24.683  1.00 21.16 ? 342 ASN B CA  1 
ATOM   1301 C C   . ASN B 2 33  ? 37.726 100.725 25.730  1.00 22.83 ? 342 ASN B C   1 
ATOM   1302 O O   . ASN B 2 33  ? 36.653 101.315 25.626  1.00 24.46 ? 342 ASN B O   1 
ATOM   1303 C CB  . ASN B 2 33  ? 39.471 102.298 24.847  1.00 19.79 ? 342 ASN B CB  1 
ATOM   1304 C CG  . ASN B 2 33  ? 40.220 102.432 26.165  1.00 20.03 ? 342 ASN B CG  1 
ATOM   1305 O OD1 . ASN B 2 33  ? 39.644 102.797 27.192  1.00 18.36 ? 342 ASN B OD1 1 
ATOM   1306 N ND2 . ASN B 2 33  ? 41.513 102.116 26.144  1.00 19.83 ? 342 ASN B ND2 1 
ATOM   1307 N N   . SER B 2 34  ? 38.001 99.884  26.726  1.00 23.74 ? 343 SER B N   1 
ATOM   1308 C CA  . SER B 2 34  ? 37.054 99.587  27.805  1.00 25.04 ? 343 SER B CA  1 
ATOM   1309 C C   . SER B 2 34  ? 36.395 100.790 28.490  1.00 25.63 ? 343 SER B C   1 
ATOM   1310 O O   . SER B 2 34  ? 35.213 100.737 28.827  1.00 24.79 ? 343 SER B O   1 
ATOM   1311 C CB  . SER B 2 34  ? 37.739 98.752  28.881  1.00 25.44 ? 343 SER B CB  1 
ATOM   1312 O OG  . SER B 2 34  ? 38.245 97.555  28.341  1.00 29.72 ? 343 SER B OG  1 
ATOM   1313 N N   . LYS B 2 35  ? 37.151 101.862 28.721  1.00 26.66 ? 344 LYS B N   1 
ATOM   1314 C CA  . LYS B 2 35  ? 36.578 103.027 29.386  1.00 27.00 ? 344 LYS B CA  1 
ATOM   1315 C C   . LYS B 2 35  ? 36.337 104.229 28.469  1.00 25.93 ? 344 LYS B C   1 
ATOM   1316 O O   . LYS B 2 35  ? 35.401 104.997 28.694  1.00 26.84 ? 344 LYS B O   1 
ATOM   1317 C CB  . LYS B 2 35  ? 37.463 103.447 30.572  1.00 29.54 ? 344 LYS B CB  1 
ATOM   1318 C CG  . LYS B 2 35  ? 38.867 103.875 30.171  1.00 34.57 ? 344 LYS B CG  1 
ATOM   1319 C CD  . LYS B 2 35  ? 39.643 104.526 31.315  1.00 36.14 ? 344 LYS B CD  1 
ATOM   1320 C CE  . LYS B 2 35  ? 40.989 105.073 30.814  1.00 36.44 ? 344 LYS B CE  1 
ATOM   1321 N NZ  . LYS B 2 35  ? 41.898 105.543 31.907  1.00 36.51 ? 344 LYS B NZ  1 
ATOM   1322 N N   . ASP B 2 36  ? 37.157 104.389 27.434  1.00 23.51 ? 345 ASP B N   1 
ATOM   1323 C CA  . ASP B 2 36  ? 37.017 105.525 26.524  1.00 23.07 ? 345 ASP B CA  1 
ATOM   1324 C C   . ASP B 2 36  ? 36.086 105.325 25.322  1.00 21.58 ? 345 ASP B C   1 
ATOM   1325 O O   . ASP B 2 36  ? 35.586 106.292 24.750  1.00 22.03 ? 345 ASP B O   1 
ATOM   1326 C CB  . ASP B 2 36  ? 38.394 105.949 26.010  1.00 25.39 ? 345 ASP B CB  1 
ATOM   1327 C CG  . ASP B 2 36  ? 39.317 106.417 27.121  1.00 28.41 ? 345 ASP B CG  1 
ATOM   1328 O OD1 . ASP B 2 36  ? 38.876 107.250 27.936  1.00 30.33 ? 345 ASP B OD1 1 
ATOM   1329 O OD2 . ASP B 2 36  ? 40.484 105.963 27.173  1.00 30.40 ? 345 ASP B OD2 1 
ATOM   1330 N N   . GLY B 2 37  ? 35.853 104.077 24.940  1.00 20.36 ? 346 GLY B N   1 
ATOM   1331 C CA  . GLY B 2 37  ? 35.017 103.806 23.787  1.00 19.19 ? 346 GLY B CA  1 
ATOM   1332 C C   . GLY B 2 37  ? 35.907 103.425 22.613  1.00 18.72 ? 346 GLY B C   1 
ATOM   1333 O O   . GLY B 2 37  ? 37.132 103.408 22.745  1.00 17.49 ? 346 GLY B O   1 
ATOM   1334 N N   . SER B 2 38  ? 35.305 103.112 21.469  1.00 17.90 ? 347 SER B N   1 
ATOM   1335 C CA  . SER B 2 38  ? 36.076 102.734 20.289  1.00 17.18 ? 347 SER B CA  1 
ATOM   1336 C C   . SER B 2 38  ? 36.775 103.973 19.729  1.00 16.89 ? 347 SER B C   1 
ATOM   1337 O O   . SER B 2 38  ? 36.273 105.080 19.870  1.00 17.76 ? 347 SER B O   1 
ATOM   1338 C CB  . SER B 2 38  ? 35.152 102.131 19.231  1.00 16.37 ? 347 SER B CB  1 
ATOM   1339 O OG  . SER B 2 38  ? 34.255 103.105 18.736  1.00 16.53 ? 347 SER B OG  1 
ATOM   1340 N N   . TRP B 2 39  ? 37.926 103.784 19.093  1.00 16.08 ? 348 TRP B N   1 
ATOM   1341 C CA  . TRP B 2 39  ? 38.682 104.902 18.537  1.00 17.09 ? 348 TRP B CA  1 
ATOM   1342 C C   . TRP B 2 39  ? 37.897 105.651 17.475  1.00 17.01 ? 348 TRP B C   1 
ATOM   1343 O O   . TRP B 2 39  ? 37.917 106.877 17.411  1.00 17.76 ? 348 TRP B O   1 
ATOM   1344 C CB  . TRP B 2 39  ? 39.985 104.416 17.895  1.00 18.29 ? 348 TRP B CB  1 
ATOM   1345 C CG  . TRP B 2 39  ? 40.936 103.694 18.811  1.00 20.06 ? 348 TRP B CG  1 
ATOM   1346 C CD1 . TRP B 2 39  ? 40.889 103.634 20.176  1.00 19.60 ? 348 TRP B CD1 1 
ATOM   1347 C CD2 . TRP B 2 39  ? 42.117 102.981 18.419  1.00 20.80 ? 348 TRP B CD2 1 
ATOM   1348 N NE1 . TRP B 2 39  ? 41.968 102.930 20.655  1.00 20.61 ? 348 TRP B NE1 1 
ATOM   1349 C CE2 . TRP B 2 39  ? 42.735 102.515 19.598  1.00 20.74 ? 348 TRP B CE2 1 
ATOM   1350 C CE3 . TRP B 2 39  ? 42.711 102.686 17.181  1.00 20.45 ? 348 TRP B CE3 1 
ATOM   1351 C CZ2 . TRP B 2 39  ? 43.925 101.783 19.577  1.00 21.84 ? 348 TRP B CZ2 1 
ATOM   1352 C CZ3 . TRP B 2 39  ? 43.893 101.958 17.162  1.00 20.21 ? 348 TRP B CZ3 1 
ATOM   1353 C CH2 . TRP B 2 39  ? 44.484 101.511 18.352  1.00 21.16 ? 348 TRP B CH2 1 
ATOM   1354 N N   . PHE B 2 40  ? 37.218 104.887 16.635  1.00 16.49 ? 349 PHE B N   1 
ATOM   1355 C CA  . PHE B 2 40  ? 36.447 105.431 15.540  1.00 14.20 ? 349 PHE B CA  1 
ATOM   1356 C C   . PHE B 2 40  ? 35.301 106.296 16.015  1.00 14.50 ? 349 PHE B C   1 
ATOM   1357 O O   . PHE B 2 40  ? 35.195 107.459 15.626  1.00 15.02 ? 349 PHE B O   1 
ATOM   1358 C CB  . PHE B 2 40  ? 35.938 104.282 14.666  1.00 11.23 ? 349 PHE B CB  1 
ATOM   1359 C CG  . PHE B 2 40  ? 35.134 104.723 13.482  1.00 11.43 ? 349 PHE B CG  1 
ATOM   1360 C CD1 . PHE B 2 40  ? 35.696 105.541 12.507  1.00 10.56 ? 349 PHE B CD1 1 
ATOM   1361 C CD2 . PHE B 2 40  ? 33.804 104.318 13.342  1.00 11.11 ? 349 PHE B CD2 1 
ATOM   1362 C CE1 . PHE B 2 40  ? 34.955 105.953 11.415  1.00 9.48  ? 349 PHE B CE1 1 
ATOM   1363 C CE2 . PHE B 2 40  ? 33.050 104.725 12.252  1.00 11.13 ? 349 PHE B CE2 1 
ATOM   1364 C CZ  . PHE B 2 40  ? 33.629 105.547 11.283  1.00 11.17 ? 349 PHE B CZ  1 
ATOM   1365 N N   . ILE B 2 41  ? 34.450 105.754 16.874  1.00 14.92 ? 350 ILE B N   1 
ATOM   1366 C CA  . ILE B 2 41  ? 33.307 106.525 17.345  1.00 15.69 ? 350 ILE B CA  1 
ATOM   1367 C C   . ILE B 2 41  ? 33.673 107.791 18.124  1.00 18.25 ? 350 ILE B C   1 
ATOM   1368 O O   . ILE B 2 41  ? 33.119 108.866 17.865  1.00 19.52 ? 350 ILE B O   1 
ATOM   1369 C CB  . ILE B 2 41  ? 32.367 105.650 18.182  1.00 13.33 ? 350 ILE B CB  1 
ATOM   1370 C CG1 . ILE B 2 41  ? 31.852 104.488 17.320  1.00 11.29 ? 350 ILE B CG1 1 
ATOM   1371 C CG2 . ILE B 2 41  ? 31.219 106.482 18.724  1.00 10.34 ? 350 ILE B CG2 1 
ATOM   1372 C CD1 . ILE B 2 41  ? 31.108 104.916 16.083  1.00 9.50  ? 350 ILE B CD1 1 
ATOM   1373 N N   . GLN B 2 42  ? 34.605 107.695 19.065  1.00 19.97 ? 351 GLN B N   1 
ATOM   1374 C CA  . GLN B 2 42  ? 34.948 108.894 19.812  1.00 21.83 ? 351 GLN B CA  1 
ATOM   1375 C C   . GLN B 2 42  ? 35.582 109.952 18.905  1.00 21.33 ? 351 GLN B C   1 
ATOM   1376 O O   . GLN B 2 42  ? 35.481 111.150 19.168  1.00 22.83 ? 351 GLN B O   1 
ATOM   1377 C CB  . GLN B 2 42  ? 35.839 108.557 21.027  1.00 24.06 ? 351 GLN B CB  1 
ATOM   1378 C CG  . GLN B 2 42  ? 37.176 107.865 20.767  1.00 28.76 ? 351 GLN B CG  1 
ATOM   1379 C CD  . GLN B 2 42  ? 37.978 107.638 22.063  1.00 30.91 ? 351 GLN B CD  1 
ATOM   1380 O OE1 . GLN B 2 42  ? 38.220 106.494 22.471  1.00 33.32 ? 351 GLN B OE1 1 
ATOM   1381 N NE2 . GLN B 2 42  ? 38.384 108.730 22.711  1.00 27.12 ? 351 GLN B NE2 1 
ATOM   1382 N N   . SER B 2 43  ? 36.199 109.513 17.812  1.00 20.85 ? 352 SER B N   1 
ATOM   1383 C CA  . SER B 2 43  ? 36.830 110.442 16.880  1.00 18.82 ? 352 SER B CA  1 
ATOM   1384 C C   . SER B 2 43  ? 35.810 110.987 15.899  1.00 17.49 ? 352 SER B C   1 
ATOM   1385 O O   . SER B 2 43  ? 35.993 112.066 15.338  1.00 17.76 ? 352 SER B O   1 
ATOM   1386 C CB  . SER B 2 43  ? 37.966 109.760 16.107  1.00 19.93 ? 352 SER B CB  1 
ATOM   1387 O OG  . SER B 2 43  ? 39.094 109.516 16.932  1.00 18.23 ? 352 SER B OG  1 
ATOM   1388 N N   . LEU B 2 44  ? 34.736 110.236 15.681  1.00 16.06 ? 353 LEU B N   1 
ATOM   1389 C CA  . LEU B 2 44  ? 33.694 110.681 14.766  1.00 12.97 ? 353 LEU B CA  1 
ATOM   1390 C C   . LEU B 2 44  ? 32.832 111.730 15.438  1.00 12.07 ? 353 LEU B C   1 
ATOM   1391 O O   . LEU B 2 44  ? 32.553 112.769 14.851  1.00 13.59 ? 353 LEU B O   1 
ATOM   1392 C CB  . LEU B 2 44  ? 32.815 109.514 14.308  1.00 12.20 ? 353 LEU B CB  1 
ATOM   1393 C CG  . LEU B 2 44  ? 31.486 109.936 13.661  1.00 11.63 ? 353 LEU B CG  1 
ATOM   1394 C CD1 . LEU B 2 44  ? 31.745 110.670 12.369  1.00 9.04  ? 353 LEU B CD1 1 
ATOM   1395 C CD2 . LEU B 2 44  ? 30.627 108.715 13.406  1.00 10.36 ? 353 LEU B CD2 1 
ATOM   1396 N N   . CYS B 2 45  ? 32.421 111.468 16.673  1.00 10.75 ? 354 CYS B N   1 
ATOM   1397 C CA  . CYS B 2 45  ? 31.580 112.412 17.400  1.00 9.85  ? 354 CYS B CA  1 
ATOM   1398 C C   . CYS B 2 45  ? 32.288 113.737 17.651  1.00 10.94 ? 354 CYS B C   1 
ATOM   1399 O O   . CYS B 2 45  ? 31.653 114.790 17.666  1.00 11.16 ? 354 CYS B O   1 
ATOM   1400 C CB  . CYS B 2 45  ? 31.132 111.809 18.734  1.00 9.60  ? 354 CYS B CB  1 
ATOM   1401 S SG  . CYS B 2 45  ? 30.085 110.330 18.603  1.00 10.00 ? 354 CYS B SG  1 
ATOM   1402 N N   . ALA B 2 46  ? 33.605 113.683 17.838  1.00 11.99 ? 355 ALA B N   1 
ATOM   1403 C CA  . ALA B 2 46  ? 34.388 114.883 18.106  1.00 11.38 ? 355 ALA B CA  1 
ATOM   1404 C C   . ALA B 2 46  ? 34.428 115.799 16.895  1.00 13.19 ? 355 ALA B C   1 
ATOM   1405 O O   . ALA B 2 46  ? 34.310 117.015 17.016  1.00 14.06 ? 355 ALA B O   1 
ATOM   1406 C CB  . ALA B 2 46  ? 35.802 114.496 18.518  1.00 11.17 ? 355 ALA B CB  1 
ATOM   1407 N N   . MET B 2 47  ? 34.599 115.203 15.723  1.00 14.96 ? 356 MET B N   1 
ATOM   1408 C CA  . MET B 2 47  ? 34.663 115.956 14.479  1.00 14.75 ? 356 MET B CA  1 
ATOM   1409 C C   . MET B 2 47  ? 33.284 116.428 14.027  1.00 14.64 ? 356 MET B C   1 
ATOM   1410 O O   . MET B 2 47  ? 33.160 117.426 13.318  1.00 15.11 ? 356 MET B O   1 
ATOM   1411 C CB  . MET B 2 47  ? 35.294 115.094 13.394  1.00 14.76 ? 356 MET B CB  1 
ATOM   1412 C CG  . MET B 2 47  ? 36.692 114.609 13.743  1.00 17.62 ? 356 MET B CG  1 
ATOM   1413 S SD  . MET B 2 47  ? 37.953 115.899 13.701  1.00 16.06 ? 356 MET B SD  1 
ATOM   1414 C CE  . MET B 2 47  ? 38.132 116.230 15.452  1.00 17.86 ? 356 MET B CE  1 
ATOM   1415 N N   . LEU B 2 48  ? 32.241 115.711 14.419  1.00 14.43 ? 357 LEU B N   1 
ATOM   1416 C CA  . LEU B 2 48  ? 30.913 116.140 14.027  1.00 15.46 ? 357 LEU B CA  1 
ATOM   1417 C C   . LEU B 2 48  ? 30.588 117.409 14.805  1.00 16.37 ? 357 LEU B C   1 
ATOM   1418 O O   . LEU B 2 48  ? 30.120 118.394 14.232  1.00 17.04 ? 357 LEU B O   1 
ATOM   1419 C CB  . LEU B 2 48  ? 29.876 115.041 14.293  1.00 13.49 ? 357 LEU B CB  1 
ATOM   1420 C CG  . LEU B 2 48  ? 29.793 113.974 13.192  1.00 12.84 ? 357 LEU B CG  1 
ATOM   1421 C CD1 . LEU B 2 48  ? 28.666 112.999 13.472  1.00 12.35 ? 357 LEU B CD1 1 
ATOM   1422 C CD2 . LEU B 2 48  ? 29.571 114.663 11.853  1.00 12.13 ? 357 LEU B CD2 1 
ATOM   1423 N N   . LYS B 2 49  ? 30.883 117.390 16.101  1.00 17.03 ? 358 LYS B N   1 
ATOM   1424 C CA  . LYS B 2 49  ? 30.632 118.533 16.965  1.00 17.36 ? 358 LYS B CA  1 
ATOM   1425 C C   . LYS B 2 49  ? 31.331 119.795 16.475  1.00 19.38 ? 358 LYS B C   1 
ATOM   1426 O O   . LYS B 2 49  ? 30.699 120.854 16.390  1.00 18.96 ? 358 LYS B O   1 
ATOM   1427 C CB  . LYS B 2 49  ? 31.075 118.216 18.391  1.00 18.44 ? 358 LYS B CB  1 
ATOM   1428 C CG  . LYS B 2 49  ? 30.263 117.111 19.033  1.00 22.40 ? 358 LYS B CG  1 
ATOM   1429 C CD  . LYS B 2 49  ? 30.929 116.603 20.292  1.00 25.79 ? 358 LYS B CD  1 
ATOM   1430 C CE  . LYS B 2 49  ? 30.371 115.253 20.710  1.00 27.83 ? 358 LYS B CE  1 
ATOM   1431 N NZ  . LYS B 2 49  ? 31.367 114.500 21.535  1.00 29.62 ? 358 LYS B NZ  1 
ATOM   1432 N N   . GLN B 2 50  ? 32.621 119.683 16.140  1.00 18.47 ? 359 GLN B N   1 
ATOM   1433 C CA  . GLN B 2 50  ? 33.393 120.835 15.679  1.00 19.35 ? 359 GLN B CA  1 
ATOM   1434 C C   . GLN B 2 50  ? 33.142 121.261 14.246  1.00 18.70 ? 359 GLN B C   1 
ATOM   1435 O O   . GLN B 2 50  ? 33.236 122.448 13.935  1.00 19.30 ? 359 GLN B O   1 
ATOM   1436 C CB  . GLN B 2 50  ? 34.899 120.587 15.776  1.00 23.83 ? 359 GLN B CB  1 
ATOM   1437 C CG  . GLN B 2 50  ? 35.424 120.023 17.073  1.00 30.16 ? 359 GLN B CG  1 
ATOM   1438 C CD  . GLN B 2 50  ? 36.949 119.929 17.068  1.00 33.86 ? 359 GLN B CD  1 
ATOM   1439 O OE1 . GLN B 2 50  ? 37.544 119.177 17.847  1.00 35.85 ? 359 GLN B OE1 1 
ATOM   1440 N NE2 . GLN B 2 50  ? 37.589 120.706 16.192  1.00 34.45 ? 359 GLN B NE2 1 
ATOM   1441 N N   . TYR B 2 51  ? 32.835 120.310 13.369  1.00 16.52 ? 360 TYR B N   1 
ATOM   1442 C CA  . TYR B 2 51  ? 32.670 120.644 11.961  1.00 15.84 ? 360 TYR B CA  1 
ATOM   1443 C C   . TYR B 2 51  ? 31.342 120.434 11.254  1.00 16.14 ? 360 TYR B C   1 
ATOM   1444 O O   . TYR B 2 51  ? 31.214 120.810 10.092  1.00 17.05 ? 360 TYR B O   1 
ATOM   1445 C CB  . TYR B 2 51  ? 33.763 119.936 11.164  1.00 17.36 ? 360 TYR B CB  1 
ATOM   1446 C CG  . TYR B 2 51  ? 35.155 120.314 11.603  1.00 17.29 ? 360 TYR B CG  1 
ATOM   1447 C CD1 . TYR B 2 51  ? 35.724 121.534 11.231  1.00 18.08 ? 360 TYR B CD1 1 
ATOM   1448 C CD2 . TYR B 2 51  ? 35.902 119.460 12.402  1.00 18.05 ? 360 TYR B CD2 1 
ATOM   1449 C CE1 . TYR B 2 51  ? 37.011 121.887 11.646  1.00 17.74 ? 360 TYR B CE1 1 
ATOM   1450 C CE2 . TYR B 2 51  ? 37.186 119.803 12.823  1.00 18.90 ? 360 TYR B CE2 1 
ATOM   1451 C CZ  . TYR B 2 51  ? 37.733 121.013 12.442  1.00 18.20 ? 360 TYR B CZ  1 
ATOM   1452 O OH  . TYR B 2 51  ? 39.002 121.337 12.855  1.00 19.75 ? 360 TYR B OH  1 
ATOM   1453 N N   . ALA B 2 52  ? 30.353 119.852 11.918  1.00 16.49 ? 361 ALA B N   1 
ATOM   1454 C CA  . ALA B 2 52  ? 29.072 119.633 11.252  1.00 16.70 ? 361 ALA B CA  1 
ATOM   1455 C C   . ALA B 2 52  ? 28.507 120.913 10.620  1.00 17.65 ? 361 ALA B C   1 
ATOM   1456 O O   . ALA B 2 52  ? 27.836 120.857 9.587   1.00 18.43 ? 361 ALA B O   1 
ATOM   1457 C CB  . ALA B 2 52  ? 28.063 119.034 12.231  1.00 15.87 ? 361 ALA B CB  1 
ATOM   1458 N N   . ASP B 2 53  ? 28.787 122.063 11.223  1.00 17.97 ? 362 ASP B N   1 
ATOM   1459 C CA  . ASP B 2 53  ? 28.275 123.323 10.694  1.00 20.06 ? 362 ASP B CA  1 
ATOM   1460 C C   . ASP B 2 53  ? 29.258 124.077 9.806   1.00 20.41 ? 362 ASP B C   1 
ATOM   1461 O O   . ASP B 2 53  ? 28.986 125.205 9.405   1.00 19.32 ? 362 ASP B O   1 
ATOM   1462 C CB  . ASP B 2 53  ? 27.824 124.240 11.843  1.00 22.14 ? 362 ASP B CB  1 
ATOM   1463 C CG  . ASP B 2 53  ? 28.996 124.884 12.587  1.00 25.56 ? 362 ASP B CG  1 
ATOM   1464 O OD1 . ASP B 2 53  ? 29.927 124.165 13.008  1.00 28.70 ? 362 ASP B OD1 1 
ATOM   1465 O OD2 . ASP B 2 53  ? 28.978 126.120 12.762  1.00 28.28 ? 362 ASP B OD2 1 
ATOM   1466 N N   . LYS B 2 54  ? 30.389 123.454 9.482   1.00 21.86 ? 363 LYS B N   1 
ATOM   1467 C CA  . LYS B 2 54  ? 31.403 124.104 8.648   1.00 21.86 ? 363 LYS B CA  1 
ATOM   1468 C C   . LYS B 2 54  ? 31.880 123.313 7.428   1.00 22.20 ? 363 LYS B C   1 
ATOM   1469 O O   . LYS B 2 54  ? 32.197 123.904 6.392   1.00 22.82 ? 363 LYS B O   1 
ATOM   1470 C CB  . LYS B 2 54  ? 32.631 124.446 9.492   1.00 22.71 ? 363 LYS B CB  1 
ATOM   1471 C CG  . LYS B 2 54  ? 32.332 125.219 10.759  1.00 25.48 ? 363 LYS B CG  1 
ATOM   1472 C CD  . LYS B 2 54  ? 33.601 125.401 11.581  1.00 24.84 ? 363 LYS B CD  1 
ATOM   1473 C CE  . LYS B 2 54  ? 33.297 126.022 12.929  1.00 24.29 ? 363 LYS B CE  1 
ATOM   1474 N NZ  . LYS B 2 54  ? 32.401 125.146 13.729  1.00 26.20 ? 363 LYS B NZ  1 
ATOM   1475 N N   . LEU B 2 55  ? 31.943 121.988 7.545   1.00 20.33 ? 364 LEU B N   1 
ATOM   1476 C CA  . LEU B 2 55  ? 32.447 121.167 6.448   1.00 18.28 ? 364 LEU B CA  1 
ATOM   1477 C C   . LEU B 2 55  ? 31.486 120.179 5.817   1.00 18.24 ? 364 LEU B C   1 
ATOM   1478 O O   . LEU B 2 55  ? 30.540 119.713 6.449   1.00 18.45 ? 364 LEU B O   1 
ATOM   1479 C CB  . LEU B 2 55  ? 33.666 120.367 6.904   1.00 18.85 ? 364 LEU B CB  1 
ATOM   1480 C CG  . LEU B 2 55  ? 34.861 121.069 7.528   1.00 19.97 ? 364 LEU B CG  1 
ATOM   1481 C CD1 . LEU B 2 55  ? 35.934 120.021 7.832   1.00 20.46 ? 364 LEU B CD1 1 
ATOM   1482 C CD2 . LEU B 2 55  ? 35.392 122.136 6.589   1.00 20.92 ? 364 LEU B CD2 1 
ATOM   1483 N N   . GLU B 2 56  ? 31.774 119.846 4.562   1.00 16.40 ? 365 GLU B N   1 
ATOM   1484 C CA  . GLU B 2 56  ? 31.000 118.871 3.818   1.00 14.21 ? 365 GLU B CA  1 
ATOM   1485 C C   . GLU B 2 56  ? 31.335 117.549 4.503   1.00 14.58 ? 365 GLU B C   1 
ATOM   1486 O O   . GLU B 2 56  ? 32.449 117.370 5.004   1.00 14.06 ? 365 GLU B O   1 
ATOM   1487 C CB  . GLU B 2 56  ? 31.458 118.870 2.365   1.00 13.36 ? 365 GLU B CB  1 
ATOM   1488 C CG  . GLU B 2 56  ? 30.615 118.047 1.414   1.00 12.60 ? 365 GLU B CG  1 
ATOM   1489 C CD  . GLU B 2 56  ? 30.940 116.573 1.460   1.00 10.23 ? 365 GLU B CD  1 
ATOM   1490 O OE1 . GLU B 2 56  ? 32.137 116.242 1.596   1.00 8.32  ? 365 GLU B OE1 1 
ATOM   1491 O OE2 . GLU B 2 56  ? 30.003 115.755 1.338   1.00 8.75  ? 365 GLU B OE2 1 
ATOM   1492 N N   . PHE B 2 57  ? 30.375 116.632 4.531   1.00 14.82 ? 366 PHE B N   1 
ATOM   1493 C CA  . PHE B 2 57  ? 30.543 115.343 5.204   1.00 15.48 ? 366 PHE B CA  1 
ATOM   1494 C C   . PHE B 2 57  ? 31.742 114.473 4.806   1.00 15.50 ? 366 PHE B C   1 
ATOM   1495 O O   . PHE B 2 57  ? 32.328 113.815 5.663   1.00 15.78 ? 366 PHE B O   1 
ATOM   1496 C CB  . PHE B 2 57  ? 29.253 114.519 5.082   1.00 14.29 ? 366 PHE B CB  1 
ATOM   1497 C CG  . PHE B 2 57  ? 29.201 113.346 6.014   1.00 13.14 ? 366 PHE B CG  1 
ATOM   1498 C CD1 . PHE B 2 57  ? 29.548 113.498 7.352   1.00 12.56 ? 366 PHE B CD1 1 
ATOM   1499 C CD2 . PHE B 2 57  ? 28.797 112.096 5.566   1.00 12.24 ? 366 PHE B CD2 1 
ATOM   1500 C CE1 . PHE B 2 57  ? 29.494 112.425 8.226   1.00 12.87 ? 366 PHE B CE1 1 
ATOM   1501 C CE2 . PHE B 2 57  ? 28.739 111.014 6.440   1.00 12.17 ? 366 PHE B CE2 1 
ATOM   1502 C CZ  . PHE B 2 57  ? 29.087 111.179 7.770   1.00 12.55 ? 366 PHE B CZ  1 
ATOM   1503 N N   . MET B 2 58  ? 32.099 114.447 3.526   1.00 15.10 ? 367 MET B N   1 
ATOM   1504 C CA  . MET B 2 58  ? 33.239 113.643 3.097   1.00 16.73 ? 367 MET B CA  1 
ATOM   1505 C C   . MET B 2 58  ? 34.545 114.164 3.681   1.00 16.39 ? 367 MET B C   1 
ATOM   1506 O O   . MET B 2 58  ? 35.470 113.396 3.946   1.00 16.27 ? 367 MET B O   1 
ATOM   1507 C CB  . MET B 2 58  ? 33.342 113.609 1.576   1.00 18.12 ? 367 MET B CB  1 
ATOM   1508 C CG  . MET B 2 58  ? 32.499 112.545 0.939   1.00 20.62 ? 367 MET B CG  1 
ATOM   1509 S SD  . MET B 2 58  ? 32.831 110.927 1.665   1.00 25.07 ? 367 MET B SD  1 
ATOM   1510 C CE  . MET B 2 58  ? 31.300 110.734 2.616   1.00 23.40 ? 367 MET B CE  1 
ATOM   1511 N N   . HIS B 2 59  ? 34.604 115.474 3.889   1.00 16.23 ? 368 HIS B N   1 
ATOM   1512 C CA  . HIS B 2 59  ? 35.780 116.123 4.451   1.00 16.45 ? 368 HIS B CA  1 
ATOM   1513 C C   . HIS B 2 59  ? 35.899 115.918 5.960   1.00 15.67 ? 368 HIS B C   1 
ATOM   1514 O O   . HIS B 2 59  ? 37.003 115.891 6.510   1.00 17.34 ? 368 HIS B O   1 
ATOM   1515 C CB  . HIS B 2 59  ? 35.749 117.616 4.123   1.00 16.79 ? 368 HIS B CB  1 
ATOM   1516 C CG  . HIS B 2 59  ? 36.148 117.928 2.717   1.00 19.01 ? 368 HIS B CG  1 
ATOM   1517 N ND1 . HIS B 2 59  ? 36.249 119.216 2.243   1.00 22.24 ? 368 HIS B ND1 1 
ATOM   1518 C CD2 . HIS B 2 59  ? 36.514 117.119 1.694   1.00 19.47 ? 368 HIS B CD2 1 
ATOM   1519 C CE1 . HIS B 2 59  ? 36.664 119.189 0.987   1.00 21.29 ? 368 HIS B CE1 1 
ATOM   1520 N NE2 . HIS B 2 59  ? 36.832 117.929 0.632   1.00 19.66 ? 368 HIS B NE2 1 
ATOM   1521 N N   . ILE B 2 60  ? 34.757 115.790 6.623   1.00 14.17 ? 369 ILE B N   1 
ATOM   1522 C CA  . ILE B 2 60  ? 34.725 115.568 8.058   1.00 13.54 ? 369 ILE B CA  1 
ATOM   1523 C C   . ILE B 2 60  ? 35.288 114.170 8.336   1.00 13.95 ? 369 ILE B C   1 
ATOM   1524 O O   . ILE B 2 60  ? 36.187 114.001 9.168   1.00 13.12 ? 369 ILE B O   1 
ATOM   1525 C CB  . ILE B 2 60  ? 33.271 115.667 8.590   1.00 13.83 ? 369 ILE B CB  1 
ATOM   1526 C CG1 . ILE B 2 60  ? 32.754 117.098 8.397   1.00 13.82 ? 369 ILE B CG1 1 
ATOM   1527 C CG2 . ILE B 2 60  ? 33.204 115.237 10.055  1.00 13.46 ? 369 ILE B CG2 1 
ATOM   1528 C CD1 . ILE B 2 60  ? 31.288 117.277 8.693   1.00 11.91 ? 369 ILE B CD1 1 
ATOM   1529 N N   . LEU B 2 61  ? 34.766 113.172 7.625   1.00 12.48 ? 370 LEU B N   1 
ATOM   1530 C CA  . LEU B 2 61  ? 35.222 111.800 7.804   1.00 13.22 ? 370 LEU B CA  1 
ATOM   1531 C C   . LEU B 2 61  ? 36.715 111.690 7.538   1.00 13.30 ? 370 LEU B C   1 
ATOM   1532 O O   . LEU B 2 61  ? 37.394 110.859 8.132   1.00 14.26 ? 370 LEU B O   1 
ATOM   1533 C CB  . LEU B 2 61  ? 34.457 110.844 6.879   1.00 11.40 ? 370 LEU B CB  1 
ATOM   1534 C CG  . LEU B 2 61  ? 32.999 110.564 7.242   1.00 10.20 ? 370 LEU B CG  1 
ATOM   1535 C CD1 . LEU B 2 61  ? 32.376 109.659 6.195   1.00 10.66 ? 370 LEU B CD1 1 
ATOM   1536 C CD2 . LEU B 2 61  ? 32.931 109.925 8.618   1.00 8.77  ? 370 LEU B CD2 1 
ATOM   1537 N N   . THR B 2 62  ? 37.224 112.528 6.642   1.00 13.36 ? 371 THR B N   1 
ATOM   1538 C CA  . THR B 2 62  ? 38.644 112.509 6.331   1.00 14.32 ? 371 THR B CA  1 
ATOM   1539 C C   . THR B 2 62  ? 39.417 112.960 7.565   1.00 14.97 ? 371 THR B C   1 
ATOM   1540 O O   . THR B 2 62  ? 40.507 112.441 7.850   1.00 12.12 ? 371 THR B O   1 
ATOM   1541 C CB  . THR B 2 62  ? 38.963 113.423 5.138   1.00 14.41 ? 371 THR B CB  1 
ATOM   1542 O OG1 . THR B 2 62  ? 38.279 112.937 3.976   1.00 14.07 ? 371 THR B OG1 1 
ATOM   1543 C CG2 . THR B 2 62  ? 40.456 113.428 4.856   1.00 14.44 ? 371 THR B CG2 1 
ATOM   1544 N N   . ARG B 2 63  ? 38.832 113.919 8.290   1.00 16.05 ? 372 ARG B N   1 
ATOM   1545 C CA  . ARG B 2 63  ? 39.399 114.452 9.529   1.00 17.34 ? 372 ARG B CA  1 
ATOM   1546 C C   . ARG B 2 63  ? 39.456 113.327 10.555  1.00 18.88 ? 372 ARG B C   1 
ATOM   1547 O O   . ARG B 2 63  ? 40.419 113.205 11.322  1.00 20.05 ? 372 ARG B O   1 
ATOM   1548 C CB  . ARG B 2 63  ? 38.507 115.553 10.088  1.00 20.54 ? 372 ARG B CB  1 
ATOM   1549 C CG  . ARG B 2 63  ? 38.454 116.816 9.270   1.00 23.52 ? 372 ARG B CG  1 
ATOM   1550 C CD  . ARG B 2 63  ? 39.728 117.592 9.414   1.00 23.18 ? 372 ARG B CD  1 
ATOM   1551 N NE  . ARG B 2 63  ? 39.550 118.969 8.980   1.00 27.30 ? 372 ARG B NE  1 
ATOM   1552 C CZ  . ARG B 2 63  ? 39.992 120.020 9.664   1.00 28.85 ? 372 ARG B CZ  1 
ATOM   1553 N NH1 . ARG B 2 63  ? 40.635 119.845 10.814  1.00 30.24 ? 372 ARG B NH1 1 
ATOM   1554 N NH2 . ARG B 2 63  ? 39.796 121.243 9.200   1.00 30.68 ? 372 ARG B NH2 1 
ATOM   1555 N N   . VAL B 2 64  ? 38.395 112.520 10.566  1.00 17.91 ? 373 VAL B N   1 
ATOM   1556 C CA  . VAL B 2 64  ? 38.273 111.380 11.460  1.00 16.81 ? 373 VAL B CA  1 
ATOM   1557 C C   . VAL B 2 64  ? 39.327 110.339 11.105  1.00 17.16 ? 373 VAL B C   1 
ATOM   1558 O O   . VAL B 2 64  ? 39.863 109.668 11.981  1.00 18.05 ? 373 VAL B O   1 
ATOM   1559 C CB  . VAL B 2 64  ? 36.870 110.745 11.352  1.00 16.89 ? 373 VAL B CB  1 
ATOM   1560 C CG1 . VAL B 2 64  ? 36.764 109.522 12.256  1.00 16.92 ? 373 VAL B CG1 1 
ATOM   1561 C CG2 . VAL B 2 64  ? 35.821 111.775 11.730  1.00 16.04 ? 373 VAL B CG2 1 
ATOM   1562 N N   . ASN B 2 65  ? 39.621 110.198 9.818   1.00 16.68 ? 374 ASN B N   1 
ATOM   1563 C CA  . ASN B 2 65  ? 40.638 109.250 9.393   1.00 17.04 ? 374 ASN B CA  1 
ATOM   1564 C C   . ASN B 2 65  ? 41.987 109.678 9.966   1.00 16.88 ? 374 ASN B C   1 
ATOM   1565 O O   . ASN B 2 65  ? 42.694 108.873 10.575  1.00 17.70 ? 374 ASN B O   1 
ATOM   1566 C CB  . ASN B 2 65  ? 40.726 109.195 7.870   1.00 17.44 ? 374 ASN B CB  1 
ATOM   1567 C CG  . ASN B 2 65  ? 39.585 108.431 7.249   1.00 18.56 ? 374 ASN B CG  1 
ATOM   1568 O OD1 . ASN B 2 65  ? 38.795 107.800 7.947   1.00 19.74 ? 374 ASN B OD1 1 
ATOM   1569 N ND2 . ASN B 2 65  ? 39.499 108.472 5.926   1.00 20.03 ? 374 ASN B ND2 1 
ATOM   1570 N N   . ARG B 2 66  ? 42.333 110.949 9.779   1.00 16.87 ? 375 ARG B N   1 
ATOM   1571 C CA  . ARG B 2 66  ? 43.597 111.473 10.287  1.00 17.32 ? 375 ARG B CA  1 
ATOM   1572 C C   . ARG B 2 66  ? 43.706 111.343 11.803  1.00 16.45 ? 375 ARG B C   1 
ATOM   1573 O O   . ARG B 2 66  ? 44.771 111.018 12.322  1.00 17.48 ? 375 ARG B O   1 
ATOM   1574 C CB  . ARG B 2 66  ? 43.783 112.950 9.886   1.00 17.85 ? 375 ARG B CB  1 
ATOM   1575 C CG  . ARG B 2 66  ? 45.078 113.580 10.417  1.00 17.07 ? 375 ARG B CG  1 
ATOM   1576 C CD  . ARG B 2 66  ? 45.525 114.816 9.619   1.00 21.82 ? 375 ARG B CD  1 
ATOM   1577 N NE  . ARG B 2 66  ? 44.719 116.024 9.858   1.00 26.61 ? 375 ARG B NE  1 
ATOM   1578 C CZ  . ARG B 2 66  ? 43.782 116.516 9.035   1.00 25.58 ? 375 ARG B CZ  1 
ATOM   1579 N NH1 . ARG B 2 66  ? 43.489 115.924 7.879   1.00 24.97 ? 375 ARG B NH1 1 
ATOM   1580 N NH2 . ARG B 2 66  ? 43.135 117.622 9.372   1.00 24.53 ? 375 ARG B NH2 1 
ATOM   1581 N N   . LYS B 2 67  ? 42.610 111.581 12.515  1.00 15.41 ? 376 LYS B N   1 
ATOM   1582 C CA  . LYS B 2 67  ? 42.658 111.496 13.964  1.00 15.74 ? 376 LYS B CA  1 
ATOM   1583 C C   . LYS B 2 67  ? 42.917 110.076 14.451  1.00 15.10 ? 376 LYS B C   1 
ATOM   1584 O O   . LYS B 2 67  ? 43.830 109.843 15.235  1.00 14.72 ? 376 LYS B O   1 
ATOM   1585 C CB  . LYS B 2 67  ? 41.363 112.033 14.575  1.00 18.97 ? 376 LYS B CB  1 
ATOM   1586 C CG  . LYS B 2 67  ? 41.578 112.661 15.947  1.00 22.24 ? 376 LYS B CG  1 
ATOM   1587 C CD  . LYS B 2 67  ? 40.280 112.857 16.719  1.00 23.68 ? 376 LYS B CD  1 
ATOM   1588 C CE  . LYS B 2 67  ? 40.572 113.528 18.057  1.00 26.43 ? 376 LYS B CE  1 
ATOM   1589 N NZ  . LYS B 2 67  ? 39.421 113.495 18.993  1.00 27.50 ? 376 LYS B NZ  1 
ATOM   1590 N N   . VAL B 2 68  ? 42.109 109.127 13.988  1.00 14.97 ? 377 VAL B N   1 
ATOM   1591 C CA  . VAL B 2 68  ? 42.266 107.730 14.380  1.00 12.32 ? 377 VAL B CA  1 
ATOM   1592 C C   . VAL B 2 68  ? 43.651 107.243 13.981  1.00 13.48 ? 377 VAL B C   1 
ATOM   1593 O O   . VAL B 2 68  ? 44.338 106.587 14.763  1.00 13.22 ? 377 VAL B O   1 
ATOM   1594 C CB  . VAL B 2 68  ? 41.198 106.820 13.700  1.00 10.72 ? 377 VAL B CB  1 
ATOM   1595 C CG1 . VAL B 2 68  ? 41.514 105.347 13.961  1.00 9.68  ? 377 VAL B CG1 1 
ATOM   1596 C CG2 . VAL B 2 68  ? 39.811 107.153 14.223  1.00 10.28 ? 377 VAL B CG2 1 
ATOM   1597 N N   . ALA B 2 69  ? 44.065 107.578 12.762  1.00 13.31 ? 378 ALA B N   1 
ATOM   1598 C CA  . ALA B 2 69  ? 45.365 107.146 12.262  1.00 13.97 ? 378 ALA B CA  1 
ATOM   1599 C C   . ALA B 2 69  ? 46.528 107.751 13.029  1.00 14.61 ? 378 ALA B C   1 
ATOM   1600 O O   . ALA B 2 69  ? 47.533 107.091 13.283  1.00 16.93 ? 378 ALA B O   1 
ATOM   1601 C CB  . ALA B 2 69  ? 45.498 107.485 10.779  1.00 10.95 ? 378 ALA B CB  1 
ATOM   1602 N N   . THR B 2 70  ? 46.372 109.007 13.408  1.00 15.93 ? 379 THR B N   1 
ATOM   1603 C CA  . THR B 2 70  ? 47.410 109.750 14.102  1.00 16.73 ? 379 THR B CA  1 
ATOM   1604 C C   . THR B 2 70  ? 47.511 109.585 15.612  1.00 16.88 ? 379 THR B C   1 
ATOM   1605 O O   . THR B 2 70  ? 48.542 109.181 16.132  1.00 19.33 ? 379 THR B O   1 
ATOM   1606 C CB  . THR B 2 70  ? 47.249 111.250 13.800  1.00 16.49 ? 379 THR B CB  1 
ATOM   1607 O OG1 . THR B 2 70  ? 47.503 111.477 12.410  1.00 15.13 ? 379 THR B OG1 1 
ATOM   1608 C CG2 . THR B 2 70  ? 48.194 112.088 14.650  1.00 18.98 ? 379 THR B CG2 1 
ATOM   1609 N N   . GLU B 2 71  A 46.429 109.899 16.304  1.00 18.01 ? 379 GLU B N   1 
ATOM   1610 C CA  . GLU B 2 71  A 46.394 109.873 17.753  1.00 19.42 ? 379 GLU B CA  1 
ATOM   1611 C C   . GLU B 2 71  A 46.095 108.582 18.509  1.00 21.11 ? 379 GLU B C   1 
ATOM   1612 O O   . GLU B 2 71  A 45.948 108.630 19.725  1.00 23.35 ? 379 GLU B O   1 
ATOM   1613 C CB  . GLU B 2 71  A 45.423 110.959 18.224  1.00 21.73 ? 379 GLU B CB  1 
ATOM   1614 C CG  . GLU B 2 71  A 45.892 112.382 17.939  1.00 22.57 ? 379 GLU B CG  1 
ATOM   1615 C CD  . GLU B 2 71  A 44.745 113.315 17.603  1.00 25.34 ? 379 GLU B CD  1 
ATOM   1616 O OE1 . GLU B 2 71  A 43.692 113.222 18.272  1.00 24.96 ? 379 GLU B OE1 1 
ATOM   1617 O OE2 . GLU B 2 71  A 44.897 114.143 16.674  1.00 25.99 ? 379 GLU B OE2 1 
ATOM   1618 N N   . PHE B 2 72  ? 46.007 107.436 17.837  1.00 21.22 ? 380 PHE B N   1 
ATOM   1619 C CA  . PHE B 2 72  ? 45.717 106.188 18.553  1.00 18.78 ? 380 PHE B CA  1 
ATOM   1620 C C   . PHE B 2 72  ? 46.703 105.071 18.265  1.00 20.46 ? 380 PHE B C   1 
ATOM   1621 O O   . PHE B 2 72  ? 47.190 104.917 17.145  1.00 20.64 ? 380 PHE B O   1 
ATOM   1622 C CB  . PHE B 2 72  ? 44.299 105.701 18.242  1.00 17.21 ? 380 PHE B CB  1 
ATOM   1623 C CG  . PHE B 2 72  ? 43.221 106.589 18.787  1.00 14.69 ? 380 PHE B CG  1 
ATOM   1624 C CD1 . PHE B 2 72  ? 42.754 106.428 20.082  1.00 12.91 ? 380 PHE B CD1 1 
ATOM   1625 C CD2 . PHE B 2 72  ? 42.700 107.618 18.012  1.00 14.24 ? 380 PHE B CD2 1 
ATOM   1626 C CE1 . PHE B 2 72  ? 41.781 107.284 20.600  1.00 13.42 ? 380 PHE B CE1 1 
ATOM   1627 C CE2 . PHE B 2 72  ? 41.731 108.473 18.520  1.00 12.72 ? 380 PHE B CE2 1 
ATOM   1628 C CZ  . PHE B 2 72  ? 41.269 108.308 19.815  1.00 11.98 ? 380 PHE B CZ  1 
ATOM   1629 N N   . GLU B 2 73  ? 46.987 104.291 19.300  1.00 20.68 ? 381 GLU B N   1 
ATOM   1630 C CA  . GLU B 2 73  ? 47.911 103.179 19.207  1.00 19.64 ? 381 GLU B CA  1 
ATOM   1631 C C   . GLU B 2 73  ? 47.628 102.273 20.395  1.00 20.56 ? 381 GLU B C   1 
ATOM   1632 O O   . GLU B 2 73  ? 47.658 102.715 21.548  1.00 19.57 ? 381 GLU B O   1 
ATOM   1633 C CB  . GLU B 2 73  ? 49.346 103.688 19.255  1.00 20.22 ? 381 GLU B CB  1 
ATOM   1634 C CG  . GLU B 2 73  ? 50.369 102.660 18.822  1.00 22.27 ? 381 GLU B CG  1 
ATOM   1635 C CD  . GLU B 2 73  ? 51.752 103.250 18.681  1.00 22.74 ? 381 GLU B CD  1 
ATOM   1636 O OE1 . GLU B 2 73  ? 51.868 104.357 18.109  1.00 25.51 ? 381 GLU B OE1 1 
ATOM   1637 O OE2 . GLU B 2 73  ? 52.719 102.605 19.129  1.00 24.58 ? 381 GLU B OE2 1 
ATOM   1638 N N   . SER B 2 74  A 47.349 101.006 20.103  1.00 20.64 ? 381 SER B N   1 
ATOM   1639 C CA  . SER B 2 74  A 47.019 100.035 21.136  1.00 20.85 ? 381 SER B CA  1 
ATOM   1640 C C   . SER B 2 74  A 48.183 99.706  22.052  1.00 22.11 ? 381 SER B C   1 
ATOM   1641 O O   . SER B 2 74  A 49.355 99.813  21.676  1.00 22.54 ? 381 SER B O   1 
ATOM   1642 C CB  . SER B 2 74  A 46.519 98.740  20.508  1.00 19.11 ? 381 SER B CB  1 
ATOM   1643 O OG  . SER B 2 74  A 47.608 97.992  20.015  1.00 17.63 ? 381 SER B OG  1 
ATOM   1644 N N   . PHE B 2 75  B 47.832 99.302  23.265  1.00 22.21 ? 381 PHE B N   1 
ATOM   1645 C CA  . PHE B 2 75  B 48.797 98.931  24.282  1.00 22.24 ? 381 PHE B CA  1 
ATOM   1646 C C   . PHE B 2 75  B 48.307 97.608  24.858  1.00 21.98 ? 381 PHE B C   1 
ATOM   1647 O O   . PHE B 2 75  B 47.128 97.468  25.192  1.00 21.40 ? 381 PHE B O   1 
ATOM   1648 C CB  . PHE B 2 75  B 48.857 100.012 25.369  1.00 21.77 ? 381 PHE B CB  1 
ATOM   1649 C CG  . PHE B 2 75  B 49.777 99.678  26.512  1.00 24.04 ? 381 PHE B CG  1 
ATOM   1650 C CD1 . PHE B 2 75  B 49.352 98.853  27.557  1.00 23.50 ? 381 PHE B CD1 1 
ATOM   1651 C CD2 . PHE B 2 75  B 51.077 100.176 26.540  1.00 23.04 ? 381 PHE B CD2 1 
ATOM   1652 C CE1 . PHE B 2 75  B 50.214 98.531  28.615  1.00 24.00 ? 381 PHE B CE1 1 
ATOM   1653 C CE2 . PHE B 2 75  B 51.939 99.861  27.591  1.00 24.20 ? 381 PHE B CE2 1 
ATOM   1654 C CZ  . PHE B 2 75  B 51.507 99.037  28.628  1.00 23.63 ? 381 PHE B CZ  1 
ATOM   1655 N N   . SER B 2 76  C 49.203 96.634  24.961  1.00 21.91 ? 381 SER B N   1 
ATOM   1656 C CA  . SER B 2 76  C 48.817 95.332  25.488  1.00 21.74 ? 381 SER B CA  1 
ATOM   1657 C C   . SER B 2 76  C 50.032 94.549  25.953  1.00 21.19 ? 381 SER B C   1 
ATOM   1658 O O   . SER B 2 76  C 51.142 94.762  25.463  1.00 19.80 ? 381 SER B O   1 
ATOM   1659 C CB  . SER B 2 76  C 48.073 94.536  24.416  1.00 21.51 ? 381 SER B CB  1 
ATOM   1660 O OG  . SER B 2 76  C 47.218 93.575  25.011  1.00 26.51 ? 381 SER B OG  1 
ATOM   1661 N N   . PHE B 2 77  D 49.815 93.646  26.905  1.00 20.67 ? 381 PHE B N   1 
ATOM   1662 C CA  . PHE B 2 77  D 50.890 92.820  27.435  1.00 20.40 ? 381 PHE B CA  1 
ATOM   1663 C C   . PHE B 2 77  D 51.144 91.695  26.451  1.00 19.79 ? 381 PHE B C   1 
ATOM   1664 O O   . PHE B 2 77  D 52.178 91.026  26.493  1.00 20.59 ? 381 PHE B O   1 
ATOM   1665 C CB  . PHE B 2 77  D 50.498 92.272  28.798  1.00 20.01 ? 381 PHE B CB  1 
ATOM   1666 C CG  . PHE B 2 77  D 50.114 93.337  29.780  1.00 21.35 ? 381 PHE B CG  1 
ATOM   1667 C CD1 . PHE B 2 77  D 51.010 94.349  30.121  1.00 21.51 ? 381 PHE B CD1 1 
ATOM   1668 C CD2 . PHE B 2 77  D 48.851 93.342  30.358  1.00 22.61 ? 381 PHE B CD2 1 
ATOM   1669 C CE1 . PHE B 2 77  D 50.654 95.351  31.026  1.00 21.57 ? 381 PHE B CE1 1 
ATOM   1670 C CE2 . PHE B 2 77  D 48.480 94.343  31.268  1.00 22.68 ? 381 PHE B CE2 1 
ATOM   1671 C CZ  . PHE B 2 77  D 49.383 95.348  31.601  1.00 22.28 ? 381 PHE B CZ  1 
ATOM   1672 N N   . ASP B 2 78  E 50.191 91.513  25.547  1.00 18.74 ? 381 ASP B N   1 
ATOM   1673 C CA  . ASP B 2 78  E 50.286 90.494  24.515  1.00 18.07 ? 381 ASP B CA  1 
ATOM   1674 C C   . ASP B 2 78  E 51.005 91.122  23.315  1.00 16.16 ? 381 ASP B C   1 
ATOM   1675 O O   . ASP B 2 78  E 50.436 91.947  22.606  1.00 16.35 ? 381 ASP B O   1 
ATOM   1676 C CB  . ASP B 2 78  E 48.878 90.046  24.116  1.00 18.69 ? 381 ASP B CB  1 
ATOM   1677 C CG  . ASP B 2 78  E 48.880 88.805  23.254  1.00 18.10 ? 381 ASP B CG  1 
ATOM   1678 O OD1 . ASP B 2 78  E 49.864 88.571  22.527  1.00 16.97 ? 381 ASP B OD1 1 
ATOM   1679 O OD2 . ASP B 2 78  E 47.877 88.068  23.290  1.00 20.82 ? 381 ASP B OD2 1 
ATOM   1680 N N   . ALA B 2 79  F 52.253 90.724  23.096  1.00 15.27 ? 381 ALA B N   1 
ATOM   1681 C CA  . ALA B 2 79  F 53.069 91.250  21.998  1.00 14.05 ? 381 ALA B CA  1 
ATOM   1682 C C   . ALA B 2 79  F 52.381 91.318  20.635  1.00 13.68 ? 381 ALA B C   1 
ATOM   1683 O O   . ALA B 2 79  F 52.581 92.271  19.882  1.00 13.24 ? 381 ALA B O   1 
ATOM   1684 C CB  . ALA B 2 79  F 54.344 90.439  21.881  1.00 12.87 ? 381 ALA B CB  1 
ATOM   1685 N N   . THR B 2 80  G 51.586 90.302  20.317  1.00 13.54 ? 381 THR B N   1 
ATOM   1686 C CA  . THR B 2 80  G 50.879 90.239  19.041  1.00 15.10 ? 381 THR B CA  1 
ATOM   1687 C C   . THR B 2 80  G 49.919 91.418  18.825  1.00 16.45 ? 381 THR B C   1 
ATOM   1688 O O   . THR B 2 80  G 49.683 91.840  17.691  1.00 16.87 ? 381 THR B O   1 
ATOM   1689 C CB  . THR B 2 80  G 50.079 88.915  18.925  1.00 14.47 ? 381 THR B CB  1 
ATOM   1690 O OG1 . THR B 2 80  G 50.962 87.807  19.122  1.00 16.00 ? 381 THR B OG1 1 
ATOM   1691 C CG2 . THR B 2 80  G 49.442 88.784  17.555  1.00 13.69 ? 381 THR B CG2 1 
ATOM   1692 N N   . PHE B 2 81  H 49.375 91.958  19.913  1.00 16.54 ? 381 PHE B N   1 
ATOM   1693 C CA  . PHE B 2 81  H 48.431 93.066  19.812  1.00 16.24 ? 381 PHE B CA  1 
ATOM   1694 C C   . PHE B 2 81  H 48.972 94.414  20.271  1.00 15.24 ? 381 PHE B C   1 
ATOM   1695 O O   . PHE B 2 81  H 48.262 95.416  20.223  1.00 12.90 ? 381 PHE B O   1 
ATOM   1696 C CB  . PHE B 2 81  H 47.165 92.744  20.609  1.00 16.82 ? 381 PHE B CB  1 
ATOM   1697 C CG  . PHE B 2 81  H 46.461 91.516  20.143  1.00 16.75 ? 381 PHE B CG  1 
ATOM   1698 C CD1 . PHE B 2 81  H 47.005 90.259  20.373  1.00 18.78 ? 381 PHE B CD1 1 
ATOM   1699 C CD2 . PHE B 2 81  H 45.261 91.607  19.462  1.00 17.52 ? 381 PHE B CD2 1 
ATOM   1700 C CE1 . PHE B 2 81  H 46.361 89.113  19.933  1.00 16.83 ? 381 PHE B CE1 1 
ATOM   1701 C CE2 . PHE B 2 81  H 44.615 90.464  19.019  1.00 16.60 ? 381 PHE B CE2 1 
ATOM   1702 C CZ  . PHE B 2 81  H 45.171 89.217  19.258  1.00 15.90 ? 381 PHE B CZ  1 
ATOM   1703 N N   . HIS B 2 82  I 50.225 94.442  20.706  1.00 14.89 ? 381 HIS B N   1 
ATOM   1704 C CA  . HIS B 2 82  I 50.812 95.680  21.189  1.00 14.36 ? 381 HIS B CA  1 
ATOM   1705 C C   . HIS B 2 82  I 51.262 96.602  20.075  1.00 14.61 ? 381 HIS B C   1 
ATOM   1706 O O   . HIS B 2 82  I 51.762 96.149  19.050  1.00 14.88 ? 381 HIS B O   1 
ATOM   1707 C CB  . HIS B 2 82  I 51.992 95.383  22.115  1.00 14.92 ? 381 HIS B CB  1 
ATOM   1708 C CG  . HIS B 2 82  I 52.597 96.611  22.720  1.00 14.24 ? 381 HIS B CG  1 
ATOM   1709 N ND1 . HIS B 2 82  I 51.857 97.527  23.433  1.00 16.34 ? 381 HIS B ND1 1 
ATOM   1710 C CD2 . HIS B 2 82  I 53.859 97.095  22.679  1.00 13.77 ? 381 HIS B CD2 1 
ATOM   1711 C CE1 . HIS B 2 82  I 52.636 98.528  23.804  1.00 15.56 ? 381 HIS B CE1 1 
ATOM   1712 N NE2 . HIS B 2 82  I 53.855 98.289  23.358  1.00 13.89 ? 381 HIS B NE2 1 
ATOM   1713 N N   . ALA B 2 83  ? 51.076 97.901  20.297  1.00 14.36 ? 382 ALA B N   1 
ATOM   1714 C CA  . ALA B 2 83  ? 51.468 98.944  19.351  1.00 14.37 ? 382 ALA B CA  1 
ATOM   1715 C C   . ALA B 2 83  ? 50.907 98.749  17.945  1.00 14.61 ? 382 ALA B C   1 
ATOM   1716 O O   . ALA B 2 83  ? 51.649 98.740  16.962  1.00 16.51 ? 382 ALA B O   1 
ATOM   1717 C CB  . ALA B 2 83  ? 52.985 99.045  19.298  1.00 11.73 ? 382 ALA B CB  1 
ATOM   1718 N N   . LYS B 2 84  ? 49.594 98.592  17.851  1.00 14.44 ? 383 LYS B N   1 
ATOM   1719 C CA  . LYS B 2 84  ? 48.958 98.419  16.560  1.00 13.77 ? 383 LYS B CA  1 
ATOM   1720 C C   . LYS B 2 84  ? 48.198 99.685  16.209  1.00 13.48 ? 383 LYS B C   1 
ATOM   1721 O O   . LYS B 2 84  ? 47.674 100.379 17.079  1.00 13.47 ? 383 LYS B O   1 
ATOM   1722 C CB  . LYS B 2 84  ? 48.010 97.221  16.577  1.00 14.80 ? 383 LYS B CB  1 
ATOM   1723 C CG  . LYS B 2 84  ? 48.682 95.925  16.950  1.00 14.82 ? 383 LYS B CG  1 
ATOM   1724 C CD  . LYS B 2 84  ? 49.877 95.688  16.052  1.00 19.39 ? 383 LYS B CD  1 
ATOM   1725 C CE  . LYS B 2 84  ? 50.635 94.442  16.446  1.00 19.72 ? 383 LYS B CE  1 
ATOM   1726 N NZ  . LYS B 2 84  ? 51.786 94.261  15.534  1.00 23.30 ? 383 LYS B NZ  1 
ATOM   1727 N N   . LYS B 2 85  ? 48.156 99.974  14.920  1.00 13.25 ? 384 LYS B N   1 
ATOM   1728 C CA  . LYS B 2 85  ? 47.497 101.154 14.406  1.00 12.57 ? 384 LYS B CA  1 
ATOM   1729 C C   . LYS B 2 85  ? 46.177 100.773 13.744  1.00 12.34 ? 384 LYS B C   1 
ATOM   1730 O O   . LYS B 2 85  ? 45.845 99.594  13.676  1.00 11.85 ? 384 LYS B O   1 
ATOM   1731 C CB  . LYS B 2 85  ? 48.440 101.841 13.413  1.00 14.85 ? 384 LYS B CB  1 
ATOM   1732 C CG  . LYS B 2 85  ? 49.440 102.789 14.074  1.00 13.15 ? 384 LYS B CG  1 
ATOM   1733 C CD  . LYS B 2 85  ? 48.706 104.058 14.458  1.00 15.91 ? 384 LYS B CD  1 
ATOM   1734 C CE  . LYS B 2 85  ? 49.582 105.033 15.187  1.00 17.23 ? 384 LYS B CE  1 
ATOM   1735 N NZ  . LYS B 2 85  ? 48.846 106.294 15.466  1.00 17.17 ? 384 LYS B NZ  1 
ATOM   1736 N N   . GLN B 2 86  ? 45.421 101.768 13.283  1.00 11.93 ? 385 GLN B N   1 
ATOM   1737 C CA  . GLN B 2 86  ? 44.144 101.528 12.619  1.00 10.71 ? 385 GLN B CA  1 
ATOM   1738 C C   . GLN B 2 86  ? 43.773 102.681 11.697  1.00 10.57 ? 385 GLN B C   1 
ATOM   1739 O O   . GLN B 2 86  ? 44.016 103.839 12.015  1.00 11.82 ? 385 GLN B O   1 
ATOM   1740 C CB  . GLN B 2 86  ? 43.029 101.325 13.650  1.00 10.93 ? 385 GLN B CB  1 
ATOM   1741 C CG  . GLN B 2 86  ? 41.636 101.204 13.028  1.00 11.11 ? 385 GLN B CG  1 
ATOM   1742 C CD  . GLN B 2 86  ? 40.535 101.054 14.058  1.00 11.19 ? 385 GLN B CD  1 
ATOM   1743 O OE1 . GLN B 2 86  ? 40.515 100.090 14.822  1.00 11.17 ? 385 GLN B OE1 1 
ATOM   1744 N NE2 . GLN B 2 86  ? 39.612 102.011 14.086  1.00 10.01 ? 385 GLN B NE2 1 
ATOM   1745 N N   . ILE B 2 87  ? 43.180 102.362 10.554  1.00 10.87 ? 386 ILE B N   1 
ATOM   1746 C CA  . ILE B 2 87  ? 42.766 103.383 9.597   1.00 10.57 ? 386 ILE B CA  1 
ATOM   1747 C C   . ILE B 2 87  ? 41.308 103.148 9.201   1.00 11.04 ? 386 ILE B C   1 
ATOM   1748 O O   . ILE B 2 87  ? 40.951 102.072 8.730   1.00 11.94 ? 386 ILE B O   1 
ATOM   1749 C CB  . ILE B 2 87  ? 43.699 103.368 8.329   1.00 10.61 ? 386 ILE B CB  1 
ATOM   1750 C CG1 . ILE B 2 87  ? 43.224 104.377 7.284   1.00 9.29  ? 386 ILE B CG1 1 
ATOM   1751 C CG2 . ILE B 2 87  ? 43.759 101.975 7.733   1.00 8.83  ? 386 ILE B CG2 1 
ATOM   1752 C CD1 . ILE B 2 87  ? 43.310 105.812 7.721   1.00 8.27  ? 386 ILE B CD1 1 
ATOM   1753 N N   . PRO B 2 88  ? 40.435 104.146 9.422   1.00 11.70 ? 387 PRO B N   1 
ATOM   1754 C CA  . PRO B 2 88  ? 39.027 103.975 9.056   1.00 11.17 ? 387 PRO B CA  1 
ATOM   1755 C C   . PRO B 2 88  ? 38.909 103.877 7.539   1.00 11.54 ? 387 PRO B C   1 
ATOM   1756 O O   . PRO B 2 88  ? 39.817 104.288 6.828   1.00 11.79 ? 387 PRO B O   1 
ATOM   1757 C CB  . PRO B 2 88  ? 38.374 105.238 9.607   1.00 10.63 ? 387 PRO B CB  1 
ATOM   1758 C CG  . PRO B 2 88  ? 39.248 105.596 10.757  1.00 10.63 ? 387 PRO B CG  1 
ATOM   1759 C CD  . PRO B 2 88  ? 40.621 105.393 10.181  1.00 10.49 ? 387 PRO B CD  1 
ATOM   1760 N N   . CYS B 2 89  ? 37.797 103.338 7.047   1.00 11.68 ? 388 CYS B N   1 
ATOM   1761 C CA  . CYS B 2 89  ? 37.588 103.193 5.609   1.00 10.70 ? 388 CYS B CA  1 
ATOM   1762 C C   . CYS B 2 89  ? 36.253 103.794 5.186   1.00 10.29 ? 388 CYS B C   1 
ATOM   1763 O O   . CYS B 2 89  ? 35.198 103.337 5.621   1.00 9.11  ? 388 CYS B O   1 
ATOM   1764 C CB  . CYS B 2 89  ? 37.636 101.709 5.225   1.00 11.66 ? 388 CYS B CB  1 
ATOM   1765 S SG  . CYS B 2 89  ? 37.368 101.317 3.463   1.00 19.22 ? 388 CYS B SG  1 
ATOM   1766 N N   . ILE B 2 90  ? 36.310 104.827 4.346   1.00 8.75  ? 389 ILE B N   1 
ATOM   1767 C CA  . ILE B 2 90  ? 35.114 105.493 3.838   1.00 9.08  ? 389 ILE B CA  1 
ATOM   1768 C C   . ILE B 2 90  ? 34.717 104.825 2.535   1.00 10.40 ? 389 ILE B C   1 
ATOM   1769 O O   . ILE B 2 90  ? 35.570 104.565 1.693   1.00 12.71 ? 389 ILE B O   1 
ATOM   1770 C CB  . ILE B 2 90  ? 35.363 106.989 3.519   1.00 8.56  ? 389 ILE B CB  1 
ATOM   1771 C CG1 . ILE B 2 90  ? 35.731 107.746 4.783   1.00 10.52 ? 389 ILE B CG1 1 
ATOM   1772 C CG2 . ILE B 2 90  ? 34.122 107.611 2.909   1.00 7.14  ? 389 ILE B CG2 1 
ATOM   1773 C CD1 . ILE B 2 90  ? 36.268 109.142 4.512   1.00 11.43 ? 389 ILE B CD1 1 
ATOM   1774 N N   . VAL B 2 91  ? 33.432 104.537 2.372   1.00 9.08  ? 390 VAL B N   1 
ATOM   1775 C CA  . VAL B 2 91  ? 32.954 103.928 1.141   1.00 8.58  ? 390 VAL B CA  1 
ATOM   1776 C C   . VAL B 2 91  ? 31.734 104.722 0.720   1.00 9.39  ? 390 VAL B C   1 
ATOM   1777 O O   . VAL B 2 91  ? 30.656 104.592 1.304   1.00 9.45  ? 390 VAL B O   1 
ATOM   1778 C CB  . VAL B 2 91  ? 32.563 102.448 1.326   1.00 9.94  ? 390 VAL B CB  1 
ATOM   1779 C CG1 . VAL B 2 91  ? 32.303 101.819 -0.041  1.00 8.59  ? 390 VAL B CG1 1 
ATOM   1780 C CG2 . VAL B 2 91  ? 33.672 101.696 2.066   1.00 6.73  ? 390 VAL B CG2 1 
ATOM   1781 N N   . SER B 2 92  ? 31.922 105.563 -0.291  1.00 9.48  ? 392 SER B N   1 
ATOM   1782 C CA  . SER B 2 92  ? 30.861 106.418 -0.774  1.00 9.65  ? 392 SER B CA  1 
ATOM   1783 C C   . SER B 2 92  ? 30.338 106.091 -2.158  1.00 11.16 ? 392 SER B C   1 
ATOM   1784 O O   . SER B 2 92  ? 31.091 105.823 -3.086  1.00 11.01 ? 392 SER B O   1 
ATOM   1785 C CB  . SER B 2 92  ? 31.317 107.877 -0.747  1.00 9.67  ? 392 SER B CB  1 
ATOM   1786 O OG  . SER B 2 92  ? 30.336 108.725 -1.331  1.00 9.27  ? 392 SER B OG  1 
ATOM   1787 N N   . MET B 2 93  ? 29.018 106.123 -2.266  1.00 12.84 ? 393 MET B N   1 
ATOM   1788 C CA  . MET B 2 93  ? 28.317 105.882 -3.505  1.00 13.87 ? 393 MET B CA  1 
ATOM   1789 C C   . MET B 2 93  ? 27.274 106.986 -3.552  1.00 13.47 ? 393 MET B C   1 
ATOM   1790 O O   . MET B 2 93  ? 26.232 106.881 -4.199  1.00 14.20 ? 393 MET B O   1 
ATOM   1791 C CB  . MET B 2 93  ? 27.701 104.483 -3.492  1.00 15.00 ? 393 MET B CB  1 
ATOM   1792 C CG  . MET B 2 93  ? 28.735 103.423 -3.816  1.00 18.91 ? 393 MET B CG  1 
ATOM   1793 S SD  . MET B 2 93  ? 28.309 101.773 -3.317  1.00 25.74 ? 393 MET B SD  1 
ATOM   1794 C CE  . MET B 2 93  ? 29.313 101.605 -1.853  1.00 22.40 ? 393 MET B CE  1 
ATOM   1795 N N   . LEU B 2 94  ? 27.581 108.054 -2.828  1.00 12.74 ? 394 LEU B N   1 
ATOM   1796 C CA  . LEU B 2 94  ? 26.721 109.219 -2.774  1.00 13.04 ? 394 LEU B CA  1 
ATOM   1797 C C   . LEU B 2 94  ? 26.811 109.929 -4.115  1.00 13.75 ? 394 LEU B C   1 
ATOM   1798 O O   . LEU B 2 94  ? 27.789 109.790 -4.845  1.00 14.76 ? 394 LEU B O   1 
ATOM   1799 C CB  . LEU B 2 94  ? 27.156 110.153 -1.639  1.00 11.53 ? 394 LEU B CB  1 
ATOM   1800 C CG  . LEU B 2 94  ? 26.979 109.581 -0.229  1.00 11.21 ? 394 LEU B CG  1 
ATOM   1801 C CD1 . LEU B 2 94  ? 27.433 110.602 0.792   1.00 10.74 ? 394 LEU B CD1 1 
ATOM   1802 C CD2 . LEU B 2 94  ? 25.523 109.210 -0.002  1.00 7.27  ? 394 LEU B CD2 1 
ATOM   1803 N N   . THR B 2 95  ? 25.785 110.700 -4.427  1.00 15.29 ? 395 THR B N   1 
ATOM   1804 C CA  . THR B 2 95  ? 25.708 111.408 -5.688  1.00 16.31 ? 395 THR B CA  1 
ATOM   1805 C C   . THR B 2 95  ? 25.953 112.916 -5.564  1.00 16.19 ? 395 THR B C   1 
ATOM   1806 O O   . THR B 2 95  ? 26.211 113.607 -6.555  1.00 14.87 ? 395 THR B O   1 
ATOM   1807 C CB  . THR B 2 95  ? 24.329 111.131 -6.306  1.00 16.94 ? 395 THR B CB  1 
ATOM   1808 O OG1 . THR B 2 95  ? 24.311 109.788 -6.797  1.00 20.70 ? 395 THR B OG1 1 
ATOM   1809 C CG2 . THR B 2 95  ? 24.017 112.090 -7.432  1.00 21.69 ? 395 THR B CG2 1 
ATOM   1810 N N   . LYS B 2 96  ? 25.888 113.420 -4.339  1.00 15.36 ? 396 LYS B N   1 
ATOM   1811 C CA  . LYS B 2 96  ? 26.067 114.842 -4.108  1.00 15.24 ? 396 LYS B CA  1 
ATOM   1812 C C   . LYS B 2 96  ? 26.825 115.058 -2.820  1.00 15.04 ? 396 LYS B C   1 
ATOM   1813 O O   . LYS B 2 96  ? 27.187 114.101 -2.134  1.00 15.19 ? 396 LYS B O   1 
ATOM   1814 C CB  . LYS B 2 96  ? 24.703 115.535 -3.998  1.00 14.82 ? 396 LYS B CB  1 
ATOM   1815 C CG  . LYS B 2 96  ? 23.661 115.042 -4.981  1.00 15.48 ? 396 LYS B CG  1 
ATOM   1816 C CD  . LYS B 2 96  ? 22.402 115.887 -4.912  1.00 17.28 ? 396 LYS B CD  1 
ATOM   1817 C CE  . LYS B 2 96  ? 21.381 115.428 -5.935  1.00 16.53 ? 396 LYS B CE  1 
ATOM   1818 N NZ  . LYS B 2 96  ? 20.284 116.413 -6.097  1.00 20.50 ? 396 LYS B NZ  1 
ATOM   1819 N N   . GLU B 2 97  ? 27.056 116.325 -2.500  1.00 14.60 ? 397 GLU B N   1 
ATOM   1820 C CA  . GLU B 2 97  ? 27.753 116.691 -1.281  1.00 16.35 ? 397 GLU B CA  1 
ATOM   1821 C C   . GLU B 2 97  ? 26.739 116.721 -0.144  1.00 16.85 ? 397 GLU B C   1 
ATOM   1822 O O   . GLU B 2 97  ? 25.565 117.039 -0.346  1.00 15.56 ? 397 GLU B O   1 
ATOM   1823 C CB  . GLU B 2 97  ? 28.418 118.044 -1.459  1.00 18.27 ? 397 GLU B CB  1 
ATOM   1824 C CG  . GLU B 2 97  ? 29.484 118.011 -2.534  1.00 23.12 ? 397 GLU B CG  1 
ATOM   1825 C CD  . GLU B 2 97  ? 30.061 119.376 -2.836  1.00 27.35 ? 397 GLU B CD  1 
ATOM   1826 O OE1 . GLU B 2 97  ? 29.889 120.286 -1.992  1.00 30.15 ? 397 GLU B OE1 1 
ATOM   1827 O OE2 . GLU B 2 97  ? 30.695 119.534 -3.908  1.00 27.99 ? 397 GLU B OE2 1 
ATOM   1828 N N   . LEU B 2 98  ? 27.194 116.373 1.051   1.00 17.21 ? 398 LEU B N   1 
ATOM   1829 C CA  . LEU B 2 98  ? 26.303 116.327 2.190   1.00 17.58 ? 398 LEU B CA  1 
ATOM   1830 C C   . LEU B 2 98  ? 26.667 117.330 3.268   1.00 17.58 ? 398 LEU B C   1 
ATOM   1831 O O   . LEU B 2 98  ? 27.757 117.296 3.828   1.00 17.20 ? 398 LEU B O   1 
ATOM   1832 C CB  . LEU B 2 98  ? 26.282 114.908 2.761   1.00 16.04 ? 398 LEU B CB  1 
ATOM   1833 C CG  . LEU B 2 98  ? 25.390 114.607 3.967   1.00 15.40 ? 398 LEU B CG  1 
ATOM   1834 C CD1 . LEU B 2 98  ? 23.985 115.114 3.742   1.00 15.24 ? 398 LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 2 98  ? 25.375 113.102 4.188   1.00 17.04 ? 398 LEU B CD2 1 
ATOM   1836 N N   . TYR B 2 99  ? 25.733 118.231 3.545   1.00 17.49 ? 399 TYR B N   1 
ATOM   1837 C CA  . TYR B 2 99  ? 25.923 119.251 4.561   1.00 17.96 ? 399 TYR B CA  1 
ATOM   1838 C C   . TYR B 2 99  ? 24.780 119.149 5.550   1.00 19.32 ? 399 TYR B C   1 
ATOM   1839 O O   . TYR B 2 99  ? 23.618 119.068 5.146   1.00 20.59 ? 399 TYR B O   1 
ATOM   1840 C CB  . TYR B 2 99  ? 25.912 120.637 3.926   1.00 15.55 ? 399 TYR B CB  1 
ATOM   1841 C CG  . TYR B 2 99  ? 27.042 120.893 2.970   1.00 14.53 ? 399 TYR B CG  1 
ATOM   1842 C CD1 . TYR B 2 99  ? 28.316 121.219 3.438   1.00 15.94 ? 399 TYR B CD1 1 
ATOM   1843 C CD2 . TYR B 2 99  ? 26.843 120.821 1.596   1.00 15.35 ? 399 TYR B CD2 1 
ATOM   1844 C CE1 . TYR B 2 99  ? 29.366 121.472 2.554   1.00 15.87 ? 399 TYR B CE1 1 
ATOM   1845 C CE2 . TYR B 2 99  ? 27.887 121.065 0.700   1.00 16.41 ? 399 TYR B CE2 1 
ATOM   1846 C CZ  . TYR B 2 99  ? 29.146 121.389 1.184   1.00 16.48 ? 399 TYR B CZ  1 
ATOM   1847 O OH  . TYR B 2 99  ? 30.186 121.609 0.304   1.00 16.40 ? 399 TYR B OH  1 
ATOM   1848 N N   . PHE B 2 100 ? 25.114 119.162 6.839   1.00 21.28 ? 400 PHE B N   1 
ATOM   1849 C CA  . PHE B 2 100 ? 24.128 119.081 7.914   1.00 23.07 ? 400 PHE B CA  1 
ATOM   1850 C C   . PHE B 2 100 ? 23.493 120.435 8.235   1.00 25.16 ? 400 PHE B C   1 
ATOM   1851 O O   . PHE B 2 100 ? 22.809 120.573 9.249   1.00 27.43 ? 400 PHE B O   1 
ATOM   1852 C CB  . PHE B 2 100 ? 24.781 118.539 9.185   1.00 23.24 ? 400 PHE B CB  1 
ATOM   1853 C CG  . PHE B 2 100 ? 25.205 117.106 9.088   1.00 24.05 ? 400 PHE B CG  1 
ATOM   1854 C CD1 . PHE B 2 100 ? 24.284 116.078 9.279   1.00 24.52 ? 400 PHE B CD1 1 
ATOM   1855 C CD2 . PHE B 2 100 ? 26.526 116.781 8.803   1.00 23.08 ? 400 PHE B CD2 1 
ATOM   1856 C CE1 . PHE B 2 100 ? 24.671 114.740 9.189   1.00 24.34 ? 400 PHE B CE1 1 
ATOM   1857 C CE2 . PHE B 2 100 ? 26.925 115.451 8.709   1.00 24.80 ? 400 PHE B CE2 1 
ATOM   1858 C CZ  . PHE B 2 100 ? 25.992 114.425 8.904   1.00 24.59 ? 400 PHE B CZ  1 
ATOM   1859 N N   . TYR B 2 101 ? 23.720 121.438 7.393   1.00 25.79 ? 401 TYR B N   1 
ATOM   1860 C CA  . TYR B 2 101 ? 23.137 122.751 7.640   1.00 26.35 ? 401 TYR B CA  1 
ATOM   1861 C C   . TYR B 2 101 ? 22.516 123.337 6.378   1.00 27.30 ? 401 TYR B C   1 
ATOM   1862 O O   . TYR B 2 101 ? 22.827 122.824 5.286   1.00 29.36 ? 401 TYR B O   1 
ATOM   1863 C CB  . TYR B 2 101 ? 24.206 123.695 8.186   1.00 27.43 ? 401 TYR B CB  1 
ATOM   1864 C CG  . TYR B 2 101 ? 25.403 123.879 7.273   1.00 28.26 ? 401 TYR B CG  1 
ATOM   1865 C CD1 . TYR B 2 101 ? 25.340 124.729 6.167   1.00 28.88 ? 401 TYR B CD1 1 
ATOM   1866 C CD2 . TYR B 2 101 ? 26.604 123.211 7.522   1.00 29.81 ? 401 TYR B CD2 1 
ATOM   1867 C CE1 . TYR B 2 101 ? 26.446 124.915 5.328   1.00 29.63 ? 401 TYR B CE1 1 
ATOM   1868 C CE2 . TYR B 2 101 ? 27.719 123.388 6.693   1.00 30.06 ? 401 TYR B CE2 1 
ATOM   1869 C CZ  . TYR B 2 101 ? 27.631 124.244 5.598   1.00 30.35 ? 401 TYR B CZ  1 
ATOM   1870 O OH  . TYR B 2 101 ? 28.724 124.443 4.787   1.00 29.40 ? 401 TYR B OH  1 
HETATM 1871 C C   . ACE C 3 1   ? 41.761 98.643  26.971  1.00 24.27 ? 501 ACE C C   1 
HETATM 1872 O O   . ACE C 3 1   ? 40.573 98.592  26.667  1.00 23.27 ? 501 ACE C O   1 
HETATM 1873 C CH3 . ACE C 3 1   ? 42.170 98.867  28.412  1.00 24.08 ? 501 ACE C CH3 1 
ATOM   1874 N N   . ASP C 3 2   ? 42.723 98.479  26.068  1.00 24.59 ? 502 ASP C N   1 
ATOM   1875 C CA  . ASP C 3 2   ? 42.346 98.271  24.668  1.00 25.00 ? 502 ASP C CA  1 
ATOM   1876 C C   . ASP C 3 2   ? 41.907 96.848  24.365  1.00 24.04 ? 502 ASP C C   1 
ATOM   1877 O O   . ASP C 3 2   ? 42.515 95.887  24.841  1.00 24.89 ? 502 ASP C O   1 
ATOM   1878 C CB  . ASP C 3 2   ? 43.476 98.639  23.712  1.00 25.23 ? 502 ASP C CB  1 
ATOM   1879 C CG  . ASP C 3 2   ? 43.909 100.098 23.829  1.00 26.72 ? 502 ASP C CG  1 
ATOM   1880 O OD1 . ASP C 3 2   ? 43.061 101.008 23.997  1.00 26.56 ? 502 ASP C OD1 1 
ATOM   1881 O OD2 . ASP C 3 2   ? 45.131 100.319 23.734  1.00 27.41 ? 502 ASP C OD2 1 
ATOM   1882 N N   . GLU C 3 3   ? 40.833 96.734  23.588  1.00 23.59 ? 503 GLU C N   1 
ATOM   1883 C CA  . GLU C 3 3   ? 40.281 95.446  23.187  1.00 21.91 ? 503 GLU C CA  1 
ATOM   1884 C C   . GLU C 3 3   ? 39.917 95.470  21.716  1.00 21.28 ? 503 GLU C C   1 
ATOM   1885 O O   . GLU C 3 3   ? 39.892 96.553  21.129  1.00 20.97 ? 503 GLU C O   1 
ATOM   1886 C CB  . GLU C 3 3   ? 39.052 95.130  23.997  1.00 21.27 ? 503 GLU C CB  1 
ATOM   1887 C CG  . GLU C 3 3   ? 39.398 94.907  25.438  1.00 22.02 ? 503 GLU C CG  1 
ATOM   1888 C CD  . GLU C 3 3   ? 38.201 94.460  26.227  1.00 23.76 ? 503 GLU C CD  1 
ATOM   1889 O OE1 . GLU C 3 3   ? 37.587 93.430  25.856  1.00 24.32 ? 503 GLU C OE1 1 
ATOM   1890 O OE2 . GLU C 3 3   ? 37.891 95.125  27.231  1.00 24.01 ? 503 GLU C OE2 1 
ATOM   1891 N N   . VAL C 3 4   ? 39.669 94.295  21.117  1.00 20.13 ? 504 VAL C N   1 
ATOM   1892 C CA  . VAL C 3 4   ? 39.305 94.226  19.692  1.00 18.41 ? 504 VAL C CA  1 
ATOM   1893 C C   . VAL C 3 4   ? 37.834 93.861  19.364  1.00 17.66 ? 504 VAL C C   1 
ATOM   1894 O O   . VAL C 3 4   ? 37.166 93.218  20.168  1.00 18.93 ? 504 VAL C O   1 
ATOM   1895 C CB  . VAL C 3 4   ? 40.249 93.254  18.910  1.00 17.30 ? 504 VAL C CB  1 
ATOM   1896 C CG1 . VAL C 3 4   ? 41.593 93.922  18.685  1.00 16.27 ? 504 VAL C CG1 1 
ATOM   1897 C CG2 . VAL C 3 4   ? 40.439 91.940  19.670  1.00 17.68 ? 504 VAL C CG2 1 
HETATM 1898 N N   . FPR C 3 5   ? 37.324 94.285  18.204  1.00 16.45 ? 505 FPR C N   1 
HETATM 1899 C C   . FPR C 3 5   ? 35.979 92.919  16.740  1.00 16.85 ? 505 FPR C C   1 
HETATM 1900 O O   . FPR C 3 5   ? 34.660 92.842  16.267  1.00 19.48 ? 505 FPR C O   1 
HETATM 1901 C C5  . FPR C 3 5   ? 37.455 86.909  16.196  1.00 31.05 ? 505 FPR C C5  1 
HETATM 1902 C C6  . FPR C 3 5   ? 37.485 85.863  15.285  1.00 32.71 ? 505 FPR C C6  1 
HETATM 1903 C C7  . FPR C 3 5   ? 36.653 85.890  14.174  1.00 32.61 ? 505 FPR C C7  1 
HETATM 1904 C C8  . FPR C 3 5   ? 35.793 86.964  13.983  1.00 31.28 ? 505 FPR C C8  1 
HETATM 1905 C C9  . FPR C 3 5   ? 35.772 88.002  14.898  1.00 30.20 ? 505 FPR C C9  1 
HETATM 1906 C C11 . FPR C 3 5   ? 36.374 91.590  17.379  1.00 19.20 ? 505 FPR C C11 1 
HETATM 1907 O OD2 . FPR C 3 5   ? 34.368 97.107  18.414  1.00 14.81 ? 505 FPR C OD2 1 
HETATM 1908 C C21 . FPR C 3 5   ? 36.152 90.464  16.410  1.00 22.65 ? 505 FPR C C21 1 
HETATM 1909 O OD1 . FPR C 3 5   ? 34.171 95.261  19.556  1.00 15.13 ? 505 FPR C OD1 1 
HETATM 1910 C C31 . FPR C 3 5   ? 36.600 89.134  16.994  1.00 26.92 ? 505 FPR C C31 1 
HETATM 1911 C C41 . FPR C 3 5   ? 36.603 87.989  16.012  1.00 29.06 ? 505 FPR C C41 1 
HETATM 1912 C CA  . FPR C 3 5   ? 35.968 93.923  17.833  1.00 15.87 ? 505 FPR C CA  1 
HETATM 1913 C CB  . FPR C 3 5   ? 35.131 95.122  17.383  1.00 14.58 ? 505 FPR C CB  1 
HETATM 1914 C CG  . FPR C 3 5   ? 34.515 95.879  18.537  1.00 13.73 ? 505 FPR C CG  1 
HETATM 1915 O O   . HOH D 4 .   ? 34.201 98.331  10.652  1.00 1.95  ? 1   HOH A O   1 
HETATM 1916 O O   . HOH D 4 .   ? 17.481 114.500 -0.744  1.00 8.75  ? 2   HOH A O   1 
HETATM 1917 O O   . HOH D 4 .   ? 21.490 112.477 24.709  1.00 16.10 ? 3   HOH A O   1 
HETATM 1918 O O   . HOH D 4 .   ? 31.097 100.366 20.344  1.00 22.31 ? 4   HOH A O   1 
HETATM 1919 O O   . HOH D 4 .   ? 48.035 90.352  11.658  1.00 16.40 ? 7   HOH A O   1 
HETATM 1920 O O   . HOH D 4 .   ? 29.989 99.625  28.129  1.00 35.93 ? 8   HOH A O   1 
HETATM 1921 O O   . HOH D 4 .   ? 19.883 103.145 26.184  1.00 18.73 ? 9   HOH A O   1 
HETATM 1922 O O   . HOH D 4 .   ? 19.852 110.280 27.287  1.00 19.44 ? 10  HOH A O   1 
HETATM 1923 O O   . HOH D 4 .   ? 23.309 85.611  8.758   1.00 17.16 ? 11  HOH A O   1 
HETATM 1924 O O   . HOH D 4 .   ? 29.389 88.409  26.739  1.00 21.49 ? 13  HOH A O   1 
HETATM 1925 O O   . HOH D 4 .   ? 27.012 91.101  3.654   1.00 32.70 ? 14  HOH A O   1 
HETATM 1926 O O   . HOH E 4 .   ? 45.515 97.054  13.836  1.00 11.24 ? 5   HOH B O   1 
HETATM 1927 O O   . HOH E 4 .   ? 33.568 104.421 31.541  1.00 32.82 ? 6   HOH B O   1 
HETATM 1928 O O   . HOH E 4 .   ? 20.588 121.557 11.883  1.00 49.56 ? 12  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   145 ?   ?   ?   A . n 
A 1 2   GLY 2   146 ?   ?   ?   A . n 
A 1 3   ILE 3   147 ?   ?   ?   A . n 
A 1 4   SER 4   148 ?   ?   ?   A . n 
A 1 5   LEU 5   149 ?   ?   ?   A . n 
A 1 6   ASP 6   150 150 ASP ASP A . n 
A 1 7   ASN 7   151 151 ASN ASN A . n 
A 1 8   SER 8   152 152 SER SER A . n 
A 1 9   TYR 9   153 153 TYR TYR A . n 
A 1 10  LYS 10  154 154 LYS LYS A . n 
A 1 11  MET 11  155 155 MET MET A . n 
A 1 12  ASP 12  156 156 ASP ASP A . n 
A 1 13  TYR 13  156 156 TYR TYR A A n 
A 1 14  PRO 14  161 161 PRO PRO A . n 
A 1 15  GLU 15  162 162 GLU GLU A . n 
A 1 16  MET 16  162 162 MET MET A A n 
A 1 17  GLY 17  163 163 GLY GLY A . n 
A 1 18  LEU 18  164 164 LEU LEU A . n 
A 1 19  CYS 19  165 165 CYS CYS A . n 
A 1 20  ILE 20  166 166 ILE ILE A . n 
A 1 21  ILE 21  167 167 ILE ILE A . n 
A 1 22  ILE 22  168 168 ILE ILE A . n 
A 1 23  ASN 23  169 169 ASN ASN A . n 
A 1 24  ASN 24  170 170 ASN ASN A . n 
A 1 25  LYS 25  171 171 LYS LYS A . n 
A 1 26  ASN 26  172 172 ASN ASN A . n 
A 1 27  PHE 27  173 173 PHE PHE A . n 
A 1 28  HIS 28  174 174 HIS HIS A . n 
A 1 29  LYS 29  175 175 LYS LYS A . n 
A 1 30  SER 30  175 175 SER SER A A n 
A 1 31  THR 31  175 175 THR THR A B n 
A 1 32  GLY 32  175 175 GLY GLY A C n 
A 1 33  MET 33  176 176 MET MET A . n 
A 1 34  THR 34  177 177 THR THR A . n 
A 1 35  SER 35  178 178 SER SER A . n 
A 1 36  ARG 36  179 179 ARG ARG A . n 
A 1 37  SER 37  180 180 SER SER A . n 
A 1 38  GLY 38  181 181 GLY GLY A . n 
A 1 39  THR 39  182 182 THR THR A . n 
A 1 40  ASP 40  183 183 ASP ASP A . n 
A 1 41  VAL 41  184 184 VAL VAL A . n 
A 1 42  ASP 42  185 185 ASP ASP A . n 
A 1 43  ALA 43  186 186 ALA ALA A . n 
A 1 44  ALA 44  187 187 ALA ALA A . n 
A 1 45  ASN 45  188 188 ASN ASN A . n 
A 1 46  LEU 46  189 189 LEU LEU A . n 
A 1 47  ARG 47  190 190 ARG ARG A . n 
A 1 48  GLU 48  191 191 GLU GLU A . n 
A 1 49  THR 49  192 192 THR THR A . n 
A 1 50  PHE 50  193 193 PHE PHE A . n 
A 1 51  ARG 51  194 194 ARG ARG A . n 
A 1 52  ASN 52  195 195 ASN ASN A . n 
A 1 53  LEU 53  196 196 LEU LEU A . n 
A 1 54  LYS 54  197 197 LYS LYS A . n 
A 1 55  TYR 55  198 198 TYR TYR A . n 
A 1 56  GLU 56  199 199 GLU GLU A . n 
A 1 57  VAL 57  200 200 VAL VAL A . n 
A 1 58  ARG 58  201 201 ARG ARG A . n 
A 1 59  ASN 59  202 202 ASN ASN A . n 
A 1 60  LYS 60  203 203 LYS LYS A . n 
A 1 61  ASN 61  204 204 ASN ASN A . n 
A 1 62  ASP 62  205 205 ASP ASP A . n 
A 1 63  LEU 63  206 206 LEU LEU A . n 
A 1 64  THR 64  207 207 THR THR A . n 
A 1 65  ARG 65  208 208 ARG ARG A . n 
A 1 66  GLU 66  209 209 GLU GLU A . n 
A 1 67  GLU 67  210 210 GLU GLU A . n 
A 1 68  ILE 68  211 211 ILE ILE A . n 
A 1 69  VAL 69  212 212 VAL VAL A . n 
A 1 70  GLU 70  213 213 GLU GLU A . n 
A 1 71  LEU 71  214 214 LEU LEU A . n 
A 1 72  MET 72  215 215 MET MET A . n 
A 1 73  ARG 73  216 216 ARG ARG A . n 
A 1 74  ASP 74  217 217 ASP ASP A . n 
A 1 75  VAL 75  218 218 VAL VAL A . n 
A 1 76  SER 76  219 219 SER SER A . n 
A 1 77  LYS 77  220 220 LYS LYS A . n 
A 1 78  GLU 78  221 221 GLU GLU A . n 
A 1 79  ASP 79  222 222 ASP ASP A . n 
A 1 80  HIS 80  224 224 HIS HIS A . n 
A 1 81  SER 81  225 225 SER SER A . n 
A 1 82  LYS 82  226 226 LYS LYS A . n 
A 1 83  ARG 83  227 227 ARG ARG A . n 
A 1 84  SER 84  228 228 SER SER A . n 
A 1 85  SER 85  229 229 SER SER A . n 
A 1 86  PHE 86  230 230 PHE PHE A . n 
A 1 87  VAL 87  231 231 VAL VAL A . n 
A 1 88  CYS 88  232 232 CYS CYS A . n 
A 1 89  VAL 89  233 233 VAL VAL A . n 
A 1 90  LEU 90  234 234 LEU LEU A . n 
A 1 91  LEU 91  235 235 LEU LEU A . n 
A 1 92  SER 92  236 236 SER SER A . n 
A 1 93  HIS 93  237 237 HIS HIS A . n 
A 1 94  GLY 94  238 238 GLY GLY A . n 
A 1 95  GLU 95  239 239 GLU GLU A . n 
A 1 96  GLU 96  240 240 GLU GLU A . n 
A 1 97  GLY 97  241 241 GLY GLY A . n 
A 1 98  ILE 98  242 242 ILE ILE A . n 
A 1 99  ILE 99  243 243 ILE ILE A . n 
A 1 100 PHE 100 244 244 PHE PHE A . n 
A 1 101 GLY 101 245 245 GLY GLY A . n 
A 1 102 THR 102 246 246 THR THR A . n 
A 1 103 ASN 103 247 247 ASN ASN A . n 
A 1 104 GLY 104 254 254 GLY GLY A . n 
A 1 105 PRO 105 255 255 PRO PRO A . n 
A 1 106 VAL 106 256 256 VAL VAL A . n 
A 1 107 ASP 107 257 257 ASP ASP A . n 
A 1 108 LEU 108 258 258 LEU LEU A . n 
A 1 109 LYS 109 259 259 LYS LYS A . n 
A 1 110 LYS 110 260 260 LYS LYS A . n 
A 1 111 ILE 111 261 261 ILE ILE A . n 
A 1 112 THR 112 262 262 THR THR A . n 
A 1 113 ASN 113 263 263 ASN ASN A . n 
A 1 114 PHE 114 264 264 PHE PHE A . n 
A 1 115 PHE 115 265 265 PHE PHE A . n 
A 1 116 ARG 116 266 266 ARG ARG A . n 
A 1 117 GLY 117 267 267 GLY GLY A . n 
A 1 118 ASP 118 268 268 ASP ASP A . n 
A 1 119 ARG 119 269 269 ARG ARG A . n 
A 1 120 CYS 120 270 270 CYS CYS A . n 
A 1 121 ARG 121 271 271 ARG ARG A . n 
A 1 122 SER 122 272 272 SER SER A . n 
A 1 123 LEU 123 273 273 LEU LEU A . n 
A 1 124 THR 124 274 274 THR THR A . n 
A 1 125 GLY 125 275 275 GLY GLY A . n 
A 1 126 LYS 126 276 276 LYS LYS A . n 
A 1 127 PRO 127 277 277 PRO PRO A . n 
A 1 128 LYS 128 278 278 LYS LYS A . n 
A 1 129 LEU 129 279 279 LEU LEU A . n 
A 1 130 PHE 130 280 280 PHE PHE A . n 
A 1 131 ILE 131 281 281 ILE ILE A . n 
A 1 132 ILE 132 282 282 ILE ILE A . n 
A 1 133 GLN 133 283 283 GLN GLN A . n 
A 1 134 ALA 134 284 284 ALA ALA A . n 
A 1 135 CYS 135 285 285 CYS CYS A . n 
A 1 136 ARG 136 286 286 ARG ARG A . n 
A 1 137 GLY 137 287 287 GLY GLY A . n 
A 1 138 THR 138 288 288 THR THR A . n 
A 1 139 GLU 139 289 289 GLU GLU A . n 
A 1 140 LEU 140 290 290 LEU LEU A . n 
A 1 141 ASP 141 291 291 ASP ASP A . n 
A 1 142 CYS 142 292 292 CYS CYS A . n 
A 1 143 GLY 143 293 293 GLY GLY A . n 
A 1 144 ILE 144 294 294 ILE ILE A . n 
A 1 145 GLU 145 295 295 GLU GLU A . n 
A 1 146 THR 146 296 ?   ?   ?   A . n 
A 1 147 ASP 147 297 ?   ?   ?   A . n 
B 2 1   SER 1   310 ?   ?   ?   B . n 
B 2 2   GLY 2   311 ?   ?   ?   B . n 
B 2 3   VAL 3   312 ?   ?   ?   B . n 
B 2 4   ASP 4   313 ?   ?   ?   B . n 
B 2 5   ASP 5   314 ?   ?   ?   B . n 
B 2 6   ASP 6   315 ?   ?   ?   B . n 
B 2 7   MET 7   316 ?   ?   ?   B . n 
B 2 8   ALA 8   317 ?   ?   ?   B . n 
B 2 9   CYS 9   318 ?   ?   ?   B . n 
B 2 10  HIS 10  319 ?   ?   ?   B . n 
B 2 11  LYS 11  320 320 LYS LYS B . n 
B 2 12  ILE 12  321 321 ILE ILE B . n 
B 2 13  PRO 13  322 322 PRO PRO B . n 
B 2 14  VAL 14  323 323 VAL VAL B . n 
B 2 15  GLU 15  324 324 GLU GLU B . n 
B 2 16  ALA 16  325 325 ALA ALA B . n 
B 2 17  ASP 17  326 326 ASP ASP B . n 
B 2 18  PHE 18  327 327 PHE PHE B . n 
B 2 19  LEU 19  328 328 LEU LEU B . n 
B 2 20  TYR 20  329 329 TYR TYR B . n 
B 2 21  ALA 21  330 330 ALA ALA B . n 
B 2 22  TYR 22  331 331 TYR TYR B . n 
B 2 23  SER 23  332 332 SER SER B . n 
B 2 24  THR 24  333 333 THR THR B . n 
B 2 25  ALA 25  334 334 ALA ALA B . n 
B 2 26  PRO 26  335 335 PRO PRO B . n 
B 2 27  GLY 27  336 336 GLY GLY B . n 
B 2 28  TYR 28  337 337 TYR TYR B . n 
B 2 29  TYR 29  338 338 TYR TYR B . n 
B 2 30  SER 30  339 339 SER SER B . n 
B 2 31  TRP 31  340 340 TRP TRP B . n 
B 2 32  ARG 32  341 341 ARG ARG B . n 
B 2 33  ASN 33  342 342 ASN ASN B . n 
B 2 34  SER 34  343 343 SER SER B . n 
B 2 35  LYS 35  344 344 LYS LYS B . n 
B 2 36  ASP 36  345 345 ASP ASP B . n 
B 2 37  GLY 37  346 346 GLY GLY B . n 
B 2 38  SER 38  347 347 SER SER B . n 
B 2 39  TRP 39  348 348 TRP TRP B . n 
B 2 40  PHE 40  349 349 PHE PHE B . n 
B 2 41  ILE 41  350 350 ILE ILE B . n 
B 2 42  GLN 42  351 351 GLN GLN B . n 
B 2 43  SER 43  352 352 SER SER B . n 
B 2 44  LEU 44  353 353 LEU LEU B . n 
B 2 45  CYS 45  354 354 CYS CYS B . n 
B 2 46  ALA 46  355 355 ALA ALA B . n 
B 2 47  MET 47  356 356 MET MET B . n 
B 2 48  LEU 48  357 357 LEU LEU B . n 
B 2 49  LYS 49  358 358 LYS LYS B . n 
B 2 50  GLN 50  359 359 GLN GLN B . n 
B 2 51  TYR 51  360 360 TYR TYR B . n 
B 2 52  ALA 52  361 361 ALA ALA B . n 
B 2 53  ASP 53  362 362 ASP ASP B . n 
B 2 54  LYS 54  363 363 LYS LYS B . n 
B 2 55  LEU 55  364 364 LEU LEU B . n 
B 2 56  GLU 56  365 365 GLU GLU B . n 
B 2 57  PHE 57  366 366 PHE PHE B . n 
B 2 58  MET 58  367 367 MET MET B . n 
B 2 59  HIS 59  368 368 HIS HIS B . n 
B 2 60  ILE 60  369 369 ILE ILE B . n 
B 2 61  LEU 61  370 370 LEU LEU B . n 
B 2 62  THR 62  371 371 THR THR B . n 
B 2 63  ARG 63  372 372 ARG ARG B . n 
B 2 64  VAL 64  373 373 VAL VAL B . n 
B 2 65  ASN 65  374 374 ASN ASN B . n 
B 2 66  ARG 66  375 375 ARG ARG B . n 
B 2 67  LYS 67  376 376 LYS LYS B . n 
B 2 68  VAL 68  377 377 VAL VAL B . n 
B 2 69  ALA 69  378 378 ALA ALA B . n 
B 2 70  THR 70  379 379 THR THR B . n 
B 2 71  GLU 71  379 379 GLU GLU B A n 
B 2 72  PHE 72  380 380 PHE PHE B . n 
B 2 73  GLU 73  381 381 GLU GLU B . n 
B 2 74  SER 74  381 381 SER SER B A n 
B 2 75  PHE 75  381 381 PHE PHE B B n 
B 2 76  SER 76  381 381 SER SER B C n 
B 2 77  PHE 77  381 381 PHE PHE B D n 
B 2 78  ASP 78  381 381 ASP ASP B E n 
B 2 79  ALA 79  381 381 ALA ALA B F n 
B 2 80  THR 80  381 381 THR THR B G n 
B 2 81  PHE 81  381 381 PHE PHE B H n 
B 2 82  HIS 82  381 381 HIS HIS B I n 
B 2 83  ALA 83  382 382 ALA ALA B . n 
B 2 84  LYS 84  383 383 LYS LYS B . n 
B 2 85  LYS 85  384 384 LYS LYS B . n 
B 2 86  GLN 86  385 385 GLN GLN B . n 
B 2 87  ILE 87  386 386 ILE ILE B . n 
B 2 88  PRO 88  387 387 PRO PRO B . n 
B 2 89  CYS 89  388 388 CYS CYS B . n 
B 2 90  ILE 90  389 389 ILE ILE B . n 
B 2 91  VAL 91  390 390 VAL VAL B . n 
B 2 92  SER 92  392 392 SER SER B . n 
B 2 93  MET 93  393 393 MET MET B . n 
B 2 94  LEU 94  394 394 LEU LEU B . n 
B 2 95  THR 95  395 395 THR THR B . n 
B 2 96  LYS 96  396 396 LYS LYS B . n 
B 2 97  GLU 97  397 397 GLU GLU B . n 
B 2 98  LEU 98  398 398 LEU LEU B . n 
B 2 99  TYR 99  399 399 TYR TYR B . n 
B 2 100 PHE 100 400 400 PHE PHE B . n 
B 2 101 TYR 101 401 401 TYR TYR B . n 
B 2 102 HIS 102 402 ?   ?   ?   B . n 
C 3 1   ACE 1   501 501 ACE ACE C . n 
C 3 2   ASP 2   502 502 ASP ASP C . n 
C 3 3   GLU 3   503 503 GLU GLU C . n 
C 3 4   VAL 4   504 504 VAL VAL C . n 
C 3 5   FPR 5   505 505 FPR FPR C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1  1  1  HOH HOH A . 
D 4 HOH 2  2  2  HOH HOH A . 
D 4 HOH 3  3  3  HOH HOH A . 
D 4 HOH 4  4  4  HOH HOH A . 
D 4 HOH 5  7  7  HOH HOH A . 
D 4 HOH 6  8  8  HOH HOH A . 
D 4 HOH 7  9  9  HOH HOH A . 
D 4 HOH 8  10 10 HOH HOH A . 
D 4 HOH 9  11 11 HOH HOH A . 
D 4 HOH 10 13 13 HOH HOH A . 
D 4 HOH 11 14 14 HOH HOH A . 
E 4 HOH 1  5  5  HOH HOH B . 
E 4 HOH 2  6  6  HOH HOH B . 
E 4 HOH 3  12 12 HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_000231 
_pdbx_molecule_features.name      
'N-acetyl-L-alpha-aspartyl-L-alpha-glutamyl-N-[(1S)-1-(carboxymethyl)-2-oxo-5-phenylpentyl]-L-valinamide' 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000231 
_pdbx_molecule.asym_id       C 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  hexameric  6 
2 software_defined_assembly            PISA tetrameric 4 
3 software_defined_assembly            PISA hexameric  6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D,E 
2 1,2 A,B,D,E   
3 1,2 A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 12600 ? 
2 MORE         -78   ? 
2 'SSA (A^2)'  18000 ? 
3 'ABSA (A^2)' 4770  ? 
3 MORE         -13   ? 
3 'SSA (A^2)'  11030 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 69.9400000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-07-27 
5 'Structure model' 1 4 2012-12-12 
6 'Structure model' 1 5 2017-10-11 
7 'Structure model' 1 6 2022-12-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Atomic model'              
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' 'Non-polymer description'   
7  4 'Structure model' 'Structure summary'         
8  5 'Structure model' Other                       
9  6 'Structure model' 'Refinement description'    
10 7 'Structure model' 'Database references'       
11 7 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 6 'Structure model' software           
2 7 'Structure model' database_2         
3 7 'Structure model' struct_conn        
4 7 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  6 'Structure model' '_software.name'                      
2  7 'Structure model' '_database_2.pdbx_DOI'                
3  7 'Structure model' '_database_2.pdbx_database_accession' 
4  7 'Structure model' '_struct_conn.pdbx_dist_value'        
5  7 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  7 'Structure model' '_struct_conn.ptnr1_auth_asym_id'     
7  7 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
8  7 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
9  7 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
10 7 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
11 7 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
12 7 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
13 7 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
14 7 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
15 7 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
16 7 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
17 7 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
18 7 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX    refinement       2002       ? 1 
X-GEN  'data reduction' .          ? 2 
SAINT  'data scaling'   'V. 4.050' ? 3 
X-PLOR phasing          .          ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 197 ? ? 74.45   32.94   
2 1 SER A 236 ? ? -179.49 -170.99 
3 1 CYS A 270 ? ? -102.05 76.10   
4 1 ASP B 326 ? ? 71.57   36.66   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 145 ? A SER 1   
2  1 Y 1 A GLY 146 ? A GLY 2   
3  1 Y 1 A ILE 147 ? A ILE 3   
4  1 Y 1 A SER 148 ? A SER 4   
5  1 Y 1 A LEU 149 ? A LEU 5   
6  1 Y 1 A THR 296 ? A THR 146 
7  1 Y 1 A ASP 297 ? A ASP 147 
8  1 Y 1 B SER 310 ? B SER 1   
9  1 Y 1 B GLY 311 ? B GLY 2   
10 1 Y 1 B VAL 312 ? B VAL 3   
11 1 Y 1 B ASP 313 ? B ASP 4   
12 1 Y 1 B ASP 314 ? B ASP 5   
13 1 Y 1 B ASP 315 ? B ASP 6   
14 1 Y 1 B MET 316 ? B MET 7   
15 1 Y 1 B ALA 317 ? B ALA 8   
16 1 Y 1 B CYS 318 ? B CYS 9   
17 1 Y 1 B HIS 319 ? B HIS 10  
18 1 Y 1 B HIS 402 ? B HIS 102 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#