data_1RHQ
# 
_entry.id   1RHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.362 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RHQ         pdb_00001rhq 10.2210/pdb1rhq/pdb 
RCSB  RCSB020752   ?            ?                   
WWPDB D_1000020752 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PAU 'Caspase-3 complex with Acetyl-Asp-Glu-Val-Asp-aldehyde' unspecified 
PDB 1RHJ .                                                        unspecified 
PDB 1RHK .                                                        unspecified 
PDB 1RHM .                                                        unspecified 
PDB 1RHR .                                                        unspecified 
PDB 1RHU .                                                        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RHQ 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, J.W.'  1 
'Rotonda, J.'   2 
'Soisson, S.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            47 
_citation.page_first                2466 
_citation.page_last                 2474 
_citation.year                      2004 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15115390 
_citation.pdbx_database_id_DOI      10.1021/jm0305523 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, J.W.'     1  ? 
primary 'Rotonda, J.'      2  ? 
primary 'Soisson, S.M.'    3  ? 
primary 'Aspiotis, R.'     4  ? 
primary 'Bayly, C.'        5  ? 
primary 'Francoeur, S.'    6  ? 
primary 'Gallant, M.'      7  ? 
primary 'Garcia-Calvo, M.' 8  ? 
primary 'Giroux, A.'       9  ? 
primary 'Grimm, E.'        10 ? 
primary 'Han, Y.'          11 ? 
primary 'McKay, D.'        12 ? 
primary 'Nicholson, D.W.'  13 ? 
primary 'Peterson, E.'     14 ? 
primary 'Renaud, J.'       15 ? 
primary 'Roy, S.'          16 ? 
primary 'Thornberry, N.'   17 ? 
primary 'Zamboni, R.'      18 ? 
# 
_cell.entry_id           1RHQ 
_cell.length_a           110.300 
_cell.length_b           96.900 
_cell.length_c           70.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         128.06 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1RHQ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Caspase-3                                                                                                      
16639.902 2 3.4.22.- ? 'P17 SUBUNIT' ?                                                                                   
2 polymer     man Caspase-3                                                                                                      
11910.604 2 3.4.22.- ? 'P12 SUBUNIT' ?                                                                                   
3 non-polymer syn '5-S-benzyl-3-({N-[(5-bromo-2-methoxyphenyl)acetyl]-L-valyl}amino)-2,3-dideoxy-5-thio-D-erythro-pentonic acid' 
581.519   2 ?        ? ?             
;BOP covalently bound to the  
N-terminus, PTF covalently 
bound to the C-terminus
;
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
2 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A,D ? 
2 'polypeptide(L)' no no 
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
B,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   SER n 
2 2   GLY n 
2 3   VAL n 
2 4   ASP n 
2 5   ASP n 
2 6   ASP n 
2 7   MET n 
2 8   ALA n 
2 9   CYS n 
2 10  HIS n 
2 11  LYS n 
2 12  ILE n 
2 13  PRO n 
2 14  VAL n 
2 15  GLU n 
2 16  ALA n 
2 17  ASP n 
2 18  PHE n 
2 19  LEU n 
2 20  TYR n 
2 21  ALA n 
2 22  TYR n 
2 23  SER n 
2 24  THR n 
2 25  ALA n 
2 26  PRO n 
2 27  GLY n 
2 28  TYR n 
2 29  TYR n 
2 30  SER n 
2 31  TRP n 
2 32  ARG n 
2 33  ASN n 
2 34  SER n 
2 35  LYS n 
2 36  ASP n 
2 37  GLY n 
2 38  SER n 
2 39  TRP n 
2 40  PHE n 
2 41  ILE n 
2 42  GLN n 
2 43  SER n 
2 44  LEU n 
2 45  CYS n 
2 46  ALA n 
2 47  MET n 
2 48  LEU n 
2 49  LYS n 
2 50  GLN n 
2 51  TYR n 
2 52  ALA n 
2 53  ASP n 
2 54  LYS n 
2 55  LEU n 
2 56  GLU n 
2 57  PHE n 
2 58  MET n 
2 59  HIS n 
2 60  ILE n 
2 61  LEU n 
2 62  THR n 
2 63  ARG n 
2 64  VAL n 
2 65  ASN n 
2 66  ARG n 
2 67  LYS n 
2 68  VAL n 
2 69  ALA n 
2 70  THR n 
2 71  GLU n 
2 72  PHE n 
2 73  GLU n 
2 74  SER n 
2 75  PHE n 
2 76  SER n 
2 77  PHE n 
2 78  ASP n 
2 79  ALA n 
2 80  THR n 
2 81  PHE n 
2 82  HIS n 
2 83  ALA n 
2 84  LYS n 
2 85  LYS n 
2 86  GLN n 
2 87  ILE n 
2 88  PRO n 
2 89  CYS n 
2 90  ILE n 
2 91  VAL n 
2 92  SER n 
2 93  MET n 
2 94  LEU n 
2 95  THR n 
2 96  LYS n 
2 97  GLU n 
2 98  LEU n 
2 99  TYR n 
2 100 PHE n 
2 101 TYR n 
2 102 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The inhibitor was chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ICE3_HUMAN P42574 1 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
29  ? 
2 UNP ICE3_HUMAN P42574 2 
;SGVDDDMACHKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
176 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RHQ A 1 ? 147 ? P42574 29  ? 175 ? 145 297 
2 1 1RHQ D 1 ? 147 ? P42574 29  ? 175 ? 145 297 
3 2 1RHQ B 1 ? 102 ? P42574 176 ? 277 ? 310 402 
4 2 1RHQ E 1 ? 102 ? P42574 176 ? 277 ? 310 402 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1RHQ GLU B 15 ? UNP P42574 ASP 190 variant 324 1 
4 1RHQ GLU E 15 ? UNP P42574 ASP 190 variant 324 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0ZZ peptide-like        . 
'5-S-benzyl-3-({N-[(5-bromo-2-methoxyphenyl)acetyl]-L-valyl}amino)-2,3-dideoxy-5-thio-D-erythro-pentonic acid' ? 
'C26 H33 Br N2 O6 S' 581.519 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          1RHQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.48 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.93 
_exptl_crystal_grow.pdbx_details    
'7.8% PEG-6000, 100 mM citrate, 120 mM ZnCl(2), 10 mM DTT, 3 mM NaN(3), pH 4.93, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1998-04-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
# 
_reflns.entry_id                     1RHQ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.999 
_reflns.number_obs                   11487 
_reflns.number_all                   11870 
_reflns.percent_possible_obs         96.77 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.22 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.39 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.999 
_reflns_shell.d_res_low              3.106 
_reflns_shell.percent_possible_all   88.7 
_reflns_shell.Rmerge_I_obs           0.163 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.03 
_reflns_shell.pdbx_redundancy        1.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1034 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1RHQ 
_refine.ls_number_reflns_obs                     9964 
_refine.ls_number_reflns_all                     9964 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               19655.73 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    84.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.273 
_refine.ls_R_factor_R_free                       0.354 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  1020 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               11.8 
_refine.aniso_B[1][1]                            6.56 
_refine.aniso_B[2][2]                            2.42 
_refine.aniso_B[3][3]                            -8.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            4.48 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.18333 
_refine.solvent_model_param_bsol                 10 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'Protein part of 1pau.pdb' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RHQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.45 
_refine_analyze.Luzzati_sigma_a_obs             0.62 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.62 
_refine_analyze.Luzzati_sigma_a_free            0.75 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3740 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3812 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        6.10  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       9.47  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        7.30  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       10.78 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             1312 
_refine_ls_shell.R_factor_R_work                  0.349 
_refine_ls_shell.percent_reflns_obs               73.7 
_refine_ls_shell.R_factor_R_free                  0.411 
_refine_ls_shell.R_factor_R_free_error            0.036 
_refine_ls_shell.percent_reflns_R_free            9.1 
_refine_ls_shell.number_reflns_R_free             132 
_refine_ls_shell.number_reflns_obs                1228 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.P PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PAR WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM     ION.TOP     'X-RAY DIFFRACTION' 
4 PARAM.ICE     TOP_NEW.ICE 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000 0.000000  0.000000 0.000000  1.000000  0.000000  0.000000 0.000000  1.000000  0.00000   0.00000  0.00000  
2 given ? 0.227930 -0.007849 0.973646 -0.007261 -0.999953 -0.006361 0.973651 -0.005619 -0.227976 -47.63420 16.08090 60.25840 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1RHQ 
_struct.title                     'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE-3 WITH A BROMOMETHOXYPHENYL INHIBITOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RHQ 
_struct_keywords.pdbx_keywords   'HYDROLASE/hydrolase inhibitor' 
_struct_keywords.text            'CYSTEINE PROTEASE, CASPASE-3, APOPAIN, CPP32, YAMA, HYDROLASE-hydrolase inhibitor complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological assembly.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 28  ? GLY A 32  C HIS A 174 GLY A 175 5 ? 5  
HELX_P HELX_P2  2  GLY A 38  ? PHE A 50  ? GLY A 181 PHE A 193 1 ? 13 
HELX_P HELX_P3  3  ARG A 51  ? LYS A 54  ? ARG A 194 LYS A 197 5 ? 4  
HELX_P HELX_P4  4  THR A 64  ? LYS A 77  ? THR A 207 LYS A 220 1 ? 14 
HELX_P HELX_P5  5  LEU A 108 ? ASN A 113 ? LEU A 258 ASN A 263 1 ? 6  
HELX_P HELX_P6  6  PHE A 114 ? ARG A 116 ? PHE A 264 ARG A 266 5 ? 3  
HELX_P HELX_P7  7  SER B 38  ? TYR B 51  ? SER B 347 TYR B 360 1 ? 14 
HELX_P HELX_P8  8  PHE B 57  ? THR B 70  ? PHE B 366 THR B 379 1 ? 14 
HELX_P HELX_P9  9  ASP B 78  E HIS B 82  I ASP B 381 HIS B 381 5 ? 5  
HELX_P HELX_P10 10 HIS C 28  ? GLY C 32  C HIS D 174 GLY D 175 5 ? 5  
HELX_P HELX_P11 11 GLY C 38  ? PHE C 50  ? GLY D 181 PHE D 193 1 ? 13 
HELX_P HELX_P12 12 ARG C 51  ? LYS C 54  ? ARG D 194 LYS D 197 5 ? 4  
HELX_P HELX_P13 13 THR C 64  ? LYS C 77  ? THR D 207 LYS D 220 1 ? 14 
HELX_P HELX_P14 14 LEU C 108 ? ASN C 113 ? LEU D 258 ASN D 263 1 ? 6  
HELX_P HELX_P15 15 PHE C 114 ? ARG C 116 ? PHE D 264 ARG D 266 5 ? 3  
HELX_P HELX_P16 16 SER D 38  ? TYR D 51  ? SER E 347 TYR E 360 1 ? 14 
HELX_P HELX_P17 17 PHE D 57  ? THR D 70  ? PHE E 366 THR E 379 1 ? 14 
HELX_P HELX_P18 18 ASP D 78  E HIS D 82  I ASP E 381 HIS E 381 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale none ? A CYS 135 SG ? ? ? 1_555 E 0ZZ . C9 ? ? A CYS 285 A 0ZZ 551 1_555 ? ? ? ? ? ? ? 1.809 ? ? 
covale2 covale none ? C CYS 135 SG ? ? ? 1_555 F 0ZZ . C9 ? ? D CYS 285 D 0ZZ 551 1_555 ? ? ? ? ? ? ? 1.809 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 8  ? 
C ? 2  ? 
D ? 2  ? 
E ? 2  ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? parallel      
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? parallel      
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
B 1  2  ? parallel      
B 2  3  ? parallel      
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? parallel      
B 7  8  ? parallel      
C 1  2  ? anti-parallel 
D 1  2  ? parallel      
E 1  2  ? anti-parallel 
F 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LYS A 60  ? ASN A 61  ? LYS A 203 ASN A 204 
A 2  ILE A 22  ? ASN A 23  ? ILE A 168 ASN A 169 
A 3  LEU A 90  ? LEU A 91  ? LEU A 234 LEU A 235 
A 4  LYS A 128 ? GLN A 133 ? LYS A 278 GLN A 283 
A 5  PHE B 18  ? TYR B 22  ? PHE B 327 TYR B 331 
A 6  CYS B 89  ? SER B 92  ? CYS B 388 SER B 392 
A 7  CYS D 89  ? SER D 92  ? CYS E 388 SER E 392 
A 8  PHE D 18  ? TYR D 22  ? PHE E 327 TYR E 331 
A 9  LYS C 128 ? GLN C 133 ? LYS D 278 GLN D 283 
A 10 LEU C 90  ? LEU C 91  ? LEU D 234 LEU D 235 
A 11 ILE C 22  ? ASN C 23  ? ILE D 168 ASN D 169 
A 12 LYS C 60  ? ASN C 61  ? LYS D 203 ASN D 204 
B 1  PHE A 86  ? VAL A 87  ? PHE A 230 VAL A 231 
B 2  LYS A 128 ? GLN A 133 ? LYS A 278 GLN A 283 
B 3  PHE B 18  ? TYR B 22  ? PHE B 327 TYR B 331 
B 4  CYS B 89  ? SER B 92  ? CYS B 388 SER B 392 
B 5  CYS D 89  ? SER D 92  ? CYS E 388 SER E 392 
B 6  PHE D 18  ? TYR D 22  ? PHE E 327 TYR E 331 
B 7  LYS C 128 ? GLN C 133 ? LYS D 278 GLN D 283 
B 8  PHE C 86  ? VAL C 87  ? PHE D 230 VAL D 231 
C 1  ILE A 98  ? PHE A 100 ? ILE A 242 PHE A 244 
C 2  PRO A 105 ? ASP A 107 ? PRO A 255 ASP A 257 
D 1  GLY A 137 ? GLU A 139 ? GLY A 287 GLU A 289 
D 2  GLY B 27  ? TYR B 28  ? GLY B 336 TYR B 337 
E 1  ILE C 98  ? PHE C 100 ? ILE D 242 PHE D 244 
E 2  PRO C 105 ? ASP C 107 ? PRO D 255 ASP D 257 
F 1  GLY C 137 ? GLU C 139 ? GLY D 287 GLU D 289 
F 2  GLY D 27  ? TYR D 28  ? GLY E 336 TYR E 337 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O LYS A 60  ? O LYS A 203 N ASN A 23  ? N ASN A 169 
A 2  3  N ILE A 22  ? N ILE A 168 O LEU A 91  ? O LEU A 235 
A 3  4  N LEU A 90  ? N LEU A 234 O ILE A 131 ? O ILE A 281 
A 4  5  N PHE A 130 ? N PHE A 280 O LEU B 19  ? O LEU B 328 
A 5  6  N TYR B 20  ? N TYR B 329 O VAL B 91  ? O VAL B 390 
A 6  7  N SER B 92  ? N SER B 392 O ILE D 90  ? O ILE E 389 
A 7  8  O VAL D 91  ? O VAL E 390 N TYR D 20  ? N TYR E 329 
A 8  9  O LEU D 19  ? O LEU E 328 N PHE C 130 ? N PHE D 280 
A 9  10 O ILE C 131 ? O ILE D 281 N LEU C 90  ? N LEU D 234 
A 10 11 O LEU C 91  ? O LEU D 235 N ILE C 22  ? N ILE D 168 
A 11 12 N ASN C 23  ? N ASN D 169 O LYS C 60  ? O LYS D 203 
B 1  2  N PHE A 86  ? N PHE A 230 O LEU A 129 ? O LEU A 279 
B 2  3  N PHE A 130 ? N PHE A 280 O LEU B 19  ? O LEU B 328 
B 3  4  N TYR B 20  ? N TYR B 329 O VAL B 91  ? O VAL B 390 
B 4  5  N SER B 92  ? N SER B 392 O ILE D 90  ? O ILE E 389 
B 5  6  O VAL D 91  ? O VAL E 390 N TYR D 20  ? N TYR E 329 
B 6  7  O LEU D 19  ? O LEU E 328 N PHE C 130 ? N PHE D 280 
B 7  8  O LEU C 129 ? O LEU D 279 N PHE C 86  ? N PHE D 230 
C 1  2  N ILE A 99  ? N ILE A 243 O VAL A 106 ? O VAL A 256 
D 1  2  N GLU A 139 ? N GLU A 289 O GLY B 27  ? O GLY B 336 
E 1  2  N ILE C 99  ? N ILE D 243 O VAL C 106 ? O VAL D 256 
F 1  2  N GLU C 139 ? N GLU D 289 O GLY D 27  ? O GLY E 336 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 0ZZ 551 ? 13 'BINDING SITE FOR RESIDUE 0ZZ A 551' 
AC2 Software D 0ZZ 551 ? 13 'BINDING SITE FOR RESIDUE 0ZZ D 551' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ARG A 36  ? ARG A 179 . ? 1_555 ? 
2  AC1 13 SER A 92  ? SER A 236 . ? 1_555 ? 
3  AC1 13 HIS A 93  ? HIS A 237 . ? 1_555 ? 
4  AC1 13 GLY A 94  ? GLY A 238 . ? 1_555 ? 
5  AC1 13 GLU A 95  ? GLU A 239 . ? 1_555 ? 
6  AC1 13 PHE A 100 ? PHE A 244 . ? 1_555 ? 
7  AC1 13 CYS A 135 ? CYS A 285 . ? 1_555 ? 
8  AC1 13 TYR B 29  ? TYR B 338 . ? 1_555 ? 
9  AC1 13 SER B 30  ? SER B 339 . ? 1_555 ? 
10 AC1 13 TRP B 31  ? TRP B 340 . ? 1_555 ? 
11 AC1 13 ARG B 32  ? ARG B 341 . ? 1_555 ? 
12 AC1 13 SER B 74  A SER B 381 . ? 1_555 ? 
13 AC1 13 PHE B 75  B PHE B 381 . ? 1_555 ? 
14 AC2 13 ARG C 36  ? ARG D 179 . ? 1_555 ? 
15 AC2 13 SER C 92  ? SER D 236 . ? 1_555 ? 
16 AC2 13 HIS C 93  ? HIS D 237 . ? 1_555 ? 
17 AC2 13 GLY C 94  ? GLY D 238 . ? 1_555 ? 
18 AC2 13 GLU C 95  ? GLU D 239 . ? 1_555 ? 
19 AC2 13 PHE C 100 ? PHE D 244 . ? 1_555 ? 
20 AC2 13 CYS C 135 ? CYS D 285 . ? 1_555 ? 
21 AC2 13 TYR D 29  ? TYR E 338 . ? 1_555 ? 
22 AC2 13 SER D 30  ? SER E 339 . ? 1_555 ? 
23 AC2 13 TRP D 31  ? TRP E 340 . ? 1_555 ? 
24 AC2 13 ARG D 32  ? ARG E 341 . ? 1_555 ? 
25 AC2 13 SER D 74  A SER E 381 . ? 1_555 ? 
26 AC2 13 PHE D 75  B PHE E 381 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RHQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RHQ 
_atom_sites.fract_transf_matrix[1][1]   0.009066 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007099 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010320 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017913 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 6   ? 80.933 0.761   95.495  1.00 24.71 ? 150 ASP A N   1 
ATOM   2    C  CA  . ASP A 1 6   ? 80.574 0.462   96.912  1.00 24.71 ? 150 ASP A CA  1 
ATOM   3    C  C   . ASP A 1 6   ? 79.126 0.847   97.212  1.00 24.71 ? 150 ASP A C   1 
ATOM   4    O  O   . ASP A 1 6   ? 78.330 1.022   96.291  1.00 24.71 ? 150 ASP A O   1 
ATOM   5    C  CB  . ASP A 1 6   ? 81.525 1.202   97.857  1.00 39.97 ? 150 ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 6   ? 82.129 0.285   98.898  1.00 39.97 ? 150 ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 6   ? 81.511 0.105   99.972  1.00 39.97 ? 150 ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 6   ? 83.216 -0.272  98.625  1.00 39.97 ? 150 ASP A OD2 1 
ATOM   9    N  N   . ASN A 1 7   ? 78.780 0.976   98.491  1.00 16.33 ? 151 ASN A N   1 
ATOM   10   C  CA  . ASN A 1 7   ? 77.415 1.337   98.867  1.00 16.33 ? 151 ASN A CA  1 
ATOM   11   C  C   . ASN A 1 7   ? 77.091 2.758   98.375  1.00 16.33 ? 151 ASN A C   1 
ATOM   12   O  O   . ASN A 1 7   ? 75.965 3.047   97.970  1.00 16.33 ? 151 ASN A O   1 
ATOM   13   C  CB  . ASN A 1 7   ? 77.233 1.262   100.394 1.00 20.77 ? 151 ASN A CB  1 
ATOM   14   C  CG  . ASN A 1 7   ? 78.280 0.394   101.078 1.00 20.77 ? 151 ASN A CG  1 
ATOM   15   O  OD1 . ASN A 1 7   ? 78.778 -0.574  100.503 1.00 20.77 ? 151 ASN A OD1 1 
ATOM   16   N  ND2 . ASN A 1 7   ? 78.604 0.728   102.324 1.00 20.77 ? 151 ASN A ND2 1 
ATOM   17   N  N   . SER A 1 8   ? 78.102 3.629   98.416  1.00 17.56 ? 152 SER A N   1 
ATOM   18   C  CA  . SER A 1 8   ? 78.001 5.024   97.979  1.00 17.56 ? 152 SER A CA  1 
ATOM   19   C  C   . SER A 1 8   ? 78.340 5.172   96.483  1.00 17.56 ? 152 SER A C   1 
ATOM   20   O  O   . SER A 1 8   ? 79.194 4.448   95.963  1.00 17.56 ? 152 SER A O   1 
ATOM   21   C  CB  . SER A 1 8   ? 78.951 5.888   98.814  1.00 15.71 ? 152 SER A CB  1 
ATOM   22   O  OG  . SER A 1 8   ? 80.298 5.491   98.621  1.00 15.71 ? 152 SER A OG  1 
ATOM   23   N  N   . TYR A 1 9   ? 77.668 6.111   95.810  1.00 7.10  ? 153 TYR A N   1 
ATOM   24   C  CA  . TYR A 1 9   ? 77.854 6.378   94.376  1.00 7.10  ? 153 TYR A CA  1 
ATOM   25   C  C   . TYR A 1 9   ? 79.223 6.979   94.059  1.00 7.10  ? 153 TYR A C   1 
ATOM   26   O  O   . TYR A 1 9   ? 79.846 7.587   94.917  1.00 7.10  ? 153 TYR A O   1 
ATOM   27   C  CB  . TYR A 1 9   ? 76.794 7.364   93.886  1.00 7.03  ? 153 TYR A CB  1 
ATOM   28   C  CG  . TYR A 1 9   ? 75.565 6.792   93.206  1.00 7.03  ? 153 TYR A CG  1 
ATOM   29   C  CD1 . TYR A 1 9   ? 75.647 6.162   91.973  1.00 7.03  ? 153 TYR A CD1 1 
ATOM   30   C  CD2 . TYR A 1 9   ? 74.305 6.970   93.770  1.00 7.03  ? 153 TYR A CD2 1 
ATOM   31   C  CE1 . TYR A 1 9   ? 74.515 5.740   91.326  1.00 7.03  ? 153 TYR A CE1 1 
ATOM   32   C  CE2 . TYR A 1 9   ? 73.165 6.549   93.134  1.00 7.03  ? 153 TYR A CE2 1 
ATOM   33   C  CZ  . TYR A 1 9   ? 73.269 5.935   91.914  1.00 7.03  ? 153 TYR A CZ  1 
ATOM   34   O  OH  . TYR A 1 9   ? 72.112 5.509   91.300  1.00 7.03  ? 153 TYR A OH  1 
ATOM   35   N  N   . LYS A 1 10  ? 79.678 6.826   92.821  1.00 7.39  ? 154 LYS A N   1 
ATOM   36   C  CA  . LYS A 1 10  ? 80.958 7.386   92.402  1.00 7.39  ? 154 LYS A CA  1 
ATOM   37   C  C   . LYS A 1 10  ? 80.786 8.885   92.084  1.00 7.39  ? 154 LYS A C   1 
ATOM   38   O  O   . LYS A 1 10  ? 80.050 9.255   91.153  1.00 7.39  ? 154 LYS A O   1 
ATOM   39   C  CB  . LYS A 1 10  ? 81.460 6.643   91.166  1.00 13.56 ? 154 LYS A CB  1 
ATOM   40   C  CG  . LYS A 1 10  ? 82.934 6.857   90.837  1.00 13.56 ? 154 LYS A CG  1 
ATOM   41   C  CD  . LYS A 1 10  ? 83.315 6.094   89.569  1.00 13.56 ? 154 LYS A CD  1 
ATOM   42   C  CE  . LYS A 1 10  ? 84.812 6.101   89.315  1.00 13.56 ? 154 LYS A CE  1 
ATOM   43   N  NZ  . LYS A 1 10  ? 85.346 7.485   89.209  1.00 13.56 ? 154 LYS A NZ  1 
ATOM   44   N  N   . MET A 1 11  ? 81.473 9.734   92.854  1.00 19.94 ? 155 MET A N   1 
ATOM   45   C  CA  . MET A 1 11  ? 81.390 11.193  92.695  1.00 19.94 ? 155 MET A CA  1 
ATOM   46   C  C   . MET A 1 11  ? 82.756 11.903  92.685  1.00 19.94 ? 155 MET A C   1 
ATOM   47   O  O   . MET A 1 11  ? 83.052 12.709  93.576  1.00 19.94 ? 155 MET A O   1 
ATOM   48   C  CB  . MET A 1 11  ? 80.522 11.787  93.822  1.00 7.03  ? 155 MET A CB  1 
ATOM   49   C  CG  . MET A 1 11  ? 79.063 11.324  93.838  1.00 7.03  ? 155 MET A CG  1 
ATOM   50   S  SD  . MET A 1 11  ? 78.075 12.104  92.542  1.00 7.03  ? 155 MET A SD  1 
ATOM   51   C  CE  . MET A 1 11  ? 76.745 12.742  93.451  1.00 7.03  ? 155 MET A CE  1 
ATOM   52   N  N   . ASP A 1 12  ? 83.586 11.617  91.686  1.00 7.03  ? 156 ASP A N   1 
ATOM   53   C  CA  . ASP A 1 12  ? 84.882 12.265  91.618  1.00 7.03  ? 156 ASP A CA  1 
ATOM   54   C  C   . ASP A 1 12  ? 85.494 12.288  90.227  1.00 7.03  ? 156 ASP A C   1 
ATOM   55   O  O   . ASP A 1 12  ? 86.686 12.048  90.056  1.00 7.03  ? 156 ASP A O   1 
ATOM   56   C  CB  . ASP A 1 12  ? 85.850 11.622  92.616  1.00 32.35 ? 156 ASP A CB  1 
ATOM   57   C  CG  . ASP A 1 12  ? 86.235 10.205  92.231  1.00 32.35 ? 156 ASP A CG  1 
ATOM   58   O  OD1 . ASP A 1 12  ? 85.348 9.471   91.739  1.00 32.35 ? 156 ASP A OD1 1 
ATOM   59   O  OD2 . ASP A 1 12  ? 87.418 9.824   92.427  1.00 32.35 ? 156 ASP A OD2 1 
ATOM   60   N  N   . TYR A 1 13  A 84.670 12.581  89.229  1.00 26.77 ? 156 TYR A N   1 
ATOM   61   C  CA  . TYR A 1 13  A 85.152 12.674  87.857  1.00 26.77 ? 156 TYR A CA  1 
ATOM   62   C  C   . TYR A 1 13  A 85.633 14.112  87.693  1.00 26.77 ? 156 TYR A C   1 
ATOM   63   O  O   . TYR A 1 13  A 85.251 14.993  88.477  1.00 26.77 ? 156 TYR A O   1 
ATOM   64   C  CB  . TYR A 1 13  A 84.026 12.386  86.853  1.00 7.03  ? 156 TYR A CB  1 
ATOM   65   C  CG  . TYR A 1 13  A 83.475 10.971  86.911  1.00 7.03  ? 156 TYR A CG  1 
ATOM   66   C  CD1 . TYR A 1 13  A 83.132 10.284  85.750  1.00 7.03  ? 156 TYR A CD1 1 
ATOM   67   C  CD2 . TYR A 1 13  A 83.290 10.324  88.124  1.00 7.03  ? 156 TYR A CD2 1 
ATOM   68   C  CE1 . TYR A 1 13  A 82.622 8.984   85.805  1.00 7.03  ? 156 TYR A CE1 1 
ATOM   69   C  CE2 . TYR A 1 13  A 82.780 9.035   88.184  1.00 7.03  ? 156 TYR A CE2 1 
ATOM   70   C  CZ  . TYR A 1 13  A 82.451 8.370   87.028  1.00 7.03  ? 156 TYR A CZ  1 
ATOM   71   O  OH  . TYR A 1 13  A 81.972 7.085   87.108  1.00 7.03  ? 156 TYR A OH  1 
ATOM   72   N  N   . PRO A 1 14  ? 86.481 14.379  86.686  1.00 30.21 ? 161 PRO A N   1 
ATOM   73   C  CA  . PRO A 1 14  ? 86.974 15.745  86.485  1.00 30.21 ? 161 PRO A CA  1 
ATOM   74   C  C   . PRO A 1 14  ? 85.902 16.855  86.490  1.00 30.21 ? 161 PRO A C   1 
ATOM   75   O  O   . PRO A 1 14  ? 86.232 18.046  86.588  1.00 30.21 ? 161 PRO A O   1 
ATOM   76   C  CB  . PRO A 1 14  ? 87.742 15.647  85.155  1.00 17.92 ? 161 PRO A CB  1 
ATOM   77   C  CG  . PRO A 1 14  ? 87.223 14.393  84.507  1.00 17.92 ? 161 PRO A CG  1 
ATOM   78   C  CD  . PRO A 1 14  ? 87.039 13.470  85.672  1.00 17.92 ? 161 PRO A CD  1 
ATOM   79   N  N   . GLU A 1 15  ? 84.633 16.460  86.399  1.00 7.86  ? 162 GLU A N   1 
ATOM   80   C  CA  . GLU A 1 15  ? 83.504 17.393  86.394  1.00 7.86  ? 162 GLU A CA  1 
ATOM   81   C  C   . GLU A 1 15  ? 82.552 16.778  87.389  1.00 7.86  ? 162 GLU A C   1 
ATOM   82   O  O   . GLU A 1 15  ? 82.499 15.564  87.499  1.00 7.86  ? 162 GLU A O   1 
ATOM   83   C  CB  . GLU A 1 15  ? 82.848 17.417  85.001  1.00 58.39 ? 162 GLU A CB  1 
ATOM   84   C  CG  . GLU A 1 15  ? 81.911 18.608  84.703  1.00 58.39 ? 162 GLU A CG  1 
ATOM   85   C  CD  . GLU A 1 15  ? 81.185 18.478  83.346  1.00 58.39 ? 162 GLU A CD  1 
ATOM   86   O  OE1 . GLU A 1 15  ? 80.797 19.520  82.762  1.00 58.39 ? 162 GLU A OE1 1 
ATOM   87   O  OE2 . GLU A 1 15  ? 80.991 17.332  82.874  1.00 58.39 ? 162 GLU A OE2 1 
ATOM   88   N  N   . MET A 1 16  A 81.810 17.583  88.130  1.00 7.03  ? 162 MET A N   1 
ATOM   89   C  CA  . MET A 1 16  A 80.883 16.995  89.079  1.00 7.03  ? 162 MET A CA  1 
ATOM   90   C  C   . MET A 1 16  A 79.536 16.789  88.404  1.00 7.03  ? 162 MET A C   1 
ATOM   91   O  O   . MET A 1 16  A 78.938 15.722  88.520  1.00 7.03  ? 162 MET A O   1 
ATOM   92   C  CB  . MET A 1 16  A 80.741 17.877  90.325  1.00 7.03  ? 162 MET A CB  1 
ATOM   93   C  CG  . MET A 1 16  A 81.028 17.151  91.632  1.00 7.03  ? 162 MET A CG  1 
ATOM   94   S  SD  . MET A 1 16  A 79.543 16.600  92.477  1.00 7.03  ? 162 MET A SD  1 
ATOM   95   C  CE  . MET A 1 16  A 79.973 16.874  94.211  1.00 7.03  ? 162 MET A CE  1 
ATOM   96   N  N   . GLY A 1 17  ? 79.064 17.796  87.677  1.00 9.78  ? 163 GLY A N   1 
ATOM   97   C  CA  . GLY A 1 17  ? 77.782 17.654  87.014  1.00 9.78  ? 163 GLY A CA  1 
ATOM   98   C  C   . GLY A 1 17  ? 77.358 18.758  86.068  1.00 9.78  ? 163 GLY A C   1 
ATOM   99   O  O   . GLY A 1 17  ? 78.160 19.592  85.653  1.00 9.78  ? 163 GLY A O   1 
ATOM   100  N  N   . LEU A 1 18  ? 76.073 18.729  85.727  1.00 10.41 ? 164 LEU A N   1 
ATOM   101  C  CA  . LEU A 1 18  ? 75.421 19.689  84.841  1.00 10.41 ? 164 LEU A CA  1 
ATOM   102  C  C   . LEU A 1 18  ? 74.001 19.811  85.384  1.00 10.41 ? 164 LEU A C   1 
ATOM   103  O  O   . LEU A 1 18  ? 73.158 18.950  85.143  1.00 10.41 ? 164 LEU A O   1 
ATOM   104  C  CB  . LEU A 1 18  ? 75.388 19.153  83.414  1.00 7.03  ? 164 LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 18  ? 74.454 19.786  82.385  1.00 7.03  ? 164 LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 18  ? 75.091 21.015  81.764  1.00 7.03  ? 164 LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 18  ? 74.152 18.751  81.306  1.00 7.03  ? 164 LEU A CD2 1 
ATOM   108  N  N   . CYS A 1 19  ? 73.747 20.881  86.125  1.00 23.09 ? 165 CYS A N   1 
ATOM   109  C  CA  . CYS A 1 19  ? 72.449 21.110  86.748  1.00 23.09 ? 165 CYS A CA  1 
ATOM   110  C  C   . CYS A 1 19  ? 71.482 21.966  85.920  1.00 23.09 ? 165 CYS A C   1 
ATOM   111  O  O   . CYS A 1 19  ? 71.546 23.185  85.994  1.00 23.09 ? 165 CYS A O   1 
ATOM   112  C  CB  . CYS A 1 19  ? 72.690 21.771  88.101  1.00 7.03  ? 165 CYS A CB  1 
ATOM   113  S  SG  . CYS A 1 19  ? 71.231 22.354  88.940  1.00 7.03  ? 165 CYS A SG  1 
ATOM   114  N  N   . ILE A 1 20  ? 70.565 21.356  85.166  1.00 17.51 ? 166 ILE A N   1 
ATOM   115  C  CA  . ILE A 1 20  ? 69.633 22.137  84.333  1.00 17.51 ? 166 ILE A CA  1 
ATOM   116  C  C   . ILE A 1 20  ? 68.285 22.593  84.964  1.00 17.51 ? 166 ILE A C   1 
ATOM   117  O  O   . ILE A 1 20  ? 67.311 21.832  85.028  1.00 17.51 ? 166 ILE A O   1 
ATOM   118  C  CB  . ILE A 1 20  ? 69.368 21.388  82.973  1.00 7.03  ? 166 ILE A CB  1 
ATOM   119  C  CG1 . ILE A 1 20  ? 70.622 21.469  82.094  1.00 7.03  ? 166 ILE A CG1 1 
ATOM   120  C  CG2 . ILE A 1 20  ? 68.155 21.971  82.246  1.00 7.03  ? 166 ILE A CG2 1 
ATOM   121  C  CD1 . ILE A 1 20  ? 70.454 20.885  80.722  1.00 7.03  ? 166 ILE A CD1 1 
ATOM   122  N  N   . ILE A 1 21  ? 68.240 23.856  85.405  1.00 15.27 ? 167 ILE A N   1 
ATOM   123  C  CA  . ILE A 1 21  ? 67.038 24.448  86.018  1.00 15.27 ? 167 ILE A CA  1 
ATOM   124  C  C   . ILE A 1 21  ? 66.130 25.137  84.987  1.00 15.27 ? 167 ILE A C   1 
ATOM   125  O  O   . ILE A 1 21  ? 66.443 26.216  84.492  1.00 15.27 ? 167 ILE A O   1 
ATOM   126  C  CB  . ILE A 1 21  ? 67.396 25.528  87.047  1.00 7.03  ? 167 ILE A CB  1 
ATOM   127  C  CG1 . ILE A 1 21  ? 68.466 25.023  88.011  1.00 7.03  ? 167 ILE A CG1 1 
ATOM   128  C  CG2 . ILE A 1 21  ? 66.135 25.965  87.778  1.00 7.03  ? 167 ILE A CG2 1 
ATOM   129  C  CD1 . ILE A 1 21  ? 69.081 26.119  88.867  1.00 7.03  ? 167 ILE A CD1 1 
ATOM   130  N  N   . ILE A 1 22  ? 64.994 24.539  84.674  1.00 7.03  ? 168 ILE A N   1 
ATOM   131  C  CA  . ILE A 1 22  ? 64.119 25.155  83.708  1.00 7.03  ? 168 ILE A CA  1 
ATOM   132  C  C   . ILE A 1 22  ? 63.020 25.906  84.416  1.00 7.03  ? 168 ILE A C   1 
ATOM   133  O  O   . ILE A 1 22  ? 61.995 25.342  84.776  1.00 7.03  ? 168 ILE A O   1 
ATOM   134  C  CB  . ILE A 1 22  ? 63.534 24.110  82.778  1.00 17.94 ? 168 ILE A CB  1 
ATOM   135  C  CG1 . ILE A 1 22  ? 64.687 23.410  82.042  1.00 17.94 ? 168 ILE A CG1 1 
ATOM   136  C  CG2 . ILE A 1 22  ? 62.539 24.768  81.821  1.00 17.94 ? 168 ILE A CG2 1 
ATOM   137  C  CD1 . ILE A 1 22  ? 64.300 22.151  81.294  1.00 17.94 ? 168 ILE A CD1 1 
ATOM   138  N  N   . ASN A 1 23  ? 63.267 27.194  84.619  1.00 7.33  ? 169 ASN A N   1 
ATOM   139  C  CA  . ASN A 1 23  ? 62.344 28.101  85.288  1.00 7.33  ? 169 ASN A CA  1 
ATOM   140  C  C   . ASN A 1 23  ? 61.270 28.518  84.300  1.00 7.33  ? 169 ASN A C   1 
ATOM   141  O  O   . ASN A 1 23  ? 61.578 29.081  83.254  1.00 7.33  ? 169 ASN A O   1 
ATOM   142  C  CB  . ASN A 1 23  ? 63.121 29.338  85.764  1.00 7.37  ? 169 ASN A CB  1 
ATOM   143  C  CG  . ASN A 1 23  ? 62.286 30.281  86.615  1.00 7.37  ? 169 ASN A CG  1 
ATOM   144  O  OD1 . ASN A 1 23  ? 62.089 30.051  87.811  1.00 7.37  ? 169 ASN A OD1 1 
ATOM   145  N  ND2 . ASN A 1 23  ? 61.794 31.359  86.000  1.00 7.37  ? 169 ASN A ND2 1 
ATOM   146  N  N   . ASN A 1 24  ? 60.014 28.216  84.608  1.00 7.15  ? 170 ASN A N   1 
ATOM   147  C  CA  . ASN A 1 24  ? 58.899 28.621  83.747  1.00 7.15  ? 170 ASN A CA  1 
ATOM   148  C  C   . ASN A 1 24  ? 58.063 29.491  84.660  1.00 7.15  ? 170 ASN A C   1 
ATOM   149  O  O   . ASN A 1 24  ? 57.918 29.180  85.841  1.00 7.15  ? 170 ASN A O   1 
ATOM   150  C  CB  . ASN A 1 24  ? 58.088 27.402  83.250  1.00 7.03  ? 170 ASN A CB  1 
ATOM   151  C  CG  . ASN A 1 24  ? 58.618 26.834  81.927  1.00 7.03  ? 170 ASN A CG  1 
ATOM   152  O  OD1 . ASN A 1 24  ? 58.334 27.359  80.847  1.00 7.03  ? 170 ASN A OD1 1 
ATOM   153  N  ND2 . ASN A 1 24  ? 59.401 25.764  82.016  1.00 7.03  ? 170 ASN A ND2 1 
ATOM   154  N  N   . LYS A 1 25  ? 57.528 30.592  84.143  1.00 20.11 ? 171 LYS A N   1 
ATOM   155  C  CA  . LYS A 1 25  ? 56.734 31.473  85.001  1.00 20.11 ? 171 LYS A CA  1 
ATOM   156  C  C   . LYS A 1 25  ? 55.624 32.228  84.297  1.00 20.11 ? 171 LYS A C   1 
ATOM   157  O  O   . LYS A 1 25  ? 54.516 32.316  84.814  1.00 20.11 ? 171 LYS A O   1 
ATOM   158  C  CB  . LYS A 1 25  ? 57.653 32.472  85.712  1.00 21.17 ? 171 LYS A CB  1 
ATOM   159  C  CG  . LYS A 1 25  ? 56.943 33.439  86.644  1.00 21.17 ? 171 LYS A CG  1 
ATOM   160  C  CD  . LYS A 1 25  ? 57.913 34.490  87.186  1.00 21.17 ? 171 LYS A CD  1 
ATOM   161  C  CE  . LYS A 1 25  ? 57.223 35.493  88.118  1.00 21.17 ? 171 LYS A CE  1 
ATOM   162  N  NZ  . LYS A 1 25  ? 58.186 36.482  88.721  1.00 21.17 ? 171 LYS A NZ  1 
ATOM   163  N  N   . ASN A 1 26  ? 55.915 32.786  83.131  1.00 8.50  ? 172 ASN A N   1 
ATOM   164  C  CA  . ASN A 1 26  ? 54.898 33.532  82.401  1.00 8.50  ? 172 ASN A CA  1 
ATOM   165  C  C   . ASN A 1 26  ? 54.270 32.663  81.321  1.00 8.50  ? 172 ASN A C   1 
ATOM   166  O  O   . ASN A 1 26  ? 54.857 32.424  80.257  1.00 8.50  ? 172 ASN A O   1 
ATOM   167  C  CB  . ASN A 1 26  ? 55.497 34.805  81.797  1.00 14.74 ? 172 ASN A CB  1 
ATOM   168  C  CG  . ASN A 1 26  ? 56.152 35.690  82.845  1.00 14.74 ? 172 ASN A CG  1 
ATOM   169  O  OD1 . ASN A 1 26  ? 55.570 35.952  83.897  1.00 14.74 ? 172 ASN A OD1 1 
ATOM   170  N  ND2 . ASN A 1 26  ? 57.368 36.155  82.561  1.00 14.74 ? 172 ASN A ND2 1 
ATOM   171  N  N   . PHE A 1 27  ? 53.060 32.199  81.620  1.00 12.35 ? 173 PHE A N   1 
ATOM   172  C  CA  . PHE A 1 27  ? 52.315 31.325  80.732  1.00 12.35 ? 173 PHE A CA  1 
ATOM   173  C  C   . PHE A 1 27  ? 51.452 32.032  79.709  1.00 12.35 ? 173 PHE A C   1 
ATOM   174  O  O   . PHE A 1 27  ? 50.694 32.944  80.042  1.00 12.35 ? 173 PHE A O   1 
ATOM   175  C  CB  . PHE A 1 27  ? 51.450 30.370  81.564  1.00 9.48  ? 173 PHE A CB  1 
ATOM   176  C  CG  . PHE A 1 27  ? 52.248 29.497  82.487  1.00 9.48  ? 173 PHE A CG  1 
ATOM   177  C  CD1 . PHE A 1 27  ? 52.542 29.911  83.774  1.00 9.48  ? 173 PHE A CD1 1 
ATOM   178  C  CD2 . PHE A 1 27  ? 52.777 28.286  82.037  1.00 9.48  ? 173 PHE A CD2 1 
ATOM   179  C  CE1 . PHE A 1 27  ? 53.355 29.137  84.601  1.00 9.48  ? 173 PHE A CE1 1 
ATOM   180  C  CE2 . PHE A 1 27  ? 53.591 27.507  82.857  1.00 9.48  ? 173 PHE A CE2 1 
ATOM   181  C  CZ  . PHE A 1 27  ? 53.882 27.933  84.138  1.00 9.48  ? 173 PHE A CZ  1 
ATOM   182  N  N   . HIS A 1 28  ? 51.576 31.603  78.459  1.00 7.03  ? 174 HIS A N   1 
ATOM   183  C  CA  . HIS A 1 28  ? 50.794 32.181  77.391  1.00 7.03  ? 174 HIS A CA  1 
ATOM   184  C  C   . HIS A 1 28  ? 49.349 32.291  77.865  1.00 7.03  ? 174 HIS A C   1 
ATOM   185  O  O   . HIS A 1 28  ? 48.764 31.328  78.370  1.00 7.03  ? 174 HIS A O   1 
ATOM   186  C  CB  . HIS A 1 28  ? 50.902 31.321  76.129  1.00 66.08 ? 174 HIS A CB  1 
ATOM   187  C  CG  . HIS A 1 28  ? 50.073 31.821  74.986  1.00 66.08 ? 174 HIS A CG  1 
ATOM   188  N  ND1 . HIS A 1 28  ? 49.915 33.164  74.710  1.00 66.08 ? 174 HIS A ND1 1 
ATOM   189  C  CD2 . HIS A 1 28  ? 49.361 31.157  74.044  1.00 66.08 ? 174 HIS A CD2 1 
ATOM   190  C  CE1 . HIS A 1 28  ? 49.140 33.304  73.648  1.00 66.08 ? 174 HIS A CE1 1 
ATOM   191  N  NE2 . HIS A 1 28  ? 48.791 32.101  73.225  1.00 66.08 ? 174 HIS A NE2 1 
ATOM   192  N  N   . LYS A 1 29  ? 48.799 33.494  77.713  1.00 49.52 ? 175 LYS A N   1 
ATOM   193  C  CA  . LYS A 1 29  ? 47.441 33.825  78.142  1.00 49.52 ? 175 LYS A CA  1 
ATOM   194  C  C   . LYS A 1 29  ? 46.377 32.858  77.647  1.00 49.52 ? 175 LYS A C   1 
ATOM   195  O  O   . LYS A 1 29  ? 45.440 32.529  78.376  1.00 49.52 ? 175 LYS A O   1 
ATOM   196  C  CB  . LYS A 1 29  ? 47.085 35.245  77.687  1.00 39.69 ? 175 LYS A CB  1 
ATOM   197  C  CG  . LYS A 1 29  ? 46.083 35.983  78.585  1.00 39.69 ? 175 LYS A CG  1 
ATOM   198  C  CD  . LYS A 1 29  ? 46.749 36.620  79.822  1.00 39.69 ? 175 LYS A CD  1 
ATOM   199  C  CE  . LYS A 1 29  ? 46.741 35.720  81.072  1.00 39.69 ? 175 LYS A CE  1 
ATOM   200  N  NZ  . LYS A 1 29  ? 45.404 35.617  81.740  1.00 39.69 ? 175 LYS A NZ  1 
ATOM   201  N  N   . SER A 1 30  A 46.519 32.410  76.407  1.00 32.94 ? 175 SER A N   1 
ATOM   202  C  CA  . SER A 1 30  A 45.558 31.495  75.823  1.00 32.94 ? 175 SER A CA  1 
ATOM   203  C  C   . SER A 1 30  A 45.388 30.238  76.676  1.00 32.94 ? 175 SER A C   1 
ATOM   204  O  O   . SER A 1 30  A 44.280 29.707  76.809  1.00 32.94 ? 175 SER A O   1 
ATOM   205  C  CB  . SER A 1 30  A 46.004 31.114  74.419  1.00 33.75 ? 175 SER A CB  1 
ATOM   206  O  OG  . SER A 1 30  A 45.068 30.240  73.821  1.00 33.75 ? 175 SER A OG  1 
ATOM   207  N  N   . THR A 1 31  B 46.486 29.774  77.264  1.00 17.21 ? 175 THR A N   1 
ATOM   208  C  CA  . THR A 1 31  B 46.459 28.578  78.094  1.00 17.21 ? 175 THR A CA  1 
ATOM   209  C  C   . THR A 1 31  B 45.705 28.883  79.383  1.00 17.21 ? 175 THR A C   1 
ATOM   210  O  O   . THR A 1 31  B 45.407 27.989  80.168  1.00 17.21 ? 175 THR A O   1 
ATOM   211  C  CB  . THR A 1 31  B 47.894 28.101  78.451  1.00 63.47 ? 175 THR A CB  1 
ATOM   212  O  OG1 . THR A 1 31  B 48.774 28.329  77.342  1.00 63.47 ? 175 THR A OG1 1 
ATOM   213  C  CG2 . THR A 1 31  B 47.899 26.604  78.772  1.00 63.47 ? 175 THR A CG2 1 
ATOM   214  N  N   . GLY A 1 32  C 45.389 30.152  79.598  1.00 17.98 ? 175 GLY A N   1 
ATOM   215  C  CA  . GLY A 1 32  C 44.676 30.517  80.804  1.00 17.98 ? 175 GLY A CA  1 
ATOM   216  C  C   . GLY A 1 32  C 45.388 29.989  82.036  1.00 17.98 ? 175 GLY A C   1 
ATOM   217  O  O   . GLY A 1 32  C 44.749 29.498  82.965  1.00 17.98 ? 175 GLY A O   1 
ATOM   218  N  N   . MET A 1 33  ? 46.715 30.090  82.037  1.00 29.07 ? 176 MET A N   1 
ATOM   219  C  CA  . MET A 1 33  ? 47.542 29.635  83.157  1.00 29.07 ? 176 MET A CA  1 
ATOM   220  C  C   . MET A 1 33  ? 48.040 30.800  84.012  1.00 29.07 ? 176 MET A C   1 
ATOM   221  O  O   . MET A 1 33  ? 48.745 31.683  83.516  1.00 29.07 ? 176 MET A O   1 
ATOM   222  C  CB  . MET A 1 33  ? 48.754 28.846  82.641  1.00 50.94 ? 176 MET A CB  1 
ATOM   223  C  CG  . MET A 1 33  ? 48.541 27.343  82.506  1.00 50.94 ? 176 MET A CG  1 
ATOM   224  S  SD  . MET A 1 33  ? 48.192 26.545  84.089  1.00 50.94 ? 176 MET A SD  1 
ATOM   225  C  CE  . MET A 1 33  ? 46.369 26.432  84.026  1.00 50.94 ? 176 MET A CE  1 
ATOM   226  N  N   . THR A 1 34  ? 47.686 30.782  85.298  1.00 12.47 ? 177 THR A N   1 
ATOM   227  C  CA  . THR A 1 34  ? 48.094 31.828  86.238  1.00 12.47 ? 177 THR A CA  1 
ATOM   228  C  C   . THR A 1 34  ? 49.605 31.977  86.244  1.00 12.47 ? 177 THR A C   1 
ATOM   229  O  O   . THR A 1 34  ? 50.317 31.108  85.759  1.00 12.47 ? 177 THR A O   1 
ATOM   230  C  CB  . THR A 1 34  ? 47.667 31.496  87.673  1.00 28.03 ? 177 THR A CB  1 
ATOM   231  O  OG1 . THR A 1 34  ? 48.597 30.567  88.244  1.00 28.03 ? 177 THR A OG1 1 
ATOM   232  C  CG2 . THR A 1 34  ? 46.274 30.878  87.682  1.00 28.03 ? 177 THR A CG2 1 
ATOM   233  N  N   . SER A 1 35  ? 50.104 33.073  86.795  1.00 8.91  ? 178 SER A N   1 
ATOM   234  C  CA  . SER A 1 35  ? 51.543 33.276  86.833  1.00 8.91  ? 178 SER A CA  1 
ATOM   235  C  C   . SER A 1 35  ? 52.124 32.753  88.126  1.00 8.91  ? 178 SER A C   1 
ATOM   236  O  O   . SER A 1 35  ? 51.406 32.589  89.113  1.00 8.91  ? 178 SER A O   1 
ATOM   237  C  CB  . SER A 1 35  ? 51.888 34.750  86.688  1.00 12.10 ? 178 SER A CB  1 
ATOM   238  O  OG  . SER A 1 35  ? 53.288 34.906  86.570  1.00 12.10 ? 178 SER A OG  1 
ATOM   239  N  N   . ARG A 1 36  ? 53.428 32.502  88.117  1.00 7.03  ? 179 ARG A N   1 
ATOM   240  C  CA  . ARG A 1 36  ? 54.118 31.975  89.288  1.00 7.03  ? 179 ARG A CA  1 
ATOM   241  C  C   . ARG A 1 36  ? 54.985 32.999  90.024  1.00 7.03  ? 179 ARG A C   1 
ATOM   242  O  O   . ARG A 1 36  ? 56.207 33.006  89.894  1.00 7.03  ? 179 ARG A O   1 
ATOM   243  C  CB  . ARG A 1 36  ? 54.973 30.777  88.877  1.00 7.03  ? 179 ARG A CB  1 
ATOM   244  C  CG  . ARG A 1 36  ? 54.174 29.572  88.439  1.00 7.03  ? 179 ARG A CG  1 
ATOM   245  C  CD  . ARG A 1 36  ? 55.062 28.357  88.327  1.00 7.03  ? 179 ARG A CD  1 
ATOM   246  N  NE  . ARG A 1 36  ? 55.696 28.062  89.606  1.00 7.03  ? 179 ARG A NE  1 
ATOM   247  C  CZ  . ARG A 1 36  ? 56.964 27.692  89.737  1.00 7.03  ? 179 ARG A CZ  1 
ATOM   248  N  NH1 . ARG A 1 36  ? 57.716 27.573  88.659  1.00 7.03  ? 179 ARG A NH1 1 
ATOM   249  N  NH2 . ARG A 1 36  ? 57.481 27.461  90.942  1.00 7.03  ? 179 ARG A NH2 1 
ATOM   250  N  N   . SER A 1 37  ? 54.347 33.831  90.832  1.00 7.42  ? 180 SER A N   1 
ATOM   251  C  CA  . SER A 1 37  ? 55.039 34.888  91.569  1.00 7.42  ? 180 SER A CA  1 
ATOM   252  C  C   . SER A 1 37  ? 56.179 34.493  92.527  1.00 7.42  ? 180 SER A C   1 
ATOM   253  O  O   . SER A 1 37  ? 55.947 34.196  93.703  1.00 7.42  ? 180 SER A O   1 
ATOM   254  C  CB  . SER A 1 37  ? 54.003 35.726  92.331  1.00 26.12 ? 180 SER A CB  1 
ATOM   255  O  OG  . SER A 1 37  ? 52.926 36.100  91.481  1.00 26.12 ? 180 SER A OG  1 
ATOM   256  N  N   . GLY A 1 38  ? 57.412 34.517  92.024  1.00 19.46 ? 181 GLY A N   1 
ATOM   257  C  CA  . GLY A 1 38  ? 58.551 34.189  92.862  1.00 19.46 ? 181 GLY A CA  1 
ATOM   258  C  C   . GLY A 1 38  ? 59.422 33.019  92.446  1.00 19.46 ? 181 GLY A C   1 
ATOM   259  O  O   . GLY A 1 38  ? 60.361 32.689  93.159  1.00 19.46 ? 181 GLY A O   1 
ATOM   260  N  N   . THR A 1 39  ? 59.133 32.388  91.310  1.00 16.54 ? 182 THR A N   1 
ATOM   261  C  CA  . THR A 1 39  ? 59.935 31.252  90.846  1.00 16.54 ? 182 THR A CA  1 
ATOM   262  C  C   . THR A 1 39  ? 61.380 31.693  90.816  1.00 16.54 ? 182 THR A C   1 
ATOM   263  O  O   . THR A 1 39  ? 62.297 30.937  91.126  1.00 16.54 ? 182 THR A O   1 
ATOM   264  C  CB  . THR A 1 39  ? 59.604 30.850  89.403  1.00 23.08 ? 182 THR A CB  1 
ATOM   265  O  OG1 . THR A 1 39  ? 58.238 31.156  89.104  1.00 23.08 ? 182 THR A OG1 1 
ATOM   266  C  CG2 . THR A 1 39  ? 59.856 29.377  89.213  1.00 23.08 ? 182 THR A CG2 1 
ATOM   267  N  N   . ASP A 1 40  ? 61.553 32.939  90.403  1.00 15.07 ? 183 ASP A N   1 
ATOM   268  C  CA  . ASP A 1 40  ? 62.851 33.558  90.283  1.00 15.07 ? 183 ASP A CA  1 
ATOM   269  C  C   . ASP A 1 40  ? 63.638 33.462  91.587  1.00 15.07 ? 183 ASP A C   1 
ATOM   270  O  O   . ASP A 1 40  ? 64.827 33.141  91.576  1.00 15.07 ? 183 ASP A O   1 
ATOM   271  C  CB  . ASP A 1 40  ? 62.654 35.008  89.840  1.00 66.40 ? 183 ASP A CB  1 
ATOM   272  C  CG  . ASP A 1 40  ? 61.942 35.114  88.479  1.00 66.40 ? 183 ASP A CG  1 
ATOM   273  O  OD1 . ASP A 1 40  ? 61.578 34.055  87.923  1.00 66.40 ? 183 ASP A OD1 1 
ATOM   274  O  OD2 . ASP A 1 40  ? 61.740 36.245  87.966  1.00 66.40 ? 183 ASP A OD2 1 
ATOM   275  N  N   . VAL A 1 41  ? 62.981 33.724  92.713  1.00 16.92 ? 184 VAL A N   1 
ATOM   276  C  CA  . VAL A 1 41  ? 63.661 33.628  93.999  1.00 16.92 ? 184 VAL A CA  1 
ATOM   277  C  C   . VAL A 1 41  ? 64.255 32.234  94.038  1.00 16.92 ? 184 VAL A C   1 
ATOM   278  O  O   . VAL A 1 41  ? 65.459 32.054  94.260  1.00 16.92 ? 184 VAL A O   1 
ATOM   279  C  CB  . VAL A 1 41  ? 62.704 33.750  95.178  1.00 7.03  ? 184 VAL A CB  1 
ATOM   280  C  CG1 . VAL A 1 41  ? 63.479 34.116  96.390  1.00 7.03  ? 184 VAL A CG1 1 
ATOM   281  C  CG2 . VAL A 1 41  ? 61.638 34.772  94.904  1.00 7.03  ? 184 VAL A CG2 1 
ATOM   282  N  N   . ASP A 1 42  ? 63.383 31.253  93.809  1.00 7.03  ? 185 ASP A N   1 
ATOM   283  C  CA  . ASP A 1 42  ? 63.783 29.868  93.768  1.00 7.03  ? 185 ASP A CA  1 
ATOM   284  C  C   . ASP A 1 42  ? 64.936 29.832  92.770  1.00 7.03  ? 185 ASP A C   1 
ATOM   285  O  O   . ASP A 1 42  ? 66.090 29.947  93.153  1.00 7.03  ? 185 ASP A O   1 
ATOM   286  C  CB  . ASP A 1 42  ? 62.634 28.990  93.264  1.00 7.03  ? 185 ASP A CB  1 
ATOM   287  C  CG  . ASP A 1 42  ? 61.369 29.118  94.106  1.00 7.03  ? 185 ASP A CG  1 
ATOM   288  O  OD1 . ASP A 1 42  ? 61.471 29.208  95.346  1.00 7.03  ? 185 ASP A OD1 1 
ATOM   289  O  OD2 . ASP A 1 42  ? 60.264 29.105  93.520  1.00 7.03  ? 185 ASP A OD2 1 
ATOM   290  N  N   . ALA A 1 43  ? 64.605 29.715  91.487  1.00 7.03  ? 186 ALA A N   1 
ATOM   291  C  CA  . ALA A 1 43  ? 65.587 29.655  90.406  1.00 7.03  ? 186 ALA A CA  1 
ATOM   292  C  C   . ALA A 1 43  ? 66.895 30.362  90.722  1.00 7.03  ? 186 ALA A C   1 
ATOM   293  O  O   . ALA A 1 43  ? 67.964 29.923  90.310  1.00 7.03  ? 186 ALA A O   1 
ATOM   294  C  CB  . ALA A 1 43  ? 64.988 30.230  89.140  1.00 9.88  ? 186 ALA A CB  1 
ATOM   295  N  N   . ALA A 1 44  ? 66.802 31.468  91.449  1.00 7.03  ? 187 ALA A N   1 
ATOM   296  C  CA  . ALA A 1 44  ? 67.980 32.238  91.817  1.00 7.03  ? 187 ALA A CA  1 
ATOM   297  C  C   . ALA A 1 44  ? 68.718 31.544  92.940  1.00 7.03  ? 187 ALA A C   1 
ATOM   298  O  O   . ALA A 1 44  ? 69.942 31.446  92.906  1.00 7.03  ? 187 ALA A O   1 
ATOM   299  C  CB  . ALA A 1 44  ? 67.579 33.626  92.247  1.00 10.28 ? 187 ALA A CB  1 
ATOM   300  N  N   . ASN A 1 45  ? 67.954 31.078  93.930  1.00 7.11  ? 188 ASN A N   1 
ATOM   301  C  CA  . ASN A 1 45  ? 68.468 30.349  95.098  1.00 7.11  ? 188 ASN A CA  1 
ATOM   302  C  C   . ASN A 1 45  ? 69.082 29.005  94.671  1.00 7.11  ? 188 ASN A C   1 
ATOM   303  O  O   . ASN A 1 45  ? 70.222 28.688  95.013  1.00 7.11  ? 188 ASN A O   1 
ATOM   304  C  CB  . ASN A 1 45  ? 67.325 30.085  96.074  1.00 27.76 ? 188 ASN A CB  1 
ATOM   305  C  CG  . ASN A 1 45  ? 67.728 30.297  97.519  1.00 27.76 ? 188 ASN A CG  1 
ATOM   306  O  OD1 . ASN A 1 45  ? 68.243 31.355  97.881  1.00 27.76 ? 188 ASN A OD1 1 
ATOM   307  N  ND2 . ASN A 1 45  ? 67.484 29.296  98.358  1.00 27.76 ? 188 ASN A ND2 1 
ATOM   308  N  N   . LEU A 1 46  ? 68.315 28.217  93.922  1.00 7.03  ? 189 LEU A N   1 
ATOM   309  C  CA  . LEU A 1 46  ? 68.800 26.930  93.441  1.00 7.03  ? 189 LEU A CA  1 
ATOM   310  C  C   . LEU A 1 46  ? 70.049 27.207  92.612  1.00 7.03  ? 189 LEU A C   1 
ATOM   311  O  O   . LEU A 1 46  ? 71.099 26.596  92.812  1.00 7.03  ? 189 LEU A O   1 
ATOM   312  C  CB  . LEU A 1 46  ? 67.761 26.237  92.544  1.00 7.03  ? 189 LEU A CB  1 
ATOM   313  C  CG  . LEU A 1 46  ? 66.289 26.043  92.927  1.00 7.03  ? 189 LEU A CG  1 
ATOM   314  C  CD1 . LEU A 1 46  ? 65.525 25.621  91.686  1.00 7.03  ? 189 LEU A CD1 1 
ATOM   315  C  CD2 . LEU A 1 46  ? 66.128 25.016  94.024  1.00 7.03  ? 189 LEU A CD2 1 
ATOM   316  N  N   . ARG A 1 47  ? 69.932 28.141  91.677  1.00 9.16  ? 190 ARG A N   1 
ATOM   317  C  CA  . ARG A 1 47  ? 71.058 28.459  90.811  1.00 9.16  ? 190 ARG A CA  1 
ATOM   318  C  C   . ARG A 1 47  ? 72.318 28.654  91.632  1.00 9.16  ? 190 ARG A C   1 
ATOM   319  O  O   . ARG A 1 47  ? 73.404 28.278  91.204  1.00 9.16  ? 190 ARG A O   1 
ATOM   320  C  CB  . ARG A 1 47  ? 70.777 29.717  89.967  1.00 7.03  ? 190 ARG A CB  1 
ATOM   321  C  CG  . ARG A 1 47  ? 71.886 30.036  88.954  1.00 7.03  ? 190 ARG A CG  1 
ATOM   322  C  CD  . ARG A 1 47  ? 71.553 31.242  88.107  1.00 7.03  ? 190 ARG A CD  1 
ATOM   323  N  NE  . ARG A 1 47  ? 72.745 31.876  87.538  1.00 7.03  ? 190 ARG A NE  1 
ATOM   324  C  CZ  . ARG A 1 47  ? 73.441 31.417  86.501  1.00 7.03  ? 190 ARG A CZ  1 
ATOM   325  N  NH1 . ARG A 1 47  ? 73.078 30.298  85.889  1.00 7.03  ? 190 ARG A NH1 1 
ATOM   326  N  NH2 . ARG A 1 47  ? 74.498 32.094  86.068  1.00 7.03  ? 190 ARG A NH2 1 
ATOM   327  N  N   . GLU A 1 48  ? 72.169 29.224  92.818  1.00 7.15  ? 191 GLU A N   1 
ATOM   328  C  CA  . GLU A 1 48  ? 73.323 29.457  93.667  1.00 7.15  ? 191 GLU A CA  1 
ATOM   329  C  C   . GLU A 1 48  ? 73.652 28.199  94.454  1.00 7.15  ? 191 GLU A C   1 
ATOM   330  O  O   . GLU A 1 48  ? 74.816 27.852  94.621  1.00 7.15  ? 191 GLU A O   1 
ATOM   331  C  CB  . GLU A 1 48  ? 73.051 30.622  94.622  1.00 13.40 ? 191 GLU A CB  1 
ATOM   332  C  CG  . GLU A 1 48  ? 74.259 31.097  95.416  1.00 13.40 ? 191 GLU A CG  1 
ATOM   333  C  CD  . GLU A 1 48  ? 75.479 31.363  94.546  1.00 13.40 ? 191 GLU A CD  1 
ATOM   334  O  OE1 . GLU A 1 48  ? 75.316 31.799  93.383  1.00 13.40 ? 191 GLU A OE1 1 
ATOM   335  O  OE2 . GLU A 1 48  ? 76.608 31.147  95.037  1.00 13.40 ? 191 GLU A OE2 1 
ATOM   336  N  N   . THR A 1 49  ? 72.620 27.510  94.921  1.00 19.18 ? 192 THR A N   1 
ATOM   337  C  CA  . THR A 1 49  ? 72.810 26.295  95.692  1.00 19.18 ? 192 THR A CA  1 
ATOM   338  C  C   . THR A 1 49  ? 73.561 25.178  94.951  1.00 19.18 ? 192 THR A C   1 
ATOM   339  O  O   . THR A 1 49  ? 74.309 24.428  95.577  1.00 19.18 ? 192 THR A O   1 
ATOM   340  C  CB  . THR A 1 49  ? 71.462 25.743  96.177  1.00 18.22 ? 192 THR A CB  1 
ATOM   341  O  OG1 . THR A 1 49  ? 70.808 26.728  96.986  1.00 18.22 ? 192 THR A OG1 1 
ATOM   342  C  CG2 . THR A 1 49  ? 71.669 24.474  96.991  1.00 18.22 ? 192 THR A CG2 1 
ATOM   343  N  N   . PHE A 1 50  ? 73.373 25.057  93.636  1.00 7.03  ? 193 PHE A N   1 
ATOM   344  C  CA  . PHE A 1 50  ? 74.056 24.003  92.872  1.00 7.03  ? 193 PHE A CA  1 
ATOM   345  C  C   . PHE A 1 50  ? 75.322 24.517  92.205  1.00 7.03  ? 193 PHE A C   1 
ATOM   346  O  O   . PHE A 1 50  ? 76.107 23.752  91.659  1.00 7.03  ? 193 PHE A O   1 
ATOM   347  C  CB  . PHE A 1 50  ? 73.114 23.397  91.821  1.00 8.31  ? 193 PHE A CB  1 
ATOM   348  C  CG  . PHE A 1 50  ? 72.148 22.364  92.379  1.00 8.31  ? 193 PHE A CG  1 
ATOM   349  C  CD1 . PHE A 1 50  ? 72.570 21.069  92.655  1.00 8.31  ? 193 PHE A CD1 1 
ATOM   350  C  CD2 . PHE A 1 50  ? 70.812 22.687  92.605  1.00 8.31  ? 193 PHE A CD2 1 
ATOM   351  C  CE1 . PHE A 1 50  ? 71.681 20.119  93.139  1.00 8.31  ? 193 PHE A CE1 1 
ATOM   352  C  CE2 . PHE A 1 50  ? 69.922 21.738  93.091  1.00 8.31  ? 193 PHE A CE2 1 
ATOM   353  C  CZ  . PHE A 1 50  ? 70.357 20.459  93.356  1.00 8.31  ? 193 PHE A CZ  1 
ATOM   354  N  N   . ARG A 1 51  ? 75.509 25.827  92.253  1.00 11.53 ? 194 ARG A N   1 
ATOM   355  C  CA  . ARG A 1 51  ? 76.694 26.451  91.693  1.00 11.53 ? 194 ARG A CA  1 
ATOM   356  C  C   . ARG A 1 51  ? 77.774 26.246  92.755  1.00 11.53 ? 194 ARG A C   1 
ATOM   357  O  O   . ARG A 1 51  ? 78.961 26.121  92.458  1.00 11.53 ? 194 ARG A O   1 
ATOM   358  C  CB  . ARG A 1 51  ? 76.435 27.946  91.497  1.00 9.68  ? 194 ARG A CB  1 
ATOM   359  C  CG  . ARG A 1 51  ? 77.569 28.731  90.833  1.00 9.68  ? 194 ARG A CG  1 
ATOM   360  C  CD  . ARG A 1 51  ? 77.765 30.074  91.515  1.00 9.68  ? 194 ARG A CD  1 
ATOM   361  N  NE  . ARG A 1 51  ? 79.130 30.218  92.012  1.00 9.68  ? 194 ARG A NE  1 
ATOM   362  C  CZ  . ARG A 1 51  ? 79.478 31.000  93.028  1.00 9.68  ? 194 ARG A CZ  1 
ATOM   363  N  NH1 . ARG A 1 51  ? 78.557 31.717  93.663  1.00 9.68  ? 194 ARG A NH1 1 
ATOM   364  N  NH2 . ARG A 1 51  ? 80.748 31.053  93.411  1.00 9.68  ? 194 ARG A NH2 1 
ATOM   365  N  N   . ASN A 1 52  ? 77.329 26.208  94.007  1.00 31.38 ? 195 ASN A N   1 
ATOM   366  C  CA  . ASN A 1 52  ? 78.211 26.037  95.148  1.00 31.38 ? 195 ASN A CA  1 
ATOM   367  C  C   . ASN A 1 52  ? 78.721 24.619  95.337  1.00 31.38 ? 195 ASN A C   1 
ATOM   368  O  O   . ASN A 1 52  ? 79.388 24.325  96.327  1.00 31.38 ? 195 ASN A O   1 
ATOM   369  C  CB  . ASN A 1 52  ? 77.499 26.463  96.430  1.00 10.08 ? 195 ASN A CB  1 
ATOM   370  C  CG  . ASN A 1 52  ? 77.982 27.803  96.956  1.00 10.08 ? 195 ASN A CG  1 
ATOM   371  O  OD1 . ASN A 1 52  ? 77.834 28.101  98.144  1.00 10.08 ? 195 ASN A OD1 1 
ATOM   372  N  ND2 . ASN A 1 52  ? 78.553 28.622  96.075  1.00 10.08 ? 195 ASN A ND2 1 
ATOM   373  N  N   . LEU A 1 53  ? 78.422 23.733  94.398  1.00 20.38 ? 196 LEU A N   1 
ATOM   374  C  CA  . LEU A 1 53  ? 78.856 22.353  94.539  1.00 20.38 ? 196 LEU A CA  1 
ATOM   375  C  C   . LEU A 1 53  ? 79.388 21.811  93.225  1.00 20.38 ? 196 LEU A C   1 
ATOM   376  O  O   . LEU A 1 53  ? 79.251 20.630  92.938  1.00 20.38 ? 196 LEU A O   1 
ATOM   377  C  CB  . LEU A 1 53  ? 77.675 21.511  95.034  1.00 7.49  ? 196 LEU A CB  1 
ATOM   378  C  CG  . LEU A 1 53  ? 76.886 22.121  96.208  1.00 7.49  ? 196 LEU A CG  1 
ATOM   379  C  CD1 . LEU A 1 53  ? 75.593 21.357  96.441  1.00 7.49  ? 196 LEU A CD1 1 
ATOM   380  C  CD2 . LEU A 1 53  ? 77.748 22.129  97.460  1.00 7.49  ? 196 LEU A CD2 1 
ATOM   381  N  N   . LYS A 1 54  ? 79.983 22.692  92.428  1.00 22.11 ? 197 LYS A N   1 
ATOM   382  C  CA  . LYS A 1 54  ? 80.565 22.343  91.132  1.00 22.11 ? 197 LYS A CA  1 
ATOM   383  C  C   . LYS A 1 54  ? 79.625 21.895  89.995  1.00 22.11 ? 197 LYS A C   1 
ATOM   384  O  O   . LYS A 1 54  ? 79.952 20.952  89.270  1.00 22.11 ? 197 LYS A O   1 
ATOM   385  C  CB  . LYS A 1 54  ? 81.647 21.267  91.302  1.00 28.60 ? 197 LYS A CB  1 
ATOM   386  C  CG  . LYS A 1 54  ? 82.888 21.670  92.099  1.00 28.60 ? 197 LYS A CG  1 
ATOM   387  C  CD  . LYS A 1 54  ? 84.095 20.761  91.728  1.00 28.60 ? 197 LYS A CD  1 
ATOM   388  C  CE  . LYS A 1 54  ? 83.777 19.250  91.795  1.00 28.60 ? 197 LYS A CE  1 
ATOM   389  N  NZ  . LYS A 1 54  ? 84.873 18.403  91.233  1.00 28.60 ? 197 LYS A NZ  1 
ATOM   390  N  N   . TYR A 1 55  ? 78.485 22.565  89.813  1.00 7.25  ? 198 TYR A N   1 
ATOM   391  C  CA  . TYR A 1 55  ? 77.567 22.183  88.736  1.00 7.25  ? 198 TYR A CA  1 
ATOM   392  C  C   . TYR A 1 55  ? 77.408 23.221  87.646  1.00 7.25  ? 198 TYR A C   1 
ATOM   393  O  O   . TYR A 1 55  ? 77.153 24.394  87.913  1.00 7.25  ? 198 TYR A O   1 
ATOM   394  C  CB  . TYR A 1 55  ? 76.172 21.864  89.269  1.00 16.79 ? 198 TYR A CB  1 
ATOM   395  C  CG  . TYR A 1 55  ? 75.995 20.468  89.797  1.00 16.79 ? 198 TYR A CG  1 
ATOM   396  C  CD1 . TYR A 1 55  ? 75.006 19.633  89.285  1.00 16.79 ? 198 TYR A CD1 1 
ATOM   397  C  CD2 . TYR A 1 55  ? 76.770 20.002  90.849  1.00 16.79 ? 198 TYR A CD2 1 
ATOM   398  C  CE1 . TYR A 1 55  ? 74.790 18.372  89.815  1.00 16.79 ? 198 TYR A CE1 1 
ATOM   399  C  CE2 . TYR A 1 55  ? 76.563 18.744  91.389  1.00 16.79 ? 198 TYR A CE2 1 
ATOM   400  C  CZ  . TYR A 1 55  ? 75.572 17.933  90.873  1.00 16.79 ? 198 TYR A CZ  1 
ATOM   401  O  OH  . TYR A 1 55  ? 75.377 16.693  91.437  1.00 16.79 ? 198 TYR A OH  1 
ATOM   402  N  N   . GLU A 1 56  ? 77.553 22.788  86.405  1.00 20.29 ? 199 GLU A N   1 
ATOM   403  C  CA  . GLU A 1 56  ? 77.367 23.704  85.302  1.00 20.29 ? 199 GLU A CA  1 
ATOM   404  C  C   . GLU A 1 56  ? 75.870 23.930  85.266  1.00 20.29 ? 199 GLU A C   1 
ATOM   405  O  O   . GLU A 1 56  ? 75.144 23.153  84.648  1.00 20.29 ? 199 GLU A O   1 
ATOM   406  C  CB  . GLU A 1 56  ? 77.835 23.083  83.975  1.00 44.37 ? 199 GLU A CB  1 
ATOM   407  C  CG  . GLU A 1 56  ? 79.330 23.233  83.653  1.00 44.37 ? 199 GLU A CG  1 
ATOM   408  C  CD  . GLU A 1 56  ? 80.253 22.855  84.813  1.00 44.37 ? 199 GLU A CD  1 
ATOM   409  O  OE1 . GLU A 1 56  ? 80.072 21.772  85.413  1.00 44.37 ? 199 GLU A OE1 1 
ATOM   410  O  OE2 . GLU A 1 56  ? 81.174 23.640  85.123  1.00 44.37 ? 199 GLU A OE2 1 
ATOM   411  N  N   . VAL A 1 57  ? 75.399 24.955  85.971  1.00 7.03  ? 200 VAL A N   1 
ATOM   412  C  CA  . VAL A 1 57  ? 73.976 25.267  85.959  1.00 7.03  ? 200 VAL A CA  1 
ATOM   413  C  C   . VAL A 1 57  ? 73.693 26.145  84.745  1.00 7.03  ? 200 VAL A C   1 
ATOM   414  O  O   . VAL A 1 57  ? 74.521 26.967  84.366  1.00 7.03  ? 200 VAL A O   1 
ATOM   415  C  CB  . VAL A 1 57  ? 73.519 26.004  87.252  1.00 7.03  ? 200 VAL A CB  1 
ATOM   416  C  CG1 . VAL A 1 57  ? 73.508 25.043  88.421  1.00 7.03  ? 200 VAL A CG1 1 
ATOM   417  C  CG2 . VAL A 1 57  ? 74.440 27.164  87.556  1.00 7.03  ? 200 VAL A CG2 1 
ATOM   418  N  N   . ARG A 1 58  ? 72.544 25.930  84.115  1.00 25.58 ? 201 ARG A N   1 
ATOM   419  C  CA  . ARG A 1 58  ? 72.125 26.709  82.947  1.00 25.58 ? 201 ARG A CA  1 
ATOM   420  C  C   . ARG A 1 58  ? 70.636 27.005  83.158  1.00 25.58 ? 201 ARG A C   1 
ATOM   421  O  O   . ARG A 1 58  ? 69.805 26.116  82.990  1.00 25.58 ? 201 ARG A O   1 
ATOM   422  C  CB  . ARG A 1 58  ? 72.295 25.907  81.639  1.00 37.55 ? 201 ARG A CB  1 
ATOM   423  C  CG  . ARG A 1 58  ? 73.723 25.653  81.135  1.00 37.55 ? 201 ARG A CG  1 
ATOM   424  C  CD  . ARG A 1 58  ? 74.457 24.667  82.015  1.00 37.55 ? 201 ARG A CD  1 
ATOM   425  N  NE  . ARG A 1 58  ? 75.594 24.011  81.360  1.00 37.55 ? 201 ARG A NE  1 
ATOM   426  C  CZ  . ARG A 1 58  ? 76.705 24.626  80.962  1.00 37.55 ? 201 ARG A CZ  1 
ATOM   427  N  NH1 . ARG A 1 58  ? 76.848 25.940  81.139  1.00 37.55 ? 201 ARG A NH1 1 
ATOM   428  N  NH2 . ARG A 1 58  ? 77.686 23.915  80.412  1.00 37.55 ? 201 ARG A NH2 1 
ATOM   429  N  N   . ASN A 1 59  ? 70.290 28.235  83.528  1.00 7.08  ? 202 ASN A N   1 
ATOM   430  C  CA  . ASN A 1 59  ? 68.892 28.573  83.769  1.00 7.08  ? 202 ASN A CA  1 
ATOM   431  C  C   . ASN A 1 59  ? 68.195 29.046  82.501  1.00 7.08  ? 202 ASN A C   1 
ATOM   432  O  O   . ASN A 1 59  ? 68.573 30.065  81.942  1.00 7.08  ? 202 ASN A O   1 
ATOM   433  C  CB  . ASN A 1 59  ? 68.783 29.679  84.817  1.00 7.03  ? 202 ASN A CB  1 
ATOM   434  C  CG  . ASN A 1 59  ? 69.634 29.417  86.048  1.00 7.03  ? 202 ASN A CG  1 
ATOM   435  O  OD1 . ASN A 1 59  ? 70.836 29.185  85.946  1.00 7.03  ? 202 ASN A OD1 1 
ATOM   436  N  ND2 . ASN A 1 59  ? 69.011 29.474  87.224  1.00 7.03  ? 202 ASN A ND2 1 
ATOM   437  N  N   . LYS A 1 60  ? 67.187 28.306  82.046  1.00 7.03  ? 203 LYS A N   1 
ATOM   438  C  CA  . LYS A 1 60  ? 66.426 28.678  80.855  1.00 7.03  ? 203 LYS A CA  1 
ATOM   439  C  C   . LYS A 1 60  ? 65.055 29.014  81.369  1.00 7.03  ? 203 LYS A C   1 
ATOM   440  O  O   . LYS A 1 60  ? 64.588 28.368  82.293  1.00 7.03  ? 203 LYS A O   1 
ATOM   441  C  CB  . LYS A 1 60  ? 66.340 27.524  79.861  1.00 9.15  ? 203 LYS A CB  1 
ATOM   442  C  CG  . LYS A 1 60  ? 67.536 27.412  78.933  1.00 9.15  ? 203 LYS A CG  1 
ATOM   443  C  CD  . LYS A 1 60  ? 68.807 27.137  79.712  1.00 9.15  ? 203 LYS A CD  1 
ATOM   444  C  CE  . LYS A 1 60  ? 69.467 25.824  79.289  1.00 9.15  ? 203 LYS A CE  1 
ATOM   445  N  NZ  . LYS A 1 60  ? 70.041 25.841  77.901  1.00 9.15  ? 203 LYS A NZ  1 
ATOM   446  N  N   . ASN A 1 61  ? 64.410 30.019  80.783  1.00 12.88 ? 204 ASN A N   1 
ATOM   447  C  CA  . ASN A 1 61  ? 63.097 30.438  81.259  1.00 12.88 ? 204 ASN A CA  1 
ATOM   448  C  C   . ASN A 1 61  ? 62.002 30.380  80.228  1.00 12.88 ? 204 ASN A C   1 
ATOM   449  O  O   . ASN A 1 61  ? 62.265 30.301  79.037  1.00 12.88 ? 204 ASN A O   1 
ATOM   450  C  CB  . ASN A 1 61  ? 63.151 31.863  81.791  1.00 10.15 ? 204 ASN A CB  1 
ATOM   451  C  CG  . ASN A 1 61  ? 64.185 32.046  82.865  1.00 10.15 ? 204 ASN A CG  1 
ATOM   452  O  OD1 . ASN A 1 61  ? 64.398 33.157  83.346  1.00 10.15 ? 204 ASN A OD1 1 
ATOM   453  N  ND2 . ASN A 1 61  ? 64.841 30.960  83.251  1.00 10.15 ? 204 ASN A ND2 1 
ATOM   454  N  N   . ASP A 1 62  ? 60.770 30.455  80.718  1.00 16.99 ? 205 ASP A N   1 
ATOM   455  C  CA  . ASP A 1 62  ? 59.574 30.423  79.896  1.00 16.99 ? 205 ASP A CA  1 
ATOM   456  C  C   . ASP A 1 62  ? 59.735 29.711  78.566  1.00 16.99 ? 205 ASP A C   1 
ATOM   457  O  O   . ASP A 1 62  ? 59.596 30.316  77.503  1.00 16.99 ? 205 ASP A O   1 
ATOM   458  C  CB  . ASP A 1 62  ? 59.072 31.839  79.668  1.00 8.29  ? 205 ASP A CB  1 
ATOM   459  C  CG  . ASP A 1 62  ? 58.635 32.494  80.949  1.00 8.29  ? 205 ASP A CG  1 
ATOM   460  O  OD1 . ASP A 1 62  ? 59.510 32.877  81.751  1.00 8.29  ? 205 ASP A OD1 1 
ATOM   461  O  OD2 . ASP A 1 62  ? 57.413 32.605  81.169  1.00 8.29  ? 205 ASP A OD2 1 
ATOM   462  N  N   . LEU A 1 63  ? 60.026 28.418  78.627  1.00 7.52  ? 206 LEU A N   1 
ATOM   463  C  CA  . LEU A 1 63  ? 60.195 27.624  77.421  1.00 7.52  ? 206 LEU A CA  1 
ATOM   464  C  C   . LEU A 1 63  ? 58.842 26.970  77.189  1.00 7.52  ? 206 LEU A C   1 
ATOM   465  O  O   . LEU A 1 63  ? 58.008 26.944  78.094  1.00 7.52  ? 206 LEU A O   1 
ATOM   466  C  CB  . LEU A 1 63  ? 61.264 26.543  77.636  1.00 7.03  ? 206 LEU A CB  1 
ATOM   467  C  CG  . LEU A 1 63  ? 62.529 26.866  78.445  1.00 7.03  ? 206 LEU A CG  1 
ATOM   468  C  CD1 . LEU A 1 63  ? 63.363 25.626  78.588  1.00 7.03  ? 206 LEU A CD1 1 
ATOM   469  C  CD2 . LEU A 1 63  ? 63.329 27.945  77.769  1.00 7.03  ? 206 LEU A CD2 1 
ATOM   470  N  N   . THR A 1 64  ? 58.610 26.452  75.989  1.00 23.22 ? 207 THR A N   1 
ATOM   471  C  CA  . THR A 1 64  ? 57.344 25.787  75.690  1.00 23.22 ? 207 THR A CA  1 
ATOM   472  C  C   . THR A 1 64  ? 57.535 24.276  75.766  1.00 23.22 ? 207 THR A C   1 
ATOM   473  O  O   . THR A 1 64  ? 58.659 23.785  75.771  1.00 23.22 ? 207 THR A O   1 
ATOM   474  C  CB  . THR A 1 64  ? 56.832 26.140  74.275  1.00 7.34  ? 207 THR A CB  1 
ATOM   475  O  OG1 . THR A 1 64  ? 57.801 25.744  73.291  1.00 7.34  ? 207 THR A OG1 1 
ATOM   476  C  CG2 . THR A 1 64  ? 56.550 27.636  74.176  1.00 7.34  ? 207 THR A CG2 1 
ATOM   477  N  N   . ARG A 1 65  ? 56.438 23.538  75.833  1.00 7.03  ? 208 ARG A N   1 
ATOM   478  C  CA  . ARG A 1 65  ? 56.537 22.093  75.881  1.00 7.03  ? 208 ARG A CA  1 
ATOM   479  C  C   . ARG A 1 65  ? 57.406 21.655  74.720  1.00 7.03  ? 208 ARG A C   1 
ATOM   480  O  O   . ARG A 1 65  ? 58.306 20.843  74.896  1.00 7.03  ? 208 ARG A O   1 
ATOM   481  C  CB  . ARG A 1 65  ? 55.153 21.467  75.763  1.00 45.57 ? 208 ARG A CB  1 
ATOM   482  C  CG  . ARG A 1 65  ? 54.354 22.008  74.590  1.00 45.57 ? 208 ARG A CG  1 
ATOM   483  C  CD  . ARG A 1 65  ? 52.892 21.603  74.657  1.00 45.57 ? 208 ARG A CD  1 
ATOM   484  N  NE  . ARG A 1 65  ? 52.680 20.164  74.540  1.00 45.57 ? 208 ARG A NE  1 
ATOM   485  C  CZ  . ARG A 1 65  ? 52.950 19.447  73.450  1.00 45.57 ? 208 ARG A CZ  1 
ATOM   486  N  NH1 . ARG A 1 65  ? 53.458 20.032  72.365  1.00 45.57 ? 208 ARG A NH1 1 
ATOM   487  N  NH2 . ARG A 1 65  ? 52.688 18.141  73.435  1.00 45.57 ? 208 ARG A NH2 1 
ATOM   488  N  N   . GLU A 1 66  ? 57.138 22.208  73.536  1.00 29.74 ? 209 GLU A N   1 
ATOM   489  C  CA  . GLU A 1 66  ? 57.902 21.872  72.333  1.00 29.74 ? 209 GLU A CA  1 
ATOM   490  C  C   . GLU A 1 66  ? 59.150 22.719  72.306  1.00 29.74 ? 209 GLU A C   1 
ATOM   491  O  O   . GLU A 1 66  ? 59.551 23.214  71.257  1.00 29.74 ? 209 GLU A O   1 
ATOM   492  C  CB  . GLU A 1 66  ? 57.108 22.145  71.045  1.00 31.33 ? 209 GLU A CB  1 
ATOM   493  C  CG  . GLU A 1 66  ? 55.625 21.871  71.132  1.00 31.33 ? 209 GLU A CG  1 
ATOM   494  C  CD  . GLU A 1 66  ? 54.828 23.143  71.272  1.00 31.33 ? 209 GLU A CD  1 
ATOM   495  O  OE1 . GLU A 1 66  ? 55.385 24.131  71.800  1.00 31.33 ? 209 GLU A OE1 1 
ATOM   496  O  OE2 . GLU A 1 66  ? 53.651 23.149  70.862  1.00 31.33 ? 209 GLU A OE2 1 
ATOM   497  N  N   . GLU A 1 67  ? 59.745 22.903  73.475  1.00 7.42  ? 210 GLU A N   1 
ATOM   498  C  CA  . GLU A 1 67  ? 60.957 23.688  73.610  1.00 7.42  ? 210 GLU A CA  1 
ATOM   499  C  C   . GLU A 1 67  ? 61.741 22.945  74.653  1.00 7.42  ? 210 GLU A C   1 
ATOM   500  O  O   . GLU A 1 67  ? 62.943 22.751  74.531  1.00 7.42  ? 210 GLU A O   1 
ATOM   501  C  CB  . GLU A 1 67  ? 60.632 25.093  74.120  1.00 34.28 ? 210 GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 67  ? 60.978 26.225  73.158  1.00 34.28 ? 210 GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 67  ? 60.794 27.608  73.781  1.00 34.28 ? 210 GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 67  ? 59.687 27.894  74.299  1.00 34.28 ? 210 GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 67  ? 61.758 28.412  73.745  1.00 34.28 ? 210 GLU A OE2 1 
ATOM   506  N  N   . ILE A 1 68  ? 61.020 22.521  75.682  1.00 25.61 ? 211 ILE A N   1 
ATOM   507  C  CA  . ILE A 1 68  ? 61.590 21.776  76.796  1.00 25.61 ? 211 ILE A CA  1 
ATOM   508  C  C   . ILE A 1 68  ? 62.111 20.431  76.304  1.00 25.61 ? 211 ILE A C   1 
ATOM   509  O  O   . ILE A 1 68  ? 63.221 20.018  76.645  1.00 25.61 ? 211 ILE A O   1 
ATOM   510  C  CB  . ILE A 1 68  ? 60.529 21.561  77.918  1.00 7.03  ? 211 ILE A CB  1 
ATOM   511  C  CG1 . ILE A 1 68  ? 60.213 22.896  78.596  1.00 7.03  ? 211 ILE A CG1 1 
ATOM   512  C  CG2 . ILE A 1 68  ? 61.038 20.597  78.953  1.00 7.03  ? 211 ILE A CG2 1 
ATOM   513  C  CD1 . ILE A 1 68  ? 59.053 22.843  79.562  1.00 7.03  ? 211 ILE A CD1 1 
ATOM   514  N  N   . VAL A 1 69  ? 61.317 19.756  75.484  1.00 32.34 ? 212 VAL A N   1 
ATOM   515  C  CA  . VAL A 1 69  ? 61.721 18.464  74.958  1.00 32.34 ? 212 VAL A CA  1 
ATOM   516  C  C   . VAL A 1 69  ? 63.030 18.596  74.180  1.00 32.34 ? 212 VAL A C   1 
ATOM   517  O  O   . VAL A 1 69  ? 63.993 17.874  74.443  1.00 32.34 ? 212 VAL A O   1 
ATOM   518  C  CB  . VAL A 1 69  ? 60.619 17.885  74.060  1.00 10.99 ? 212 VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 69  ? 61.017 16.504  73.542  1.00 10.99 ? 212 VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 69  ? 59.319 17.814  74.852  1.00 10.99 ? 212 VAL A CG2 1 
ATOM   521  N  N   . GLU A 1 70  ? 63.074 19.528  73.237  1.00 7.03  ? 213 GLU A N   1 
ATOM   522  C  CA  . GLU A 1 70  ? 64.279 19.736  72.446  1.00 7.03  ? 213 GLU A CA  1 
ATOM   523  C  C   . GLU A 1 70  ? 65.435 19.857  73.408  1.00 7.03  ? 213 GLU A C   1 
ATOM   524  O  O   . GLU A 1 70  ? 66.391 19.092  73.359  1.00 7.03  ? 213 GLU A O   1 
ATOM   525  C  CB  . GLU A 1 70  ? 64.158 21.020  71.635  1.00 59.33 ? 213 GLU A CB  1 
ATOM   526  C  CG  . GLU A 1 70  ? 62.740 21.287  71.165  1.00 59.33 ? 213 GLU A CG  1 
ATOM   527  C  CD  . GLU A 1 70  ? 62.055 20.025  70.655  1.00 59.33 ? 213 GLU A CD  1 
ATOM   528  O  OE1 . GLU A 1 70  ? 62.530 19.458  69.643  1.00 59.33 ? 213 GLU A OE1 1 
ATOM   529  O  OE2 . GLU A 1 70  ? 61.048 19.599  71.268  1.00 59.33 ? 213 GLU A OE2 1 
ATOM   530  N  N   . LEU A 1 71  ? 65.331 20.835  74.292  1.00 7.03  ? 214 LEU A N   1 
ATOM   531  C  CA  . LEU A 1 71  ? 66.361 21.063  75.277  1.00 7.03  ? 214 LEU A CA  1 
ATOM   532  C  C   . LEU A 1 71  ? 66.846 19.710  75.749  1.00 7.03  ? 214 LEU A C   1 
ATOM   533  O  O   . LEU A 1 71  ? 68.021 19.366  75.616  1.00 7.03  ? 214 LEU A O   1 
ATOM   534  C  CB  . LEU A 1 71  ? 65.785 21.873  76.439  1.00 7.03  ? 214 LEU A CB  1 
ATOM   535  C  CG  . LEU A 1 71  ? 66.592 21.941  77.729  1.00 7.03  ? 214 LEU A CG  1 
ATOM   536  C  CD1 . LEU A 1 71  ? 68.052 22.117  77.410  1.00 7.03  ? 214 LEU A CD1 1 
ATOM   537  C  CD2 . LEU A 1 71  ? 66.080 23.070  78.591  1.00 7.03  ? 214 LEU A CD2 1 
ATOM   538  N  N   . MET A 1 72  ? 65.918 18.927  76.273  1.00 7.03  ? 215 MET A N   1 
ATOM   539  C  CA  . MET A 1 72  ? 66.252 17.608  76.766  1.00 7.03  ? 215 MET A CA  1 
ATOM   540  C  C   . MET A 1 72  ? 66.973 16.816  75.682  1.00 7.03  ? 215 MET A C   1 
ATOM   541  O  O   . MET A 1 72  ? 68.172 16.596  75.790  1.00 7.03  ? 215 MET A O   1 
ATOM   542  C  CB  . MET A 1 72  ? 64.983 16.883  77.214  1.00 30.17 ? 215 MET A CB  1 
ATOM   543  C  CG  . MET A 1 72  ? 64.102 17.694  78.166  1.00 30.17 ? 215 MET A CG  1 
ATOM   544  S  SD  . MET A 1 72  ? 64.783 17.985  79.811  1.00 30.17 ? 215 MET A SD  1 
ATOM   545  C  CE  . MET A 1 72  ? 65.962 19.283  79.490  1.00 30.17 ? 215 MET A CE  1 
ATOM   546  N  N   . ARG A 1 73  ? 66.255 16.412  74.635  1.00 7.03  ? 216 ARG A N   1 
ATOM   547  C  CA  . ARG A 1 73  ? 66.849 15.638  73.544  1.00 7.03  ? 216 ARG A CA  1 
ATOM   548  C  C   . ARG A 1 73  ? 68.229 16.180  73.192  1.00 7.03  ? 216 ARG A C   1 
ATOM   549  O  O   . ARG A 1 73  ? 69.058 15.476  72.632  1.00 7.03  ? 216 ARG A O   1 
ATOM   550  C  CB  . ARG A 1 73  ? 65.959 15.668  72.279  1.00 34.83 ? 216 ARG A CB  1 
ATOM   551  C  CG  . ARG A 1 73  ? 66.391 16.707  71.228  1.00 34.83 ? 216 ARG A CG  1 
ATOM   552  C  CD  . ARG A 1 73  ? 65.632 16.668  69.884  1.00 34.83 ? 216 ARG A CD  1 
ATOM   553  N  NE  . ARG A 1 73  ? 64.253 17.144  69.981  1.00 34.83 ? 216 ARG A NE  1 
ATOM   554  C  CZ  . ARG A 1 73  ? 63.184 16.355  69.898  1.00 34.83 ? 216 ARG A CZ  1 
ATOM   555  N  NH1 . ARG A 1 73  ? 63.336 15.050  69.713  1.00 34.83 ? 216 ARG A NH1 1 
ATOM   556  N  NH2 . ARG A 1 73  ? 61.961 16.864  70.005  1.00 34.83 ? 216 ARG A NH2 1 
ATOM   557  N  N   . ASP A 1 74  ? 68.463 17.444  73.516  1.00 12.37 ? 217 ASP A N   1 
ATOM   558  C  CA  . ASP A 1 74  ? 69.734 18.083  73.232  1.00 12.37 ? 217 ASP A CA  1 
ATOM   559  C  C   . ASP A 1 74  ? 70.737 17.762  74.328  1.00 12.37 ? 217 ASP A C   1 
ATOM   560  O  O   . ASP A 1 74  ? 71.910 17.513  74.056  1.00 12.37 ? 217 ASP A O   1 
ATOM   561  C  CB  . ASP A 1 74  ? 69.530 19.592  73.141  1.00 29.56 ? 217 ASP A CB  1 
ATOM   562  C  CG  . ASP A 1 74  ? 69.569 20.100  71.722  1.00 29.56 ? 217 ASP A CG  1 
ATOM   563  O  OD1 . ASP A 1 74  ? 68.872 19.528  70.858  1.00 29.56 ? 217 ASP A OD1 1 
ATOM   564  O  OD2 . ASP A 1 74  ? 70.299 21.080  71.472  1.00 29.56 ? 217 ASP A OD2 1 
ATOM   565  N  N   . VAL A 1 75  ? 70.263 17.775  75.568  1.00 9.04  ? 218 VAL A N   1 
ATOM   566  C  CA  . VAL A 1 75  ? 71.107 17.492  76.713  1.00 9.04  ? 218 VAL A CA  1 
ATOM   567  C  C   . VAL A 1 75  ? 71.512 16.018  76.771  1.00 9.04  ? 218 VAL A C   1 
ATOM   568  O  O   . VAL A 1 75  ? 72.679 15.705  76.990  1.00 9.04  ? 218 VAL A O   1 
ATOM   569  C  CB  . VAL A 1 75  ? 70.396 17.876  78.018  1.00 7.28  ? 218 VAL A CB  1 
ATOM   570  C  CG1 . VAL A 1 75  ? 71.371 17.794  79.190  1.00 7.28  ? 218 VAL A CG1 1 
ATOM   571  C  CG2 . VAL A 1 75  ? 69.817 19.268  77.891  1.00 7.28  ? 218 VAL A CG2 1 
ATOM   572  N  N   . SER A 1 76  ? 70.553 15.118  76.569  1.00 30.93 ? 219 SER A N   1 
ATOM   573  C  CA  . SER A 1 76  ? 70.812 13.672  76.600  1.00 30.93 ? 219 SER A CA  1 
ATOM   574  C  C   . SER A 1 76  ? 71.777 13.217  75.496  1.00 30.93 ? 219 SER A C   1 
ATOM   575  O  O   . SER A 1 76  ? 72.466 12.196  75.635  1.00 30.93 ? 219 SER A O   1 
ATOM   576  C  CB  . SER A 1 76  ? 69.498 12.907  76.465  1.00 10.01 ? 219 SER A CB  1 
ATOM   577  O  OG  . SER A 1 76  ? 68.858 13.231  75.243  1.00 10.01 ? 219 SER A OG  1 
ATOM   578  N  N   . LYS A 1 77  ? 71.802 13.971  74.399  1.00 12.67 ? 220 LYS A N   1 
ATOM   579  C  CA  . LYS A 1 77  ? 72.685 13.690  73.268  1.00 12.67 ? 220 LYS A CA  1 
ATOM   580  C  C   . LYS A 1 77  ? 73.923 14.522  73.511  1.00 12.67 ? 220 LYS A C   1 
ATOM   581  O  O   . LYS A 1 77  ? 74.215 15.462  72.780  1.00 12.67 ? 220 LYS A O   1 
ATOM   582  C  CB  . LYS A 1 77  ? 72.037 14.123  71.949  1.00 30.23 ? 220 LYS A CB  1 
ATOM   583  C  CG  . LYS A 1 77  ? 70.789 13.353  71.568  1.00 30.23 ? 220 LYS A CG  1 
ATOM   584  C  CD  . LYS A 1 77  ? 70.317 13.715  70.167  1.00 30.23 ? 220 LYS A CD  1 
ATOM   585  C  CE  . LYS A 1 77  ? 69.259 12.727  69.697  1.00 30.23 ? 220 LYS A CE  1 
ATOM   586  N  NZ  . LYS A 1 77  ? 69.735 11.305  69.828  1.00 30.23 ? 220 LYS A NZ  1 
ATOM   587  N  N   . GLU A 1 78  ? 74.664 14.170  74.541  1.00 17.59 ? 221 GLU A N   1 
ATOM   588  C  CA  . GLU A 1 78  ? 75.829 14.947  74.875  1.00 17.59 ? 221 GLU A CA  1 
ATOM   589  C  C   . GLU A 1 78  ? 76.828 14.066  75.582  1.00 17.59 ? 221 GLU A C   1 
ATOM   590  O  O   . GLU A 1 78  ? 76.447 13.119  76.279  1.00 17.59 ? 221 GLU A O   1 
ATOM   591  C  CB  . GLU A 1 78  ? 75.389 16.064  75.802  1.00 7.03  ? 221 GLU A CB  1 
ATOM   592  C  CG  . GLU A 1 78  ? 76.094 17.360  75.611  1.00 7.03  ? 221 GLU A CG  1 
ATOM   593  C  CD  . GLU A 1 78  ? 75.410 18.452  76.370  1.00 7.03  ? 221 GLU A CD  1 
ATOM   594  O  OE1 . GLU A 1 78  ? 75.311 18.336  77.604  1.00 7.03  ? 221 GLU A OE1 1 
ATOM   595  O  OE2 . GLU A 1 78  ? 74.955 19.416  75.734  1.00 7.03  ? 221 GLU A OE2 1 
ATOM   596  N  N   . ASP A 1 79  ? 78.107 14.371  75.409  1.00 17.98 ? 222 ASP A N   1 
ATOM   597  C  CA  . ASP A 1 79  ? 79.120 13.587  76.081  1.00 17.98 ? 222 ASP A CA  1 
ATOM   598  C  C   . ASP A 1 79  ? 79.078 13.981  77.543  1.00 17.98 ? 222 ASP A C   1 
ATOM   599  O  O   . ASP A 1 79  ? 79.273 15.145  77.886  1.00 17.98 ? 222 ASP A O   1 
ATOM   600  C  CB  . ASP A 1 79  ? 80.509 13.849  75.503  1.00 21.39 ? 222 ASP A CB  1 
ATOM   601  C  CG  . ASP A 1 79  ? 81.559 12.941  76.108  1.00 21.39 ? 222 ASP A CG  1 
ATOM   602  O  OD1 . ASP A 1 79  ? 81.184 11.807  76.471  1.00 21.39 ? 222 ASP A OD1 1 
ATOM   603  O  OD2 . ASP A 1 79  ? 82.742 13.342  76.211  1.00 21.39 ? 222 ASP A OD2 1 
ATOM   604  N  N   . HIS A 1 80  ? 78.770 13.006  78.389  1.00 11.59 ? 224 HIS A N   1 
ATOM   605  C  CA  . HIS A 1 80  ? 78.702 13.196  79.832  1.00 11.59 ? 224 HIS A CA  1 
ATOM   606  C  C   . HIS A 1 80  ? 79.664 12.145  80.356  1.00 11.59 ? 224 HIS A C   1 
ATOM   607  O  O   . HIS A 1 80  ? 79.666 11.801  81.540  1.00 11.59 ? 224 HIS A O   1 
ATOM   608  C  CB  . HIS A 1 80  ? 77.295 12.892  80.351  1.00 22.05 ? 224 HIS A CB  1 
ATOM   609  C  CG  . HIS A 1 80  ? 76.233 13.803  79.817  1.00 22.05 ? 224 HIS A CG  1 
ATOM   610  N  ND1 . HIS A 1 80  ? 76.077 15.103  80.250  1.00 22.05 ? 224 HIS A ND1 1 
ATOM   611  C  CD2 . HIS A 1 80  ? 75.258 13.592  78.902  1.00 22.05 ? 224 HIS A CD2 1 
ATOM   612  C  CE1 . HIS A 1 80  ? 75.048 15.650  79.627  1.00 22.05 ? 224 HIS A CE1 1 
ATOM   613  N  NE2 . HIS A 1 80  ? 74.534 14.754  78.804  1.00 22.05 ? 224 HIS A NE2 1 
ATOM   614  N  N   . SER A 1 81  ? 80.479 11.627  79.444  1.00 8.55  ? 225 SER A N   1 
ATOM   615  C  CA  . SER A 1 81  ? 81.430 10.586  79.775  1.00 8.55  ? 225 SER A CA  1 
ATOM   616  C  C   . SER A 1 81  ? 82.234 10.877  81.015  1.00 8.55  ? 225 SER A C   1 
ATOM   617  O  O   . SER A 1 81  ? 82.470 9.981   81.819  1.00 8.55  ? 225 SER A O   1 
ATOM   618  C  CB  . SER A 1 81  ? 82.367 10.346  78.596  1.00 7.03  ? 225 SER A CB  1 
ATOM   619  O  OG  . SER A 1 81  ? 81.649 9.801   77.503  1.00 7.03  ? 225 SER A OG  1 
ATOM   620  N  N   . LYS A 1 82  ? 82.622 12.138  81.175  1.00 10.03 ? 226 LYS A N   1 
ATOM   621  C  CA  . LYS A 1 82  ? 83.444 12.565  82.304  1.00 10.03 ? 226 LYS A CA  1 
ATOM   622  C  C   . LYS A 1 82  ? 82.733 13.319  83.432  1.00 10.03 ? 226 LYS A C   1 
ATOM   623  O  O   . LYS A 1 82  ? 83.385 14.010  84.206  1.00 10.03 ? 226 LYS A O   1 
ATOM   624  C  CB  . LYS A 1 82  ? 84.575 13.435  81.771  1.00 32.26 ? 226 LYS A CB  1 
ATOM   625  C  CG  . LYS A 1 82  ? 85.494 12.739  80.765  1.00 32.26 ? 226 LYS A CG  1 
ATOM   626  C  CD  . LYS A 1 82  ? 85.819 13.652  79.579  1.00 32.26 ? 226 LYS A CD  1 
ATOM   627  C  CE  . LYS A 1 82  ? 86.050 15.101  80.005  1.00 32.26 ? 226 LYS A CE  1 
ATOM   628  N  NZ  . LYS A 1 82  ? 87.115 15.242  81.036  1.00 32.26 ? 226 LYS A NZ  1 
ATOM   629  N  N   . ARG A 1 83  ? 81.415 13.163  83.545  1.00 17.51 ? 227 ARG A N   1 
ATOM   630  C  CA  . ARG A 1 83  ? 80.623 13.864  84.564  1.00 17.51 ? 227 ARG A CA  1 
ATOM   631  C  C   . ARG A 1 83  ? 79.936 12.931  85.594  1.00 17.51 ? 227 ARG A C   1 
ATOM   632  O  O   . ARG A 1 83  ? 79.353 11.917  85.231  1.00 17.51 ? 227 ARG A O   1 
ATOM   633  C  CB  . ARG A 1 83  ? 79.591 14.739  83.834  1.00 44.81 ? 227 ARG A CB  1 
ATOM   634  C  CG  . ARG A 1 83  ? 78.878 15.777  84.678  1.00 44.81 ? 227 ARG A CG  1 
ATOM   635  C  CD  . ARG A 1 83  ? 78.078 16.760  83.800  1.00 44.81 ? 227 ARG A CD  1 
ATOM   636  N  NE  . ARG A 1 83  ? 76.968 16.134  83.069  1.00 44.81 ? 227 ARG A NE  1 
ATOM   637  C  CZ  . ARG A 1 83  ? 75.711 16.049  83.505  1.00 44.81 ? 227 ARG A CZ  1 
ATOM   638  N  NH1 . ARG A 1 83  ? 75.369 16.549  84.679  1.00 44.81 ? 227 ARG A NH1 1 
ATOM   639  N  NH2 . ARG A 1 83  ? 74.790 15.468  82.754  1.00 44.81 ? 227 ARG A NH2 1 
ATOM   640  N  N   . SER A 1 84  ? 80.000 13.294  86.875  1.00 30.21 ? 228 SER A N   1 
ATOM   641  C  CA  . SER A 1 84  ? 79.432 12.490  87.969  1.00 30.21 ? 228 SER A CA  1 
ATOM   642  C  C   . SER A 1 84  ? 77.924 12.469  88.239  1.00 30.21 ? 228 SER A C   1 
ATOM   643  O  O   . SER A 1 84  ? 77.487 11.784  89.171  1.00 30.21 ? 228 SER A O   1 
ATOM   644  C  CB  . SER A 1 84  ? 80.116 12.848  89.292  1.00 17.71 ? 228 SER A CB  1 
ATOM   645  O  OG  . SER A 1 84  ? 81.278 12.078  89.489  1.00 17.71 ? 228 SER A OG  1 
ATOM   646  N  N   . SER A 1 85  ? 77.123 13.203  87.473  1.00 10.69 ? 229 SER A N   1 
ATOM   647  C  CA  . SER A 1 85  ? 75.686 13.190  87.729  1.00 10.69 ? 229 SER A CA  1 
ATOM   648  C  C   . SER A 1 85  ? 74.920 14.112  86.812  1.00 10.69 ? 229 SER A C   1 
ATOM   649  O  O   . SER A 1 85  ? 75.488 14.674  85.886  1.00 10.69 ? 229 SER A O   1 
ATOM   650  C  CB  . SER A 1 85  ? 75.424 13.579  89.178  1.00 7.03  ? 229 SER A CB  1 
ATOM   651  O  OG  . SER A 1 85  ? 76.263 14.653  89.552  1.00 7.03  ? 229 SER A OG  1 
ATOM   652  N  N   . PHE A 1 86  ? 73.624 14.256  87.064  1.00 7.44  ? 230 PHE A N   1 
ATOM   653  C  CA  . PHE A 1 86  ? 72.784 15.137  86.264  1.00 7.44  ? 230 PHE A CA  1 
ATOM   654  C  C   . PHE A 1 86  ? 71.574 15.571  87.061  1.00 7.44  ? 230 PHE A C   1 
ATOM   655  O  O   . PHE A 1 86  ? 70.661 14.778  87.254  1.00 7.44  ? 230 PHE A O   1 
ATOM   656  C  CB  . PHE A 1 86  ? 72.304 14.433  84.998  1.00 7.64  ? 230 PHE A CB  1 
ATOM   657  C  CG  . PHE A 1 86  ? 71.295 15.228  84.198  1.00 7.64  ? 230 PHE A CG  1 
ATOM   658  C  CD1 . PHE A 1 86  ? 71.686 16.335  83.457  1.00 7.64  ? 230 PHE A CD1 1 
ATOM   659  C  CD2 . PHE A 1 86  ? 69.951 14.857  84.178  1.00 7.64  ? 230 PHE A CD2 1 
ATOM   660  C  CE1 . PHE A 1 86  ? 70.759 17.054  82.712  1.00 7.64  ? 230 PHE A CE1 1 
ATOM   661  C  CE2 . PHE A 1 86  ? 69.022 15.573  83.436  1.00 7.64  ? 230 PHE A CE2 1 
ATOM   662  C  CZ  . PHE A 1 86  ? 69.426 16.668  82.705  1.00 7.64  ? 230 PHE A CZ  1 
ATOM   663  N  N   . VAL A 1 87  ? 71.572 16.818  87.533  1.00 9.29  ? 231 VAL A N   1 
ATOM   664  C  CA  . VAL A 1 87  ? 70.437 17.366  88.285  1.00 9.29  ? 231 VAL A CA  1 
ATOM   665  C  C   . VAL A 1 87  ? 69.540 18.159  87.337  1.00 9.29  ? 231 VAL A C   1 
ATOM   666  O  O   . VAL A 1 87  ? 70.035 18.995  86.585  1.00 9.29  ? 231 VAL A O   1 
ATOM   667  C  CB  . VAL A 1 87  ? 70.895 18.318  89.402  1.00 7.03  ? 231 VAL A CB  1 
ATOM   668  C  CG1 . VAL A 1 87  ? 69.694 19.047  89.986  1.00 7.03  ? 231 VAL A CG1 1 
ATOM   669  C  CG2 . VAL A 1 87  ? 71.603 17.537  90.479  1.00 7.03  ? 231 VAL A CG2 1 
ATOM   670  N  N   . CYS A 1 88  ? 68.234 17.898  87.353  1.00 7.27  ? 232 CYS A N   1 
ATOM   671  C  CA  . CYS A 1 88  ? 67.343 18.639  86.466  1.00 7.27  ? 232 CYS A CA  1 
ATOM   672  C  C   . CYS A 1 88  ? 66.123 19.280  87.089  1.00 7.27  ? 232 CYS A C   1 
ATOM   673  O  O   . CYS A 1 88  ? 64.988 18.816  86.922  1.00 7.27  ? 232 CYS A O   1 
ATOM   674  C  CB  . CYS A 1 88  ? 66.868 17.800  85.286  1.00 8.58  ? 232 CYS A CB  1 
ATOM   675  S  SG  . CYS A 1 88  ? 65.671 18.755  84.299  1.00 8.58  ? 232 CYS A SG  1 
ATOM   676  N  N   . VAL A 1 89  ? 66.370 20.379  87.785  1.00 26.18 ? 233 VAL A N   1 
ATOM   677  C  CA  . VAL A 1 89  ? 65.306 21.124  88.424  1.00 26.18 ? 233 VAL A CA  1 
ATOM   678  C  C   . VAL A 1 89  ? 64.301 21.616  87.381  1.00 26.18 ? 233 VAL A C   1 
ATOM   679  O  O   . VAL A 1 89  ? 64.663 22.013  86.268  1.00 26.18 ? 233 VAL A O   1 
ATOM   680  C  CB  . VAL A 1 89  ? 65.875 22.333  89.165  1.00 7.03  ? 233 VAL A CB  1 
ATOM   681  C  CG1 . VAL A 1 89  ? 64.755 23.106  89.850  1.00 7.03  ? 233 VAL A CG1 1 
ATOM   682  C  CG2 . VAL A 1 89  ? 66.938 21.875  90.142  1.00 7.03  ? 233 VAL A CG2 1 
ATOM   683  N  N   . LEU A 1 90  ? 63.033 21.550  87.758  1.00 20.90 ? 234 LEU A N   1 
ATOM   684  C  CA  . LEU A 1 90  ? 61.939 21.999  86.922  1.00 20.90 ? 234 LEU A CA  1 
ATOM   685  C  C   . LEU A 1 90  ? 61.145 22.928  87.799  1.00 20.90 ? 234 LEU A C   1 
ATOM   686  O  O   . LEU A 1 90  ? 61.113 22.760  89.022  1.00 20.90 ? 234 LEU A O   1 
ATOM   687  C  CB  . LEU A 1 90  ? 61.036 20.841  86.511  1.00 7.03  ? 234 LEU A CB  1 
ATOM   688  C  CG  . LEU A 1 90  ? 61.492 19.961  85.365  1.00 7.03  ? 234 LEU A CG  1 
ATOM   689  C  CD1 . LEU A 1 90  ? 60.481 18.857  85.172  1.00 7.03  ? 234 LEU A CD1 1 
ATOM   690  C  CD2 . LEU A 1 90  ? 61.625 20.789  84.108  1.00 7.03  ? 234 LEU A CD2 1 
ATOM   691  N  N   . LEU A 1 91  ? 60.508 23.909  87.177  1.00 7.03  ? 235 LEU A N   1 
ATOM   692  C  CA  . LEU A 1 91  ? 59.690 24.855  87.903  1.00 7.03  ? 235 LEU A CA  1 
ATOM   693  C  C   . LEU A 1 91  ? 58.588 25.252  86.954  1.00 7.03  ? 235 LEU A C   1 
ATOM   694  O  O   . LEU A 1 91  ? 58.844 25.747  85.869  1.00 7.03  ? 235 LEU A O   1 
ATOM   695  C  CB  . LEU A 1 91  ? 60.525 26.061  88.323  1.00 7.39  ? 235 LEU A CB  1 
ATOM   696  C  CG  . LEU A 1 91  ? 61.580 25.775  89.397  1.00 7.39  ? 235 LEU A CG  1 
ATOM   697  C  CD1 . LEU A 1 91  ? 62.415 27.014  89.627  1.00 7.39  ? 235 LEU A CD1 1 
ATOM   698  C  CD2 . LEU A 1 91  ? 60.915 25.344  90.687  1.00 7.39  ? 235 LEU A CD2 1 
ATOM   699  N  N   . SER A 1 92  ? 57.355 25.021  87.371  1.00 7.03  ? 236 SER A N   1 
ATOM   700  C  CA  . SER A 1 92  ? 56.218 25.320  86.530  1.00 7.03  ? 236 SER A CA  1 
ATOM   701  C  C   . SER A 1 92  ? 54.941 24.943  87.276  1.00 7.03  ? 236 SER A C   1 
ATOM   702  O  O   . SER A 1 92  ? 54.939 24.851  88.507  1.00 7.03  ? 236 SER A O   1 
ATOM   703  C  CB  . SER A 1 92  ? 56.346 24.509  85.244  1.00 8.87  ? 236 SER A CB  1 
ATOM   704  O  OG  . SER A 1 92  ? 55.319 24.822  84.334  1.00 8.87  ? 236 SER A OG  1 
ATOM   705  N  N   . HIS A 1 93  ? 53.855 24.742  86.537  1.00 9.50  ? 237 HIS A N   1 
ATOM   706  C  CA  . HIS A 1 93  ? 52.586 24.344  87.137  1.00 9.50  ? 237 HIS A CA  1 
ATOM   707  C  C   . HIS A 1 93  ? 52.391 22.923  86.703  1.00 9.50  ? 237 HIS A C   1 
ATOM   708  O  O   . HIS A 1 93  ? 53.318 22.325  86.176  1.00 9.50  ? 237 HIS A O   1 
ATOM   709  C  CB  . HIS A 1 93  ? 51.426 25.184  86.604  1.00 11.27 ? 237 HIS A CB  1 
ATOM   710  C  CG  . HIS A 1 93  ? 51.360 26.561  87.182  1.00 11.27 ? 237 HIS A CG  1 
ATOM   711  N  ND1 . HIS A 1 93  ? 50.320 26.986  87.980  1.00 11.27 ? 237 HIS A ND1 1 
ATOM   712  C  CD2 . HIS A 1 93  ? 52.210 27.606  87.085  1.00 11.27 ? 237 HIS A CD2 1 
ATOM   713  C  CE1 . HIS A 1 93  ? 50.533 28.236  88.350  1.00 11.27 ? 237 HIS A CE1 1 
ATOM   714  N  NE2 . HIS A 1 93  ? 51.674 28.636  87.820  1.00 11.27 ? 237 HIS A NE2 1 
ATOM   715  N  N   . GLY A 1 94  ? 51.197 22.373  86.914  1.00 41.02 ? 238 GLY A N   1 
ATOM   716  C  CA  . GLY A 1 94  ? 50.968 21.004  86.487  1.00 41.02 ? 238 GLY A CA  1 
ATOM   717  C  C   . GLY A 1 94  ? 49.887 20.154  87.133  1.00 41.02 ? 238 GLY A C   1 
ATOM   718  O  O   . GLY A 1 94  ? 49.275 20.499  88.148  1.00 41.02 ? 238 GLY A O   1 
ATOM   719  N  N   . GLU A 1 95  ? 49.659 19.017  86.493  1.00 7.03  ? 239 GLU A N   1 
ATOM   720  C  CA  . GLU A 1 95  ? 48.699 18.031  86.934  1.00 7.03  ? 239 GLU A CA  1 
ATOM   721  C  C   . GLU A 1 95  ? 49.594 16.828  87.153  1.00 7.03  ? 239 GLU A C   1 
ATOM   722  O  O   . GLU A 1 95  ? 50.765 16.859  86.776  1.00 7.03  ? 239 GLU A O   1 
ATOM   723  C  CB  . GLU A 1 95  ? 47.706 17.735  85.814  1.00 32.95 ? 239 GLU A CB  1 
ATOM   724  C  CG  . GLU A 1 95  ? 46.976 18.960  85.289  1.00 32.95 ? 239 GLU A CG  1 
ATOM   725  C  CD  . GLU A 1 95  ? 46.302 18.724  83.945  1.00 32.95 ? 239 GLU A CD  1 
ATOM   726  O  OE1 . GLU A 1 95  ? 47.019 18.583  82.926  1.00 32.95 ? 239 GLU A OE1 1 
ATOM   727  O  OE2 . GLU A 1 95  ? 45.053 18.678  83.909  1.00 32.95 ? 239 GLU A OE2 1 
ATOM   728  N  N   . GLU A 1 96  ? 49.054 15.773  87.753  1.00 10.95 ? 240 GLU A N   1 
ATOM   729  C  CA  . GLU A 1 96  ? 49.821 14.555  87.995  1.00 10.95 ? 240 GLU A CA  1 
ATOM   730  C  C   . GLU A 1 96  ? 50.506 14.058  86.716  1.00 10.95 ? 240 GLU A C   1 
ATOM   731  O  O   . GLU A 1 96  ? 49.897 14.024  85.653  1.00 10.95 ? 240 GLU A O   1 
ATOM   732  C  CB  . GLU A 1 96  ? 48.897 13.464  88.536  1.00 27.79 ? 240 GLU A CB  1 
ATOM   733  C  CG  . GLU A 1 96  ? 49.644 12.235  88.987  1.00 27.79 ? 240 GLU A CG  1 
ATOM   734  C  CD  . GLU A 1 96  ? 50.635 12.545  90.099  1.00 27.79 ? 240 GLU A CD  1 
ATOM   735  O  OE1 . GLU A 1 96  ? 50.194 12.693  91.257  1.00 27.79 ? 240 GLU A OE1 1 
ATOM   736  O  OE2 . GLU A 1 96  ? 51.850 12.654  89.818  1.00 27.79 ? 240 GLU A OE2 1 
ATOM   737  N  N   . GLY A 1 97  ? 51.772 13.673  86.816  1.00 7.13  ? 241 GLY A N   1 
ATOM   738  C  CA  . GLY A 1 97  ? 52.477 13.193  85.638  1.00 7.13  ? 241 GLY A CA  1 
ATOM   739  C  C   . GLY A 1 97  ? 52.737 14.260  84.584  1.00 7.13  ? 241 GLY A C   1 
ATOM   740  O  O   . GLY A 1 97  ? 53.751 14.213  83.891  1.00 7.13  ? 241 GLY A O   1 
ATOM   741  N  N   . ILE A 1 98  ? 51.827 15.220  84.457  1.00 23.06 ? 242 ILE A N   1 
ATOM   742  C  CA  . ILE A 1 98  ? 51.977 16.308  83.488  1.00 23.06 ? 242 ILE A CA  1 
ATOM   743  C  C   . ILE A 1 98  ? 53.076 17.302  83.927  1.00 23.06 ? 242 ILE A C   1 
ATOM   744  O  O   . ILE A 1 98  ? 53.721 17.112  84.956  1.00 23.06 ? 242 ILE A O   1 
ATOM   745  C  CB  . ILE A 1 98  ? 50.638 17.078  83.320  1.00 15.18 ? 242 ILE A CB  1 
ATOM   746  C  CG1 . ILE A 1 98  ? 49.512 16.114  82.954  1.00 15.18 ? 242 ILE A CG1 1 
ATOM   747  C  CG2 . ILE A 1 98  ? 50.747 18.086  82.194  1.00 15.18 ? 242 ILE A CG2 1 
ATOM   748  C  CD1 . ILE A 1 98  ? 49.668 15.507  81.577  1.00 15.18 ? 242 ILE A CD1 1 
ATOM   749  N  N   . ILE A 1 99  ? 53.287 18.349  83.134  1.00 9.56  ? 243 ILE A N   1 
ATOM   750  C  CA  . ILE A 1 99  ? 54.278 19.391  83.407  1.00 9.56  ? 243 ILE A CA  1 
ATOM   751  C  C   . ILE A 1 99  ? 54.034 20.461  82.346  1.00 9.56  ? 243 ILE A C   1 
ATOM   752  O  O   . ILE A 1 99  ? 54.005 20.166  81.158  1.00 9.56  ? 243 ILE A O   1 
ATOM   753  C  CB  . ILE A 1 99  ? 55.720 18.828  83.316  1.00 18.80 ? 243 ILE A CB  1 
ATOM   754  C  CG1 . ILE A 1 99  ? 56.736 19.956  83.127  1.00 18.80 ? 243 ILE A CG1 1 
ATOM   755  C  CG2 . ILE A 1 99  ? 55.813 17.806  82.209  1.00 18.80 ? 243 ILE A CG2 1 
ATOM   756  C  CD1 . ILE A 1 99  ? 57.079 20.696  84.400  1.00 18.80 ? 243 ILE A CD1 1 
ATOM   757  N  N   . PHE A 1 100 ? 53.843 21.703  82.771  1.00 21.74 ? 244 PHE A N   1 
ATOM   758  C  CA  . PHE A 1 100 ? 53.541 22.769  81.830  1.00 21.74 ? 244 PHE A CA  1 
ATOM   759  C  C   . PHE A 1 100 ? 54.644 23.590  81.152  1.00 21.74 ? 244 PHE A C   1 
ATOM   760  O  O   . PHE A 1 100 ? 55.606 24.035  81.783  1.00 21.74 ? 244 PHE A O   1 
ATOM   761  C  CB  . PHE A 1 100 ? 52.549 23.733  82.478  1.00 16.47 ? 244 PHE A CB  1 
ATOM   762  C  CG  . PHE A 1 100 ? 51.133 23.263  82.427  1.00 16.47 ? 244 PHE A CG  1 
ATOM   763  C  CD1 . PHE A 1 100 ? 50.587 22.507  83.448  1.00 16.47 ? 244 PHE A CD1 1 
ATOM   764  C  CD2 . PHE A 1 100 ? 50.342 23.574  81.334  1.00 16.47 ? 244 PHE A CD2 1 
ATOM   765  C  CE1 . PHE A 1 100 ? 49.261 22.066  83.378  1.00 16.47 ? 244 PHE A CE1 1 
ATOM   766  C  CE2 . PHE A 1 100 ? 49.022 23.140  81.254  1.00 16.47 ? 244 PHE A CE2 1 
ATOM   767  C  CZ  . PHE A 1 100 ? 48.480 22.389  82.271  1.00 16.47 ? 244 PHE A CZ  1 
ATOM   768  N  N   . GLY A 1 101 ? 54.465 23.791  79.849  1.00 12.07 ? 245 GLY A N   1 
ATOM   769  C  CA  . GLY A 1 101 ? 55.373 24.601  79.064  1.00 12.07 ? 245 GLY A CA  1 
ATOM   770  C  C   . GLY A 1 101 ? 54.639 25.918  78.952  1.00 12.07 ? 245 GLY A C   1 
ATOM   771  O  O   . GLY A 1 101 ? 53.563 26.046  79.530  1.00 12.07 ? 245 GLY A O   1 
ATOM   772  N  N   . THR A 1 102 ? 55.189 26.889  78.227  1.00 61.48 ? 246 THR A N   1 
ATOM   773  C  CA  . THR A 1 102 ? 54.528 28.191  78.101  1.00 61.48 ? 246 THR A CA  1 
ATOM   774  C  C   . THR A 1 102 ? 53.464 28.259  76.998  1.00 61.48 ? 246 THR A C   1 
ATOM   775  O  O   . THR A 1 102 ? 53.243 29.322  76.400  1.00 61.48 ? 246 THR A O   1 
ATOM   776  C  CB  . THR A 1 102 ? 55.559 29.333  77.873  1.00 19.74 ? 246 THR A CB  1 
ATOM   777  O  OG1 . THR A 1 102 ? 56.394 29.016  76.749  1.00 19.74 ? 246 THR A OG1 1 
ATOM   778  C  CG2 . THR A 1 102 ? 56.413 29.541  79.121  1.00 19.74 ? 246 THR A CG2 1 
ATOM   779  N  N   . ASN A 1 103 ? 52.815 27.128  76.721  1.00 17.08 ? 247 ASN A N   1 
ATOM   780  C  CA  . ASN A 1 103 ? 51.749 27.062  75.719  1.00 17.08 ? 247 ASN A CA  1 
ATOM   781  C  C   . ASN A 1 103 ? 50.749 25.992  76.124  1.00 17.08 ? 247 ASN A C   1 
ATOM   782  O  O   . ASN A 1 103 ? 49.547 26.136  75.915  1.00 17.08 ? 247 ASN A O   1 
ATOM   783  C  CB  . ASN A 1 103 ? 52.296 26.768  74.309  1.00 7.99  ? 247 ASN A CB  1 
ATOM   784  C  CG  . ASN A 1 103 ? 53.319 25.648  74.292  1.00 7.99  ? 247 ASN A CG  1 
ATOM   785  O  OD1 . ASN A 1 103 ? 53.396 24.850  75.222  1.00 7.99  ? 247 ASN A OD1 1 
ATOM   786  N  ND2 . ASN A 1 103 ? 54.100 25.576  73.219  1.00 7.99  ? 247 ASN A ND2 1 
ATOM   787  N  N   . GLY A 1 104 ? 51.246 24.922  76.728  1.00 29.24 ? 254 GLY A N   1 
ATOM   788  C  CA  . GLY A 1 104 ? 50.361 23.857  77.151  1.00 29.24 ? 254 GLY A CA  1 
ATOM   789  C  C   . GLY A 1 104 ? 51.097 22.736  77.857  1.00 29.24 ? 254 GLY A C   1 
ATOM   790  O  O   . GLY A 1 104 ? 52.322 22.756  77.952  1.00 29.24 ? 254 GLY A O   1 
ATOM   791  N  N   . PRO A 1 105 ? 50.370 21.721  78.337  1.00 8.70  ? 255 PRO A N   1 
ATOM   792  C  CA  . PRO A 1 105 ? 50.951 20.583  79.043  1.00 8.70  ? 255 PRO A CA  1 
ATOM   793  C  C   . PRO A 1 105 ? 51.932 19.741  78.255  1.00 8.70  ? 255 PRO A C   1 
ATOM   794  O  O   . PRO A 1 105 ? 52.052 19.852  77.038  1.00 8.70  ? 255 PRO A O   1 
ATOM   795  C  CB  . PRO A 1 105 ? 49.727 19.779  79.439  1.00 11.69 ? 255 PRO A CB  1 
ATOM   796  C  CG  . PRO A 1 105 ? 48.814 20.005  78.286  1.00 11.69 ? 255 PRO A CG  1 
ATOM   797  C  CD  . PRO A 1 105 ? 48.935 21.495  78.098  1.00 11.69 ? 255 PRO A CD  1 
ATOM   798  N  N   . VAL A 1 106 ? 52.645 18.906  78.993  1.00 19.94 ? 256 VAL A N   1 
ATOM   799  C  CA  . VAL A 1 106 ? 53.600 17.968  78.434  1.00 19.94 ? 256 VAL A CA  1 
ATOM   800  C  C   . VAL A 1 106 ? 53.697 16.853  79.466  1.00 19.94 ? 256 VAL A C   1 
ATOM   801  O  O   . VAL A 1 106 ? 53.296 17.023  80.618  1.00 19.94 ? 256 VAL A O   1 
ATOM   802  C  CB  . VAL A 1 106 ? 54.996 18.605  78.156  1.00 13.14 ? 256 VAL A CB  1 
ATOM   803  C  CG1 . VAL A 1 106 ? 55.704 18.973  79.434  1.00 13.14 ? 256 VAL A CG1 1 
ATOM   804  C  CG2 . VAL A 1 106 ? 55.843 17.632  77.362  1.00 13.14 ? 256 VAL A CG2 1 
ATOM   805  N  N   . ASP A 1 107 ? 54.188 15.699  79.047  1.00 7.03  ? 257 ASP A N   1 
ATOM   806  C  CA  . ASP A 1 107 ? 54.288 14.574  79.947  1.00 7.03  ? 257 ASP A CA  1 
ATOM   807  C  C   . ASP A 1 107 ? 55.657 14.389  80.564  1.00 7.03  ? 257 ASP A C   1 
ATOM   808  O  O   . ASP A 1 107 ? 56.677 14.283  79.876  1.00 7.03  ? 257 ASP A O   1 
ATOM   809  C  CB  . ASP A 1 107 ? 53.879 13.298  79.237  1.00 20.51 ? 257 ASP A CB  1 
ATOM   810  C  CG  . ASP A 1 107 ? 54.500 12.084  79.863  1.00 20.51 ? 257 ASP A CG  1 
ATOM   811  O  OD1 . ASP A 1 107 ? 54.451 11.977  81.113  1.00 20.51 ? 257 ASP A OD1 1 
ATOM   812  O  OD2 . ASP A 1 107 ? 55.041 11.246  79.105  1.00 20.51 ? 257 ASP A OD2 1 
ATOM   813  N  N   . LEU A 1 108 ? 55.653 14.311  81.883  1.00 11.94 ? 258 LEU A N   1 
ATOM   814  C  CA  . LEU A 1 108 ? 56.869 14.149  82.630  1.00 11.94 ? 258 LEU A CA  1 
ATOM   815  C  C   . LEU A 1 108 ? 57.688 12.968  82.135  1.00 11.94 ? 258 LEU A C   1 
ATOM   816  O  O   . LEU A 1 108 ? 58.907 13.067  82.014  1.00 11.94 ? 258 LEU A O   1 
ATOM   817  C  CB  . LEU A 1 108 ? 56.534 13.958  84.093  1.00 7.03  ? 258 LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 108 ? 57.744 14.170  84.978  1.00 7.03  ? 258 LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 108 ? 58.163 15.618  84.871  1.00 7.03  ? 258 LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 108 ? 57.414 13.790  86.410  1.00 7.03  ? 258 LEU A CD2 1 
ATOM   821  N  N   . LYS A 1 109 ? 57.020 11.856  81.837  1.00 15.78 ? 259 LYS A N   1 
ATOM   822  C  CA  . LYS A 1 109 ? 57.709 10.645  81.384  1.00 15.78 ? 259 LYS A CA  1 
ATOM   823  C  C   . LYS A 1 109 ? 58.497 10.778  80.075  1.00 15.78 ? 259 LYS A C   1 
ATOM   824  O  O   . LYS A 1 109 ? 59.685 10.484  80.056  1.00 15.78 ? 259 LYS A O   1 
ATOM   825  C  CB  . LYS A 1 109 ? 56.713 9.477   81.285  1.00 35.22 ? 259 LYS A CB  1 
ATOM   826  C  CG  . LYS A 1 109 ? 57.203 8.127   81.867  1.00 35.22 ? 259 LYS A CG  1 
ATOM   827  C  CD  . LYS A 1 109 ? 58.020 7.308   80.857  1.00 35.22 ? 259 LYS A CD  1 
ATOM   828  C  CE  . LYS A 1 109 ? 58.354 5.890   81.371  1.00 35.22 ? 259 LYS A CE  1 
ATOM   829  N  NZ  . LYS A 1 109 ? 59.129 5.068   80.375  1.00 35.22 ? 259 LYS A NZ  1 
ATOM   830  N  N   . LYS A 1 110 ? 57.873 11.223  78.987  1.00 7.75  ? 260 LYS A N   1 
ATOM   831  C  CA  . LYS A 1 110 ? 58.609 11.336  77.723  1.00 7.75  ? 260 LYS A CA  1 
ATOM   832  C  C   . LYS A 1 110 ? 59.688 12.399  77.793  1.00 7.75  ? 260 LYS A C   1 
ATOM   833  O  O   . LYS A 1 110 ? 60.266 12.790  76.774  1.00 7.75  ? 260 LYS A O   1 
ATOM   834  C  CB  . LYS A 1 110 ? 57.669 11.634  76.553  1.00 33.75 ? 260 LYS A CB  1 
ATOM   835  C  CG  . LYS A 1 110 ? 57.194 13.068  76.448  1.00 33.75 ? 260 LYS A CG  1 
ATOM   836  C  CD  . LYS A 1 110 ? 56.031 13.162  75.476  1.00 33.75 ? 260 LYS A CD  1 
ATOM   837  C  CE  . LYS A 1 110 ? 54.864 12.287  75.939  1.00 33.75 ? 260 LYS A CE  1 
ATOM   838  N  NZ  . LYS A 1 110 ? 53.686 12.343  75.027  1.00 33.75 ? 260 LYS A NZ  1 
ATOM   839  N  N   . ILE A 1 111 ? 59.933 12.872  79.008  1.00 7.03  ? 261 ILE A N   1 
ATOM   840  C  CA  . ILE A 1 111 ? 60.966 13.860  79.267  1.00 7.03  ? 261 ILE A CA  1 
ATOM   841  C  C   . ILE A 1 111 ? 62.164 13.077  79.795  1.00 7.03  ? 261 ILE A C   1 
ATOM   842  O  O   . ILE A 1 111 ? 63.268 13.097  79.240  1.00 7.03  ? 261 ILE A O   1 
ATOM   843  C  CB  . ILE A 1 111 ? 60.542 14.829  80.376  1.00 34.24 ? 261 ILE A CB  1 
ATOM   844  C  CG1 . ILE A 1 111 ? 59.222 15.495  80.007  1.00 34.24 ? 261 ILE A CG1 1 
ATOM   845  C  CG2 . ILE A 1 111 ? 61.648 15.858  80.628  1.00 34.24 ? 261 ILE A CG2 1 
ATOM   846  C  CD1 . ILE A 1 111 ? 58.813 16.595  80.972  1.00 34.24 ? 261 ILE A CD1 1 
ATOM   847  N  N   . THR A 1 112 ? 61.902 12.374  80.886  1.00 7.03  ? 262 THR A N   1 
ATOM   848  C  CA  . THR A 1 112 ? 62.891 11.571  81.564  1.00 7.03  ? 262 THR A CA  1 
ATOM   849  C  C   . THR A 1 112 ? 63.473 10.475  80.655  1.00 7.03  ? 262 THR A C   1 
ATOM   850  O  O   . THR A 1 112 ? 64.634 10.093  80.786  1.00 7.03  ? 262 THR A O   1 
ATOM   851  C  CB  . THR A 1 112 ? 62.247 10.987  82.837  1.00 12.99 ? 262 THR A CB  1 
ATOM   852  O  OG1 . THR A 1 112 ? 61.058 10.259  82.494  1.00 12.99 ? 262 THR A OG1 1 
ATOM   853  C  CG2 . THR A 1 112 ? 61.851 12.121  83.780  1.00 12.99 ? 262 THR A CG2 1 
ATOM   854  N  N   . ASN A 1 113 ? 62.664 10.004  79.713  1.00 13.80 ? 263 ASN A N   1 
ATOM   855  C  CA  . ASN A 1 113 ? 63.060 8.963   78.770  1.00 13.80 ? 263 ASN A CA  1 
ATOM   856  C  C   . ASN A 1 113 ? 64.423 9.135   78.142  1.00 13.80 ? 263 ASN A C   1 
ATOM   857  O  O   . ASN A 1 113 ? 65.197 8.188   78.075  1.00 13.80 ? 263 ASN A O   1 
ATOM   858  C  CB  . ASN A 1 113 ? 62.046 8.850   77.637  1.00 23.63 ? 263 ASN A CB  1 
ATOM   859  C  CG  . ASN A 1 113 ? 60.890 7.949   77.981  1.00 23.63 ? 263 ASN A CG  1 
ATOM   860  O  OD1 . ASN A 1 113 ? 60.011 7.710   77.147  1.00 23.63 ? 263 ASN A OD1 1 
ATOM   861  N  ND2 . ASN A 1 113 ? 60.882 7.432   79.210  1.00 23.63 ? 263 ASN A ND2 1 
ATOM   862  N  N   . PHE A 1 114 ? 64.720 10.335  77.672  1.00 7.03  ? 264 PHE A N   1 
ATOM   863  C  CA  . PHE A 1 114 ? 65.987 10.565  77.011  1.00 7.03  ? 264 PHE A CA  1 
ATOM   864  C  C   . PHE A 1 114 ? 67.207 10.245  77.860  1.00 7.03  ? 264 PHE A C   1 
ATOM   865  O  O   . PHE A 1 114 ? 68.334 10.302  77.375  1.00 7.03  ? 264 PHE A O   1 
ATOM   866  C  CB  . PHE A 1 114 ? 66.042 12.003  76.490  1.00 19.51 ? 264 PHE A CB  1 
ATOM   867  C  CG  . PHE A 1 114 ? 64.860 12.375  75.639  1.00 19.51 ? 264 PHE A CG  1 
ATOM   868  C  CD1 . PHE A 1 114 ? 64.369 11.486  74.688  1.00 19.51 ? 264 PHE A CD1 1 
ATOM   869  C  CD2 . PHE A 1 114 ? 64.207 13.587  75.815  1.00 19.51 ? 264 PHE A CD2 1 
ATOM   870  C  CE1 . PHE A 1 114 ? 63.240 11.796  73.932  1.00 19.51 ? 264 PHE A CE1 1 
ATOM   871  C  CE2 . PHE A 1 114 ? 63.079 13.909  75.065  1.00 19.51 ? 264 PHE A CE2 1 
ATOM   872  C  CZ  . PHE A 1 114 ? 62.594 13.015  74.126  1.00 19.51 ? 264 PHE A CZ  1 
ATOM   873  N  N   . PHE A 1 115 ? 66.990 9.873   79.116  1.00 9.09  ? 265 PHE A N   1 
ATOM   874  C  CA  . PHE A 1 115 ? 68.112 9.560   80.002  1.00 9.09  ? 265 PHE A CA  1 
ATOM   875  C  C   . PHE A 1 115 ? 68.149 8.091   80.406  1.00 9.09  ? 265 PHE A C   1 
ATOM   876  O  O   . PHE A 1 115 ? 69.174 7.585   80.877  1.00 9.09  ? 265 PHE A O   1 
ATOM   877  C  CB  . PHE A 1 115 ? 68.045 10.479  81.223  1.00 15.05 ? 265 PHE A CB  1 
ATOM   878  C  CG  . PHE A 1 115 ? 68.023 11.939  80.855  1.00 15.05 ? 265 PHE A CG  1 
ATOM   879  C  CD1 . PHE A 1 115 ? 69.191 12.591  80.481  1.00 15.05 ? 265 PHE A CD1 1 
ATOM   880  C  CD2 . PHE A 1 115 ? 66.817 12.633  80.779  1.00 15.05 ? 265 PHE A CD2 1 
ATOM   881  C  CE1 . PHE A 1 115 ? 69.162 13.906  80.032  1.00 15.05 ? 265 PHE A CE1 1 
ATOM   882  C  CE2 . PHE A 1 115 ? 66.779 13.953  80.328  1.00 15.05 ? 265 PHE A CE2 1 
ATOM   883  C  CZ  . PHE A 1 115 ? 67.950 14.590  79.953  1.00 15.05 ? 265 PHE A CZ  1 
ATOM   884  N  N   . ARG A 1 116 ? 67.019 7.426   80.163  1.00 27.26 ? 266 ARG A N   1 
ATOM   885  C  CA  . ARG A 1 116 ? 66.776 6.006   80.441  1.00 27.26 ? 266 ARG A CA  1 
ATOM   886  C  C   . ARG A 1 116 ? 67.907 5.068   79.984  1.00 27.26 ? 266 ARG A C   1 
ATOM   887  O  O   . ARG A 1 116 ? 68.120 4.876   78.790  1.00 27.26 ? 266 ARG A O   1 
ATOM   888  C  CB  . ARG A 1 116 ? 65.460 5.590   79.762  1.00 16.72 ? 266 ARG A CB  1 
ATOM   889  C  CG  . ARG A 1 116 ? 64.615 4.539   80.491  1.00 16.72 ? 266 ARG A CG  1 
ATOM   890  C  CD  . ARG A 1 116 ? 63.456 4.104   79.606  1.00 16.72 ? 266 ARG A CD  1 
ATOM   891  N  NE  . ARG A 1 116 ? 63.947 3.443   78.399  1.00 16.72 ? 266 ARG A NE  1 
ATOM   892  C  CZ  . ARG A 1 116 ? 63.416 3.584   77.185  1.00 16.72 ? 266 ARG A CZ  1 
ATOM   893  N  NH1 . ARG A 1 116 ? 62.365 4.374   76.994  1.00 16.72 ? 266 ARG A NH1 1 
ATOM   894  N  NH2 . ARG A 1 116 ? 63.939 2.928   76.155  1.00 16.72 ? 266 ARG A NH2 1 
ATOM   895  N  N   . GLY A 1 117 ? 68.604 4.480   80.957  1.00 7.03  ? 267 GLY A N   1 
ATOM   896  C  CA  . GLY A 1 117 ? 69.706 3.564   80.709  1.00 7.03  ? 267 GLY A CA  1 
ATOM   897  C  C   . GLY A 1 117 ? 70.293 3.484   79.316  1.00 7.03  ? 267 GLY A C   1 
ATOM   898  O  O   . GLY A 1 117 ? 71.421 3.904   79.103  1.00 7.03  ? 267 GLY A O   1 
ATOM   899  N  N   . ASP A 1 118 ? 69.532 2.932   78.376  1.00 7.03  ? 268 ASP A N   1 
ATOM   900  C  CA  . ASP A 1 118 ? 69.980 2.749   76.994  1.00 7.03  ? 268 ASP A CA  1 
ATOM   901  C  C   . ASP A 1 118 ? 69.980 3.991   76.124  1.00 7.03  ? 268 ASP A C   1 
ATOM   902  O  O   . ASP A 1 118 ? 70.627 4.024   75.087  1.00 7.03  ? 268 ASP A O   1 
ATOM   903  C  CB  . ASP A 1 118 ? 69.139 1.660   76.309  1.00 20.56 ? 268 ASP A CB  1 
ATOM   904  C  CG  . ASP A 1 118 ? 67.634 1.908   76.417  1.00 20.56 ? 268 ASP A CG  1 
ATOM   905  O  OD1 . ASP A 1 118 ? 67.095 1.865   77.548  1.00 20.56 ? 268 ASP A OD1 1 
ATOM   906  O  OD2 . ASP A 1 118 ? 66.990 2.141   75.366  1.00 20.56 ? 268 ASP A OD2 1 
ATOM   907  N  N   . ARG A 1 119 ? 69.236 5.003   76.541  1.00 7.44  ? 269 ARG A N   1 
ATOM   908  C  CA  . ARG A 1 119 ? 69.142 6.259   75.813  1.00 7.44  ? 269 ARG A CA  1 
ATOM   909  C  C   . ARG A 1 119 ? 70.415 7.068   76.052  1.00 7.44  ? 269 ARG A C   1 
ATOM   910  O  O   . ARG A 1 119 ? 71.282 7.168   75.180  1.00 7.44  ? 269 ARG A O   1 
ATOM   911  C  CB  . ARG A 1 119 ? 67.934 7.040   76.323  1.00 68.43 ? 269 ARG A CB  1 
ATOM   912  C  CG  . ARG A 1 119 ? 66.668 6.888   75.506  1.00 68.43 ? 269 ARG A CG  1 
ATOM   913  C  CD  . ARG A 1 119 ? 66.789 7.695   74.222  1.00 68.43 ? 269 ARG A CD  1 
ATOM   914  N  NE  . ARG A 1 119 ? 67.511 8.945   74.464  1.00 68.43 ? 269 ARG A NE  1 
ATOM   915  C  CZ  . ARG A 1 119 ? 67.622 9.938   73.587  1.00 68.43 ? 269 ARG A CZ  1 
ATOM   916  N  NH1 . ARG A 1 119 ? 67.052 9.839   72.391  1.00 68.43 ? 269 ARG A NH1 1 
ATOM   917  N  NH2 . ARG A 1 119 ? 68.308 11.028  73.909  1.00 68.43 ? 269 ARG A NH2 1 
ATOM   918  N  N   . CYS A 1 120 ? 70.503 7.647   77.247  1.00 7.64  ? 270 CYS A N   1 
ATOM   919  C  CA  . CYS A 1 120 ? 71.649 8.434   77.671  1.00 7.64  ? 270 CYS A CA  1 
ATOM   920  C  C   . CYS A 1 120 ? 72.668 7.462   78.245  1.00 7.64  ? 270 CYS A C   1 
ATOM   921  O  O   . CYS A 1 120 ? 72.569 7.056   79.406  1.00 7.64  ? 270 CYS A O   1 
ATOM   922  C  CB  . CYS A 1 120 ? 71.219 9.427   78.745  1.00 14.07 ? 270 CYS A CB  1 
ATOM   923  S  SG  . CYS A 1 120 ? 72.563 10.411  79.405  1.00 14.07 ? 270 CYS A SG  1 
ATOM   924  N  N   . ARG A 1 121 ? 73.648 7.100   77.428  1.00 7.41  ? 271 ARG A N   1 
ATOM   925  C  CA  . ARG A 1 121 ? 74.668 6.145   77.835  1.00 7.41  ? 271 ARG A CA  1 
ATOM   926  C  C   . ARG A 1 121 ? 75.657 6.683   78.840  1.00 7.41  ? 271 ARG A C   1 
ATOM   927  O  O   . ARG A 1 121 ? 75.764 6.153   79.947  1.00 7.41  ? 271 ARG A O   1 
ATOM   928  C  CB  . ARG A 1 121 ? 75.418 5.637   76.613  1.00 25.37 ? 271 ARG A CB  1 
ATOM   929  C  CG  . ARG A 1 121 ? 74.493 5.090   75.541  1.00 25.37 ? 271 ARG A CG  1 
ATOM   930  C  CD  . ARG A 1 121 ? 74.335 6.045   74.356  1.00 25.37 ? 271 ARG A CD  1 
ATOM   931  N  NE  . ARG A 1 121 ? 75.393 5.868   73.362  1.00 25.37 ? 271 ARG A NE  1 
ATOM   932  C  CZ  . ARG A 1 121 ? 76.527 6.562   73.329  1.00 25.37 ? 271 ARG A CZ  1 
ATOM   933  N  NH1 . ARG A 1 121 ? 76.760 7.500   74.238  1.00 25.37 ? 271 ARG A NH1 1 
ATOM   934  N  NH2 . ARG A 1 121 ? 77.433 6.311   72.391  1.00 25.37 ? 271 ARG A NH2 1 
ATOM   935  N  N   . SER A 1 122 ? 76.395 7.721   78.448  1.00 7.48  ? 272 SER A N   1 
ATOM   936  C  CA  . SER A 1 122 ? 77.365 8.343   79.338  1.00 7.48  ? 272 SER A CA  1 
ATOM   937  C  C   . SER A 1 122 ? 76.772 8.370   80.743  1.00 7.48  ? 272 SER A C   1 
ATOM   938  O  O   . SER A 1 122 ? 77.449 8.088   81.719  1.00 7.48  ? 272 SER A O   1 
ATOM   939  C  CB  . SER A 1 122 ? 77.700 9.758   78.859  1.00 7.03  ? 272 SER A CB  1 
ATOM   940  O  OG  . SER A 1 122 ? 76.647 10.324  78.115  1.00 7.03  ? 272 SER A OG  1 
ATOM   941  N  N   . LEU A 1 123 ? 75.489 8.682   80.837  1.00 9.29  ? 273 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 123 ? 74.834 8.700   82.127  1.00 9.29  ? 273 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 123 ? 74.212 7.336   82.454  1.00 9.29  ? 273 LEU A C   1 
ATOM   944  O  O   . LEU A 1 123 ? 72.985 7.181   82.525  1.00 9.29  ? 273 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 123 ? 73.769 9.804   82.169  1.00 7.34  ? 273 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 123 ? 74.241 11.259  82.271  1.00 7.34  ? 273 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 123 ? 73.040 12.170  82.225  1.00 7.34  ? 273 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 123 ? 74.995 11.480  83.557  1.00 7.34  ? 273 LEU A CD2 1 
ATOM   949  N  N   . THR A 1 124 ? 75.068 6.337   82.627  1.00 7.03  ? 274 THR A N   1 
ATOM   950  C  CA  . THR A 1 124 ? 74.611 5.000   82.989  1.00 7.03  ? 274 THR A CA  1 
ATOM   951  C  C   . THR A 1 124 ? 75.406 4.642   84.221  1.00 7.03  ? 274 THR A C   1 
ATOM   952  O  O   . THR A 1 124 ? 76.634 4.613   84.178  1.00 7.03  ? 274 THR A O   1 
ATOM   953  C  CB  . THR A 1 124 ? 74.889 3.975   81.893  1.00 7.03  ? 274 THR A CB  1 
ATOM   954  O  OG1 . THR A 1 124 ? 74.010 4.208   80.790  1.00 7.03  ? 274 THR A OG1 1 
ATOM   955  C  CG2 . THR A 1 124 ? 74.644 2.583   82.411  1.00 7.03  ? 274 THR A CG2 1 
ATOM   956  N  N   . GLY A 1 125 ? 74.711 4.378   85.320  1.00 9.24  ? 275 GLY A N   1 
ATOM   957  C  CA  . GLY A 1 125 ? 75.409 4.070   86.552  1.00 9.24  ? 275 GLY A CA  1 
ATOM   958  C  C   . GLY A 1 125 ? 75.782 5.396   87.183  1.00 9.24  ? 275 GLY A C   1 
ATOM   959  O  O   . GLY A 1 125 ? 76.727 5.506   87.982  1.00 9.24  ? 275 GLY A O   1 
ATOM   960  N  N   . LYS A 1 126 ? 75.037 6.421   86.778  1.00 7.03  ? 276 LYS A N   1 
ATOM   961  C  CA  . LYS A 1 126 ? 75.218 7.770   87.282  1.00 7.03  ? 276 LYS A CA  1 
ATOM   962  C  C   . LYS A 1 126 ? 73.856 8.311   87.655  1.00 7.03  ? 276 LYS A C   1 
ATOM   963  O  O   . LYS A 1 126 ? 72.911 8.195   86.889  1.00 7.03  ? 276 LYS A O   1 
ATOM   964  C  CB  . LYS A 1 126 ? 75.876 8.656   86.227  1.00 10.21 ? 276 LYS A CB  1 
ATOM   965  C  CG  . LYS A 1 126 ? 77.368 8.381   86.075  1.00 10.21 ? 276 LYS A CG  1 
ATOM   966  C  CD  . LYS A 1 126 ? 78.036 9.337   85.095  1.00 10.21 ? 276 LYS A CD  1 
ATOM   967  C  CE  . LYS A 1 126 ? 79.466 8.899   84.792  1.00 10.21 ? 276 LYS A CE  1 
ATOM   968  N  NZ  . LYS A 1 126 ? 80.045 9.591   83.600  1.00 10.21 ? 276 LYS A NZ  1 
ATOM   969  N  N   . PRO A 1 127 ? 73.742 8.906   88.847  1.00 7.12  ? 277 PRO A N   1 
ATOM   970  C  CA  . PRO A 1 127 ? 72.486 9.466   89.329  1.00 7.12  ? 277 PRO A CA  1 
ATOM   971  C  C   . PRO A 1 127 ? 71.837 10.533  88.444  1.00 7.12  ? 277 PRO A C   1 
ATOM   972  O  O   . PRO A 1 127 ? 72.470 11.515  88.076  1.00 7.12  ? 277 PRO A O   1 
ATOM   973  C  CB  . PRO A 1 127 ? 72.870 10.018  90.703  1.00 7.03  ? 277 PRO A CB  1 
ATOM   974  C  CG  . PRO A 1 127 ? 74.268 10.417  90.514  1.00 7.03  ? 277 PRO A CG  1 
ATOM   975  C  CD  . PRO A 1 127 ? 74.828 9.226   89.786  1.00 7.03  ? 277 PRO A CD  1 
ATOM   976  N  N   . LYS A 1 128 ? 70.577 10.313  88.086  1.00 7.03  ? 278 LYS A N   1 
ATOM   977  C  CA  . LYS A 1 128 ? 69.820 11.279  87.324  1.00 7.03  ? 278 LYS A CA  1 
ATOM   978  C  C   . LYS A 1 128 ? 68.821 11.780  88.374  1.00 7.03  ? 278 LYS A C   1 
ATOM   979  O  O   . LYS A 1 128 ? 67.901 11.062  88.761  1.00 7.03  ? 278 LYS A O   1 
ATOM   980  C  CB  . LYS A 1 128 ? 69.076 10.618  86.167  1.00 7.03  ? 278 LYS A CB  1 
ATOM   981  C  CG  . LYS A 1 128 ? 69.940 9.932   85.116  1.00 7.03  ? 278 LYS A CG  1 
ATOM   982  C  CD  . LYS A 1 128 ? 69.859 8.398   85.234  1.00 7.03  ? 278 LYS A CD  1 
ATOM   983  C  CE  . LYS A 1 128 ? 70.404 7.694   83.989  1.00 7.03  ? 278 LYS A CE  1 
ATOM   984  N  NZ  . LYS A 1 128 ? 70.536 6.231   84.173  1.00 7.03  ? 278 LYS A NZ  1 
ATOM   985  N  N   . LEU A 1 129 ? 69.020 12.998  88.864  1.00 7.03  ? 279 LEU A N   1 
ATOM   986  C  CA  . LEU A 1 129 ? 68.139 13.549  89.884  1.00 7.03  ? 279 LEU A CA  1 
ATOM   987  C  C   . LEU A 1 129 ? 67.177 14.535  89.244  1.00 7.03  ? 279 LEU A C   1 
ATOM   988  O  O   . LEU A 1 129 ? 67.602 15.508  88.643  1.00 7.03  ? 279 LEU A O   1 
ATOM   989  C  CB  . LEU A 1 129 ? 68.977 14.251  90.957  1.00 7.03  ? 279 LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 129 ? 70.334 13.606  91.281  1.00 7.03  ? 279 LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 129 ? 70.952 14.255  92.491  1.00 7.03  ? 279 LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 129 ? 70.145 12.144  91.562  1.00 7.03  ? 279 LEU A CD2 1 
ATOM   993  N  N   . PHE A 1 130 ? 65.879 14.281  89.345  1.00 7.03  ? 280 PHE A N   1 
ATOM   994  C  CA  . PHE A 1 130 ? 64.901 15.194  88.763  1.00 7.03  ? 280 PHE A CA  1 
ATOM   995  C  C   . PHE A 1 130 ? 64.079 15.852  89.837  1.00 7.03  ? 280 PHE A C   1 
ATOM   996  O  O   . PHE A 1 130 ? 63.091 15.301  90.294  1.00 7.03  ? 280 PHE A O   1 
ATOM   997  C  CB  . PHE A 1 130 ? 63.943 14.478  87.818  1.00 7.03  ? 280 PHE A CB  1 
ATOM   998  C  CG  . PHE A 1 130 ? 64.544 14.105  86.501  1.00 7.03  ? 280 PHE A CG  1 
ATOM   999  C  CD1 . PHE A 1 130 ? 65.583 13.189  86.426  1.00 7.03  ? 280 PHE A CD1 1 
ATOM   1000 C  CD2 . PHE A 1 130 ? 64.029 14.629  85.327  1.00 7.03  ? 280 PHE A CD2 1 
ATOM   1001 C  CE1 . PHE A 1 130 ? 66.096 12.794  85.190  1.00 7.03  ? 280 PHE A CE1 1 
ATOM   1002 C  CE2 . PHE A 1 130 ? 64.534 14.243  84.095  1.00 7.03  ? 280 PHE A CE2 1 
ATOM   1003 C  CZ  . PHE A 1 130 ? 65.567 13.324  84.021  1.00 7.03  ? 280 PHE A CZ  1 
ATOM   1004 N  N   . ILE A 1 131 ? 64.487 17.031  90.260  1.00 7.03  ? 281 ILE A N   1 
ATOM   1005 C  CA  . ILE A 1 131 ? 63.716 17.727  91.269  1.00 7.03  ? 281 ILE A CA  1 
ATOM   1006 C  C   . ILE A 1 131 ? 62.631 18.458  90.491  1.00 7.03  ? 281 ILE A C   1 
ATOM   1007 O  O   . ILE A 1 131 ? 62.915 19.123  89.491  1.00 7.03  ? 281 ILE A O   1 
ATOM   1008 C  CB  . ILE A 1 131 ? 64.580 18.731  92.032  1.00 7.65  ? 281 ILE A CB  1 
ATOM   1009 C  CG1 . ILE A 1 131 ? 65.901 18.066  92.414  1.00 7.65  ? 281 ILE A CG1 1 
ATOM   1010 C  CG2 . ILE A 1 131 ? 63.829 19.230  93.271  1.00 7.65  ? 281 ILE A CG2 1 
ATOM   1011 C  CD1 . ILE A 1 131 ? 66.968 19.022  92.786  1.00 7.65  ? 281 ILE A CD1 1 
ATOM   1012 N  N   . ILE A 1 132 ? 61.395 18.314  90.955  1.00 7.03  ? 282 ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 132 ? 60.234 18.907  90.309  1.00 7.03  ? 282 ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 132 ? 59.431 19.724  91.301  1.00 7.03  ? 282 ILE A C   1 
ATOM   1015 O  O   . ILE A 1 132 ? 59.016 19.211  92.336  1.00 7.03  ? 282 ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 132 ? 59.317 17.809  89.739  1.00 7.03  ? 282 ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 132 ? 60.146 16.797  88.945  1.00 7.03  ? 282 ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 132 ? 58.262 18.422  88.842  1.00 7.03  ? 282 ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 132 ? 59.408 15.507  88.640  1.00 7.03  ? 282 ILE A CD1 1 
ATOM   1020 N  N   . GLN A 1 133 ? 59.210 20.994  90.970  1.00 7.60  ? 283 GLN A N   1 
ATOM   1021 C  CA  . GLN A 1 133 ? 58.449 21.914  91.818  1.00 7.60  ? 283 GLN A CA  1 
ATOM   1022 C  C   . GLN A 1 133 ? 57.209 22.423  91.064  1.00 7.60  ? 283 GLN A C   1 
ATOM   1023 O  O   . GLN A 1 133 ? 57.280 23.389  90.301  1.00 7.60  ? 283 GLN A O   1 
ATOM   1024 C  CB  . GLN A 1 133 ? 59.348 23.081  92.248  1.00 7.03  ? 283 GLN A CB  1 
ATOM   1025 C  CG  . GLN A 1 133 ? 58.615 24.242  92.859  1.00 7.03  ? 283 GLN A CG  1 
ATOM   1026 C  CD  . GLN A 1 133 ? 57.682 23.801  93.949  1.00 7.03  ? 283 GLN A CD  1 
ATOM   1027 O  OE1 . GLN A 1 133 ? 58.080 23.100  94.874  1.00 7.03  ? 283 GLN A OE1 1 
ATOM   1028 N  NE2 . GLN A 1 133 ? 56.426 24.208  93.851  1.00 7.03  ? 283 GLN A NE2 1 
ATOM   1029 N  N   . ALA A 1 134 ? 56.081 21.751  91.286  1.00 7.03  ? 284 ALA A N   1 
ATOM   1030 C  CA  . ALA A 1 134 ? 54.824 22.087  90.630  1.00 7.03  ? 284 ALA A CA  1 
ATOM   1031 C  C   . ALA A 1 134 ? 53.660 21.311  91.230  1.00 7.03  ? 284 ALA A C   1 
ATOM   1032 O  O   . ALA A 1 134 ? 53.846 20.474  92.102  1.00 7.03  ? 284 ALA A O   1 
ATOM   1033 C  CB  . ALA A 1 134 ? 54.918 21.783  89.153  1.00 7.03  ? 284 ALA A CB  1 
ATOM   1034 N  N   . CYS A 1 135 ? 52.455 21.599  90.753  1.00 7.03  ? 285 CYS A N   1 
ATOM   1035 C  CA  . CYS A 1 135 ? 51.258 20.921  91.228  1.00 7.03  ? 285 CYS A CA  1 
ATOM   1036 C  C   . CYS A 1 135 ? 51.187 19.499  90.685  1.00 7.03  ? 285 CYS A C   1 
ATOM   1037 O  O   . CYS A 1 135 ? 51.530 19.240  89.525  1.00 7.03  ? 285 CYS A O   1 
ATOM   1038 C  CB  . CYS A 1 135 ? 49.996 21.676  90.790  1.00 37.62 ? 285 CYS A CB  1 
ATOM   1039 S  SG  . CYS A 1 135 ? 49.587 23.113  91.791  1.00 37.62 ? 285 CYS A SG  1 
ATOM   1040 N  N   . ARG A 1 136 ? 50.739 18.583  91.538  1.00 8.78  ? 286 ARG A N   1 
ATOM   1041 C  CA  . ARG A 1 136 ? 50.585 17.181  91.167  1.00 8.78  ? 286 ARG A CA  1 
ATOM   1042 C  C   . ARG A 1 136 ? 49.109 16.809  91.234  1.00 8.78  ? 286 ARG A C   1 
ATOM   1043 O  O   . ARG A 1 136 ? 48.760 15.704  91.603  1.00 8.78  ? 286 ARG A O   1 
ATOM   1044 C  CB  . ARG A 1 136 ? 51.388 16.279  92.114  1.00 7.75  ? 286 ARG A CB  1 
ATOM   1045 C  CG  . ARG A 1 136 ? 52.894 16.485  92.041  1.00 7.75  ? 286 ARG A CG  1 
ATOM   1046 C  CD  . ARG A 1 136 ? 53.674 15.412  92.805  1.00 7.75  ? 286 ARG A CD  1 
ATOM   1047 N  NE  . ARG A 1 136 ? 53.566 14.103  92.170  1.00 7.75  ? 286 ARG A NE  1 
ATOM   1048 C  CZ  . ARG A 1 136 ? 54.028 12.971  92.693  1.00 7.75  ? 286 ARG A CZ  1 
ATOM   1049 N  NH1 . ARG A 1 136 ? 54.644 12.995  93.869  1.00 7.75  ? 286 ARG A NH1 1 
ATOM   1050 N  NH2 . ARG A 1 136 ? 53.852 11.816  92.052  1.00 7.75  ? 286 ARG A NH2 1 
ATOM   1051 N  N   . GLY A 1 137 ? 48.241 17.738  90.864  1.00 7.24  ? 287 GLY A N   1 
ATOM   1052 C  CA  . GLY A 1 137 ? 46.823 17.466  90.917  1.00 7.24  ? 287 GLY A CA  1 
ATOM   1053 C  C   . GLY A 1 137 ? 46.183 18.641  91.601  1.00 7.24  ? 287 GLY A C   1 
ATOM   1054 O  O   . GLY A 1 137 ? 46.687 19.748  91.482  1.00 7.24  ? 287 GLY A O   1 
ATOM   1055 N  N   . THR A 1 138 ? 45.099 18.415  92.338  1.00 20.03 ? 288 THR A N   1 
ATOM   1056 C  CA  . THR A 1 138 ? 44.419 19.519  93.014  1.00 20.03 ? 288 THR A CA  1 
ATOM   1057 C  C   . THR A 1 138 ? 43.760 19.199  94.357  1.00 20.03 ? 288 THR A C   1 
ATOM   1058 O  O   . THR A 1 138 ? 42.680 19.712  94.649  1.00 20.03 ? 288 THR A O   1 
ATOM   1059 C  CB  . THR A 1 138 ? 43.327 20.122  92.118  1.00 24.11 ? 288 THR A CB  1 
ATOM   1060 O  OG1 . THR A 1 138 ? 42.374 19.102  91.782  1.00 24.11 ? 288 THR A OG1 1 
ATOM   1061 C  CG2 . THR A 1 138 ? 43.932 20.704  90.850  1.00 24.11 ? 288 THR A CG2 1 
ATOM   1062 N  N   . GLU A 1 139 ? 44.378 18.355  95.175  1.00 24.31 ? 289 GLU A N   1 
ATOM   1063 C  CA  . GLU A 1 139 ? 43.796 18.062  96.477  1.00 24.31 ? 289 GLU A CA  1 
ATOM   1064 C  C   . GLU A 1 139 ? 44.345 19.062  97.488  1.00 24.31 ? 289 GLU A C   1 
ATOM   1065 O  O   . GLU A 1 139 ? 45.327 19.755  97.217  1.00 24.31 ? 289 GLU A O   1 
ATOM   1066 C  CB  . GLU A 1 139 ? 44.124 16.633  96.919  1.00 45.94 ? 289 GLU A CB  1 
ATOM   1067 C  CG  . GLU A 1 139 ? 42.934 15.671  96.845  1.00 45.94 ? 289 GLU A CG  1 
ATOM   1068 C  CD  . GLU A 1 139 ? 41.762 16.101  97.734  1.00 45.94 ? 289 GLU A CD  1 
ATOM   1069 O  OE1 . GLU A 1 139 ? 41.874 15.986  98.979  1.00 45.94 ? 289 GLU A OE1 1 
ATOM   1070 O  OE2 . GLU A 1 139 ? 40.730 16.565  97.188  1.00 45.94 ? 289 GLU A OE2 1 
ATOM   1071 N  N   . LEU A 1 140 ? 43.704 19.146  98.647  1.00 7.03  ? 290 LEU A N   1 
ATOM   1072 C  CA  . LEU A 1 140 ? 44.132 20.071  99.690  1.00 7.03  ? 290 LEU A CA  1 
ATOM   1073 C  C   . LEU A 1 140 ? 44.443 19.274  100.947 1.00 7.03  ? 290 LEU A C   1 
ATOM   1074 O  O   . LEU A 1 140 ? 43.720 18.343  101.291 1.00 7.03  ? 290 LEU A O   1 
ATOM   1075 C  CB  . LEU A 1 140 ? 43.017 21.078  99.978  1.00 7.03  ? 290 LEU A CB  1 
ATOM   1076 C  CG  . LEU A 1 140 ? 42.497 21.894  98.785  1.00 7.03  ? 290 LEU A CG  1 
ATOM   1077 C  CD1 . LEU A 1 140 ? 41.164 22.515  99.119  1.00 7.03  ? 290 LEU A CD1 1 
ATOM   1078 C  CD2 . LEU A 1 140 ? 43.497 22.950  98.404  1.00 7.03  ? 290 LEU A CD2 1 
ATOM   1079 N  N   . ASP A 1 141 ? 45.524 19.629  101.628 1.00 7.96  ? 291 ASP A N   1 
ATOM   1080 C  CA  . ASP A 1 141 ? 45.909 18.926  102.846 1.00 7.96  ? 291 ASP A CA  1 
ATOM   1081 C  C   . ASP A 1 141 ? 45.560 19.741  104.097 1.00 7.96  ? 291 ASP A C   1 
ATOM   1082 O  O   . ASP A 1 141 ? 46.251 20.705  104.450 1.00 7.96  ? 291 ASP A O   1 
ATOM   1083 C  CB  . ASP A 1 141 ? 47.407 18.636  102.829 1.00 7.03  ? 291 ASP A CB  1 
ATOM   1084 C  CG  . ASP A 1 141 ? 47.811 17.565  103.832 1.00 7.03  ? 291 ASP A CG  1 
ATOM   1085 O  OD1 . ASP A 1 141 ? 47.219 17.512  104.937 1.00 7.03  ? 291 ASP A OD1 1 
ATOM   1086 O  OD2 . ASP A 1 141 ? 48.738 16.781  103.514 1.00 7.03  ? 291 ASP A OD2 1 
ATOM   1087 N  N   . CYS A 1 142 ? 44.484 19.351  104.771 1.00 7.03  ? 292 CYS A N   1 
ATOM   1088 C  CA  . CYS A 1 142 ? 44.054 20.040  105.975 1.00 7.03  ? 292 CYS A CA  1 
ATOM   1089 C  C   . CYS A 1 142 ? 44.974 19.823  107.160 1.00 7.03  ? 292 CYS A C   1 
ATOM   1090 O  O   . CYS A 1 142 ? 45.177 20.728  107.963 1.00 7.03  ? 292 CYS A O   1 
ATOM   1091 C  CB  . CYS A 1 142 ? 42.650 19.606  106.335 1.00 16.87 ? 292 CYS A CB  1 
ATOM   1092 S  SG  . CYS A 1 142 ? 41.465 20.282  105.202 1.00 16.87 ? 292 CYS A SG  1 
ATOM   1093 N  N   . GLY A 1 143 ? 45.534 18.624  107.272 1.00 12.19 ? 293 GLY A N   1 
ATOM   1094 C  CA  . GLY A 1 143 ? 46.428 18.338  108.379 1.00 12.19 ? 293 GLY A CA  1 
ATOM   1095 C  C   . GLY A 1 143 ? 45.654 17.980  109.626 1.00 12.19 ? 293 GLY A C   1 
ATOM   1096 O  O   . GLY A 1 143 ? 44.423 17.990  109.616 1.00 12.19 ? 293 GLY A O   1 
ATOM   1097 N  N   . ILE A 1 144 ? 46.369 17.679  110.704 1.00 15.79 ? 294 ILE A N   1 
ATOM   1098 C  CA  . ILE A 1 144 ? 45.723 17.298  111.958 1.00 15.79 ? 294 ILE A CA  1 
ATOM   1099 C  C   . ILE A 1 144 ? 46.689 17.524  113.123 1.00 15.79 ? 294 ILE A C   1 
ATOM   1100 O  O   . ILE A 1 144 ? 47.785 18.047  112.924 1.00 15.79 ? 294 ILE A O   1 
ATOM   1101 C  CB  . ILE A 1 144 ? 45.304 15.796  111.916 1.00 7.03  ? 294 ILE A CB  1 
ATOM   1102 C  CG1 . ILE A 1 144 ? 44.379 15.443  113.086 1.00 7.03  ? 294 ILE A CG1 1 
ATOM   1103 C  CG2 . ILE A 1 144 ? 46.536 14.922  111.965 1.00 7.03  ? 294 ILE A CG2 1 
ATOM   1104 C  CD1 . ILE A 1 144 ? 42.983 16.047  113.001 1.00 7.03  ? 294 ILE A CD1 1 
ATOM   1105 N  N   . GLU A 1 145 ? 46.269 17.127  114.325 1.00 35.17 ? 295 GLU A N   1 
ATOM   1106 C  CA  . GLU A 1 145 ? 47.064 17.234  115.550 1.00 35.17 ? 295 GLU A CA  1 
ATOM   1107 C  C   . GLU A 1 145 ? 47.066 18.665  116.073 1.00 35.17 ? 295 GLU A C   1 
ATOM   1108 O  O   . GLU A 1 145 ? 46.411 19.514  115.433 1.00 35.17 ? 295 GLU A O   1 
ATOM   1109 C  CB  . GLU A 1 145 ? 48.507 16.752  115.312 1.00 41.43 ? 295 GLU A CB  1 
ATOM   1110 C  CG  . GLU A 1 145 ? 49.293 16.451  116.587 1.00 41.43 ? 295 GLU A CG  1 
ATOM   1111 C  CD  . GLU A 1 145 ? 48.978 15.081  117.205 1.00 41.43 ? 295 GLU A CD  1 
ATOM   1112 O  OE1 . GLU A 1 145 ? 47.849 14.572  117.020 1.00 41.43 ? 295 GLU A OE1 1 
ATOM   1113 O  OE2 . GLU A 1 145 ? 49.863 14.516  117.900 1.00 41.43 ? 295 GLU A OE2 1 
ATOM   1114 N  N   . LYS B 2 11  ? 74.897 -5.567  82.413  1.00 31.71 ? 320 LYS B N   1 
ATOM   1115 C  CA  . LYS B 2 11  ? 73.442 -5.596  82.053  1.00 31.71 ? 320 LYS B CA  1 
ATOM   1116 C  C   . LYS B 2 11  ? 72.572 -5.157  83.242  1.00 31.71 ? 320 LYS B C   1 
ATOM   1117 O  O   . LYS B 2 11  ? 72.287 -5.973  84.120  1.00 31.71 ? 320 LYS B O   1 
ATOM   1118 C  CB  . LYS B 2 11  ? 73.046 -7.014  81.628  1.00 7.03  ? 320 LYS B CB  1 
ATOM   1119 C  CG  . LYS B 2 11  ? 71.611 -7.147  81.118  1.00 7.03  ? 320 LYS B CG  1 
ATOM   1120 C  CD  . LYS B 2 11  ? 71.542 -7.056  79.610  1.00 7.03  ? 320 LYS B CD  1 
ATOM   1121 C  CE  . LYS B 2 11  ? 70.108 -7.084  79.144  1.00 7.03  ? 320 LYS B CE  1 
ATOM   1122 N  NZ  . LYS B 2 11  ? 69.429 -8.325  79.577  1.00 7.03  ? 320 LYS B NZ  1 
ATOM   1123 N  N   . ILE B 2 12  ? 72.143 -3.889  83.272  1.00 8.38  ? 321 ILE B N   1 
ATOM   1124 C  CA  . ILE B 2 12  ? 71.315 -3.404  84.389  1.00 8.38  ? 321 ILE B CA  1 
ATOM   1125 C  C   . ILE B 2 12  ? 70.025 -2.696  83.981  1.00 8.38  ? 321 ILE B C   1 
ATOM   1126 O  O   . ILE B 2 12  ? 69.903 -2.223  82.856  1.00 8.38  ? 321 ILE B O   1 
ATOM   1127 C  CB  . ILE B 2 12  ? 72.133 -2.463  85.350  1.00 27.76 ? 321 ILE B CB  1 
ATOM   1128 C  CG1 . ILE B 2 12  ? 72.515 -1.161  84.649  1.00 27.76 ? 321 ILE B CG1 1 
ATOM   1129 C  CG2 . ILE B 2 12  ? 73.394 -3.174  85.846  1.00 27.76 ? 321 ILE B CG2 1 
ATOM   1130 C  CD1 . ILE B 2 12  ? 71.600 0.004   84.989  1.00 27.76 ? 321 ILE B CD1 1 
ATOM   1131 N  N   . PRO B 2 13  ? 69.042 -2.628  84.895  1.00 7.20  ? 322 PRO B N   1 
ATOM   1132 C  CA  . PRO B 2 13  ? 67.751 -1.981  84.646  1.00 7.20  ? 322 PRO B CA  1 
ATOM   1133 C  C   . PRO B 2 13  ? 67.947 -0.556  84.145  1.00 7.20  ? 322 PRO B C   1 
ATOM   1134 O  O   . PRO B 2 13  ? 68.836 0.149   84.628  1.00 7.20  ? 322 PRO B O   1 
ATOM   1135 C  CB  . PRO B 2 13  ? 67.088 -1.999  86.017  1.00 7.03  ? 322 PRO B CB  1 
ATOM   1136 C  CG  . PRO B 2 13  ? 67.651 -3.180  86.638  1.00 7.03  ? 322 PRO B CG  1 
ATOM   1137 C  CD  . PRO B 2 13  ? 69.100 -3.109  86.278  1.00 7.03  ? 322 PRO B CD  1 
ATOM   1138 N  N   . VAL B 2 14  ? 67.120 -0.118  83.199  1.00 31.78 ? 323 VAL B N   1 
ATOM   1139 C  CA  . VAL B 2 14  ? 67.263 1.240   82.673  1.00 31.78 ? 323 VAL B CA  1 
ATOM   1140 C  C   . VAL B 2 14  ? 66.553 2.321   83.485  1.00 31.78 ? 323 VAL B C   1 
ATOM   1141 O  O   . VAL B 2 14  ? 66.883 3.500   83.360  1.00 31.78 ? 323 VAL B O   1 
ATOM   1142 C  CB  . VAL B 2 14  ? 66.756 1.349   81.234  1.00 33.55 ? 323 VAL B CB  1 
ATOM   1143 C  CG1 . VAL B 2 14  ? 67.495 0.358   80.352  1.00 33.55 ? 323 VAL B CG1 1 
ATOM   1144 C  CG2 . VAL B 2 14  ? 65.255 1.121   81.198  1.00 33.55 ? 323 VAL B CG2 1 
ATOM   1145 N  N   . GLU B 2 15  ? 65.583 1.925   84.307  1.00 20.49 ? 324 GLU B N   1 
ATOM   1146 C  CA  . GLU B 2 15  ? 64.839 2.876   85.125  1.00 20.49 ? 324 GLU B CA  1 
ATOM   1147 C  C   . GLU B 2 15  ? 65.524 3.139   86.451  1.00 20.49 ? 324 GLU B C   1 
ATOM   1148 O  O   . GLU B 2 15  ? 65.058 3.951   87.251  1.00 20.49 ? 324 GLU B O   1 
ATOM   1149 C  CB  . GLU B 2 15  ? 63.430 2.356   85.375  1.00 8.07  ? 324 GLU B CB  1 
ATOM   1150 C  CG  . GLU B 2 15  ? 62.638 2.180   84.112  1.00 8.07  ? 324 GLU B CG  1 
ATOM   1151 C  CD  . GLU B 2 15  ? 62.357 3.487   83.424  1.00 8.07  ? 324 GLU B CD  1 
ATOM   1152 O  OE1 . GLU B 2 15  ? 63.309 4.274   83.230  1.00 8.07  ? 324 GLU B OE1 1 
ATOM   1153 O  OE2 . GLU B 2 15  ? 61.183 3.725   83.076  1.00 8.07  ? 324 GLU B OE2 1 
ATOM   1154 N  N   . ALA B 2 16  ? 66.636 2.450   86.679  1.00 8.14  ? 325 ALA B N   1 
ATOM   1155 C  CA  . ALA B 2 16  ? 67.384 2.610   87.916  1.00 8.14  ? 325 ALA B CA  1 
ATOM   1156 C  C   . ALA B 2 16  ? 68.384 3.755   87.826  1.00 8.14  ? 325 ALA B C   1 
ATOM   1157 O  O   . ALA B 2 16  ? 68.802 4.160   86.739  1.00 8.14  ? 325 ALA B O   1 
ATOM   1158 C  CB  . ALA B 2 16  ? 68.093 1.309   88.275  1.00 7.03  ? 325 ALA B CB  1 
ATOM   1159 N  N   . ASP B 2 17  ? 68.765 4.252   88.996  1.00 7.03  ? 326 ASP B N   1 
ATOM   1160 C  CA  . ASP B 2 17  ? 69.684 5.362   89.114  1.00 7.03  ? 326 ASP B CA  1 
ATOM   1161 C  C   . ASP B 2 17  ? 68.923 6.648   88.918  1.00 7.03  ? 326 ASP B C   1 
ATOM   1162 O  O   . ASP B 2 17  ? 69.512 7.697   88.724  1.00 7.03  ? 326 ASP B O   1 
ATOM   1163 C  CB  . ASP B 2 17  ? 70.796 5.277   88.085  1.00 13.51 ? 326 ASP B CB  1 
ATOM   1164 C  CG  . ASP B 2 17  ? 71.804 4.212   88.413  1.00 13.51 ? 326 ASP B CG  1 
ATOM   1165 O  OD1 . ASP B 2 17  ? 71.953 3.864   89.605  1.00 13.51 ? 326 ASP B OD1 1 
ATOM   1166 O  OD2 . ASP B 2 17  ? 72.468 3.742   87.470  1.00 13.51 ? 326 ASP B OD2 1 
ATOM   1167 N  N   . PHE B 2 18  ? 67.603 6.556   88.941  1.00 7.03  ? 327 PHE B N   1 
ATOM   1168 C  CA  . PHE B 2 18  ? 66.779 7.734   88.804  1.00 7.03  ? 327 PHE B CA  1 
ATOM   1169 C  C   . PHE B 2 18  ? 66.413 8.150   90.205  1.00 7.03  ? 327 PHE B C   1 
ATOM   1170 O  O   . PHE B 2 18  ? 66.684 7.436   91.165  1.00 7.03  ? 327 PHE B O   1 
ATOM   1171 C  CB  . PHE B 2 18  ? 65.514 7.441   88.003  1.00 7.03  ? 327 PHE B CB  1 
ATOM   1172 C  CG  . PHE B 2 18  ? 65.654 7.706   86.533  1.00 7.03  ? 327 PHE B CG  1 
ATOM   1173 C  CD1 . PHE B 2 18  ? 66.535 6.961   85.753  1.00 7.03  ? 327 PHE B CD1 1 
ATOM   1174 C  CD2 . PHE B 2 18  ? 64.899 8.705   85.922  1.00 7.03  ? 327 PHE B CD2 1 
ATOM   1175 C  CE1 . PHE B 2 18  ? 66.661 7.211   84.382  1.00 7.03  ? 327 PHE B CE1 1 
ATOM   1176 C  CE2 . PHE B 2 18  ? 65.015 8.962   84.561  1.00 7.03  ? 327 PHE B CE2 1 
ATOM   1177 C  CZ  . PHE B 2 18  ? 65.897 8.215   83.787  1.00 7.03  ? 327 PHE B CZ  1 
ATOM   1178 N  N   . LEU B 2 19  ? 65.806 9.320   90.312  1.00 7.06  ? 328 LEU B N   1 
ATOM   1179 C  CA  . LEU B 2 19  ? 65.390 9.877   91.589  1.00 7.06  ? 328 LEU B CA  1 
ATOM   1180 C  C   . LEU B 2 19  ? 64.489 11.065  91.332  1.00 7.06  ? 328 LEU B C   1 
ATOM   1181 O  O   . LEU B 2 19  ? 64.837 11.989  90.600  1.00 7.06  ? 328 LEU B O   1 
ATOM   1182 C  CB  . LEU B 2 19  ? 66.595 10.332  92.391  1.00 7.03  ? 328 LEU B CB  1 
ATOM   1183 C  CG  . LEU B 2 19  ? 66.308 11.527  93.281  1.00 7.03  ? 328 LEU B CG  1 
ATOM   1184 C  CD1 . LEU B 2 19  ? 65.332 11.203  94.391  1.00 7.03  ? 328 LEU B CD1 1 
ATOM   1185 C  CD2 . LEU B 2 19  ? 67.626 11.988  93.811  1.00 7.03  ? 328 LEU B CD2 1 
ATOM   1186 N  N   . TYR B 2 20  ? 63.325 11.039  91.945  1.00 7.93  ? 329 TYR B N   1 
ATOM   1187 C  CA  . TYR B 2 20  ? 62.385 12.106  91.756  1.00 7.93  ? 329 TYR B CA  1 
ATOM   1188 C  C   . TYR B 2 20  ? 62.002 12.638  93.121  1.00 7.93  ? 329 TYR B C   1 
ATOM   1189 O  O   . TYR B 2 20  ? 61.358 11.951  93.900  1.00 7.93  ? 329 TYR B O   1 
ATOM   1190 C  CB  . TYR B 2 20  ? 61.126 11.582  91.060  1.00 14.95 ? 329 TYR B CB  1 
ATOM   1191 C  CG  . TYR B 2 20  ? 61.339 10.753  89.807  1.00 14.95 ? 329 TYR B CG  1 
ATOM   1192 C  CD1 . TYR B 2 20  ? 62.069 9.566   89.835  1.00 14.95 ? 329 TYR B CD1 1 
ATOM   1193 C  CD2 . TYR B 2 20  ? 60.769 11.136  88.596  1.00 14.95 ? 329 TYR B CD2 1 
ATOM   1194 C  CE1 . TYR B 2 20  ? 62.229 8.777   88.679  1.00 14.95 ? 329 TYR B CE1 1 
ATOM   1195 C  CE2 . TYR B 2 20  ? 60.920 10.358  87.439  1.00 14.95 ? 329 TYR B CE2 1 
ATOM   1196 C  CZ  . TYR B 2 20  ? 61.651 9.184   87.489  1.00 14.95 ? 329 TYR B CZ  1 
ATOM   1197 O  OH  . TYR B 2 20  ? 61.812 8.444   86.339  1.00 14.95 ? 329 TYR B OH  1 
ATOM   1198 N  N   . ALA B 2 21  ? 62.402 13.855  93.433  1.00 38.39 ? 330 ALA B N   1 
ATOM   1199 C  CA  . ALA B 2 21  ? 62.019 14.424  94.713  1.00 38.39 ? 330 ALA B CA  1 
ATOM   1200 C  C   . ALA B 2 21  ? 60.984 15.491  94.388  1.00 38.39 ? 330 ALA B C   1 
ATOM   1201 O  O   . ALA B 2 21  ? 61.336 16.605  94.020  1.00 38.39 ? 330 ALA B O   1 
ATOM   1202 C  CB  . ALA B 2 21  ? 63.228 15.038  95.412  1.00 24.69 ? 330 ALA B CB  1 
ATOM   1203 N  N   . TYR B 2 22  ? 59.710 15.126  94.492  1.00 7.03  ? 331 TYR B N   1 
ATOM   1204 C  CA  . TYR B 2 22  ? 58.602 16.032  94.214  1.00 7.03  ? 331 TYR B CA  1 
ATOM   1205 C  C   . TYR B 2 22  ? 58.383 17.007  95.383  1.00 7.03  ? 331 TYR B C   1 
ATOM   1206 O  O   . TYR B 2 22  ? 58.705 16.701  96.535  1.00 7.03  ? 331 TYR B O   1 
ATOM   1207 C  CB  . TYR B 2 22  ? 57.319 15.222  93.974  1.00 14.78 ? 331 TYR B CB  1 
ATOM   1208 C  CG  . TYR B 2 22  ? 57.378 14.258  92.802  1.00 14.78 ? 331 TYR B CG  1 
ATOM   1209 C  CD1 . TYR B 2 22  ? 56.934 14.635  91.538  1.00 14.78 ? 331 TYR B CD1 1 
ATOM   1210 C  CD2 . TYR B 2 22  ? 57.906 12.973  92.952  1.00 14.78 ? 331 TYR B CD2 1 
ATOM   1211 C  CE1 . TYR B 2 22  ? 57.018 13.759  90.451  1.00 14.78 ? 331 TYR B CE1 1 
ATOM   1212 C  CE2 . TYR B 2 22  ? 57.994 12.095  91.871  1.00 14.78 ? 331 TYR B CE2 1 
ATOM   1213 C  CZ  . TYR B 2 22  ? 57.551 12.497  90.628  1.00 14.78 ? 331 TYR B CZ  1 
ATOM   1214 O  OH  . TYR B 2 22  ? 57.656 11.653  89.552  1.00 14.78 ? 331 TYR B OH  1 
ATOM   1215 N  N   . SER B 2 23  ? 57.832 18.178  95.071  1.00 8.10  ? 332 SER B N   1 
ATOM   1216 C  CA  . SER B 2 23  ? 57.558 19.201  96.072  1.00 8.10  ? 332 SER B CA  1 
ATOM   1217 C  C   . SER B 2 23  ? 56.360 18.807  96.913  1.00 8.10  ? 332 SER B C   1 
ATOM   1218 O  O   . SER B 2 23  ? 56.214 19.221  98.063  1.00 8.10  ? 332 SER B O   1 
ATOM   1219 C  CB  . SER B 2 23  ? 57.273 20.531  95.388  1.00 9.62  ? 332 SER B CB  1 
ATOM   1220 O  OG  . SER B 2 23  ? 56.238 20.378  94.442  1.00 9.62  ? 332 SER B OG  1 
ATOM   1221 N  N   . THR B 2 24  ? 55.490 18.010  96.313  1.00 18.15 ? 333 THR B N   1 
ATOM   1222 C  CA  . THR B 2 24  ? 54.302 17.548  97.000  1.00 18.15 ? 333 THR B CA  1 
ATOM   1223 C  C   . THR B 2 24  ? 54.018 16.087  96.676  1.00 18.15 ? 333 THR B C   1 
ATOM   1224 O  O   . THR B 2 24  ? 54.685 15.474  95.841  1.00 18.15 ? 333 THR B O   1 
ATOM   1225 C  CB  . THR B 2 24  ? 53.080 18.395  96.626  1.00 7.03  ? 333 THR B CB  1 
ATOM   1226 O  OG1 . THR B 2 24  ? 51.952 17.968  97.393  1.00 7.03  ? 333 THR B OG1 1 
ATOM   1227 C  CG2 . THR B 2 24  ? 52.768 18.262  95.163  1.00 7.03  ? 333 THR B CG2 1 
ATOM   1228 N  N   . ALA B 2 25  ? 53.030 15.536  97.368  1.00 31.77 ? 334 ALA B N   1 
ATOM   1229 C  CA  . ALA B 2 25  ? 52.617 14.153  97.191  1.00 31.77 ? 334 ALA B CA  1 
ATOM   1230 C  C   . ALA B 2 25  ? 51.601 14.115  96.066  1.00 31.77 ? 334 ALA B C   1 
ATOM   1231 O  O   . ALA B 2 25  ? 50.984 15.122  95.739  1.00 31.77 ? 334 ALA B O   1 
ATOM   1232 C  CB  . ALA B 2 25  ? 51.999 13.617  98.482  1.00 16.55 ? 334 ALA B CB  1 
ATOM   1233 N  N   . PRO B 2 26  ? 51.405 12.938  95.468  1.00 29.20 ? 335 PRO B N   1 
ATOM   1234 C  CA  . PRO B 2 26  ? 50.482 12.671  94.355  1.00 29.20 ? 335 PRO B CA  1 
ATOM   1235 C  C   . PRO B 2 26  ? 49.030 13.116  94.504  1.00 29.20 ? 335 PRO B C   1 
ATOM   1236 O  O   . PRO B 2 26  ? 48.343 12.696  95.429  1.00 29.20 ? 335 PRO B O   1 
ATOM   1237 C  CB  . PRO B 2 26  ? 50.596 11.167  94.188  1.00 41.70 ? 335 PRO B CB  1 
ATOM   1238 C  CG  . PRO B 2 26  ? 52.036 10.916  94.564  1.00 41.70 ? 335 PRO B CG  1 
ATOM   1239 C  CD  . PRO B 2 26  ? 52.175 11.731  95.809  1.00 41.70 ? 335 PRO B CD  1 
ATOM   1240 N  N   . GLY B 2 27  ? 48.570 13.954  93.577  1.00 7.61  ? 336 GLY B N   1 
ATOM   1241 C  CA  . GLY B 2 27  ? 47.195 14.429  93.602  1.00 7.61  ? 336 GLY B CA  1 
ATOM   1242 C  C   . GLY B 2 27  ? 46.950 15.772  94.270  1.00 7.61  ? 336 GLY B C   1 
ATOM   1243 O  O   . GLY B 2 27  ? 45.895 16.387  94.070  1.00 7.61  ? 336 GLY B O   1 
ATOM   1244 N  N   . TYR B 2 28  ? 47.931 16.227  95.048  1.00 7.03  ? 337 TYR B N   1 
ATOM   1245 C  CA  . TYR B 2 28  ? 47.846 17.477  95.793  1.00 7.03  ? 337 TYR B CA  1 
ATOM   1246 C  C   . TYR B 2 28  ? 48.385 18.722  95.098  1.00 7.03  ? 337 TYR B C   1 
ATOM   1247 O  O   . TYR B 2 28  ? 48.991 18.662  94.024  1.00 7.03  ? 337 TYR B O   1 
ATOM   1248 C  CB  . TYR B 2 28  ? 48.563 17.314  97.136  1.00 11.42 ? 337 TYR B CB  1 
ATOM   1249 C  CG  . TYR B 2 28  ? 47.854 16.396  98.107  1.00 11.42 ? 337 TYR B CG  1 
ATOM   1250 C  CD1 . TYR B 2 28  ? 47.644 15.053  97.810  1.00 11.42 ? 337 TYR B CD1 1 
ATOM   1251 C  CD2 . TYR B 2 28  ? 47.343 16.885  99.306  1.00 11.42 ? 337 TYR B CD2 1 
ATOM   1252 C  CE1 . TYR B 2 28  ? 46.935 14.222  98.679  1.00 11.42 ? 337 TYR B CE1 1 
ATOM   1253 C  CE2 . TYR B 2 28  ? 46.628 16.061  100.185 1.00 11.42 ? 337 TYR B CE2 1 
ATOM   1254 C  CZ  . TYR B 2 28  ? 46.424 14.733  99.865  1.00 11.42 ? 337 TYR B CZ  1 
ATOM   1255 O  OH  . TYR B 2 28  ? 45.692 13.925  100.717 1.00 11.42 ? 337 TYR B OH  1 
ATOM   1256 N  N   . TYR B 2 29  ? 48.134 19.856  95.741  1.00 12.96 ? 338 TYR B N   1 
ATOM   1257 C  CA  . TYR B 2 29  ? 48.582 21.160  95.268  1.00 12.96 ? 338 TYR B CA  1 
ATOM   1258 C  C   . TYR B 2 29  ? 49.941 21.435  95.892  1.00 12.96 ? 338 TYR B C   1 
ATOM   1259 O  O   . TYR B 2 29  ? 50.232 20.964  96.988  1.00 12.96 ? 338 TYR B O   1 
ATOM   1260 C  CB  . TYR B 2 29  ? 47.660 22.268  95.764  1.00 11.61 ? 338 TYR B CB  1 
ATOM   1261 C  CG  . TYR B 2 29  ? 46.431 22.587  94.954  1.00 11.61 ? 338 TYR B CG  1 
ATOM   1262 C  CD1 . TYR B 2 29  ? 46.521 22.983  93.624  1.00 11.61 ? 338 TYR B CD1 1 
ATOM   1263 C  CD2 . TYR B 2 29  ? 45.182 22.618  95.563  1.00 11.61 ? 338 TYR B CD2 1 
ATOM   1264 C  CE1 . TYR B 2 29  ? 45.389 23.415  92.934  1.00 11.61 ? 338 TYR B CE1 1 
ATOM   1265 C  CE2 . TYR B 2 29  ? 44.058 23.044  94.887  1.00 11.61 ? 338 TYR B CE2 1 
ATOM   1266 C  CZ  . TYR B 2 29  ? 44.160 23.443  93.582  1.00 11.61 ? 338 TYR B CZ  1 
ATOM   1267 O  OH  . TYR B 2 29  ? 43.027 23.893  92.949  1.00 11.61 ? 338 TYR B OH  1 
ATOM   1268 N  N   . SER B 2 30  ? 50.762 22.216  95.204  1.00 7.03  ? 339 SER B N   1 
ATOM   1269 C  CA  . SER B 2 30  ? 52.057 22.578  95.737  1.00 7.03  ? 339 SER B CA  1 
ATOM   1270 C  C   . SER B 2 30  ? 52.009 24.055  96.067  1.00 7.03  ? 339 SER B C   1 
ATOM   1271 O  O   . SER B 2 30  ? 51.517 24.871  95.277  1.00 7.03  ? 339 SER B O   1 
ATOM   1272 C  CB  . SER B 2 30  ? 53.157 22.307  94.729  1.00 7.03  ? 339 SER B CB  1 
ATOM   1273 O  OG  . SER B 2 30  ? 53.376 20.923  94.610  1.00 7.03  ? 339 SER B OG  1 
ATOM   1274 N  N   . TRP B 2 31  ? 52.514 24.390  97.248  1.00 24.71 ? 340 TRP B N   1 
ATOM   1275 C  CA  . TRP B 2 31  ? 52.527 25.763  97.711  1.00 24.71 ? 340 TRP B CA  1 
ATOM   1276 C  C   . TRP B 2 31  ? 53.841 26.479  97.433  1.00 24.71 ? 340 TRP B C   1 
ATOM   1277 O  O   . TRP B 2 31  ? 54.927 25.929  97.633  1.00 24.71 ? 340 TRP B O   1 
ATOM   1278 C  CB  . TRP B 2 31  ? 52.202 25.813  99.203  1.00 11.51 ? 340 TRP B CB  1 
ATOM   1279 C  CG  . TRP B 2 31  ? 50.870 25.244  99.512  1.00 11.51 ? 340 TRP B CG  1 
ATOM   1280 C  CD1 . TRP B 2 31  ? 50.601 23.975  99.878  1.00 11.51 ? 340 TRP B CD1 1 
ATOM   1281 C  CD2 . TRP B 2 31  ? 49.608 25.916  99.425  1.00 11.51 ? 340 TRP B CD2 1 
ATOM   1282 N  NE1 . TRP B 2 31  ? 49.250 23.797  100.028 1.00 11.51 ? 340 TRP B NE1 1 
ATOM   1283 C  CE2 . TRP B 2 31  ? 48.614 24.977  99.758  1.00 11.51 ? 340 TRP B CE2 1 
ATOM   1284 C  CE3 . TRP B 2 31  ? 49.220 27.222  99.099  1.00 11.51 ? 340 TRP B CE3 1 
ATOM   1285 C  CZ2 . TRP B 2 31  ? 47.245 25.299  99.774  1.00 11.51 ? 340 TRP B CZ2 1 
ATOM   1286 C  CZ3 . TRP B 2 31  ? 47.857 27.545  99.113  1.00 11.51 ? 340 TRP B CZ3 1 
ATOM   1287 C  CH2 . TRP B 2 31  ? 46.890 26.586  99.451  1.00 11.51 ? 340 TRP B CH2 1 
ATOM   1288 N  N   . ARG B 2 32  ? 53.700 27.715  96.961  1.00 7.03  ? 341 ARG B N   1 
ATOM   1289 C  CA  . ARG B 2 32  ? 54.800 28.602  96.608  1.00 7.03  ? 341 ARG B CA  1 
ATOM   1290 C  C   . ARG B 2 32  ? 54.466 29.996  97.146  1.00 7.03  ? 341 ARG B C   1 
ATOM   1291 O  O   . ARG B 2 32  ? 53.312 30.405  97.117  1.00 7.03  ? 341 ARG B O   1 
ATOM   1292 C  CB  . ARG B 2 32  ? 54.935 28.632  95.092  1.00 7.08  ? 341 ARG B CB  1 
ATOM   1293 C  CG  . ARG B 2 32  ? 55.868 29.674  94.544  1.00 7.08  ? 341 ARG B CG  1 
ATOM   1294 C  CD  . ARG B 2 32  ? 55.372 30.036  93.170  1.00 7.08  ? 341 ARG B CD  1 
ATOM   1295 N  NE  . ARG B 2 32  ? 53.984 30.493  93.250  1.00 7.08  ? 341 ARG B NE  1 
ATOM   1296 C  CZ  . ARG B 2 32  ? 53.012 30.109  92.431  1.00 7.08  ? 341 ARG B CZ  1 
ATOM   1297 N  NH1 . ARG B 2 32  ? 53.261 29.244  91.453  1.00 7.08  ? 341 ARG B NH1 1 
ATOM   1298 N  NH2 . ARG B 2 32  ? 51.791 30.601  92.586  1.00 7.08  ? 341 ARG B NH2 1 
ATOM   1299 N  N   . ASN B 2 33  ? 55.474 30.719  97.632  1.00 33.61 ? 342 ASN B N   1 
ATOM   1300 C  CA  . ASN B 2 33  ? 55.264 32.061  98.198  1.00 33.61 ? 342 ASN B CA  1 
ATOM   1301 C  C   . ASN B 2 33  ? 55.505 33.230  97.223  1.00 33.61 ? 342 ASN B C   1 
ATOM   1302 O  O   . ASN B 2 33  ? 56.589 33.380  96.657  1.00 33.61 ? 342 ASN B O   1 
ATOM   1303 C  CB  . ASN B 2 33  ? 56.139 32.237  99.449  1.00 39.90 ? 342 ASN B CB  1 
ATOM   1304 C  CG  . ASN B 2 33  ? 55.836 33.526  100.215 1.00 39.90 ? 342 ASN B CG  1 
ATOM   1305 O  OD1 . ASN B 2 33  ? 56.518 33.844  101.194 1.00 39.90 ? 342 ASN B OD1 1 
ATOM   1306 N  ND2 . ASN B 2 33  ? 54.815 34.266  99.776  1.00 39.90 ? 342 ASN B ND2 1 
ATOM   1307 N  N   . SER B 2 34  ? 54.484 34.065  97.056  1.00 7.03  ? 343 SER B N   1 
ATOM   1308 C  CA  . SER B 2 34  ? 54.561 35.197  96.151  1.00 7.03  ? 343 SER B CA  1 
ATOM   1309 C  C   . SER B 2 34  ? 55.740 36.098  96.469  1.00 7.03  ? 343 SER B C   1 
ATOM   1310 O  O   . SER B 2 34  ? 56.070 36.995  95.701  1.00 7.03  ? 343 SER B O   1 
ATOM   1311 C  CB  . SER B 2 34  ? 53.254 35.979  96.209  1.00 8.35  ? 343 SER B CB  1 
ATOM   1312 O  OG  . SER B 2 34  ? 52.162 35.135  95.872  1.00 8.35  ? 343 SER B OG  1 
ATOM   1313 N  N   . LYS B 2 35  ? 56.381 35.844  97.604  1.00 9.35  ? 344 LYS B N   1 
ATOM   1314 C  CA  . LYS B 2 35  ? 57.536 36.629  98.014  1.00 9.35  ? 344 LYS B CA  1 
ATOM   1315 C  C   . LYS B 2 35  ? 58.827 35.808  98.042  1.00 9.35  ? 344 LYS B C   1 
ATOM   1316 O  O   . LYS B 2 35  ? 59.679 35.960  97.175  1.00 9.35  ? 344 LYS B O   1 
ATOM   1317 C  CB  . LYS B 2 35  ? 57.296 37.259  99.395  1.00 33.23 ? 344 LYS B CB  1 
ATOM   1318 C  CG  . LYS B 2 35  ? 58.370 38.286  99.800  1.00 33.23 ? 344 LYS B CG  1 
ATOM   1319 C  CD  . LYS B 2 35  ? 58.138 38.880  101.199 1.00 33.23 ? 344 LYS B CD  1 
ATOM   1320 C  CE  . LYS B 2 35  ? 59.187 39.946  101.533 1.00 33.23 ? 344 LYS B CE  1 
ATOM   1321 N  NZ  . LYS B 2 35  ? 59.169 40.346  102.971 1.00 33.23 ? 344 LYS B NZ  1 
ATOM   1322 N  N   . ASP B 2 36  ? 58.959 34.924  99.025  1.00 8.92  ? 345 ASP B N   1 
ATOM   1323 C  CA  . ASP B 2 36  ? 60.169 34.119  99.175  1.00 8.92  ? 345 ASP B CA  1 
ATOM   1324 C  C   . ASP B 2 36  ? 60.427 33.014  98.147  1.00 8.92  ? 345 ASP B C   1 
ATOM   1325 O  O   . ASP B 2 36  ? 61.547 32.852  97.681  1.00 8.92  ? 345 ASP B O   1 
ATOM   1326 C  CB  . ASP B 2 36  ? 60.222 33.514  100.581 1.00 50.73 ? 345 ASP B CB  1 
ATOM   1327 C  CG  . ASP B 2 36  ? 60.541 34.546  101.661 1.00 50.73 ? 345 ASP B CG  1 
ATOM   1328 O  OD1 . ASP B 2 36  ? 61.599 35.213  101.557 1.00 50.73 ? 345 ASP B OD1 1 
ATOM   1329 O  OD2 . ASP B 2 36  ? 59.740 34.683  102.619 1.00 50.73 ? 345 ASP B OD2 1 
ATOM   1330 N  N   . GLY B 2 37  ? 59.409 32.242  97.797  1.00 19.98 ? 346 GLY B N   1 
ATOM   1331 C  CA  . GLY B 2 37  ? 59.617 31.172  96.838  1.00 19.98 ? 346 GLY B CA  1 
ATOM   1332 C  C   . GLY B 2 37  ? 59.045 29.870  97.361  1.00 19.98 ? 346 GLY B C   1 
ATOM   1333 O  O   . GLY B 2 37  ? 58.736 29.750  98.549  1.00 19.98 ? 346 GLY B O   1 
ATOM   1334 N  N   . SER B 2 38  ? 58.914 28.892  96.476  1.00 7.03  ? 347 SER B N   1 
ATOM   1335 C  CA  . SER B 2 38  ? 58.365 27.602  96.841  1.00 7.03  ? 347 SER B CA  1 
ATOM   1336 C  C   . SER B 2 38  ? 58.774 27.111  98.224  1.00 7.03  ? 347 SER B C   1 
ATOM   1337 O  O   . SER B 2 38  ? 59.938 27.185  98.597  1.00 7.03  ? 347 SER B O   1 
ATOM   1338 C  CB  . SER B 2 38  ? 58.775 26.571  95.799  1.00 31.98 ? 347 SER B CB  1 
ATOM   1339 O  OG  . SER B 2 38  ? 58.459 27.029  94.498  1.00 31.98 ? 347 SER B OG  1 
ATOM   1340 N  N   . TRP B 2 39  ? 57.799 26.628  98.988  1.00 7.03  ? 348 TRP B N   1 
ATOM   1341 C  CA  . TRP B 2 39  ? 58.074 26.080  100.302 1.00 7.03  ? 348 TRP B CA  1 
ATOM   1342 C  C   . TRP B 2 39  ? 59.208 25.100  100.090 1.00 7.03  ? 348 TRP B C   1 
ATOM   1343 O  O   . TRP B 2 39  ? 60.364 25.357  100.420 1.00 7.03  ? 348 TRP B O   1 
ATOM   1344 C  CB  . TRP B 2 39  ? 56.866 25.307  100.813 1.00 7.03  ? 348 TRP B CB  1 
ATOM   1345 C  CG  . TRP B 2 39  ? 55.743 26.158  101.255 1.00 7.03  ? 348 TRP B CG  1 
ATOM   1346 C  CD1 . TRP B 2 39  ? 55.648 27.501  101.128 1.00 7.03  ? 348 TRP B CD1 1 
ATOM   1347 C  CD2 . TRP B 2 39  ? 54.571 25.738  101.966 1.00 7.03  ? 348 TRP B CD2 1 
ATOM   1348 N  NE1 . TRP B 2 39  ? 54.496 27.952  101.724 1.00 7.03  ? 348 TRP B NE1 1 
ATOM   1349 C  CE2 . TRP B 2 39  ? 53.815 26.884  102.243 1.00 7.03  ? 348 TRP B CE2 1 
ATOM   1350 C  CE3 . TRP B 2 39  ? 54.087 24.498  102.390 1.00 7.03  ? 348 TRP B CE3 1 
ATOM   1351 C  CZ2 . TRP B 2 39  ? 52.611 26.840  102.929 1.00 7.03  ? 348 TRP B CZ2 1 
ATOM   1352 C  CZ3 . TRP B 2 39  ? 52.879 24.453  103.078 1.00 7.03  ? 348 TRP B CZ3 1 
ATOM   1353 C  CH2 . TRP B 2 39  ? 52.160 25.615  103.336 1.00 7.03  ? 348 TRP B CH2 1 
ATOM   1354 N  N   . PHE B 2 40  ? 58.848 23.970  99.504  1.00 7.03  ? 349 PHE B N   1 
ATOM   1355 C  CA  . PHE B 2 40  ? 59.785 22.908  99.221  1.00 7.03  ? 349 PHE B CA  1 
ATOM   1356 C  C   . PHE B 2 40  ? 61.113 23.366  98.638  1.00 7.03  ? 349 PHE B C   1 
ATOM   1357 O  O   . PHE B 2 40  ? 62.163 22.856  99.013  1.00 7.03  ? 349 PHE B O   1 
ATOM   1358 C  CB  . PHE B 2 40  ? 59.131 21.905  98.273  1.00 7.03  ? 349 PHE B CB  1 
ATOM   1359 C  CG  . PHE B 2 40  ? 60.071 20.869  97.752  1.00 7.03  ? 349 PHE B CG  1 
ATOM   1360 C  CD1 . PHE B 2 40  ? 60.780 20.051  98.631  1.00 7.03  ? 349 PHE B CD1 1 
ATOM   1361 C  CD2 . PHE B 2 40  ? 60.244 20.704  96.384  1.00 7.03  ? 349 PHE B CD2 1 
ATOM   1362 C  CE1 . PHE B 2 40  ? 61.650 19.081  98.153  1.00 7.03  ? 349 PHE B CE1 1 
ATOM   1363 C  CE2 . PHE B 2 40  ? 61.110 19.735  95.886  1.00 7.03  ? 349 PHE B CE2 1 
ATOM   1364 C  CZ  . PHE B 2 40  ? 61.818 18.918  96.775  1.00 7.03  ? 349 PHE B CZ  1 
ATOM   1365 N  N   . ILE B 2 41  ? 61.081 24.330  97.729  1.00 7.03  ? 350 ILE B N   1 
ATOM   1366 C  CA  . ILE B 2 41  ? 62.320 24.772  97.109  1.00 7.03  ? 350 ILE B CA  1 
ATOM   1367 C  C   . ILE B 2 41  ? 63.284 25.528  97.998  1.00 7.03  ? 350 ILE B C   1 
ATOM   1368 O  O   . ILE B 2 41  ? 64.502 25.436  97.813  1.00 7.03  ? 350 ILE B O   1 
ATOM   1369 C  CB  . ILE B 2 41  ? 62.061 25.612  95.863  1.00 7.03  ? 350 ILE B CB  1 
ATOM   1370 C  CG1 . ILE B 2 41  ? 61.428 24.734  94.780  1.00 7.03  ? 350 ILE B CG1 1 
ATOM   1371 C  CG2 . ILE B 2 41  ? 63.372 26.175  95.348  1.00 7.03  ? 350 ILE B CG2 1 
ATOM   1372 C  CD1 . ILE B 2 41  ? 62.363 23.677  94.209  1.00 7.03  ? 350 ILE B CD1 1 
ATOM   1373 N  N   . GLN B 2 42  ? 62.758 26.274  98.961  1.00 9.89  ? 351 GLN B N   1 
ATOM   1374 C  CA  . GLN B 2 42  ? 63.638 27.021  99.838  1.00 9.89  ? 351 GLN B CA  1 
ATOM   1375 C  C   . GLN B 2 42  ? 64.178 26.074  100.895 1.00 9.89  ? 351 GLN B C   1 
ATOM   1376 O  O   . GLN B 2 42  ? 65.399 25.937  101.058 1.00 9.89  ? 351 GLN B O   1 
ATOM   1377 C  CB  . GLN B 2 42  ? 62.911 28.223  100.467 1.00 7.03  ? 351 GLN B CB  1 
ATOM   1378 C  CG  . GLN B 2 42  ? 61.741 27.914  101.370 1.00 7.03  ? 351 GLN B CG  1 
ATOM   1379 C  CD  . GLN B 2 42  ? 61.111 29.178  101.969 1.00 7.03  ? 351 GLN B CD  1 
ATOM   1380 O  OE1 . GLN B 2 42  ? 60.178 29.772  101.409 1.00 7.03  ? 351 GLN B OE1 1 
ATOM   1381 N  NE2 . GLN B 2 42  ? 61.634 29.597  103.110 1.00 7.03  ? 351 GLN B NE2 1 
ATOM   1382 N  N   . SER B 2 43  ? 63.272 25.393  101.591 1.00 7.03  ? 352 SER B N   1 
ATOM   1383 C  CA  . SER B 2 43  ? 63.679 24.445  102.616 1.00 7.03  ? 352 SER B CA  1 
ATOM   1384 C  C   . SER B 2 43  ? 64.753 23.532  102.039 1.00 7.03  ? 352 SER B C   1 
ATOM   1385 O  O   . SER B 2 43  ? 65.660 23.093  102.743 1.00 7.03  ? 352 SER B O   1 
ATOM   1386 C  CB  . SER B 2 43  ? 62.476 23.637  103.059 1.00 7.03  ? 352 SER B CB  1 
ATOM   1387 O  OG  . SER B 2 43  ? 61.570 23.534  101.988 1.00 7.03  ? 352 SER B OG  1 
ATOM   1388 N  N   . LEU B 2 44  ? 64.658 23.281  100.738 1.00 7.41  ? 353 LEU B N   1 
ATOM   1389 C  CA  . LEU B 2 44  ? 65.607 22.425  100.057 1.00 7.41  ? 353 LEU B CA  1 
ATOM   1390 C  C   . LEU B 2 44  ? 67.012 22.997  100.087 1.00 7.41  ? 353 LEU B C   1 
ATOM   1391 O  O   . LEU B 2 44  ? 67.913 22.420  100.705 1.00 7.41  ? 353 LEU B O   1 
ATOM   1392 C  CB  . LEU B 2 44  ? 65.188 22.208  98.610  1.00 7.03  ? 353 LEU B CB  1 
ATOM   1393 C  CG  . LEU B 2 44  ? 66.100 21.189  97.917  1.00 7.03  ? 353 LEU B CG  1 
ATOM   1394 C  CD1 . LEU B 2 44  ? 65.947 19.849  98.589  1.00 7.03  ? 353 LEU B CD1 1 
ATOM   1395 C  CD2 . LEU B 2 44  ? 65.760 21.068  96.459  1.00 7.03  ? 353 LEU B CD2 1 
ATOM   1396 N  N   . CYS B 2 45  ? 67.199 24.122  99.399  1.00 7.03  ? 354 CYS B N   1 
ATOM   1397 C  CA  . CYS B 2 45  ? 68.503 24.784  99.341  1.00 7.03  ? 354 CYS B CA  1 
ATOM   1398 C  C   . CYS B 2 45  ? 68.989 24.986  100.755 1.00 7.03  ? 354 CYS B C   1 
ATOM   1399 O  O   . CYS B 2 45  ? 70.168 24.826  101.053 1.00 7.03  ? 354 CYS B O   1 
ATOM   1400 C  CB  . CYS B 2 45  ? 68.384 26.151  98.681  1.00 14.28 ? 354 CYS B CB  1 
ATOM   1401 S  SG  . CYS B 2 45  ? 67.367 26.189  97.206  1.00 14.28 ? 354 CYS B SG  1 
ATOM   1402 N  N   . ALA B 2 46  ? 68.045 25.349  101.615 1.00 18.85 ? 355 ALA B N   1 
ATOM   1403 C  CA  . ALA B 2 46  ? 68.309 25.611  103.022 1.00 18.85 ? 355 ALA B CA  1 
ATOM   1404 C  C   . ALA B 2 46  ? 68.944 24.433  103.747 1.00 18.85 ? 355 ALA B C   1 
ATOM   1405 O  O   . ALA B 2 46  ? 69.692 24.615  104.706 1.00 18.85 ? 355 ALA B O   1 
ATOM   1406 C  CB  . ALA B 2 46  ? 67.023 26.015  103.714 1.00 23.75 ? 355 ALA B CB  1 
ATOM   1407 N  N   . MET B 2 47  ? 68.639 23.224  103.293 1.00 27.23 ? 356 MET B N   1 
ATOM   1408 C  CA  . MET B 2 47  ? 69.196 22.024  103.900 1.00 27.23 ? 356 MET B CA  1 
ATOM   1409 C  C   . MET B 2 47  ? 70.480 21.676  103.184 1.00 27.23 ? 356 MET B C   1 
ATOM   1410 O  O   . MET B 2 47  ? 71.497 21.380  103.802 1.00 27.23 ? 356 MET B O   1 
ATOM   1411 C  CB  . MET B 2 47  ? 68.202 20.876  103.789 1.00 17.04 ? 356 MET B CB  1 
ATOM   1412 C  CG  . MET B 2 47  ? 66.983 21.063  104.665 1.00 17.04 ? 356 MET B CG  1 
ATOM   1413 S  SD  . MET B 2 47  ? 67.409 21.072  106.414 1.00 17.04 ? 356 MET B SD  1 
ATOM   1414 C  CE  . MET B 2 47  ? 67.657 22.813  106.719 1.00 17.04 ? 356 MET B CE  1 
ATOM   1415 N  N   . LEU B 2 48  ? 70.429 21.715  101.865 1.00 7.03  ? 357 LEU B N   1 
ATOM   1416 C  CA  . LEU B 2 48  ? 71.605 21.424  101.081 1.00 7.03  ? 357 LEU B CA  1 
ATOM   1417 C  C   . LEU B 2 48  ? 72.680 22.426  101.431 1.00 7.03  ? 357 LEU B C   1 
ATOM   1418 O  O   . LEU B 2 48  ? 73.815 22.282  101.012 1.00 7.03  ? 357 LEU B O   1 
ATOM   1419 C  CB  . LEU B 2 48  ? 71.294 21.552  99.602  1.00 22.37 ? 357 LEU B CB  1 
ATOM   1420 C  CG  . LEU B 2 48  ? 71.276 20.287  98.764  1.00 22.37 ? 357 LEU B CG  1 
ATOM   1421 C  CD1 . LEU B 2 48  ? 71.090 20.687  97.327  1.00 22.37 ? 357 LEU B CD1 1 
ATOM   1422 C  CD2 . LEU B 2 48  ? 72.560 19.520  98.931  1.00 22.37 ? 357 LEU B CD2 1 
ATOM   1423 N  N   . LYS B 2 49  ? 72.309 23.453  102.186 1.00 10.34 ? 358 LYS B N   1 
ATOM   1424 C  CA  . LYS B 2 49  ? 73.247 24.506  102.583 1.00 10.34 ? 358 LYS B CA  1 
ATOM   1425 C  C   . LYS B 2 49  ? 74.046 24.079  103.805 1.00 10.34 ? 358 LYS B C   1 
ATOM   1426 O  O   . LYS B 2 49  ? 75.279 24.104  103.813 1.00 10.34 ? 358 LYS B O   1 
ATOM   1427 C  CB  . LYS B 2 49  ? 72.479 25.790  102.922 1.00 33.91 ? 358 LYS B CB  1 
ATOM   1428 C  CG  . LYS B 2 49  ? 73.285 27.083  102.773 1.00 33.91 ? 358 LYS B CG  1 
ATOM   1429 C  CD  . LYS B 2 49  ? 73.069 27.726  101.393 1.00 33.91 ? 358 LYS B CD  1 
ATOM   1430 C  CE  . LYS B 2 49  ? 71.658 28.340  101.235 1.00 33.91 ? 358 LYS B CE  1 
ATOM   1431 N  NZ  . LYS B 2 49  ? 71.377 28.875  99.857  1.00 33.91 ? 358 LYS B NZ  1 
ATOM   1432 N  N   . GLN B 2 50  ? 73.318 23.703  104.846 1.00 15.44 ? 359 GLN B N   1 
ATOM   1433 C  CA  . GLN B 2 50  ? 73.941 23.276  106.077 1.00 15.44 ? 359 GLN B CA  1 
ATOM   1434 C  C   . GLN B 2 50  ? 74.425 21.839  105.947 1.00 15.44 ? 359 GLN B C   1 
ATOM   1435 O  O   . GLN B 2 50  ? 75.549 21.528  106.331 1.00 15.44 ? 359 GLN B O   1 
ATOM   1436 C  CB  . GLN B 2 50  ? 72.949 23.346  107.256 1.00 38.49 ? 359 GLN B CB  1 
ATOM   1437 C  CG  . GLN B 2 50  ? 71.864 24.431  107.187 1.00 38.49 ? 359 GLN B CG  1 
ATOM   1438 C  CD  . GLN B 2 50  ? 72.399 25.855  107.288 1.00 38.49 ? 359 GLN B CD  1 
ATOM   1439 O  OE1 . GLN B 2 50  ? 71.676 26.825  107.016 1.00 38.49 ? 359 GLN B OE1 1 
ATOM   1440 N  NE2 . GLN B 2 50  ? 73.661 25.991  107.683 1.00 38.49 ? 359 GLN B NE2 1 
ATOM   1441 N  N   . TYR B 2 51  ? 73.597 20.974  105.367 1.00 7.03  ? 360 TYR B N   1 
ATOM   1442 C  CA  . TYR B 2 51  ? 73.921 19.553  105.288 1.00 7.03  ? 360 TYR B CA  1 
ATOM   1443 C  C   . TYR B 2 51  ? 74.610 18.875  104.098 1.00 7.03  ? 360 TYR B C   1 
ATOM   1444 O  O   . TYR B 2 51  ? 75.101 17.764  104.255 1.00 7.03  ? 360 TYR B O   1 
ATOM   1445 C  CB  . TYR B 2 51  ? 72.657 18.766  105.627 1.00 8.04  ? 360 TYR B CB  1 
ATOM   1446 C  CG  . TYR B 2 51  ? 71.981 19.239  106.892 1.00 8.04  ? 360 TYR B CG  1 
ATOM   1447 C  CD1 . TYR B 2 51  ? 72.614 19.137  108.123 1.00 8.04  ? 360 TYR B CD1 1 
ATOM   1448 C  CD2 . TYR B 2 51  ? 70.716 19.809  106.852 1.00 8.04  ? 360 TYR B CD2 1 
ATOM   1449 C  CE1 . TYR B 2 51  ? 72.007 19.592  109.283 1.00 8.04  ? 360 TYR B CE1 1 
ATOM   1450 C  CE2 . TYR B 2 51  ? 70.098 20.270  108.007 1.00 8.04  ? 360 TYR B CE2 1 
ATOM   1451 C  CZ  . TYR B 2 51  ? 70.750 20.160  109.219 1.00 8.04  ? 360 TYR B CZ  1 
ATOM   1452 O  OH  . TYR B 2 51  ? 70.144 20.635  110.360 1.00 8.04  ? 360 TYR B OH  1 
ATOM   1453 N  N   . ALA B 2 52  ? 74.663 19.500  102.928 1.00 7.03  ? 361 ALA B N   1 
ATOM   1454 C  CA  . ALA B 2 52  ? 75.304 18.864  101.768 1.00 7.03  ? 361 ALA B CA  1 
ATOM   1455 C  C   . ALA B 2 52  ? 76.762 18.423  101.942 1.00 7.03  ? 361 ALA B C   1 
ATOM   1456 O  O   . ALA B 2 52  ? 77.401 18.042  100.960 1.00 7.03  ? 361 ALA B O   1 
ATOM   1457 C  CB  . ALA B 2 52  ? 75.216 19.772  100.574 1.00 7.03  ? 361 ALA B CB  1 
ATOM   1458 N  N   . ASP B 2 53  ? 77.288 18.489  103.170 1.00 34.00 ? 362 ASP B N   1 
ATOM   1459 C  CA  . ASP B 2 53  ? 78.677 18.089  103.477 1.00 34.00 ? 362 ASP B CA  1 
ATOM   1460 C  C   . ASP B 2 53  ? 78.785 17.375  104.827 1.00 34.00 ? 362 ASP B C   1 
ATOM   1461 O  O   . ASP B 2 53  ? 79.879 17.229  105.381 1.00 34.00 ? 362 ASP B O   1 
ATOM   1462 C  CB  . ASP B 2 53  ? 79.626 19.309  103.488 1.00 26.86 ? 362 ASP B CB  1 
ATOM   1463 C  CG  . ASP B 2 53  ? 79.361 20.274  104.655 1.00 26.86 ? 362 ASP B CG  1 
ATOM   1464 O  OD1 . ASP B 2 53  ? 78.357 21.016  104.614 1.00 26.86 ? 362 ASP B OD1 1 
ATOM   1465 O  OD2 . ASP B 2 53  ? 80.159 20.293  105.619 1.00 26.86 ? 362 ASP B OD2 1 
ATOM   1466 N  N   . LYS B 2 54  ? 77.646 16.933  105.352 1.00 18.68 ? 363 LYS B N   1 
ATOM   1467 C  CA  . LYS B 2 54  ? 77.601 16.245  106.643 1.00 18.68 ? 363 LYS B CA  1 
ATOM   1468 C  C   . LYS B 2 54  ? 76.867 14.917  106.493 1.00 18.68 ? 363 LYS B C   1 
ATOM   1469 O  O   . LYS B 2 54  ? 77.311 13.882  106.994 1.00 18.68 ? 363 LYS B O   1 
ATOM   1470 C  CB  . LYS B 2 54  ? 76.835 17.084  107.672 1.00 61.20 ? 363 LYS B CB  1 
ATOM   1471 C  CG  . LYS B 2 54  ? 77.026 18.600  107.585 1.00 61.20 ? 363 LYS B CG  1 
ATOM   1472 C  CD  . LYS B 2 54  ? 78.082 19.112  108.557 1.00 61.20 ? 363 LYS B CD  1 
ATOM   1473 C  CE  . LYS B 2 54  ? 78.044 20.632  108.663 1.00 61.20 ? 363 LYS B CE  1 
ATOM   1474 N  NZ  . LYS B 2 54  ? 76.750 21.124  109.230 1.00 61.20 ? 363 LYS B NZ  1 
ATOM   1475 N  N   . LEU B 2 55  ? 75.730 14.984  105.800 1.00 28.16 ? 364 LEU B N   1 
ATOM   1476 C  CA  . LEU B 2 55  ? 74.848 13.843  105.566 1.00 28.16 ? 364 LEU B CA  1 
ATOM   1477 C  C   . LEU B 2 55  ? 74.980 13.171  104.202 1.00 28.16 ? 364 LEU B C   1 
ATOM   1478 O  O   . LEU B 2 55  ? 75.959 13.378  103.463 1.00 28.16 ? 364 LEU B O   1 
ATOM   1479 C  CB  . LEU B 2 55  ? 73.397 14.276  105.738 1.00 7.03  ? 364 LEU B CB  1 
ATOM   1480 C  CG  . LEU B 2 55  ? 73.082 14.972  107.050 1.00 7.03  ? 364 LEU B CG  1 
ATOM   1481 C  CD1 . LEU B 2 55  ? 71.647 15.446  106.984 1.00 7.03  ? 364 LEU B CD1 1 
ATOM   1482 C  CD2 . LEU B 2 55  ? 73.314 14.043  108.235 1.00 7.03  ? 364 LEU B CD2 1 
ATOM   1483 N  N   . GLU B 2 56  ? 73.957 12.377  103.886 1.00 7.03  ? 365 GLU B N   1 
ATOM   1484 C  CA  . GLU B 2 56  ? 73.890 11.639  102.642 1.00 7.03  ? 365 GLU B CA  1 
ATOM   1485 C  C   . GLU B 2 56  ? 73.152 12.473  101.609 1.00 7.03  ? 365 GLU B C   1 
ATOM   1486 O  O   . GLU B 2 56  ? 73.675 13.464  101.106 1.00 7.03  ? 365 GLU B O   1 
ATOM   1487 C  CB  . GLU B 2 56  ? 73.170 10.325  102.893 1.00 7.03  ? 365 GLU B CB  1 
ATOM   1488 C  CG  . GLU B 2 56  ? 73.510 9.228   101.921 1.00 7.03  ? 365 GLU B CG  1 
ATOM   1489 C  CD  . GLU B 2 56  ? 72.357 8.890   101.030 1.00 7.03  ? 365 GLU B CD  1 
ATOM   1490 O  OE1 . GLU B 2 56  ? 71.260 8.635   101.566 1.00 7.03  ? 365 GLU B OE1 1 
ATOM   1491 O  OE2 . GLU B 2 56  ? 72.548 8.877   99.802  1.00 7.03  ? 365 GLU B OE2 1 
ATOM   1492 N  N   . PHE B 2 57  ? 71.943 12.071  101.274 1.00 7.03  ? 366 PHE B N   1 
ATOM   1493 C  CA  . PHE B 2 57  ? 71.163 12.831  100.323 1.00 7.03  ? 366 PHE B CA  1 
ATOM   1494 C  C   . PHE B 2 57  ? 69.725 12.549  100.615 1.00 7.03  ? 366 PHE B C   1 
ATOM   1495 O  O   . PHE B 2 57  ? 68.917 13.470  100.716 1.00 7.03  ? 366 PHE B O   1 
ATOM   1496 C  CB  . PHE B 2 57  ? 71.451 12.420  98.896  1.00 7.03  ? 366 PHE B CB  1 
ATOM   1497 C  CG  . PHE B 2 57  ? 70.619 13.158  97.892  1.00 7.03  ? 366 PHE B CG  1 
ATOM   1498 C  CD1 . PHE B 2 57  ? 70.909 14.475  97.560  1.00 7.03  ? 366 PHE B CD1 1 
ATOM   1499 C  CD2 . PHE B 2 57  ? 69.536 12.546  97.280  1.00 7.03  ? 366 PHE B CD2 1 
ATOM   1500 C  CE1 . PHE B 2 57  ? 70.133 15.154  96.634  1.00 7.03  ? 366 PHE B CE1 1 
ATOM   1501 C  CE2 . PHE B 2 57  ? 68.759 13.237  96.352  1.00 7.03  ? 366 PHE B CE2 1 
ATOM   1502 C  CZ  . PHE B 2 57  ? 69.059 14.528  96.033  1.00 7.03  ? 366 PHE B CZ  1 
ATOM   1503 N  N   . MET B 2 58  ? 69.410 11.260  100.725 1.00 7.03  ? 367 MET B N   1 
ATOM   1504 C  CA  . MET B 2 58  ? 68.063 10.845  101.037 1.00 7.03  ? 367 MET B CA  1 
ATOM   1505 C  C   . MET B 2 58  ? 67.900 11.389  102.414 1.00 7.03  ? 367 MET B C   1 
ATOM   1506 O  O   . MET B 2 58  ? 66.919 12.065  102.721 1.00 7.03  ? 367 MET B O   1 
ATOM   1507 C  CB  . MET B 2 58  ? 67.944 9.333   101.075 1.00 10.01 ? 367 MET B CB  1 
ATOM   1508 C  CG  . MET B 2 58  ? 67.993 8.642   99.712  1.00 10.01 ? 367 MET B CG  1 
ATOM   1509 S  SD  . MET B 2 58  ? 66.547 8.894   98.630  1.00 10.01 ? 367 MET B SD  1 
ATOM   1510 C  CE  . MET B 2 58  ? 67.291 9.913   97.305  1.00 10.01 ? 367 MET B CE  1 
ATOM   1511 N  N   . HIS B 2 59  ? 68.896 11.110  103.244 1.00 7.65  ? 368 HIS B N   1 
ATOM   1512 C  CA  . HIS B 2 59  ? 68.885 11.593  104.616 1.00 7.65  ? 368 HIS B CA  1 
ATOM   1513 C  C   . HIS B 2 59  ? 68.683 13.087  104.614 1.00 7.65  ? 368 HIS B C   1 
ATOM   1514 O  O   . HIS B 2 59  ? 68.041 13.635  105.505 1.00 7.65  ? 368 HIS B O   1 
ATOM   1515 C  CB  . HIS B 2 59  ? 70.183 11.217  105.314 1.00 10.64 ? 368 HIS B CB  1 
ATOM   1516 C  CG  . HIS B 2 59  ? 70.155 9.842   105.896 1.00 10.64 ? 368 HIS B CG  1 
ATOM   1517 N  ND1 . HIS B 2 59  ? 71.195 9.318   106.632 1.00 10.64 ? 368 HIS B ND1 1 
ATOM   1518 C  CD2 . HIS B 2 59  ? 69.190 8.890   105.874 1.00 10.64 ? 368 HIS B CD2 1 
ATOM   1519 C  CE1 . HIS B 2 59  ? 70.869 8.102   107.038 1.00 10.64 ? 368 HIS B CE1 1 
ATOM   1520 N  NE2 . HIS B 2 59  ? 69.658 7.819   106.592 1.00 10.64 ? 368 HIS B NE2 1 
ATOM   1521 N  N   . ILE B 2 60  ? 69.218 13.732  103.588 1.00 7.27  ? 369 ILE B N   1 
ATOM   1522 C  CA  . ILE B 2 60  ? 69.077 15.161  103.430 1.00 7.27  ? 369 ILE B CA  1 
ATOM   1523 C  C   . ILE B 2 60  ? 67.638 15.450  102.990 1.00 7.27  ? 369 ILE B C   1 
ATOM   1524 O  O   . ILE B 2 60  ? 66.978 16.331  103.543 1.00 7.27  ? 369 ILE B O   1 
ATOM   1525 C  CB  . ILE B 2 60  ? 70.106 15.693  102.387 1.00 7.03  ? 369 ILE B CB  1 
ATOM   1526 C  CG1 . ILE B 2 60  ? 71.525 15.359  102.875 1.00 7.03  ? 369 ILE B CG1 1 
ATOM   1527 C  CG2 . ILE B 2 60  ? 69.943 17.203  102.176 1.00 7.03  ? 369 ILE B CG2 1 
ATOM   1528 C  CD1 . ILE B 2 60  ? 72.636 15.988  102.076 1.00 7.03  ? 369 ILE B CD1 1 
ATOM   1529 N  N   . LEU B 2 61  ? 67.137 14.681  102.028 1.00 7.03  ? 370 LEU B N   1 
ATOM   1530 C  CA  . LEU B 2 61  ? 65.779 14.868  101.536 1.00 7.03  ? 370 LEU B CA  1 
ATOM   1531 C  C   . LEU B 2 61  ? 64.693 14.752  102.609 1.00 7.03  ? 370 LEU B C   1 
ATOM   1532 O  O   . LEU B 2 61  ? 63.632 15.352  102.481 1.00 7.03  ? 370 LEU B O   1 
ATOM   1533 C  CB  . LEU B 2 61  ? 65.497 13.875  100.408 1.00 7.03  ? 370 LEU B CB  1 
ATOM   1534 C  CG  . LEU B 2 61  ? 66.014 14.327  99.049  1.00 7.03  ? 370 LEU B CG  1 
ATOM   1535 C  CD1 . LEU B 2 61  ? 65.961 13.216  98.014  1.00 7.03  ? 370 LEU B CD1 1 
ATOM   1536 C  CD2 . LEU B 2 61  ? 65.168 15.501  98.623  1.00 7.03  ? 370 LEU B CD2 1 
ATOM   1537 N  N   . THR B 2 62  ? 64.960 14.009  103.675 1.00 7.03  ? 371 THR B N   1 
ATOM   1538 C  CA  . THR B 2 62  ? 63.975 13.813  104.744 1.00 7.03  ? 371 THR B CA  1 
ATOM   1539 C  C   . THR B 2 62  ? 63.697 15.008  105.667 1.00 7.03  ? 371 THR B C   1 
ATOM   1540 O  O   . THR B 2 62  ? 62.584 15.159  106.174 1.00 7.03  ? 371 THR B O   1 
ATOM   1541 C  CB  . THR B 2 62  ? 64.367 12.609  105.618 1.00 7.03  ? 371 THR B CB  1 
ATOM   1542 O  OG1 . THR B 2 62  ? 64.582 11.471  104.774 1.00 7.03  ? 371 THR B OG1 1 
ATOM   1543 C  CG2 . THR B 2 62  ? 63.268 12.288  106.627 1.00 7.03  ? 371 THR B CG2 1 
ATOM   1544 N  N   . ARG B 2 63  ? 64.699 15.845  105.912 1.00 29.28 ? 372 ARG B N   1 
ATOM   1545 C  CA  . ARG B 2 63  ? 64.492 17.020  106.758 1.00 29.28 ? 372 ARG B CA  1 
ATOM   1546 C  C   . ARG B 2 63  ? 63.823 18.083  105.897 1.00 29.28 ? 372 ARG B C   1 
ATOM   1547 O  O   . ARG B 2 63  ? 63.124 18.954  106.410 1.00 29.28 ? 372 ARG B O   1 
ATOM   1548 C  CB  . ARG B 2 63  ? 65.819 17.529  107.307 1.00 44.59 ? 372 ARG B CB  1 
ATOM   1549 C  CG  . ARG B 2 63  ? 66.614 16.427  107.951 1.00 44.59 ? 372 ARG B CG  1 
ATOM   1550 C  CD  . ARG B 2 63  ? 67.824 16.936  108.690 1.00 44.59 ? 372 ARG B CD  1 
ATOM   1551 N  NE  . ARG B 2 63  ? 68.609 15.823  109.214 1.00 44.59 ? 372 ARG B NE  1 
ATOM   1552 C  CZ  . ARG B 2 63  ? 69.421 15.909  110.261 1.00 44.59 ? 372 ARG B CZ  1 
ATOM   1553 N  NH1 . ARG B 2 63  ? 69.558 17.065  110.902 1.00 44.59 ? 372 ARG B NH1 1 
ATOM   1554 N  NH2 . ARG B 2 63  ? 70.091 14.837  110.675 1.00 44.59 ? 372 ARG B NH2 1 
ATOM   1555 N  N   . VAL B 2 64  ? 64.061 18.010  104.587 1.00 18.21 ? 373 VAL B N   1 
ATOM   1556 C  CA  . VAL B 2 64  ? 63.417 18.911  103.652 1.00 18.21 ? 373 VAL B CA  1 
ATOM   1557 C  C   . VAL B 2 64  ? 61.933 18.685  103.922 1.00 18.21 ? 373 VAL B C   1 
ATOM   1558 O  O   . VAL B 2 64  ? 61.190 19.615  104.240 1.00 18.21 ? 373 VAL B O   1 
ATOM   1559 C  CB  . VAL B 2 64  ? 63.700 18.507  102.222 1.00 7.03  ? 373 VAL B CB  1 
ATOM   1560 C  CG1 . VAL B 2 64  ? 62.849 19.335  101.284 1.00 7.03  ? 373 VAL B CG1 1 
ATOM   1561 C  CG2 . VAL B 2 64  ? 65.162 18.676  101.933 1.00 7.03  ? 373 VAL B CG2 1 
ATOM   1562 N  N   . ASN B 2 65  ? 61.517 17.428  103.800 1.00 7.03  ? 374 ASN B N   1 
ATOM   1563 C  CA  . ASN B 2 65  ? 60.139 17.039  104.060 1.00 7.03  ? 374 ASN B CA  1 
ATOM   1564 C  C   . ASN B 2 65  ? 59.794 17.492  105.470 1.00 7.03  ? 374 ASN B C   1 
ATOM   1565 O  O   . ASN B 2 65  ? 58.754 18.112  105.699 1.00 7.03  ? 374 ASN B O   1 
ATOM   1566 C  CB  . ASN B 2 65  ? 59.979 15.520  104.002 1.00 7.22  ? 374 ASN B CB  1 
ATOM   1567 C  CG  . ASN B 2 65  ? 60.463 14.923  102.706 1.00 7.22  ? 374 ASN B CG  1 
ATOM   1568 O  OD1 . ASN B 2 65  ? 60.617 13.722  102.615 1.00 7.22  ? 374 ASN B OD1 1 
ATOM   1569 N  ND2 . ASN B 2 65  ? 60.703 15.753  101.701 1.00 7.22  ? 374 ASN B ND2 1 
ATOM   1570 N  N   . ARG B 2 66  ? 60.662 17.165  106.424 1.00 14.30 ? 375 ARG B N   1 
ATOM   1571 C  CA  . ARG B 2 66  ? 60.419 17.553  107.811 1.00 14.30 ? 375 ARG B CA  1 
ATOM   1572 C  C   . ARG B 2 66  ? 60.195 19.055  107.899 1.00 14.30 ? 375 ARG B C   1 
ATOM   1573 O  O   . ARG B 2 66  ? 59.174 19.519  108.405 1.00 14.30 ? 375 ARG B O   1 
ATOM   1574 C  CB  . ARG B 2 66  ? 61.594 17.148  108.720 1.00 19.89 ? 375 ARG B CB  1 
ATOM   1575 C  CG  . ARG B 2 66  ? 61.469 17.723  110.134 1.00 19.89 ? 375 ARG B CG  1 
ATOM   1576 C  CD  . ARG B 2 66  ? 61.880 16.766  111.262 1.00 19.89 ? 375 ARG B CD  1 
ATOM   1577 N  NE  . ARG B 2 66  ? 63.324 16.613  111.451 1.00 19.89 ? 375 ARG B NE  1 
ATOM   1578 C  CZ  . ARG B 2 66  ? 64.090 15.766  110.767 1.00 19.89 ? 375 ARG B CZ  1 
ATOM   1579 N  NH1 . ARG B 2 66  ? 63.561 14.988  109.833 1.00 19.89 ? 375 ARG B NH1 1 
ATOM   1580 N  NH2 . ARG B 2 66  ? 65.384 15.670  111.035 1.00 19.89 ? 375 ARG B NH2 1 
ATOM   1581 N  N   . LYS B 2 67  ? 61.149 19.801  107.359 1.00 18.68 ? 376 LYS B N   1 
ATOM   1582 C  CA  . LYS B 2 67  ? 61.122 21.251  107.386 1.00 18.68 ? 376 LYS B CA  1 
ATOM   1583 C  C   . LYS B 2 67  ? 60.035 21.891  106.539 1.00 18.68 ? 376 LYS B C   1 
ATOM   1584 O  O   . LYS B 2 67  ? 60.072 23.084  106.305 1.00 18.68 ? 376 LYS B O   1 
ATOM   1585 C  CB  . LYS B 2 67  ? 62.491 21.776  106.956 1.00 7.03  ? 376 LYS B CB  1 
ATOM   1586 C  CG  . LYS B 2 67  ? 62.718 23.253  107.179 1.00 7.03  ? 376 LYS B CG  1 
ATOM   1587 C  CD  . LYS B 2 67  ? 64.055 23.652  106.600 1.00 7.03  ? 376 LYS B CD  1 
ATOM   1588 C  CE  . LYS B 2 67  ? 64.312 25.122  106.751 1.00 7.03  ? 376 LYS B CE  1 
ATOM   1589 N  NZ  . LYS B 2 67  ? 65.546 25.466  106.024 1.00 7.03  ? 376 LYS B NZ  1 
ATOM   1590 N  N   . VAL B 2 68  ? 59.063 21.113  106.089 1.00 7.03  ? 377 VAL B N   1 
ATOM   1591 C  CA  . VAL B 2 68  ? 57.992 21.659  105.265 1.00 7.03  ? 377 VAL B CA  1 
ATOM   1592 C  C   . VAL B 2 68  ? 56.667 21.170  105.836 1.00 7.03  ? 377 VAL B C   1 
ATOM   1593 O  O   . VAL B 2 68  ? 55.618 21.784  105.668 1.00 7.03  ? 377 VAL B O   1 
ATOM   1594 C  CB  . VAL B 2 68  ? 58.157 21.203  103.776 1.00 7.03  ? 377 VAL B CB  1 
ATOM   1595 C  CG1 . VAL B 2 68  ? 57.045 21.782  102.896 1.00 7.03  ? 377 VAL B CG1 1 
ATOM   1596 C  CG2 . VAL B 2 68  ? 59.518 21.647  103.247 1.00 7.03  ? 377 VAL B CG2 1 
ATOM   1597 N  N   . ALA B 2 69  ? 56.734 20.052  106.534 1.00 7.03  ? 378 ALA B N   1 
ATOM   1598 C  CA  . ALA B 2 69  ? 55.555 19.477  107.137 1.00 7.03  ? 378 ALA B CA  1 
ATOM   1599 C  C   . ALA B 2 69  ? 55.379 20.174  108.451 1.00 7.03  ? 378 ALA B C   1 
ATOM   1600 O  O   . ALA B 2 69  ? 54.268 20.403  108.911 1.00 7.03  ? 378 ALA B O   1 
ATOM   1601 C  CB  . ALA B 2 69  ? 55.763 17.989  107.362 1.00 12.87 ? 378 ALA B CB  1 
ATOM   1602 N  N   . THR B 2 70  ? 56.509 20.523  109.044 1.00 7.03  ? 379 THR B N   1 
ATOM   1603 C  CA  . THR B 2 70  ? 56.531 21.181  110.339 1.00 7.03  ? 379 THR B CA  1 
ATOM   1604 C  C   . THR B 2 70  ? 56.356 22.712  110.373 1.00 7.03  ? 379 THR B C   1 
ATOM   1605 O  O   . THR B 2 70  ? 55.332 23.209  110.845 1.00 7.03  ? 379 THR B O   1 
ATOM   1606 C  CB  . THR B 2 70  ? 57.834 20.793  111.123 1.00 7.08  ? 379 THR B CB  1 
ATOM   1607 O  OG1 . THR B 2 70  ? 58.983 20.891  110.270 1.00 7.08  ? 379 THR B OG1 1 
ATOM   1608 C  CG2 . THR B 2 70  ? 57.731 19.378  111.656 1.00 7.08  ? 379 THR B CG2 1 
ATOM   1609 N  N   . GLU B 2 71  A 57.342 23.447  109.859 1.00 33.71 ? 379 GLU B N   1 
ATOM   1610 C  CA  . GLU B 2 71  A 57.323 24.914  109.876 1.00 33.71 ? 379 GLU B CA  1 
ATOM   1611 C  C   . GLU B 2 71  A 56.627 25.712  108.741 1.00 33.71 ? 379 GLU B C   1 
ATOM   1612 O  O   . GLU B 2 71  A 56.891 26.906  108.584 1.00 33.71 ? 379 GLU B O   1 
ATOM   1613 C  CB  . GLU B 2 71  A 58.760 25.433  110.055 1.00 7.03  ? 379 GLU B CB  1 
ATOM   1614 C  CG  . GLU B 2 71  A 59.828 24.399  109.782 1.00 7.03  ? 379 GLU B CG  1 
ATOM   1615 C  CD  . GLU B 2 71  A 61.224 24.987  109.726 1.00 7.03  ? 379 GLU B CD  1 
ATOM   1616 O  OE1 . GLU B 2 71  A 61.470 25.879  108.886 1.00 7.03  ? 379 GLU B OE1 1 
ATOM   1617 O  OE2 . GLU B 2 71  A 62.085 24.551  110.513 1.00 7.03  ? 379 GLU B OE2 1 
ATOM   1618 N  N   . PHE B 2 72  ? 55.741 25.081  107.969 1.00 7.03  ? 380 PHE B N   1 
ATOM   1619 C  CA  . PHE B 2 72  ? 55.023 25.786  106.903 1.00 7.03  ? 380 PHE B CA  1 
ATOM   1620 C  C   . PHE B 2 72  ? 53.516 25.569  107.010 1.00 7.03  ? 380 PHE B C   1 
ATOM   1621 O  O   . PHE B 2 72  ? 53.076 24.553  107.532 1.00 7.03  ? 380 PHE B O   1 
ATOM   1622 C  CB  . PHE B 2 72  ? 55.494 25.333  105.521 1.00 7.03  ? 380 PHE B CB  1 
ATOM   1623 C  CG  . PHE B 2 72  ? 56.813 25.921  105.093 1.00 7.03  ? 380 PHE B CG  1 
ATOM   1624 C  CD1 . PHE B 2 72  ? 57.978 25.170  105.155 1.00 7.03  ? 380 PHE B CD1 1 
ATOM   1625 C  CD2 . PHE B 2 72  ? 56.885 27.212  104.603 1.00 7.03  ? 380 PHE B CD2 1 
ATOM   1626 C  CE1 . PHE B 2 72  ? 59.201 25.698  104.729 1.00 7.03  ? 380 PHE B CE1 1 
ATOM   1627 C  CE2 . PHE B 2 72  ? 58.094 27.746  104.180 1.00 7.03  ? 380 PHE B CE2 1 
ATOM   1628 C  CZ  . PHE B 2 72  ? 59.254 26.986  104.242 1.00 7.03  ? 380 PHE B CZ  1 
ATOM   1629 N  N   . GLU B 2 73  ? 52.733 26.533  106.525 1.00 7.24  ? 381 GLU B N   1 
ATOM   1630 C  CA  . GLU B 2 73  ? 51.269 26.455  106.556 1.00 7.24  ? 381 GLU B CA  1 
ATOM   1631 C  C   . GLU B 2 73  ? 50.658 27.549  105.669 1.00 7.24  ? 381 GLU B C   1 
ATOM   1632 O  O   . GLU B 2 73  ? 51.106 28.686  105.708 1.00 7.24  ? 381 GLU B O   1 
ATOM   1633 C  CB  . GLU B 2 73  ? 50.751 26.621  107.985 1.00 7.03  ? 381 GLU B CB  1 
ATOM   1634 C  CG  . GLU B 2 73  ? 49.555 25.749  108.309 1.00 7.03  ? 381 GLU B CG  1 
ATOM   1635 C  CD  . GLU B 2 73  ? 48.633 26.337  109.366 1.00 7.03  ? 381 GLU B CD  1 
ATOM   1636 O  OE1 . GLU B 2 73  ? 49.110 26.749  110.439 1.00 7.03  ? 381 GLU B OE1 1 
ATOM   1637 O  OE2 . GLU B 2 73  ? 47.411 26.375  109.121 1.00 7.03  ? 381 GLU B OE2 1 
ATOM   1638 N  N   . SER B 2 74  A 49.636 27.208  104.886 1.00 7.03  ? 381 SER B N   1 
ATOM   1639 C  CA  . SER B 2 74  A 48.966 28.154  103.988 1.00 7.03  ? 381 SER B CA  1 
ATOM   1640 C  C   . SER B 2 74  A 48.132 29.204  104.745 1.00 7.03  ? 381 SER B C   1 
ATOM   1641 O  O   . SER B 2 74  A 47.635 28.936  105.842 1.00 7.03  ? 381 SER B O   1 
ATOM   1642 C  CB  . SER B 2 74  A 48.076 27.372  103.007 1.00 17.86 ? 381 SER B CB  1 
ATOM   1643 O  OG  . SER B 2 74  A 47.290 28.216  102.181 1.00 17.86 ? 381 SER B OG  1 
ATOM   1644 N  N   . PHE B 2 75  B 47.987 30.391  104.143 1.00 10.39 ? 381 PHE B N   1 
ATOM   1645 C  CA  . PHE B 2 75  B 47.238 31.510  104.726 1.00 10.39 ? 381 PHE B CA  1 
ATOM   1646 C  C   . PHE B 2 75  B 46.454 32.271  103.664 1.00 10.39 ? 381 PHE B C   1 
ATOM   1647 O  O   . PHE B 2 75  B 47.054 32.873  102.772 1.00 10.39 ? 381 PHE B O   1 
ATOM   1648 C  CB  . PHE B 2 75  B 48.197 32.494  105.392 1.00 7.31  ? 381 PHE B CB  1 
ATOM   1649 C  CG  . PHE B 2 75  B 47.537 33.770  105.842 1.00 7.31  ? 381 PHE B CG  1 
ATOM   1650 C  CD1 . PHE B 2 75  B 46.771 33.801  107.003 1.00 7.31  ? 381 PHE B CD1 1 
ATOM   1651 C  CD2 . PHE B 2 75  B 47.651 34.932  105.091 1.00 7.31  ? 381 PHE B CD2 1 
ATOM   1652 C  CE1 . PHE B 2 75  B 46.124 34.969  107.415 1.00 7.31  ? 381 PHE B CE1 1 
ATOM   1653 C  CE2 . PHE B 2 75  B 47.006 36.104  105.493 1.00 7.31  ? 381 PHE B CE2 1 
ATOM   1654 C  CZ  . PHE B 2 75  B 46.240 36.120  106.660 1.00 7.31  ? 381 PHE B CZ  1 
ATOM   1655 N  N   . SER B 2 76  C 45.128 32.276  103.765 1.00 7.03  ? 381 SER B N   1 
ATOM   1656 C  CA  . SER B 2 76  C 44.337 32.987  102.776 1.00 7.03  ? 381 SER B CA  1 
ATOM   1657 C  C   . SER B 2 76  C 42.975 33.455  103.261 1.00 7.03  ? 381 SER B C   1 
ATOM   1658 O  O   . SER B 2 76  C 42.510 33.073  104.331 1.00 7.03  ? 381 SER B O   1 
ATOM   1659 C  CB  . SER B 2 76  C 44.171 32.117  101.533 1.00 9.28  ? 381 SER B CB  1 
ATOM   1660 O  OG  . SER B 2 76  C 44.036 32.911  100.365 1.00 9.28  ? 381 SER B OG  1 
ATOM   1661 N  N   . PHE B 2 77  D 42.344 34.288  102.440 1.00 11.59 ? 381 PHE B N   1 
ATOM   1662 C  CA  . PHE B 2 77  D 41.026 34.851  102.719 1.00 11.59 ? 381 PHE B CA  1 
ATOM   1663 C  C   . PHE B 2 77  D 39.932 33.899  102.258 1.00 11.59 ? 381 PHE B C   1 
ATOM   1664 O  O   . PHE B 2 77  D 38.777 33.992  102.688 1.00 11.59 ? 381 PHE B O   1 
ATOM   1665 C  CB  . PHE B 2 77  D 40.868 36.188  101.985 1.00 25.40 ? 381 PHE B CB  1 
ATOM   1666 C  CG  . PHE B 2 77  D 42.012 37.136  102.205 1.00 25.40 ? 381 PHE B CG  1 
ATOM   1667 C  CD1 . PHE B 2 77  D 42.875 37.470  101.158 1.00 25.40 ? 381 PHE B CD1 1 
ATOM   1668 C  CD2 . PHE B 2 77  D 42.253 37.671  103.472 1.00 25.40 ? 381 PHE B CD2 1 
ATOM   1669 C  CE1 . PHE B 2 77  D 43.965 38.322  101.374 1.00 25.40 ? 381 PHE B CE1 1 
ATOM   1670 C  CE2 . PHE B 2 77  D 43.342 38.522  103.695 1.00 25.40 ? 381 PHE B CE2 1 
ATOM   1671 C  CZ  . PHE B 2 77  D 44.198 38.845  102.645 1.00 25.40 ? 381 PHE B CZ  1 
ATOM   1672 N  N   . ASP B 2 78  E 40.315 33.002  101.354 1.00 13.67 ? 381 ASP B N   1 
ATOM   1673 C  CA  . ASP B 2 78  E 39.410 32.005  100.804 1.00 13.67 ? 381 ASP B CA  1 
ATOM   1674 C  C   . ASP B 2 78  E 39.225 30.905  101.796 1.00 13.67 ? 381 ASP B C   1 
ATOM   1675 O  O   . ASP B 2 78  E 40.171 30.176  102.093 1.00 13.67 ? 381 ASP B O   1 
ATOM   1676 C  CB  . ASP B 2 78  E 39.996 31.366  99.563  1.00 45.66 ? 381 ASP B CB  1 
ATOM   1677 C  CG  . ASP B 2 78  E 40.062 32.307  98.416  1.00 45.66 ? 381 ASP B CG  1 
ATOM   1678 O  OD1 . ASP B 2 78  E 39.059 32.389  97.674  1.00 45.66 ? 381 ASP B OD1 1 
ATOM   1679 O  OD2 . ASP B 2 78  E 41.115 32.968  98.267  1.00 45.66 ? 381 ASP B OD2 1 
ATOM   1680 N  N   . ALA B 2 79  F 38.014 30.768  102.311 1.00 25.83 ? 381 ALA B N   1 
ATOM   1681 C  CA  . ALA B 2 79  F 37.777 29.700  103.254 1.00 25.83 ? 381 ALA B CA  1 
ATOM   1682 C  C   . ALA B 2 79  F 38.591 28.547  102.681 1.00 25.83 ? 381 ALA B C   1 
ATOM   1683 O  O   . ALA B 2 79  F 39.511 28.030  103.324 1.00 25.83 ? 381 ALA B O   1 
ATOM   1684 C  CB  . ALA B 2 79  F 36.285 29.342  103.287 1.00 7.03  ? 381 ALA B CB  1 
ATOM   1685 N  N   . THR B 2 80  G 38.292 28.241  101.418 1.00 22.40 ? 381 THR B N   1 
ATOM   1686 C  CA  . THR B 2 80  G 38.893 27.140  100.678 1.00 22.40 ? 381 THR B CA  1 
ATOM   1687 C  C   . THR B 2 80  G 40.410 26.954  100.584 1.00 22.40 ? 381 THR B C   1 
ATOM   1688 O  O   . THR B 2 80  G 40.867 25.818  100.520 1.00 22.40 ? 381 THR B O   1 
ATOM   1689 C  CB  . THR B 2 80  G 38.292 27.071  99.262  1.00 18.98 ? 381 THR B CB  1 
ATOM   1690 O  OG1 . THR B 2 80  G 39.002 26.099  98.484  1.00 18.98 ? 381 THR B OG1 1 
ATOM   1691 C  CG2 . THR B 2 80  G 38.335 28.440  98.596  1.00 18.98 ? 381 THR B CG2 1 
ATOM   1692 N  N   . PHE B 2 81  H 41.214 28.007  100.575 1.00 7.03  ? 381 PHE B N   1 
ATOM   1693 C  CA  . PHE B 2 81  H 42.649 27.739  100.503 1.00 7.03  ? 381 PHE B CA  1 
ATOM   1694 C  C   . PHE B 2 81  H 43.371 28.012  101.800 1.00 7.03  ? 381 PHE B C   1 
ATOM   1695 O  O   . PHE B 2 81  H 44.570 27.751  101.933 1.00 7.03  ? 381 PHE B O   1 
ATOM   1696 C  CB  . PHE B 2 81  H 43.302 28.535  99.389  1.00 21.03 ? 381 PHE B CB  1 
ATOM   1697 C  CG  . PHE B 2 81  H 42.750 28.233  98.044  1.00 21.03 ? 381 PHE B CG  1 
ATOM   1698 C  CD1 . PHE B 2 81  H 41.536 28.781  97.644  1.00 21.03 ? 381 PHE B CD1 1 
ATOM   1699 C  CD2 . PHE B 2 81  H 43.429 27.382  97.179  1.00 21.03 ? 381 PHE B CD2 1 
ATOM   1700 C  CE1 . PHE B 2 81  H 40.996 28.490  96.400  1.00 21.03 ? 381 PHE B CE1 1 
ATOM   1701 C  CE2 . PHE B 2 81  H 42.899 27.082  95.931  1.00 21.03 ? 381 PHE B CE2 1 
ATOM   1702 C  CZ  . PHE B 2 81  H 41.677 27.639  95.541  1.00 21.03 ? 381 PHE B CZ  1 
ATOM   1703 N  N   . HIS B 2 82  I 42.626 28.513  102.769 1.00 11.03 ? 381 HIS B N   1 
ATOM   1704 C  CA  . HIS B 2 82  I 43.221 28.841  104.037 1.00 11.03 ? 381 HIS B CA  1 
ATOM   1705 C  C   . HIS B 2 82  I 43.438 27.662  104.974 1.00 11.03 ? 381 HIS B C   1 
ATOM   1706 O  O   . HIS B 2 82  I 42.565 26.815  105.145 1.00 11.03 ? 381 HIS B O   1 
ATOM   1707 C  CB  . HIS B 2 82  I 42.386 29.906  104.747 1.00 7.03  ? 381 HIS B CB  1 
ATOM   1708 C  CG  . HIS B 2 82  I 43.007 30.392  106.015 1.00 7.03  ? 381 HIS B CG  1 
ATOM   1709 N  ND1 . HIS B 2 82  I 44.217 31.050  106.043 1.00 7.03  ? 381 HIS B ND1 1 
ATOM   1710 C  CD2 . HIS B 2 82  I 42.615 30.266  107.303 1.00 7.03  ? 381 HIS B CD2 1 
ATOM   1711 C  CE1 . HIS B 2 82  I 44.545 31.304  107.296 1.00 7.03  ? 381 HIS B CE1 1 
ATOM   1712 N  NE2 . HIS B 2 82  I 43.590 30.839  108.080 1.00 7.03  ? 381 HIS B NE2 1 
ATOM   1713 N  N   . ALA B 2 83  ? 44.620 27.634  105.583 1.00 7.03  ? 382 ALA B N   1 
ATOM   1714 C  CA  . ALA B 2 83  ? 45.005 26.610  106.548 1.00 7.03  ? 382 ALA B CA  1 
ATOM   1715 C  C   . ALA B 2 83  ? 45.341 25.280  105.932 1.00 7.03  ? 382 ALA B C   1 
ATOM   1716 O  O   . ALA B 2 83  ? 44.818 24.252  106.352 1.00 7.03  ? 382 ALA B O   1 
ATOM   1717 C  CB  . ALA B 2 83  ? 43.910 26.424  107.572 1.00 18.77 ? 382 ALA B CB  1 
ATOM   1718 N  N   . LYS B 2 84  ? 46.230 25.285  104.954 1.00 7.03  ? 383 LYS B N   1 
ATOM   1719 C  CA  . LYS B 2 84  ? 46.588 24.040  104.311 1.00 7.03  ? 383 LYS B CA  1 
ATOM   1720 C  C   . LYS B 2 84  ? 48.055 23.697  104.460 1.00 7.03  ? 383 LYS B C   1 
ATOM   1721 O  O   . LYS B 2 84  ? 48.886 24.571  104.657 1.00 7.03  ? 383 LYS B O   1 
ATOM   1722 C  CB  . LYS B 2 84  ? 46.185 24.100  102.842 1.00 7.44  ? 383 LYS B CB  1 
ATOM   1723 C  CG  . LYS B 2 84  ? 44.699 24.334  102.659 1.00 7.44  ? 383 LYS B CG  1 
ATOM   1724 C  CD  . LYS B 2 84  ? 43.910 23.347  103.486 1.00 7.44  ? 383 LYS B CD  1 
ATOM   1725 C  CE  . LYS B 2 84  ? 42.445 23.445  103.185 1.00 7.44  ? 383 LYS B CE  1 
ATOM   1726 N  NZ  . LYS B 2 84  ? 42.003 24.854  103.235 1.00 7.44  ? 383 LYS B NZ  1 
ATOM   1727 N  N   . LYS B 2 85  ? 48.363 22.408  104.376 1.00 7.41  ? 384 LYS B N   1 
ATOM   1728 C  CA  . LYS B 2 85  ? 49.733 21.947  104.519 1.00 7.41  ? 384 LYS B CA  1 
ATOM   1729 C  C   . LYS B 2 85  ? 50.272 21.342  103.233 1.00 7.41  ? 384 LYS B C   1 
ATOM   1730 O  O   . LYS B 2 85  ? 49.590 21.281  102.206 1.00 7.41  ? 384 LYS B O   1 
ATOM   1731 C  CB  . LYS B 2 85  ? 49.821 20.898  105.617 1.00 7.03  ? 384 LYS B CB  1 
ATOM   1732 C  CG  . LYS B 2 85  ? 49.314 21.340  106.960 1.00 7.03  ? 384 LYS B CG  1 
ATOM   1733 C  CD  . LYS B 2 85  ? 50.181 22.425  107.579 1.00 7.03  ? 384 LYS B CD  1 
ATOM   1734 C  CE  . LYS B 2 85  ? 51.590 21.947  107.909 1.00 7.03  ? 384 LYS B CE  1 
ATOM   1735 N  NZ  . LYS B 2 85  ? 52.419 21.722  106.685 1.00 7.03  ? 384 LYS B NZ  1 
ATOM   1736 N  N   . GLN B 2 86  ? 51.516 20.894  103.315 1.00 7.03  ? 385 GLN B N   1 
ATOM   1737 C  CA  . GLN B 2 86  ? 52.192 20.264  102.209 1.00 7.03  ? 385 GLN B CA  1 
ATOM   1738 C  C   . GLN B 2 86  ? 53.116 19.189  102.755 1.00 7.03  ? 385 GLN B C   1 
ATOM   1739 O  O   . GLN B 2 86  ? 53.418 19.146  103.946 1.00 7.03  ? 385 GLN B O   1 
ATOM   1740 C  CB  . GLN B 2 86  ? 52.999 21.290  101.405 1.00 7.03  ? 385 GLN B CB  1 
ATOM   1741 C  CG  . GLN B 2 86  ? 53.891 20.653  100.350 1.00 7.03  ? 385 GLN B CG  1 
ATOM   1742 C  CD  . GLN B 2 86  ? 54.363 21.611  99.291  1.00 7.03  ? 385 GLN B CD  1 
ATOM   1743 O  OE1 . GLN B 2 86  ? 53.569 22.328  98.694  1.00 7.03  ? 385 GLN B OE1 1 
ATOM   1744 N  NE2 . GLN B 2 86  ? 55.666 21.618  99.037  1.00 7.03  ? 385 GLN B NE2 1 
ATOM   1745 N  N   . ILE B 2 87  ? 53.532 18.305  101.861 1.00 7.62  ? 386 ILE B N   1 
ATOM   1746 C  CA  . ILE B 2 87  ? 54.449 17.218  102.165 1.00 7.62  ? 386 ILE B CA  1 
ATOM   1747 C  C   . ILE B 2 87  ? 55.133 16.865  100.852 1.00 7.62  ? 386 ILE B C   1 
ATOM   1748 O  O   . ILE B 2 87  ? 54.477 16.583  99.866  1.00 7.62  ? 386 ILE B O   1 
ATOM   1749 C  CB  . ILE B 2 87  ? 53.703 15.972  102.707 1.00 7.03  ? 386 ILE B CB  1 
ATOM   1750 C  CG1 . ILE B 2 87  ? 54.694 14.824  102.901 1.00 7.03  ? 386 ILE B CG1 1 
ATOM   1751 C  CG2 . ILE B 2 87  ? 52.577 15.576  101.772 1.00 7.03  ? 386 ILE B CG2 1 
ATOM   1752 C  CD1 . ILE B 2 87  ? 55.705 15.067  104.008 1.00 7.03  ? 386 ILE B CD1 1 
ATOM   1753 N  N   . PRO B 2 88  ? 56.460 16.931  100.808 1.00 7.25  ? 387 PRO B N   1 
ATOM   1754 C  CA  . PRO B 2 88  ? 57.076 16.578  99.532  1.00 7.25  ? 387 PRO B CA  1 
ATOM   1755 C  C   . PRO B 2 88  ? 57.013 15.058  99.333  1.00 7.25  ? 387 PRO B C   1 
ATOM   1756 O  O   . PRO B 2 88  ? 56.445 14.318  100.151 1.00 7.25  ? 387 PRO B O   1 
ATOM   1757 C  CB  . PRO B 2 88  ? 58.508 17.069  99.687  1.00 7.03  ? 387 PRO B CB  1 
ATOM   1758 C  CG  . PRO B 2 88  ? 58.399 18.153  100.701 1.00 7.03  ? 387 PRO B CG  1 
ATOM   1759 C  CD  . PRO B 2 88  ? 57.424 17.595  101.692 1.00 7.03  ? 387 PRO B CD  1 
ATOM   1760 N  N   . CYS B 2 89  ? 57.627 14.591  98.257  1.00 7.03  ? 388 CYS B N   1 
ATOM   1761 C  CA  . CYS B 2 89  ? 57.617 13.183  97.944  1.00 7.03  ? 388 CYS B CA  1 
ATOM   1762 C  C   . CYS B 2 89  ? 58.960 12.764  97.368  1.00 7.03  ? 388 CYS B C   1 
ATOM   1763 O  O   . CYS B 2 89  ? 59.347 13.231  96.307  1.00 7.03  ? 388 CYS B O   1 
ATOM   1764 C  CB  . CYS B 2 89  ? 56.496 12.925  96.942  1.00 17.05 ? 388 CYS B CB  1 
ATOM   1765 S  SG  . CYS B 2 89  ? 56.459 11.286  96.234  1.00 17.05 ? 388 CYS B SG  1 
ATOM   1766 N  N   . ILE B 2 90  ? 59.672 11.888  98.076  1.00 7.03  ? 389 ILE B N   1 
ATOM   1767 C  CA  . ILE B 2 90  ? 60.975 11.405  97.621  1.00 7.03  ? 389 ILE B CA  1 
ATOM   1768 C  C   . ILE B 2 90  ? 60.838 10.050  96.943  1.00 7.03  ? 389 ILE B C   1 
ATOM   1769 O  O   . ILE B 2 90  ? 60.519 9.058   97.588  1.00 7.03  ? 389 ILE B O   1 
ATOM   1770 C  CB  . ILE B 2 90  ? 61.938 11.212  98.777  1.00 7.03  ? 389 ILE B CB  1 
ATOM   1771 C  CG1 . ILE B 2 90  ? 61.657 12.234  99.861  1.00 7.03  ? 389 ILE B CG1 1 
ATOM   1772 C  CG2 . ILE B 2 90  ? 63.361 11.339  98.285  1.00 7.03  ? 389 ILE B CG2 1 
ATOM   1773 C  CD1 . ILE B 2 90  ? 62.463 11.996  101.103 1.00 7.03  ? 389 ILE B CD1 1 
ATOM   1774 N  N   . VAL B 2 91  ? 61.083 10.009  95.644  1.00 7.03  ? 390 VAL B N   1 
ATOM   1775 C  CA  . VAL B 2 91  ? 60.993 8.769   94.899  1.00 7.03  ? 390 VAL B CA  1 
ATOM   1776 C  C   . VAL B 2 91  ? 62.396 8.445   94.412  1.00 7.03  ? 390 VAL B C   1 
ATOM   1777 O  O   . VAL B 2 91  ? 63.027 9.259   93.735  1.00 7.03  ? 390 VAL B O   1 
ATOM   1778 C  CB  . VAL B 2 91  ? 60.021 8.923   93.705  1.00 7.03  ? 390 VAL B CB  1 
ATOM   1779 C  CG1 . VAL B 2 91  ? 60.041 7.681   92.819  1.00 7.03  ? 390 VAL B CG1 1 
ATOM   1780 C  CG2 . VAL B 2 91  ? 58.611 9.186   94.226  1.00 7.03  ? 390 VAL B CG2 1 
ATOM   1781 N  N   . SER B 2 92  ? 62.888 7.257   94.763  1.00 7.63  ? 392 SER B N   1 
ATOM   1782 C  CA  . SER B 2 92  ? 64.233 6.840   94.380  1.00 7.63  ? 392 SER B CA  1 
ATOM   1783 C  C   . SER B 2 92  ? 64.360 5.458   93.717  1.00 7.63  ? 392 SER B C   1 
ATOM   1784 O  O   . SER B 2 92  ? 63.839 4.464   94.209  1.00 7.63  ? 392 SER B O   1 
ATOM   1785 C  CB  . SER B 2 92  ? 65.144 6.908   95.611  1.00 7.03  ? 392 SER B CB  1 
ATOM   1786 O  OG  . SER B 2 92  ? 66.485 6.633   95.270  1.00 7.03  ? 392 SER B OG  1 
ATOM   1787 N  N   . MET B 2 93  ? 65.067 5.433   92.591  1.00 7.03  ? 393 MET B N   1 
ATOM   1788 C  CA  . MET B 2 93  ? 65.346 4.224   91.823  1.00 7.03  ? 393 MET B CA  1 
ATOM   1789 C  C   . MET B 2 93  ? 66.867 4.133   91.805  1.00 7.03  ? 393 MET B C   1 
ATOM   1790 O  O   . MET B 2 93  ? 67.458 3.384   91.032  1.00 7.03  ? 393 MET B O   1 
ATOM   1791 C  CB  . MET B 2 93  ? 64.861 4.380   90.382  1.00 8.62  ? 393 MET B CB  1 
ATOM   1792 C  CG  . MET B 2 93  ? 63.505 5.024   90.271  1.00 8.62  ? 393 MET B CG  1 
ATOM   1793 S  SD  . MET B 2 93  ? 62.257 3.882   89.726  1.00 8.62  ? 393 MET B SD  1 
ATOM   1794 C  CE  . MET B 2 93  ? 61.640 4.720   88.275  1.00 8.62  ? 393 MET B CE  1 
ATOM   1795 N  N   . LEU B 2 94  ? 67.493 4.945   92.643  1.00 7.03  ? 394 LEU B N   1 
ATOM   1796 C  CA  . LEU B 2 94  ? 68.931 4.962   92.719  1.00 7.03  ? 394 LEU B CA  1 
ATOM   1797 C  C   . LEU B 2 94  ? 69.333 3.623   93.283  1.00 7.03  ? 394 LEU B C   1 
ATOM   1798 O  O   . LEU B 2 94  ? 68.534 2.942   93.915  1.00 7.03  ? 394 LEU B O   1 
ATOM   1799 C  CB  . LEU B 2 94  ? 69.403 6.108   93.606  1.00 7.03  ? 394 LEU B CB  1 
ATOM   1800 C  CG  . LEU B 2 94  ? 68.992 7.489   93.086  1.00 7.03  ? 394 LEU B CG  1 
ATOM   1801 C  CD1 . LEU B 2 94  ? 69.397 8.581   94.053  1.00 7.03  ? 394 LEU B CD1 1 
ATOM   1802 C  CD2 . LEU B 2 94  ? 69.642 7.726   91.751  1.00 7.03  ? 394 LEU B CD2 1 
ATOM   1803 N  N   . THR B 2 95  ? 70.579 3.250   93.029  1.00 15.77 ? 395 THR B N   1 
ATOM   1804 C  CA  . THR B 2 95  ? 71.132 1.971   93.449  1.00 15.77 ? 395 THR B CA  1 
ATOM   1805 C  C   . THR B 2 95  ? 72.315 2.084   94.419  1.00 15.77 ? 395 THR B C   1 
ATOM   1806 O  O   . THR B 2 95  ? 72.946 1.077   94.755  1.00 15.77 ? 395 THR B O   1 
ATOM   1807 C  CB  . THR B 2 95  ? 71.574 1.190   92.209  1.00 7.03  ? 395 THR B CB  1 
ATOM   1808 O  OG1 . THR B 2 95  ? 72.443 2.012   91.415  1.00 7.03  ? 395 THR B OG1 1 
ATOM   1809 C  CG2 . THR B 2 95  ? 70.360 0.811   91.378  1.00 7.03  ? 395 THR B CG2 1 
ATOM   1810 N  N   . LYS B 2 96  ? 72.605 3.309   94.859  1.00 7.11  ? 396 LYS B N   1 
ATOM   1811 C  CA  . LYS B 2 96  ? 73.698 3.587   95.788  1.00 7.11  ? 396 LYS B CA  1 
ATOM   1812 C  C   . LYS B 2 96  ? 73.373 4.864   96.539  1.00 7.11  ? 396 LYS B C   1 
ATOM   1813 O  O   . LYS B 2 96  ? 72.493 5.604   96.134  1.00 7.11  ? 396 LYS B O   1 
ATOM   1814 C  CB  . LYS B 2 96  ? 75.014 3.780   95.029  1.00 7.78  ? 396 LYS B CB  1 
ATOM   1815 C  CG  . LYS B 2 96  ? 75.477 2.582   94.207  1.00 7.78  ? 396 LYS B CG  1 
ATOM   1816 C  CD  . LYS B 2 96  ? 76.841 2.822   93.574  1.00 7.78  ? 396 LYS B CD  1 
ATOM   1817 C  CE  . LYS B 2 96  ? 77.231 1.662   92.685  1.00 7.78  ? 396 LYS B CE  1 
ATOM   1818 N  NZ  . LYS B 2 96  ? 77.217 0.367   93.440  1.00 7.78  ? 396 LYS B NZ  1 
ATOM   1819 N  N   . GLU B 2 97  ? 74.076 5.118   97.636  1.00 7.03  ? 397 GLU B N   1 
ATOM   1820 C  CA  . GLU B 2 97  ? 73.864 6.340   98.402  1.00 7.03  ? 397 GLU B CA  1 
ATOM   1821 C  C   . GLU B 2 97  ? 74.569 7.443   97.629  1.00 7.03  ? 397 GLU B C   1 
ATOM   1822 O  O   . GLU B 2 97  ? 75.346 7.169   96.709  1.00 7.03  ? 397 GLU B O   1 
ATOM   1823 C  CB  . GLU B 2 97  ? 74.516 6.262   99.773  1.00 7.03  ? 397 GLU B CB  1 
ATOM   1824 C  CG  . GLU B 2 97  ? 74.168 5.058   100.592 1.00 7.03  ? 397 GLU B CG  1 
ATOM   1825 C  CD  . GLU B 2 97  ? 75.079 4.935   101.786 1.00 7.03  ? 397 GLU B CD  1 
ATOM   1826 O  OE1 . GLU B 2 97  ? 76.307 4.966   101.585 1.00 7.03  ? 397 GLU B OE1 1 
ATOM   1827 O  OE2 . GLU B 2 97  ? 74.575 4.813   102.919 1.00 7.03  ? 397 GLU B OE2 1 
ATOM   1828 N  N   . LEU B 2 98  ? 74.308 8.690   98.004  1.00 7.33  ? 398 LEU B N   1 
ATOM   1829 C  CA  . LEU B 2 98  ? 74.943 9.817   97.343  1.00 7.33  ? 398 LEU B CA  1 
ATOM   1830 C  C   . LEU B 2 98  ? 75.374 10.850  98.383  1.00 7.33  ? 398 LEU B C   1 
ATOM   1831 O  O   . LEU B 2 98  ? 74.573 11.278  99.217  1.00 7.33  ? 398 LEU B O   1 
ATOM   1832 C  CB  . LEU B 2 98  ? 73.987 10.422  96.306  1.00 7.03  ? 398 LEU B CB  1 
ATOM   1833 C  CG  . LEU B 2 98  ? 74.605 11.361  95.263  1.00 7.03  ? 398 LEU B CG  1 
ATOM   1834 C  CD1 . LEU B 2 98  ? 73.809 11.325  93.980  1.00 7.03  ? 398 LEU B CD1 1 
ATOM   1835 C  CD2 . LEU B 2 98  ? 74.658 12.760  95.816  1.00 7.03  ? 398 LEU B CD2 1 
ATOM   1836 N  N   . TYR B 2 99  ? 76.661 11.194  98.351  1.00 7.11  ? 399 TYR B N   1 
ATOM   1837 C  CA  . TYR B 2 99  ? 77.261 12.187  99.244  1.00 7.11  ? 399 TYR B CA  1 
ATOM   1838 C  C   . TYR B 2 99  ? 77.996 13.217  98.355  1.00 7.11  ? 399 TYR B C   1 
ATOM   1839 O  O   . TYR B 2 99  ? 79.006 12.899  97.728  1.00 7.11  ? 399 TYR B O   1 
ATOM   1840 C  CB  . TYR B 2 99  ? 78.274 11.534  100.194 1.00 7.03  ? 399 TYR B CB  1 
ATOM   1841 C  CG  . TYR B 2 99  ? 77.735 10.590  101.259 1.00 7.03  ? 399 TYR B CG  1 
ATOM   1842 C  CD1 . TYR B 2 99  ? 77.439 9.259   100.963 1.00 7.03  ? 399 TYR B CD1 1 
ATOM   1843 C  CD2 . TYR B 2 99  ? 77.593 11.014  102.583 1.00 7.03  ? 399 TYR B CD2 1 
ATOM   1844 C  CE1 . TYR B 2 99  ? 77.021 8.368   101.964 1.00 7.03  ? 399 TYR B CE1 1 
ATOM   1845 C  CE2 . TYR B 2 99  ? 77.177 10.137  103.586 1.00 7.03  ? 399 TYR B CE2 1 
ATOM   1846 C  CZ  . TYR B 2 99  ? 76.893 8.815   103.269 1.00 7.03  ? 399 TYR B CZ  1 
ATOM   1847 O  OH  . TYR B 2 99  ? 76.485 7.944   104.252 1.00 7.03  ? 399 TYR B OH  1 
ATOM   1848 N  N   . PHE B 2 100 ? 77.505 14.451  98.317  1.00 26.46 ? 400 PHE B N   1 
ATOM   1849 C  CA  . PHE B 2 100 ? 78.088 15.484  97.466  1.00 26.46 ? 400 PHE B CA  1 
ATOM   1850 C  C   . PHE B 2 100 ? 79.528 15.944  97.705  1.00 26.46 ? 400 PHE B C   1 
ATOM   1851 O  O   . PHE B 2 100 ? 79.745 17.068  98.151  1.00 26.46 ? 400 PHE B O   1 
ATOM   1852 C  CB  . PHE B 2 100 ? 77.169 16.709  97.475  1.00 8.01  ? 400 PHE B CB  1 
ATOM   1853 C  CG  . PHE B 2 100 ? 75.874 16.503  96.736  1.00 8.01  ? 400 PHE B CG  1 
ATOM   1854 C  CD1 . PHE B 2 100 ? 75.835 16.562  95.344  1.00 8.01  ? 400 PHE B CD1 1 
ATOM   1855 C  CD2 . PHE B 2 100 ? 74.697 16.256  97.430  1.00 8.01  ? 400 PHE B CD2 1 
ATOM   1856 C  CE1 . PHE B 2 100 ? 74.648 16.383  94.659  1.00 8.01  ? 400 PHE B CE1 1 
ATOM   1857 C  CE2 . PHE B 2 100 ? 73.505 16.074  96.751  1.00 8.01  ? 400 PHE B CE2 1 
ATOM   1858 C  CZ  . PHE B 2 100 ? 73.481 16.138  95.365  1.00 8.01  ? 400 PHE B CZ  1 
ATOM   1859 N  N   . TYR B 2 101 ? 80.504 15.092  97.390  1.00 24.73 ? 401 TYR B N   1 
ATOM   1860 C  CA  . TYR B 2 101 ? 81.930 15.431  97.535  1.00 24.73 ? 401 TYR B CA  1 
ATOM   1861 C  C   . TYR B 2 101 ? 82.913 14.288  97.255  1.00 24.73 ? 401 TYR B C   1 
ATOM   1862 O  O   . TYR B 2 101 ? 83.867 14.480  96.465  1.00 24.73 ? 401 TYR B O   1 
ATOM   1863 C  CB  . TYR B 2 101 ? 82.230 16.012  98.921  1.00 47.36 ? 401 TYR B CB  1 
ATOM   1864 C  CG  . TYR B 2 101 ? 81.630 15.284  100.106 1.00 47.36 ? 401 TYR B CG  1 
ATOM   1865 C  CD1 . TYR B 2 101 ? 80.419 15.702  100.667 1.00 47.36 ? 401 TYR B CD1 1 
ATOM   1866 C  CD2 . TYR B 2 101 ? 82.312 14.239  100.729 1.00 47.36 ? 401 TYR B CD2 1 
ATOM   1867 C  CE1 . TYR B 2 101 ? 79.910 15.107  101.829 1.00 47.36 ? 401 TYR B CE1 1 
ATOM   1868 C  CE2 . TYR B 2 101 ? 81.810 13.633  101.894 1.00 47.36 ? 401 TYR B CE2 1 
ATOM   1869 C  CZ  . TYR B 2 101 ? 80.611 14.075  102.442 1.00 47.36 ? 401 TYR B CZ  1 
ATOM   1870 O  OH  . TYR B 2 101 ? 80.134 13.509  103.612 1.00 47.36 ? 401 TYR B OH  1 
ATOM   1871 N  N   . ASP C 1 6   ? 63.786 14.148  117.283 1.00 24.71 ? 150 ASP D N   1 
ATOM   1872 C  CA  . ASP C 1 6   ? 65.086 14.442  116.612 1.00 24.71 ? 150 ASP D CA  1 
ATOM   1873 C  C   . ASP C 1 6   ? 65.045 14.067  115.132 1.00 24.71 ? 150 ASP D C   1 
ATOM   1874 O  O   . ASP C 1 6   ? 63.966 13.903  114.566 1.00 24.71 ? 150 ASP D O   1 
ATOM   1875 C  CB  . ASP C 1 6   ? 66.218 13.689  117.318 1.00 39.97 ? 150 ASP D CB  1 
ATOM   1876 C  CG  . ASP C 1 6   ? 67.376 14.596  117.675 1.00 39.97 ? 150 ASP D CG  1 
ATOM   1877 O  OD1 . ASP C 1 6   ? 68.282 14.774  116.829 1.00 39.97 ? 150 ASP D OD1 1 
ATOM   1878 O  OD2 . ASP C 1 6   ? 67.362 15.146  118.799 1.00 39.97 ? 150 ASP D OD2 1 
ATOM   1879 N  N   . ASN C 1 7   ? 66.211 13.933  114.502 1.00 16.33 ? 151 ASN D N   1 
ATOM   1880 C  CA  . ASN C 1 7   ? 66.263 13.581  113.085 1.00 16.33 ? 151 ASN D CA  1 
ATOM   1881 C  C   . ASN C 1 7   ? 65.700 12.165  112.873 1.00 16.33 ? 151 ASN D C   1 
ATOM   1882 O  O   . ASN C 1 7   ? 65.047 11.887  111.867 1.00 16.33 ? 151 ASN D O   1 
ATOM   1883 C  CB  . ASN C 1 7   ? 67.709 13.649  112.561 1.00 20.77 ? 151 ASN D CB  1 
ATOM   1884 C  CG  . ASN C 1 7   ? 68.620 14.505  113.430 1.00 20.77 ? 151 ASN D CG  1 
ATOM   1885 O  OD1 . ASN C 1 7   ? 68.181 15.472  114.052 1.00 20.77 ? 151 ASN D OD1 1 
ATOM   1886 N  ND2 . ASN C 1 7   ? 69.905 14.161  113.459 1.00 20.77 ? 151 ASN D ND2 1 
ATOM   1887 N  N   . SER C 1 8   ? 65.964 11.286  113.843 1.00 17.56 ? 152 SER D N   1 
ATOM   1888 C  CA  . SER C 1 8   ? 65.505 9.894   113.835 1.00 17.56 ? 152 SER D CA  1 
ATOM   1889 C  C   . SER C 1 8   ? 64.125 9.752   114.505 1.00 17.56 ? 152 SER D C   1 
ATOM   1890 O  O   . SER C 1 8   ? 63.819 10.472  115.460 1.00 17.56 ? 152 SER D O   1 
ATOM   1891 C  CB  . SER C 1 8   ? 66.529 9.018   114.564 1.00 15.71 ? 152 SER D CB  1 
ATOM   1892 O  OG  . SER C 1 8   ? 66.651 9.406   115.922 1.00 15.71 ? 152 SER D OG  1 
ATOM   1893 N  N   . TYR C 1 9   ? 63.310 8.822   113.998 1.00 7.10  ? 153 TYR D N   1 
ATOM   1894 C  CA  . TYR C 1 9   ? 61.954 8.562   114.505 1.00 7.10  ? 153 TYR D CA  1 
ATOM   1895 C  C   . TYR C 1 9   ? 61.953 7.952   115.906 1.00 7.10  ? 153 TYR D C   1 
ATOM   1896 O  O   . TYR C 1 9   ? 62.926 7.334   116.313 1.00 7.10  ? 153 TYR D O   1 
ATOM   1897 C  CB  . TYR C 1 9   ? 61.228 7.587   113.578 1.00 7.03  ? 153 TYR D CB  1 
ATOM   1898 C  CG  . TYR C 1 9   ? 60.290 8.172   112.540 1.00 7.03  ? 153 TYR D CG  1 
ATOM   1899 C  CD1 . TYR C 1 9   ? 59.113 8.809   112.905 1.00 7.03  ? 153 TYR D CD1 1 
ATOM   1900 C  CD2 . TYR C 1 9   ? 60.551 8.001   111.184 1.00 7.03  ? 153 TYR D CD2 1 
ATOM   1901 C  CE1 . TYR C 1 9   ? 58.228 9.243   111.953 1.00 7.03  ? 153 TYR D CE1 1 
ATOM   1902 C  CE2 . TYR C 1 9   ? 59.675 8.435   110.221 1.00 7.03  ? 153 TYR D CE2 1 
ATOM   1903 C  CZ  . TYR C 1 9   ? 58.515 9.055   110.605 1.00 7.03  ? 153 TYR D CZ  1 
ATOM   1904 O  OH  . TYR C 1 9   ? 57.657 9.493   109.621 1.00 7.03  ? 153 TYR D OH  1 
ATOM   1905 N  N   . LYS C 1 10  ? 60.853 8.108   116.632 1.00 7.39  ? 154 LYS D N   1 
ATOM   1906 C  CA  . LYS C 1 10  ? 60.732 7.541   117.970 1.00 7.39  ? 154 LYS D CA  1 
ATOM   1907 C  C   . LYS C 1 10  ? 60.373 6.045   117.866 1.00 7.39  ? 154 LYS D C   1 
ATOM   1908 O  O   . LYS C 1 10  ? 59.296 5.686   117.359 1.00 7.39  ? 154 LYS D O   1 
ATOM   1909 C  CB  . LYS C 1 10  ? 59.649 8.287   118.746 1.00 13.56 ? 154 LYS D CB  1 
ATOM   1910 C  CG  . LYS C 1 10  ? 59.663 8.063   120.254 1.00 13.56 ? 154 LYS D CG  1 
ATOM   1911 C  CD  . LYS C 1 10  ? 58.520 8.830   120.919 1.00 13.56 ? 154 LYS D CD  1 
ATOM   1912 C  CE  . LYS C 1 10  ? 58.614 8.813   122.435 1.00 13.56 ? 154 LYS D CE  1 
ATOM   1913 N  NZ  . LYS C 1 10  ? 58.623 7.425   122.970 1.00 13.56 ? 154 LYS D NZ  1 
ATOM   1914 N  N   . MET C 1 11  ? 61.273 5.186   118.354 1.00 19.94 ? 155 MET D N   1 
ATOM   1915 C  CA  . MET C 1 11  ? 61.088 3.729   118.300 1.00 19.94 ? 155 MET D CA  1 
ATOM   1916 C  C   . MET C 1 11  ? 61.385 3.008   119.628 1.00 19.94 ? 155 MET D C   1 
ATOM   1917 O  O   . MET C 1 11  ? 62.314 2.195   119.708 1.00 19.94 ? 155 MET D O   1 
ATOM   1918 C  CB  . MET C 1 11  ? 61.983 3.135   117.194 1.00 7.03  ? 155 MET D CB  1 
ATOM   1919 C  CG  . MET C 1 11  ? 61.670 3.610   115.773 1.00 7.03  ? 155 MET D CG  1 
ATOM   1920 S  SD  . MET C 1 11  ? 60.177 2.845   115.101 1.00 7.03  ? 155 MET D SD  1 
ATOM   1921 C  CE  . MET C 1 11  ? 60.754 2.212   113.595 1.00 7.03  ? 155 MET D CE  1 
ATOM   1922 N  N   . ASP C 1 12  ? 60.603 3.293   120.665 1.00 7.03  ? 156 ASP D N   1 
ATOM   1923 C  CA  . ASP C 1 12  ? 60.828 2.635   121.939 1.00 7.03  ? 156 ASP D CA  1 
ATOM   1924 C  C   . ASP C 1 12  ? 59.613 2.615   122.852 1.00 7.03  ? 156 ASP D C   1 
ATOM   1925 O  O   . ASP C 1 12  ? 59.720 2.847   124.053 1.00 7.03  ? 156 ASP D O   1 
ATOM   1926 C  CB  . ASP C 1 12  ? 62.025 3.265   122.658 1.00 32.35 ? 156 ASP D CB  1 
ATOM   1927 C  CG  . ASP C 1 12  ? 61.748 4.681   123.129 1.00 32.35 ? 156 ASP D CG  1 
ATOM   1928 O  OD1 . ASP C 1 12  ? 61.072 5.425   122.383 1.00 32.35 ? 156 ASP D OD1 1 
ATOM   1929 O  OD2 . ASP C 1 12  ? 62.211 5.052   124.239 1.00 32.35 ? 156 ASP D OD2 1 
ATOM   1930 N  N   . TYR C 1 13  A 58.451 2.335   122.275 1.00 26.77 ? 156 TYR D N   1 
ATOM   1931 C  CA  . TYR C 1 13  A 57.225 2.245   123.056 1.00 26.77 ? 156 TYR D CA  1 
ATOM   1932 C  C   . TYR C 1 13  A 57.164 0.805   123.553 1.00 26.77 ? 156 TYR D C   1 
ATOM   1933 O  O   . TYR C 1 13  A 57.834 -0.078  122.997 1.00 26.77 ? 156 TYR D O   1 
ATOM   1934 C  CB  . TYR C 1 13  A 55.992 2.548   122.191 1.00 7.03  ? 156 TYR D CB  1 
ATOM   1935 C  CG  . TYR C 1 13  A 55.934 3.967   121.650 1.00 7.03  ? 156 TYR D CG  1 
ATOM   1936 C  CD1 . TYR C 1 13  A 54.730 4.663   121.585 1.00 7.03  ? 156 TYR D CD1 1 
ATOM   1937 C  CD2 . TYR C 1 13  A 57.077 4.608   121.198 1.00 7.03  ? 156 TYR D CD2 1 
ATOM   1938 C  CE1 . TYR C 1 13  A 54.677 5.967   121.084 1.00 7.03  ? 156 TYR D CE1 1 
ATOM   1939 C  CE2 . TYR C 1 13  A 57.029 5.901   120.696 1.00 7.03  ? 156 TYR D CE2 1 
ATOM   1940 C  CZ  . TYR C 1 13  A 55.833 6.575   120.643 1.00 7.03  ? 156 TYR D CZ  1 
ATOM   1941 O  OH  . TYR C 1 13  A 55.811 7.863   120.167 1.00 7.03  ? 156 TYR D OH  1 
ATOM   1942 N  N   . PRO C 1 14  ? 56.375 0.537   124.606 1.00 30.21 ? 161 PRO D N   1 
ATOM   1943 C  CA  . PRO C 1 14  ? 56.282 -0.832  125.124 1.00 30.21 ? 161 PRO D CA  1 
ATOM   1944 C  C   . PRO C 1 14  ? 56.034 -1.934  124.072 1.00 30.21 ? 161 PRO D C   1 
ATOM   1945 O  O   . PRO C 1 14  ? 56.196 -3.128  124.363 1.00 30.21 ? 161 PRO D O   1 
ATOM   1946 C  CB  . PRO C 1 14  ? 55.162 -0.733  126.175 1.00 17.92 ? 161 PRO D CB  1 
ATOM   1947 C  CG  . PRO C 1 14  ? 54.422 0.529   125.826 1.00 17.92 ? 161 PRO D CG  1 
ATOM   1948 C  CD  . PRO C 1 14  ? 55.521 1.447   125.387 1.00 17.92 ? 161 PRO D CD  1 
ATOM   1949 N  N   . GLU C 1 15  ? 55.659 -1.528  122.859 1.00 7.86  ? 162 GLU D N   1 
ATOM   1950 C  CA  . GLU C 1 15  ? 55.390 -2.452  121.755 1.00 7.86  ? 162 GLU D CA  1 
ATOM   1951 C  C   . GLU C 1 15  ? 56.146 -1.835  120.606 1.00 7.86  ? 162 GLU D C   1 
ATOM   1952 O  O   . GLU C 1 15  ? 56.250 -0.622  120.537 1.00 7.86  ? 162 GLU D O   1 
ATOM   1953 C  CB  . GLU C 1 15  ? 53.884 -2.463  121.434 1.00 58.39 ? 162 GLU D CB  1 
ATOM   1954 C  CG  . GLU C 1 15  ? 53.372 -3.645  120.582 1.00 58.39 ? 162 GLU D CG  1 
ATOM   1955 C  CD  . GLU C 1 15  ? 51.886 -3.502  120.185 1.00 58.39 ? 162 GLU D CD  1 
ATOM   1956 O  OE1 . GLU C 1 15  ? 51.221 -4.537  119.934 1.00 58.39 ? 162 GLU D OE1 1 
ATOM   1957 O  OE2 . GLU C 1 15  ? 51.391 -2.352  120.111 1.00 58.39 ? 162 GLU D OE2 1 
ATOM   1958 N  N   . MET C 1 16  A 56.693 -2.639  119.709 1.00 7.03  ? 162 MET D N   1 
ATOM   1959 C  CA  . MET C 1 16  A 57.410 -2.049  118.594 1.00 7.03  ? 162 MET D CA  1 
ATOM   1960 C  C   . MET C 1 16  A 56.447 -1.828  117.438 1.00 7.03  ? 162 MET D C   1 
ATOM   1961 O  O   . MET C 1 16  A 56.432 -0.757  116.836 1.00 7.03  ? 162 MET D O   1 
ATOM   1962 C  CB  . MET C 1 16  A 58.584 -2.937  118.166 1.00 7.03  ? 162 MET D CB  1 
ATOM   1963 C  CG  . MET C 1 16  A 59.928 -2.220  118.152 1.00 7.03  ? 162 MET D CG  1 
ATOM   1964 S  SD  . MET C 1 16  A 60.416 -1.662  116.517 1.00 7.03  ? 162 MET D SD  1 
ATOM   1965 C  CE  . MET C 1 16  A 62.200 -1.949  116.539 1.00 7.03  ? 162 MET D CE  1 
ATOM   1966 N  N   . GLY C 1 17  ? 55.624 -2.827  117.137 1.00 9.78  ? 163 GLY D N   1 
ATOM   1967 C  CA  . GLY C 1 17  ? 54.688 -2.672  116.041 1.00 9.78  ? 163 GLY D CA  1 
ATOM   1968 C  C   . GLY C 1 17  ? 53.662 -3.767  115.837 1.00 9.78  ? 163 GLY D C   1 
ATOM   1969 O  O   . GLY C 1 17  ? 53.435 -4.605  116.707 1.00 9.78  ? 163 GLY D O   1 
ATOM   1970 N  N   . LEU C 1 18  ? 53.037 -3.726  114.664 1.00 10.41 ? 164 LEU D N   1 
ATOM   1971 C  CA  . LEU C 1 18  ? 52.019 -4.676  114.225 1.00 10.41 ? 164 LEU D CA  1 
ATOM   1972 C  C   . LEU C 1 18  ? 52.223 -4.790  112.718 1.00 10.41 ? 164 LEU D C   1 
ATOM   1973 O  O   . LEU C 1 18  ? 51.803 -3.921  111.957 1.00 10.41 ? 164 LEU D O   1 
ATOM   1974 C  CB  . LEU C 1 18  ? 50.626 -4.132  114.521 1.00 7.03  ? 164 LEU D CB  1 
ATOM   1975 C  CG  . LEU C 1 18  ? 49.407 -4.751  113.843 1.00 7.03  ? 164 LEU D CG  1 
ATOM   1976 C  CD1 . LEU C 1 18  ? 48.938 -5.982  114.597 1.00 7.03  ? 164 LEU D CD1 1 
ATOM   1977 C  CD2 . LEU C 1 18  ? 48.295 -3.708  113.801 1.00 7.03  ? 164 LEU D CD2 1 
ATOM   1978 N  N   . CYS C 1 19  ? 52.879 -5.862  112.295 1.00 23.09 ? 165 CYS D N   1 
ATOM   1979 C  CA  . CYS C 1 19  ? 53.188 -6.084  110.887 1.00 23.09 ? 165 CYS D CA  1 
ATOM   1980 C  C   . CYS C 1 19  ? 52.155 -6.928  110.129 1.00 23.09 ? 165 CYS D C   1 
ATOM   1981 O  O   . CYS C 1 19  ? 52.233 -8.148  110.167 1.00 23.09 ? 165 CYS D O   1 
ATOM   1982 C  CB  . CYS C 1 19  ? 54.556 -6.755  110.809 1.00 7.03  ? 165 CYS D CB  1 
ATOM   1983 S  SG  . CYS C 1 19  ? 55.036 -7.331  109.194 1.00 7.03  ? 165 CYS D SG  1 
ATOM   1984 N  N   . ILE C 1 20  ? 51.217 -6.307  109.412 1.00 17.51 ? 166 ILE D N   1 
ATOM   1985 C  CA  . ILE C 1 20  ? 50.187 -7.075  108.690 1.00 17.51 ? 166 ILE D CA  1 
ATOM   1986 C  C   . ILE C 1 20  ? 50.491 -7.524  107.230 1.00 17.51 ? 166 ILE D C   1 
ATOM   1987 O  O   . ILE C 1 20  ? 50.337 -6.756  106.272 1.00 17.51 ? 166 ILE D O   1 
ATOM   1988 C  CB  . ILE C 1 20  ? 48.808 -6.317  108.746 1.00 7.03  ? 166 ILE D CB  1 
ATOM   1989 C  CG1 . ILE C 1 20  ? 48.238 -6.403  110.167 1.00 7.03  ? 166 ILE D CG1 1 
ATOM   1990 C  CG2 . ILE C 1 20  ? 47.820 -6.886  107.727 1.00 7.03  ? 166 ILE D CG2 1 
ATOM   1991 C  CD1 . ILE C 1 20  ? 46.868 -5.810  110.320 1.00 7.03  ? 166 ILE D CD1 1 
ATOM   1992 N  N   . ILE C 1 21  ? 50.901 -8.789  107.078 1.00 15.27 ? 167 ILE D N   1 
ATOM   1993 C  CA  . ILE C 1 21  ? 51.220 -9.375  105.764 1.00 15.27 ? 167 ILE D CA  1 
ATOM   1994 C  C   . ILE C 1 21  ? 50.004 -10.052 105.111 1.00 15.27 ? 167 ILE D C   1 
ATOM   1995 O  O   . ILE C 1 21  ? 49.586 -11.130 105.521 1.00 15.27 ? 167 ILE D O   1 
ATOM   1996 C  CB  . ILE C 1 21  ? 52.295 -10.464 105.871 1.00 7.03  ? 167 ILE D CB  1 
ATOM   1997 C  CG1 . ILE C 1 21  ? 53.482 -9.973  106.696 1.00 7.03  ? 167 ILE D CG1 1 
ATOM   1998 C  CG2 . ILE C 1 21  ? 52.717 -10.895 104.474 1.00 7.03  ? 167 ILE D CG2 1 
ATOM   1999 C  CD1 . ILE C 1 21  ? 54.447 -11.078 107.093 1.00 7.03  ? 167 ILE D CD1 1 
ATOM   2000 N  N   . ILE C 1 22  ? 49.445 -9.443  104.080 1.00 7.03  ? 168 ILE D N   1 
ATOM   2001 C  CA  . ILE C 1 22  ? 48.300 -10.047 103.444 1.00 7.03  ? 168 ILE D CA  1 
ATOM   2002 C  C   . ILE C 1 22  ? 48.734 -10.793 102.208 1.00 7.03  ? 168 ILE D C   1 
ATOM   2003 O  O   . ILE C 1 22  ? 48.855 -10.223 101.131 1.00 7.03  ? 168 ILE D O   1 
ATOM   2004 C  CB  . ILE C 1 22  ? 47.269 -8.992  103.093 1.00 17.94 ? 168 ILE D CB  1 
ATOM   2005 C  CG1 . ILE C 1 22  ? 46.820 -8.297  104.388 1.00 17.94 ? 168 ILE D CG1 1 
ATOM   2006 C  CG2 . ILE C 1 22  ? 46.106 -9.637  102.338 1.00 17.94 ? 168 ILE D CG2 1 
ATOM   2007 C  CD1 . ILE C 1 22  ? 46.013 -7.031  104.190 1.00 17.94 ? 168 ILE D CD1 1 
ATOM   2008 N  N   . ASN C 1 23  ? 48.978 -12.084 102.394 1.00 7.33  ? 169 ASN D N   1 
ATOM   2009 C  CA  . ASN C 1 23  ? 49.413 -12.987 101.337 1.00 7.33  ? 169 ASN D CA  1 
ATOM   2010 C  C   . ASN C 1 23  ? 48.203 -13.390 100.514 1.00 7.33  ? 169 ASN D C   1 
ATOM   2011 O  O   . ASN C 1 23  ? 47.250 -13.950 101.049 1.00 7.33  ? 169 ASN D O   1 
ATOM   2012 C  CB  . ASN C 1 23  ? 50.044 -14.233 101.977 1.00 7.37  ? 169 ASN D CB  1 
ATOM   2013 C  CG  . ASN C 1 23  ? 50.676 -15.174 100.964 1.00 7.37  ? 169 ASN D CG  1 
ATOM   2014 O  OD1 . ASN C 1 23  ? 51.797 -14.949 100.501 1.00 7.37  ? 169 ASN D OD1 1 
ATOM   2015 N  ND2 . ASN C 1 23  ? 49.957 -16.245 100.618 1.00 7.37  ? 169 ASN D ND2 1 
ATOM   2016 N  N   . ASN C 1 24  ? 48.219 -13.080 99.223  1.00 7.15  ? 170 ASN D N   1 
ATOM   2017 C  CA  . ASN C 1 24  ? 47.123 -13.472 98.331  1.00 7.15  ? 170 ASN D CA  1 
ATOM   2018 C  C   . ASN C 1 24  ? 47.815 -14.340 97.303  1.00 7.15  ? 170 ASN D C   1 
ATOM   2019 O  O   . ASN C 1 24  ? 48.934 -14.035 96.895  1.00 7.15  ? 170 ASN D O   1 
ATOM   2020 C  CB  . ASN C 1 24  ? 46.463 -12.244 97.662  1.00 7.03  ? 170 ASN D CB  1 
ATOM   2021 C  CG  . ASN C 1 24  ? 45.300 -11.672 98.483  1.00 7.03  ? 170 ASN D CG  1 
ATOM   2022 O  OD1 . ASN C 1 24  ? 44.180 -12.189 98.450  1.00 7.03  ? 170 ASN D OD1 1 
ATOM   2023 N  ND2 . ASN C 1 24  ? 45.573 -10.609 99.232  1.00 7.03  ? 170 ASN D ND2 1 
ATOM   2024 N  N   . LYS C 1 25  ? 47.182 -15.434 96.893  1.00 20.11 ? 171 LYS D N   1 
ATOM   2025 C  CA  . LYS C 1 25  ? 47.830 -16.314 95.919  1.00 20.11 ? 171 LYS D CA  1 
ATOM   2026 C  C   . LYS C 1 25  ? 46.886 -17.056 94.994  1.00 20.11 ? 171 LYS D C   1 
ATOM   2027 O  O   . LYS C 1 25  ? 47.136 -17.138 93.797  1.00 20.11 ? 171 LYS D O   1 
ATOM   2028 C  CB  . LYS C 1 25  ? 48.724 -17.324 96.645  1.00 21.17 ? 171 LYS D CB  1 
ATOM   2029 C  CG  . LYS C 1 25  ? 49.463 -18.290 95.735  1.00 21.17 ? 171 LYS D CG  1 
ATOM   2030 C  CD  . LYS C 1 25  ? 50.204 -19.352 96.549  1.00 21.17 ? 171 LYS D CD  1 
ATOM   2031 C  CE  . LYS C 1 25  ? 50.947 -20.355 95.659  1.00 21.17 ? 171 LYS D CE  1 
ATOM   2032 N  NZ  . LYS C 1 25  ? 51.747 -21.355 96.453  1.00 21.17 ? 171 LYS D NZ  1 
ATOM   2033 N  N   . ASN C 1 26  ? 45.813 -17.610 95.539  1.00 8.50  ? 172 ASN D N   1 
ATOM   2034 C  CA  . ASN C 1 26  ? 44.865 -18.343 94.711  1.00 8.50  ? 172 ASN D CA  1 
ATOM   2035 C  C   . ASN C 1 26  ? 43.677 -17.463 94.351  1.00 8.50  ? 172 ASN D C   1 
ATOM   2036 O  O   . ASN C 1 26  ? 42.776 -17.223 95.167  1.00 8.50  ? 172 ASN D O   1 
ATOM   2037 C  CB  . ASN C 1 26  ? 44.404 -19.618 95.424  1.00 14.74 ? 172 ASN D CB  1 
ATOM   2038 C  CG  . ASN C 1 26  ? 45.567 -20.514 95.817  1.00 14.74 ? 172 ASN D CG  1 
ATOM   2039 O  OD1 . ASN C 1 26  ? 46.457 -20.777 95.009  1.00 14.74 ? 172 ASN D OD1 1 
ATOM   2040 N  ND2 . ASN C 1 26  ? 45.565 -20.987 97.063  1.00 14.74 ? 172 ASN D ND2 1 
ATOM   2041 N  N   . PHE C 1 27  ? 43.695 -16.992 93.108  1.00 12.35 ? 173 PHE D N   1 
ATOM   2042 C  CA  . PHE C 1 27  ? 42.667 -16.107 92.590  1.00 12.35 ? 173 PHE D CA  1 
ATOM   2043 C  C   . PHE C 1 27  ? 41.469 -16.801 91.979  1.00 12.35 ? 173 PHE D C   1 
ATOM   2044 O  O   . PHE C 1 27  ? 41.614 -17.709 91.159  1.00 12.35 ? 173 PHE D O   1 
ATOM   2045 C  CB  . PHE C 1 27  ? 43.287 -15.150 91.565  1.00 9.48  ? 173 PHE D CB  1 
ATOM   2046 C  CG  . PHE C 1 27  ? 44.374 -14.288 92.137  1.00 9.48  ? 173 PHE D CG  1 
ATOM   2047 C  CD1 . PHE C 1 27  ? 45.691 -14.712 92.127  1.00 9.48  ? 173 PHE D CD1 1 
ATOM   2048 C  CD2 . PHE C 1 27  ? 44.065 -13.079 92.762  1.00 9.48  ? 173 PHE D CD2 1 
ATOM   2049 C  CE1 . PHE C 1 27  ? 46.687 -13.949 92.735  1.00 9.48  ? 173 PHE D CE1 1 
ATOM   2050 C  CE2 . PHE C 1 27  ? 45.055 -12.311 93.373  1.00 9.48  ? 173 PHE D CE2 1 
ATOM   2051 C  CZ  . PHE C 1 27  ? 46.365 -12.746 93.361  1.00 9.48  ? 173 PHE D CZ  1 
ATOM   2052 N  N   . HIS C 1 28  ? 40.284 -16.366 92.387  1.00 7.03  ? 174 HIS D N   1 
ATOM   2053 C  CA  . HIS C 1 28  ? 39.061 -16.932 91.866  1.00 7.03  ? 174 HIS D CA  1 
ATOM   2054 C  C   . HIS C 1 28  ? 39.193 -17.033 90.350  1.00 7.03  ? 174 HIS D C   1 
ATOM   2055 O  O   . HIS C 1 28  ? 39.558 -16.069 89.672  1.00 7.03  ? 174 HIS D O   1 
ATOM   2056 C  CB  . HIS C 1 28  ? 37.864 -16.066 92.264  1.00 66.08 ? 174 HIS D CB  1 
ATOM   2057 C  CG  . HIS C 1 28  ? 36.558 -16.553 91.714  1.00 66.08 ? 174 HIS D CG  1 
ATOM   2058 N  ND1 . HIS C 1 28  ? 36.244 -17.893 91.615  1.00 66.08 ? 174 HIS D ND1 1 
ATOM   2059 C  CD2 . HIS C 1 28  ? 35.483 -15.878 91.240  1.00 66.08 ? 174 HIS D CD2 1 
ATOM   2060 C  CE1 . HIS C 1 28  ? 35.032 -18.021 91.102  1.00 66.08 ? 174 HIS D CE1 1 
ATOM   2061 N  NE2 . HIS C 1 28  ? 34.549 -16.813 90.866  1.00 66.08 ? 174 HIS D NE2 1 
ATOM   2062 N  N   . LYS C 1 29  ? 38.911 -18.231 89.842  1.00 49.52 ? 175 LYS D N   1 
ATOM   2063 C  CA  . LYS C 1 29  ? 39.016 -18.554 88.419  1.00 49.52 ? 175 LYS D CA  1 
ATOM   2064 C  C   . LYS C 1 29  ? 38.299 -17.576 87.503  1.00 49.52 ? 175 LYS D C   1 
ATOM   2065 O  O   . LYS C 1 29  ? 38.798 -17.244 86.426  1.00 49.52 ? 175 LYS D O   1 
ATOM   2066 C  CB  . LYS C 1 29  ? 38.482 -19.969 88.168  1.00 39.69 ? 175 LYS D CB  1 
ATOM   2067 C  CG  . LYS C 1 29  ? 39.123 -20.704 86.983  1.00 39.69 ? 175 LYS D CG  1 
ATOM   2068 C  CD  . LYS C 1 29  ? 40.474 -21.353 87.345  1.00 39.69 ? 175 LYS D CD  1 
ATOM   2069 C  CE  . LYS C 1 29  ? 41.696 -20.460 87.058  1.00 39.69 ? 175 LYS D CE  1 
ATOM   2070 N  NZ  . LYS C 1 29  ? 42.042 -20.350 85.605  1.00 39.69 ? 175 LYS D NZ  1 
ATOM   2071 N  N   . SER C 1 30  A 37.127 -17.122 87.926  1.00 32.94 ? 175 SER D N   1 
ATOM   2072 C  CA  . SER C 1 30  A 36.346 -16.196 87.130  1.00 32.94 ? 175 SER D CA  1 
ATOM   2073 C  C   . SER C 1 30  A 37.147 -14.943 86.778  1.00 32.94 ? 175 SER D C   1 
ATOM   2074 O  O   . SER C 1 30  A 37.028 -14.404 85.672  1.00 32.94 ? 175 SER D O   1 
ATOM   2075 C  CB  . SER C 1 30  A 35.084 -15.811 87.886  1.00 33.75 ? 175 SER D CB  1 
ATOM   2076 O  OG  . SER C 1 30  A 34.294 -14.926 87.117  1.00 33.75 ? 175 SER D OG  1 
ATOM   2077 N  N   . THR C 1 31  B 37.973 -14.491 87.716  1.00 17.21 ? 175 THR D N   1 
ATOM   2078 C  CA  . THR C 1 31  B 38.784 -13.299 87.508  1.00 17.21 ? 175 THR D CA  1 
ATOM   2079 C  C   . THR C 1 31  B 39.865 -13.606 86.478  1.00 17.21 ? 175 THR D C   1 
ATOM   2080 O  O   . THR C 1 31  B 40.568 -12.714 86.014  1.00 17.21 ? 175 THR D O   1 
ATOM   2081 C  CB  . THR C 1 31  B 39.462 -12.836 88.827  1.00 63.47 ? 175 THR D CB  1 
ATOM   2082 O  OG1 . THR C 1 31  B 38.581 -13.064 89.935  1.00 63.47 ? 175 THR D OG1 1 
ATOM   2083 C  CG2 . THR C 1 31  B 39.787 -11.340 88.768  1.00 63.47 ? 175 THR D CG2 1 
ATOM   2084 N  N   . GLY C 1 32  C 39.993 -14.873 86.113  1.00 17.98 ? 175 GLY D N   1 
ATOM   2085 C  CA  . GLY C 1 32  C 41.002 -15.239 85.142  1.00 17.98 ? 175 GLY D CA  1 
ATOM   2086 C  C   . GLY C 1 32  C 42.368 -14.724 85.557  1.00 17.98 ? 175 GLY D C   1 
ATOM   2087 O  O   . GLY C 1 32  C 43.130 -14.233 84.726  1.00 17.98 ? 175 GLY D O   1 
ATOM   2088 N  N   . MET C 1 33  ? 42.670 -14.835 86.848  1.00 29.07 ? 176 MET D N   1 
ATOM   2089 C  CA  . MET C 1 33  ? 43.953 -14.393 87.401  1.00 29.07 ? 176 MET D CA  1 
ATOM   2090 C  C   . MET C 1 33  ? 44.890 -15.567 87.684  1.00 29.07 ? 176 MET D C   1 
ATOM   2091 O  O   . MET C 1 33  ? 44.562 -16.452 88.478  1.00 29.07 ? 176 MET D O   1 
ATOM   2092 C  CB  . MET C 1 33  ? 43.732 -13.611 88.704  1.00 50.94 ? 176 MET D CB  1 
ATOM   2093 C  CG  . MET C 1 33  ? 43.563 -12.105 88.537  1.00 50.94 ? 176 MET D CG  1 
ATOM   2094 S  SD  . MET C 1 33  ? 45.031 -11.314 87.841  1.00 50.94 ? 176 MET D SD  1 
ATOM   2095 C  CE  . MET C 1 33  ? 44.555 -11.186 86.081  1.00 50.94 ? 176 MET D CE  1 
ATOM   2096 N  N   . THR C 1 34  ? 46.062 -15.553 87.046  1.00 12.47 ? 177 THR D N   1 
ATOM   2097 C  CA  . THR C 1 34  ? 47.062 -16.608 87.222  1.00 12.47 ? 177 THR D CA  1 
ATOM   2098 C  C   . THR C 1 34  ? 47.412 -16.769 88.691  1.00 12.47 ? 177 THR D C   1 
ATOM   2099 O  O   . THR C 1 34  ? 47.108 -15.902 89.500  1.00 12.47 ? 177 THR D O   1 
ATOM   2100 C  CB  . THR C 1 34  ? 48.365 -16.280 86.481  1.00 28.03 ? 177 THR D CB  1 
ATOM   2101 O  OG1 . THR C 1 34  ? 49.139 -15.362 87.263  1.00 28.03 ? 177 THR D OG1 1 
ATOM   2102 C  CG2 . THR C 1 34  ? 48.060 -15.652 85.127  1.00 28.03 ? 177 THR D CG2 1 
ATOM   2103 N  N   . SER C 1 35  ? 48.054 -17.872 89.044  1.00 8.91  ? 178 SER D N   1 
ATOM   2104 C  CA  . SER C 1 35  ? 48.417 -18.086 90.436  1.00 8.91  ? 178 SER D CA  1 
ATOM   2105 C  C   . SER C 1 35  ? 49.813 -17.575 90.710  1.00 8.91  ? 178 SER D C   1 
ATOM   2106 O  O   . SER C 1 35  ? 50.611 -17.411 89.787  1.00 8.91  ? 178 SER D O   1 
ATOM   2107 C  CB  . SER C 1 35  ? 48.344 -19.562 90.795  1.00 12.10 ? 178 SER D CB  1 
ATOM   2108 O  OG  . SER C 1 35  ? 48.547 -19.728 92.184  1.00 12.10 ? 178 SER D OG  1 
ATOM   2109 N  N   . ARG C 1 36  ? 50.103 -17.334 91.983  1.00 7.03  ? 179 ARG D N   1 
ATOM   2110 C  CA  . ARG C 1 36  ? 51.404 -16.819 92.391  1.00 7.03  ? 179 ARG D CA  1 
ATOM   2111 C  C   . ARG C 1 36  ? 52.311 -17.854 93.061  1.00 7.03  ? 179 ARG D C   1 
ATOM   2112 O  O   . ARG C 1 36  ? 52.463 -17.870 94.280  1.00 7.03  ? 179 ARG D O   1 
ATOM   2113 C  CB  . ARG C 1 36  ? 51.208 -15.626 93.325  1.00 7.03  ? 179 ARG D CB  1 
ATOM   2114 C  CG  . ARG C 1 36  ? 50.608 -14.412 92.655  1.00 7.03  ? 179 ARG D CG  1 
ATOM   2115 C  CD  . ARG C 1 36  ? 50.710 -13.203 93.552  1.00 7.03  ? 179 ARG D CD  1 
ATOM   2116 N  NE  . ARG C 1 36  ? 52.102 -12.920 93.880  1.00 7.03  ? 179 ARG D NE  1 
ATOM   2117 C  CZ  . ARG C 1 36  ? 52.521 -12.561 95.087  1.00 7.03  ? 179 ARG D CZ  1 
ATOM   2118 N  NH1 . ARG C 1 36  ? 51.644 -12.442 96.066  1.00 7.03  ? 179 ARG D NH1 1 
ATOM   2119 N  NH2 . ARG C 1 36  ? 53.814 -12.341 95.317  1.00 7.03  ? 179 ARG D NH2 1 
ATOM   2120 N  N   . SER C 1 37  ? 52.946 -18.685 92.250  1.00 7.42  ? 180 SER D N   1 
ATOM   2121 C  CA  . SER C 1 37  ? 53.814 -19.752 92.749  1.00 7.42  ? 180 SER D CA  1 
ATOM   2122 C  C   . SER C 1 37  ? 55.009 -19.371 93.644  1.00 7.42  ? 180 SER D C   1 
ATOM   2123 O  O   . SER C 1 37  ? 56.104 -19.079 93.151  1.00 7.42  ? 180 SER D O   1 
ATOM   2124 C  CB  . SER C 1 37  ? 54.313 -20.586 91.562  1.00 26.12 ? 180 SER D CB  1 
ATOM   2125 O  OG  . SER C 1 37  ? 53.238 -20.947 90.704  1.00 26.12 ? 180 SER D OG  1 
ATOM   2126 N  N   . GLY C 1 38  ? 54.800 -19.402 94.959  1.00 19.46 ? 181 GLY D N   1 
ATOM   2127 C  CA  . GLY C 1 38  ? 55.878 -19.088 95.879  1.00 19.46 ? 181 GLY D CA  1 
ATOM   2128 C  C   . GLY C 1 38  ? 55.680 -17.922 96.829  1.00 19.46 ? 181 GLY D C   1 
ATOM   2129 O  O   . GLY C 1 38  ? 56.591 -17.604 97.583  1.00 19.46 ? 181 GLY D O   1 
ATOM   2130 N  N   . THR C 1 39  ? 54.513 -17.283 96.811  1.00 16.54 ? 182 THR D N   1 
ATOM   2131 C  CA  . THR C 1 39  ? 54.252 -16.151 97.704  1.00 16.54 ? 182 THR D CA  1 
ATOM   2132 C  C   . THR C 1 39  ? 54.549 -16.603 99.115  1.00 16.54 ? 182 THR D C   1 
ATOM   2133 O  O   . THR C 1 39  ? 55.065 -15.856 99.942  1.00 16.54 ? 182 THR D O   1 
ATOM   2134 C  CB  . THR C 1 39  ? 52.775 -15.738 97.714  1.00 23.08 ? 182 THR D CB  1 
ATOM   2135 O  OG1 . THR C 1 39  ? 52.170 -16.031 96.450  1.00 23.08 ? 182 THR D OG1 1 
ATOM   2136 C  CG2 . THR C 1 39  ? 52.658 -14.266 98.012  1.00 23.08 ? 182 THR D CG2 1 
ATOM   2137 N  N   . ASP C 1 40  ? 54.177 -17.848 99.370  1.00 15.07 ? 183 ASP D N   1 
ATOM   2138 C  CA  . ASP C 1 40  ? 54.352 -18.476 100.657 1.00 15.07 ? 183 ASP D CA  1 
ATOM   2139 C  C   . ASP C 1 40  ? 55.802 -18.394 101.127 1.00 15.07 ? 183 ASP D C   1 
ATOM   2140 O  O   . ASP C 1 40  ? 56.064 -18.082 102.289 1.00 15.07 ? 183 ASP D O   1 
ATOM   2141 C  CB  . ASP C 1 40  ? 53.865 -19.922 100.557 1.00 66.40 ? 183 ASP D CB  1 
ATOM   2142 C  CG  . ASP C 1 40  ? 52.377 -20.015 100.174 1.00 66.40 ? 183 ASP D CG  1 
ATOM   2143 O  OD1 . ASP C 1 40  ? 51.760 -18.950 99.953  1.00 66.40 ? 183 ASP D OD1 1 
ATOM   2144 O  OD2 . ASP C 1 40  ? 51.823 -21.141 100.087 1.00 66.40 ? 183 ASP D OD2 1 
ATOM   2145 N  N   . VAL C 1 41  ? 56.746 -18.657 100.229 1.00 16.92 ? 184 VAL D N   1 
ATOM   2146 C  CA  . VAL C 1 41  ? 58.154 -18.573 100.598 1.00 16.92 ? 184 VAL D CA  1 
ATOM   2147 C  C   . VAL C 1 41  ? 58.338 -17.184 101.177 1.00 16.92 ? 184 VAL D C   1 
ATOM   2148 O  O   . VAL C 1 41  ? 58.829 -17.015 102.299 1.00 16.92 ? 184 VAL D O   1 
ATOM   2149 C  CB  . VAL C 1 41  ? 59.083 -18.694 99.397  1.00 7.03  ? 184 VAL D CB  1 
ATOM   2150 C  CG1 . VAL C 1 41  ? 60.437 -19.073 99.873  1.00 7.03  ? 184 VAL D CG1 1 
ATOM   2151 C  CG2 . VAL C 1 41  ? 58.566 -19.707 98.415  1.00 7.03  ? 184 VAL D CG2 1 
ATOM   2152 N  N   . ASP C 1 42  ? 57.923 -16.195 100.386 1.00 7.03  ? 185 ASP D N   1 
ATOM   2153 C  CA  . ASP C 1 42  ? 57.984 -14.813 100.794 1.00 7.03  ? 185 ASP D CA  1 
ATOM   2154 C  C   . ASP C 1 42  ? 57.276 -14.781 102.144 1.00 7.03  ? 185 ASP D C   1 
ATOM   2155 O  O   . ASP C 1 42  ? 57.911 -14.907 103.180 1.00 7.03  ? 185 ASP D O   1 
ATOM   2156 C  CB  . ASP C 1 42  ? 57.238 -13.923 99.795  1.00 7.03  ? 185 ASP D CB  1 
ATOM   2157 C  CG  . ASP C 1 42  ? 57.769 -14.046 98.371  1.00 7.03  ? 185 ASP D CG  1 
ATOM   2158 O  OD1 . ASP C 1 42  ? 58.999 -14.144 98.187  1.00 7.03  ? 185 ASP D OD1 1 
ATOM   2159 O  OD2 . ASP C 1 42  ? 56.946 -14.021 97.429  1.00 7.03  ? 185 ASP D OD2 1 
ATOM   2160 N  N   . ALA C 1 43  ? 55.952 -14.654 102.115 1.00 7.03  ? 186 ALA D N   1 
ATOM   2161 C  CA  . ALA C 1 43  ? 55.124 -14.595 103.318 1.00 7.03  ? 186 ALA D CA  1 
ATOM   2162 C  C   . ALA C 1 43  ? 55.724 -15.314 104.515 1.00 7.03  ? 186 ALA D C   1 
ATOM   2163 O  O   . ALA C 1 43  ? 55.570 -14.882 105.652 1.00 7.03  ? 186 ALA D O   1 
ATOM   2164 C  CB  . ALA C 1 43  ? 53.750 -15.159 103.020 1.00 9.88  ? 186 ALA D CB  1 
ATOM   2165 N  N   . ALA C 1 44  ? 56.403 -16.424 104.252 1.00 7.03  ? 187 ALA D N   1 
ATOM   2166 C  CA  . ALA C 1 44  ? 57.024 -17.205 105.310 1.00 7.03  ? 187 ALA D CA  1 
ATOM   2167 C  C   . ALA C 1 44  ? 58.291 -16.523 105.777 1.00 7.03  ? 187 ALA D C   1 
ATOM   2168 O  O   . ALA C 1 44  ? 58.537 -16.435 106.977 1.00 7.03  ? 187 ALA D O   1 
ATOM   2169 C  CB  . ALA C 1 44  ? 57.341 -18.592 104.812 1.00 10.28 ? 187 ALA D CB  1 
ATOM   2170 N  N   . ASN C 1 45  ? 59.084 -16.057 104.810 1.00 7.11  ? 188 ASN D N   1 
ATOM   2171 C  CA  . ASN C 1 45  ? 60.344 -15.338 105.049 1.00 7.11  ? 188 ASN D CA  1 
ATOM   2172 C  C   . ASN C 1 45  ? 60.078 -13.997 105.753 1.00 7.11  ? 188 ASN D C   1 
ATOM   2173 O  O   . ASN C 1 45  ? 60.673 -13.691 106.787 1.00 7.11  ? 188 ASN D O   1 
ATOM   2174 C  CB  . ASN C 1 45  ? 61.035 -15.071 103.715 1.00 27.76 ? 188 ASN D CB  1 
ATOM   2175 C  CG  . ASN C 1 45  ? 62.533 -15.294 103.777 1.00 27.76 ? 188 ASN D CG  1 
ATOM   2176 O  OD1 . ASN C 1 45  ? 62.995 -16.358 104.189 1.00 27.76 ? 188 ASN D OD1 1 
ATOM   2177 N  ND2 . ASN C 1 45  ? 63.301 -14.296 103.354 1.00 27.76 ? 188 ASN D ND2 1 
ATOM   2178 N  N   . LEU C 1 46  ? 59.179 -13.199 105.182 1.00 7.03  ? 189 LEU D N   1 
ATOM   2179 C  CA  . LEU C 1 46  ? 58.831 -11.913 105.772 1.00 7.03  ? 189 LEU D CA  1 
ATOM   2180 C  C   . LEU C 1 46  ? 58.306 -12.195 107.175 1.00 7.03  ? 189 LEU D C   1 
ATOM   2181 O  O   . LEU C 1 46  ? 58.745 -11.593 108.156 1.00 7.03  ? 189 LEU D O   1 
ATOM   2182 C  CB  . LEU C 1 46  ? 57.726 -11.207 104.969 1.00 7.03  ? 189 LEU D CB  1 
ATOM   2183 C  CG  . LEU C 1 46  ? 57.764 -11.003 103.450 1.00 7.03  ? 189 LEU D CG  1 
ATOM   2184 C  CD1 . LEU C 1 46  ? 56.385 -10.568 102.991 1.00 7.03  ? 189 LEU D CD1 1 
ATOM   2185 C  CD2 . LEU C 1 46  ? 58.803 -9.981  103.049 1.00 7.03  ? 189 LEU D CD2 1 
ATOM   2186 N  N   . ARG C 1 47  ? 57.362 -13.123 107.268 1.00 9.16  ? 190 ARG D N   1 
ATOM   2187 C  CA  . ARG C 1 47  ? 56.774 -13.445 108.560 1.00 9.16  ? 190 ARG D CA  1 
ATOM   2188 C  C   . ARG C 1 47  ? 57.859 -13.654 109.598 1.00 9.16  ? 190 ARG D C   1 
ATOM   2189 O  O   . ARG C 1 47  ? 57.692 -13.284 110.756 1.00 9.16  ? 190 ARG D O   1 
ATOM   2190 C  CB  . ARG C 1 47  ? 55.879 -14.696 108.471 1.00 7.03  ? 190 ARG D CB  1 
ATOM   2191 C  CG  . ARG C 1 47  ? 55.143 -15.018 109.779 1.00 7.03  ? 190 ARG D CG  1 
ATOM   2192 C  CD  . ARG C 1 47  ? 54.233 -16.216 109.641 1.00 7.03  ? 190 ARG D CD  1 
ATOM   2193 N  NE  . ARG C 1 47  ? 53.947 -16.856 110.927 1.00 7.03  ? 190 ARG D NE  1 
ATOM   2194 C  CZ  . ARG C 1 47  ? 53.099 -16.397 111.844 1.00 7.03  ? 190 ARG D CZ  1 
ATOM   2195 N  NH1 . ARG C 1 47  ? 52.428 -15.272 111.637 1.00 7.03  ? 190 ARG D NH1 1 
ATOM   2196 N  NH2 . ARG C 1 47  ? 52.913 -17.080 112.967 1.00 7.03  ? 190 ARG D NH2 1 
ATOM   2197 N  N   . GLU C 1 48  ? 58.975 -14.230 109.179 1.00 7.15  ? 191 GLU D N   1 
ATOM   2198 C  CA  . GLU C 1 48  ? 60.063 -14.477 110.108 1.00 7.15  ? 191 GLU D CA  1 
ATOM   2199 C  C   . GLU C 1 48  ? 60.914 -13.226 110.257 1.00 7.15  ? 191 GLU D C   1 
ATOM   2200 O  O   . GLU C 1 48  ? 61.344 -12.889 111.354 1.00 7.15  ? 191 GLU D O   1 
ATOM   2201 C  CB  . GLU C 1 48  ? 60.923 -15.645 109.618 1.00 13.40 ? 191 GLU D CB  1 
ATOM   2202 C  CG  . GLU C 1 48  ? 61.968 -16.134 110.610 1.00 13.40 ? 191 GLU D CG  1 
ATOM   2203 C  CD  . GLU C 1 48  ? 61.397 -16.404 111.995 1.00 13.40 ? 191 GLU D CD  1 
ATOM   2204 O  OE1 . GLU C 1 48  ? 60.224 -16.832 112.098 1.00 13.40 ? 191 GLU D OE1 1 
ATOM   2205 O  OE2 . GLU C 1 48  ? 62.134 -16.200 112.983 1.00 13.40 ? 191 GLU D OE2 1 
ATOM   2206 N  N   . THR C 1 49  ? 61.138 -12.531 109.150 1.00 19.18 ? 192 THR D N   1 
ATOM   2207 C  CA  . THR C 1 49  ? 61.941 -11.322 109.167 1.00 19.18 ? 192 THR D CA  1 
ATOM   2208 C  C   . THR C 1 49  ? 61.399 -10.207 110.074 1.00 19.18 ? 192 THR D C   1 
ATOM   2209 O  O   . THR C 1 49  ? 62.184 -9.466  110.664 1.00 19.18 ? 192 THR D O   1 
ATOM   2210 C  CB  . THR C 1 49  ? 62.110 -10.762 107.747 1.00 18.22 ? 192 THR D CB  1 
ATOM   2211 O  OG1 . THR C 1 49  ? 62.742 -11.747 106.920 1.00 18.22 ? 192 THR D OG1 1 
ATOM   2212 C  CG2 . THR C 1 49  ? 62.959 -9.499  107.771 1.00 18.22 ? 192 THR D CG2 1 
ATOM   2213 N  N   . PHE C 1 50  ? 60.077 -10.077 110.192 1.00 7.03  ? 193 PHE D N   1 
ATOM   2214 C  CA  . PHE C 1 50  ? 59.496 -9.024  111.037 1.00 7.03  ? 193 PHE D CA  1 
ATOM   2215 C  C   . PHE C 1 50  ? 59.131 -9.544  112.419 1.00 7.03  ? 193 PHE D C   1 
ATOM   2216 O  O   . PHE C 1 50  ? 58.784 -8.782  113.313 1.00 7.03  ? 193 PHE D O   1 
ATOM   2217 C  CB  . PHE C 1 50  ? 58.262 -8.405  110.364 1.00 8.31  ? 193 PHE D CB  1 
ATOM   2218 C  CG  . PHE C 1 50  ? 58.593 -7.367  109.303 1.00 8.31  ? 193 PHE D CG  1 
ATOM   2219 C  CD1 . PHE C 1 50  ? 58.967 -6.077  109.659 1.00 8.31  ? 193 PHE D CD1 1 
ATOM   2220 C  CD2 . PHE C 1 50  ? 58.506 -7.681  107.948 1.00 8.31  ? 193 PHE D CD2 1 
ATOM   2221 C  CE1 . PHE C 1 50  ? 59.243 -5.123  108.689 1.00 8.31  ? 193 PHE D CE1 1 
ATOM   2222 C  CE2 . PHE C 1 50  ? 58.783 -6.728  106.977 1.00 8.31  ? 193 PHE D CE2 1 
ATOM   2223 C  CZ  . PHE C 1 50  ? 59.150 -5.454  107.348 1.00 8.31  ? 193 PHE D CZ  1 
ATOM   2224 N  N   . ARG C 1 51  ? 59.211 -10.856 112.582 1.00 11.53 ? 194 ARG D N   1 
ATOM   2225 C  CA  . ARG C 1 51  ? 58.932 -11.486 113.859 1.00 11.53 ? 194 ARG D CA  1 
ATOM   2226 C  C   . ARG C 1 51  ? 60.213 -11.296 114.670 1.00 11.53 ? 194 ARG D C   1 
ATOM   2227 O  O   . ARG C 1 51  ? 60.196 -11.178 115.894 1.00 11.53 ? 194 ARG D O   1 
ATOM   2228 C  CB  . ARG C 1 51  ? 58.671 -12.978 113.642 1.00 9.68  ? 194 ARG D CB  1 
ATOM   2229 C  CG  . ARG C 1 51  ? 58.277 -13.768 114.893 1.00 9.68  ? 194 ARG D CG  1 
ATOM   2230 C  CD  . ARG C 1 51  ? 58.976 -15.116 114.919 1.00 9.68  ? 194 ARG D CD  1 
ATOM   2231 N  NE  . ARG C 1 51  ? 59.770 -15.274 116.134 1.00 9.68  ? 194 ARG D NE  1 
ATOM   2232 C  CZ  . ARG C 1 51  ? 60.833 -16.064 116.236 1.00 9.68  ? 194 ARG D CZ  1 
ATOM   2233 N  NH1 . ARG C 1 51  ? 61.236 -16.777 115.190 1.00 9.68  ? 194 ARG D NH1 1 
ATOM   2234 N  NH2 . ARG C 1 51  ? 61.495 -16.129 117.385 1.00 9.68  ? 194 ARG D NH2 1 
ATOM   2235 N  N   . ASN C 1 52  ? 61.331 -11.261 113.951 1.00 31.38 ? 195 ASN D N   1 
ATOM   2236 C  CA  . ASN C 1 52  ? 62.644 -11.103 114.551 1.00 31.38 ? 195 ASN D CA  1 
ATOM   2237 C  C   . ASN C 1 52  ? 62.955 -9.691  115.014 1.00 31.38 ? 195 ASN D C   1 
ATOM   2238 O  O   . ASN C 1 52  ? 64.073 -9.407  115.439 1.00 31.38 ? 195 ASN D O   1 
ATOM   2239 C  CB  . ASN C 1 52  ? 63.727 -11.531 113.563 1.00 10.08 ? 195 ASN D CB  1 
ATOM   2240 C  CG  . ASN C 1 52  ? 64.340 -12.878 113.905 1.00 10.08 ? 195 ASN D CG  1 
ATOM   2241 O  OD1 . ASN C 1 52  ? 65.460 -13.181 113.488 1.00 10.08 ? 195 ASN D OD1 1 
ATOM   2242 N  ND2 . ASN C 1 52  ? 63.606 -13.696 114.656 1.00 10.08 ? 195 ASN D ND2 1 
ATOM   2243 N  N   . LEU C 1 53  ? 61.979 -8.797  114.942 1.00 20.38 ? 196 LEU D N   1 
ATOM   2244 C  CA  . LEU C 1 53  ? 62.225 -7.421  115.341 1.00 20.38 ? 196 LEU D CA  1 
ATOM   2245 C  C   . LEU C 1 53  ? 61.071 -6.876  116.162 1.00 20.38 ? 196 LEU D C   1 
ATOM   2246 O  O   . LEU C 1 53  ? 60.769 -5.692  116.102 1.00 20.38 ? 196 LEU D O   1 
ATOM   2247 C  CB  . LEU C 1 53  ? 62.444 -6.573  114.084 1.00 7.49  ? 196 LEU D CB  1 
ATOM   2248 C  CG  . LEU C 1 53  ? 63.403 -7.183  113.044 1.00 7.49  ? 196 LEU D CG  1 
ATOM   2249 C  CD1 . LEU C 1 53  ? 63.341 -6.410  111.737 1.00 7.49  ? 196 LEU D CD1 1 
ATOM   2250 C  CD2 . LEU C 1 53  ? 64.818 -7.205  113.598 1.00 7.49  ? 196 LEU D CD2 1 
ATOM   2251 N  N   . LYS C 1 54  ? 60.424 -7.757  116.918 1.00 22.11 ? 197 LYS D N   1 
ATOM   2252 C  CA  . LYS C 1 54  ? 59.298 -7.405  117.782 1.00 22.11 ? 197 LYS D CA  1 
ATOM   2253 C  C   . LYS C 1 54  ? 57.979 -6.944  117.129 1.00 22.11 ? 197 LYS D C   1 
ATOM   2254 O  O   . LYS C 1 54  ? 57.355 -5.999  117.619 1.00 22.11 ? 197 LYS D O   1 
ATOM   2255 C  CB  . LYS C 1 54  ? 59.717 -6.339  118.804 1.00 28.60 ? 197 LYS D CB  1 
ATOM   2256 C  CG  . LYS C 1 54  ? 60.773 -6.756  119.828 1.00 28.60 ? 197 LYS D CG  1 
ATOM   2257 C  CD  . LYS C 1 54  ? 60.694 -5.855  121.093 1.00 28.60 ? 197 LYS D CD  1 
ATOM   2258 C  CE  . LYS C 1 54  ? 60.698 -4.342  120.778 1.00 28.60 ? 197 LYS D CE  1 
ATOM   2259 N  NZ  . LYS C 1 54  ? 60.406 -3.500  121.979 1.00 28.60 ? 197 LYS D NZ  1 
ATOM   2260 N  N   . TYR C 1 55  ? 57.538 -7.604  116.056 1.00 7.25  ? 198 TYR D N   1 
ATOM   2261 C  CA  . TYR C 1 55  ? 56.282 -7.208  115.410 1.00 7.25  ? 198 TYR D CA  1 
ATOM   2262 C  C   . TYR C 1 55  ? 55.177 -8.239  115.497 1.00 7.25  ? 198 TYR D C   1 
ATOM   2263 O  O   . TYR C 1 55  ? 55.371 -9.412  115.181 1.00 7.25  ? 198 TYR D O   1 
ATOM   2264 C  CB  . TYR C 1 55  ? 56.486 -6.882  113.933 1.00 16.79 ? 198 TYR D CB  1 
ATOM   2265 C  CG  . TYR C 1 55  ? 56.970 -5.487  113.649 1.00 16.79 ? 198 TYR D CG  1 
ATOM   2266 C  CD1 . TYR C 1 55  ? 56.252 -4.642  112.808 1.00 16.79 ? 198 TYR D CD1 1 
ATOM   2267 C  CD2 . TYR C 1 55  ? 58.174 -5.033  114.167 1.00 16.79 ? 198 TYR D CD2 1 
ATOM   2268 C  CE1 . TYR C 1 55  ? 56.728 -3.382  112.485 1.00 16.79 ? 198 TYR D CE1 1 
ATOM   2269 C  CE2 . TYR C 1 55  ? 58.662 -3.777  113.850 1.00 16.79 ? 198 TYR D CE2 1 
ATOM   2270 C  CZ  . TYR C 1 55  ? 57.939 -2.955  113.008 1.00 16.79 ? 198 TYR D CZ  1 
ATOM   2271 O  OH  . TYR C 1 55  ? 58.453 -1.717  112.697 1.00 16.79 ? 198 TYR D OH  1 
ATOM   2272 N  N   . GLU C 1 56  ? 54.005 -7.800  115.924 1.00 20.29 ? 199 GLU D N   1 
ATOM   2273 C  CA  . GLU C 1 56  ? 52.882 -8.709  115.989 1.00 20.29 ? 199 GLU D CA  1 
ATOM   2274 C  C   . GLU C 1 56  ? 52.504 -8.923  114.538 1.00 20.29 ? 199 GLU D C   1 
ATOM   2275 O  O   . GLU C 1 56  ? 51.743 -8.136  113.977 1.00 20.29 ? 199 GLU D O   1 
ATOM   2276 C  CB  . GLU C 1 56  ? 51.701 -8.084  116.751 1.00 44.37 ? 199 GLU D CB  1 
ATOM   2277 C  CG  . GLU C 1 56  ? 51.728 -8.244  118.279 1.00 44.37 ? 199 GLU D CG  1 
ATOM   2278 C  CD  . GLU C 1 56  ? 53.070 -7.879  118.916 1.00 44.37 ? 199 GLU D CD  1 
ATOM   2279 O  OE1 . GLU C 1 56  ? 53.621 -6.798  118.610 1.00 44.37 ? 199 GLU D OE1 1 
ATOM   2280 O  OE2 . GLU C 1 56  ? 53.576 -8.673  119.737 1.00 44.37 ? 199 GLU D OE2 1 
ATOM   2281 N  N   . VAL C 1 57  ? 53.076 -9.948  113.912 1.00 7.03  ? 200 VAL D N   1 
ATOM   2282 C  CA  . VAL C 1 57  ? 52.738 -10.249 112.528 1.00 7.03  ? 200 VAL D CA  1 
ATOM   2283 C  C   . VAL C 1 57  ? 51.485 -11.117 112.523 1.00 7.03  ? 200 VAL D C   1 
ATOM   2284 O  O   . VAL C 1 57  ? 51.299 -11.944 113.411 1.00 7.03  ? 200 VAL D O   1 
ATOM   2285 C  CB  . VAL C 1 57  ? 53.887 -10.989 111.783 1.00 7.03  ? 200 VAL D CB  1 
ATOM   2286 C  CG1 . VAL C 1 57  ? 55.030 -10.035 111.512 1.00 7.03  ? 200 VAL D CG1 1 
ATOM   2287 C  CG2 . VAL C 1 57  ? 54.385 -12.158 112.603 1.00 7.03  ? 200 VAL D CG2 1 
ATOM   2288 N  N   . ARG C 1 58  ? 50.611 -10.890 111.549 1.00 25.58 ? 201 ARG D N   1 
ATOM   2289 C  CA  . ARG C 1 58  ? 49.373 -11.659 111.403 1.00 25.58 ? 201 ARG D CA  1 
ATOM   2290 C  C   . ARG C 1 58  ? 49.237 -11.945 109.903 1.00 25.58 ? 201 ARG D C   1 
ATOM   2291 O  O   . ARG C 1 58  ? 48.890 -11.048 109.138 1.00 25.58 ? 201 ARG D O   1 
ATOM   2292 C  CB  . ARG C 1 58  ? 48.144 -10.851 111.872 1.00 37.55 ? 201 ARG D CB  1 
ATOM   2293 C  CG  . ARG C 1 58  ? 47.980 -10.605 113.378 1.00 37.55 ? 201 ARG D CG  1 
ATOM   2294 C  CD  . ARG C 1 58  ? 49.012 -9.630  113.899 1.00 37.55 ? 201 ARG D CD  1 
ATOM   2295 N  NE  . ARG C 1 58  ? 48.638 -8.979  115.159 1.00 37.55 ? 201 ARG D NE  1 
ATOM   2296 C  CZ  . ARG C 1 58  ? 48.499 -9.601  116.328 1.00 37.55 ? 201 ARG D CZ  1 
ATOM   2297 N  NH1 . ARG C 1 58  ? 48.694 -10.917 116.418 1.00 37.55 ? 201 ARG D NH1 1 
ATOM   2298 N  NH2 . ARG C 1 58  ? 48.192 -8.895  117.413 1.00 37.55 ? 201 ARG D NH2 1 
ATOM   2299 N  N   . ASN C 1 59  ? 49.509 -13.174 109.474 1.00 7.08  ? 202 ASN D N   1 
ATOM   2300 C  CA  . ASN C 1 59  ? 49.423 -13.502 108.056 1.00 7.08  ? 202 ASN D CA  1 
ATOM   2301 C  C   . ASN C 1 59  ? 48.026 -13.963 107.663 1.00 7.08  ? 202 ASN D C   1 
ATOM   2302 O  O   . ASN C 1 59  ? 47.560 -14.981 108.152 1.00 7.08  ? 202 ASN D O   1 
ATOM   2303 C  CB  . ASN C 1 59  ? 50.410 -14.613 107.704 1.00 7.03  ? 202 ASN D CB  1 
ATOM   2304 C  CG  . ASN C 1 59  ? 51.805 -14.365 108.253 1.00 7.03  ? 202 ASN D CG  1 
ATOM   2305 O  OD1 . ASN C 1 59  ? 51.981 -14.142 109.448 1.00 7.03  ? 202 ASN D OD1 1 
ATOM   2306 N  ND2 . ASN C 1 59  ? 52.807 -14.423 107.378 1.00 7.03  ? 202 ASN D ND2 1 
ATOM   2307 N  N   . LYS C 1 60  ? 47.358 -13.212 106.790 1.00 7.03  ? 203 LYS D N   1 
ATOM   2308 C  CA  . LYS C 1 60  ? 46.023 -13.571 106.318 1.00 7.03  ? 203 LYS D CA  1 
ATOM   2309 C  C   . LYS C 1 60  ? 46.208 -13.900 104.864 1.00 7.03  ? 203 LYS D C   1 
ATOM   2310 O  O   . LYS C 1 60  ? 47.006 -13.255 104.203 1.00 7.03  ? 203 LYS D O   1 
ATOM   2311 C  CB  . LYS C 1 60  ? 45.044 -12.411 106.469 1.00 9.15  ? 203 LYS D CB  1 
ATOM   2312 C  CG  . LYS C 1 60  ? 44.413 -12.303 107.845 1.00 9.15  ? 203 LYS D CG  1 
ATOM   2313 C  CD  . LYS C 1 60  ? 45.464 -12.043 108.907 1.00 9.15  ? 203 LYS D CD  1 
ATOM   2314 C  CE  . LYS C 1 60  ? 45.212 -10.733 109.654 1.00 9.15  ? 203 LYS D CE  1 
ATOM   2315 N  NZ  . LYS C 1 60  ? 43.991 -10.746 110.530 1.00 9.15  ? 203 LYS D NZ  1 
ATOM   2316 N  N   . ASN C 1 61  ? 45.483 -14.896 104.363 1.00 12.88 ? 204 ASN D N   1 
ATOM   2317 C  CA  . ASN C 1 61  ? 45.644 -15.308 102.974 1.00 12.88 ? 204 ASN D CA  1 
ATOM   2318 C  C   . ASN C 1 61  ? 44.391 -15.235 102.143 1.00 12.88 ? 204 ASN D C   1 
ATOM   2319 O  O   . ASN C 1 61  ? 43.292 -15.152 102.671 1.00 12.88 ? 204 ASN D O   1 
ATOM   2320 C  CB  . ASN C 1 61  ? 46.164 -16.736 102.896 1.00 10.15 ? 204 ASN D CB  1 
ATOM   2321 C  CG  . ASN C 1 61  ? 47.444 -16.933 103.657 1.00 10.15 ? 204 ASN D CG  1 
ATOM   2322 O  OD1 . ASN C 1 61  ? 47.953 -18.048 103.747 1.00 10.15 ? 204 ASN D OD1 1 
ATOM   2323 N  ND2 . ASN C 1 61  ? 47.978 -15.854 104.214 1.00 10.15 ? 204 ASN D ND2 1 
ATOM   2324 N  N   . ASP C 1 62  ? 44.587 -15.303 100.831 1.00 16.99 ? 205 ASP D N   1 
ATOM   2325 C  CA  . ASP C 1 62  ? 43.514 -15.257 99.854  1.00 16.99 ? 205 ASP D CA  1 
ATOM   2326 C  C   . ASP C 1 62  ? 42.261 -14.539 100.319 1.00 16.99 ? 205 ASP D C   1 
ATOM   2327 O  O   . ASP C 1 62  ? 41.190 -15.137 100.422 1.00 16.99 ? 205 ASP D O   1 
ATOM   2328 C  CB  . ASP C 1 62  ? 43.168 -16.668 99.409  1.00 8.29  ? 205 ASP D CB  1 
ATOM   2329 C  CG  . ASP C 1 62  ? 44.311 -17.327 98.687  1.00 8.29  ? 205 ASP D CG  1 
ATOM   2330 O  OD1 . ASP C 1 62  ? 45.288 -17.721 99.354  1.00 8.29  ? 205 ASP D OD1 1 
ATOM   2331 O  OD2 . ASP C 1 62  ? 44.245 -17.429 97.446  1.00 8.29  ? 205 ASP D OD2 1 
ATOM   2332 N  N   . LEU C 1 63  ? 42.396 -13.249 100.597 1.00 7.52  ? 206 LEU D N   1 
ATOM   2333 C  CA  . LEU C 1 63  ? 41.267 -12.449 101.041 1.00 7.52  ? 206 LEU D CA  1 
ATOM   2334 C  C   . LEU C 1 63  ? 40.737 -11.783 99.781  1.00 7.52  ? 206 LEU D C   1 
ATOM   2335 O  O   . LEU C 1 63  ? 41.428 -11.756 98.763  1.00 7.52  ? 206 LEU D O   1 
ATOM   2336 C  CB  . LEU C 1 63  ? 41.727 -11.378 102.040 1.00 7.03  ? 206 LEU D CB  1 
ATOM   2337 C  CG  . LEU C 1 63  ? 42.801 -11.715 103.085 1.00 7.03  ? 206 LEU D CG  1 
ATOM   2338 C  CD1 . LEU C 1 63  ? 43.139 -10.483 103.872 1.00 7.03  ? 206 LEU D CD1 1 
ATOM   2339 C  CD2 . LEU C 1 63  ? 42.317 -12.797 104.011 1.00 7.03  ? 206 LEU D CD2 1 
ATOM   2340 N  N   . THR C 1 64  ? 39.519 -11.257 99.832  1.00 23.22 ? 207 THR D N   1 
ATOM   2341 C  CA  . THR C 1 64  ? 38.945 -10.580 98.672  1.00 23.22 ? 207 THR D CA  1 
ATOM   2342 C  C   . THR C 1 64  ? 39.073 -9.071  98.850  1.00 23.22 ? 207 THR D C   1 
ATOM   2343 O  O   . THR C 1 64  ? 39.338 -8.589  99.946  1.00 23.22 ? 207 THR D O   1 
ATOM   2344 C  CB  . THR C 1 64  ? 37.448 -10.921 98.493  1.00 7.34  ? 207 THR D CB  1 
ATOM   2345 O  OG1 . THR C 1 64  ? 36.713 -10.527 99.664  1.00 7.34  ? 207 THR D OG1 1 
ATOM   2346 C  CG2 . THR C 1 64  ? 37.276 -12.414 98.232  1.00 7.34  ? 207 THR D CG2 1 
ATOM   2347 N  N   . ARG C 1 65  ? 38.894 -8.325  97.771  1.00 7.03  ? 208 ARG D N   1 
ATOM   2348 C  CA  . ARG C 1 65  ? 38.973 -6.881  97.866  1.00 7.03  ? 208 ARG D CA  1 
ATOM   2349 C  C   . ARG C 1 65  ? 38.044 -6.444  98.979  1.00 7.03  ? 208 ARG D C   1 
ATOM   2350 O  O   . ARG C 1 65  ? 38.427 -5.640  99.821  1.00 7.03  ? 208 ARG D O   1 
ATOM   2351 C  CB  . ARG C 1 65  ? 38.548 -6.244  96.549  1.00 45.57 ? 208 ARG D CB  1 
ATOM   2352 C  CG  . ARG C 1 65  ? 37.220 -6.772  96.035  1.00 45.57 ? 208 ARG D CG  1 
ATOM   2353 C  CD  . ARG C 1 65  ? 36.954 -6.356  94.599  1.00 45.57 ? 208 ARG D CD  1 
ATOM   2354 N  NE  . ARG C 1 65  ? 36.803 -4.914  94.428  1.00 45.57 ? 208 ARG D NE  1 
ATOM   2355 C  CZ  . ARG C 1 65  ? 35.808 -4.194  94.944  1.00 45.57 ? 208 ARG D CZ  1 
ATOM   2356 N  NH1 . ARG C 1 65  ? 34.863 -4.776  95.683  1.00 45.57 ? 208 ARG D NH1 1 
ATOM   2357 N  NH2 . ARG C 1 65  ? 35.743 -2.885  94.701  1.00 45.57 ? 208 ARG D NH2 1 
ATOM   2358 N  N   . GLU C 1 66  ? 36.826 -6.988  98.985  1.00 29.74 ? 209 GLU D N   1 
ATOM   2359 C  CA  . GLU C 1 66  ? 35.832 -6.651  100.005 1.00 29.74 ? 209 GLU D CA  1 
ATOM   2360 C  C   . GLU C 1 66  ? 36.084 -7.508  101.221 1.00 29.74 ? 209 GLU D C   1 
ATOM   2361 O  O   . GLU C 1 66  ? 35.150 -8.000  101.847 1.00 29.74 ? 209 GLU D O   1 
ATOM   2362 C  CB  . GLU C 1 66  ? 34.395 -6.911  99.524  1.00 31.33 ? 209 GLU D CB  1 
ATOM   2363 C  CG  . GLU C 1 66  ? 34.143 -6.625  98.062  1.00 31.33 ? 209 GLU D CG  1 
ATOM   2364 C  CD  . GLU C 1 66  ? 34.089 -7.892  97.246  1.00 31.33 ? 209 GLU D CD  1 
ATOM   2365 O  OE1 . GLU C 1 66  ? 34.723 -8.887  97.662  1.00 31.33 ? 209 GLU D OE1 1 
ATOM   2366 O  OE2 . GLU C 1 66  ? 33.421 -7.886  96.193  1.00 31.33 ? 209 GLU D OE2 1 
ATOM   2367 N  N   . GLU C 1 67  ? 37.356 -7.703  101.533 1.00 7.42  ? 210 GLU D N   1 
ATOM   2368 C  CA  . GLU C 1 67  ? 37.758 -8.498  102.677 1.00 7.42  ? 210 GLU D CA  1 
ATOM   2369 C  C   . GLU C 1 67  ? 38.958 -7.767  103.207 1.00 7.42  ? 210 GLU D C   1 
ATOM   2370 O  O   . GLU C 1 67  ? 39.114 -7.582  104.407 1.00 7.42  ? 210 GLU D O   1 
ATOM   2371 C  CB  . GLU C 1 67  ? 38.170 -9.903  102.235 1.00 34.28 ? 210 GLU D CB  1 
ATOM   2372 C  CG  . GLU C 1 67  ? 37.304 -11.033 102.784 1.00 34.28 ? 210 GLU D CG  1 
ATOM   2373 C  CD  . GLU C 1 67  ? 37.859 -12.418 102.454 1.00 34.28 ? 210 GLU D CD  1 
ATOM   2374 O  OE1 . GLU C 1 67  ? 38.109 -12.698 101.257 1.00 34.28 ? 210 GLU D OE1 1 
ATOM   2375 O  OE2 . GLU C 1 67  ? 38.038 -13.229 103.396 1.00 34.28 ? 210 GLU D OE2 1 
ATOM   2376 N  N   . ILE C 1 68  ? 39.798 -7.343  102.273 1.00 25.61 ? 211 ILE D N   1 
ATOM   2377 C  CA  . ILE C 1 68  ? 41.018 -6.609  102.579 1.00 25.61 ? 211 ILE D CA  1 
ATOM   2378 C  C   . ILE C 1 68  ? 40.668 -5.265  103.207 1.00 25.61 ? 211 ILE D C   1 
ATOM   2379 O  O   . ILE C 1 68  ? 41.256 -4.863  104.213 1.00 25.61 ? 211 ILE D O   1 
ATOM   2380 C  CB  . ILE C 1 68  ? 41.871 -6.392  101.292 1.00 7.03  ? 211 ILE D CB  1 
ATOM   2381 C  CG1 . ILE C 1 68  ? 42.449 -7.728  100.821 1.00 7.03  ? 211 ILE D CG1 1 
ATOM   2382 C  CG2 . ILE C 1 68  ? 43.001 -5.438  101.557 1.00 7.03  ? 211 ILE D CG2 1 
ATOM   2383 C  CD1 . ILE C 1 68  ? 43.126 -7.672  99.472  1.00 7.03  ? 211 ILE D CD1 1 
ATOM   2384 N  N   . VAL C 1 69  ? 39.693 -4.580  102.625 1.00 32.34 ? 212 VAL D N   1 
ATOM   2385 C  CA  . VAL C 1 69  ? 39.283 -3.288  103.147 1.00 32.34 ? 212 VAL D CA  1 
ATOM   2386 C  C   . VAL C 1 69  ? 38.823 -3.426  104.598 1.00 32.34 ? 212 VAL D C   1 
ATOM   2387 O  O   . VAL C 1 69  ? 39.303 -2.713  105.480 1.00 32.34 ? 212 VAL D O   1 
ATOM   2388 C  CB  . VAL C 1 69  ? 38.161 -2.695  102.282 1.00 10.99 ? 212 VAL D CB  1 
ATOM   2389 C  CG1 . VAL C 1 69  ? 37.758 -1.314  102.797 1.00 10.99 ? 212 VAL D CG1 1 
ATOM   2390 C  CG2 . VAL C 1 69  ? 38.637 -2.618  100.836 1.00 10.99 ? 212 VAL D CG2 1 
ATOM   2391 N  N   . GLU C 1 70  ? 37.908 -4.353  104.850 1.00 7.03  ? 213 GLU D N   1 
ATOM   2392 C  CA  . GLU C 1 70  ? 37.411 -4.566  106.202 1.00 7.03  ? 213 GLU D CA  1 
ATOM   2393 C  C   . GLU C 1 70  ? 38.610 -4.701  107.107 1.00 7.03  ? 213 GLU D C   1 
ATOM   2394 O  O   . GLU C 1 70  ? 38.786 -3.944  108.054 1.00 7.03  ? 213 GLU D O   1 
ATOM   2395 C  CB  . GLU C 1 70  ? 36.584 -5.844  106.261 1.00 59.33 ? 213 GLU D CB  1 
ATOM   2396 C  CG  . GLU C 1 70  ? 35.801 -6.097  104.986 1.00 59.33 ? 213 GLU D CG  1 
ATOM   2397 C  CD  . GLU C 1 70  ? 35.158 -4.827  104.443 1.00 59.33 ? 213 GLU D CD  1 
ATOM   2398 O  OE1 . GLU C 1 70  ? 34.285 -4.258  105.140 1.00 59.33 ? 213 GLU D OE1 1 
ATOM   2399 O  OE2 . GLU C 1 70  ? 35.528 -4.397  103.325 1.00 59.33 ? 213 GLU D OE2 1 
ATOM   2400 N  N   . LEU C 1 71  ? 39.440 -5.683  106.798 1.00 7.03  ? 214 LEU D N   1 
ATOM   2401 C  CA  . LEU C 1 71  ? 40.632 -5.925  107.575 1.00 7.03  ? 214 LEU D CA  1 
ATOM   2402 C  C   . LEU C 1 71  ? 41.212 -4.578  107.948 1.00 7.03  ? 214 LEU D C   1 
ATOM   2403 O  O   . LEU C 1 71  ? 41.353 -4.243  109.125 1.00 7.03  ? 214 LEU D O   1 
ATOM   2404 C  CB  . LEU C 1 71  ? 41.626 -6.737  106.744 1.00 7.03  ? 214 LEU D CB  1 
ATOM   2405 C  CG  . LEU C 1 71  ? 43.066 -6.819  107.236 1.00 7.03  ? 214 LEU D CG  1 
ATOM   2406 C  CD1 . LEU C 1 71  ? 43.087 -7.004  108.729 1.00 7.03  ? 214 LEU D CD1 1 
ATOM   2407 C  CD2 . LEU C 1 71  ? 43.780 -7.948  106.533 1.00 7.03  ? 214 LEU D CD2 1 
ATOM   2408 N  N   . MET C 1 72  ? 41.516 -3.791  106.930 1.00 7.03  ? 215 MET D N   1 
ATOM   2409 C  CA  . MET C 1 72  ? 42.082 -2.478  107.152 1.00 7.03  ? 215 MET D CA  1 
ATOM   2410 C  C   . MET C 1 72  ? 41.197 -1.685  108.106 1.00 7.03  ? 215 MET D C   1 
ATOM   2411 O  O   . MET C 1 72  ? 41.577 -1.475  109.250 1.00 7.03  ? 215 MET D O   1 
ATOM   2412 C  CB  . MET C 1 72  ? 42.234 -1.745  105.819 1.00 30.17 ? 215 MET D CB  1 
ATOM   2413 C  CG  . MET C 1 72  ? 42.954 -2.555  104.739 1.00 30.17 ? 215 MET D CG  1 
ATOM   2414 S  SD  . MET C 1 72  ? 44.709 -2.860  105.025 1.00 30.17 ? 215 MET D SD  1 
ATOM   2415 C  CE  . MET C 1 72  ? 44.656 -4.166  106.238 1.00 30.17 ? 215 MET D CE  1 
ATOM   2416 N  N   . ARG C 1 73  ? 40.017 -1.270  107.648 1.00 7.03  ? 216 ARG D N   1 
ATOM   2417 C  CA  . ARG C 1 73  ? 39.095 -0.494  108.480 1.00 7.03  ? 216 ARG D CA  1 
ATOM   2418 C  C   . ARG C 1 73  ? 39.063 -1.045  109.900 1.00 7.03  ? 216 ARG D C   1 
ATOM   2419 O  O   . ARG C 1 73  ? 38.712 -0.345  110.840 1.00 7.03  ? 216 ARG D O   1 
ATOM   2420 C  CB  . ARG C 1 73  ? 37.661 -0.510  107.902 1.00 34.83 ? 216 ARG D CB  1 
ATOM   2421 C  CG  . ARG C 1 73  ? 36.728 -1.547  108.555 1.00 34.83 ? 216 ARG D CG  1 
ATOM   2422 C  CD  . ARG C 1 73  ? 35.247 -1.494  108.123 1.00 34.83 ? 216 ARG D CD  1 
ATOM   2423 N  NE  . ARG C 1 73  ? 35.024 -1.960  106.755 1.00 34.83 ? 216 ARG D NE  1 
ATOM   2424 C  CZ  . ARG C 1 73  ? 34.705 -1.162  105.738 1.00 34.83 ? 216 ARG D CZ  1 
ATOM   2425 N  NH1 . ARG C 1 73  ? 34.569 0.143   105.937 1.00 34.83 ? 216 ARG D NH1 1 
ATOM   2426 N  NH2 . ARG C 1 73  ? 34.527 -1.662  104.520 1.00 34.83 ? 216 ARG D NH2 1 
ATOM   2427 N  N   . ASP C 1 74  ? 39.423 -2.313  110.046 1.00 12.37 ? 217 ASP D N   1 
ATOM   2428 C  CA  . ASP C 1 74  ? 39.431 -2.960  111.344 1.00 12.37 ? 217 ASP D CA  1 
ATOM   2429 C  C   . ASP C 1 74  ? 40.729 -2.653  112.073 1.00 12.37 ? 217 ASP D C   1 
ATOM   2430 O  O   . ASP C 1 74  ? 40.734 -2.412  113.279 1.00 12.37 ? 217 ASP D O   1 
ATOM   2431 C  CB  . ASP C 1 74  ? 39.285 -4.467  111.157 1.00 29.56 ? 217 ASP D CB  1 
ATOM   2432 C  CG  . ASP C 1 74  ? 37.909 -4.967  111.515 1.00 29.56 ? 217 ASP D CG  1 
ATOM   2433 O  OD1 . ASP C 1 74  ? 36.913 -4.385  111.037 1.00 29.56 ? 217 ASP D OD1 1 
ATOM   2434 O  OD2 . ASP C 1 74  ? 37.825 -5.951  112.277 1.00 29.56 ? 217 ASP D OD2 1 
ATOM   2435 N  N   . VAL C 1 75  ? 41.829 -2.669  111.329 1.00 9.04  ? 218 VAL D N   1 
ATOM   2436 C  CA  . VAL C 1 75  ? 43.138 -2.399  111.891 1.00 9.04  ? 218 VAL D CA  1 
ATOM   2437 C  C   . VAL C 1 75  ? 43.297 -0.929  112.282 1.00 9.04  ? 218 VAL D C   1 
ATOM   2438 O  O   . VAL C 1 75  ? 43.779 -0.626  113.370 1.00 9.04  ? 218 VAL D O   1 
ATOM   2439 C  CB  . VAL C 1 75  ? 44.244 -2.785  110.899 1.00 7.28  ? 218 VAL D CB  1 
ATOM   2440 C  CG1 . VAL C 1 75  ? 45.608 -2.717  111.582 1.00 7.28  ? 218 VAL D CG1 1 
ATOM   2441 C  CG2 . VAL C 1 75  ? 43.978 -4.172  110.356 1.00 7.28  ? 218 VAL D CG2 1 
ATOM   2442 N  N   . SER C 1 76  ? 42.889 -0.020  111.400 1.00 30.93 ? 219 SER D N   1 
ATOM   2443 C  CA  . SER C 1 76  ? 42.988 1.423   111.654 1.00 30.93 ? 219 SER D CA  1 
ATOM   2444 C  C   . SER C 1 76  ? 42.137 1.877   112.848 1.00 30.93 ? 219 SER D C   1 
ATOM   2445 O  O   . SER C 1 76  ? 42.437 2.892   113.494 1.00 30.93 ? 219 SER D O   1 
ATOM   2446 C  CB  . SER C 1 76  ? 42.563 2.199   110.411 1.00 10.01 ? 219 SER D CB  1 
ATOM   2447 O  OG  . SER C 1 76  ? 41.225 1.887   110.064 1.00 10.01 ? 219 SER D OG  1 
ATOM   2448 N  N   . LYS C 1 77  ? 41.069 1.129   113.118 1.00 12.67 ? 220 LYS D N   1 
ATOM   2449 C  CA  . LYS C 1 77  ? 40.171 1.409   114.237 1.00 12.67 ? 220 LYS D CA  1 
ATOM   2450 C  C   . LYS C 1 77  ? 40.684 0.566   115.382 1.00 12.67 ? 220 LYS D C   1 
ATOM   2451 O  O   . LYS C 1 77  ? 40.032 -0.372  115.827 1.00 12.67 ? 220 LYS D O   1 
ATOM   2452 C  CB  . LYS C 1 77  ? 38.736 0.989   113.904 1.00 30.23 ? 220 LYS D CB  1 
ATOM   2453 C  CG  . LYS C 1 77  ? 38.086 1.771   112.781 1.00 30.23 ? 220 LYS D CG  1 
ATOM   2454 C  CD  . LYS C 1 77  ? 36.612 1.420   112.639 1.00 30.23 ? 220 LYS D CD  1 
ATOM   2455 C  CE  . LYS C 1 77  ? 35.920 2.419   111.722 1.00 30.23 ? 220 LYS D CE  1 
ATOM   2456 N  NZ  . LYS C 1 77  ? 36.167 3.837   112.165 1.00 30.23 ? 220 LYS D NZ  1 
ATOM   2457 N  N   . GLU C 1 78  ? 41.858 0.907   115.871 1.00 17.59 ? 221 GLU D N   1 
ATOM   2458 C  CA  . GLU C 1 78  ? 42.443 0.119   116.924 1.00 17.59 ? 221 GLU D CA  1 
ATOM   2459 C  C   . GLU C 1 78  ? 43.366 0.988   117.741 1.00 17.59 ? 221 GLU D C   1 
ATOM   2460 O  O   . GLU C 1 78  ? 43.964 1.934   117.217 1.00 17.59 ? 221 GLU D O   1 
ATOM   2461 C  CB  . GLU C 1 78  ? 43.237 -1.000  116.277 1.00 7.03  ? 221 GLU D CB  1 
ATOM   2462 C  CG  . GLU C 1 78  ? 43.203 -2.300  116.999 1.00 7.03  ? 221 GLU D CG  1 
ATOM   2463 C  CD  . GLU C 1 78  ? 43.778 -3.391  116.153 1.00 7.03  ? 221 GLU D CD  1 
ATOM   2464 O  OE1 . GLU C 1 78  ? 44.958 -3.281  115.776 1.00 7.03  ? 221 GLU D OE1 1 
ATOM   2465 O  OE2 . GLU C 1 78  ? 43.048 -4.348  115.849 1.00 7.03  ? 221 GLU D OE2 1 
ATOM   2466 N  N   . ASP C 1 79  ? 43.486 0.674   119.024 1.00 17.98 ? 222 ASP D N   1 
ATOM   2467 C  CA  . ASP C 1 79  ? 44.377 1.446   119.862 1.00 17.98 ? 222 ASP D CA  1 
ATOM   2468 C  C   . ASP C 1 79  ? 45.788 1.044   119.486 1.00 17.98 ? 222 ASP D C   1 
ATOM   2469 O  O   . ASP C 1 79  ? 46.158 -0.123  119.590 1.00 17.98 ? 222 ASP D O   1 
ATOM   2470 C  CB  . ASP C 1 79  ? 44.129 1.176   121.345 1.00 21.39 ? 222 ASP D CB  1 
ATOM   2471 C  CG  . ASP C 1 79  ? 44.964 2.073   122.235 1.00 21.39 ? 222 ASP D CG  1 
ATOM   2472 O  OD1 . ASP C 1 79  ? 45.240 3.208   121.794 1.00 21.39 ? 222 ASP D OD1 1 
ATOM   2473 O  OD2 . ASP C 1 79  ? 45.331 1.662   123.361 1.00 21.39 ? 222 ASP D OD2 1 
ATOM   2474 N  N   . HIS C 1 80  ? 46.549 2.017   118.999 1.00 11.59 ? 224 HIS D N   1 
ATOM   2475 C  CA  . HIS C 1 80  ? 47.937 1.819   118.603 1.00 11.59 ? 224 HIS D CA  1 
ATOM   2476 C  C   . HIS C 1 80  ? 48.674 2.860   119.426 1.00 11.59 ? 224 HIS D C   1 
ATOM   2477 O  O   . HIS C 1 80  ? 49.830 3.197   119.161 1.00 11.59 ? 224 HIS D O   1 
ATOM   2478 C  CB  . HIS C 1 80  ? 48.124 2.131   117.116 1.00 22.05 ? 224 HIS D CB  1 
ATOM   2479 C  CG  . HIS C 1 80  ? 47.355 1.232   116.198 1.00 22.05 ? 224 HIS D CG  1 
ATOM   2480 N  ND1 . HIS C 1 80  ? 47.732 -0.069  115.939 1.00 22.05 ? 224 HIS D ND1 1 
ATOM   2481 C  CD2 . HIS C 1 80  ? 46.244 1.455   115.459 1.00 22.05 ? 224 HIS D CD2 1 
ATOM   2482 C  CE1 . HIS C 1 80  ? 46.887 -0.605  115.076 1.00 22.05 ? 224 HIS D CE1 1 
ATOM   2483 N  NE2 . HIS C 1 80  ? 45.975 0.300   114.769 1.00 22.05 ? 224 HIS D NE2 1 
ATOM   2484 N  N   . SER C 1 81  ? 47.976 3.376   120.431 1.00 8.55  ? 225 SER D N   1 
ATOM   2485 C  CA  . SER C 1 81  ? 48.522 4.408   121.288 1.00 8.55  ? 225 SER D CA  1 
ATOM   2486 C  C   . SER C 1 81  ? 49.911 4.104   121.787 1.00 8.55  ? 225 SER D C   1 
ATOM   2487 O  O   . SER C 1 81  ? 50.754 4.993   121.839 1.00 8.55  ? 225 SER D O   1 
ATOM   2488 C  CB  . SER C 1 81  ? 47.590 4.647   122.471 1.00 7.03  ? 225 SER D CB  1 
ATOM   2489 O  OG  . SER C 1 81  ? 46.366 5.204   122.024 1.00 7.03  ? 225 SER D OG  1 
ATOM   2490 N  N   . LYS C 1 82  ? 50.146 2.839   122.120 1.00 10.03 ? 226 LYS D N   1 
ATOM   2491 C  CA  . LYS C 1 82  ? 51.429 2.399   122.660 1.00 10.03 ? 226 LYS D CA  1 
ATOM   2492 C  C   . LYS C 1 82  ? 52.360 1.644   121.706 1.00 10.03 ? 226 LYS D C   1 
ATOM   2493 O  O   . LYS C 1 82  ? 53.257 0.944   122.160 1.00 10.03 ? 226 LYS D O   1 
ATOM   2494 C  CB  . LYS C 1 82  ? 51.162 1.523   123.877 1.00 32.26 ? 226 LYS D CB  1 
ATOM   2495 C  CG  . LYS C 1 82  ? 50.397 2.218   125.006 1.00 32.26 ? 226 LYS D CG  1 
ATOM   2496 C  CD  . LYS C 1 82  ? 49.310 1.309   125.587 1.00 32.26 ? 226 LYS D CD  1 
ATOM   2497 C  CE  . LYS C 1 82  ? 49.766 -0.144  125.705 1.00 32.26 ? 226 LYS D CE  1 
ATOM   2498 N  NZ  . LYS C 1 82  ? 51.012 -0.299  126.506 1.00 32.26 ? 226 LYS D NZ  1 
ATOM   2499 N  N   . ARG C 1 83  ? 52.171 1.810   120.398 1.00 17.51 ? 227 ARG D N   1 
ATOM   2500 C  CA  . ARG C 1 83  ? 52.977 1.110   119.390 1.00 17.51 ? 227 ARG D CA  1 
ATOM   2501 C  C   . ARG C 1 83  ? 53.830 2.042   118.492 1.00 17.51 ? 227 ARG D C   1 
ATOM   2502 O  O   . ARG C 1 83  ? 53.351 3.063   118.014 1.00 17.51 ? 227 ARG D O   1 
ATOM   2503 C  CB  . ARG C 1 83  ? 52.025 0.247   118.546 1.00 44.81 ? 227 ARG D CB  1 
ATOM   2504 C  CG  . ARG C 1 83  ? 52.677 -0.790  117.653 1.00 44.81 ? 227 ARG D CG  1 
ATOM   2505 C  CD  . ARG C 1 83  ? 51.632 -1.762  117.068 1.00 44.81 ? 227 ARG D CD  1 
ATOM   2506 N  NE  . ARG C 1 83  ? 50.672 -1.123  116.158 1.00 44.81 ? 227 ARG D NE  1 
ATOM   2507 C  CZ  . ARG C 1 83  ? 50.811 -1.031  114.835 1.00 44.81 ? 227 ARG D CZ  1 
ATOM   2508 N  NH1 . ARG C 1 83  ? 51.872 -1.535  114.231 1.00 44.81 ? 227 ARG D NH1 1 
ATOM   2509 N  NH2 . ARG C 1 83  ? 49.874 -0.438  114.113 1.00 44.81 ? 227 ARG D NH2 1 
ATOM   2510 N  N   . SER C 1 84  ? 55.090 1.671   118.260 1.00 30.21 ? 228 SER D N   1 
ATOM   2511 C  CA  . SER C 1 84  ? 56.031 2.474   117.463 1.00 30.21 ? 228 SER D CA  1 
ATOM   2512 C  C   . SER C 1 84  ? 55.950 2.505   115.933 1.00 30.21 ? 228 SER D C   1 
ATOM   2513 O  O   . SER C 1 84  ? 56.763 3.188   115.299 1.00 30.21 ? 228 SER D O   1 
ATOM   2514 C  CB  . SER C 1 84  ? 57.473 2.103   117.825 1.00 17.71 ? 228 SER D CB  1 
ATOM   2515 O  OG  . SER C 1 84  ? 57.935 2.863   118.916 1.00 17.71 ? 228 SER D OG  1 
ATOM   2516 N  N   . SER C 1 85  ? 55.017 1.782   115.323 1.00 10.69 ? 229 SER D N   1 
ATOM   2517 C  CA  . SER C 1 85  ? 54.939 1.805   113.866 1.00 10.69 ? 229 SER D CA  1 
ATOM   2518 C  C   . SER C 1 85  ? 53.864 0.894   113.323 1.00 10.69 ? 229 SER D C   1 
ATOM   2519 O  O   . SER C 1 85  ? 53.088 0.332   114.084 1.00 10.69 ? 229 SER D O   1 
ATOM   2520 C  CB  . SER C 1 85  ? 56.287 1.409   113.278 1.00 7.03  ? 229 SER D CB  1 
ATOM   2521 O  OG  . SER C 1 85  ? 56.834 0.327   114.003 1.00 7.03  ? 229 SER D OG  1 
ATOM   2522 N  N   . PHE C 1 86  ? 53.813 0.758   112.003 1.00 7.44  ? 230 PHE D N   1 
ATOM   2523 C  CA  . PHE C 1 86  ? 52.837 -0.111  111.362 1.00 7.44  ? 230 PHE D CA  1 
ATOM   2524 C  C   . PHE C 1 86  ? 53.334 -0.540  109.999 1.00 7.44  ? 230 PHE D C   1 
ATOM   2525 O  O   . PHE C 1 86  ? 53.319 0.259   109.071 1.00 7.44  ? 230 PHE D O   1 
ATOM   2526 C  CB  . PHE C 1 86  ? 51.500 0.603   111.188 1.00 7.64  ? 230 PHE D CB  1 
ATOM   2527 C  CG  . PHE C 1 86  ? 50.485 -0.179  110.383 1.00 7.64  ? 230 PHE D CG  1 
ATOM   2528 C  CD1 . PHE C 1 86  ? 49.845 -1.285  110.925 1.00 7.64  ? 230 PHE D CD1 1 
ATOM   2529 C  CD2 . PHE C 1 86  ? 50.162 0.203   109.081 1.00 7.64  ? 230 PHE D CD2 1 
ATOM   2530 C  CE1 . PHE C 1 86  ? 48.903 -1.992  110.188 1.00 7.64  ? 230 PHE D CE1 1 
ATOM   2531 C  CE2 . PHE C 1 86  ? 49.222 -0.502  108.341 1.00 7.64  ? 230 PHE D CE2 1 
ATOM   2532 C  CZ  . PHE C 1 86  ? 48.595 -1.596  108.894 1.00 7.64  ? 230 PHE D CZ  1 
ATOM   2533 N  N   . VAL C 1 87  ? 53.784 -1.790  109.882 1.00 9.29  ? 231 VAL D N   1 
ATOM   2534 C  CA  . VAL C 1 87  ? 54.253 -2.333  108.602 1.00 9.29  ? 231 VAL D CA  1 
ATOM   2535 C  C   . VAL C 1 87  ? 53.120 -3.114  107.939 1.00 9.29  ? 231 VAL D C   1 
ATOM   2536 O  O   . VAL C 1 87  ? 52.495 -3.949  108.588 1.00 9.29  ? 231 VAL D O   1 
ATOM   2537 C  CB  . VAL C 1 87  ? 55.438 -3.295  108.787 1.00 7.03  ? 231 VAL D CB  1 
ATOM   2538 C  CG1 . VAL C 1 87  ? 55.728 -4.018  107.480 1.00 7.03  ? 231 VAL D CG1 1 
ATOM   2539 C  CG2 . VAL C 1 87  ? 56.654 -2.526  109.236 1.00 7.03  ? 231 VAL D CG2 1 
ATOM   2540 N  N   . CYS C 1 88  ? 52.840 -2.843  106.666 1.00 7.27  ? 232 CYS D N   1 
ATOM   2541 C  CA  . CYS C 1 88  ? 51.768 -3.572  105.996 1.00 7.27  ? 232 CYS D CA  1 
ATOM   2542 C  C   . CYS C 1 88  ? 52.092 -4.207  104.662 1.00 7.27  ? 232 CYS D C   1 
ATOM   2543 O  O   . CYS C 1 88  ? 51.674 -3.733  103.598 1.00 7.27  ? 232 CYS D O   1 
ATOM   2544 C  CB  . CYS C 1 88  ? 50.517 -2.722  105.808 1.00 8.58  ? 232 CYS D CB  1 
ATOM   2545 S  SG  . CYS C 1 88  ? 49.276 -3.662  104.861 1.00 8.58  ? 232 CYS D SG  1 
ATOM   2546 N  N   . VAL C 1 89  ? 52.817 -5.311  104.737 1.00 26.18 ? 233 VAL D N   1 
ATOM   2547 C  CA  . VAL C 1 89  ? 53.192 -6.052  103.550 1.00 26.18 ? 233 VAL D CA  1 
ATOM   2548 C  C   . VAL C 1 89  ? 51.944 -6.530  102.807 1.00 26.18 ? 233 VAL D C   1 
ATOM   2549 O  O   . VAL C 1 89  ? 50.940 -6.923  103.410 1.00 26.18 ? 233 VAL D O   1 
ATOM   2550 C  CB  . VAL C 1 89  ? 54.034 -7.269  103.928 1.00 7.03  ? 233 VAL D CB  1 
ATOM   2551 C  CG1 . VAL C 1 89  ? 54.440 -8.037  102.676 1.00 7.03  ? 233 VAL D CG1 1 
ATOM   2552 C  CG2 . VAL C 1 89  ? 55.231 -6.825  104.743 1.00 7.03  ? 233 VAL D CG2 1 
ATOM   2553 N  N   . LEU C 1 90  ? 52.022 -6.456  101.486 1.00 20.90 ? 234 LEU D N   1 
ATOM   2554 C  CA  . LEU C 1 90  ? 50.956 -6.892  100.609 1.00 20.90 ? 234 LEU D CA  1 
ATOM   2555 C  C   . LEU C 1 90  ? 51.622 -7.819  99.630  1.00 20.90 ? 234 LEU D C   1 
ATOM   2556 O  O   . LEU C 1 90  ? 52.806 -7.658  99.321  1.00 20.90 ? 234 LEU D O   1 
ATOM   2557 C  CB  . LEU C 1 90  ? 50.358 -5.724  99.831  1.00 7.03  ? 234 LEU D CB  1 
ATOM   2558 C  CG  . LEU C 1 90  ? 49.352 -4.841  100.542 1.00 7.03  ? 234 LEU D CG  1 
ATOM   2559 C  CD1 . LEU C 1 90  ? 48.942 -3.729  99.608  1.00 7.03  ? 234 LEU D CD1 1 
ATOM   2560 C  CD2 . LEU C 1 90  ? 48.153 -5.663  100.952 1.00 7.03  ? 234 LEU D CD2 1 
ATOM   2561 N  N   . LEU C 1 91  ? 50.864 -8.792  99.145  1.00 7.03  ? 235 LEU D N   1 
ATOM   2562 C  CA  . LEU C 1 91  ? 51.377 -9.735  98.177  1.00 7.03  ? 235 LEU D CA  1 
ATOM   2563 C  C   . LEU C 1 91  ? 50.199 -10.118 97.318  1.00 7.03  ? 235 LEU D C   1 
ATOM   2564 O  O   . LEU C 1 91  ? 49.198 -10.609 97.812  1.00 7.03  ? 235 LEU D O   1 
ATOM   2565 C  CB  . LEU C 1 91  ? 51.968 -10.950 98.887  1.00 7.39  ? 235 LEU D CB  1 
ATOM   2566 C  CG  . LEU C 1 91  ? 53.256 -10.679 99.671  1.00 7.39  ? 235 LEU D CG  1 
ATOM   2567 C  CD1 . LEU C 1 91  ? 53.661 -11.925 100.424 1.00 7.39  ? 235 LEU D CD1 1 
ATOM   2568 C  CD2 . LEU C 1 91  ? 54.364 -10.250 98.732  1.00 7.39  ? 235 LEU D CD2 1 
ATOM   2569 N  N   . SER C 1 92  ? 50.326 -9.880  96.024  1.00 7.03  ? 236 SER D N   1 
ATOM   2570 C  CA  . SER C 1 92  ? 49.246 -10.165 95.107  1.00 7.03  ? 236 SER D CA  1 
ATOM   2571 C  C   . SER C 1 92  ? 49.684 -9.783  93.696  1.00 7.03  ? 236 SER D C   1 
ATOM   2572 O  O   . SER C 1 92  ? 50.883 -9.697  93.414  1.00 7.03  ? 236 SER D O   1 
ATOM   2573 C  CB  . SER C 1 92  ? 48.029 -9.348  95.530  1.00 8.87  ? 236 SER D CB  1 
ATOM   2574 O  OG  . SER C 1 92  ? 46.906 -9.648  94.736  1.00 8.87  ? 236 SER D OG  1 
ATOM   2575 N  N   . HIS C 1 93  ? 48.718 -9.569  92.808  1.00 9.50  ? 237 HIS D N   1 
ATOM   2576 C  CA  . HIS C 1 93  ? 49.016 -9.164  91.439  1.00 9.50  ? 237 HIS D CA  1 
ATOM   2577 C  C   . HIS C 1 93  ? 48.559 -7.739  91.357  1.00 9.50  ? 237 HIS D C   1 
ATOM   2578 O  O   . HIS C 1 93  ? 48.262 -7.146  92.383  1.00 9.50  ? 237 HIS D O   1 
ATOM   2579 C  CB  . HIS C 1 93  ? 48.227 -9.992  90.425  1.00 11.27 ? 237 HIS D CB  1 
ATOM   2580 C  CG  . HIS C 1 93  ? 48.764 -11.372 90.221  1.00 11.27 ? 237 HIS D CG  1 
ATOM   2581 N  ND1 . HIS C 1 93  ? 49.301 -11.793 89.023  1.00 11.27 ? 237 HIS D ND1 1 
ATOM   2582 C  CD2 . HIS C 1 93  ? 48.856 -12.423 91.064  1.00 11.27 ? 237 HIS D CD2 1 
ATOM   2583 C  CE1 . HIS C 1 93  ? 49.701 -13.047 89.138  1.00 11.27 ? 237 HIS D CE1 1 
ATOM   2584 N  NE2 . HIS C 1 93  ? 49.442 -13.453 90.368  1.00 11.27 ? 237 HIS D NE2 1 
ATOM   2585 N  N   . GLY C 1 94  ? 48.497 -7.181  90.150  1.00 41.02 ? 238 GLY D N   1 
ATOM   2586 C  CA  . GLY C 1 94  ? 48.039 -5.808  90.033  1.00 41.02 ? 238 GLY D CA  1 
ATOM   2587 C  C   . GLY C 1 94  ? 48.427 -4.953  88.838  1.00 41.02 ? 238 GLY D C   1 
ATOM   2588 O  O   . GLY C 1 94  ? 49.274 -5.299  88.009  1.00 41.02 ? 238 GLY D O   1 
ATOM   2589 N  N   . GLU C 1 95  ? 47.760 -3.811  88.769  1.00 7.03  ? 239 GLU D N   1 
ATOM   2590 C  CA  . GLU C 1 95  ? 47.978 -2.820  87.740  1.00 7.03  ? 239 GLU D CA  1 
ATOM   2591 C  C   . GLU C 1 95  ? 48.404 -1.625  88.570  1.00 7.03  ? 239 GLU D C   1 
ATOM   2592 O  O   . GLU C 1 95  ? 48.304 -1.663  89.795  1.00 7.03  ? 239 GLU D O   1 
ATOM   2593 C  CB  . GLU C 1 95  ? 46.664 -2.510  87.031  1.00 32.95 ? 239 GLU D CB  1 
ATOM   2594 C  CG  . GLU C 1 95  ? 45.977 -3.726  86.432  1.00 32.95 ? 239 GLU D CG  1 
ATOM   2595 C  CD  . GLU C 1 95  ? 44.517 -3.477  86.084  1.00 32.95 ? 239 GLU D CD  1 
ATOM   2596 O  OE1 . GLU C 1 95  ? 43.689 -3.336  87.015  1.00 32.95 ? 239 GLU D OE1 1 
ATOM   2597 O  OE2 . GLU C 1 95  ? 44.197 -3.421  84.876  1.00 32.95 ? 239 GLU D OE2 1 
ATOM   2598 N  N   . GLU C 1 96  ? 48.873 -0.569  87.914  1.00 10.95 ? 240 GLU D N   1 
ATOM   2599 C  CA  . GLU C 1 96  ? 49.292 0.641   88.613  1.00 10.95 ? 240 GLU D CA  1 
ATOM   2600 C  C   . GLU C 1 96  ? 48.207 1.140   89.575  1.00 10.95 ? 240 GLU D C   1 
ATOM   2601 O  O   . GLU C 1 96  ? 47.033 1.185   89.224  1.00 10.95 ? 240 GLU D O   1 
ATOM   2602 C  CB  . GLU C 1 96  ? 49.616 1.736   87.597  1.00 27.79 ? 240 GLU D CB  1 
ATOM   2603 C  CG  . GLU C 1 96  ? 50.235 2.957   88.229  1.00 27.79 ? 240 GLU D CG  1 
ATOM   2604 C  CD  . GLU C 1 96  ? 51.541 2.633   88.939  1.00 27.79 ? 240 GLU D CD  1 
ATOM   2605 O  OE1 . GLU C 1 96  ? 52.567 2.482   88.244  1.00 27.79 ? 240 GLU D OE1 1 
ATOM   2606 O  OE2 . GLU C 1 96  ? 51.543 2.516   90.185  1.00 27.79 ? 240 GLU D OE2 1 
ATOM   2607 N  N   . GLY C 1 97  ? 48.595 1.514   90.787  1.00 7.13  ? 241 GLY D N   1 
ATOM   2608 C  CA  . GLY C 1 97  ? 47.613 1.995   91.745  1.00 7.13  ? 241 GLY D CA  1 
ATOM   2609 C  C   . GLY C 1 97  ? 46.638 0.932   92.232  1.00 7.13  ? 241 GLY D C   1 
ATOM   2610 O  O   . GLY C 1 97  ? 46.195 0.975   93.377  1.00 7.13  ? 241 GLY D O   1 
ATOM   2611 N  N   . ILE C 1 98  ? 46.300 -0.020  91.369  1.00 23.06 ? 242 ILE D N   1 
ATOM   2612 C  CA  . ILE C 1 98  ? 45.383 -1.103  91.729  1.00 23.06 ? 242 ILE D CA  1 
ATOM   2613 C  C   . ILE C 1 98  ? 46.053 -2.108  92.692  1.00 23.06 ? 242 ILE D C   1 
ATOM   2614 O  O   . ILE C 1 98  ? 47.204 -1.929  93.087  1.00 23.06 ? 242 ILE D O   1 
ATOM   2615 C  CB  . ILE C 1 98  ? 44.908 -1.862  90.458  1.00 15.18 ? 242 ILE D CB  1 
ATOM   2616 C  CG1 . ILE C 1 98  ? 44.302 -0.887  89.452  1.00 15.18 ? 242 ILE D CG1 1 
ATOM   2617 C  CG2 . ILE C 1 98  ? 43.830 -2.864  90.815  1.00 15.18 ? 242 ILE D CG2 1 
ATOM   2618 C  CD1 . ILE C 1 98  ? 43.002 -0.274  89.921  1.00 15.18 ? 242 ILE D CD1 1 
ATOM   2619 N  N   . ILE C 1 99  ? 45.322 -3.153  93.072  1.00 9.56  ? 243 ILE D N   1 
ATOM   2620 C  CA  . ILE C 1 99  ? 45.806 -4.204  93.968  1.00 9.56  ? 243 ILE D CA  1 
ATOM   2621 C  C   . ILE C 1 99  ? 44.709 -5.266  93.965  1.00 9.56  ? 243 ILE D C   1 
ATOM   2622 O  O   . ILE C 1 99  ? 43.548 -4.964  94.210  1.00 9.56  ? 243 ILE D O   1 
ATOM   2623 C  CB  . ILE C 1 99  ? 46.050 -3.652  95.396  1.00 18.80 ? 243 ILE D CB  1 
ATOM   2624 C  CG1 . ILE C 1 99  ? 46.089 -4.787  96.421  1.00 18.80 ? 243 ILE D CG1 1 
ATOM   2625 C  CG2 . ILE C 1 99  ? 45.001 -2.624  95.746  1.00 18.80 ? 243 ILE D CG2 1 
ATOM   2626 C  CD1 . ILE C 1 99  ? 47.402 -5.536  96.460  1.00 18.80 ? 243 ILE D CD1 1 
ATOM   2627 N  N   . PHE C 1 100 ? 45.071 -6.509  93.675  1.00 21.74 ? 244 PHE D N   1 
ATOM   2628 C  CA  . PHE C 1 100 ? 44.078 -7.567  93.588  1.00 21.74 ? 244 PHE D CA  1 
ATOM   2629 C  C   . PHE C 1 100 ? 43.663 -8.393  94.812  1.00 21.74 ? 244 PHE D C   1 
ATOM   2630 O  O   . PHE C 1 100 ? 44.494 -8.849  95.602  1.00 21.74 ? 244 PHE D O   1 
ATOM   2631 C  CB  . PHE C 1 100 ? 44.476 -8.527  92.469  1.00 16.47 ? 244 PHE D CB  1 
ATOM   2632 C  CG  . PHE C 1 100 ? 44.107 -8.046  91.104  1.00 16.47 ? 244 PHE D CG  1 
ATOM   2633 C  CD1 . PHE C 1 100 ? 44.982 -7.291  90.345  1.00 16.47 ? 244 PHE D CD1 1 
ATOM   2634 C  CD2 . PHE C 1 100 ? 42.860 -8.344  90.582  1.00 16.47 ? 244 PHE D CD2 1 
ATOM   2635 C  CE1 . PHE C 1 100 ? 44.615 -6.839  89.073  1.00 16.47 ? 244 PHE D CE1 1 
ATOM   2636 C  CE2 . PHE C 1 100 ? 42.484 -7.899  89.317  1.00 16.47 ? 244 PHE D CE2 1 
ATOM   2637 C  CZ  . PHE C 1 100 ? 43.357 -7.150  88.563  1.00 16.47 ? 244 PHE D CZ  1 
ATOM   2638 N  N   . GLY C 1 101 ? 42.352 -8.585  94.933  1.00 12.07 ? 245 GLY D N   1 
ATOM   2639 C  CA  . GLY C 1 101 ? 41.789 -9.398  95.991  1.00 12.07 ? 245 GLY D CA  1 
ATOM   2640 C  C   . GLY C 1 101 ? 41.503 -10.708 95.293  1.00 12.07 ? 245 GLY D C   1 
ATOM   2641 O  O   . GLY C 1 101 ? 41.820 -10.831 94.113  1.00 12.07 ? 245 GLY D O   1 
ATOM   2642 N  N   . THR C 1 102 ? 40.916 -11.680 95.988  1.00 61.48 ? 246 THR D N   1 
ATOM   2643 C  CA  . THR C 1 102 ? 40.633 -12.976 95.365  1.00 61.48 ? 246 THR D CA  1 
ATOM   2644 C  C   . THR C 1 102 ? 39.316 -13.029 94.580  1.00 61.48 ? 246 THR D C   1 
ATOM   2645 O  O   . THR C 1 102 ? 38.676 -14.087 94.494  1.00 61.48 ? 246 THR D O   1 
ATOM   2646 C  CB  . THR C 1 102 ? 40.637 -14.124 96.413  1.00 19.74 ? 246 THR D CB  1 
ATOM   2647 O  OG1 . THR C 1 102 ? 39.736 -13.808 97.485  1.00 19.74 ? 246 THR D OG1 1 
ATOM   2648 C  CG2 . THR C 1 102 ? 42.046 -14.346 96.959  1.00 19.74 ? 246 THR D CG2 1 
ATOM   2649 N  N   . ASN C 1 103 ? 38.906 -11.891 94.018  1.00 17.08 ? 247 ASN D N   1 
ATOM   2650 C  CA  . ASN C 1 103 ? 37.688 -11.811 93.209  1.00 17.08 ? 247 ASN D CA  1 
ATOM   2651 C  C   . ASN C 1 103 ? 37.863 -10.736 92.150  1.00 17.08 ? 247 ASN D C   1 
ATOM   2652 O  O   . ASN C 1 103 ? 37.384 -10.869 91.027  1.00 17.08 ? 247 ASN D O   1 
ATOM   2653 C  CB  . ASN C 1 103 ? 36.442 -11.514 94.065  1.00 7.99  ? 247 ASN D CB  1 
ATOM   2654 C  CG  . ASN C 1 103 ? 36.667 -10.402 95.072  1.00 7.99  ? 247 ASN D CG  1 
ATOM   2655 O  OD1 . ASN C 1 103 ? 37.596 -9.610  94.940  1.00 7.99  ? 247 ASN D OD1 1 
ATOM   2656 N  ND2 . ASN C 1 103 ? 35.801 -10.330 96.078  1.00 7.99  ? 247 ASN D ND2 1 
ATOM   2657 N  N   . GLY C 1 104 ? 38.572 -9.673  92.503  1.00 29.24 ? 254 GLY D N   1 
ATOM   2658 C  CA  . GLY C 1 104 ? 38.790 -8.604  91.552  1.00 29.24 ? 254 GLY D CA  1 
ATOM   2659 C  C   . GLY C 1 104 ? 39.653 -7.493  92.115  1.00 29.24 ? 254 GLY D C   1 
ATOM   2660 O  O   . GLY C 1 104 ? 40.024 -7.523  93.286  1.00 29.24 ? 254 GLY D O   1 
ATOM   2661 N  N   . PRO C 1 105 ? 39.962 -6.475  91.304  1.00 8.70  ? 255 PRO D N   1 
ATOM   2662 C  CA  . PRO C 1 105 ? 40.790 -5.345  91.716  1.00 8.70  ? 255 PRO D CA  1 
ATOM   2663 C  C   . PRO C 1 105 ? 40.252 -4.506  92.856  1.00 8.70  ? 255 PRO D C   1 
ATOM   2664 O  O   . PRO C 1 105 ? 39.094 -4.612  93.250  1.00 8.70  ? 255 PRO D O   1 
ATOM   2665 C  CB  . PRO C 1 105 ? 40.902 -4.534  90.439  1.00 11.69 ? 255 PRO D CB  1 
ATOM   2666 C  CG  . PRO C 1 105 ? 39.570 -4.746  89.811  1.00 11.69 ? 255 PRO D CG  1 
ATOM   2667 C  CD  . PRO C 1 105 ? 39.404 -6.236  89.963  1.00 11.69 ? 255 PRO D CD  1 
ATOM   2668 N  N   . VAL C 1 106 ? 41.140 -3.681  93.387  1.00 19.94 ? 256 VAL D N   1 
ATOM   2669 C  CA  . VAL C 1 106 ? 40.820 -2.748  94.450  1.00 19.94 ? 256 VAL D CA  1 
ATOM   2670 C  C   . VAL C 1 106 ? 41.855 -1.639  94.317  1.00 19.94 ? 256 VAL D C   1 
ATOM   2671 O  O   . VAL C 1 106 ? 42.884 -1.813  93.663  1.00 19.94 ? 256 VAL D O   1 
ATOM   2672 C  CB  . VAL C 1 106 ? 40.863 -3.394  95.869  1.00 13.14 ? 256 VAL D CB  1 
ATOM   2673 C  CG1 . VAL C 1 106 ? 42.266 -3.775  96.265  1.00 13.14 ? 256 VAL D CG1 1 
ATOM   2674 C  CG2 . VAL C 1 106 ? 40.290 -2.423  96.881  1.00 13.14 ? 256 VAL D CG2 1 
ATOM   2675 N  N   . ASP C 1 107 ? 41.567 -0.487  94.898  1.00 7.03  ? 257 ASP D N   1 
ATOM   2676 C  CA  . ASP C 1 107 ? 42.474 0.632   94.797  1.00 7.03  ? 257 ASP D CA  1 
ATOM   2677 C  C   . ASP C 1 107 ? 43.388 0.803   95.990  1.00 7.03  ? 257 ASP D C   1 
ATOM   2678 O  O   . ASP C 1 107 ? 42.952 0.905   97.141  1.00 7.03  ? 257 ASP D O   1 
ATOM   2679 C  CB  . ASP C 1 107 ? 41.699 1.915   94.569  1.00 20.51 ? 257 ASP D CB  1 
ATOM   2680 C  CG  . ASP C 1 107 ? 42.459 3.121   95.038  1.00 20.51 ? 257 ASP D CG  1 
ATOM   2681 O  OD1 . ASP C 1 107 ? 43.666 3.221   94.706  1.00 20.51 ? 257 ASP D OD1 1 
ATOM   2682 O  OD2 . ASP C 1 107 ? 41.850 3.959   95.743  1.00 20.51 ? 257 ASP D OD2 1 
ATOM   2683 N  N   . LEU C 1 108 ? 44.672 0.874   95.686  1.00 11.94 ? 258 LEU D N   1 
ATOM   2684 C  CA  . LEU C 1 108 ? 45.678 1.022   96.701  1.00 11.94 ? 258 LEU D CA  1 
ATOM   2685 C  C   . LEU C 1 108 ? 45.391 2.199   97.619  1.00 11.94 ? 258 LEU D C   1 
ATOM   2686 O  O   . LEU C 1 108 ? 45.551 2.091   98.833  1.00 11.94 ? 258 LEU D O   1 
ATOM   2687 C  CB  . LEU C 1 108 ? 47.027 1.207   96.043  1.00 7.03  ? 258 LEU D CB  1 
ATOM   2688 C  CG  . LEU C 1 108 ? 48.163 0.981   97.018  1.00 7.03  ? 258 LEU D CG  1 
ATOM   2689 C  CD1 . LEU C 1 108 ? 48.144 -0.470  97.441  1.00 7.03  ? 258 LEU D CD1 1 
ATOM   2690 C  CD2 . LEU C 1 108 ? 49.485 1.355   96.372  1.00 7.03  ? 258 LEU D CD2 1 
ATOM   2691 N  N   . LYS C 1 109 ? 44.957 3.318   97.043  1.00 15.78 ? 259 LYS D N   1 
ATOM   2692 C  CA  . LYS C 1 109 ? 44.682 4.526   97.825  1.00 15.78 ? 259 LYS D CA  1 
ATOM   2693 C  C   . LYS C 1 109 ? 43.586 4.394   98.890  1.00 15.78 ? 259 LYS D C   1 
ATOM   2694 O  O   . LYS C 1 109 ? 43.840 4.679   100.053 1.00 15.78 ? 259 LYS D O   1 
ATOM   2695 C  CB  . LYS C 1 109 ? 44.367 5.702   96.885  1.00 35.22 ? 259 LYS D CB  1 
ATOM   2696 C  CG  . LYS C 1 109 ? 45.055 7.045   97.238  1.00 35.22 ? 259 LYS D CG  1 
ATOM   2697 C  CD  . LYS C 1 109 ? 44.264 7.864   98.269  1.00 35.22 ? 259 LYS D CD  1 
ATOM   2698 C  CE  . LYS C 1 109 ? 44.851 9.276   98.486  1.00 35.22 ? 259 LYS D CE  1 
ATOM   2699 N  NZ  . LYS C 1 109 ? 44.063 10.097  99.473  1.00 35.22 ? 259 LYS D NZ  1 
ATOM   2700 N  N   . LYS C 1 110 ? 42.381 3.960   98.528  1.00 7.75  ? 260 LYS D N   1 
ATOM   2701 C  CA  . LYS C 1 110 ? 41.317 3.849   99.532  1.00 7.75  ? 260 LYS D CA  1 
ATOM   2702 C  C   . LYS C 1 110 ? 41.624 2.777   100.560 1.00 7.75  ? 260 LYS D C   1 
ATOM   2703 O  O   . LYS C 1 110 ? 40.760 2.387   101.352 1.00 7.75  ? 260 LYS D O   1 
ATOM   2704 C  CB  . LYS C 1 110 ? 39.962 3.565   98.881  1.00 33.75 ? 260 LYS D CB  1 
ATOM   2705 C  CG  . LYS C 1 110 ? 39.741 2.135   98.434  1.00 33.75 ? 260 LYS D CG  1 
ATOM   2706 C  CD  . LYS C 1 110 ? 38.529 2.056   97.522  1.00 33.75 ? 260 LYS D CD  1 
ATOM   2707 C  CE  . LYS C 1 110 ? 38.720 2.937   96.286  1.00 33.75 ? 260 LYS D CE  1 
ATOM   2708 N  NZ  . LYS C 1 110 ? 37.563 2.896   95.347  1.00 33.75 ? 260 LYS D NZ  1 
ATOM   2709 N  N   . ILE C 1 111 ? 42.859 2.295   100.518 1.00 7.03  ? 261 ILE D N   1 
ATOM   2710 C  CA  . ILE C 1 111 ? 43.340 1.298   101.459 1.00 7.03  ? 261 ILE D CA  1 
ATOM   2711 C  C   . ILE C 1 111 ? 44.132 2.068   102.510 1.00 7.03  ? 261 ILE D C   1 
ATOM   2712 O  O   . ILE C 1 111 ? 43.843 2.043   103.711 1.00 7.03  ? 261 ILE D O   1 
ATOM   2713 C  CB  . ILE C 1 111 ? 44.316 0.326   100.787 1.00 34.24 ? 261 ILE D CB  1 
ATOM   2714 C  CG1 . ILE C 1 111 ? 43.651 -0.328  99.581  1.00 34.24 ? 261 ILE D CG1 1 
ATOM   2715 C  CG2 . ILE C 1 111 ? 44.806 -0.713  101.800 1.00 34.24 ? 261 ILE D CG2 1 
ATOM   2716 C  CD1 . ILE C 1 111 ? 44.489 -1.430  98.956  1.00 34.24 ? 261 ILE D CD1 1 
ATOM   2717 N  N   . THR C 1 112 ? 45.140 2.767   102.010 1.00 7.03  ? 262 THR D N   1 
ATOM   2718 C  CA  . THR C 1 112 ? 46.031 3.559   102.824 1.00 7.03  ? 262 THR D CA  1 
ATOM   2719 C  C   . THR C 1 112 ? 45.287 4.655   103.605 1.00 7.03  ? 262 THR D C   1 
ATOM   2720 O  O   . THR C 1 112 ? 45.682 5.027   104.708 1.00 7.03  ? 262 THR D O   1 
ATOM   2721 C  CB  . THR C 1 112 ? 47.128 4.140   101.910 1.00 12.99 ? 262 THR D CB  1 
ATOM   2722 O  OG1 . THR C 1 112 ? 46.529 4.880   100.835 1.00 12.99 ? 262 THR D OG1 1 
ATOM   2723 C  CG2 . THR C 1 112 ? 47.948 3.004   101.302 1.00 12.99 ? 262 THR D CG2 1 
ATOM   2724 N  N   . ASN C 1 113 ? 44.189 5.138   103.035 1.00 13.80 ? 263 ASN D N   1 
ATOM   2725 C  CA  . ASN C 1 113 ? 43.368 6.181   103.642 1.00 13.80 ? 263 ASN D CA  1 
ATOM   2726 C  C   . ASN C 1 113 ? 43.066 6.002   105.111 1.00 13.80 ? 263 ASN D C   1 
ATOM   2727 O  O   . ASN C 1 113 ? 43.184 6.943   105.886 1.00 13.80 ? 263 ASN D O   1 
ATOM   2728 C  CB  . ASN C 1 113 ? 42.035 6.308   102.914 1.00 23.63 ? 263 ASN D CB  1 
ATOM   2729 C  CG  . ASN C 1 113 ? 42.113 7.216   101.715 1.00 23.63 ? 263 ASN D CG  1 
ATOM   2730 O  OD1 . ASN C 1 113 ? 41.102 7.467   101.051 1.00 23.63 ? 263 ASN D OD1 1 
ATOM   2731 N  ND2 . ASN C 1 113 ? 43.312 7.726   101.431 1.00 23.63 ? 263 ASN D ND2 1 
ATOM   2732 N  N   . PHE C 1 114 ? 42.668 4.802   105.500 1.00 7.03  ? 264 PHE D N   1 
ATOM   2733 C  CA  . PHE C 1 114 ? 42.311 4.566   106.883 1.00 7.03  ? 264 PHE D CA  1 
ATOM   2734 C  C   . PHE C 1 114 ? 43.418 4.871   107.879 1.00 7.03  ? 264 PHE D C   1 
ATOM   2735 O  O   . PHE C 1 114 ? 43.203 4.808   109.086 1.00 7.03  ? 264 PHE D O   1 
ATOM   2736 C  CB  . PHE C 1 114 ? 41.806 3.130   107.046 1.00 19.51 ? 264 PHE D CB  1 
ATOM   2737 C  CG  . PHE C 1 114 ? 40.705 2.772   106.086 1.00 19.51 ? 264 PHE D CG  1 
ATOM   2738 C  CD1 . PHE C 1 114 ? 39.674 3.671   105.831 1.00 19.51 ? 264 PHE D CD1 1 
ATOM   2739 C  CD2 . PHE C 1 114 ? 40.719 1.565   105.403 1.00 19.51 ? 264 PHE D CD2 1 
ATOM   2740 C  CE1 . PHE C 1 114 ? 38.678 3.374   104.902 1.00 19.51 ? 264 PHE D CE1 1 
ATOM   2741 C  CE2 . PHE C 1 114 ? 39.730 1.256   104.474 1.00 19.51 ? 264 PHE D CE2 1 
ATOM   2742 C  CZ  . PHE C 1 114 ? 38.711 2.159   104.221 1.00 19.51 ? 264 PHE D CZ  1 
ATOM   2743 N  N   . PHE C 1 115 ? 44.595 5.238   107.384 1.00 9.09  ? 265 PHE D N   1 
ATOM   2744 C  CA  . PHE C 1 115 ? 45.715 5.537   108.276 1.00 9.09  ? 265 PHE D CA  1 
ATOM   2745 C  C   . PHE C 1 115 ? 46.128 7.004   108.229 1.00 9.09  ? 265 PHE D C   1 
ATOM   2746 O  O   . PHE C 1 115 ? 46.824 7.499   109.123 1.00 9.09  ? 265 PHE D O   1 
ATOM   2747 C  CB  . PHE C 1 115 ? 46.882 4.612   107.927 1.00 15.05 ? 265 PHE D CB  1 
ATOM   2748 C  CG  . PHE C 1 115 ? 46.508 3.154   107.980 1.00 15.05 ? 265 PHE D CG  1 
ATOM   2749 C  CD1 . PHE C 1 115 ? 46.405 2.495   109.198 1.00 15.05 ? 265 PHE D CD1 1 
ATOM   2750 C  CD2 . PHE C 1 115 ? 46.154 2.470   106.818 1.00 15.05 ? 265 PHE D CD2 1 
ATOM   2751 C  CE1 . PHE C 1 115 ? 45.952 1.183   109.264 1.00 15.05 ? 265 PHE D CE1 1 
ATOM   2752 C  CE2 . PHE C 1 115 ? 45.697 1.153   106.876 1.00 15.05 ? 265 PHE D CE2 1 
ATOM   2753 C  CZ  . PHE C 1 115 ? 45.594 0.509   108.097 1.00 15.05 ? 265 PHE D CZ  1 
ATOM   2754 N  N   . ARG C 1 116 ? 45.638 7.679   107.189 1.00 27.26 ? 266 ARG D N   1 
ATOM   2755 C  CA  . ARG C 1 116 ? 45.864 9.099   106.898 1.00 27.26 ? 266 ARG D CA  1 
ATOM   2756 C  C   . ARG C 1 116 ? 45.684 10.031  108.109 1.00 27.26 ? 266 ARG D C   1 
ATOM   2757 O  O   . ARG C 1 116 ? 44.571 10.228  108.590 1.00 27.26 ? 266 ARG D O   1 
ATOM   2758 C  CB  . ARG C 1 116 ? 44.906 9.529   105.774 1.00 16.72 ? 266 ARG D CB  1 
ATOM   2759 C  CG  . ARG C 1 116 ? 45.431 10.583  104.792 1.00 16.72 ? 266 ARG D CG  1 
ATOM   2760 C  CD  . ARG C 1 116 ? 44.308 11.032  103.868 1.00 16.72 ? 266 ARG D CD  1 
ATOM   2761 N  NE  . ARG C 1 116 ? 43.250 11.696  104.625 1.00 16.72 ? 266 ARG D NE  1 
ATOM   2762 C  CZ  . ARG C 1 116 ? 41.945 11.566  104.384 1.00 16.72 ? 266 ARG D CZ  1 
ATOM   2763 N  NH1 . ARG C 1 116 ? 41.514 10.785  103.399 1.00 16.72 ? 266 ARG D NH1 1 
ATOM   2764 N  NH2 . ARG C 1 116 ? 41.067 12.223  105.132 1.00 16.72 ? 266 ARG D NH2 1 
ATOM   2765 N  N   . GLY C 1 117 ? 46.794 10.608  108.570 1.00 7.03  ? 267 GLY D N   1 
ATOM   2766 C  CA  . GLY C 1 117 ? 46.810 11.516  109.705 1.00 7.03  ? 267 GLY D CA  1 
ATOM   2767 C  C   . GLY C 1 117 ? 45.588 11.600  110.595 1.00 7.03  ? 267 GLY D C   1 
ATOM   2768 O  O   . GLY C 1 117 ? 45.635 11.172  111.739 1.00 7.03  ? 267 GLY D O   1 
ATOM   2769 N  N   . ASP C 1 118 ? 44.504 12.163  110.071 1.00 7.03  ? 268 ASP D N   1 
ATOM   2770 C  CA  . ASP C 1 118 ? 43.262 12.350  110.824 1.00 7.03  ? 268 ASP D CA  1 
ATOM   2771 C  C   . ASP C 1 118 ? 42.406 11.113  111.014 1.00 7.03  ? 268 ASP D C   1 
ATOM   2772 O  O   . ASP C 1 118 ? 41.543 11.081  111.880 1.00 7.03  ? 268 ASP D O   1 
ATOM   2773 C  CB  . ASP C 1 118 ? 42.411 13.450  110.168 1.00 20.56 ? 268 ASP D CB  1 
ATOM   2774 C  CG  . ASP C 1 118 ? 42.171 13.213  108.677 1.00 20.56 ? 268 ASP D CG  1 
ATOM   2775 O  OD1 . ASP C 1 118 ? 43.150 13.254  107.894 1.00 20.56 ? 268 ASP D OD1 1 
ATOM   2776 O  OD2 . ASP C 1 118 ? 40.999 12.991  108.288 1.00 20.56 ? 268 ASP D OD2 1 
ATOM   2777 N  N   . ARG C 1 119 ? 42.635 10.105  110.188 1.00 7.44  ? 269 ARG D N   1 
ATOM   2778 C  CA  . ARG C 1 119 ? 41.895 8.854   110.255 1.00 7.44  ? 269 ARG D CA  1 
ATOM   2779 C  C   . ARG C 1 119 ? 42.412 8.033   111.435 1.00 7.44  ? 269 ARG D C   1 
ATOM   2780 O  O   . ARG C 1 119 ? 41.760 7.931   112.477 1.00 7.44  ? 269 ARG D O   1 
ATOM   2781 C  CB  . ARG C 1 119 ? 42.111 8.079   108.957 1.00 68.43 ? 269 ARG D CB  1 
ATOM   2782 C  CG  . ARG C 1 119 ? 41.028 8.246   107.912 1.00 68.43 ? 269 ARG D CG  1 
ATOM   2783 C  CD  . ARG C 1 119 ? 39.799 7.445   108.317 1.00 68.43 ? 269 ARG D CD  1 
ATOM   2784 N  NE  . ARG C 1 119 ? 40.191 6.188   108.957 1.00 68.43 ? 269 ARG D NE  1 
ATOM   2785 C  CZ  . ARG C 1 119 ? 39.355 5.199   109.259 1.00 68.43 ? 269 ARG D CZ  1 
ATOM   2786 N  NH1 . ARG C 1 119 ? 38.061 5.309   108.977 1.00 68.43 ? 269 ARG D NH1 1 
ATOM   2787 N  NH2 . ARG C 1 119 ? 39.817 4.102   109.847 1.00 68.43 ? 269 ARG D NH2 1 
ATOM   2788 N  N   . CYS C 1 120 ? 43.592 7.447   111.244 1.00 7.64  ? 270 CYS D N   1 
ATOM   2789 C  CA  . CYS C 1 120 ? 44.260 6.648   112.258 1.00 7.64  ? 270 CYS D CA  1 
ATOM   2790 C  C   . CYS C 1 120 ? 45.058 7.609   113.126 1.00 7.64  ? 270 CYS D C   1 
ATOM   2791 O  O   . CYS C 1 120 ? 46.169 8.009   112.767 1.00 7.64  ? 270 CYS D O   1 
ATOM   2792 C  CB  . CYS C 1 120 ? 45.200 5.653   111.589 1.00 14.07 ? 270 CYS D CB  1 
ATOM   2793 S  SG  . CYS C 1 120 ? 46.142 4.655   112.740 1.00 14.07 ? 270 CYS D SG  1 
ATOM   2794 N  N   . ARG C 1 121 ? 44.489 7.968   114.269 1.00 7.41  ? 271 ARG D N   1 
ATOM   2795 C  CA  . ARG C 1 121 ? 45.124 8.913   115.175 1.00 7.41  ? 271 ARG D CA  1 
ATOM   2796 C  C   . ARG C 1 121 ? 46.324 8.361   115.905 1.00 7.41  ? 271 ARG D C   1 
ATOM   2797 O  O   . ARG C 1 121 ? 47.430 8.884   115.761 1.00 7.41  ? 271 ARG D O   1 
ATOM   2798 C  CB  . ARG C 1 121 ? 44.109 9.422   116.187 1.00 25.37 ? 271 ARG D CB  1 
ATOM   2799 C  CG  . ARG C 1 121 ? 42.859 9.982   115.534 1.00 25.37 ? 271 ARG D CG  1 
ATOM   2800 C  CD  . ARG C 1 121 ? 41.662 9.035   115.645 1.00 25.37 ? 271 ARG D CD  1 
ATOM   2801 N  NE  . ARG C 1 121 ? 40.937 9.209   116.902 1.00 25.37 ? 271 ARG D NE  1 
ATOM   2802 C  CZ  . ARG C 1 121 ? 41.158 8.507   118.010 1.00 25.37 ? 271 ARG D CZ  1 
ATOM   2803 N  NH1 . ARG C 1 121 ? 42.089 7.562   118.023 1.00 25.37 ? 271 ARG D NH1 1 
ATOM   2804 N  NH2 . ARG C 1 121 ? 40.453 8.756   119.107 1.00 25.37 ? 271 ARG D NH2 1 
ATOM   2805 N  N   . SER C 1 122 ? 46.103 7.320   116.707 1.00 7.48  ? 272 SER D N   1 
ATOM   2806 C  CA  . SER C 1 122 ? 47.187 6.685   117.444 1.00 7.48  ? 272 SER D CA  1 
ATOM   2807 C  C   . SER C 1 122 ? 48.419 6.655   116.546 1.00 7.48  ? 272 SER D C   1 
ATOM   2808 O  O   . SER C 1 122 ? 49.526 6.926   116.985 1.00 7.48  ? 272 SER D O   1 
ATOM   2809 C  CB  . SER C 1 122 ? 46.786 5.270   117.871 1.00 7.03  ? 272 SER D CB  1 
ATOM   2810 O  OG  . SER C 1 122 ? 45.818 4.717   117.011 1.00 7.03  ? 272 SER D OG  1 
ATOM   2811 N  N   . LEU C 1 123 ? 48.216 6.353   115.274 1.00 9.29  ? 273 LEU D N   1 
ATOM   2812 C  CA  . LEU C 1 123 ? 49.323 6.332   114.342 1.00 9.29  ? 273 LEU D CA  1 
ATOM   2813 C  C   . LEU C 1 123 ? 49.509 7.699   113.670 1.00 9.29  ? 273 LEU D C   1 
ATOM   2814 O  O   . LEU C 1 123 ? 49.300 7.864   112.461 1.00 9.29  ? 273 LEU D O   1 
ATOM   2815 C  CB  . LEU C 1 123 ? 49.113 5.237   113.288 1.00 7.34  ? 273 LEU D CB  1 
ATOM   2816 C  CG  . LEU C 1 123 ? 49.309 3.777   113.715 1.00 7.34  ? 273 LEU D CG  1 
ATOM   2817 C  CD1 . LEU C 1 123 ? 48.984 2.876   112.551 1.00 7.34  ? 273 LEU D CD1 1 
ATOM   2818 C  CD2 . LEU C 1 123 ? 50.731 3.543   114.155 1.00 7.34  ? 273 LEU D CD2 1 
ATOM   2819 N  N   . THR C 1 124 ? 49.880 8.691   114.471 1.00 7.03  ? 274 THR D N   1 
ATOM   2820 C  CA  . THR C 1 124 ? 50.138 10.029  113.952 1.00 7.03  ? 274 THR D CA  1 
ATOM   2821 C  C   . THR C 1 124 ? 51.521 10.374  114.447 1.00 7.03  ? 274 THR D C   1 
ATOM   2822 O  O   . THR C 1 124 ? 51.759 10.394  115.653 1.00 7.03  ? 274 THR D O   1 
ATOM   2823 C  CB  . THR C 1 124 ? 49.142 11.058  114.479 1.00 7.03  ? 274 THR D CB  1 
ATOM   2824 O  OG1 . THR C 1 124 ? 47.866 10.838  113.873 1.00 7.03  ? 274 THR D OG1 1 
ATOM   2825 C  CG2 . THR C 1 124 ? 49.600 12.449  114.131 1.00 7.03  ? 274 THR D CG2 1 
ATOM   2826 N  N   . GLY C 1 125 ? 52.435 10.637  113.522 1.00 9.24  ? 275 GLY D N   1 
ATOM   2827 C  CA  . GLY C 1 125 ? 53.796 10.933  113.922 1.00 9.24  ? 275 GLY D CA  1 
ATOM   2828 C  C   . GLY C 1 125 ? 54.485 9.600   114.133 1.00 9.24  ? 275 GLY D C   1 
ATOM   2829 O  O   . GLY C 1 125 ? 55.478 9.479   114.871 1.00 9.24  ? 275 GLY D O   1 
ATOM   2830 N  N   . LYS C 1 126 ? 53.914 8.584   113.494 1.00 7.03  ? 276 LYS D N   1 
ATOM   2831 C  CA  . LYS C 1 126 ? 54.436 7.230   113.546 1.00 7.03  ? 276 LYS D CA  1 
ATOM   2832 C  C   . LYS C 1 126 ? 54.485 6.698   112.132 1.00 7.03  ? 276 LYS D C   1 
ATOM   2833 O  O   . LYS C 1 126 ? 53.524 6.826   111.387 1.00 7.03  ? 276 LYS D O   1 
ATOM   2834 C  CB  . LYS C 1 126 ? 53.552 6.345   114.422 1.00 10.21 ? 276 LYS D CB  1 
ATOM   2835 C  CG  . LYS C 1 126 ? 53.746 6.609   115.911 1.00 10.21 ? 276 LYS D CG  1 
ATOM   2836 C  CD  . LYS C 1 126 ? 52.938 5.654   116.779 1.00 10.21 ? 276 LYS D CD  1 
ATOM   2837 C  CE  . LYS C 1 126 ? 52.972 6.082   118.243 1.00 10.21 ? 276 LYS D CE  1 
ATOM   2838 N  NZ  . LYS C 1 126 ? 51.938 5.392   119.074 1.00 10.21 ? 276 LYS D NZ  1 
ATOM   2839 N  N   . PRO C 1 127 ? 55.615 6.097   111.745 1.00 7.12  ? 277 PRO D N   1 
ATOM   2840 C  CA  . PRO C 1 127 ? 55.794 5.544   110.409 1.00 7.12  ? 277 PRO D CA  1 
ATOM   2841 C  C   . PRO C 1 127 ? 54.777 4.488   109.972 1.00 7.12  ? 277 PRO D C   1 
ATOM   2842 O  O   . PRO C 1 127 ? 54.556 3.503   110.666 1.00 7.12  ? 277 PRO D O   1 
ATOM   2843 C  CB  . PRO C 1 127 ? 57.215 4.982   110.466 1.00 7.03  ? 277 PRO D CB  1 
ATOM   2844 C  CG  . PRO C 1 127 ? 57.347 4.573   111.868 1.00 7.03  ? 277 PRO D CG  1 
ATOM   2845 C  CD  . PRO C 1 127 ? 56.775 5.764   112.587 1.00 7.03  ? 277 PRO D CD  1 
ATOM   2846 N  N   . LYS C 1 128 ? 54.143 4.719   108.828 1.00 7.03  ? 278 LYS D N   1 
ATOM   2847 C  CA  . LYS C 1 128 ? 53.221 3.764   108.259 1.00 7.03  ? 278 LYS D CA  1 
ATOM   2848 C  C   . LYS C 1 128 ? 54.012 3.265   107.044 1.00 7.03  ? 278 LYS D C   1 
ATOM   2849 O  O   . LYS C 1 128 ? 54.184 3.988   106.064 1.00 7.03  ? 278 LYS D O   1 
ATOM   2850 C  CB  . LYS C 1 128 ? 51.930 4.437   107.802 1.00 7.03  ? 278 LYS D CB  1 
ATOM   2851 C  CG  . LYS C 1 128 ? 51.108 5.122   108.888 1.00 7.03  ? 278 LYS D CG  1 
ATOM   2852 C  CD  . LYS C 1 128 ? 51.216 6.656   108.792 1.00 7.03  ? 278 LYS D CD  1 
ATOM   2853 C  CE  . LYS C 1 128 ? 50.133 7.363   109.611 1.00 7.03  ? 278 LYS D CE  1 
ATOM   2854 N  NZ  . LYS C 1 128 ? 50.353 8.824   109.706 1.00 7.03  ? 278 LYS D NZ  1 
ATOM   2855 N  N   . LEU C 1 129 ? 54.526 2.042   107.118 1.00 7.03  ? 279 LEU D N   1 
ATOM   2856 C  CA  . LEU C 1 129 ? 55.314 1.493   106.024 1.00 7.03  ? 279 LEU D CA  1 
ATOM   2857 C  C   . LEU C 1 129 ? 54.464 0.518   105.227 1.00 7.03  ? 279 LEU D C   1 
ATOM   2858 O  O   . LEU C 1 129 ? 53.969 -0.455  105.772 1.00 7.03  ? 279 LEU D O   1 
ATOM   2859 C  CB  . LEU C 1 129 ? 56.545 0.778   106.591 1.00 7.03  ? 279 LEU D CB  1 
ATOM   2860 C  CG  . LEU C 1 129 ? 57.174 1.411   107.842 1.00 7.03  ? 279 LEU D CG  1 
ATOM   2861 C  CD1 . LEU C 1 129 ? 58.488 0.750   108.164 1.00 7.03  ? 279 LEU D CD1 1 
ATOM   2862 C  CD2 . LEU C 1 129 ? 57.415 2.872   107.604 1.00 7.03  ? 279 LEU D CD2 1 
ATOM   2863 N  N   . PHE C 1 130 ? 54.269 0.781   103.942 1.00 7.03  ? 280 PHE D N   1 
ATOM   2864 C  CA  . PHE C 1 130 ? 53.473 -0.121  103.117 1.00 7.03  ? 280 PHE D CA  1 
ATOM   2865 C  C   . PHE C 1 130 ? 54.326 -0.778  102.067 1.00 7.03  ? 280 PHE D C   1 
ATOM   2866 O  O   . PHE C 1 130 ? 54.550 -0.222  101.005 1.00 7.03  ? 280 PHE D O   1 
ATOM   2867 C  CB  . PHE C 1 130 ? 52.339 0.608   102.404 1.00 7.03  ? 280 PHE D CB  1 
ATOM   2868 C  CG  . PHE C 1 130 ? 51.197 0.984   103.292 1.00 7.03  ? 280 PHE D CG  1 
ATOM   2869 C  CD1 . PHE C 1 130 ? 51.367 1.892   104.326 1.00 7.03  ? 280 PHE D CD1 1 
ATOM   2870 C  CD2 . PHE C 1 130 ? 49.932 0.471   103.054 1.00 7.03  ? 280 PHE D CD2 1 
ATOM   2871 C  CE1 . PHE C 1 130 ? 50.283 2.290   105.110 1.00 7.03  ? 280 PHE D CE1 1 
ATOM   2872 C  CE2 . PHE C 1 130 ? 48.851 0.860   103.829 1.00 7.03  ? 280 PHE D CE2 1 
ATOM   2873 C  CZ  . PHE C 1 130 ? 49.021 1.771   104.858 1.00 7.03  ? 280 PHE D CZ  1 
ATOM   2874 N  N   . ILE C 1 131 ? 54.822 -1.963  102.360 1.00 7.03  ? 281 ILE D N   1 
ATOM   2875 C  CA  . ILE C 1 131 ? 55.624 -2.658  101.375 1.00 7.03  ? 281 ILE D CA  1 
ATOM   2876 C  C   . ILE C 1 131 ? 54.614 -3.376  100.492 1.00 7.03  ? 281 ILE D C   1 
ATOM   2877 O  O   . ILE C 1 131 ? 53.700 -4.038  100.992 1.00 7.03  ? 281 ILE D O   1 
ATOM   2878 C  CB  . ILE C 1 131 ? 56.557 -3.673  102.036 1.00 7.65  ? 281 ILE D CB  1 
ATOM   2879 C  CG1 . ILE C 1 131 ? 57.234 -3.021  103.240 1.00 7.65  ? 281 ILE D CG1 1 
ATOM   2880 C  CG2 . ILE C 1 131 ? 57.588 -4.173  101.019 1.00 7.65  ? 281 ILE D CG2 1 
ATOM   2881 C  CD1 . ILE C 1 131 ? 57.833 -3.987  104.188 1.00 7.65  ? 281 ILE D CD1 1 
ATOM   2882 N  N   . ILE C 1 132 ? 54.785 -3.225  99.183  1.00 7.03  ? 282 ILE D N   1 
ATOM   2883 C  CA  . ILE C 1 132 ? 53.887 -3.805  98.196  1.00 7.03  ? 282 ILE D CA  1 
ATOM   2884 C  C   . ILE C 1 132 ? 54.664 -4.622  97.183  1.00 7.03  ? 282 ILE D C   1 
ATOM   2885 O  O   . ILE C 1 132 ? 55.581 -4.111  96.547  1.00 7.03  ? 282 ILE D O   1 
ATOM   2886 C  CB  . ILE C 1 132 ? 53.131 -2.697  97.441  1.00 7.03  ? 282 ILE D CB  1 
ATOM   2887 C  CG1 . ILE C 1 132 ? 52.554 -1.687  98.435  1.00 7.03  ? 282 ILE D CG1 1 
ATOM   2888 C  CG2 . ILE C 1 132 ? 52.013 -3.297  96.614  1.00 7.03  ? 282 ILE D CG2 1 
ATOM   2889 C  CD1 . ILE C 1 132 ? 52.098 -0.390  97.794  1.00 7.03  ? 282 ILE D CD1 1 
ATOM   2890 N  N   . GLN C 1 133 ? 54.282 -5.888  97.035  1.00 7.60  ? 283 GLN D N   1 
ATOM   2891 C  CA  . GLN C 1 133 ? 54.928 -6.807  96.095  1.00 7.60  ? 283 GLN D CA  1 
ATOM   2892 C  C   . GLN C 1 133 ? 53.907 -7.302  95.057  1.00 7.60  ? 283 GLN D C   1 
ATOM   2893 O  O   . GLN C 1 133 ? 53.173 -8.264  95.294  1.00 7.60  ? 283 GLN D O   1 
ATOM   2894 C  CB  . GLN C 1 133 ? 55.543 -7.983  96.865  1.00 7.03  ? 283 GLN D CB  1 
ATOM   2895 C  CG  . GLN C 1 133 ? 55.962 -9.142  96.005  1.00 7.03  ? 283 GLN D CG  1 
ATOM   2896 C  CD  . GLN C 1 133 ? 56.814 -8.700  94.851  1.00 7.03  ? 283 GLN D CD  1 
ATOM   2897 O  OE1 . GLN C 1 133 ? 57.810 -8.007  95.032  1.00 7.03  ? 283 GLN D OE1 1 
ATOM   2898 N  NE2 . GLN C 1 133 ? 56.429 -9.096  93.648  1.00 7.03  ? 283 GLN D NE2 1 
ATOM   2899 N  N   . ALA C 1 134 ? 53.871 -6.622  93.912  1.00 7.03  ? 284 ALA D N   1 
ATOM   2900 C  CA  . ALA C 1 134 ? 52.943 -6.945  92.836  1.00 7.03  ? 284 ALA D CA  1 
ATOM   2901 C  C   . ALA C 1 134 ? 53.268 -6.163  91.570  1.00 7.03  ? 284 ALA D C   1 
ATOM   2902 O  O   . ALA C 1 134 ? 54.165 -5.332  91.558  1.00 7.03  ? 284 ALA D O   1 
ATOM   2903 C  CB  . ALA C 1 134 ? 51.529 -6.633  93.266  1.00 7.03  ? 284 ALA D CB  1 
ATOM   2904 N  N   . CYS C 1 135 ? 52.527 -6.439  90.504  1.00 7.03  ? 285 CYS D N   1 
ATOM   2905 C  CA  . CYS C 1 135 ? 52.721 -5.754  89.235  1.00 7.03  ? 285 CYS D CA  1 
ATOM   2906 C  C   . CYS C 1 135 ? 52.187 -4.329  89.298  1.00 7.03  ? 285 CYS D C   1 
ATOM   2907 O  O   . CYS C 1 135 ? 51.137 -4.066  89.898  1.00 7.03  ? 285 CYS D O   1 
ATOM   2908 C  CB  . CYS C 1 135 ? 52.002 -6.497  88.101  1.00 37.62 ? 285 CYS D CB  1 
ATOM   2909 S  SG  . CYS C 1 135 ? 52.873 -7.936  87.465  1.00 37.62 ? 285 CYS D SG  1 
ATOM   2910 N  N   . ARG C 1 136 ? 52.922 -3.414  88.674  1.00 8.78  ? 286 ARG D N   1 
ATOM   2911 C  CA  . ARG C 1 136 ? 52.536 -2.009  88.617  1.00 8.78  ? 286 ARG D CA  1 
ATOM   2912 C  C   . ARG C 1 136 ? 52.267 -1.625  87.167  1.00 8.78  ? 286 ARG D C   1 
ATOM   2913 O  O   . ARG C 1 136 ? 52.555 -0.520  86.750  1.00 8.78  ? 286 ARG D O   1 
ATOM   2914 C  CB  . ARG C 1 136 ? 53.647 -1.118  89.189  1.00 7.75  ? 286 ARG D CB  1 
ATOM   2915 C  CG  . ARG C 1 136 ? 53.918 -1.336  90.670  1.00 7.75  ? 286 ARG D CG  1 
ATOM   2916 C  CD  . ARG C 1 136 ? 54.847 -0.273  91.263  1.00 7.75  ? 286 ARG D CD  1 
ATOM   2917 N  NE  . ARG C 1 136 ? 54.214 1.040   91.310  1.00 7.75  ? 286 ARG D NE  1 
ATOM   2918 C  CZ  . ARG C 1 136 ? 54.837 2.166   91.648  1.00 7.75  ? 286 ARG D CZ  1 
ATOM   2919 N  NH1 . ARG C 1 136 ? 56.122 2.130   91.980  1.00 7.75  ? 286 ARG D NH1 1 
ATOM   2920 N  NH2 . ARG C 1 136 ? 54.181 3.326   91.630  1.00 7.75  ? 286 ARG D NH2 1 
ATOM   2921 N  N   . GLY C 1 137 ? 51.702 -2.545  86.400  1.00 7.24  ? 287 GLY D N   1 
ATOM   2922 C  CA  . GLY C 1 137 ? 51.433 -2.263  85.009  1.00 7.24  ? 287 GLY D CA  1 
ATOM   2923 C  C   . GLY C 1 137 ? 51.944 -3.436  84.223  1.00 7.24  ? 287 GLY D C   1 
ATOM   2924 O  O   . GLY C 1 137 ? 51.935 -4.547  84.734  1.00 7.24  ? 287 GLY D O   1 
ATOM   2925 N  N   . THR C 1 138 ? 52.416 -3.206  83.001  1.00 20.03 ? 288 THR D N   1 
ATOM   2926 C  CA  . THR C 1 138 ? 52.912 -4.308  82.178  1.00 20.03 ? 288 THR D CA  1 
ATOM   2927 C  C   . THR C 1 138 ? 54.071 -3.991  81.232  1.00 20.03 ? 288 THR D C   1 
ATOM   2928 O  O   . THR C 1 138 ? 54.106 -4.497  80.111  1.00 20.03 ? 288 THR D O   1 
ATOM   2929 C  CB  . THR C 1 138 ? 51.786 -4.898  81.315  1.00 24.11 ? 288 THR D CB  1 
ATOM   2930 O  OG1 . THR C 1 138 ? 51.249 -3.869  80.470  1.00 24.11 ? 288 THR D OG1 1 
ATOM   2931 C  CG2 . THR C 1 138 ? 50.685 -5.477  82.189  1.00 24.11 ? 288 THR D CG2 1 
ATOM   2932 N  N   . GLU C 1 139 ? 55.015 -3.156  81.652  1.00 24.31 ? 289 GLU D N   1 
ATOM   2933 C  CA  . GLU C 1 139 ? 56.152 -2.866  80.791  1.00 24.31 ? 289 GLU D CA  1 
ATOM   2934 C  C   . GLU C 1 139 ? 57.254 -3.876  81.089  1.00 24.31 ? 289 GLU D C   1 
ATOM   2935 O  O   . GLU C 1 139 ? 57.209 -4.575  82.102  1.00 24.31 ? 289 GLU D O   1 
ATOM   2936 C  CB  . GLU C 1 139 ? 56.667 -1.442  81.019  1.00 45.94 ? 289 GLU D CB  1 
ATOM   2937 C  CG  . GLU C 1 139 ? 56.331 -0.471  79.883  1.00 45.94 ? 289 GLU D CG  1 
ATOM   2938 C  CD  . GLU C 1 139 ? 56.927 -0.896  78.536  1.00 45.94 ? 289 GLU D CD  1 
ATOM   2939 O  OE1 . GLU C 1 139 ? 58.165 -0.789  78.362  1.00 45.94 ? 289 GLU D OE1 1 
ATOM   2940 O  OE2 . GLU C 1 139 ? 56.156 -1.349  77.653  1.00 45.94 ? 289 GLU D OE2 1 
ATOM   2941 N  N   . LEU C 1 140 ? 58.236 -3.962  80.200  1.00 7.03  ? 290 LEU D N   1 
ATOM   2942 C  CA  . LEU C 1 140 ? 59.342 -4.896  80.373  1.00 7.03  ? 290 LEU D CA  1 
ATOM   2943 C  C   . LEU C 1 140 ? 60.643 -4.108  80.394  1.00 7.03  ? 290 LEU D C   1 
ATOM   2944 O  O   . LEU C 1 140 ? 60.820 -3.174  79.618  1.00 7.03  ? 290 LEU D O   1 
ATOM   2945 C  CB  . LEU C 1 140 ? 59.361 -5.896  79.215  1.00 7.03  ? 290 LEU D CB  1 
ATOM   2946 C  CG  . LEU C 1 140 ? 58.075 -6.701  78.976  1.00 7.03  ? 290 LEU D CG  1 
ATOM   2947 C  CD1 . LEU C 1 140 ? 58.092 -7.313  77.598  1.00 7.03  ? 290 LEU D CD1 1 
ATOM   2948 C  CD2 . LEU C 1 140 ? 57.925 -7.762  80.029  1.00 7.03  ? 290 LEU D CD2 1 
ATOM   2949 N  N   . ASP C 1 141 ? 61.550 -4.476  81.289  1.00 7.96  ? 291 ASP D N   1 
ATOM   2950 C  CA  . ASP C 1 141 ? 62.829 -3.782  81.391  1.00 7.96  ? 291 ASP D CA  1 
ATOM   2951 C  C   . ASP C 1 141 ? 63.961 -4.602  80.761  1.00 7.96  ? 291 ASP D C   1 
ATOM   2952 O  O   . ASP C 1 141 ? 64.455 -5.573  81.347  1.00 7.96  ? 291 ASP D O   1 
ATOM   2953 C  CB  . ASP C 1 141 ? 63.156 -3.504  82.855  1.00 7.03  ? 291 ASP D CB  1 
ATOM   2954 C  CG  . ASP C 1 141 ? 64.232 -2.442  83.026  1.00 7.03  ? 291 ASP D CG  1 
ATOM   2955 O  OD1 . ASP C 1 141 ? 65.173 -2.391  82.198  1.00 7.03  ? 291 ASP D OD1 1 
ATOM   2956 O  OD2 . ASP C 1 141 ? 64.139 -1.664  84.007  1.00 7.03  ? 291 ASP D OD2 1 
ATOM   2957 N  N   . CYS C 1 142 ? 64.375 -4.207  79.562  1.00 7.03  ? 292 CYS D N   1 
ATOM   2958 C  CA  . CYS C 1 142 ? 65.444 -4.899  78.864  1.00 7.03  ? 292 CYS D CA  1 
ATOM   2959 C  C   . CYS C 1 142 ? 66.809 -4.696  79.491  1.00 7.03  ? 292 CYS D C   1 
ATOM   2960 O  O   . CYS C 1 142 ? 67.631 -5.607  79.500  1.00 7.03  ? 292 CYS D O   1 
ATOM   2961 C  CB  . CYS C 1 142 ? 65.478 -4.456  77.418  1.00 16.87 ? 292 CYS D CB  1 
ATOM   2962 S  SG  . CYS C 1 142 ? 64.100 -5.117  76.518  1.00 16.87 ? 292 CYS D SG  1 
ATOM   2963 N  N   . GLY C 1 143 ? 67.055 -3.502  80.018  1.00 12.19 ? 293 GLY D N   1 
ATOM   2964 C  CA  . GLY C 1 143 ? 68.338 -3.230  80.638  1.00 12.19 ? 293 GLY D CA  1 
ATOM   2965 C  C   . GLY C 1 143 ? 69.379 -2.873  79.603  1.00 12.19 ? 293 GLY D C   1 
ATOM   2966 O  O   . GLY C 1 143 ? 69.088 -2.873  78.406  1.00 12.19 ? 293 GLY D O   1 
ATOM   2967 N  N   . ILE C 1 144 ? 70.593 -2.583  80.055  1.00 15.79 ? 294 ILE D N   1 
ATOM   2968 C  CA  . ILE C 1 144 ? 71.670 -2.204  79.143  1.00 15.79 ? 294 ILE D CA  1 
ATOM   2969 C  C   . ILE C 1 144 ? 73.023 -2.444  79.816  1.00 15.79 ? 294 ILE D C   1 
ATOM   2970 O  O   . ILE C 1 144 ? 73.075 -2.975  80.925  1.00 15.79 ? 294 ILE D O   1 
ATOM   2971 C  CB  . ILE C 1 144 ? 71.544 -0.699  78.754  1.00 7.03  ? 294 ILE D CB  1 
ATOM   2972 C  CG1 . ILE C 1 144 ? 72.475 -0.345  77.589  1.00 7.03  ? 294 ILE D CG1 1 
ATOM   2973 C  CG2 . ILE C 1 144 ? 71.879 0.165   79.948  1.00 7.03  ? 294 ILE D CG2 1 
ATOM   2974 C  CD1 . ILE C 1 144 ? 72.070 -0.938  76.245  1.00 7.03  ? 294 ILE D CD1 1 
ATOM   2975 N  N   . GLU C 1 145 ? 74.100 -2.051  79.136  1.00 35.17 ? 295 GLU D N   1 
ATOM   2976 C  CA  . GLU C 1 145 ? 75.473 -2.171  79.630  1.00 35.17 ? 295 GLU D CA  1 
ATOM   2977 C  C   . GLU C 1 145 ? 75.973 -3.605  79.503  1.00 35.17 ? 295 GLU D C   1 
ATOM   2978 O  O   . GLU C 1 145 ? 75.194 -4.445  79.006  1.00 35.17 ? 295 GLU D O   1 
ATOM   2979 C  CB  . GLU C 1 145 ? 75.574 -1.699  81.092  1.00 41.43 ? 295 GLU D CB  1 
ATOM   2980 C  CG  . GLU C 1 145 ? 76.997 -1.411  81.569  1.00 41.43 ? 295 GLU D CG  1 
ATOM   2981 C  CD  . GLU C 1 145 ? 77.537 -0.042  81.130  1.00 41.43 ? 295 GLU D CD  1 
ATOM   2982 O  OE1 . GLU C 1 145 ? 77.103 0.476   80.076  1.00 41.43 ? 295 GLU D OE1 1 
ATOM   2983 O  OE2 . GLU C 1 145 ? 78.419 0.512   81.837  1.00 41.43 ? 295 GLU D OE2 1 
ATOM   2984 N  N   . LYS D 2 11  ? 49.719 20.597  114.429 1.00 31.71 ? 320 LYS E N   1 
ATOM   2985 C  CA  . LYS D 2 11  ? 49.037 20.639  113.094 1.00 31.71 ? 320 LYS E CA  1 
ATOM   2986 C  C   . LYS D 2 11  ? 49.993 20.200  111.973 1.00 31.71 ? 320 LYS E C   1 
ATOM   2987 O  O   . LYS D 2 11  ? 50.789 21.014  111.501 1.00 31.71 ? 320 LYS E O   1 
ATOM   2988 C  CB  . LYS D 2 11  ? 48.543 22.063  112.815 1.00 7.03  ? 320 LYS E CB  1 
ATOM   2989 C  CG  . LYS D 2 11  ? 47.721 22.210  111.535 1.00 7.03  ? 320 LYS E CG  1 
ATOM   2990 C  CD  . LYS D 2 11  ? 46.236 22.128  111.811 1.00 7.03  ? 320 LYS E CD  1 
ATOM   2991 C  CE  . LYS D 2 11  ? 45.456 22.170  110.521 1.00 7.03  ? 320 LYS E CE  1 
ATOM   2992 N  NZ  . LYS D 2 11  ? 45.731 23.413  109.769 1.00 7.03  ? 320 LYS E NZ  1 
ATOM   2993 N  N   . ILE D 2 12  ? 49.915 18.936  111.541 1.00 8.38  ? 321 ILE E N   1 
ATOM   2994 C  CA  . ILE D 2 12  ? 50.811 18.451  110.477 1.00 8.38  ? 321 ILE E CA  1 
ATOM   2995 C  C   . ILE D 2 12  ? 50.114 17.755  109.309 1.00 8.38  ? 321 ILE E C   1 
ATOM   2996 O  O   . ILE D 2 12  ? 48.988 17.290  109.444 1.00 8.38  ? 321 ILE E O   1 
ATOM   2997 C  CB  . ILE D 2 12  ? 51.926 17.498  111.048 1.00 27.76 ? 321 ILE E CB  1 
ATOM   2998 C  CG1 . ILE D 2 12  ? 51.321 16.197  111.572 1.00 27.76 ? 321 ILE E CG1 1 
ATOM   2999 C  CG2 . ILE D 2 12  ? 52.702 18.196  112.168 1.00 27.76 ? 321 ILE E CG2 1 
ATOM   3000 C  CD1 . ILE D 2 12  ? 51.435 15.037  110.596 1.00 27.76 ? 321 ILE E CD1 1 
ATOM   3001 N  N   . PRO D 2 13  ? 50.780 17.690  108.144 1.00 7.20  ? 322 PRO E N   1 
ATOM   3002 C  CA  . PRO D 2 13  ? 50.238 17.054  106.939 1.00 7.20  ? 322 PRO E CA  1 
ATOM   3003 C  C   . PRO D 2 13  ? 49.785 15.631  107.235 1.00 7.20  ? 322 PRO E C   1 
ATOM   3004 O  O   . PRO D 2 13  ? 50.453 14.916  107.986 1.00 7.20  ? 322 PRO E O   1 
ATOM   3005 C  CB  . PRO D 2 13  ? 51.422 17.070  105.981 1.00 7.03  ? 322 PRO E CB  1 
ATOM   3006 C  CG  . PRO D 2 13  ? 52.164 18.243  106.395 1.00 7.03  ? 322 PRO E CG  1 
ATOM   3007 C  CD  . PRO D 2 13  ? 52.143 18.163  107.888 1.00 7.03  ? 322 PRO E CD  1 
ATOM   3008 N  N   . VAL D 2 14  ? 48.672 15.205  106.643 1.00 31.78 ? 323 VAL E N   1 
ATOM   3009 C  CA  . VAL D 2 14  ? 48.183 13.848  106.893 1.00 31.78 ? 323 VAL E CA  1 
ATOM   3010 C  C   . VAL D 2 14  ? 48.804 12.769  106.010 1.00 31.78 ? 323 VAL E C   1 
ATOM   3011 O  O   . VAL D 2 14  ? 48.749 11.588  106.352 1.00 31.78 ? 323 VAL E O   1 
ATOM   3012 C  CB  . VAL D 2 14  ? 46.665 13.752  106.727 1.00 33.55 ? 323 VAL E CB  1 
ATOM   3013 C  CG1 . VAL D 2 14  ? 45.982 14.742  107.654 1.00 33.55 ? 323 VAL E CG1 1 
ATOM   3014 C  CG2 . VAL D 2 14  ? 46.290 13.992  105.275 1.00 33.55 ? 323 VAL E CG2 1 
ATOM   3015 N  N   . GLU D 2 15  ? 49.386 13.168  104.881 1.00 20.49 ? 324 GLU E N   1 
ATOM   3016 C  CA  . GLU D 2 15  ? 50.006 12.218  103.964 1.00 20.49 ? 324 GLU E CA  1 
ATOM   3017 C  C   . GLU D 2 15  ? 51.451 11.942  104.327 1.00 20.49 ? 324 GLU E C   1 
ATOM   3018 O  O   . GLU D 2 15  ? 52.118 11.129  103.686 1.00 20.49 ? 324 GLU E O   1 
ATOM   3019 C  CB  . GLU D 2 15  ? 49.932 12.747  102.538 1.00 8.07  ? 324 GLU E CB  1 
ATOM   3020 C  CG  . GLU D 2 15  ? 48.523 12.937  102.056 1.00 8.07  ? 324 GLU E CG  1 
ATOM   3021 C  CD  . GLU D 2 15  ? 47.779 11.636  101.931 1.00 8.07  ? 324 GLU E CD  1 
ATOM   3022 O  OE1 . GLU D 2 15  ? 47.802 10.843  102.897 1.00 8.07  ? 324 GLU E OE1 1 
ATOM   3023 O  OE2 . GLU D 2 15  ? 47.171 11.409  100.866 1.00 8.07  ? 324 GLU E OE2 1 
ATOM   3024 N  N   . ALA D 2 16  ? 51.931 12.621  105.362 1.00 8.14  ? 325 ALA E N   1 
ATOM   3025 C  CA  . ALA D 2 16  ? 53.305 12.448  105.807 1.00 8.14  ? 325 ALA E CA  1 
ATOM   3026 C  C   . ALA D 2 16  ? 53.437 11.296  106.794 1.00 8.14  ? 325 ALA E C   1 
ATOM   3027 O  O   . ALA D 2 16  ? 52.471 10.894  107.446 1.00 8.14  ? 325 ALA E O   1 
ATOM   3028 C  CB  . ALA D 2 16  ? 53.826 13.741  106.424 1.00 7.03  ? 325 ALA E CB  1 
ATOM   3029 N  N   . ASP D 2 17  ? 54.660 10.789  106.895 1.00 7.03  ? 326 ASP E N   1 
ATOM   3030 C  CA  . ASP D 2 17  ? 54.976 9.671   107.756 1.00 7.03  ? 326 ASP E CA  1 
ATOM   3031 C  C   . ASP D 2 17  ? 54.602 8.393   107.052 1.00 7.03  ? 326 ASP E C   1 
ATOM   3032 O  O   . ASP D 2 17  ? 54.540 7.340   107.663 1.00 7.03  ? 326 ASP E O   1 
ATOM   3033 C  CB  . ASP D 2 17  ? 54.228 9.754   109.074 1.00 13.51 ? 326 ASP E CB  1 
ATOM   3034 C  CG  . ASP D 2 17  ? 54.785 10.809  109.987 1.00 13.51 ? 326 ASP E CG  1 
ATOM   3035 O  OD1 . ASP D 2 17  ? 55.982 11.149  109.863 1.00 13.51 ? 326 ASP E OD1 1 
ATOM   3036 O  OD2 . ASP D 2 17  ? 54.022 11.279  110.852 1.00 13.51 ? 326 ASP E OD2 1 
ATOM   3037 N  N   . PHE D 2 18  ? 54.324 8.495   105.762 1.00 7.03  ? 327 PHE E N   1 
ATOM   3038 C  CA  . PHE D 2 18  ? 53.995 7.324   104.983 1.00 7.03  ? 327 PHE E CA  1 
ATOM   3039 C  C   . PHE D 2 18  ? 55.272 6.903   104.305 1.00 7.03  ? 327 PHE E C   1 
ATOM   3040 O  O   . PHE D 2 18  ? 56.274 7.610   104.354 1.00 7.03  ? 327 PHE E O   1 
ATOM   3041 C  CB  . PHE D 2 18  ? 52.929 7.632   103.936 1.00 7.03  ? 327 PHE E CB  1 
ATOM   3042 C  CG  . PHE D 2 18  ? 51.527 7.374   104.406 1.00 7.03  ? 327 PHE E CG  1 
ATOM   3043 C  CD1 . PHE D 2 18  ? 50.974 8.116   105.446 1.00 7.03  ? 327 PHE E CD1 1 
ATOM   3044 C  CD2 . PHE D 2 18  ? 50.753 6.384   103.804 1.00 7.03  ? 327 PHE E CD2 1 
ATOM   3045 C  CE1 . PHE D 2 18  ? 49.666 7.873   105.880 1.00 7.03  ? 327 PHE E CE1 1 
ATOM   3046 C  CE2 . PHE D 2 18  ? 49.452 6.134   104.225 1.00 7.03  ? 327 PHE E CE2 1 
ATOM   3047 C  CZ  . PHE D 2 18  ? 48.905 6.878   105.265 1.00 7.03  ? 327 PHE E CZ  1 
ATOM   3048 N  N   . LEU D 2 19  ? 55.230 5.737   103.682 1.00 7.06  ? 328 LEU E N   1 
ATOM   3049 C  CA  . LEU D 2 19  ? 56.374 5.176   102.982 1.00 7.06  ? 328 LEU E CA  1 
ATOM   3050 C  C   . LEU D 2 19  ? 55.910 3.997   102.156 1.00 7.06  ? 328 LEU E C   1 
ATOM   3051 O  O   . LEU D 2 19  ? 55.270 3.074   102.656 1.00 7.06  ? 328 LEU E O   1 
ATOM   3052 C  CB  . LEU D 2 19  ? 57.426 4.708   103.970 1.00 7.03  ? 328 LEU E CB  1 
ATOM   3053 C  CG  . LEU D 2 19  ? 58.219 3.510   103.480 1.00 7.03  ? 328 LEU E CG  1 
ATOM   3054 C  CD1 . LEU D 2 19  ? 59.079 3.835   102.278 1.00 7.03  ? 328 LEU E CD1 1 
ATOM   3055 C  CD2 . LEU D 2 19  ? 59.032 3.036   104.639 1.00 7.03  ? 328 LEU E CD2 1 
ATOM   3056 N  N   . TYR D 2 20  ? 56.242 4.029   100.883 1.00 7.93  ? 329 TYR E N   1 
ATOM   3057 C  CA  . TYR D 2 20  ? 55.836 2.970   100.004 1.00 7.93  ? 329 TYR E CA  1 
ATOM   3058 C  C   . TYR D 2 20  ? 57.074 2.434   99.317  1.00 7.93  ? 329 TYR E C   1 
ATOM   3059 O  O   . TYR D 2 20  ? 57.690 3.121   98.516  1.00 7.93  ? 329 TYR E O   1 
ATOM   3060 C  CB  . TYR D 2 20  ? 54.875 3.508   98.940  1.00 14.95 ? 329 TYR E CB  1 
ATOM   3061 C  CG  . TYR D 2 20  ? 53.709 4.342   99.439  1.00 14.95 ? 329 TYR E CG  1 
ATOM   3062 C  CD1 . TYR D 2 20  ? 53.912 5.523   100.151 1.00 14.95 ? 329 TYR E CD1 1 
ATOM   3063 C  CD2 . TYR D 2 20  ? 52.398 3.971   99.157  1.00 14.95 ? 329 TYR E CD2 1 
ATOM   3064 C  CE1 . TYR D 2 20  ? 52.828 6.318   100.575 1.00 14.95 ? 329 TYR E CE1 1 
ATOM   3065 C  CE2 . TYR D 2 20  ? 51.311 4.754   99.573  1.00 14.95 ? 329 TYR E CE2 1 
ATOM   3066 C  CZ  . TYR D 2 20  ? 51.535 5.922   100.281 1.00 14.95 ? 329 TYR E CZ  1 
ATOM   3067 O  OH  . TYR D 2 20  ? 50.457 6.667   100.704 1.00 14.95 ? 329 TYR E OH  1 
ATOM   3068 N  N   . ALA D 2 21  ? 57.460 1.212   99.627  1.00 38.39 ? 330 ALA E N   1 
ATOM   3069 C  CA  . ALA D 2 21  ? 58.614 0.639   98.959  1.00 38.39 ? 330 ALA E CA  1 
ATOM   3070 C  C   . ALA D 2 21  ? 58.054 -0.418  98.018  1.00 38.39 ? 330 ALA E C   1 
ATOM   3071 O  O   . ALA D 2 21  ? 57.768 -1.533  98.438  1.00 38.39 ? 330 ALA E O   1 
ATOM   3072 C  CB  . ALA D 2 21  ? 59.566 0.011   99.973  1.00 24.69 ? 330 ALA E CB  1 
ATOM   3073 N  N   . TYR D 2 22  ? 57.868 -0.044  96.757  1.00 7.03  ? 331 TYR E N   1 
ATOM   3074 C  CA  . TYR D 2 22  ? 57.338 -0.940  95.735  1.00 7.03  ? 331 TYR E CA  1 
ATOM   3075 C  C   . TYR D 2 22  ? 58.419 -1.920  95.250  1.00 7.03  ? 331 TYR E C   1 
ATOM   3076 O  O   . TYR D 2 22  ? 59.617 -1.623  95.302  1.00 7.03  ? 331 TYR E O   1 
ATOM   3077 C  CB  . TYR D 2 22  ? 56.818 -0.118  94.546  1.00 14.78 ? 331 TYR E CB  1 
ATOM   3078 C  CG  . TYR D 2 22  ? 55.697 0.852   94.877  1.00 14.78 ? 331 TYR E CG  1 
ATOM   3079 C  CD1 . TYR D 2 22  ? 54.363 0.485   94.730  1.00 14.78 ? 331 TYR E CD1 1 
ATOM   3080 C  CD2 . TYR D 2 22  ? 55.973 2.132   95.365  1.00 14.78 ? 331 TYR E CD2 1 
ATOM   3081 C  CE1 . TYR D 2 22  ? 53.330 1.367   95.066  1.00 14.78 ? 331 TYR E CE1 1 
ATOM   3082 C  CE2 . TYR D 2 22  ? 54.947 3.015   95.703  1.00 14.78 ? 331 TYR E CE2 1 
ATOM   3083 C  CZ  . TYR D 2 22  ? 53.633 2.624   95.552  1.00 14.78 ? 331 TYR E CZ  1 
ATOM   3084 O  OH  . TYR D 2 22  ? 52.615 3.473   95.905  1.00 14.78 ? 331 TYR E OH  1 
ATOM   3085 N  N   . SER D 2 23  ? 57.981 -3.084  94.777  1.00 8.10  ? 332 SER E N   1 
ATOM   3086 C  CA  . SER D 2 23  ? 58.886 -4.111  94.275  1.00 8.10  ? 332 SER E CA  1 
ATOM   3087 C  C   . SER D 2 23  ? 59.435 -3.712  92.920  1.00 8.10  ? 332 SER E C   1 
ATOM   3088 O  O   . SER D 2 23  ? 60.518 -4.131  92.513  1.00 8.10  ? 332 SER E O   1 
ATOM   3089 C  CB  . SER D 2 23  ? 58.146 -5.435  94.145  1.00 9.62  ? 332 SER E CB  1 
ATOM   3090 O  OG  . SER D 2 23  ? 56.990 -5.268  93.354  1.00 9.62  ? 332 SER E OG  1 
ATOM   3091 N  N   . THR D 2 24  ? 58.658 -2.905  92.214  1.00 18.15 ? 333 THR E N   1 
ATOM   3092 C  CA  . THR D 2 24  ? 59.060 -2.438  90.904  1.00 18.15 ? 333 THR E CA  1 
ATOM   3093 C  C   . THR D 2 24  ? 58.690 -0.973  90.711  1.00 18.15 ? 333 THR E C   1 
ATOM   3094 O  O   . THR D 2 24  ? 58.033 -0.360  91.554  1.00 18.15 ? 333 THR E O   1 
ATOM   3095 C  CB  . THR D 2 24  ? 58.411 -3.273  89.794  1.00 7.03  ? 333 THR E CB  1 
ATOM   3096 O  OG1 . THR D 2 24  ? 58.904 -2.841  88.524  1.00 7.03  ? 333 THR E OG1 1 
ATOM   3097 C  CG2 . THR D 2 24  ? 56.916 -3.129  89.825  1.00 7.03  ? 333 THR E CG2 1 
ATOM   3098 N  N   . ALA D 2 25  ? 59.143 -0.418  89.594  1.00 31.77 ? 334 ALA E N   1 
ATOM   3099 C  CA  . ALA D 2 25  ? 58.886 0.969   89.241  1.00 31.77 ? 334 ALA E CA  1 
ATOM   3100 C  C   . ALA D 2 25  ? 57.559 1.022   88.509  1.00 31.77 ? 334 ALA E C   1 
ATOM   3101 O  O   . ALA D 2 25  ? 57.093 0.021   87.976  1.00 31.77 ? 334 ALA E O   1 
ATOM   3102 C  CB  . ALA D 2 25  ? 60.006 1.503   88.349  1.00 16.55 ? 334 ALA E CB  1 
ATOM   3103 N  N   . PRO D 2 26  ? 56.941 2.204   88.462  1.00 29.20 ? 335 PRO E N   1 
ATOM   3104 C  CA  . PRO D 2 26  ? 55.649 2.484   87.819  1.00 29.20 ? 335 PRO E CA  1 
ATOM   3105 C  C   . PRO D 2 26  ? 55.460 2.050   86.368  1.00 29.20 ? 335 PRO E C   1 
ATOM   3106 O  O   . PRO D 2 26  ? 56.207 2.470   85.491  1.00 29.20 ? 335 PRO E O   1 
ATOM   3107 C  CB  . PRO D 2 26  ? 55.523 3.988   87.977  1.00 41.70 ? 335 PRO E CB  1 
ATOM   3108 C  CG  . PRO D 2 26  ? 56.219 4.226   89.295  1.00 41.70 ? 335 PRO E CG  1 
ATOM   3109 C  CD  . PRO D 2 26  ? 57.457 3.403   89.142  1.00 41.70 ? 335 PRO E CD  1 
ATOM   3110 N  N   . GLY D 2 27  ? 54.446 1.221   86.126  1.00 7.61  ? 336 GLY E N   1 
ATOM   3111 C  CA  . GLY D 2 27  ? 54.154 0.756   84.779  1.00 7.61  ? 336 GLY E CA  1 
ATOM   3112 C  C   . GLY D 2 27  ? 54.739 -0.589  84.379  1.00 7.61  ? 336 GLY E C   1 
ATOM   3113 O  O   . GLY D 2 27  ? 54.299 -1.194  83.394  1.00 7.61  ? 336 GLY E O   1 
ATOM   3114 N  N   . TYR D 2 28  ? 55.716 -1.056  85.154  1.00 7.03  ? 337 TYR E N   1 
ATOM   3115 C  CA  . TYR D 2 28  ? 56.413 -2.309  84.894  1.00 7.03  ? 337 TYR E CA  1 
ATOM   3116 C  C   . TYR D 2 28  ? 55.851 -3.554  85.569  1.00 7.03  ? 337 TYR E C   1 
ATOM   3117 O  O   . TYR D 2 28  ? 54.943 -3.493  86.404  1.00 7.03  ? 337 TYR E O   1 
ATOM   3118 C  CB  . TYR D 2 28  ? 57.886 -2.159  85.287  1.00 11.42 ? 337 TYR E CB  1 
ATOM   3119 C  CG  . TYR D 2 28  ? 58.676 -1.241  84.381  1.00 11.42 ? 337 TYR E CG  1 
ATOM   3120 C  CD1 . TYR D 2 28  ? 58.349 0.105   84.253  1.00 11.42 ? 337 TYR E CD1 1 
ATOM   3121 C  CD2 . TYR D 2 28  ? 59.723 -1.733  83.607  1.00 11.42 ? 337 TYR E CD2 1 
ATOM   3122 C  CE1 . TYR D 2 28  ? 59.039 0.937   83.370  1.00 11.42 ? 337 TYR E CE1 1 
ATOM   3123 C  CE2 . TYR D 2 28  ? 60.422 -0.908  82.716  1.00 11.42 ? 337 TYR E CE2 1 
ATOM   3124 C  CZ  . TYR D 2 28  ? 60.074 0.423   82.598  1.00 11.42 ? 337 TYR E CZ  1 
ATOM   3125 O  OH  . TYR D 2 28  ? 60.742 1.232   81.697  1.00 11.42 ? 337 TYR E OH  1 
ATOM   3126 N  N   . TYR D 2 29  ? 56.411 -4.690  85.171  1.00 12.96 ? 338 TYR E N   1 
ATOM   3127 C  CA  . TYR D 2 29  ? 56.043 -5.995  85.707  1.00 12.96 ? 338 TYR E CA  1 
ATOM   3128 C  C   . TYR D 2 29  ? 56.959 -6.284  86.886  1.00 12.96 ? 338 TYR E C   1 
ATOM   3129 O  O   . TYR D 2 29  ? 58.095 -5.821  86.922  1.00 12.96 ? 338 TYR E O   1 
ATOM   3130 C  CB  . TYR D 2 29  ? 56.308 -7.098  84.689  1.00 11.61 ? 338 TYR E CB  1 
ATOM   3131 C  CG  . TYR D 2 29  ? 55.237 -7.403  83.675  1.00 11.61 ? 338 TYR E CG  1 
ATOM   3132 C  CD1 . TYR D 2 29  ? 53.960 -7.792  84.063  1.00 11.61 ? 338 TYR E CD1 1 
ATOM   3133 C  CD2 . TYR D 2 29  ? 55.545 -7.428  82.320  1.00 11.61 ? 338 TYR E CD2 1 
ATOM   3134 C  CE1 . TYR D 2 29  ? 53.027 -8.211  83.116  1.00 11.61 ? 338 TYR E CE1 1 
ATOM   3135 C  CE2 . TYR D 2 29  ? 54.627 -7.841  81.377  1.00 11.61 ? 338 TYR E CE2 1 
ATOM   3136 C  CZ  . TYR D 2 29  ? 53.377 -8.233  81.771  1.00 11.61 ? 338 TYR E CZ  1 
ATOM   3137 O  OH  . TYR D 2 29  ? 52.499 -8.671  80.809  1.00 11.61 ? 338 TYR E OH  1 
ATOM   3138 N  N   . SER D 2 30  ? 56.470 -7.067  87.837  1.00 7.03  ? 339 SER E N   1 
ATOM   3139 C  CA  . SER D 2 30  ? 57.282 -7.443  88.974  1.00 7.03  ? 339 SER E CA  1 
ATOM   3140 C  C   . SER D 2 30  ? 57.581 -8.921  88.843  1.00 7.03  ? 339 SER E C   1 
ATOM   3141 O  O   . SER D 2 30  ? 56.694 -9.729  88.539  1.00 7.03  ? 339 SER E O   1 
ATOM   3142 C  CB  . SER D 2 30  ? 56.553 -7.175  90.277  1.00 7.03  ? 339 SER E CB  1 
ATOM   3143 O  OG  . SER D 2 30  ? 56.497 -5.792  90.526  1.00 7.03  ? 339 SER E OG  1 
ATOM   3144 N  N   . TRP D 2 31  ? 58.844 -9.267  89.063  1.00 24.71 ? 340 TRP E N   1 
ATOM   3145 C  CA  . TRP D 2 31  ? 59.288 -10.642 88.961  1.00 24.71 ? 340 TRP E CA  1 
ATOM   3146 C  C   . TRP D 2 31  ? 59.311 -11.367 90.300  1.00 24.71 ? 340 TRP E C   1 
ATOM   3147 O  O   . TRP D 2 31  ? 59.758 -10.827 91.315  1.00 24.71 ? 340 TRP E O   1 
ATOM   3148 C  CB  . TRP D 2 31  ? 60.666 -10.698 88.305  1.00 11.51 ? 340 TRP E CB  1 
ATOM   3149 C  CG  . TRP D 2 31  ? 60.667 -10.120 86.941  1.00 11.51 ? 340 TRP E CG  1 
ATOM   3150 C  CD1 . TRP D 2 31  ? 60.972 -8.851  86.604  1.00 11.51 ? 340 TRP E CD1 1 
ATOM   3151 C  CD2 . TRP D 2 31  ? 60.290 -10.782 85.728  1.00 11.51 ? 340 TRP E CD2 1 
ATOM   3152 N  NE1 . TRP D 2 31  ? 60.811 -8.664  85.255  1.00 11.51 ? 340 TRP E NE1 1 
ATOM   3153 C  CE2 . TRP D 2 31  ? 60.395 -9.837  84.690  1.00 11.51 ? 340 TRP E CE2 1 
ATOM   3154 C  CE3 . TRP D 2 31  ? 59.875 -12.083 85.416  1.00 11.51 ? 340 TRP E CE3 1 
ATOM   3155 C  CZ2 . TRP D 2 31  ? 60.096 -10.148 83.351  1.00 11.51 ? 340 TRP E CZ2 1 
ATOM   3156 C  CZ3 . TRP D 2 31  ? 59.575 -12.395 84.084  1.00 11.51 ? 340 TRP E CZ3 1 
ATOM   3157 C  CH2 . TRP D 2 31  ? 59.691 -11.431 83.071  1.00 11.51 ? 340 TRP E CH2 1 
ATOM   3158 N  N   . ARG D 2 32  ? 58.811 -12.599 90.262  1.00 7.03  ? 341 ARG E N   1 
ATOM   3159 C  CA  . ARG D 2 32  ? 58.711 -13.493 91.408  1.00 7.03  ? 341 ARG E CA  1 
ATOM   3160 C  C   . ARG D 2 32  ? 59.149 -14.887 90.951  1.00 7.03  ? 341 ARG E C   1 
ATOM   3161 O  O   . ARG D 2 32  ? 58.854 -15.287 89.832  1.00 7.03  ? 341 ARG E O   1 
ATOM   3162 C  CB  . ARG D 2 32  ? 57.266 -13.515 91.885  1.00 7.08  ? 341 ARG E CB  1 
ATOM   3163 C  CG  . ARG D 2 32  ? 56.937 -14.561 92.912  1.00 7.08  ? 341 ARG E CG  1 
ATOM   3164 C  CD  . ARG D 2 32  ? 55.484 -14.912 92.740  1.00 7.08  ? 341 ARG E CD  1 
ATOM   3165 N  NE  . ARG D 2 32  ? 55.242 -15.358 91.367  1.00 7.08  ? 341 ARG E NE  1 
ATOM   3166 C  CZ  . ARG D 2 32  ? 54.226 -14.962 90.610  1.00 7.08  ? 341 ARG E CZ  1 
ATOM   3167 N  NH1 . ARG D 2 32  ? 53.337 -14.094 91.081  1.00 7.08  ? 341 ARG E NH1 1 
ATOM   3168 N  NH2 . ARG D 2 32  ? 54.095 -15.445 89.382  1.00 7.08  ? 341 ARG E NH2 1 
ATOM   3169 N  N   . ASN D 2 33  ? 59.846 -15.621 91.817  1.00 33.61 ? 342 ASN E N   1 
ATOM   3170 C  CA  . ASN D 2 33  ? 60.340 -16.964 91.475  1.00 33.61 ? 342 ASN E CA  1 
ATOM   3171 C  C   . ASN D 2 33  ? 59.437 -18.129 91.925  1.00 33.61 ? 342 ASN E C   1 
ATOM   3172 O  O   . ASN D 2 33  ? 59.132 -18.285 93.108  1.00 33.61 ? 342 ASN E O   1 
ATOM   3173 C  CB  . ASN D 2 33  ? 61.756 -17.154 92.041  1.00 39.90 ? 342 ASN E CB  1 
ATOM   3174 C  CG  . ASN D 2 33  ? 62.424 -18.445 91.563  1.00 39.90 ? 342 ASN E CG  1 
ATOM   3175 O  OD1 . ASN D 2 33  ? 63.530 -18.774 92.002  1.00 39.90 ? 342 ASN E OD1 1 
ATOM   3176 N  ND2 . ASN D 2 33  ? 61.758 -19.174 90.664  1.00 39.90 ? 342 ASN E ND2 1 
ATOM   3177 N  N   . SER D 2 34  ? 59.036 -18.955 90.963  1.00 7.03  ? 343 SER E N   1 
ATOM   3178 C  CA  . SER D 2 34  ? 58.164 -20.083 91.237  1.00 7.03  ? 343 SER E CA  1 
ATOM   3179 C  C   . SER D 2 34  ? 58.736 -20.995 92.307  1.00 7.03  ? 343 SER E C   1 
ATOM   3180 O  O   . SER D 2 34  ? 58.057 -21.890 92.798  1.00 7.03  ? 343 SER E O   1 
ATOM   3181 C  CB  . SER D 2 34  ? 57.917 -20.855 89.947  1.00 8.35  ? 343 SER E CB  1 
ATOM   3182 O  OG  . SER D 2 34  ? 57.346 -20.001 88.966  1.00 8.35  ? 343 SER E OG  1 
ATOM   3183 N  N   . LYS D 2 35  ? 59.989 -20.752 92.674  1.00 9.35  ? 344 LYS E N   1 
ATOM   3184 C  CA  . LYS D 2 35  ? 60.645 -21.549 93.700  1.00 9.35  ? 344 LYS E CA  1 
ATOM   3185 C  C   . LYS D 2 35  ? 60.973 -20.738 94.956  1.00 9.35  ? 344 LYS E C   1 
ATOM   3186 O  O   . LYS D 2 35  ? 60.322 -20.892 95.982  1.00 9.35  ? 344 LYS E O   1 
ATOM   3187 C  CB  . LYS D 2 35  ? 61.931 -22.185 93.148  1.00 33.23 ? 344 LYS E CB  1 
ATOM   3188 C  CG  . LYS D 2 35  ? 62.562 -23.222 94.095  1.00 33.23 ? 344 LYS E CG  1 
ATOM   3189 C  CD  . LYS D 2 35  ? 63.867 -23.822 93.546  1.00 33.23 ? 344 LYS E CD  1 
ATOM   3190 C  CE  . LYS D 2 35  ? 64.424 -24.898 94.484  1.00 33.23 ? 344 LYS E CE  1 
ATOM   3191 N  NZ  . LYS D 2 35  ? 65.817 -25.306 94.136  1.00 33.23 ? 344 LYS E NZ  1 
ATOM   3192 N  N   . ASP D 2 36  ? 61.967 -19.861 94.866  1.00 8.92  ? 345 ASP E N   1 
ATOM   3193 C  CA  . ASP D 2 36  ? 62.394 -19.066 96.015  1.00 8.92  ? 345 ASP E CA  1 
ATOM   3194 C  C   . ASP D 2 36  ? 61.460 -17.957 96.508  1.00 8.92  ? 345 ASP E C   1 
ATOM   3195 O  O   . ASP D 2 36  ? 61.263 -17.802 97.705  1.00 8.92  ? 345 ASP E O   1 
ATOM   3196 C  CB  . ASP D 2 36  ? 63.780 -18.469 95.750  1.00 50.73 ? 345 ASP E CB  1 
ATOM   3197 C  CG  . ASP D 2 36  ? 64.896 -19.510 95.808  1.00 50.73 ? 345 ASP E CG  1 
ATOM   3198 O  OD1 . ASP D 2 36  ? 65.031 -20.185 96.857  1.00 50.73 ? 345 ASP E OD1 1 
ATOM   3199 O  OD2 . ASP D 2 36  ? 65.646 -19.646 94.809  1.00 50.73 ? 345 ASP E OD2 1 
ATOM   3200 N  N   . GLY D 2 37  ? 60.893 -17.175 95.601  1.00 19.98 ? 346 GLY E N   1 
ATOM   3201 C  CA  . GLY D 2 37  ? 60.014 -16.102 96.029  1.00 19.98 ? 346 GLY E CA  1 
ATOM   3202 C  C   . GLY D 2 37  ? 60.403 -14.798 95.361  1.00 19.98 ? 346 GLY E C   1 
ATOM   3203 O  O   . GLY D 2 37  ? 61.490 -14.682 94.790  1.00 19.98 ? 346 GLY E O   1 
ATOM   3204 N  N   . SER D 2 38  ? 59.518 -13.814 95.442  1.00 7.03  ? 347 SER E N   1 
ATOM   3205 C  CA  . SER D 2 38  ? 59.758 -12.522 94.832  1.00 7.03  ? 347 SER E CA  1 
ATOM   3206 C  C   . SER D 2 38  ? 61.201 -12.042 94.918  1.00 7.03  ? 347 SER E C   1 
ATOM   3207 O  O   . SER D 2 38  ? 61.829 -12.127 95.966  1.00 7.03  ? 347 SER E O   1 
ATOM   3208 C  CB  . SER D 2 38  ? 58.844 -11.488 95.476  1.00 31.98 ? 347 SER E CB  1 
ATOM   3209 O  OG  . SER D 2 38  ? 57.502 -11.937 95.462  1.00 31.98 ? 347 SER E OG  1 
ATOM   3210 N  N   . TRP D 2 39  ? 61.726 -11.556 93.798  1.00 7.03  ? 348 TRP E N   1 
ATOM   3211 C  CA  . TRP D 2 39  ? 63.072 -11.017 93.770  1.00 7.03  ? 348 TRP E CA  1 
ATOM   3212 C  C   . TRP D 2 39  ? 63.132 -10.045 94.928  1.00 7.03  ? 348 TRP E C   1 
ATOM   3213 O  O   . TRP D 2 39  ? 63.714 -10.313 95.977  1.00 7.03  ? 348 TRP E O   1 
ATOM   3214 C  CB  . TRP D 2 39  ? 63.300 -10.238 92.482  1.00 7.03  ? 348 TRP E CB  1 
ATOM   3215 C  CG  . TRP D 2 39  ? 63.468 -11.082 91.282  1.00 7.03  ? 348 TRP E CG  1 
ATOM   3216 C  CD1 . TRP D 2 39  ? 63.313 -12.424 91.210  1.00 7.03  ? 348 TRP E CD1 1 
ATOM   3217 C  CD2 . TRP D 2 39  ? 63.897 -10.657 89.982  1.00 7.03  ? 348 TRP E CD2 1 
ATOM   3218 N  NE1 . TRP D 2 39  ? 63.628 -12.869 89.950  1.00 7.03  ? 348 TRP E NE1 1 
ATOM   3219 C  CE2 . TRP D 2 39  ? 63.986 -11.799 89.175  1.00 7.03  ? 348 TRP E CE2 1 
ATOM   3220 C  CE3 . TRP D 2 39  ? 64.208 -9.416  89.422  1.00 7.03  ? 348 TRP E CE3 1 
ATOM   3221 C  CZ2 . TRP D 2 39  ? 64.379 -11.749 87.847  1.00 7.03  ? 348 TRP E CZ2 1 
ATOM   3222 C  CZ3 . TRP D 2 39  ? 64.603 -9.365  88.089  1.00 7.03  ? 348 TRP E CZ3 1 
ATOM   3223 C  CH2 . TRP D 2 39  ? 64.682 -10.523 87.323  1.00 7.03  ? 348 TRP E CH2 1 
ATOM   3224 N  N   . PHE D 2 40  ? 62.487 -8.909  94.719  1.00 7.03  ? 349 PHE E N   1 
ATOM   3225 C  CA  . PHE D 2 40  ? 62.433 -7.853  95.702  1.00 7.03  ? 349 PHE E CA  1 
ATOM   3226 C  C   . PHE D 2 40  ? 62.165 -8.318  97.125  1.00 7.03  ? 349 PHE E C   1 
ATOM   3227 O  O   . PHE D 2 40  ? 62.773 -7.818  98.065  1.00 7.03  ? 349 PHE E O   1 
ATOM   3228 C  CB  . PHE D 2 40  ? 61.368 -6.839  95.288  1.00 7.03  ? 349 PHE E CB  1 
ATOM   3229 C  CG  . PHE D 2 40  ? 61.083 -5.808  96.328  1.00 7.03  ? 349 PHE E CG  1 
ATOM   3230 C  CD1 . PHE D 2 40  ? 62.106 -5.000  96.824  1.00 7.03  ? 349 PHE E CD1 1 
ATOM   3231 C  CD2 . PHE D 2 40  ? 59.791 -5.637  96.810  1.00 7.03  ? 349 PHE E CD2 1 
ATOM   3232 C  CE1 . PHE D 2 40  ? 61.846 -4.035  97.786  1.00 7.03  ? 349 PHE E CE1 1 
ATOM   3233 C  CE2 . PHE D 2 40  ? 59.511 -4.672  97.773  1.00 7.03  ? 349 PHE E CE2 1 
ATOM   3234 C  CZ  . PHE D 2 40  ? 60.544 -3.865  98.265  1.00 7.03  ? 349 PHE E CZ  1 
ATOM   3235 N  N   . ILE D 2 41  ? 61.265 -9.277  97.295  1.00 7.03  ? 350 ILE E N   1 
ATOM   3236 C  CA  . ILE D 2 41  ? 60.941 -9.725  98.640  1.00 7.03  ? 350 ILE E CA  1 
ATOM   3237 C  C   . ILE D 2 41  ? 62.021 -10.493 99.371  1.00 7.03  ? 350 ILE E C   1 
ATOM   3238 O  O   . ILE D 2 41  ? 62.119 -10.410 100.600 1.00 7.03  ? 350 ILE E O   1 
ATOM   3239 C  CB  . ILE D 2 41  ? 59.662 -10.556 98.666  1.00 7.03  ? 350 ILE E CB  1 
ATOM   3240 C  CG1 . ILE D 2 41  ? 58.470 -9.667  98.303  1.00 7.03  ? 350 ILE E CG1 1 
ATOM   3241 C  CG2 . ILE D 2 41  ? 59.456 -11.126 100.057 1.00 7.03  ? 350 ILE E CG2 1 
ATOM   3242 C  CD1 . ILE D 2 41  ? 58.135 -8.614  99.350  1.00 7.03  ? 350 ILE E CD1 1 
ATOM   3243 N  N   . GLN D 2 42  ? 62.833 -11.241 98.635  1.00 9.89  ? 351 GLN E N   1 
ATOM   3244 C  CA  . GLN D 2 42  ? 63.882 -11.999 99.287  1.00 9.89  ? 351 GLN E CA  1 
ATOM   3245 C  C   . GLN D 2 42  ? 65.041 -11.063 99.578  1.00 9.89  ? 351 GLN E C   1 
ATOM   3246 O  O   . GLN D 2 42  ? 65.479 -10.936 100.730 1.00 9.89  ? 351 GLN E O   1 
ATOM   3247 C  CB  . GLN D 2 42  ? 64.320 -13.199 98.428  1.00 7.03  ? 351 GLN E CB  1 
ATOM   3248 C  CG  . GLN D 2 42  ? 64.935 -12.886 97.085  1.00 7.03  ? 351 GLN E CG  1 
ATOM   3249 C  CD  . GLN D 2 42  ? 65.365 -14.148 96.327  1.00 7.03  ? 351 GLN E CD  1 
ATOM   3250 O  OE1 . GLN D 2 42  ? 64.603 -14.732 95.542  1.00 7.03  ? 351 GLN E OE1 1 
ATOM   3251 N  NE2 . GLN D 2 42  ? 66.592 -14.578 96.573  1.00 7.03  ? 351 GLN E NE2 1 
ATOM   3252 N  N   . SER D 2 43  ? 65.517 -10.378 98.541  1.00 7.03  ? 352 SER E N   1 
ATOM   3253 C  CA  . SER D 2 43  ? 66.615 -9.439  98.710  1.00 7.03  ? 352 SER E CA  1 
ATOM   3254 C  C   . SER D 2 43  ? 66.304 -8.532  99.893  1.00 7.03  ? 352 SER E C   1 
ATOM   3255 O  O   . SER D 2 43  ? 67.200 -8.104  100.618 1.00 7.03  ? 352 SER E O   1 
ATOM   3256 C  CB  . SER D 2 43  ? 66.778 -8.624  97.443  1.00 7.03  ? 352 SER E CB  1 
ATOM   3257 O  OG  . SER D 2 43  ? 65.529 -8.508  96.805  1.00 7.03  ? 352 SER E OG  1 
ATOM   3258 N  N   . LEU D 2 44  ? 65.018 -8.273  100.098 1.00 7.41  ? 353 LEU E N   1 
ATOM   3259 C  CA  . LEU D 2 44  ? 64.577 -7.420  101.183 1.00 7.41  ? 353 LEU E CA  1 
ATOM   3260 C  C   . LEU D 2 44  ? 64.923 -8.003  102.541 1.00 7.41  ? 353 LEU E C   1 
ATOM   3261 O  O   . LEU D 2 44  ? 65.734 -7.437  103.281 1.00 7.41  ? 353 LEU E O   1 
ATOM   3262 C  CB  . LEU D 2 44  ? 63.075 -7.192  101.106 1.00 7.03  ? 353 LEU E CB  1 
ATOM   3263 C  CG  . LEU D 2 44  ? 62.615 -6.176  102.159 1.00 7.03  ? 353 LEU E CG  1 
ATOM   3264 C  CD1 . LEU D 2 44  ? 63.244 -4.839  101.865 1.00 7.03  ? 353 LEU E CD1 1 
ATOM   3265 C  CD2 . LEU D 2 44  ? 61.119 -6.044  102.161 1.00 7.03  ? 353 LEU E CD2 1 
ATOM   3266 N  N   . CYS D 2 45  ? 64.287 -9.126  102.872 1.00 7.03  ? 354 CYS E N   1 
ATOM   3267 C  CA  . CYS D 2 45  ? 64.523 -9.798  104.151 1.00 7.03  ? 354 CYS E CA  1 
ATOM   3268 C  C   . CYS D 2 45  ? 66.009 -10.012 104.301 1.00 7.03  ? 354 CYS E C   1 
ATOM   3269 O  O   . CYS D 2 45  ? 66.569 -9.862  105.382 1.00 7.03  ? 354 CYS E O   1 
ATOM   3270 C  CB  . CYS D 2 45  ? 63.844 -11.160 104.177 1.00 14.28 ? 354 CYS E CB  1 
ATOM   3271 S  SG  . CYS D 2 45  ? 62.175 -11.182 103.523 1.00 14.28 ? 354 CYS E SG  1 
ATOM   3272 N  N   . ALA D 2 46  ? 66.629 -10.372 103.183 1.00 18.85 ? 355 ALA E N   1 
ATOM   3273 C  CA  . ALA D 2 46  ? 68.057 -10.644 103.118 1.00 18.85 ? 355 ALA E CA  1 
ATOM   3274 C  C   . ALA D 2 46  ? 68.916 -9.475  103.578 1.00 18.85 ? 355 ALA E C   1 
ATOM   3275 O  O   . ALA D 2 46  ? 70.019 -9.668  104.087 1.00 18.85 ? 355 ALA E O   1 
ATOM   3276 C  CB  . ALA D 2 46  ? 68.435 -11.042 101.705 1.00 23.75 ? 355 ALA E CB  1 
ATOM   3277 N  N   . MET D 2 47  ? 68.413 -8.261  103.392 1.00 27.23 ? 356 MET E N   1 
ATOM   3278 C  CA  . MET D 2 47  ? 69.140 -7.069  103.804 1.00 27.23 ? 356 MET E CA  1 
ATOM   3279 C  C   . MET D 2 47  ? 68.738 -6.727  105.220 1.00 27.23 ? 356 MET E C   1 
ATOM   3280 O  O   . MET D 2 47  ? 69.574 -6.443  106.071 1.00 27.23 ? 356 MET E O   1 
ATOM   3281 C  CB  . MET D 2 47  ? 68.814 -5.913  102.869 1.00 17.04 ? 356 MET E CB  1 
ATOM   3282 C  CG  . MET D 2 47  ? 69.387 -6.095  101.481 1.00 17.04 ? 356 MET E CG  1 
ATOM   3283 S  SD  . MET D 2 47  ? 71.187 -6.117  101.497 1.00 17.04 ? 356 MET E SD  1 
ATOM   3284 C  CE  . MET D 2 47  ? 71.528 -7.862  101.658 1.00 17.04 ? 356 MET E CE  1 
ATOM   3285 N  N   . LEU D 2 48  ? 67.442 -6.758  105.470 1.00 7.03  ? 357 LEU E N   1 
ATOM   3286 C  CA  . LEU D 2 48  ? 66.949 -6.472  106.796 1.00 7.03  ? 357 LEU E CA  1 
ATOM   3287 C  C   . LEU D 2 48  ? 67.527 -7.484  107.757 1.00 7.03  ? 357 LEU E C   1 
ATOM   3288 O  O   . LEU D 2 48  ? 67.379 -7.347  108.958 1.00 7.03  ? 357 LEU E O   1 
ATOM   3289 C  CB  . LEU D 2 48  ? 65.437 -6.589  106.830 1.00 22.37 ? 357 LEU E CB  1 
ATOM   3290 C  CG  . LEU D 2 48  ? 64.626 -5.320  107.011 1.00 22.37 ? 357 LEU E CG  1 
ATOM   3291 C  CD1 . LEU D 2 48  ? 63.182 -5.710  107.155 1.00 22.37 ? 357 LEU E CD1 1 
ATOM   3292 C  CD2 . LEU D 2 48  ? 65.087 -4.564  108.228 1.00 22.37 ? 357 LEU E CD2 1 
ATOM   3293 N  N   . LYS D 2 49  ? 68.170 -8.513  107.217 1.00 10.34 ? 358 LYS E N   1 
ATOM   3294 C  CA  . LYS D 2 49  ? 68.763 -9.575  108.033 1.00 10.34 ? 358 LYS E CA  1 
ATOM   3295 C  C   . LYS D 2 49  ? 70.138 -9.161  108.535 1.00 10.34 ? 358 LYS E C   1 
ATOM   3296 O  O   . LYS D 2 49  ? 70.427 -9.196  109.733 1.00 10.34 ? 358 LYS E O   1 
ATOM   3297 C  CB  . LYS D 2 49  ? 68.909 -10.855 107.199 1.00 33.91 ? 358 LYS E CB  1 
ATOM   3298 C  CG  . LYS D 2 49  ? 68.938 -12.154 108.010 1.00 33.91 ? 358 LYS E CG  1 
ATOM   3299 C  CD  . LYS D 2 49  ? 67.540 -12.787 108.110 1.00 33.91 ? 358 LYS E CD  1 
ATOM   3300 C  CE  . LYS D 2 49  ? 67.061 -13.389 106.769 1.00 33.91 ? 358 LYS E CE  1 
ATOM   3301 N  NZ  . LYS D 2 49  ? 65.651 -13.914 106.806 1.00 33.91 ? 358 LYS E NZ  1 
ATOM   3302 N  N   . GLN D 2 50  ? 70.988 -8.786  107.591 1.00 15.44 ? 359 GLN E N   1 
ATOM   3303 C  CA  . GLN D 2 50  ? 72.332 -8.370  107.920 1.00 15.44 ? 359 GLN E CA  1 
ATOM   3304 C  C   . GLN D 2 50  ? 72.326 -6.937  108.430 1.00 15.44 ? 359 GLN E C   1 
ATOM   3305 O  O   . GLN D 2 50  ? 72.959 -6.637  109.439 1.00 15.44 ? 359 GLN E O   1 
ATOM   3306 C  CB  . GLN D 2 50  ? 73.253 -8.439  106.685 1.00 38.49 ? 359 GLN E CB  1 
ATOM   3307 C  CG  . GLN D 2 50  ? 72.931 -9.515  105.637 1.00 38.49 ? 359 GLN E CG  1 
ATOM   3308 C  CD  . GLN D 2 50  ? 73.141 -10.944 106.126 1.00 38.49 ? 359 GLN E CD  1 
ATOM   3309 O  OE1 . GLN D 2 50  ? 72.704 -11.907 105.478 1.00 38.49 ? 359 GLN E OE1 1 
ATOM   3310 N  NE2 . GLN D 2 50  ? 73.812 -11.092 107.264 1.00 38.49 ? 359 GLN E NE2 1 
ATOM   3311 N  N   . TYR D 2 51  ? 71.579 -6.062  107.761 1.00 7.03  ? 360 TYR E N   1 
ATOM   3312 C  CA  . TYR D 2 51  ? 71.586 -4.643  108.104 1.00 7.03  ? 360 TYR E CA  1 
ATOM   3313 C  C   . TYR D 2 51  ? 70.590 -3.964  109.050 1.00 7.03  ? 360 TYR E C   1 
ATOM   3314 O  O   . TYR D 2 51  ? 70.863 -2.858  109.500 1.00 7.03  ? 360 TYR E O   1 
ATOM   3315 C  CB  . TYR D 2 51  ? 71.634 -3.848  106.801 1.00 8.04  ? 360 TYR E CB  1 
ATOM   3316 C  CG  . TYR D 2 51  ? 72.708 -4.323  105.851 1.00 8.04  ? 360 TYR E CG  1 
ATOM   3317 C  CD1 . TYR D 2 51  ? 74.052 -4.233  106.188 1.00 8.04  ? 360 TYR E CD1 1 
ATOM   3318 C  CD2 . TYR D 2 51  ? 72.377 -4.883  104.625 1.00 8.04  ? 360 TYR E CD2 1 
ATOM   3319 C  CE1 . TYR D 2 51  ? 75.040 -4.689  105.329 1.00 8.04  ? 360 TYR E CE1 1 
ATOM   3320 C  CE2 . TYR D 2 51  ? 73.357 -5.345  103.757 1.00 8.04  ? 360 TYR E CE2 1 
ATOM   3321 C  CZ  . TYR D 2 51  ? 74.687 -5.247  104.116 1.00 8.04  ? 360 TYR E CZ  1 
ATOM   3322 O  OH  . TYR D 2 51  ? 75.656 -5.724  103.263 1.00 8.04  ? 360 TYR E OH  1 
ATOM   3323 N  N   . ALA D 2 52  ? 69.458 -4.583  109.365 1.00 7.03  ? 361 ALA E N   1 
ATOM   3324 C  CA  . ALA D 2 52  ? 68.479 -3.945  110.257 1.00 7.03  ? 361 ALA E CA  1 
ATOM   3325 C  C   . ALA D 2 52  ? 68.984 -3.517  111.640 1.00 7.03  ? 361 ALA E C   1 
ATOM   3326 O  O   . ALA D 2 52  ? 68.177 -3.135  112.488 1.00 7.03  ? 361 ALA E O   1 
ATOM   3327 C  CB  . ALA D 2 52  ? 67.290 -4.846  110.438 1.00 7.03  ? 361 ALA E CB  1 
ATOM   3328 N  N   . ASP D 2 53  ? 70.299 -3.594  111.872 1.00 34.00 ? 362 ASP E N   1 
ATOM   3329 C  CA  . ASP D 2 53  ? 70.918 -3.206  113.157 1.00 34.00 ? 362 ASP E CA  1 
ATOM   3330 C  C   . ASP D 2 53  ? 72.262 -2.501  112.959 1.00 34.00 ? 362 ASP E C   1 
ATOM   3331 O  O   . ASP D 2 53  ? 73.052 -2.366  113.898 1.00 34.00 ? 362 ASP E O   1 
ATOM   3332 C  CB  . ASP D 2 53  ? 71.136 -4.434  114.070 1.00 26.86 ? 362 ASP E CB  1 
ATOM   3333 C  CG  . ASP D 2 53  ? 72.205 -5.403  113.540 1.00 26.86 ? 362 ASP E CG  1 
ATOM   3334 O  OD1 . ASP D 2 53  ? 71.931 -6.137  112.567 1.00 26.86 ? 362 ASP E OD1 1 
ATOM   3335 O  OD2 . ASP D 2 53  ? 73.325 -5.434  114.097 1.00 26.86 ? 362 ASP E OD2 1 
ATOM   3336 N  N   . LYS D 2 54  ? 72.517 -2.053  111.733 1.00 18.68 ? 363 LYS E N   1 
ATOM   3337 C  CA  . LYS D 2 54  ? 73.769 -1.372  111.399 1.00 18.68 ? 363 LYS E CA  1 
ATOM   3338 C  C   . LYS D 2 54  ? 73.465 -0.037  110.727 1.00 18.68 ? 363 LYS E C   1 
ATOM   3339 O  O   . LYS D 2 54  ? 74.061 0.992   111.052 1.00 18.68 ? 363 LYS E O   1 
ATOM   3340 C  CB  . LYS D 2 54  ? 74.590 -2.210  110.413 1.00 61.20 ? 363 LYS E CB  1 
ATOM   3341 C  CG  . LYS D 2 54  ? 74.538 -3.727  110.609 1.00 61.20 ? 363 LYS E CG  1 
ATOM   3342 C  CD  . LYS D 2 54  ? 75.721 -4.253  111.413 1.00 61.20 ? 363 LYS E CD  1 
ATOM   3343 C  CE  . LYS D 2 54  ? 75.804 -5.773  111.342 1.00 61.20 ? 363 LYS E CE  1 
ATOM   3344 N  NZ  . LYS D 2 54  ? 76.058 -6.258  109.950 1.00 61.20 ? 363 LYS E NZ  1 
ATOM   3345 N  N   . LEU D 2 55  ? 72.530 -0.091  109.777 1.00 28.16 ? 364 LEU E N   1 
ATOM   3346 C  CA  . LEU D 2 55  ? 72.110 1.058   108.979 1.00 28.16 ? 364 LEU E CA  1 
ATOM   3347 C  C   . LEU D 2 55  ? 70.817 1.736   109.423 1.00 28.16 ? 364 LEU E C   1 
ATOM   3348 O  O   . LEU D 2 55  ? 70.319 1.526   110.543 1.00 28.16 ? 364 LEU E O   1 
ATOM   3349 C  CB  . LEU D 2 55  ? 71.943 0.635   107.525 1.00 7.03  ? 364 LEU E CB  1 
ATOM   3350 C  CG  . LEU D 2 55  ? 73.144 -0.066  106.914 1.00 7.03  ? 364 LEU E CG  1 
ATOM   3351 C  CD1 . LEU D 2 55  ? 72.749 -0.528  105.529 1.00 7.03  ? 364 LEU E CD1 1 
ATOM   3352 C  CD2 . LEU D 2 55  ? 74.357 0.855   106.876 1.00 7.03  ? 364 LEU E CD2 1 
ATOM   3353 N  N   . GLU D 2 56  ? 70.282 2.540   108.504 1.00 7.03  ? 365 GLU E N   1 
ATOM   3354 C  CA  . GLU D 2 56  ? 69.061 3.286   108.727 1.00 7.03  ? 365 GLU E CA  1 
ATOM   3355 C  C   . GLU D 2 56  ? 67.880 2.463   108.239 1.00 7.03  ? 365 GLU E C   1 
ATOM   3356 O  O   . GLU D 2 56  ? 67.503 1.471   108.856 1.00 7.03  ? 365 GLU E O   1 
ATOM   3357 C  CB  . GLU D 2 56  ? 69.150 4.604   107.977 1.00 7.03  ? 365 GLU E CB  1 
ATOM   3358 C  CG  . GLU D 2 56  ? 68.289 5.704   108.537 1.00 7.03  ? 365 GLU E CG  1 
ATOM   3359 C  CD  . GLU D 2 56  ? 67.162 6.056   107.620 1.00 7.03  ? 365 GLU E CD  1 
ATOM   3360 O  OE1 . GLU D 2 56  ? 67.435 6.316   106.431 1.00 7.03  ? 365 GLU E OE1 1 
ATOM   3361 O  OE2 . GLU D 2 56  ? 66.010 6.074   108.086 1.00 7.03  ? 365 GLU E OE2 1 
ATOM   3362 N  N   . PHE D 2 57  ? 67.282 2.877   107.141 1.00 7.03  ? 366 PHE E N   1 
ATOM   3363 C  CA  . PHE D 2 57  ? 66.172 2.128   106.593 1.00 7.03  ? 366 PHE E CA  1 
ATOM   3364 C  C   . PHE D 2 57  ? 66.131 2.420   105.128 1.00 7.03  ? 366 PHE E C   1 
ATOM   3365 O  O   . PHE D 2 57  ? 66.038 1.505   104.313 1.00 7.03  ? 366 PHE E O   1 
ATOM   3366 C  CB  . PHE D 2 57  ? 64.852 2.545   107.201 1.00 7.03  ? 366 PHE E CB  1 
ATOM   3367 C  CG  . PHE D 2 57  ? 63.679 1.819   106.616 1.00 7.03  ? 366 PHE E CG  1 
ATOM   3368 C  CD1 . PHE D 2 57  ? 63.412 0.502   106.965 1.00 7.03  ? 366 PHE E CD1 1 
ATOM   3369 C  CD2 . PHE D 2 57  ? 62.841 2.443   105.705 1.00 7.03  ? 366 PHE E CD2 1 
ATOM   3370 C  CE1 . PHE D 2 57  ? 62.329 -0.166  106.416 1.00 7.03  ? 366 PHE E CE1 1 
ATOM   3371 C  CE2 . PHE D 2 57  ? 61.755 1.763   105.155 1.00 7.03  ? 366 PHE E CE2 1 
ATOM   3372 C  CZ  . PHE D 2 57  ? 61.504 0.472   105.512 1.00 7.03  ? 366 PHE E CZ  1 
ATOM   3373 N  N   . MET D 2 58  ? 66.176 3.711   104.805 1.00 7.03  ? 367 MET E N   1 
ATOM   3374 C  CA  . MET D 2 58  ? 66.175 4.134   103.425 1.00 7.03  ? 367 MET E CA  1 
ATOM   3375 C  C   . MET D 2 58  ? 67.475 3.584   102.949 1.00 7.03  ? 367 MET E C   1 
ATOM   3376 O  O   . MET D 2 58  ? 67.545 2.914   101.919 1.00 7.03  ? 367 MET E O   1 
ATOM   3377 C  CB  . MET D 2 58  ? 66.196 5.647   103.310 1.00 10.01 ? 367 MET E CB  1 
ATOM   3378 C  CG  . MET D 2 58  ? 64.885 6.345   103.673 1.00 10.01 ? 367 MET E CG  1 
ATOM   3379 S  SD  . MET D 2 58  ? 63.500 6.111   102.510 1.00 10.01 ? 367 MET E SD  1 
ATOM   3380 C  CE  . MET D 2 58  ? 62.373 5.093   103.530 1.00 10.01 ? 367 MET E CE  1 
ATOM   3381 N  N   . HIS D 2 59  ? 68.512 3.851   103.731 1.00 7.65  ? 368 HIS E N   1 
ATOM   3382 C  CA  . HIS D 2 59  ? 69.842 3.360   103.404 1.00 7.65  ? 368 HIS E CA  1 
ATOM   3383 C  C   . HIS D 2 59  ? 69.783 1.868   103.199 1.00 7.65  ? 368 HIS E C   1 
ATOM   3384 O  O   . HIS D 2 59  ? 70.500 1.320   102.367 1.00 7.65  ? 368 HIS E O   1 
ATOM   3385 C  CB  . HIS D 2 59  ? 70.820 3.722   104.511 1.00 10.64 ? 368 HIS E CB  1 
ATOM   3386 C  CG  . HIS D 2 59  ? 71.391 5.094   104.360 1.00 10.64 ? 368 HIS E CG  1 
ATOM   3387 N  ND1 . HIS D 2 59  ? 72.348 5.605   105.208 1.00 10.64 ? 368 HIS E ND1 1 
ATOM   3388 C  CD2 . HIS D 2 59  ? 71.156 6.053   103.432 1.00 10.64 ? 368 HIS E CD2 1 
ATOM   3389 C  CE1 . HIS D 2 59  ? 72.678 6.822   104.806 1.00 10.64 ? 368 HIS E CE1 1 
ATOM   3390 N  NE2 . HIS D 2 59  ? 71.970 7.117   103.730 1.00 10.64 ? 368 HIS E NE2 1 
ATOM   3391 N  N   . ILE D 2 60  ? 68.902 1.224   103.949 1.00 7.27  ? 369 ILE E N   1 
ATOM   3392 C  CA  . ILE D 2 60  ? 68.705 -0.203  103.839 1.00 7.27  ? 369 ILE E CA  1 
ATOM   3393 C  C   . ILE D 2 60  ? 67.947 -0.478  102.536 1.00 7.27  ? 369 ILE E C   1 
ATOM   3394 O  O   . ILE D 2 60  ? 68.328 -1.357  101.762 1.00 7.27  ? 369 ILE E O   1 
ATOM   3395 C  CB  . ILE D 2 60  ? 67.920 -0.737  105.075 1.00 7.03  ? 369 ILE E CB  1 
ATOM   3396 C  CG1 . ILE D 2 60  ? 68.721 -0.417  106.348 1.00 7.03  ? 369 ILE E CG1 1 
ATOM   3397 C  CG2 . ILE D 2 60  ? 67.667 -2.244  104.955 1.00 7.03  ? 369 ILE E CG2 1 
ATOM   3398 C  CD1 . ILE D 2 60  ? 68.192 -1.050  107.608 1.00 7.03  ? 369 ILE E CD1 1 
ATOM   3399 N  N   . LEU D 2 61  ? 66.901 0.300   102.273 1.00 7.03  ? 370 LEU E N   1 
ATOM   3400 C  CA  . LEU D 2 61  ? 66.111 0.127   101.062 1.00 7.03  ? 370 LEU E CA  1 
ATOM   3401 C  C   . LEU D 2 61  ? 66.910 0.245   99.760  1.00 7.03  ? 370 LEU E C   1 
ATOM   3402 O  O   . LEU D 2 61  ? 66.539 -0.346  98.753  1.00 7.03  ? 370 LEU E O   1 
ATOM   3403 C  CB  . LEU D 2 61  ? 64.956 1.128   101.050 1.00 7.03  ? 370 LEU E CB  1 
ATOM   3404 C  CG  . LEU D 2 61  ? 63.748 0.680   101.861 1.00 7.03  ? 370 LEU E CG  1 
ATOM   3405 C  CD1 . LEU D 2 61  ? 62.736 1.797   102.052 1.00 7.03  ? 370 LEU E CD1 1 
ATOM   3406 C  CD2 . LEU D 2 61  ? 63.131 -0.485  101.127 1.00 7.03  ? 370 LEU E CD2 1 
ATOM   3407 N  N   . THR D 2 62  ? 68.014 0.980   99.782  1.00 7.03  ? 371 THR E N   1 
ATOM   3408 C  CA  . THR D 2 62  ? 68.831 1.178   98.580  1.00 7.03  ? 371 THR E CA  1 
ATOM   3409 C  C   . THR D 2 62  ? 69.658 -0.020  98.092  1.00 7.03  ? 371 THR E C   1 
ATOM   3410 O  O   . THR D 2 62  ? 69.897 -0.165  96.892  1.00 7.03  ? 371 THR E O   1 
ATOM   3411 C  CB  . THR D 2 62  ? 69.780 2.374   98.771  1.00 7.03  ? 371 THR E CB  1 
ATOM   3412 O  OG1 . THR D 2 62  ? 69.016 3.515   99.179  1.00 7.03  ? 371 THR E OG1 1 
ATOM   3413 C  CG2 . THR D 2 62  ? 70.515 2.698   97.472  1.00 7.03  ? 371 THR E CG2 1 
ATOM   3414 N  N   . ARG D 2 63  ? 70.119 -0.866  99.006  1.00 29.28 ? 372 ARG E N   1 
ATOM   3415 C  CA  . ARG D 2 63  ? 70.887 -2.044  98.604  1.00 29.28 ? 372 ARG E CA  1 
ATOM   3416 C  C   . ARG D 2 63  ? 69.888 -3.097  98.142  1.00 29.28 ? 372 ARG E C   1 
ATOM   3417 O  O   . ARG D 2 63  ? 70.222 -3.966  97.339  1.00 29.28 ? 372 ARG E O   1 
ATOM   3418 C  CB  . ARG D 2 63  ? 71.720 -2.567  99.768  1.00 44.59 ? 372 ARG E CB  1 
ATOM   3419 C  CG  . ARG D 2 63  ? 72.536 -1.475  100.402 1.00 44.59 ? 372 ARG E CG  1 
ATOM   3420 C  CD  . ARG D 2 63  ? 73.528 -1.997  101.409 1.00 44.59 ? 372 ARG E CD  1 
ATOM   3421 N  NE  . ARG D 2 63  ? 74.225 -0.894  102.060 1.00 44.59 ? 372 ARG E NE  1 
ATOM   3422 C  CZ  . ARG D 2 63  ? 75.429 -0.992  102.612 1.00 44.59 ? 372 ARG E CZ  1 
ATOM   3423 N  NH1 . ARG D 2 63  ? 76.076 -2.152  102.592 1.00 44.59 ? 372 ARG E NH1 1 
ATOM   3424 N  NH2 . ARG D 2 63  ? 75.993 0.073   103.177 1.00 44.59 ? 372 ARG E NH2 1 
ATOM   3425 N  N   . VAL D 2 64  ? 68.668 -3.019  98.673  1.00 18.21 ? 373 VAL E N   1 
ATOM   3426 C  CA  . VAL D 2 64  ? 67.604 -3.909  98.254  1.00 18.21 ? 373 VAL E CA  1 
ATOM   3427 C  C   . VAL D 2 64  ? 67.530 -3.673  96.749  1.00 18.21 ? 373 VAL E C   1 
ATOM   3428 O  O   . VAL D 2 64  ? 67.664 -4.599  95.947  1.00 18.21 ? 373 VAL E O   1 
ATOM   3429 C  CB  . VAL D 2 64  ? 66.279 -3.500  98.858  1.00 7.03  ? 373 VAL E CB  1 
ATOM   3430 C  CG1 . VAL D 2 64  ? 65.166 -4.316  98.238  1.00 7.03  ? 373 VAL E CG1 1 
ATOM   3431 C  CG2 . VAL D 2 64  ? 66.330 -3.678  100.346 1.00 7.03  ? 373 VAL E CG2 1 
ATOM   3432 N  N   . ASN D 2 65  ? 67.326 -2.412  96.379  1.00 7.03  ? 374 ASN E N   1 
ATOM   3433 C  CA  . ASN D 2 65  ? 67.268 -2.014  94.981  1.00 7.03  ? 374 ASN E CA  1 
ATOM   3434 C  C   . ASN D 2 65  ? 68.559 -2.472  94.321  1.00 7.03  ? 374 ASN E C   1 
ATOM   3435 O  O   . ASN D 2 65  ? 68.540 -3.085  93.252  1.00 7.03  ? 374 ASN E O   1 
ATOM   3436 C  CB  . ASN D 2 65  ? 67.186 -0.494  94.848  1.00 7.22  ? 374 ASN E CB  1 
ATOM   3437 C  CG  . ASN D 2 65  ? 66.039 0.107   95.619  1.00 7.22  ? 374 ASN E CG  1 
ATOM   3438 O  OD1 . ASN D 2 65  ? 65.994 1.307   95.797  1.00 7.22  ? 374 ASN E OD1 1 
ATOM   3439 N  ND2 . ASN D 2 65  ? 65.109 -0.719  96.076  1.00 7.22  ? 374 ASN E ND2 1 
ATOM   3440 N  N   . ARG D 2 66  ? 69.688 -2.157  94.950  1.00 14.30 ? 375 ARG E N   1 
ATOM   3441 C  CA  . ARG D 2 66  ? 70.980 -2.551  94.395  1.00 14.30 ? 375 ARG E CA  1 
ATOM   3442 C  C   . ARG D 2 66  ? 71.004 -4.052  94.147  1.00 14.30 ? 375 ARG E C   1 
ATOM   3443 O  O   . ARG D 2 66  ? 71.260 -4.511  93.035  1.00 14.30 ? 375 ARG E O   1 
ATOM   3444 C  CB  . ARG D 2 66  ? 72.136 -2.161  95.335  1.00 19.89 ? 375 ARG E CB  1 
ATOM   3445 C  CG  . ARG D 2 66  ? 73.480 -2.743  94.887  1.00 19.89 ? 375 ARG E CG  1 
ATOM   3446 C  CD  . ARG D 2 66  ? 74.679 -1.795  95.036  1.00 19.89 ? 375 ARG E CD  1 
ATOM   3447 N  NE  . ARG D 2 66  ? 75.193 -1.655  96.400  1.00 19.89 ? 375 ARG E NE  1 
ATOM   3448 C  CZ  . ARG D 2 66  ? 74.708 -0.810  97.307  1.00 19.89 ? 375 ARG E CZ  1 
ATOM   3449 N  NH1 . ARG D 2 66  ? 73.683 -0.022  97.010  1.00 19.89 ? 375 ARG E NH1 1 
ATOM   3450 N  NH2 . ARG D 2 66  ? 75.264 -0.725  98.506  1.00 19.89 ? 375 ARG E NH2 1 
ATOM   3451 N  N   . LYS D 2 67  ? 70.690 -4.802  95.195  1.00 18.68 ? 376 LYS E N   1 
ATOM   3452 C  CA  . LYS D 2 67  ? 70.700 -6.252  95.153  1.00 18.68 ? 376 LYS E CA  1 
ATOM   3453 C  C   . LYS D 2 67  ? 69.622 -6.879  94.284  1.00 18.68 ? 376 LYS E C   1 
ATOM   3454 O  O   . LYS D 2 67  ? 69.394 -8.071  94.365  1.00 18.68 ? 376 LYS E O   1 
ATOM   3455 C  CB  . LYS D 2 67  ? 70.589 -6.786  96.581  1.00 7.03  ? 376 LYS E CB  1 
ATOM   3456 C  CG  . LYS D 2 67  ? 70.847 -8.266  96.741  1.00 7.03  ? 376 LYS E CG  1 
ATOM   3457 C  CD  . LYS D 2 67  ? 70.585 -8.672  98.173  1.00 7.03  ? 376 LYS E CD  1 
ATOM   3458 C  CE  . LYS D 2 67  ? 70.780 -10.145 98.379  1.00 7.03  ? 376 LYS E CE  1 
ATOM   3459 N  NZ  . LYS D 2 67  ? 70.351 -10.494 99.744  1.00 7.03  ? 376 LYS E NZ  1 
ATOM   3460 N  N   . VAL D 2 68  ? 68.968 -6.091  93.445  1.00 7.03  ? 377 VAL E N   1 
ATOM   3461 C  CA  . VAL D 2 68  ? 67.918 -6.624  92.586  1.00 7.03  ? 377 VAL E CA  1 
ATOM   3462 C  C   . VAL D 2 68  ? 68.176 -6.128  91.169  1.00 7.03  ? 377 VAL E C   1 
ATOM   3463 O  O   . VAL D 2 68  ? 67.768 -6.732  90.182  1.00 7.03  ? 377 VAL E O   1 
ATOM   3464 C  CB  . VAL D 2 68  ? 66.509 -6.161  93.089  1.00 7.03  ? 377 VAL E CB  1 
ATOM   3465 C  CG1 . VAL D 2 68  ? 65.395 -6.726  92.204  1.00 7.03  ? 377 VAL E CG1 1 
ATOM   3466 C  CG2 . VAL D 2 68  ? 66.301 -6.612  94.532  1.00 7.03  ? 377 VAL E CG2 1 
ATOM   3467 N  N   . ALA D 2 69  ? 68.879 -5.014  91.082  1.00 7.03  ? 378 ALA E N   1 
ATOM   3468 C  CA  . ALA D 2 69  ? 69.201 -4.433  89.801  1.00 7.03  ? 378 ALA E CA  1 
ATOM   3469 C  C   . ALA D 2 69  ? 70.435 -5.136  89.325  1.00 7.03  ? 378 ALA E C   1 
ATOM   3470 O  O   . ALA D 2 69  ? 70.628 -5.359  88.137  1.00 7.03  ? 378 ALA E O   1 
ATOM   3471 C  CB  . ALA D 2 69  ? 69.478 -2.948  89.961  1.00 12.87 ? 378 ALA E CB  1 
ATOM   3472 N  N   . THR D 2 70  ? 71.268 -5.497  90.288  1.00 7.03  ? 379 THR E N   1 
ATOM   3473 C  CA  . THR D 2 70  ? 72.529 -6.163  90.010  1.00 7.03  ? 379 THR E CA  1 
ATOM   3474 C  C   . THR D 2 70  ? 72.511 -7.693  89.822  1.00 7.03  ? 379 THR E C   1 
ATOM   3475 O  O   . THR D 2 70  ? 72.733 -8.184  88.715  1.00 7.03  ? 379 THR E O   1 
ATOM   3476 C  CB  . THR D 2 70  ? 73.592 -5.789  91.103  1.00 7.08  ? 379 THR E CB  1 
ATOM   3477 O  OG1 . THR D 2 70  ? 73.023 -5.892  92.415  1.00 7.08  ? 379 THR E OG1 1 
ATOM   3478 C  CG2 . THR D 2 70  ? 74.098 -4.377  90.890  1.00 7.08  ? 379 THR E CG2 1 
ATOM   3479 N  N   . GLU D 2 71  A 72.230 -8.432  90.895  1.00 33.71 ? 379 GLU E N   1 
ATOM   3480 C  CA  . GLU D 2 71  A 72.231 -9.899  90.863  1.00 33.71 ? 379 GLU E CA  1 
ATOM   3481 C  C   . GLU D 2 71  A 70.962 -10.685 90.439  1.00 33.71 ? 379 GLU E C   1 
ATOM   3482 O  O   . GLU D 2 71  A 70.861 -11.881 90.724  1.00 33.71 ? 379 GLU E O   1 
ATOM   3483 C  CB  . GLU D 2 71  A 72.729 -10.431 92.218  1.00 7.03  ? 379 GLU E CB  1 
ATOM   3484 C  CG  . GLU D 2 71  A 72.715 -9.403  93.327  1.00 7.03  ? 379 GLU E CG  1 
ATOM   3485 C  CD  . GLU D 2 71  A 72.974 -10.002 94.695  1.00 7.03  ? 379 GLU E CD  1 
ATOM   3486 O  OE1 . GLU D 2 71  A 72.206 -10.891 95.120  1.00 7.03  ? 379 GLU E OE1 1 
ATOM   3487 O  OE2 . GLU D 2 71  A 73.940 -9.577  95.357  1.00 7.03  ? 379 GLU E OE2 1 
ATOM   3488 N  N   . PHE D 2 72  ? 70.013 -10.043 89.757  1.00 7.03  ? 380 PHE E N   1 
ATOM   3489 C  CA  . PHE D 2 72  ? 68.806 -10.736 89.296  1.00 7.03  ? 380 PHE E CA  1 
ATOM   3490 C  C   . PHE D 2 72  ? 68.568 -10.508 87.806  1.00 7.03  ? 380 PHE E C   1 
ATOM   3491 O  O   . PHE D 2 72  ? 68.984 -9.492  87.265  1.00 7.03  ? 380 PHE E O   1 
ATOM   3492 C  CB  . PHE D 2 72  ? 67.571 -10.279 90.073  1.00 7.03  ? 380 PHE E CB  1 
ATOM   3493 C  CG  . PHE D 2 72  ? 67.451 -10.875 91.451  1.00 7.03  ? 380 PHE E CG  1 
ATOM   3494 C  CD1 . PHE D 2 72  ? 67.782 -10.134 92.576  1.00 7.03  ? 380 PHE E CD1 1 
ATOM   3495 C  CD2 . PHE D 2 72  ? 66.981 -12.164 91.624  1.00 7.03  ? 380 PHE E CD2 1 
ATOM   3496 C  CE1 . PHE D 2 72  ? 67.642 -10.669 93.860  1.00 7.03  ? 380 PHE E CE1 1 
ATOM   3497 C  CE2 . PHE D 2 72  ? 66.841 -12.705 92.894  1.00 7.03  ? 380 PHE E CE2 1 
ATOM   3498 C  CZ  . PHE D 2 72  ? 67.171 -11.955 94.014  1.00 7.03  ? 380 PHE E CZ  1 
ATOM   3499 N  N   . GLU D 2 73  ? 67.911 -11.463 87.148  1.00 7.24  ? 381 GLU E N   1 
ATOM   3500 C  CA  . GLU D 2 73  ? 67.608 -11.374 85.716  1.00 7.24  ? 381 GLU E CA  1 
ATOM   3501 C  C   . GLU D 2 73  ? 66.597 -12.458 85.316  1.00 7.24  ? 381 GLU E C   1 
ATOM   3502 O  O   . GLU D 2 73  ? 66.729 -13.599 85.736  1.00 7.24  ? 381 GLU E O   1 
ATOM   3503 C  CB  . GLU D 2 73  ? 68.880 -11.544 84.885  1.00 7.03  ? 381 GLU E CB  1 
ATOM   3504 C  CG  . GLU D 2 73  ? 68.929 -10.664 83.652  1.00 7.03  ? 381 GLU E CG  1 
ATOM   3505 C  CD  . GLU D 2 73  ? 69.744 -11.251 82.509  1.00 7.03  ? 381 GLU E CD  1 
ATOM   3506 O  OE1 . GLU D 2 73  ? 70.894 -11.673 82.727  1.00 7.03  ? 381 GLU E OE1 1 
ATOM   3507 O  OE2 . GLU D 2 73  ? 69.226 -11.278 81.375  1.00 7.03  ? 381 GLU E OE2 1 
ATOM   3508 N  N   . SER D 2 74  A 65.604 -12.105 84.502  1.00 7.03  ? 381 SER E N   1 
ATOM   3509 C  CA  . SER D 2 74  A 64.570 -13.040 84.048  1.00 7.03  ? 381 SER E CA  1 
ATOM   3510 C  C   . SER D 2 74  A 65.110 -14.088 83.057  1.00 7.03  ? 381 SER E C   1 
ATOM   3511 O  O   . SER D 2 74  A 66.066 -13.822 82.325  1.00 7.03  ? 381 SER E O   1 
ATOM   3512 C  CB  . SER D 2 74  A 63.418 -12.246 83.410  1.00 17.86 ? 381 SER E CB  1 
ATOM   3513 O  OG  . SER D 2 74  A 62.428 -13.079 82.828  1.00 17.86 ? 381 SER E OG  1 
ATOM   3514 N  N   . PHE D 2 75  B 64.482 -15.271 83.045  1.00 10.39 ? 381 PHE E N   1 
ATOM   3515 C  CA  . PHE D 2 75  B 64.871 -16.387 82.176  1.00 10.39 ? 381 PHE E CA  1 
ATOM   3516 C  C   . PHE D 2 75  B 63.652 -17.136 81.650  1.00 10.39 ? 381 PHE E C   1 
ATOM   3517 O  O   . PHE D 2 75  B 62.916 -17.737 82.434  1.00 10.39 ? 381 PHE E O   1 
ATOM   3518 C  CB  . PHE D 2 75  B 65.730 -17.382 82.952  1.00 7.31  ? 381 PHE E CB  1 
ATOM   3519 C  CG  . PHE D 2 75  B 66.009 -18.655 82.198  1.00 7.31  ? 381 PHE E CG  1 
ATOM   3520 C  CD1 . PHE D 2 75  B 66.964 -18.687 81.188  1.00 7.31  ? 381 PHE E CD1 1 
ATOM   3521 C  CD2 . PHE D 2 75  B 65.295 -19.814 82.473  1.00 7.31  ? 381 PHE E CD2 1 
ATOM   3522 C  CE1 . PHE D 2 75  B 67.210 -19.852 80.456  1.00 7.31  ? 381 PHE E CE1 1 
ATOM   3523 C  CE2 . PHE D 2 75  B 65.531 -20.983 81.746  1.00 7.31  ? 381 PHE E CE2 1 
ATOM   3524 C  CZ  . PHE D 2 75  B 66.493 -21.000 80.734  1.00 7.31  ? 381 PHE E CZ  1 
ATOM   3525 N  N   . SER D 2 76  C 63.448 -17.131 80.336  1.00 7.03  ? 381 SER E N   1 
ATOM   3526 C  CA  . SER D 2 76  C 62.300 -17.830 79.787  1.00 7.03  ? 381 SER E CA  1 
ATOM   3527 C  C   . SER D 2 76  C 62.458 -18.290 78.347  1.00 7.03  ? 381 SER E C   1 
ATOM   3528 O  O   . SER D 2 76  C 63.397 -17.910 77.653  1.00 7.03  ? 381 SER E O   1 
ATOM   3529 C  CB  . SER D 2 76  C 61.058 -16.952 79.914  1.00 9.28  ? 381 SER E CB  1 
ATOM   3530 O  OG  . SER D 2 76  C 59.884 -17.738 80.044  1.00 9.28  ? 381 SER E OG  1 
ATOM   3531 N  N   . PHE D 2 77  D 61.509 -19.113 77.914  1.00 11.59 ? 381 PHE E N   1 
ATOM   3532 C  CA  . PHE D 2 77  D 61.476 -19.668 76.564  1.00 11.59 ? 381 PHE E CA  1 
ATOM   3533 C  C   . PHE D 2 77  D 60.785 -18.705 75.610  1.00 11.59 ? 381 PHE E C   1 
ATOM   3534 O  O   . PHE D 2 77  D 60.940 -18.791 74.387  1.00 11.59 ? 381 PHE E O   1 
ATOM   3535 C  CB  . PHE D 2 77  D 60.716 -20.999 76.569  1.00 25.40 ? 381 PHE E CB  1 
ATOM   3536 C  CG  . PHE D 2 77  D 61.184 -21.957 77.627  1.00 25.40 ? 381 PHE E CG  1 
ATOM   3537 C  CD1 . PHE D 2 77  D 60.359 -22.292 78.704  1.00 25.40 ? 381 PHE E CD1 1 
ATOM   3538 C  CD2 . PHE D 2 77  D 62.469 -22.501 77.569  1.00 25.40 ? 381 PHE E CD2 1 
ATOM   3539 C  CE1 . PHE D 2 77  D 60.811 -23.154 79.710  1.00 25.40 ? 381 PHE E CE1 1 
ATOM   3540 C  CE2 . PHE D 2 77  D 62.928 -23.362 78.573  1.00 25.40 ? 381 PHE E CE2 1 
ATOM   3541 C  CZ  . PHE D 2 77  D 62.098 -23.686 79.644  1.00 25.40 ? 381 PHE E CZ  1 
ATOM   3542 N  N   . ASP D 2 78  E 59.999 -17.805 76.195  1.00 13.67 ? 381 ASP E N   1 
ATOM   3543 C  CA  . ASP D 2 78  E 59.264 -16.798 75.445  1.00 13.67 ? 381 ASP E CA  1 
ATOM   3544 C  C   . ASP D 2 78  E 60.196 -15.703 75.046  1.00 13.67 ? 381 ASP E C   1 
ATOM   3545 O  O   . ASP D 2 78  E 60.706 -14.983 75.904  1.00 13.67 ? 381 ASP E O   1 
ATOM   3546 C  CB  . ASP D 2 78  E 58.194 -16.157 76.303  1.00 45.66 ? 381 ASP E CB  1 
ATOM   3547 C  CG  . ASP D 2 78  E 57.085 -17.092 76.623  1.00 45.66 ? 381 ASP E CG  1 
ATOM   3548 O  OD1 . ASP D 2 78  E 56.134 -17.162 75.815  1.00 45.66 ? 381 ASP E OD1 1 
ATOM   3549 O  OD2 . ASP D 2 78  E 57.176 -17.760 77.678  1.00 45.66 ? 381 ASP E OD2 1 
ATOM   3550 N  N   . ALA D 2 79  F 60.422 -15.559 73.750  1.00 25.83 ? 381 ALA E N   1 
ATOM   3551 C  CA  . ALA D 2 79  F 61.294 -14.494 73.311  1.00 25.83 ? 381 ALA E CA  1 
ATOM   3552 C  C   . ALA D 2 79  F 60.930 -13.345 74.242  1.00 25.83 ? 381 ALA E C   1 
ATOM   3553 O  O   . ALA D 2 79  F 61.770 -12.838 74.994  1.00 25.83 ? 381 ALA E O   1 
ATOM   3554 C  CB  . ALA D 2 79  F 60.989 -14.125 71.854  1.00 7.03  ? 381 ALA E CB  1 
ATOM   3555 N  N   . THR D 2 80  G 59.634 -13.029 74.241  1.00 22.40 ? 381 THR E N   1 
ATOM   3556 C  CA  . THR D 2 80  G 59.059 -11.929 75.002  1.00 22.40 ? 381 THR E CA  1 
ATOM   3557 C  C   . THR D 2 80  G 59.314 -11.754 76.501  1.00 22.40 ? 381 THR E C   1 
ATOM   3558 O  O   . THR D 2 80  G 59.365 -10.621 76.968  1.00 22.40 ? 381 THR E O   1 
ATOM   3559 C  CB  . THR D 2 80  G 57.544 -11.847 74.740  1.00 18.98 ? 381 THR E CB  1 
ATOM   3560 O  OG1 . THR D 2 80  G 56.955 -10.876 75.615  1.00 18.98 ? 381 THR E OG1 1 
ATOM   3561 C  CG2 . THR D 2 80  G 56.895 -13.213 74.925  1.00 18.98 ? 381 THR E CG2 1 
ATOM   3562 N  N   . PHE D 2 81  H 59.481 -12.813 77.279  1.00 7.03  ? 381 PHE E N   1 
ATOM   3563 C  CA  . PHE D 2 81  H 59.740 -12.556 78.695  1.00 7.03  ? 381 PHE E CA  1 
ATOM   3564 C  C   . PHE D 2 81  H 61.166 -12.842 79.100  1.00 7.03  ? 381 PHE E C   1 
ATOM   3565 O  O   . PHE D 2 81  H 61.570 -12.591 80.239  1.00 7.03  ? 381 PHE E O   1 
ATOM   3566 C  CB  . PHE D 2 81  H 58.799 -13.351 79.579  1.00 21.03 ? 381 PHE E CB  1 
ATOM   3567 C  CG  . PHE D 2 81  H 57.365 -13.037 79.351  1.00 21.03 ? 381 PHE E CG  1 
ATOM   3568 C  CD1 . PHE D 2 81  H 56.695 -13.573 78.256  1.00 21.03 ? 381 PHE E CD1 1 
ATOM   3569 C  CD2 . PHE D 2 81  H 56.684 -12.187 80.214  1.00 21.03 ? 381 PHE E CD2 1 
ATOM   3570 C  CE1 . PHE D 2 81  H 55.363 -13.271 78.016  1.00 21.03 ? 381 PHE E CE1 1 
ATOM   3571 C  CE2 . PHE D 2 81  H 55.350 -11.876 79.985  1.00 21.03 ? 381 PHE E CE2 1 
ATOM   3572 C  CZ  . PHE D 2 81  H 54.688 -12.421 78.880  1.00 21.03 ? 381 PHE E CZ  1 
ATOM   3573 N  N   . HIS D 2 82  I 61.936 -13.343 78.151  1.00 11.03 ? 381 HIS E N   1 
ATOM   3574 C  CA  . HIS D 2 82  I 63.303 -13.683 78.439  1.00 11.03 ? 381 HIS E CA  1 
ATOM   3575 C  C   . HIS D 2 82  I 64.274 -12.511 78.444  1.00 11.03 ? 381 HIS E C   1 
ATOM   3576 O  O   . HIS D 2 82  I 64.247 -11.658 77.561  1.00 11.03 ? 381 HIS E O   1 
ATOM   3577 C  CB  . HIS D 2 82  I 63.797 -14.745 77.457  1.00 7.03  ? 381 HIS E CB  1 
ATOM   3578 C  CG  . HIS D 2 82  I 65.169 -15.243 77.770  1.00 7.03  ? 381 HIS E CG  1 
ATOM   3579 N  ND1 . HIS D 2 82  I 65.468 -15.911 78.937  1.00 7.03  ? 381 HIS E ND1 1 
ATOM   3580 C  CD2 . HIS D 2 82  I 66.335 -15.121 77.095  1.00 7.03  ? 381 HIS E CD2 1 
ATOM   3581 C  CE1 . HIS D 2 82  I 66.760 -16.174 78.969  1.00 7.03  ? 381 HIS E CE1 1 
ATOM   3582 N  NE2 . HIS D 2 82  I 67.310 -15.706 77.864  1.00 7.03  ? 381 HIS E NE2 1 
ATOM   3583 N  N   . ALA D 2 83  ? 65.136 -12.495 79.456  1.00 7.03  ? 382 ALA E N   1 
ATOM   3584 C  CA  . ALA D 2 83  ? 66.171 -11.480 79.618  1.00 7.03  ? 382 ALA E CA  1 
ATOM   3585 C  C   . ALA D 2 83  ? 65.658 -10.149 80.094  1.00 7.03  ? 382 ALA E C   1 
ATOM   3586 O  O   . ALA D 2 83  ? 65.955 -9.119  79.495  1.00 7.03  ? 382 ALA E O   1 
ATOM   3587 C  CB  . ALA D 2 83  ? 66.920 -11.291 78.319  1.00 18.77 ? 382 ALA E CB  1 
ATOM   3588 N  N   . LYS D 2 84  ? 64.908 -10.156 81.182  1.00 7.03  ? 383 LYS E N   1 
ATOM   3589 C  CA  . LYS D 2 84  ? 64.373 -8.910  81.685  1.00 7.03  ? 383 LYS E CA  1 
ATOM   3590 C  C   . LYS D 2 84  ? 64.854 -8.579  83.082  1.00 7.03  ? 383 LYS E C   1 
ATOM   3591 O  O   . LYS D 2 84  ? 65.229 -9.461  83.840  1.00 7.03  ? 383 LYS E O   1 
ATOM   3592 C  CB  . LYS D 2 84  ? 62.850 -8.958  81.627  1.00 7.44  ? 383 LYS E CB  1 
ATOM   3593 C  CG  . LYS D 2 84  ? 62.331 -9.180  80.221  1.00 7.44  ? 383 LYS E CG  1 
ATOM   3594 C  CD  . LYS D 2 84  ? 62.964 -8.191  79.270  1.00 7.44  ? 383 LYS E CD  1 
ATOM   3595 C  CE  . LYS D 2 84  ? 62.336 -8.276  77.912  1.00 7.44  ? 383 LYS E CE  1 
ATOM   3596 N  NZ  . LYS D 2 84  ? 62.274 -9.682  77.461  1.00 7.44  ? 383 LYS E NZ  1 
ATOM   3597 N  N   . LYS D 2 85  ? 64.852 -7.292  83.409  1.00 7.41  ? 384 LYS E N   1 
ATOM   3598 C  CA  . LYS D 2 85  ? 65.307 -6.843  84.713  1.00 7.41  ? 384 LYS E CA  1 
ATOM   3599 C  C   . LYS D 2 85  ? 64.182 -6.235  85.535  1.00 7.41  ? 384 LYS E C   1 
ATOM   3600 O  O   . LYS D 2 85  ? 63.027 -6.163  85.106  1.00 7.41  ? 384 LYS E O   1 
ATOM   3601 C  CB  . LYS D 2 85  ? 66.404 -5.801  84.555  1.00 7.03  ? 384 LYS E CB  1 
ATOM   3602 C  CG  . LYS D 2 85  ? 67.593 -6.246  83.753  1.00 7.03  ? 384 LYS E CG  1 
ATOM   3603 C  CD  . LYS D 2 85  ? 68.385 -7.341  84.449  1.00 7.03  ? 384 LYS E CD  1 
ATOM   3604 C  CE  . LYS D 2 85  ? 69.031 -6.876  85.749  1.00 7.03  ? 384 LYS E CE  1 
ATOM   3605 N  NZ  . LYS D 2 85  ? 68.030 -6.651  86.836  1.00 7.03  ? 384 LYS E NZ  1 
ATOM   3606 N  N   . GLN D 2 86  ? 64.549 -5.797  86.730  1.00 7.03  ? 385 GLN E N   1 
ATOM   3607 C  CA  . GLN D 2 86  ? 63.631 -5.166  87.645  1.00 7.03  ? 385 GLN E CA  1 
ATOM   3608 C  C   . GLN D 2 86  ? 64.381 -4.101  88.427  1.00 7.03  ? 385 GLN E C   1 
ATOM   3609 O  O   . GLN D 2 86  ? 65.609 -4.068  88.450  1.00 7.03  ? 385 GLN E O   1 
ATOM   3610 C  CB  . GLN D 2 86  ? 63.024 -6.194  88.607  1.00 7.03  ? 385 GLN E CB  1 
ATOM   3611 C  CG  . GLN D 2 86  ? 62.205 -5.558  89.720  1.00 7.03  ? 385 GLN E CG  1 
ATOM   3612 C  CD  . GLN D 2 86  ? 61.275 -6.514  90.415  1.00 7.03  ? 385 GLN E CD  1 
ATOM   3613 O  OE1 . GLN D 2 86  ? 60.507 -7.221  89.774  1.00 7.03  ? 385 GLN E OE1 1 
ATOM   3614 N  NE2 . GLN D 2 86  ? 61.324 -6.529  91.742  1.00 7.03  ? 385 GLN E NE2 1 
ATOM   3615 N  N   . ILE D 2 87  ? 63.611 -3.216  89.041  1.00 7.62  ? 386 ILE E N   1 
ATOM   3616 C  CA  . ILE D 2 87  ? 64.124 -2.138  89.872  1.00 7.62  ? 386 ILE E CA  1 
ATOM   3617 C  C   . ILE D 2 87  ? 63.004 -1.783  90.839  1.00 7.62  ? 386 ILE E C   1 
ATOM   3618 O  O   . ILE D 2 87  ? 61.897 -1.490  90.427  1.00 7.62  ? 386 ILE E O   1 
ATOM   3619 C  CB  . ILE D 2 87  ? 64.491 -0.889  89.030  1.00 7.03  ? 386 ILE E CB  1 
ATOM   3620 C  CG1 . ILE D 2 87  ? 64.914 0.250   89.958  1.00 7.03  ? 386 ILE E CG1 1 
ATOM   3621 C  CG2 . ILE D 2 87  ? 63.327 -0.479  88.149  1.00 7.03  ? 386 ILE E CG2 1 
ATOM   3622 C  CD1 . ILE D 2 87  ? 66.221 -0.007  90.688  1.00 7.03  ? 386 ILE E CD1 1 
ATOM   3623 N  N   . PRO D 2 88  ? 63.264 -1.859  92.141  1.00 7.25  ? 387 PRO E N   1 
ATOM   3624 C  CA  . PRO D 2 88  ? 62.164 -1.504  93.034  1.00 7.25  ? 387 PRO E CA  1 
ATOM   3625 C  C   . PRO D 2 88  ? 61.967 0.018   93.028  1.00 7.25  ? 387 PRO E C   1 
ATOM   3626 O  O   . PRO D 2 88  ? 62.639 0.758   92.293  1.00 7.25  ? 387 PRO E O   1 
ATOM   3627 C  CB  . PRO D 2 88  ? 62.638 -2.007  94.390  1.00 7.03  ? 387 PRO E CB  1 
ATOM   3628 C  CG  . PRO D 2 88  ? 63.592 -3.095  94.045  1.00 7.03  ? 387 PRO E CG  1 
ATOM   3629 C  CD  . PRO D 2 88  ? 64.339 -2.535  92.874  1.00 7.03  ? 387 PRO E CD  1 
ATOM   3630 N  N   . CYS D 2 89  ? 61.063 0.486   93.874  1.00 7.03  ? 388 CYS E N   1 
ATOM   3631 C  CA  . CYS D 2 89  ? 60.766 1.896   93.944  1.00 7.03  ? 388 CYS E CA  1 
ATOM   3632 C  C   . CYS D 2 89  ? 60.514 2.308   95.386  1.00 7.03  ? 388 CYS E C   1 
ATOM   3633 O  O   . CYS D 2 89  ? 59.566 1.844   96.002  1.00 7.03  ? 388 CYS E O   1 
ATOM   3634 C  CB  . CYS D 2 89  ? 59.537 2.168   93.083  1.00 17.05 ? 388 CYS E CB  1 
ATOM   3635 S  SG  . CYS D 2 89  ? 58.851 3.812   93.219  1.00 17.05 ? 388 CYS E SG  1 
ATOM   3636 N  N   . ILE D 2 90  ? 61.372 3.174   95.923  1.00 7.03  ? 389 ILE E N   1 
ATOM   3637 C  CA  . ILE D 2 90  ? 61.230 3.649   97.299  1.00 7.03  ? 389 ILE E CA  1 
ATOM   3638 C  C   . ILE D 2 90  ? 60.548 5.009   97.328  1.00 7.03  ? 389 ILE E C   1 
ATOM   3639 O  O   . ILE D 2 90  ? 61.111 6.000   96.877  1.00 7.03  ? 389 ILE E O   1 
ATOM   3640 C  CB  . ILE D 2 90  ? 62.576 3.828   97.974  1.00 7.03  ? 389 ILE E CB  1 
ATOM   3641 C  CG1 . ILE D 2 90  ? 63.560 2.802   97.447  1.00 7.03  ? 389 ILE E CG1 1 
ATOM   3642 C  CG2 . ILE D 2 90  ? 62.421 3.693   99.471  1.00 7.03  ? 389 ILE E CG2 1 
ATOM   3643 C  CD1 . ILE D 2 90  ? 64.955 3.027   97.950  1.00 7.03  ? 389 ILE E CD1 1 
ATOM   3644 N  N   . VAL D 2 91  ? 59.340 5.056   97.863  1.00 7.03  ? 390 VAL E N   1 
ATOM   3645 C  CA  . VAL D 2 91  ? 58.603 6.300   97.954  1.00 7.03  ? 390 VAL E CA  1 
ATOM   3646 C  C   . VAL D 2 91  ? 58.451 6.616   99.433  1.00 7.03  ? 390 VAL E C   1 
ATOM   3647 O  O   . VAL D 2 91  ? 57.929 5.801   100.196 1.00 7.03  ? 390 VAL E O   1 
ATOM   3648 C  CB  . VAL D 2 91  ? 57.218 6.161   97.278  1.00 7.03  ? 390 VAL E CB  1 
ATOM   3649 C  CG1 . VAL D 2 91  ? 56.368 7.407   97.508  1.00 7.03  ? 390 VAL E CG1 1 
ATOM   3650 C  CG2 . VAL D 2 91  ? 57.402 5.906   95.785  1.00 7.03  ? 390 VAL E CG2 1 
ATOM   3651 N  N   . SER D 2 92  ? 58.913 7.798   99.839  1.00 7.63  ? 392 SER E N   1 
ATOM   3652 C  CA  . SER D 2 92  ? 58.850 8.207   101.239 1.00 7.63  ? 392 SER E CA  1 
ATOM   3653 C  C   . SER D 2 92  ? 58.243 9.591   101.522 1.00 7.63  ? 392 SER E C   1 
ATOM   3654 O  O   . SER D 2 92  ? 58.611 10.587  100.909 1.00 7.63  ? 392 SER E O   1 
ATOM   3655 C  CB  . SER D 2 92  ? 60.256 8.125   101.845 1.00 7.03  ? 392 SER E CB  1 
ATOM   3656 O  OG  . SER D 2 92  ? 60.231 8.391   103.230 1.00 7.03  ? 392 SER E OG  1 
ATOM   3657 N  N   . MET D 2 93  ? 57.308 9.617   102.468 1.00 7.03  ? 393 MET E N   1 
ATOM   3658 C  CA  . MET D 2 93  ? 56.633 10.828  102.922 1.00 7.03  ? 393 MET E CA  1 
ATOM   3659 C  C   . MET D 2 93  ? 56.963 10.907  104.408 1.00 7.03  ? 393 MET E C   1 
ATOM   3660 O  O   . MET D 2 93  ? 56.350 11.656  105.164 1.00 7.03  ? 393 MET E O   1 
ATOM   3661 C  CB  . MET D 2 93  ? 55.118 10.684  102.777 1.00 8.62  ? 393 MET E CB  1 
ATOM   3662 C  CG  . MET D 2 93  ? 54.696 10.051  101.478 1.00 8.62  ? 393 MET E CG  1 
ATOM   3663 S  SD  . MET D 2 93  ? 53.890 11.206  100.395 1.00 8.62  ? 393 MET E SD  1 
ATOM   3664 C  CE  . MET D 2 93  ? 52.330 10.381  100.119 1.00 8.62  ? 393 MET E CE  1 
ATOM   3665 N  N   . LEU D 2 94  ? 57.916 10.086  104.821 1.00 7.03  ? 394 LEU E N   1 
ATOM   3666 C  CA  . LEU D 2 94  ? 58.317 10.057  106.204 1.00 7.03  ? 394 LEU E CA  1 
ATOM   3667 C  C   . LEU D 2 94  ? 58.968 11.390  106.475 1.00 7.03  ? 394 LEU E C   1 
ATOM   3668 O  O   . LEU D 2 94  ? 59.406 12.073  105.557 1.00 7.03  ? 394 LEU E O   1 
ATOM   3669 C  CB  . LEU D 2 94  ? 59.280 8.902   106.454 1.00 7.03  ? 394 LEU E CB  1 
ATOM   3670 C  CG  . LEU D 2 94  ? 58.670 7.528   106.163 1.00 7.03  ? 394 LEU E CG  1 
ATOM   3671 C  CD1 . LEU D 2 94  ? 59.696 6.427   106.330 1.00 7.03  ? 394 LEU E CD1 1 
ATOM   3672 C  CD2 . LEU D 2 94  ? 57.517 7.293   107.099 1.00 7.03  ? 394 LEU E CD2 1 
ATOM   3673 N  N   . THR D 2 95  ? 59.007 11.754  107.748 1.00 15.77 ? 395 THR E N   1 
ATOM   3674 C  CA  . THR D 2 95  ? 59.551 13.027  108.199 1.00 15.77 ? 395 THR E CA  1 
ATOM   3675 C  C   . THR D 2 95  ? 60.765 12.899  109.129 1.00 15.77 ? 395 THR E C   1 
ATOM   3676 O  O   . THR D 2 95  ? 61.243 13.899  109.673 1.00 15.77 ? 395 THR E O   1 
ATOM   3677 C  CB  . THR D 2 95  ? 58.450 13.811  108.917 1.00 7.03  ? 395 THR E CB  1 
ATOM   3678 O  OG1 . THR D 2 95  ? 57.869 12.987  109.939 1.00 7.03  ? 395 THR E OG1 1 
ATOM   3679 C  CG2 . THR D 2 95  ? 57.367 14.204  107.927 1.00 7.03  ? 395 THR E CG2 1 
ATOM   3680 N  N   . LYS D 2 96  ? 61.250 11.669  109.303 1.00 7.11  ? 396 LYS E N   1 
ATOM   3681 C  CA  . LYS D 2 96  ? 62.402 11.377  110.154 1.00 7.11  ? 396 LYS E CA  1 
ATOM   3682 C  C   . LYS D 2 96  ? 63.050 10.099  109.658 1.00 7.11  ? 396 LYS E C   1 
ATOM   3683 O  O   . LYS D 2 96  ? 62.449 9.368   108.889 1.00 7.11  ? 396 LYS E O   1 
ATOM   3684 C  CB  . LYS D 2 96  ? 61.961 11.178  111.607 1.00 7.78  ? 396 LYS E CB  1 
ATOM   3685 C  CG  . LYS D 2 96  ? 61.275 12.377  112.253 1.00 7.78  ? 396 LYS E CG  1 
ATOM   3686 C  CD  . LYS D 2 96  ? 60.968 12.130  113.724 1.00 7.78  ? 396 LYS E CD  1 
ATOM   3687 C  CE  . LYS D 2 96  ? 60.200 13.292  114.314 1.00 7.78  ? 396 LYS E CE  1 
ATOM   3688 N  NZ  . LYS D 2 96  ? 60.941 14.583  114.136 1.00 7.78  ? 396 LYS E NZ  1 
ATOM   3689 N  N   . GLU D 2 97  ? 64.276 9.833   110.091 1.00 7.03  ? 397 GLU E N   1 
ATOM   3690 C  CA  . GLU D 2 97  ? 64.965 8.609   109.702 1.00 7.03  ? 397 GLU E CA  1 
ATOM   3691 C  C   . GLU D 2 97  ? 64.365 7.504   110.558 1.00 7.03  ? 397 GLU E C   1 
ATOM   3692 O  O   . GLU D 2 97  ? 63.648 7.777   111.526 1.00 7.03  ? 397 GLU E O   1 
ATOM   3693 C  CB  . GLU D 2 97  ? 66.449 8.674   110.025 1.00 7.03  ? 397 GLU E CB  1 
ATOM   3694 C  CG  . GLU D 2 97  ? 67.176 9.876   109.507 1.00 7.03  ? 397 GLU E CG  1 
ATOM   3695 C  CD  . GLU D 2 97  ? 68.547 9.985   110.123 1.00 7.03  ? 397 GLU E CD  1 
ATOM   3696 O  OE1 . GLU D 2 97  ? 68.631 9.945   111.364 1.00 7.03  ? 397 GLU E OE1 1 
ATOM   3697 O  OE2 . GLU D 2 97  ? 69.536 10.104  109.374 1.00 7.03  ? 397 GLU E OE2 1 
ATOM   3698 N  N   . LEU D 2 98  ? 64.661 6.257   110.210 1.00 7.33  ? 398 LEU E N   1 
ATOM   3699 C  CA  . LEU D 2 98  ? 64.154 5.129   110.972 1.00 7.33  ? 398 LEU E CA  1 
ATOM   3700 C  C   . LEU D 2 98  ? 65.258 4.087   111.148 1.00 7.33  ? 398 LEU E C   1 
ATOM   3701 O  O   . LEU D 2 98  ? 65.884 3.661   110.175 1.00 7.33  ? 398 LEU E O   1 
ATOM   3702 C  CB  . LEU D 2 98  ? 62.922 4.538   110.274 1.00 7.03  ? 398 LEU E CB  1 
ATOM   3703 C  CG  . LEU D 2 98  ? 62.041 3.600   111.107 1.00 7.03  ? 398 LEU E CG  1 
ATOM   3704 C  CD1 . LEU D 2 98  ? 60.611 3.649   110.625 1.00 7.03  ? 398 LEU E CD1 1 
ATOM   3705 C  CD2 . LEU D 2 98  ? 62.581 2.197   111.024 1.00 7.03  ? 398 LEU E CD2 1 
ATOM   3706 N  N   . TYR D 2 99  ? 65.517 3.733   112.406 1.00 7.11  ? 399 TYR E N   1 
ATOM   3707 C  CA  . TYR D 2 99  ? 66.516 2.730   112.780 1.00 7.11  ? 399 TYR E CA  1 
ATOM   3708 C  C   . TYR D 2 99  ? 65.811 1.700   113.692 1.00 7.11  ? 399 TYR E C   1 
ATOM   3709 O  O   . TYR D 2 99  ? 65.433 2.013   114.821 1.00 7.11  ? 399 TYR E O   1 
ATOM   3710 C  CB  . TYR D 2 99  ? 67.677 3.370   113.554 1.00 7.03  ? 399 TYR E CB  1 
ATOM   3711 C  CG  . TYR D 2 99  ? 68.598 4.312   112.793 1.00 7.03  ? 399 TYR E CG  1 
ATOM   3712 C  CD1 . TYR D 2 99  ? 68.252 5.647   112.581 1.00 7.03  ? 399 TYR E CD1 1 
ATOM   3713 C  CD2 . TYR D 2 99  ? 69.852 3.882   112.350 1.00 7.03  ? 399 TYR E CD2 1 
ATOM   3714 C  CE1 . TYR D 2 99  ? 69.138 6.536   111.951 1.00 7.03  ? 399 TYR E CE1 1 
ATOM   3715 C  CE2 . TYR D 2 99  ? 70.740 4.757   111.722 1.00 7.03  ? 399 TYR E CE2 1 
ATOM   3716 C  CZ  . TYR D 2 99  ? 70.376 6.083   111.526 1.00 7.03  ? 399 TYR E CZ  1 
ATOM   3717 O  OH  . TYR D 2 99  ? 71.246 6.951   110.910 1.00 7.03  ? 399 TYR E OH  1 
ATOM   3718 N  N   . PHE D 2 100 ? 65.653 0.470   113.215 1.00 26.46 ? 400 PHE E N   1 
ATOM   3719 C  CA  . PHE D 2 100 ? 64.950 -0.563  113.970 1.00 26.46 ? 400 PHE E CA  1 
ATOM   3720 C  C   . PHE D 2 100 ? 65.507 -1.036  115.315 1.00 26.46 ? 400 PHE E C   1 
ATOM   3721 O  O   . PHE D 2 100 ? 65.983 -2.164  115.417 1.00 26.46 ? 400 PHE E O   1 
ATOM   3722 C  CB  . PHE D 2 100 ? 64.740 -1.781  113.065 1.00 8.01  ? 400 PHE E CB  1 
ATOM   3723 C  CG  . PHE D 2 100 ? 63.727 -1.560  111.974 1.00 8.01  ? 400 PHE E CG  1 
ATOM   3724 C  CD1 . PHE D 2 100 ? 62.362 -1.611  112.253 1.00 8.01  ? 400 PHE E CD1 1 
ATOM   3725 C  CD2 . PHE D 2 100 ? 64.136 -1.308  110.672 1.00 8.01  ? 400 PHE E CD2 1 
ATOM   3726 C  CE1 . PHE D 2 100 ? 61.426 -1.419  111.255 1.00 8.01  ? 400 PHE E CE1 1 
ATOM   3727 C  CE2 . PHE D 2 100 ? 63.205 -1.113  109.667 1.00 8.01  ? 400 PHE E CE2 1 
ATOM   3728 C  CZ  . PHE D 2 100 ? 61.849 -1.169  109.959 1.00 8.01  ? 400 PHE E CZ  1 
ATOM   3729 N  N   . TYR D 2 101 ? 65.429 -0.190  116.342 1.00 24.73 ? 401 TYR E N   1 
ATOM   3730 C  CA  . TYR D 2 101 ? 65.893 -0.540  117.695 1.00 24.73 ? 401 TYR E CA  1 
ATOM   3731 C  C   . TYR D 2 101 ? 65.853 0.596   118.724 1.00 24.73 ? 401 TYR E C   1 
ATOM   3732 O  O   . TYR D 2 101 ? 65.300 0.401   119.831 1.00 24.73 ? 401 TYR E O   1 
ATOM   3733 C  CB  . TYR D 2 101 ? 67.307 -1.132  117.668 1.00 47.36 ? 401 TYR E CB  1 
ATOM   3734 C  CG  . TYR D 2 101 ? 68.329 -0.406  116.818 1.00 47.36 ? 401 TYR E CG  1 
ATOM   3735 C  CD1 . TYR D 2 101 ? 68.596 -0.817  115.508 1.00 47.36 ? 401 TYR E CD1 1 
ATOM   3736 C  CD2 . TYR D 2 101 ? 69.099 0.631   117.347 1.00 47.36 ? 401 TYR E CD2 1 
ATOM   3737 C  CE1 . TYR D 2 101 ? 69.616 -0.225  114.752 1.00 47.36 ? 401 TYR E CE1 1 
ATOM   3738 C  CE2 . TYR D 2 101 ? 70.123 1.234   116.596 1.00 47.36 ? 401 TYR E CE2 1 
ATOM   3739 C  CZ  . TYR D 2 101 ? 70.380 0.798   115.301 1.00 47.36 ? 401 TYR E CZ  1 
ATOM   3740 O  OH  . TYR D 2 101 ? 71.415 1.361   114.574 1.00 47.36 ? 401 TYR E OH  1 
HETATM 3741 C  C2  . 0ZZ E 3 .   ? 47.648 30.827  97.591  1.00 22.47 ? 551 0ZZ A C2  1 
HETATM 3742 C  C3  . 0ZZ E 3 .   ? 47.066 30.944  98.863  1.00 22.47 ? 551 0ZZ A C3  1 
HETATM 3743 C  C4  . 0ZZ E 3 .   ? 47.846 31.051  100.003 1.00 22.47 ? 551 0ZZ A C4  1 
HETATM 3744 C  C5  . 0ZZ E 3 .   ? 49.240 31.050  99.923  1.00 22.47 ? 551 0ZZ A C5  1 
HETATM 3745 C  C6  . 0ZZ E 3 .   ? 49.835 30.953  98.652  1.00 22.47 ? 551 0ZZ A C6  1 
HETATM 3746 O  O1  . 0ZZ E 3 .   ? 46.812 30.580  96.439  1.00 22.47 ? 551 0ZZ A O1  1 
HETATM 3747 C  C7  . 0ZZ E 3 .   ? 46.684 31.561  95.364  1.00 22.47 ? 551 0ZZ A C7  1 
HETATM 3748 BR BR1 . 0ZZ E 3 .   ? 50.319 31.065  101.522 1.00 22.47 ? 551 0ZZ A BR1 1 
HETATM 3749 C  C1  . 0ZZ E 3 .   ? 49.052 30.844  97.488  1.00 22.47 ? 551 0ZZ A C1  1 
HETATM 3750 C  C   . 0ZZ E 3 .   ? 50.041 29.262  95.749  1.00 7.03  ? 551 0ZZ A C   1 
HETATM 3751 O  O   . 0ZZ E 3 .   ? 50.998 28.711  96.268  1.00 7.03  ? 551 0ZZ A O   1 
HETATM 3752 C  CH3 . 0ZZ E 3 .   ? 49.701 30.699  96.123  1.00 7.03  ? 551 0ZZ A CH3 1 
HETATM 3753 N  N   . 0ZZ E 3 .   ? 49.265 28.659  94.845  1.00 24.57 ? 551 0ZZ A N   1 
HETATM 3754 C  CA  . 0ZZ E 3 .   ? 49.473 27.267  94.423  1.00 24.57 ? 551 0ZZ A CA  1 
HETATM 3755 C  C8  . 0ZZ E 3 .   ? 49.900 27.070  92.956  1.00 24.57 ? 551 0ZZ A C8  1 
HETATM 3756 O  O2  . 0ZZ E 3 .   ? 49.740 27.966  92.118  1.00 24.57 ? 551 0ZZ A O2  1 
HETATM 3757 C  CB  . 0ZZ E 3 .   ? 48.188 26.447  94.615  1.00 7.03  ? 551 0ZZ A CB  1 
HETATM 3758 C  CG1 . 0ZZ E 3 .   ? 47.825 26.374  96.068  1.00 7.03  ? 551 0ZZ A CG1 1 
HETATM 3759 C  CG2 . 0ZZ E 3 .   ? 47.064 27.076  93.816  1.00 7.03  ? 551 0ZZ A CG2 1 
HETATM 3760 N  N1  . 0ZZ E 3 .   ? 50.432 25.882  92.660  1.00 7.35  ? 551 0ZZ A N1  1 
HETATM 3761 C  CA1 . 0ZZ E 3 .   ? 50.850 25.525  91.304  1.00 7.35  ? 551 0ZZ A CA1 1 
HETATM 3762 C  C9  . 0ZZ E 3 .   ? 49.862 24.512  90.677  1.00 7.35  ? 551 0ZZ A C9  1 
HETATM 3763 O  O3  . 0ZZ E 3 .   ? 50.412 24.059  89.426  1.00 7.35  ? 551 0ZZ A O3  1 
HETATM 3764 C  CB1 . 0ZZ E 3 .   ? 52.258 24.939  91.323  1.00 7.03  ? 551 0ZZ A CB1 1 
HETATM 3765 C  CG  . 0ZZ E 3 .   ? 53.319 26.000  91.288  1.00 7.03  ? 551 0ZZ A CG  1 
HETATM 3766 O  OD1 . 0ZZ E 3 .   ? 53.824 26.305  90.200  1.00 7.03  ? 551 0ZZ A OD1 1 
HETATM 3767 O  OD2 . 0ZZ E 3 .   ? 53.643 26.542  92.347  1.00 7.03  ? 551 0ZZ A OD2 1 
HETATM 3768 C  C11 . 0ZZ E 3 .   ? 48.548 25.253  90.375  1.00 15.01 ? 551 0ZZ A C11 1 
HETATM 3769 S  S2  . 0ZZ E 3 .   ? 47.227 24.150  89.879  1.00 15.01 ? 551 0ZZ A S2  1 
HETATM 3770 C  C31 . 0ZZ E 3 .   ? 47.860 23.520  88.346  1.00 15.01 ? 551 0ZZ A C31 1 
HETATM 3771 C  C41 . 0ZZ E 3 .   ? 46.768 23.142  87.386  1.00 15.01 ? 551 0ZZ A C41 1 
HETATM 3772 C  C51 . 0ZZ E 3 .   ? 47.081 22.575  86.154  1.00 15.01 ? 551 0ZZ A C51 1 
HETATM 3773 C  C61 . 0ZZ E 3 .   ? 46.076 22.182  85.264  1.00 15.01 ? 551 0ZZ A C61 1 
HETATM 3774 C  C71 . 0ZZ E 3 .   ? 44.741 22.364  85.614  1.00 15.01 ? 551 0ZZ A C71 1 
HETATM 3775 C  C81 . 0ZZ E 3 .   ? 44.422 22.932  86.837  1.00 15.01 ? 551 0ZZ A C81 1 
HETATM 3776 C  C91 . 0ZZ E 3 .   ? 45.425 23.320  87.716  1.00 15.01 ? 551 0ZZ A C91 1 
HETATM 3777 C  C2  . 0ZZ F 3 .   ? 58.022 -15.667 84.206  1.00 22.47 ? 551 0ZZ D C2  1 
HETATM 3778 C  C3  . 0ZZ F 3 .   ? 59.127 -15.787 83.349  1.00 22.47 ? 551 0ZZ D C3  1 
HETATM 3779 C  C4  . 0ZZ F 3 .   ? 60.414 -15.906 83.848  1.00 22.47 ? 551 0ZZ D C4  1 
HETATM 3780 C  C5  . 0ZZ F 3 .   ? 60.654 -15.916 85.223  1.00 22.47 ? 551 0ZZ D C5  1 
HETATM 3781 C  C6  . 0ZZ F 3 .   ? 59.553 -15.816 86.093  1.00 22.47 ? 551 0ZZ D C6  1 
HETATM 3782 O  O1  . 0ZZ F 3 .   ? 56.712 -15.407 83.656  1.00 22.47 ? 551 0ZZ D O1  1 
HETATM 3783 C  C7  . 0ZZ F 3 .   ? 55.629 -16.381 83.771  1.00 22.47 ? 551 0ZZ D C7  1 
HETATM 3784 BR BR1 . 0ZZ F 3 .   ? 62.456 -15.948 85.909  1.00 22.47 ? 551 0ZZ D BR1 1 
HETATM 3785 C  C1  . 0ZZ F 3 .   ? 58.242 -15.694 85.597  1.00 22.47 ? 551 0ZZ D C1  1 
HETATM 3786 C  C   . 0ZZ F 3 .   ? 56.785 -14.111 86.966  1.00 7.03  ? 551 0ZZ D C   1 
HETATM 3787 O  O   . 0ZZ F 3 .   ? 57.513 -13.570 87.783  1.00 7.03  ? 551 0ZZ D O   1 
HETATM 3788 C  CH3 . 0ZZ F 3 .   ? 57.062 -15.547 86.541  1.00 7.03  ? 551 0ZZ D CH3 1 
HETATM 3789 N  N   . 0ZZ F 3 .   ? 55.733 -13.496 86.420  1.00 24.57 ? 551 0ZZ D N   1 
HETATM 3790 C  CA  . 0ZZ F 3 .   ? 55.379 -12.104 86.728  1.00 24.57 ? 551 0ZZ D CA  1 
HETATM 3791 C  C8  . 0ZZ F 3 .   ? 54.050 -11.902 87.479  1.00 24.57 ? 551 0ZZ D C8  1 
HETATM 3792 O  O2  . 0ZZ F 3 .   ? 53.191 -12.792 87.509  1.00 24.57 ? 551 0ZZ D O2  1 
HETATM 3793 C  CB  . 0ZZ F 3 .   ? 55.279 -11.275 85.438  1.00 7.03  ? 551 0ZZ D CB  1 
HETATM 3794 C  CG1 . 0ZZ F 3 .   ? 56.612 -11.207 84.754  1.00 7.03  ? 551 0ZZ D CG1 1 
HETATM 3795 C  CG2 . 0ZZ F 3 .   ? 54.241 -11.890 84.522  1.00 7.03  ? 551 0ZZ D CG2 1 
HETATM 3796 N  N1  . 0ZZ F 3 .   ? 53.891 -10.716 88.072  1.00 7.35  ? 551 0ZZ D N1  1 
HETATM 3797 C  CA1 . 0ZZ F 3 .   ? 52.669 -10.355 88.791  1.00 7.35  ? 551 0ZZ D CA1 1 
HETATM 3798 C  C9  . 0ZZ F 3 .   ? 51.841 -9.331  87.978  1.00 7.35  ? 551 0ZZ D C9  1 
HETATM 3799 O  O3  . 0ZZ F 3 .   ? 50.751 -8.875  88.802  1.00 7.35  ? 551 0ZZ D O3  1 
HETATM 3800 C  CB1 . 0ZZ F 3 .   ? 53.013 -9.780  90.161  1.00 7.03  ? 551 0ZZ D CB1 1 
HETATM 3801 C  CG  . 0ZZ F 3 .   ? 53.213 -10.849 91.195  1.00 7.03  ? 551 0ZZ D CG  1 
HETATM 3802 O  OD1 . 0ZZ F 3 .   ? 52.266 -11.152 91.933  1.00 7.03  ? 551 0ZZ D OD1 1 
HETATM 3803 O  OD2 . 0ZZ F 3 .   ? 54.314 -11.400 91.266  1.00 7.03  ? 551 0ZZ D OD2 1 
HETATM 3804 C  C11 . 0ZZ F 3 .   ? 51.242 -10.060 86.763  1.00 15.01 ? 551 0ZZ D C11 1 
HETATM 3805 S  S2  . 0ZZ F 3 .   ? 50.466 -8.944  85.597  1.00 15.01 ? 551 0ZZ D S2  1 
HETATM 3806 C  C31 . 0ZZ F 3 .   ? 49.122 -8.310  86.567  1.00 15.01 ? 551 0ZZ D C31 1 
HETATM 3807 C  C41 . 0ZZ F 3 .   ? 47.941 -7.918  85.725  1.00 15.01 ? 551 0ZZ D C41 1 
HETATM 3808 C  C51 . 0ZZ F 3 .   ? 46.817 -7.347  86.314  1.00 15.01 ? 551 0ZZ D C51 1 
HETATM 3809 C  C61 . 0ZZ F 3 .   ? 45.724 -6.941  85.541  1.00 15.01 ? 551 0ZZ D C61 1 
HETATM 3810 C  C71 . 0ZZ F 3 .   ? 45.759 -7.114  84.160  1.00 15.01 ? 551 0ZZ D C71 1 
HETATM 3811 C  C81 . 0ZZ F 3 .   ? 46.873 -7.687  83.567  1.00 15.01 ? 551 0ZZ D C81 1 
HETATM 3812 C  C91 . 0ZZ F 3 .   ? 47.955 -8.087  84.341  1.00 15.01 ? 551 0ZZ D C91 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   145 ?   ?   ?   A . n 
A 1 2   GLY 2   146 ?   ?   ?   A . n 
A 1 3   ILE 3   147 ?   ?   ?   A . n 
A 1 4   SER 4   148 ?   ?   ?   A . n 
A 1 5   LEU 5   149 ?   ?   ?   A . n 
A 1 6   ASP 6   150 150 ASP ASP A . n 
A 1 7   ASN 7   151 151 ASN ASN A . n 
A 1 8   SER 8   152 152 SER SER A . n 
A 1 9   TYR 9   153 153 TYR TYR A . n 
A 1 10  LYS 10  154 154 LYS LYS A . n 
A 1 11  MET 11  155 155 MET MET A . n 
A 1 12  ASP 12  156 156 ASP ASP A . n 
A 1 13  TYR 13  156 156 TYR TYR A A n 
A 1 14  PRO 14  161 161 PRO PRO A . n 
A 1 15  GLU 15  162 162 GLU GLU A . n 
A 1 16  MET 16  162 162 MET MET A A n 
A 1 17  GLY 17  163 163 GLY GLY A . n 
A 1 18  LEU 18  164 164 LEU LEU A . n 
A 1 19  CYS 19  165 165 CYS CYS A . n 
A 1 20  ILE 20  166 166 ILE ILE A . n 
A 1 21  ILE 21  167 167 ILE ILE A . n 
A 1 22  ILE 22  168 168 ILE ILE A . n 
A 1 23  ASN 23  169 169 ASN ASN A . n 
A 1 24  ASN 24  170 170 ASN ASN A . n 
A 1 25  LYS 25  171 171 LYS LYS A . n 
A 1 26  ASN 26  172 172 ASN ASN A . n 
A 1 27  PHE 27  173 173 PHE PHE A . n 
A 1 28  HIS 28  174 174 HIS HIS A . n 
A 1 29  LYS 29  175 175 LYS LYS A . n 
A 1 30  SER 30  175 175 SER SER A A n 
A 1 31  THR 31  175 175 THR THR A B n 
A 1 32  GLY 32  175 175 GLY GLY A C n 
A 1 33  MET 33  176 176 MET MET A . n 
A 1 34  THR 34  177 177 THR THR A . n 
A 1 35  SER 35  178 178 SER SER A . n 
A 1 36  ARG 36  179 179 ARG ARG A . n 
A 1 37  SER 37  180 180 SER SER A . n 
A 1 38  GLY 38  181 181 GLY GLY A . n 
A 1 39  THR 39  182 182 THR THR A . n 
A 1 40  ASP 40  183 183 ASP ASP A . n 
A 1 41  VAL 41  184 184 VAL VAL A . n 
A 1 42  ASP 42  185 185 ASP ASP A . n 
A 1 43  ALA 43  186 186 ALA ALA A . n 
A 1 44  ALA 44  187 187 ALA ALA A . n 
A 1 45  ASN 45  188 188 ASN ASN A . n 
A 1 46  LEU 46  189 189 LEU LEU A . n 
A 1 47  ARG 47  190 190 ARG ARG A . n 
A 1 48  GLU 48  191 191 GLU GLU A . n 
A 1 49  THR 49  192 192 THR THR A . n 
A 1 50  PHE 50  193 193 PHE PHE A . n 
A 1 51  ARG 51  194 194 ARG ARG A . n 
A 1 52  ASN 52  195 195 ASN ASN A . n 
A 1 53  LEU 53  196 196 LEU LEU A . n 
A 1 54  LYS 54  197 197 LYS LYS A . n 
A 1 55  TYR 55  198 198 TYR TYR A . n 
A 1 56  GLU 56  199 199 GLU GLU A . n 
A 1 57  VAL 57  200 200 VAL VAL A . n 
A 1 58  ARG 58  201 201 ARG ARG A . n 
A 1 59  ASN 59  202 202 ASN ASN A . n 
A 1 60  LYS 60  203 203 LYS LYS A . n 
A 1 61  ASN 61  204 204 ASN ASN A . n 
A 1 62  ASP 62  205 205 ASP ASP A . n 
A 1 63  LEU 63  206 206 LEU LEU A . n 
A 1 64  THR 64  207 207 THR THR A . n 
A 1 65  ARG 65  208 208 ARG ARG A . n 
A 1 66  GLU 66  209 209 GLU GLU A . n 
A 1 67  GLU 67  210 210 GLU GLU A . n 
A 1 68  ILE 68  211 211 ILE ILE A . n 
A 1 69  VAL 69  212 212 VAL VAL A . n 
A 1 70  GLU 70  213 213 GLU GLU A . n 
A 1 71  LEU 71  214 214 LEU LEU A . n 
A 1 72  MET 72  215 215 MET MET A . n 
A 1 73  ARG 73  216 216 ARG ARG A . n 
A 1 74  ASP 74  217 217 ASP ASP A . n 
A 1 75  VAL 75  218 218 VAL VAL A . n 
A 1 76  SER 76  219 219 SER SER A . n 
A 1 77  LYS 77  220 220 LYS LYS A . n 
A 1 78  GLU 78  221 221 GLU GLU A . n 
A 1 79  ASP 79  222 222 ASP ASP A . n 
A 1 80  HIS 80  224 224 HIS HIS A . n 
A 1 81  SER 81  225 225 SER SER A . n 
A 1 82  LYS 82  226 226 LYS LYS A . n 
A 1 83  ARG 83  227 227 ARG ARG A . n 
A 1 84  SER 84  228 228 SER SER A . n 
A 1 85  SER 85  229 229 SER SER A . n 
A 1 86  PHE 86  230 230 PHE PHE A . n 
A 1 87  VAL 87  231 231 VAL VAL A . n 
A 1 88  CYS 88  232 232 CYS CYS A . n 
A 1 89  VAL 89  233 233 VAL VAL A . n 
A 1 90  LEU 90  234 234 LEU LEU A . n 
A 1 91  LEU 91  235 235 LEU LEU A . n 
A 1 92  SER 92  236 236 SER SER A . n 
A 1 93  HIS 93  237 237 HIS HIS A . n 
A 1 94  GLY 94  238 238 GLY GLY A . n 
A 1 95  GLU 95  239 239 GLU GLU A . n 
A 1 96  GLU 96  240 240 GLU GLU A . n 
A 1 97  GLY 97  241 241 GLY GLY A . n 
A 1 98  ILE 98  242 242 ILE ILE A . n 
A 1 99  ILE 99  243 243 ILE ILE A . n 
A 1 100 PHE 100 244 244 PHE PHE A . n 
A 1 101 GLY 101 245 245 GLY GLY A . n 
A 1 102 THR 102 246 246 THR THR A . n 
A 1 103 ASN 103 247 247 ASN ASN A . n 
A 1 104 GLY 104 254 254 GLY GLY A . n 
A 1 105 PRO 105 255 255 PRO PRO A . n 
A 1 106 VAL 106 256 256 VAL VAL A . n 
A 1 107 ASP 107 257 257 ASP ASP A . n 
A 1 108 LEU 108 258 258 LEU LEU A . n 
A 1 109 LYS 109 259 259 LYS LYS A . n 
A 1 110 LYS 110 260 260 LYS LYS A . n 
A 1 111 ILE 111 261 261 ILE ILE A . n 
A 1 112 THR 112 262 262 THR THR A . n 
A 1 113 ASN 113 263 263 ASN ASN A . n 
A 1 114 PHE 114 264 264 PHE PHE A . n 
A 1 115 PHE 115 265 265 PHE PHE A . n 
A 1 116 ARG 116 266 266 ARG ARG A . n 
A 1 117 GLY 117 267 267 GLY GLY A . n 
A 1 118 ASP 118 268 268 ASP ASP A . n 
A 1 119 ARG 119 269 269 ARG ARG A . n 
A 1 120 CYS 120 270 270 CYS CYS A . n 
A 1 121 ARG 121 271 271 ARG ARG A . n 
A 1 122 SER 122 272 272 SER SER A . n 
A 1 123 LEU 123 273 273 LEU LEU A . n 
A 1 124 THR 124 274 274 THR THR A . n 
A 1 125 GLY 125 275 275 GLY GLY A . n 
A 1 126 LYS 126 276 276 LYS LYS A . n 
A 1 127 PRO 127 277 277 PRO PRO A . n 
A 1 128 LYS 128 278 278 LYS LYS A . n 
A 1 129 LEU 129 279 279 LEU LEU A . n 
A 1 130 PHE 130 280 280 PHE PHE A . n 
A 1 131 ILE 131 281 281 ILE ILE A . n 
A 1 132 ILE 132 282 282 ILE ILE A . n 
A 1 133 GLN 133 283 283 GLN GLN A . n 
A 1 134 ALA 134 284 284 ALA ALA A . n 
A 1 135 CYS 135 285 285 CYS CYS A . n 
A 1 136 ARG 136 286 286 ARG ARG A . n 
A 1 137 GLY 137 287 287 GLY GLY A . n 
A 1 138 THR 138 288 288 THR THR A . n 
A 1 139 GLU 139 289 289 GLU GLU A . n 
A 1 140 LEU 140 290 290 LEU LEU A . n 
A 1 141 ASP 141 291 291 ASP ASP A . n 
A 1 142 CYS 142 292 292 CYS CYS A . n 
A 1 143 GLY 143 293 293 GLY GLY A . n 
A 1 144 ILE 144 294 294 ILE ILE A . n 
A 1 145 GLU 145 295 295 GLU GLU A . n 
A 1 146 THR 146 296 ?   ?   ?   A . n 
A 1 147 ASP 147 297 ?   ?   ?   A . n 
B 2 1   SER 1   310 ?   ?   ?   B . n 
B 2 2   GLY 2   311 ?   ?   ?   B . n 
B 2 3   VAL 3   312 ?   ?   ?   B . n 
B 2 4   ASP 4   313 ?   ?   ?   B . n 
B 2 5   ASP 5   314 ?   ?   ?   B . n 
B 2 6   ASP 6   315 ?   ?   ?   B . n 
B 2 7   MET 7   316 ?   ?   ?   B . n 
B 2 8   ALA 8   317 ?   ?   ?   B . n 
B 2 9   CYS 9   318 ?   ?   ?   B . n 
B 2 10  HIS 10  319 ?   ?   ?   B . n 
B 2 11  LYS 11  320 320 LYS LYS B . n 
B 2 12  ILE 12  321 321 ILE ILE B . n 
B 2 13  PRO 13  322 322 PRO PRO B . n 
B 2 14  VAL 14  323 323 VAL VAL B . n 
B 2 15  GLU 15  324 324 GLU GLU B . n 
B 2 16  ALA 16  325 325 ALA ALA B . n 
B 2 17  ASP 17  326 326 ASP ASP B . n 
B 2 18  PHE 18  327 327 PHE PHE B . n 
B 2 19  LEU 19  328 328 LEU LEU B . n 
B 2 20  TYR 20  329 329 TYR TYR B . n 
B 2 21  ALA 21  330 330 ALA ALA B . n 
B 2 22  TYR 22  331 331 TYR TYR B . n 
B 2 23  SER 23  332 332 SER SER B . n 
B 2 24  THR 24  333 333 THR THR B . n 
B 2 25  ALA 25  334 334 ALA ALA B . n 
B 2 26  PRO 26  335 335 PRO PRO B . n 
B 2 27  GLY 27  336 336 GLY GLY B . n 
B 2 28  TYR 28  337 337 TYR TYR B . n 
B 2 29  TYR 29  338 338 TYR TYR B . n 
B 2 30  SER 30  339 339 SER SER B . n 
B 2 31  TRP 31  340 340 TRP TRP B . n 
B 2 32  ARG 32  341 341 ARG ARG B . n 
B 2 33  ASN 33  342 342 ASN ASN B . n 
B 2 34  SER 34  343 343 SER SER B . n 
B 2 35  LYS 35  344 344 LYS LYS B . n 
B 2 36  ASP 36  345 345 ASP ASP B . n 
B 2 37  GLY 37  346 346 GLY GLY B . n 
B 2 38  SER 38  347 347 SER SER B . n 
B 2 39  TRP 39  348 348 TRP TRP B . n 
B 2 40  PHE 40  349 349 PHE PHE B . n 
B 2 41  ILE 41  350 350 ILE ILE B . n 
B 2 42  GLN 42  351 351 GLN GLN B . n 
B 2 43  SER 43  352 352 SER SER B . n 
B 2 44  LEU 44  353 353 LEU LEU B . n 
B 2 45  CYS 45  354 354 CYS CYS B . n 
B 2 46  ALA 46  355 355 ALA ALA B . n 
B 2 47  MET 47  356 356 MET MET B . n 
B 2 48  LEU 48  357 357 LEU LEU B . n 
B 2 49  LYS 49  358 358 LYS LYS B . n 
B 2 50  GLN 50  359 359 GLN GLN B . n 
B 2 51  TYR 51  360 360 TYR TYR B . n 
B 2 52  ALA 52  361 361 ALA ALA B . n 
B 2 53  ASP 53  362 362 ASP ASP B . n 
B 2 54  LYS 54  363 363 LYS LYS B . n 
B 2 55  LEU 55  364 364 LEU LEU B . n 
B 2 56  GLU 56  365 365 GLU GLU B . n 
B 2 57  PHE 57  366 366 PHE PHE B . n 
B 2 58  MET 58  367 367 MET MET B . n 
B 2 59  HIS 59  368 368 HIS HIS B . n 
B 2 60  ILE 60  369 369 ILE ILE B . n 
B 2 61  LEU 61  370 370 LEU LEU B . n 
B 2 62  THR 62  371 371 THR THR B . n 
B 2 63  ARG 63  372 372 ARG ARG B . n 
B 2 64  VAL 64  373 373 VAL VAL B . n 
B 2 65  ASN 65  374 374 ASN ASN B . n 
B 2 66  ARG 66  375 375 ARG ARG B . n 
B 2 67  LYS 67  376 376 LYS LYS B . n 
B 2 68  VAL 68  377 377 VAL VAL B . n 
B 2 69  ALA 69  378 378 ALA ALA B . n 
B 2 70  THR 70  379 379 THR THR B . n 
B 2 71  GLU 71  379 379 GLU GLU B A n 
B 2 72  PHE 72  380 380 PHE PHE B . n 
B 2 73  GLU 73  381 381 GLU GLU B . n 
B 2 74  SER 74  381 381 SER SER B A n 
B 2 75  PHE 75  381 381 PHE PHE B B n 
B 2 76  SER 76  381 381 SER SER B C n 
B 2 77  PHE 77  381 381 PHE PHE B D n 
B 2 78  ASP 78  381 381 ASP ASP B E n 
B 2 79  ALA 79  381 381 ALA ALA B F n 
B 2 80  THR 80  381 381 THR THR B G n 
B 2 81  PHE 81  381 381 PHE PHE B H n 
B 2 82  HIS 82  381 381 HIS HIS B I n 
B 2 83  ALA 83  382 382 ALA ALA B . n 
B 2 84  LYS 84  383 383 LYS LYS B . n 
B 2 85  LYS 85  384 384 LYS LYS B . n 
B 2 86  GLN 86  385 385 GLN GLN B . n 
B 2 87  ILE 87  386 386 ILE ILE B . n 
B 2 88  PRO 88  387 387 PRO PRO B . n 
B 2 89  CYS 89  388 388 CYS CYS B . n 
B 2 90  ILE 90  389 389 ILE ILE B . n 
B 2 91  VAL 91  390 390 VAL VAL B . n 
B 2 92  SER 92  392 392 SER SER B . n 
B 2 93  MET 93  393 393 MET MET B . n 
B 2 94  LEU 94  394 394 LEU LEU B . n 
B 2 95  THR 95  395 395 THR THR B . n 
B 2 96  LYS 96  396 396 LYS LYS B . n 
B 2 97  GLU 97  397 397 GLU GLU B . n 
B 2 98  LEU 98  398 398 LEU LEU B . n 
B 2 99  TYR 99  399 399 TYR TYR B . n 
B 2 100 PHE 100 400 400 PHE PHE B . n 
B 2 101 TYR 101 401 401 TYR TYR B . n 
B 2 102 HIS 102 402 ?   ?   ?   B . n 
C 1 1   SER 1   145 ?   ?   ?   D . n 
C 1 2   GLY 2   146 ?   ?   ?   D . n 
C 1 3   ILE 3   147 ?   ?   ?   D . n 
C 1 4   SER 4   148 ?   ?   ?   D . n 
C 1 5   LEU 5   149 ?   ?   ?   D . n 
C 1 6   ASP 6   150 150 ASP ASP D . n 
C 1 7   ASN 7   151 151 ASN ASN D . n 
C 1 8   SER 8   152 152 SER SER D . n 
C 1 9   TYR 9   153 153 TYR TYR D . n 
C 1 10  LYS 10  154 154 LYS LYS D . n 
C 1 11  MET 11  155 155 MET MET D . n 
C 1 12  ASP 12  156 156 ASP ASP D . n 
C 1 13  TYR 13  156 156 TYR TYR D A n 
C 1 14  PRO 14  161 161 PRO PRO D . n 
C 1 15  GLU 15  162 162 GLU GLU D . n 
C 1 16  MET 16  162 162 MET MET D A n 
C 1 17  GLY 17  163 163 GLY GLY D . n 
C 1 18  LEU 18  164 164 LEU LEU D . n 
C 1 19  CYS 19  165 165 CYS CYS D . n 
C 1 20  ILE 20  166 166 ILE ILE D . n 
C 1 21  ILE 21  167 167 ILE ILE D . n 
C 1 22  ILE 22  168 168 ILE ILE D . n 
C 1 23  ASN 23  169 169 ASN ASN D . n 
C 1 24  ASN 24  170 170 ASN ASN D . n 
C 1 25  LYS 25  171 171 LYS LYS D . n 
C 1 26  ASN 26  172 172 ASN ASN D . n 
C 1 27  PHE 27  173 173 PHE PHE D . n 
C 1 28  HIS 28  174 174 HIS HIS D . n 
C 1 29  LYS 29  175 175 LYS LYS D . n 
C 1 30  SER 30  175 175 SER SER D A n 
C 1 31  THR 31  175 175 THR THR D B n 
C 1 32  GLY 32  175 175 GLY GLY D C n 
C 1 33  MET 33  176 176 MET MET D . n 
C 1 34  THR 34  177 177 THR THR D . n 
C 1 35  SER 35  178 178 SER SER D . n 
C 1 36  ARG 36  179 179 ARG ARG D . n 
C 1 37  SER 37  180 180 SER SER D . n 
C 1 38  GLY 38  181 181 GLY GLY D . n 
C 1 39  THR 39  182 182 THR THR D . n 
C 1 40  ASP 40  183 183 ASP ASP D . n 
C 1 41  VAL 41  184 184 VAL VAL D . n 
C 1 42  ASP 42  185 185 ASP ASP D . n 
C 1 43  ALA 43  186 186 ALA ALA D . n 
C 1 44  ALA 44  187 187 ALA ALA D . n 
C 1 45  ASN 45  188 188 ASN ASN D . n 
C 1 46  LEU 46  189 189 LEU LEU D . n 
C 1 47  ARG 47  190 190 ARG ARG D . n 
C 1 48  GLU 48  191 191 GLU GLU D . n 
C 1 49  THR 49  192 192 THR THR D . n 
C 1 50  PHE 50  193 193 PHE PHE D . n 
C 1 51  ARG 51  194 194 ARG ARG D . n 
C 1 52  ASN 52  195 195 ASN ASN D . n 
C 1 53  LEU 53  196 196 LEU LEU D . n 
C 1 54  LYS 54  197 197 LYS LYS D . n 
C 1 55  TYR 55  198 198 TYR TYR D . n 
C 1 56  GLU 56  199 199 GLU GLU D . n 
C 1 57  VAL 57  200 200 VAL VAL D . n 
C 1 58  ARG 58  201 201 ARG ARG D . n 
C 1 59  ASN 59  202 202 ASN ASN D . n 
C 1 60  LYS 60  203 203 LYS LYS D . n 
C 1 61  ASN 61  204 204 ASN ASN D . n 
C 1 62  ASP 62  205 205 ASP ASP D . n 
C 1 63  LEU 63  206 206 LEU LEU D . n 
C 1 64  THR 64  207 207 THR THR D . n 
C 1 65  ARG 65  208 208 ARG ARG D . n 
C 1 66  GLU 66  209 209 GLU GLU D . n 
C 1 67  GLU 67  210 210 GLU GLU D . n 
C 1 68  ILE 68  211 211 ILE ILE D . n 
C 1 69  VAL 69  212 212 VAL VAL D . n 
C 1 70  GLU 70  213 213 GLU GLU D . n 
C 1 71  LEU 71  214 214 LEU LEU D . n 
C 1 72  MET 72  215 215 MET MET D . n 
C 1 73  ARG 73  216 216 ARG ARG D . n 
C 1 74  ASP 74  217 217 ASP ASP D . n 
C 1 75  VAL 75  218 218 VAL VAL D . n 
C 1 76  SER 76  219 219 SER SER D . n 
C 1 77  LYS 77  220 220 LYS LYS D . n 
C 1 78  GLU 78  221 221 GLU GLU D . n 
C 1 79  ASP 79  222 222 ASP ASP D . n 
C 1 80  HIS 80  224 224 HIS HIS D . n 
C 1 81  SER 81  225 225 SER SER D . n 
C 1 82  LYS 82  226 226 LYS LYS D . n 
C 1 83  ARG 83  227 227 ARG ARG D . n 
C 1 84  SER 84  228 228 SER SER D . n 
C 1 85  SER 85  229 229 SER SER D . n 
C 1 86  PHE 86  230 230 PHE PHE D . n 
C 1 87  VAL 87  231 231 VAL VAL D . n 
C 1 88  CYS 88  232 232 CYS CYS D . n 
C 1 89  VAL 89  233 233 VAL VAL D . n 
C 1 90  LEU 90  234 234 LEU LEU D . n 
C 1 91  LEU 91  235 235 LEU LEU D . n 
C 1 92  SER 92  236 236 SER SER D . n 
C 1 93  HIS 93  237 237 HIS HIS D . n 
C 1 94  GLY 94  238 238 GLY GLY D . n 
C 1 95  GLU 95  239 239 GLU GLU D . n 
C 1 96  GLU 96  240 240 GLU GLU D . n 
C 1 97  GLY 97  241 241 GLY GLY D . n 
C 1 98  ILE 98  242 242 ILE ILE D . n 
C 1 99  ILE 99  243 243 ILE ILE D . n 
C 1 100 PHE 100 244 244 PHE PHE D . n 
C 1 101 GLY 101 245 245 GLY GLY D . n 
C 1 102 THR 102 246 246 THR THR D . n 
C 1 103 ASN 103 247 247 ASN ASN D . n 
C 1 104 GLY 104 254 254 GLY GLY D . n 
C 1 105 PRO 105 255 255 PRO PRO D . n 
C 1 106 VAL 106 256 256 VAL VAL D . n 
C 1 107 ASP 107 257 257 ASP ASP D . n 
C 1 108 LEU 108 258 258 LEU LEU D . n 
C 1 109 LYS 109 259 259 LYS LYS D . n 
C 1 110 LYS 110 260 260 LYS LYS D . n 
C 1 111 ILE 111 261 261 ILE ILE D . n 
C 1 112 THR 112 262 262 THR THR D . n 
C 1 113 ASN 113 263 263 ASN ASN D . n 
C 1 114 PHE 114 264 264 PHE PHE D . n 
C 1 115 PHE 115 265 265 PHE PHE D . n 
C 1 116 ARG 116 266 266 ARG ARG D . n 
C 1 117 GLY 117 267 267 GLY GLY D . n 
C 1 118 ASP 118 268 268 ASP ASP D . n 
C 1 119 ARG 119 269 269 ARG ARG D . n 
C 1 120 CYS 120 270 270 CYS CYS D . n 
C 1 121 ARG 121 271 271 ARG ARG D . n 
C 1 122 SER 122 272 272 SER SER D . n 
C 1 123 LEU 123 273 273 LEU LEU D . n 
C 1 124 THR 124 274 274 THR THR D . n 
C 1 125 GLY 125 275 275 GLY GLY D . n 
C 1 126 LYS 126 276 276 LYS LYS D . n 
C 1 127 PRO 127 277 277 PRO PRO D . n 
C 1 128 LYS 128 278 278 LYS LYS D . n 
C 1 129 LEU 129 279 279 LEU LEU D . n 
C 1 130 PHE 130 280 280 PHE PHE D . n 
C 1 131 ILE 131 281 281 ILE ILE D . n 
C 1 132 ILE 132 282 282 ILE ILE D . n 
C 1 133 GLN 133 283 283 GLN GLN D . n 
C 1 134 ALA 134 284 284 ALA ALA D . n 
C 1 135 CYS 135 285 285 CYS CYS D . n 
C 1 136 ARG 136 286 286 ARG ARG D . n 
C 1 137 GLY 137 287 287 GLY GLY D . n 
C 1 138 THR 138 288 288 THR THR D . n 
C 1 139 GLU 139 289 289 GLU GLU D . n 
C 1 140 LEU 140 290 290 LEU LEU D . n 
C 1 141 ASP 141 291 291 ASP ASP D . n 
C 1 142 CYS 142 292 292 CYS CYS D . n 
C 1 143 GLY 143 293 293 GLY GLY D . n 
C 1 144 ILE 144 294 294 ILE ILE D . n 
C 1 145 GLU 145 295 295 GLU GLU D . n 
C 1 146 THR 146 296 ?   ?   ?   D . n 
C 1 147 ASP 147 297 ?   ?   ?   D . n 
D 2 1   SER 1   310 ?   ?   ?   E . n 
D 2 2   GLY 2   311 ?   ?   ?   E . n 
D 2 3   VAL 3   312 ?   ?   ?   E . n 
D 2 4   ASP 4   313 ?   ?   ?   E . n 
D 2 5   ASP 5   314 ?   ?   ?   E . n 
D 2 6   ASP 6   315 ?   ?   ?   E . n 
D 2 7   MET 7   316 ?   ?   ?   E . n 
D 2 8   ALA 8   317 ?   ?   ?   E . n 
D 2 9   CYS 9   318 ?   ?   ?   E . n 
D 2 10  HIS 10  319 ?   ?   ?   E . n 
D 2 11  LYS 11  320 320 LYS LYS E . n 
D 2 12  ILE 12  321 321 ILE ILE E . n 
D 2 13  PRO 13  322 322 PRO PRO E . n 
D 2 14  VAL 14  323 323 VAL VAL E . n 
D 2 15  GLU 15  324 324 GLU GLU E . n 
D 2 16  ALA 16  325 325 ALA ALA E . n 
D 2 17  ASP 17  326 326 ASP ASP E . n 
D 2 18  PHE 18  327 327 PHE PHE E . n 
D 2 19  LEU 19  328 328 LEU LEU E . n 
D 2 20  TYR 20  329 329 TYR TYR E . n 
D 2 21  ALA 21  330 330 ALA ALA E . n 
D 2 22  TYR 22  331 331 TYR TYR E . n 
D 2 23  SER 23  332 332 SER SER E . n 
D 2 24  THR 24  333 333 THR THR E . n 
D 2 25  ALA 25  334 334 ALA ALA E . n 
D 2 26  PRO 26  335 335 PRO PRO E . n 
D 2 27  GLY 27  336 336 GLY GLY E . n 
D 2 28  TYR 28  337 337 TYR TYR E . n 
D 2 29  TYR 29  338 338 TYR TYR E . n 
D 2 30  SER 30  339 339 SER SER E . n 
D 2 31  TRP 31  340 340 TRP TRP E . n 
D 2 32  ARG 32  341 341 ARG ARG E . n 
D 2 33  ASN 33  342 342 ASN ASN E . n 
D 2 34  SER 34  343 343 SER SER E . n 
D 2 35  LYS 35  344 344 LYS LYS E . n 
D 2 36  ASP 36  345 345 ASP ASP E . n 
D 2 37  GLY 37  346 346 GLY GLY E . n 
D 2 38  SER 38  347 347 SER SER E . n 
D 2 39  TRP 39  348 348 TRP TRP E . n 
D 2 40  PHE 40  349 349 PHE PHE E . n 
D 2 41  ILE 41  350 350 ILE ILE E . n 
D 2 42  GLN 42  351 351 GLN GLN E . n 
D 2 43  SER 43  352 352 SER SER E . n 
D 2 44  LEU 44  353 353 LEU LEU E . n 
D 2 45  CYS 45  354 354 CYS CYS E . n 
D 2 46  ALA 46  355 355 ALA ALA E . n 
D 2 47  MET 47  356 356 MET MET E . n 
D 2 48  LEU 48  357 357 LEU LEU E . n 
D 2 49  LYS 49  358 358 LYS LYS E . n 
D 2 50  GLN 50  359 359 GLN GLN E . n 
D 2 51  TYR 51  360 360 TYR TYR E . n 
D 2 52  ALA 52  361 361 ALA ALA E . n 
D 2 53  ASP 53  362 362 ASP ASP E . n 
D 2 54  LYS 54  363 363 LYS LYS E . n 
D 2 55  LEU 55  364 364 LEU LEU E . n 
D 2 56  GLU 56  365 365 GLU GLU E . n 
D 2 57  PHE 57  366 366 PHE PHE E . n 
D 2 58  MET 58  367 367 MET MET E . n 
D 2 59  HIS 59  368 368 HIS HIS E . n 
D 2 60  ILE 60  369 369 ILE ILE E . n 
D 2 61  LEU 61  370 370 LEU LEU E . n 
D 2 62  THR 62  371 371 THR THR E . n 
D 2 63  ARG 63  372 372 ARG ARG E . n 
D 2 64  VAL 64  373 373 VAL VAL E . n 
D 2 65  ASN 65  374 374 ASN ASN E . n 
D 2 66  ARG 66  375 375 ARG ARG E . n 
D 2 67  LYS 67  376 376 LYS LYS E . n 
D 2 68  VAL 68  377 377 VAL VAL E . n 
D 2 69  ALA 69  378 378 ALA ALA E . n 
D 2 70  THR 70  379 379 THR THR E . n 
D 2 71  GLU 71  379 379 GLU GLU E A n 
D 2 72  PHE 72  380 380 PHE PHE E . n 
D 2 73  GLU 73  381 381 GLU GLU E . n 
D 2 74  SER 74  381 381 SER SER E A n 
D 2 75  PHE 75  381 381 PHE PHE E B n 
D 2 76  SER 76  381 381 SER SER E C n 
D 2 77  PHE 77  381 381 PHE PHE E D n 
D 2 78  ASP 78  381 381 ASP ASP E E n 
D 2 79  ALA 79  381 381 ALA ALA E F n 
D 2 80  THR 80  381 381 THR THR E G n 
D 2 81  PHE 81  381 381 PHE PHE E H n 
D 2 82  HIS 82  381 381 HIS HIS E I n 
D 2 83  ALA 83  382 382 ALA ALA E . n 
D 2 84  LYS 84  383 383 LYS LYS E . n 
D 2 85  LYS 85  384 384 LYS LYS E . n 
D 2 86  GLN 86  385 385 GLN GLN E . n 
D 2 87  ILE 87  386 386 ILE ILE E . n 
D 2 88  PRO 88  387 387 PRO PRO E . n 
D 2 89  CYS 89  388 388 CYS CYS E . n 
D 2 90  ILE 90  389 389 ILE ILE E . n 
D 2 91  VAL 91  390 390 VAL VAL E . n 
D 2 92  SER 92  392 392 SER SER E . n 
D 2 93  MET 93  393 393 MET MET E . n 
D 2 94  LEU 94  394 394 LEU LEU E . n 
D 2 95  THR 95  395 395 THR THR E . n 
D 2 96  LYS 96  396 396 LYS LYS E . n 
D 2 97  GLU 97  397 397 GLU GLU E . n 
D 2 98  LEU 98  398 398 LEU LEU E . n 
D 2 99  TYR 99  399 399 TYR TYR E . n 
D 2 100 PHE 100 400 400 PHE PHE E . n 
D 2 101 TYR 101 401 401 TYR TYR E . n 
D 2 102 HIS 102 402 ?   ?   ?   E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 0ZZ 1 551 551 0ZZ BOP A . 
F 3 0ZZ 1 551 551 0ZZ BOP D . 
# 
_pdbx_molecule_features.prd_id    PRD_000391 
_pdbx_molecule_features.name      
'(3S)-5-(benzylsulfanyl)-3-({N-[(5-bromo-2-methoxyphenyl)acetyl]-L-valyl}amino)-4-oxopentanoic acid' 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
loop_
_pdbx_molecule.instance_id 
_pdbx_molecule.prd_id 
_pdbx_molecule.asym_id 
1 PRD_000391 E 
2 PRD_000391 F 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13370 ? 
1 MORE         -74   ? 
1 'SSA (A^2)'  17670 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-12-12 
5 'Structure model' 1 4 2014-01-22 
6 'Structure model' 1 5 2017-10-11 
7 'Structure model' 1 6 2022-12-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Atomic model'              
3  3 'Structure model' 'Database references'       
4  3 'Structure model' 'Derived calculations'      
5  3 'Structure model' 'Non-polymer description'   
6  3 'Structure model' 'Structure summary'         
7  3 'Structure model' 'Version format compliance' 
8  4 'Structure model' Other                       
9  5 'Structure model' Other                       
10 6 'Structure model' 'Refinement description'    
11 7 'Structure model' 'Database references'       
12 7 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 6 'Structure model' software           
2 7 'Structure model' database_2         
3 7 'Structure model' struct_conn        
4 7 'Structure model' struct_ref_seq_dif 
5 7 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 6 'Structure model' '_software.name'                      
2 7 'Structure model' '_database_2.pdbx_DOI'                
3 7 'Structure model' '_database_2.pdbx_database_accession' 
4 7 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 7 'Structure model' '_struct_ref_seq_dif.details'         
6 7 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 7 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 7 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX    refinement       2002       ? 1 
X-GEN  'data reduction' .          ? 2 
SAINT  'data scaling'   'V. 4.050' ? 3 
X-PLOR phasing          .          ? 4 
# 
_pdbx_entry_details.entry_id                 1RHQ 
_pdbx_entry_details.nonpolymer_details       
;THE INHIBITOR BINDS TO THE CATALYTIC CYS 285 IN CHAINS 
A AND D VIA HEMITHIOACETAL LINKAGES
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE2 A GLU 239 ? ? 1_555 OE2 A GLU 239 ? ? 2_758 0.72 
2 1 NE2 D HIS 174 ? ? 1_555 OD1 E ASP 381 E ? 2_758 1.49 
3 1 O   A GLY 175 C ? 1_555 O   A GLY 175 C ? 2_758 1.54 
4 1 CA  A GLY 175 C ? 1_555 CG2 A THR 177 ? ? 2_758 1.83 
5 1 CD  A GLU 239 ? ? 1_555 OE2 A GLU 239 ? ? 2_758 1.92 
6 1 CE1 D HIS 174 ? ? 1_555 OD1 E ASP 381 E ? 2_758 1.98 
7 1 NE2 D HIS 174 ? ? 1_555 CG  E ASP 381 E ? 2_758 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 156 ? ? -157.62 42.68   
2  1 PRO A 161 ? ? -48.51  -13.33  
3  1 LYS A 171 ? ? -149.51 -44.33  
4  1 ARG A 179 ? ? -105.66 79.64   
5  1 SER A 180 ? ? -58.01  93.48   
6  1 ASP A 185 ? ? -52.64  -85.45  
7  1 ALA A 186 ? ? -27.34  -35.80  
8  1 ASP A 205 ? ? 25.72   63.01   
9  1 GLU A 209 ? ? -83.89  39.38   
10 1 GLU A 210 ? ? -142.70 -42.62  
11 1 MET A 215 ? ? -53.45  -70.90  
12 1 SER A 229 ? ? 177.79  -173.72 
13 1 SER A 236 ? ? 179.76  -159.13 
14 1 HIS A 237 ? ? -109.75 -168.62 
15 1 ILE A 243 ? ? -172.62 126.40  
16 1 THR A 246 ? ? -84.64  30.26   
17 1 ASN A 247 ? ? -149.38 -34.96  
18 1 LYS A 260 ? ? -66.58  10.78   
19 1 PHE A 264 ? ? -57.95  -3.83   
20 1 ARG A 269 ? ? -76.24  -75.34  
21 1 THR A 288 ? ? -146.94 37.63   
22 1 ASP B 326 ? ? 81.66   12.40   
23 1 SER B 343 ? ? -55.43  -9.58   
24 1 LYS B 344 ? ? -114.35 -72.54  
25 1 SER B 347 ? ? -37.67  133.61  
26 1 TRP B 348 ? ? -50.10  -74.38  
27 1 ALA B 361 ? ? -56.31  8.32    
28 1 ASP B 362 ? ? -141.69 15.82   
29 1 GLU B 365 ? ? -92.14  -108.60 
30 1 PHE B 366 ? ? -154.19 -49.67  
31 1 LYS B 376 ? ? -68.40  13.61   
32 1 ALA B 382 ? ? 75.06   52.28   
33 1 PHE B 400 ? ? -63.01  71.00   
34 1 ASP D 156 ? ? -157.65 42.63   
35 1 PRO D 161 ? ? -48.56  -13.30  
36 1 LYS D 171 ? ? -149.49 -44.36  
37 1 ARG D 179 ? ? -105.65 79.65   
38 1 SER D 180 ? ? -57.97  93.46   
39 1 ASP D 185 ? ? -52.62  -85.47  
40 1 ALA D 186 ? ? -27.37  -35.76  
41 1 ASP D 205 ? ? 25.72   63.00   
42 1 GLU D 209 ? ? -83.91  39.43   
43 1 GLU D 210 ? ? -142.74 -42.60  
44 1 MET D 215 ? ? -53.49  -70.83  
45 1 SER D 229 ? ? 177.82  -173.69 
46 1 SER D 236 ? ? 179.77  -159.12 
47 1 HIS D 237 ? ? -109.76 -168.63 
48 1 ILE D 243 ? ? -172.63 126.44  
49 1 THR D 246 ? ? -84.58  30.25   
50 1 ASN D 247 ? ? -149.35 -35.00  
51 1 LYS D 260 ? ? -66.59  10.75   
52 1 PHE D 264 ? ? -58.04  -3.78   
53 1 ARG D 269 ? ? -76.25  -75.27  
54 1 THR D 288 ? ? -146.94 37.65   
55 1 ASP E 326 ? ? 81.65   12.40   
56 1 SER E 343 ? ? -55.43  -9.58   
57 1 LYS E 344 ? ? -114.41 -72.52  
58 1 SER E 347 ? ? -37.70  133.63  
59 1 TRP E 348 ? ? -50.07  -74.33  
60 1 ALA E 361 ? ? -56.39  8.37    
61 1 ASP E 362 ? ? -141.69 15.84   
62 1 GLU E 365 ? ? -92.11  -108.61 
63 1 PHE E 366 ? ? -154.19 -49.67  
64 1 LYS E 376 ? ? -68.45  13.67   
65 1 ALA E 382 ? ? 75.08   52.27   
66 1 PHE E 400 ? ? -62.99  70.96   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 145 ? A SER 1   
2  1 Y 1 A GLY 146 ? A GLY 2   
3  1 Y 1 A ILE 147 ? A ILE 3   
4  1 Y 1 A SER 148 ? A SER 4   
5  1 Y 1 A LEU 149 ? A LEU 5   
6  1 Y 1 A THR 296 ? A THR 146 
7  1 Y 1 A ASP 297 ? A ASP 147 
8  1 Y 1 B SER 310 ? B SER 1   
9  1 Y 1 B GLY 311 ? B GLY 2   
10 1 Y 1 B VAL 312 ? B VAL 3   
11 1 Y 1 B ASP 313 ? B ASP 4   
12 1 Y 1 B ASP 314 ? B ASP 5   
13 1 Y 1 B ASP 315 ? B ASP 6   
14 1 Y 1 B MET 316 ? B MET 7   
15 1 Y 1 B ALA 317 ? B ALA 8   
16 1 Y 1 B CYS 318 ? B CYS 9   
17 1 Y 1 B HIS 319 ? B HIS 10  
18 1 Y 1 B HIS 402 ? B HIS 102 
19 1 Y 1 D SER 145 ? C SER 1   
20 1 Y 1 D GLY 146 ? C GLY 2   
21 1 Y 1 D ILE 147 ? C ILE 3   
22 1 Y 1 D SER 148 ? C SER 4   
23 1 Y 1 D LEU 149 ? C LEU 5   
24 1 Y 1 D THR 296 ? C THR 146 
25 1 Y 1 D ASP 297 ? C ASP 147 
26 1 Y 1 E SER 310 ? D SER 1   
27 1 Y 1 E GLY 311 ? D GLY 2   
28 1 Y 1 E VAL 312 ? D VAL 3   
29 1 Y 1 E ASP 313 ? D ASP 4   
30 1 Y 1 E ASP 314 ? D ASP 5   
31 1 Y 1 E ASP 315 ? D ASP 6   
32 1 Y 1 E MET 316 ? D MET 7   
33 1 Y 1 E ALA 317 ? D ALA 8   
34 1 Y 1 E CYS 318 ? D CYS 9   
35 1 Y 1 E HIS 319 ? D HIS 10  
36 1 Y 1 E HIS 402 ? D HIS 102 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        
'5-S-benzyl-3-({N-[(5-bromo-2-methoxyphenyl)acetyl]-L-valyl}amino)-2,3-dideoxy-5-thio-D-erythro-pentonic acid' 
_pdbx_entity_nonpoly.comp_id     0ZZ 
#