data_1RHU
# 
_entry.id   1RHU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.362 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RHU         pdb_00001rhu 10.2210/pdb1rhu/pdb 
RCSB  RCSB020754   ?            ?                   
WWPDB D_1000020754 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PAU 'Caspase-3 complex with Acetyl-Asp-Glu-Val-Asp-aldehyde' unspecified 
PDB 1RHJ .                                                        unspecified 
PDB 1RHK .                                                        unspecified 
PDB 1RHM .                                                        unspecified 
PDB 1RHQ .                                                        unspecified 
PDB 1RHR .                                                        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RHU 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, J.W.'  1 
'Rotonda, J.'   2 
'Soisson, S.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            47 
_citation.page_first                2466 
_citation.page_last                 2474 
_citation.year                      2004 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15115390 
_citation.pdbx_database_id_DOI      10.1021/jm0305523 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, J.W.'     1  ? 
primary 'Rotonda, J.'      2  ? 
primary 'Soisson, S.M.'    3  ? 
primary 'Aspiotis, R.'     4  ? 
primary 'Bayly, C.'        5  ? 
primary 'Francoeur, S.'    6  ? 
primary 'Gallant, M.'      7  ? 
primary 'Garcia-Calvo, M.' 8  ? 
primary 'Giroux, A.'       9  ? 
primary 'Grimm, E.'        10 ? 
primary 'Han, Y.'          11 ? 
primary 'McKay, D.'        12 ? 
primary 'Nicholson, D.W.'  13 ? 
primary 'Peterson, E.'     14 ? 
primary 'Renaud, J.'       15 ? 
primary 'Roy, S.'          16 ? 
primary 'Thornberry, N.'   17 ? 
primary 'Zamboni, R.'      18 ? 
# 
_cell.entry_id           1RHU 
_cell.length_a           69.500 
_cell.length_b           98.000 
_cell.length_c           44.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RHU 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Caspase-3 16639.902 1  3.4.22.- ? 'P17 SUBUNIT' ? 
2 polymer     man Caspase-3 11910.604 1  3.4.22.- ? 'P12 SUBUNIT' ? 
3 non-polymer syn 
;(3S)-3-[({(2S)-5-[(N-ACETYL-L-ALPHA-ASPARTYL)AMINO]-4-OXO-1,2,4,5,6,7-HEXAHYDROAZEPINO[3,2,1-HI]INDOL-2-YL}CARBONYL)AMINO]-5-(BENZYLSULFANYL)-4-OXOPENTANOIC ACID
;
638.688   1  ?        ? ?             ? 
4 water       nat water 18.015    99 ?        ? ?             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
2 'Cysteine protease CPP32, Yama protein, CPP-32, Apopain, CASP-3, SREBP cleavage activity 1, SCA-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A ? 
2 'polypeptide(L)' no no 
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   SER n 
2 2   GLY n 
2 3   VAL n 
2 4   ASP n 
2 5   ASP n 
2 6   ASP n 
2 7   MET n 
2 8   ALA n 
2 9   CYS n 
2 10  HIS n 
2 11  LYS n 
2 12  ILE n 
2 13  PRO n 
2 14  VAL n 
2 15  GLU n 
2 16  ALA n 
2 17  ASP n 
2 18  PHE n 
2 19  LEU n 
2 20  TYR n 
2 21  ALA n 
2 22  TYR n 
2 23  SER n 
2 24  THR n 
2 25  ALA n 
2 26  PRO n 
2 27  GLY n 
2 28  TYR n 
2 29  TYR n 
2 30  SER n 
2 31  TRP n 
2 32  ARG n 
2 33  ASN n 
2 34  SER n 
2 35  LYS n 
2 36  ASP n 
2 37  GLY n 
2 38  SER n 
2 39  TRP n 
2 40  PHE n 
2 41  ILE n 
2 42  GLN n 
2 43  SER n 
2 44  LEU n 
2 45  CYS n 
2 46  ALA n 
2 47  MET n 
2 48  LEU n 
2 49  LYS n 
2 50  GLN n 
2 51  TYR n 
2 52  ALA n 
2 53  ASP n 
2 54  LYS n 
2 55  LEU n 
2 56  GLU n 
2 57  PHE n 
2 58  MET n 
2 59  HIS n 
2 60  ILE n 
2 61  LEU n 
2 62  THR n 
2 63  ARG n 
2 64  VAL n 
2 65  ASN n 
2 66  ARG n 
2 67  LYS n 
2 68  VAL n 
2 69  ALA n 
2 70  THR n 
2 71  GLU n 
2 72  PHE n 
2 73  GLU n 
2 74  SER n 
2 75  PHE n 
2 76  SER n 
2 77  PHE n 
2 78  ASP n 
2 79  ALA n 
2 80  THR n 
2 81  PHE n 
2 82  HIS n 
2 83  ALA n 
2 84  LYS n 
2 85  LYS n 
2 86  GLN n 
2 87  ILE n 
2 88  PRO n 
2 89  CYS n 
2 90  ILE n 
2 91  VAL n 
2 92  SER n 
2 93  MET n 
2 94  LEU n 
2 95  THR n 
2 96  LYS n 
2 97  GLU n 
2 98  LEU n 
2 99  TYR n 
2 100 PHE n 
2 101 TYR n 
2 102 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo 'CASP3, CPP32' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CASP3_HUMAN P42574 1 
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
29  ? 
2 UNP CASP3_HUMAN P42574 2 
;SGVDDDMACHKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
176 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RHU A 1 ? 147 ? P42574 29  ? 175 ? 145 297 
2 2 1RHU B 1 ? 102 ? P42574 176 ? 277 ? 310 402 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1RHU 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      15 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P42574 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          190 
_struct_ref_seq_dif.details                      variant 
_struct_ref_seq_dif.pdbx_auth_seq_num            324 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3CY non-polymer         . 
;(3S)-3-[({(2S)-5-[(N-ACETYL-L-ALPHA-ASPARTYL)AMINO]-4-OXO-1,2,4,5,6,7-HEXAHYDROAZEPINO[3,2,1-HI]INDOL-2-YL}CARBONYL)AMINO]-5-(BENZYLSULFANYL)-4-OXOPENTANOIC ACID
;
? 'C31 H34 N4 O9 S' 638.688 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RHU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.12 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.62 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              3.60 
_exptl_crystal_grow.pdbx_details    
'0.5% PEG-6000, 100 mM citrate, 3 mM NaN(3), pH 3.60, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1999-04-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
# 
_reflns.entry_id                     1RHU 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             49.0 
_reflns.d_resolution_high            2.513 
_reflns.number_obs                   9500 
_reflns.number_all                   10801 
_reflns.percent_possible_obs         88.0 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.17 
_reflns.B_iso_Wilson_estimate        18.1 
_reflns.pdbx_redundancy              3.085 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.513 
_reflns_shell.d_res_low              2.603 
_reflns_shell.percent_possible_all   25.0 
_reflns_shell.Rmerge_I_obs           0.193 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.34 
_reflns_shell.pdbx_redundancy        1.408 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      265 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1RHU 
_refine.ls_number_reflns_obs                     8836 
_refine.ls_number_reflns_all                     8836 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               47703.24 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.00 
_refine.ls_d_res_high                            2.51 
_refine.ls_percent_reflns_obs                    81.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.166 
_refine.ls_R_factor_R_free                       0.212 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.4 
_refine.ls_number_reflns_R_free                  916 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               29.4 
_refine.aniso_B[1][1]                            6.26 
_refine.aniso_B[2][2]                            -7.49 
_refine.aniso_B[3][3]                            1.23 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.290242 
_refine.solvent_model_param_bsol                 21.3842 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'Protein part of 1PAU.pdb' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RHU 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1870 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             99 
_refine_hist.number_atoms_total               2014 
_refine_hist.d_res_high                       2.51 
_refine_hist.d_res_low                        49.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.22  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.04  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.05  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.20  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             524 
_refine_ls_shell.R_factor_R_work                  0.211 
_refine_ls_shell.percent_reflns_obs               32.0 
_refine_ls_shell.R_factor_R_free                  0.242 
_refine_ls_shell.R_factor_R_free_error            0.035 
_refine_ls_shell.percent_reflns_R_free            8.6 
_refine_ls_shell.number_reflns_R_free             49 
_refine_ls_shell.number_reflns_obs                515 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.P PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PAR WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM     ION.TOP     'X-RAY DIFFRACTION' 
4 TRI.PAR       TRI.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RHU 
_struct.title                     'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE-3 WITH A 5,6,7 TRICYCLIC PEPTIDOMIMETIC INHIBITOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RHU 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'CYSTEINE PROTEASE, CASPASE-3, APOPAIN, CPP32, YAMA, COMPLEX (PROTEASE-INHIBITOR), HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The second part of the biological assembly is generated by the two-fold axis: 2-x, -y, z' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 38  ? LEU A 53  ? GLY A 181 LEU A 196 1 ? 16 
HELX_P HELX_P2 2 THR A 64  ? GLU A 78  ? THR A 207 GLU A 221 1 ? 15 
HELX_P HELX_P3 3 LEU A 108 ? ASN A 113 ? LEU A 258 ASN A 263 1 ? 6  
HELX_P HELX_P4 4 PHE A 114 ? ARG A 116 ? PHE A 264 ARG A 266 5 ? 3  
HELX_P HELX_P5 5 CYS A 120 ? THR A 124 ? CYS A 270 THR A 274 5 ? 5  
HELX_P HELX_P6 6 TRP B 39  ? ALA B 52  ? TRP B 348 ALA B 361 1 ? 14 
HELX_P HELX_P7 7 GLU B 56  ? PHE B 72  ? GLU B 365 PHE B 380 1 ? 17 
HELX_P HELX_P8 8 ASP B 78  E HIS B 82  I ASP B 381 HIS B 381 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            135 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           C 
_struct_conn.ptnr2_label_comp_id           3CY 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C9 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             285 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            3CY 
_struct_conn.ptnr2_auth_seq_id             501 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.795 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 56  ? ASN A 61  ? GLU A 199 ASN A 204 
A 2 GLU A 15  ? ASN A 23  ? GLU A 162 ASN A 169 
A 3 ARG A 83  ? LEU A 91  ? ARG A 227 LEU A 235 
A 4 LYS A 128 ? GLN A 133 ? LYS A 278 GLN A 283 
A 5 PHE B 18  ? TYR B 22  ? PHE B 327 TYR B 331 
A 6 CYS B 89  ? SER B 92  ? CYS B 388 SER B 392 
B 1 GLY A 94  ? GLU A 95  ? GLY A 238 GLU A 239 
B 2 ILE A 98  ? GLY A 101 ? ILE A 242 GLY A 245 
B 3 GLY A 104 ? ASP A 107 ? GLY A 254 ASP A 257 
C 1 ARG B 32  ? ASN B 33  ? ARG B 341 ASN B 342 
C 2 GLY B 37  ? SER B 38  ? GLY B 346 SER B 347 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 60  ? O LYS A 203 N ASN A 23  ? N ASN A 169 
A 2 3 N ILE A 20  ? N ILE A 166 O VAL A 89  ? O VAL A 233 
A 3 4 N LEU A 90  ? N LEU A 234 O GLN A 133 ? O GLN A 283 
A 4 5 N PHE A 130 ? N PHE A 280 O LEU B 19  ? O LEU B 328 
A 5 6 N TYR B 22  ? N TYR B 331 O CYS B 89  ? O CYS B 388 
B 1 2 N GLU A 95  ? N GLU A 239 O ILE A 98  ? O ILE A 242 
B 2 3 N GLY A 101 ? N GLY A 245 O GLY A 104 ? O GLY A 254 
C 1 2 N ASN B 33  ? N ASN B 342 O GLY B 37  ? O GLY B 346 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    3CY 
_struct_site.pdbx_auth_seq_id     501 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    18 
_struct_site.details              'BINDING SITE FOR RESIDUE 3CY A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 HOH D .   ? HOH A 16  . ? 1_555 ? 
2  AC1 18 HOH D .   ? HOH A 47  . ? 1_555 ? 
3  AC1 18 HOH D .   ? HOH A 55  . ? 1_555 ? 
4  AC1 18 ARG A 36  ? ARG A 179 . ? 1_555 ? 
5  AC1 18 HIS A 93  ? HIS A 237 . ? 1_555 ? 
6  AC1 18 GLU A 95  ? GLU A 239 . ? 1_555 ? 
7  AC1 18 GLN A 133 ? GLN A 283 . ? 1_555 ? 
8  AC1 18 CYS A 135 ? CYS A 285 . ? 1_555 ? 
9  AC1 18 THR A 138 ? THR A 288 . ? 1_555 ? 
10 AC1 18 SER B 30  ? SER B 339 . ? 1_555 ? 
11 AC1 18 TRP B 31  ? TRP B 340 . ? 1_555 ? 
12 AC1 18 ARG B 32  ? ARG B 341 . ? 1_555 ? 
13 AC1 18 ASN B 33  ? ASN B 342 . ? 1_555 ? 
14 AC1 18 SER B 34  ? SER B 343 . ? 1_555 ? 
15 AC1 18 TRP B 39  ? TRP B 348 . ? 1_555 ? 
16 AC1 18 SER B 74  A SER B 381 . ? 1_555 ? 
17 AC1 18 PHE B 75  B PHE B 381 . ? 1_555 ? 
18 AC1 18 PHE B 81  H PHE B 381 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RHU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RHU 
_atom_sites.fract_transf_matrix[1][1]   0.014388 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010204 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022727 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 6   ? 55.856 7.989   124.801 1.00 56.95 ? 150 ASP A N   1 
ATOM   2    C CA  . ASP A 1 6   ? 56.452 6.628   124.677 1.00 57.12 ? 150 ASP A CA  1 
ATOM   3    C C   . ASP A 1 6   ? 57.482 6.534   123.562 1.00 56.13 ? 150 ASP A C   1 
ATOM   4    O O   . ASP A 1 6   ? 57.288 7.069   122.465 1.00 56.54 ? 150 ASP A O   1 
ATOM   5    C CB  . ASP A 1 6   ? 55.367 5.575   124.430 1.00 59.38 ? 150 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 6   ? 54.817 4.985   125.717 1.00 61.28 ? 150 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 6   ? 54.503 3.774   125.726 1.00 61.57 ? 150 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 6   ? 54.692 5.728   126.714 1.00 62.80 ? 150 ASP A OD2 1 
ATOM   9    N N   . ASN A 1 7   ? 58.571 5.831   123.855 1.00 53.69 ? 151 ASN A N   1 
ATOM   10   C CA  . ASN A 1 7   ? 59.659 5.637   122.908 1.00 51.05 ? 151 ASN A CA  1 
ATOM   11   C C   . ASN A 1 7   ? 59.815 4.166   122.540 1.00 47.59 ? 151 ASN A C   1 
ATOM   12   O O   . ASN A 1 7   ? 60.886 3.732   122.121 1.00 46.82 ? 151 ASN A O   1 
ATOM   13   C CB  . ASN A 1 7   ? 60.955 6.174   123.511 1.00 53.67 ? 151 ASN A CB  1 
ATOM   14   C CG  . ASN A 1 7   ? 60.930 6.165   125.029 1.00 56.05 ? 151 ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 7   ? 60.761 5.113   125.655 1.00 58.08 ? 151 ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 7   ? 61.087 7.342   125.631 1.00 55.02 ? 151 ASN A ND2 1 
ATOM   17   N N   . SER A 1 8   ? 58.737 3.406   122.710 1.00 44.01 ? 152 SER A N   1 
ATOM   18   C CA  . SER A 1 8   ? 58.726 1.982   122.380 1.00 40.44 ? 152 SER A CA  1 
ATOM   19   C C   . SER A 1 8   ? 57.322 1.590   121.948 1.00 37.03 ? 152 SER A C   1 
ATOM   20   O O   . SER A 1 8   ? 56.341 2.063   122.514 1.00 37.19 ? 152 SER A O   1 
ATOM   21   C CB  . SER A 1 8   ? 59.139 1.144   123.586 1.00 38.84 ? 152 SER A CB  1 
ATOM   22   O OG  . SER A 1 8   ? 58.168 1.245   124.601 1.00 40.50 ? 152 SER A OG  1 
ATOM   23   N N   . TYR A 1 9   ? 57.229 0.729   120.940 1.00 34.06 ? 153 TYR A N   1 
ATOM   24   C CA  . TYR A 1 9   ? 55.935 0.285   120.429 1.00 31.56 ? 153 TYR A CA  1 
ATOM   25   C C   . TYR A 1 9   ? 55.082 -0.400  121.487 1.00 31.55 ? 153 TYR A C   1 
ATOM   26   O O   . TYR A 1 9   ? 55.595 -0.965  122.449 1.00 30.58 ? 153 TYR A O   1 
ATOM   27   C CB  . TYR A 1 9   ? 56.126 -0.674  119.252 1.00 26.89 ? 153 TYR A CB  1 
ATOM   28   C CG  . TYR A 1 9   ? 56.670 -0.021  118.010 1.00 22.82 ? 153 TYR A CG  1 
ATOM   29   C CD1 . TYR A 1 9   ? 55.878 0.837   117.244 1.00 21.19 ? 153 TYR A CD1 1 
ATOM   30   C CD2 . TYR A 1 9   ? 57.987 -0.235  117.612 1.00 22.09 ? 153 TYR A CD2 1 
ATOM   31   C CE1 . TYR A 1 9   ? 56.387 1.467   116.112 1.00 18.10 ? 153 TYR A CE1 1 
ATOM   32   C CE2 . TYR A 1 9   ? 58.510 0.390   116.481 1.00 20.37 ? 153 TYR A CE2 1 
ATOM   33   C CZ  . TYR A 1 9   ? 57.708 1.240   115.739 1.00 18.70 ? 153 TYR A CZ  1 
ATOM   34   O OH  . TYR A 1 9   ? 58.241 1.870   114.642 1.00 14.60 ? 153 TYR A OH  1 
ATOM   35   N N   . LYS A 1 10  ? 53.771 -0.344  121.288 1.00 32.72 ? 154 LYS A N   1 
ATOM   36   C CA  . LYS A 1 10  ? 52.813 -0.962  122.195 1.00 34.18 ? 154 LYS A CA  1 
ATOM   37   C C   . LYS A 1 10  ? 52.690 -2.432  121.797 1.00 33.94 ? 154 LYS A C   1 
ATOM   38   O O   . LYS A 1 10  ? 52.145 -2.754  120.747 1.00 32.93 ? 154 LYS A O   1 
ATOM   39   C CB  . LYS A 1 10  ? 51.460 -0.263  122.070 1.00 35.50 ? 154 LYS A CB  1 
ATOM   40   C CG  . LYS A 1 10  ? 50.331 -0.888  122.861 1.00 40.06 ? 154 LYS A CG  1 
ATOM   41   C CD  . LYS A 1 10  ? 49.003 -0.254  122.463 1.00 44.86 ? 154 LYS A CD  1 
ATOM   42   C CE  . LYS A 1 10  ? 47.820 -0.910  123.163 1.00 48.05 ? 154 LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 10  ? 46.510 -0.382  122.663 1.00 50.90 ? 154 LYS A NZ  1 
ATOM   44   N N   . MET A 1 11  ? 53.209 -3.321  122.636 1.00 34.35 ? 155 MET A N   1 
ATOM   45   C CA  . MET A 1 11  ? 53.166 -4.748  122.347 1.00 34.39 ? 155 MET A CA  1 
ATOM   46   C C   . MET A 1 11  ? 52.183 -5.493  123.241 1.00 34.67 ? 155 MET A C   1 
ATOM   47   O O   . MET A 1 11  ? 52.284 -6.711  123.413 1.00 34.11 ? 155 MET A O   1 
ATOM   48   C CB  . MET A 1 11  ? 54.561 -5.350  122.501 1.00 32.98 ? 155 MET A CB  1 
ATOM   49   C CG  . MET A 1 11  ? 55.589 -4.750  121.567 1.00 33.45 ? 155 MET A CG  1 
ATOM   50   S SD  . MET A 1 11  ? 55.165 -4.995  119.835 1.00 34.49 ? 155 MET A SD  1 
ATOM   51   C CE  . MET A 1 11  ? 55.924 -6.566  119.513 1.00 32.55 ? 155 MET A CE  1 
ATOM   52   N N   . ASP A 1 12  ? 51.230 -4.760  123.804 1.00 34.25 ? 156 ASP A N   1 
ATOM   53   C CA  . ASP A 1 12  ? 50.253 -5.379  124.676 1.00 34.91 ? 156 ASP A CA  1 
ATOM   54   C C   . ASP A 1 12  ? 48.880 -5.536  124.044 1.00 34.47 ? 156 ASP A C   1 
ATOM   55   O O   . ASP A 1 12  ? 47.867 -5.514  124.746 1.00 35.55 ? 156 ASP A O   1 
ATOM   56   C CB  . ASP A 1 12  ? 50.138 -4.608  125.995 1.00 36.24 ? 156 ASP A CB  1 
ATOM   57   C CG  . ASP A 1 12  ? 49.796 -3.142  125.795 1.00 39.31 ? 156 ASP A CG  1 
ATOM   58   O OD1 . ASP A 1 12  ? 48.909 -2.831  124.967 1.00 39.61 ? 156 ASP A OD1 1 
ATOM   59   O OD2 . ASP A 1 12  ? 50.411 -2.297  126.482 1.00 42.78 ? 156 ASP A OD2 1 
ATOM   60   N N   . TYR A 1 13  A 48.832 -5.679  122.723 1.00 32.68 ? 156 TYR A N   1 
ATOM   61   C CA  . TYR A 1 13  A 47.547 -5.892  122.059 1.00 32.39 ? 156 TYR A CA  1 
ATOM   62   C C   . TYR A 1 13  A 47.151 -7.330  122.370 1.00 31.96 ? 156 TYR A C   1 
ATOM   63   O O   . TYR A 1 13  A 47.996 -8.137  122.765 1.00 32.21 ? 156 TYR A O   1 
ATOM   64   C CB  . TYR A 1 13  A 47.661 -5.709  120.542 1.00 32.21 ? 156 TYR A CB  1 
ATOM   65   C CG  . TYR A 1 13  A 47.689 -4.268  120.091 1.00 32.84 ? 156 TYR A CG  1 
ATOM   66   C CD1 . TYR A 1 13  A 48.830 -3.486  120.255 1.00 33.30 ? 156 TYR A CD1 1 
ATOM   67   C CD2 . TYR A 1 13  A 46.567 -3.682  119.508 1.00 33.06 ? 156 TYR A CD2 1 
ATOM   68   C CE1 . TYR A 1 13  A 48.856 -2.156  119.849 1.00 34.63 ? 156 TYR A CE1 1 
ATOM   69   C CE2 . TYR A 1 13  A 46.580 -2.349  119.096 1.00 34.02 ? 156 TYR A CE2 1 
ATOM   70   C CZ  . TYR A 1 13  A 47.729 -1.591  119.268 1.00 35.42 ? 156 TYR A CZ  1 
ATOM   71   O OH  . TYR A 1 13  A 47.757 -0.276  118.848 1.00 35.61 ? 156 TYR A OH  1 
ATOM   72   N N   . PRO A 1 14  ? 45.866 -7.678  122.202 1.00 31.69 ? 161 PRO A N   1 
ATOM   73   C CA  . PRO A 1 14  ? 45.489 -9.065  122.503 1.00 31.26 ? 161 PRO A CA  1 
ATOM   74   C C   . PRO A 1 14  ? 46.326 -10.117 121.765 1.00 31.35 ? 161 PRO A C   1 
ATOM   75   O O   . PRO A 1 14  ? 46.549 -11.209 122.281 1.00 31.74 ? 161 PRO A O   1 
ATOM   76   C CB  . PRO A 1 14  ? 44.000 -9.113  122.137 1.00 29.44 ? 161 PRO A CB  1 
ATOM   77   C CG  . PRO A 1 14  ? 43.844 -8.011  121.127 1.00 30.93 ? 161 PRO A CG  1 
ATOM   78   C CD  . PRO A 1 14  ? 44.712 -6.915  121.693 1.00 30.96 ? 161 PRO A CD  1 
ATOM   79   N N   . GLU A 1 15  ? 46.811 -9.773  120.575 1.00 31.26 ? 162 GLU A N   1 
ATOM   80   C CA  . GLU A 1 15  ? 47.617 -10.690 119.770 1.00 31.20 ? 162 GLU A CA  1 
ATOM   81   C C   . GLU A 1 15  ? 48.947 -10.086 119.334 1.00 29.36 ? 162 GLU A C   1 
ATOM   82   O O   . GLU A 1 15  ? 48.988 -8.985  118.780 1.00 29.66 ? 162 GLU A O   1 
ATOM   83   C CB  . GLU A 1 15  ? 46.841 -11.109 118.523 1.00 34.19 ? 162 GLU A CB  1 
ATOM   84   C CG  . GLU A 1 15  ? 45.750 -12.133 118.753 1.00 38.05 ? 162 GLU A CG  1 
ATOM   85   C CD  . GLU A 1 15  ? 44.917 -12.360 117.506 1.00 41.73 ? 162 GLU A CD  1 
ATOM   86   O OE1 . GLU A 1 15  ? 45.505 -12.421 116.403 1.00 43.01 ? 162 GLU A OE1 1 
ATOM   87   O OE2 . GLU A 1 15  ? 43.678 -12.484 117.629 1.00 43.69 ? 162 GLU A OE2 1 
ATOM   88   N N   . MET A 1 16  A 50.027 -10.824 119.561 1.00 27.09 ? 162 MET A N   1 
ATOM   89   C CA  . MET A 1 16  A 51.367 -10.369 119.194 1.00 26.18 ? 162 MET A CA  1 
ATOM   90   C C   . MET A 1 16  A 51.436 -10.021 117.708 1.00 25.20 ? 162 MET A C   1 
ATOM   91   O O   . MET A 1 16  A 52.092 -9.051  117.307 1.00 23.74 ? 162 MET A O   1 
ATOM   92   C CB  . MET A 1 16  A 52.396 -11.455 119.506 1.00 27.22 ? 162 MET A CB  1 
ATOM   93   C CG  . MET A 1 16  A 53.794 -10.929 119.722 1.00 29.40 ? 162 MET A CG  1 
ATOM   94   S SD  . MET A 1 16  A 53.934 -9.910  121.212 1.00 32.01 ? 162 MET A SD  1 
ATOM   95   C CE  . MET A 1 16  A 55.700 -9.882  121.402 1.00 31.40 ? 162 MET A CE  1 
ATOM   96   N N   . GLY A 1 17  ? 50.758 -10.817 116.891 1.00 23.70 ? 163 GLY A N   1 
ATOM   97   C CA  . GLY A 1 17  ? 50.762 -10.552 115.466 1.00 24.02 ? 163 GLY A CA  1 
ATOM   98   C C   . GLY A 1 17  ? 50.997 -11.772 114.600 1.00 24.04 ? 163 GLY A C   1 
ATOM   99   O O   . GLY A 1 17  ? 51.250 -12.871 115.089 1.00 24.72 ? 163 GLY A O   1 
ATOM   100  N N   . LEU A 1 18  ? 50.925 -11.569 113.295 1.00 23.88 ? 164 LEU A N   1 
ATOM   101  C CA  . LEU A 1 18  ? 51.108 -12.647 112.340 1.00 23.89 ? 164 LEU A CA  1 
ATOM   102  C C   . LEU A 1 18  ? 52.560 -12.755 111.863 1.00 23.78 ? 164 LEU A C   1 
ATOM   103  O O   . LEU A 1 18  ? 53.275 -11.759 111.798 1.00 23.18 ? 164 LEU A O   1 
ATOM   104  C CB  . LEU A 1 18  ? 50.162 -12.409 111.169 1.00 23.85 ? 164 LEU A CB  1 
ATOM   105  C CG  . LEU A 1 18  ? 50.127 -13.425 110.047 1.00 26.80 ? 164 LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 18  ? 49.955 -14.819 110.614 1.00 28.32 ? 164 LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 18  ? 48.974 -13.071 109.115 1.00 29.66 ? 164 LEU A CD2 1 
ATOM   108  N N   . CYS A 1 19  ? 52.995 -13.972 111.540 1.00 23.17 ? 165 CYS A N   1 
ATOM   109  C CA  . CYS A 1 19  ? 54.363 -14.214 111.068 1.00 22.05 ? 165 CYS A CA  1 
ATOM   110  C C   . CYS A 1 19  ? 54.375 -15.189 109.896 1.00 19.82 ? 165 CYS A C   1 
ATOM   111  O O   . CYS A 1 19  ? 54.259 -16.394 110.079 1.00 21.20 ? 165 CYS A O   1 
ATOM   112  C CB  . CYS A 1 19  ? 55.232 -14.770 112.205 1.00 22.75 ? 165 CYS A CB  1 
ATOM   113  S SG  . CYS A 1 19  ? 56.866 -15.408 111.698 1.00 24.17 ? 165 CYS A SG  1 
ATOM   114  N N   . ILE A 1 20  ? 54.524 -14.663 108.690 1.00 19.28 ? 166 ILE A N   1 
ATOM   115  C CA  . ILE A 1 20  ? 54.536 -15.503 107.505 1.00 20.44 ? 166 ILE A CA  1 
ATOM   116  C C   . ILE A 1 20  ? 55.961 -15.903 107.157 1.00 21.56 ? 166 ILE A C   1 
ATOM   117  O O   . ILE A 1 20  ? 56.851 -15.059 107.120 1.00 22.58 ? 166 ILE A O   1 
ATOM   118  C CB  . ILE A 1 20  ? 53.946 -14.764 106.275 1.00 19.22 ? 166 ILE A CB  1 
ATOM   119  C CG1 . ILE A 1 20  ? 52.624 -14.073 106.632 1.00 19.88 ? 166 ILE A CG1 1 
ATOM   120  C CG2 . ILE A 1 20  ? 53.730 -15.743 105.152 1.00 18.40 ? 166 ILE A CG2 1 
ATOM   121  C CD1 . ILE A 1 20  ? 51.575 -14.984 107.221 1.00 20.33 ? 166 ILE A CD1 1 
ATOM   122  N N   . ILE A 1 21  ? 56.176 -17.191 106.906 1.00 21.36 ? 167 ILE A N   1 
ATOM   123  C CA  . ILE A 1 21  ? 57.493 -17.683 106.515 1.00 20.43 ? 167 ILE A CA  1 
ATOM   124  C C   . ILE A 1 21  ? 57.336 -18.294 105.124 1.00 21.64 ? 167 ILE A C   1 
ATOM   125  O O   . ILE A 1 21  ? 56.575 -19.244 104.938 1.00 22.27 ? 167 ILE A O   1 
ATOM   126  C CB  . ILE A 1 21  ? 58.028 -18.784 107.480 1.00 17.19 ? 167 ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 21  ? 58.167 -18.235 108.900 1.00 17.08 ? 167 ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 21  ? 59.373 -19.280 107.002 1.00 13.33 ? 167 ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 21  ? 58.685 -19.249 109.914 1.00 15.78 ? 167 ILE A CD1 1 
ATOM   130  N N   . ILE A 1 22  ? 58.022 -17.726 104.140 1.00 22.16 ? 168 ILE A N   1 
ATOM   131  C CA  . ILE A 1 22  ? 57.956 -18.253 102.788 1.00 21.72 ? 168 ILE A CA  1 
ATOM   132  C C   . ILE A 1 22  ? 59.266 -18.966 102.546 1.00 21.95 ? 168 ILE A C   1 
ATOM   133  O O   . ILE A 1 22  ? 60.309 -18.343 102.387 1.00 21.90 ? 168 ILE A O   1 
ATOM   134  C CB  . ILE A 1 22  ? 57.741 -17.132 101.760 1.00 21.57 ? 168 ILE A CB  1 
ATOM   135  C CG1 . ILE A 1 22  ? 56.342 -16.541 101.950 1.00 21.92 ? 168 ILE A CG1 1 
ATOM   136  C CG2 . ILE A 1 22  ? 57.889 -17.682 100.346 1.00 20.62 ? 168 ILE A CG2 1 
ATOM   137  C CD1 . ILE A 1 22  ? 56.064 -15.337 101.106 1.00 22.49 ? 168 ILE A CD1 1 
ATOM   138  N N   . ASN A 1 23  ? 59.198 -20.290 102.529 1.00 23.42 ? 169 ASN A N   1 
ATOM   139  C CA  . ASN A 1 23  ? 60.379 -21.127 102.361 1.00 24.47 ? 169 ASN A CA  1 
ATOM   140  C C   . ASN A 1 23  ? 60.525 -21.758 100.968 1.00 24.59 ? 169 ASN A C   1 
ATOM   141  O O   . ASN A 1 23  ? 59.934 -22.795 100.685 1.00 24.77 ? 169 ASN A O   1 
ATOM   142  C CB  . ASN A 1 23  ? 60.344 -22.210 103.449 1.00 24.51 ? 169 ASN A CB  1 
ATOM   143  C CG  . ASN A 1 23  ? 61.468 -23.205 103.326 1.00 25.56 ? 169 ASN A CG  1 
ATOM   144  O OD1 . ASN A 1 23  ? 62.637 -22.836 103.256 1.00 25.45 ? 169 ASN A OD1 1 
ATOM   145  N ND2 . ASN A 1 23  ? 61.118 -24.485 103.311 1.00 27.35 ? 169 ASN A ND2 1 
ATOM   146  N N   . ASN A 1 24  ? 61.314 -21.127 100.103 1.00 24.21 ? 170 ASN A N   1 
ATOM   147  C CA  . ASN A 1 24  ? 61.535 -21.638 98.752  1.00 24.93 ? 170 ASN A CA  1 
ATOM   148  C C   . ASN A 1 24  ? 62.797 -22.476 98.674  1.00 27.43 ? 170 ASN A C   1 
ATOM   149  O O   . ASN A 1 24  ? 63.914 -21.967 98.840  1.00 28.43 ? 170 ASN A O   1 
ATOM   150  C CB  . ASN A 1 24  ? 61.615 -20.488 97.748  1.00 23.68 ? 170 ASN A CB  1 
ATOM   151  C CG  . ASN A 1 24  ? 60.246 -20.017 97.307  1.00 23.04 ? 170 ASN A CG  1 
ATOM   152  O OD1 . ASN A 1 24  ? 59.231 -20.436 97.865  1.00 21.87 ? 170 ASN A OD1 1 
ATOM   153  N ND2 . ASN A 1 24  ? 60.206 -19.144 96.306  1.00 20.28 ? 170 ASN A ND2 1 
ATOM   154  N N   . LYS A 1 25  ? 62.612 -23.761 98.390  1.00 28.13 ? 171 LYS A N   1 
ATOM   155  C CA  . LYS A 1 25  ? 63.718 -24.704 98.322  1.00 30.55 ? 171 LYS A CA  1 
ATOM   156  C C   . LYS A 1 25  ? 64.012 -25.263 96.933  1.00 31.96 ? 171 LYS A C   1 
ATOM   157  O O   . LYS A 1 25  ? 65.168 -25.562 96.611  1.00 31.89 ? 171 LYS A O   1 
ATOM   158  C CB  . LYS A 1 25  ? 63.430 -25.857 99.283  1.00 32.49 ? 171 LYS A CB  1 
ATOM   159  C CG  . LYS A 1 25  ? 64.419 -27.009 99.243  1.00 35.34 ? 171 LYS A CG  1 
ATOM   160  C CD  . LYS A 1 25  ? 63.912 -28.158 100.108 1.00 37.27 ? 171 LYS A CD  1 
ATOM   161  C CE  . LYS A 1 25  ? 64.842 -29.359 100.041 1.00 40.86 ? 171 LYS A CE  1 
ATOM   162  N NZ  . LYS A 1 25  ? 64.364 -30.493 100.888 1.00 42.38 ? 171 LYS A NZ  1 
ATOM   163  N N   . ASN A 1 26  ? 62.971 -25.409 96.117  1.00 32.61 ? 172 ASN A N   1 
ATOM   164  C CA  . ASN A 1 26  ? 63.127 -25.969 94.781  1.00 33.50 ? 172 ASN A CA  1 
ATOM   165  C C   . ASN A 1 26  ? 62.700 -24.995 93.701  1.00 34.45 ? 172 ASN A C   1 
ATOM   166  O O   . ASN A 1 26  ? 61.661 -24.354 93.812  1.00 34.33 ? 172 ASN A O   1 
ATOM   167  C CB  . ASN A 1 26  ? 62.329 -27.273 94.669  1.00 33.49 ? 172 ASN A CB  1 
ATOM   168  C CG  . ASN A 1 26  ? 62.779 -28.326 95.685  1.00 33.17 ? 172 ASN A CG  1 
ATOM   169  O OD1 . ASN A 1 26  ? 62.138 -28.522 96.722  1.00 33.95 ? 172 ASN A OD1 1 
ATOM   170  N ND2 . ASN A 1 26  ? 63.890 -28.995 95.395  1.00 29.57 ? 172 ASN A ND2 1 
ATOM   171  N N   . PHE A 1 27  ? 63.504 -24.907 92.646  1.00 35.97 ? 173 PHE A N   1 
ATOM   172  C CA  . PHE A 1 27  ? 63.242 -23.980 91.549  1.00 38.68 ? 173 PHE A CA  1 
ATOM   173  C C   . PHE A 1 27  ? 63.176 -24.633 90.163  1.00 41.46 ? 173 PHE A C   1 
ATOM   174  O O   . PHE A 1 27  ? 63.900 -25.596 89.880  1.00 41.66 ? 173 PHE A O   1 
ATOM   175  C CB  . PHE A 1 27  ? 64.325 -22.894 91.552  1.00 37.04 ? 173 PHE A CB  1 
ATOM   176  C CG  . PHE A 1 27  ? 64.447 -22.178 92.861  1.00 37.25 ? 173 PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 27  ? 63.697 -21.031 93.118  1.00 37.42 ? 173 PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 27  ? 65.258 -22.690 93.869  1.00 36.38 ? 173 PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 27  ? 63.752 -20.405 94.363  1.00 35.79 ? 173 PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 27  ? 65.318 -22.075 95.114  1.00 35.72 ? 173 PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 27  ? 64.564 -20.932 95.362  1.00 36.60 ? 173 PHE A CZ  1 
ATOM   182  N N   . HIS A 1 28  ? 62.307 -24.090 89.308  1.00 42.82 ? 174 HIS A N   1 
ATOM   183  C CA  . HIS A 1 28  ? 62.133 -24.570 87.936  1.00 45.44 ? 174 HIS A CA  1 
ATOM   184  C C   . HIS A 1 28  ? 63.436 -24.427 87.150  1.00 45.76 ? 174 HIS A C   1 
ATOM   185  O O   . HIS A 1 28  ? 64.168 -23.454 87.325  1.00 44.73 ? 174 HIS A O   1 
ATOM   186  C CB  . HIS A 1 28  ? 61.044 -23.763 87.233  1.00 48.57 ? 174 HIS A CB  1 
ATOM   187  C CG  . HIS A 1 28  ? 59.709 -23.845 87.902  1.00 53.54 ? 174 HIS A CG  1 
ATOM   188  N ND1 . HIS A 1 28  ? 59.568 -24.062 89.256  1.00 55.59 ? 174 HIS A ND1 1 
ATOM   189  C CD2 . HIS A 1 28  ? 58.453 -23.711 87.410  1.00 55.58 ? 174 HIS A CD2 1 
ATOM   190  C CE1 . HIS A 1 28  ? 58.284 -24.060 89.570  1.00 56.29 ? 174 HIS A CE1 1 
ATOM   191  N NE2 . HIS A 1 28  ? 57.587 -23.848 88.467  1.00 56.91 ? 174 HIS A NE2 1 
ATOM   192  N N   . LYS A 1 29  ? 63.711 -25.391 86.275  1.00 47.25 ? 175 LYS A N   1 
ATOM   193  C CA  . LYS A 1 29  ? 64.932 -25.372 85.472  1.00 47.98 ? 175 LYS A CA  1 
ATOM   194  C C   . LYS A 1 29  ? 65.072 -24.042 84.739  1.00 47.15 ? 175 LYS A C   1 
ATOM   195  O O   . LYS A 1 29  ? 66.184 -23.563 84.517  1.00 46.92 ? 175 LYS A O   1 
ATOM   196  C CB  . LYS A 1 29  ? 64.928 -26.515 84.450  1.00 49.45 ? 175 LYS A CB  1 
ATOM   197  C CG  . LYS A 1 29  ? 64.538 -27.878 85.005  1.00 52.79 ? 175 LYS A CG  1 
ATOM   198  C CD  . LYS A 1 29  ? 64.684 -28.961 83.930  1.00 55.56 ? 175 LYS A CD  1 
ATOM   199  C CE  . LYS A 1 29  ? 64.014 -30.277 84.337  1.00 56.87 ? 175 LYS A CE  1 
ATOM   200  N NZ  . LYS A 1 29  ? 62.525 -30.155 84.432  1.00 56.96 ? 175 LYS A NZ  1 
ATOM   201  N N   . SER A 1 30  A 63.941 -23.453 84.364  1.00 46.36 ? 175 SER A N   1 
ATOM   202  C CA  . SER A 1 30  A 63.939 -22.178 83.652  1.00 46.43 ? 175 SER A CA  1 
ATOM   203  C C   . SER A 1 30  A 64.713 -21.093 84.399  1.00 45.86 ? 175 SER A C   1 
ATOM   204  O O   . SER A 1 30  A 65.462 -20.326 83.790  1.00 46.61 ? 175 SER A O   1 
ATOM   205  C CB  . SER A 1 30  A 62.498 -21.702 83.410  1.00 46.93 ? 175 SER A CB  1 
ATOM   206  O OG  . SER A 1 30  A 61.786 -21.515 84.626  1.00 47.34 ? 175 SER A OG  1 
ATOM   207  N N   . THR A 1 31  B 64.535 -21.036 85.717  1.00 43.62 ? 175 THR A N   1 
ATOM   208  C CA  . THR A 1 31  B 65.205 -20.036 86.541  1.00 41.56 ? 175 THR A CA  1 
ATOM   209  C C   . THR A 1 31  B 66.722 -20.215 86.538  1.00 39.34 ? 175 THR A C   1 
ATOM   210  O O   . THR A 1 31  B 67.469 -19.241 86.461  1.00 37.55 ? 175 THR A O   1 
ATOM   211  C CB  . THR A 1 31  B 64.699 -20.091 88.003  1.00 42.40 ? 175 THR A CB  1 
ATOM   212  O OG1 . THR A 1 31  B 65.097 -21.331 88.605  1.00 41.94 ? 175 THR A OG1 1 
ATOM   213  C CG2 . THR A 1 31  B 63.172 -19.967 88.043  1.00 40.81 ? 175 THR A CG2 1 
ATOM   214  N N   . GLY A 1 32  C 67.169 -21.462 86.621  1.00 38.56 ? 175 GLY A N   1 
ATOM   215  C CA  . GLY A 1 32  C 68.595 -21.739 86.634  1.00 39.41 ? 175 GLY A CA  1 
ATOM   216  C C   . GLY A 1 32  C 69.189 -21.683 88.035  1.00 39.94 ? 175 GLY A C   1 
ATOM   217  O O   . GLY A 1 32  C 70.414 -21.665 88.193  1.00 39.10 ? 175 GLY A O   1 
ATOM   218  N N   . MET A 1 33  ? 68.320 -21.651 89.047  1.00 39.39 ? 176 MET A N   1 
ATOM   219  C CA  . MET A 1 33  ? 68.745 -21.593 90.442  1.00 39.23 ? 176 MET A CA  1 
ATOM   220  C C   . MET A 1 33  ? 68.904 -23.001 91.024  1.00 38.70 ? 176 MET A C   1 
ATOM   221  O O   . MET A 1 33  ? 68.079 -23.879 90.777  1.00 38.91 ? 176 MET A O   1 
ATOM   222  C CB  . MET A 1 33  ? 67.715 -20.832 91.284  1.00 40.14 ? 176 MET A CB  1 
ATOM   223  C CG  . MET A 1 33  ? 67.331 -19.446 90.791  1.00 41.70 ? 176 MET A CG  1 
ATOM   224  S SD  . MET A 1 33  ? 68.702 -18.298 90.610  1.00 42.85 ? 176 MET A SD  1 
ATOM   225  C CE  . MET A 1 33  ? 69.663 -18.650 92.067  1.00 45.55 ? 176 MET A CE  1 
ATOM   226  N N   . THR A 1 34  ? 69.956 -23.204 91.814  1.00 38.36 ? 177 THR A N   1 
ATOM   227  C CA  . THR A 1 34  ? 70.211 -24.502 92.437  1.00 38.30 ? 177 THR A CA  1 
ATOM   228  C C   . THR A 1 34  ? 69.266 -24.714 93.619  1.00 37.63 ? 177 THR A C   1 
ATOM   229  O O   . THR A 1 34  ? 68.724 -23.754 94.170  1.00 37.76 ? 177 THR A O   1 
ATOM   230  C CB  . THR A 1 34  ? 71.666 -24.611 92.954  1.00 37.87 ? 177 THR A CB  1 
ATOM   231  O OG1 . THR A 1 34  ? 71.788 -23.933 94.212  1.00 39.25 ? 177 THR A OG1 1 
ATOM   232  C CG2 . THR A 1 34  ? 72.628 -23.985 91.951  1.00 36.11 ? 177 THR A CG2 1 
ATOM   233  N N   . SER A 1 35  ? 69.074 -25.971 94.006  1.00 36.83 ? 178 SER A N   1 
ATOM   234  C CA  . SER A 1 35  ? 68.193 -26.301 95.119  1.00 35.74 ? 178 SER A CA  1 
ATOM   235  C C   . SER A 1 35  ? 68.758 -25.684 96.399  1.00 33.97 ? 178 SER A C   1 
ATOM   236  O O   . SER A 1 35  ? 69.962 -25.719 96.625  1.00 34.23 ? 178 SER A O   1 
ATOM   237  C CB  . SER A 1 35  ? 68.091 -27.815 95.261  1.00 36.11 ? 178 SER A CB  1 
ATOM   238  O OG  . SER A 1 35  ? 67.141 -28.166 96.247  1.00 42.59 ? 178 SER A OG  1 
ATOM   239  N N   . ARG A 1 36  ? 67.897 -25.118 97.239  1.00 32.34 ? 179 ARG A N   1 
ATOM   240  C CA  . ARG A 1 36  ? 68.371 -24.481 98.471  1.00 31.11 ? 179 ARG A CA  1 
ATOM   241  C C   . ARG A 1 36  ? 68.386 -25.408 99.689  1.00 30.84 ? 179 ARG A C   1 
ATOM   242  O O   . ARG A 1 36  ? 67.533 -25.323 100.577 1.00 30.77 ? 179 ARG A O   1 
ATOM   243  C CB  . ARG A 1 36  ? 67.548 -23.215 98.751  1.00 28.55 ? 179 ARG A CB  1 
ATOM   244  C CG  . ARG A 1 36  ? 67.741 -22.142 97.678  1.00 26.57 ? 179 ARG A CG  1 
ATOM   245  C CD  . ARG A 1 36  ? 67.080 -20.817 98.036  1.00 25.76 ? 179 ARG A CD  1 
ATOM   246  N NE  . ARG A 1 36  ? 67.592 -20.288 99.296  1.00 23.37 ? 179 ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 36  ? 66.994 -20.438 100.472 1.00 22.68 ? 179 ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 36  ? 65.842 -21.098 100.559 1.00 22.47 ? 179 ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 36  ? 67.560 -19.943 101.563 1.00 20.88 ? 179 ARG A NH2 1 
ATOM   250  N N   . SER A 1 37  ? 69.389 -26.284 99.719  1.00 29.62 ? 180 SER A N   1 
ATOM   251  C CA  . SER A 1 37  ? 69.561 -27.259 100.791 1.00 27.24 ? 180 SER A CA  1 
ATOM   252  C C   . SER A 1 37  ? 69.829 -26.610 102.144 1.00 25.54 ? 180 SER A C   1 
ATOM   253  O O   . SER A 1 37  ? 70.692 -25.746 102.264 1.00 23.02 ? 180 SER A O   1 
ATOM   254  C CB  . SER A 1 37  ? 70.717 -28.204 100.455 1.00 27.11 ? 180 SER A CB  1 
ATOM   255  O OG  . SER A 1 37  ? 70.589 -28.726 99.143  1.00 27.31 ? 180 SER A OG  1 
ATOM   256  N N   . GLY A 1 38  ? 69.089 -27.054 103.158 1.00 25.29 ? 181 GLY A N   1 
ATOM   257  C CA  . GLY A 1 38  ? 69.247 -26.527 104.500 1.00 25.64 ? 181 GLY A CA  1 
ATOM   258  C C   . GLY A 1 38  ? 68.189 -25.505 104.872 1.00 25.59 ? 181 GLY A C   1 
ATOM   259  O O   . GLY A 1 38  ? 68.031 -25.167 106.040 1.00 26.18 ? 181 GLY A O   1 
ATOM   260  N N   . THR A 1 39  ? 67.452 -25.020 103.881 1.00 25.87 ? 182 THR A N   1 
ATOM   261  C CA  . THR A 1 39  ? 66.428 -24.019 104.128 1.00 25.89 ? 182 THR A CA  1 
ATOM   262  C C   . THR A 1 39  ? 65.308 -24.496 105.058 1.00 26.32 ? 182 THR A C   1 
ATOM   263  O O   . THR A 1 39  ? 64.682 -23.690 105.755 1.00 25.16 ? 182 THR A O   1 
ATOM   264  C CB  . THR A 1 39  ? 65.824 -23.527 102.804 1.00 26.47 ? 182 THR A CB  1 
ATOM   265  O OG1 . THR A 1 39  ? 65.029 -22.365 103.059 1.00 28.32 ? 182 THR A OG1 1 
ATOM   266  C CG2 . THR A 1 39  ? 64.959 -24.616 102.157 1.00 25.47 ? 182 THR A CG2 1 
ATOM   267  N N   . ASP A 1 40  ? 65.074 -25.807 105.075 1.00 27.39 ? 183 ASP A N   1 
ATOM   268  C CA  . ASP A 1 40  ? 64.045 -26.411 105.923 1.00 26.78 ? 183 ASP A CA  1 
ATOM   269  C C   . ASP A 1 40  ? 64.409 -26.271 107.385 1.00 24.31 ? 183 ASP A C   1 
ATOM   270  O O   . ASP A 1 40  ? 63.538 -26.067 108.233 1.00 25.43 ? 183 ASP A O   1 
ATOM   271  C CB  . ASP A 1 40  ? 63.870 -27.891 105.587 1.00 29.78 ? 183 ASP A CB  1 
ATOM   272  C CG  . ASP A 1 40  ? 63.341 -28.102 104.199 1.00 33.18 ? 183 ASP A CG  1 
ATOM   273  O OD1 . ASP A 1 40  ? 62.269 -27.537 103.884 1.00 36.35 ? 183 ASP A OD1 1 
ATOM   274  O OD2 . ASP A 1 40  ? 63.998 -28.827 103.423 1.00 35.73 ? 183 ASP A OD2 1 
ATOM   275  N N   . VAL A 1 41  ? 65.694 -26.396 107.680 1.00 20.60 ? 184 VAL A N   1 
ATOM   276  C CA  . VAL A 1 41  ? 66.149 -26.236 109.045 1.00 20.54 ? 184 VAL A CA  1 
ATOM   277  C C   . VAL A 1 41  ? 65.762 -24.819 109.481 1.00 21.80 ? 184 VAL A C   1 
ATOM   278  O O   . VAL A 1 41  ? 65.159 -24.626 110.538 1.00 21.67 ? 184 VAL A O   1 
ATOM   279  C CB  . VAL A 1 41  ? 67.675 -26.413 109.140 1.00 20.76 ? 184 VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 41  ? 68.148 -26.220 110.573 1.00 19.44 ? 184 VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 41  ? 68.060 -27.795 108.642 1.00 19.37 ? 184 VAL A CG2 1 
ATOM   282  N N   . ASP A 1 42  ? 66.074 -23.829 108.649 1.00 21.84 ? 185 ASP A N   1 
ATOM   283  C CA  . ASP A 1 42  ? 65.731 -22.455 108.986 1.00 21.31 ? 185 ASP A CA  1 
ATOM   284  C C   . ASP A 1 42  ? 64.228 -22.343 109.220 1.00 21.43 ? 185 ASP A C   1 
ATOM   285  O O   . ASP A 1 42  ? 63.783 -21.825 110.248 1.00 20.76 ? 185 ASP A O   1 
ATOM   286  C CB  . ASP A 1 42  ? 66.121 -21.485 107.867 1.00 22.11 ? 185 ASP A CB  1 
ATOM   287  C CG  . ASP A 1 42  ? 67.617 -21.417 107.635 1.00 25.00 ? 185 ASP A CG  1 
ATOM   288  O OD1 . ASP A 1 42  ? 68.399 -21.698 108.575 1.00 26.32 ? 185 ASP A OD1 1 
ATOM   289  O OD2 . ASP A 1 42  ? 68.012 -21.064 106.504 1.00 26.30 ? 185 ASP A OD2 1 
ATOM   290  N N   . ALA A 1 43  ? 63.447 -22.839 108.265 1.00 20.25 ? 186 ALA A N   1 
ATOM   291  C CA  . ALA A 1 43  ? 62.000 -22.758 108.369 1.00 19.61 ? 186 ALA A CA  1 
ATOM   292  C C   . ALA A 1 43  ? 61.491 -23.345 109.680 1.00 21.21 ? 186 ALA A C   1 
ATOM   293  O O   . ALA A 1 43  ? 60.622 -22.755 110.333 1.00 21.50 ? 186 ALA A O   1 
ATOM   294  C CB  . ALA A 1 43  ? 61.353 -23.452 107.183 1.00 18.11 ? 186 ALA A CB  1 
ATOM   295  N N   . ALA A 1 44  ? 62.041 -24.497 110.068 1.00 21.89 ? 187 ALA A N   1 
ATOM   296  C CA  . ALA A 1 44  ? 61.646 -25.169 111.308 1.00 21.02 ? 187 ALA A CA  1 
ATOM   297  C C   . ALA A 1 44  ? 62.105 -24.363 112.511 1.00 21.37 ? 187 ALA A C   1 
ATOM   298  O O   . ALA A 1 44  ? 61.361 -24.175 113.472 1.00 21.75 ? 187 ALA A O   1 
ATOM   299  C CB  . ALA A 1 44  ? 62.248 -26.561 111.363 1.00 17.28 ? 187 ALA A CB  1 
ATOM   300  N N   . ASN A 1 45  ? 63.345 -23.899 112.446 1.00 22.24 ? 188 ASN A N   1 
ATOM   301  C CA  . ASN A 1 45  ? 63.940 -23.097 113.506 1.00 24.35 ? 188 ASN A CA  1 
ATOM   302  C C   . ASN A 1 45  ? 63.086 -21.832 113.743 1.00 25.18 ? 188 ASN A C   1 
ATOM   303  O O   . ASN A 1 45  ? 62.625 -21.561 114.864 1.00 21.29 ? 188 ASN A O   1 
ATOM   304  C CB  . ASN A 1 45  ? 65.345 -22.693 113.077 1.00 26.07 ? 188 ASN A CB  1 
ATOM   305  C CG  . ASN A 1 45  ? 66.295 -22.583 114.231 1.00 29.61 ? 188 ASN A CG  1 
ATOM   306  O OD1 . ASN A 1 45  ? 65.924 -22.133 115.314 1.00 32.78 ? 188 ASN A OD1 1 
ATOM   307  N ND2 . ASN A 1 45  ? 67.544 -22.979 114.007 1.00 32.28 ? 188 ASN A ND2 1 
ATOM   308  N N   . LEU A 1 46  ? 62.891 -21.068 112.665 1.00 24.21 ? 189 LEU A N   1 
ATOM   309  C CA  . LEU A 1 46  ? 62.109 -19.837 112.700 1.00 24.02 ? 189 LEU A CA  1 
ATOM   310  C C   . LEU A 1 46  ? 60.717 -20.079 113.263 1.00 23.82 ? 189 LEU A C   1 
ATOM   311  O O   . LEU A 1 46  ? 60.245 -19.339 114.122 1.00 23.74 ? 189 LEU A O   1 
ATOM   312  C CB  . LEU A 1 46  ? 61.989 -19.246 111.290 1.00 22.04 ? 189 LEU A CB  1 
ATOM   313  C CG  . LEU A 1 46  ? 63.234 -18.595 110.676 1.00 23.01 ? 189 LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 46  ? 63.112 -18.540 109.152 1.00 18.34 ? 189 LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 46  ? 63.415 -17.198 111.268 1.00 21.44 ? 189 LEU A CD2 1 
ATOM   316  N N   . ARG A 1 47  ? 60.059 -21.121 112.777 1.00 25.06 ? 190 ARG A N   1 
ATOM   317  C CA  . ARG A 1 47  ? 58.715 -21.426 113.226 1.00 25.06 ? 190 ARG A CA  1 
ATOM   318  C C   . ARG A 1 47  ? 58.660 -21.562 114.750 1.00 23.79 ? 190 ARG A C   1 
ATOM   319  O O   . ARG A 1 47  ? 57.832 -20.933 115.406 1.00 22.16 ? 190 ARG A O   1 
ATOM   320  C CB  . ARG A 1 47  ? 58.233 -22.698 112.533 1.00 26.62 ? 190 ARG A CB  1 
ATOM   321  C CG  . ARG A 1 47  ? 56.796 -23.069 112.833 1.00 31.90 ? 190 ARG A CG  1 
ATOM   322  C CD  . ARG A 1 47  ? 56.453 -24.392 112.168 1.00 34.77 ? 190 ARG A CD  1 
ATOM   323  N NE  . ARG A 1 47  ? 55.150 -24.905 112.582 1.00 36.36 ? 190 ARG A NE  1 
ATOM   324  C CZ  . ARG A 1 47  ? 53.980 -24.419 112.179 1.00 36.16 ? 190 ARG A CZ  1 
ATOM   325  N NH1 . ARG A 1 47  ? 52.860 -24.966 112.622 1.00 38.41 ? 190 ARG A NH1 1 
ATOM   326  N NH2 . ARG A 1 47  ? 53.925 -23.394 111.337 1.00 36.51 ? 190 ARG A NH2 1 
ATOM   327  N N   . GLU A 1 48  ? 59.562 -22.364 115.306 1.00 22.80 ? 191 GLU A N   1 
ATOM   328  C CA  . GLU A 1 48  ? 59.626 -22.588 116.751 1.00 22.82 ? 191 GLU A CA  1 
ATOM   329  C C   . GLU A 1 48  ? 59.957 -21.329 117.546 1.00 21.32 ? 191 GLU A C   1 
ATOM   330  O O   . GLU A 1 48  ? 59.385 -21.087 118.614 1.00 20.82 ? 191 GLU A O   1 
ATOM   331  C CB  . GLU A 1 48  ? 60.663 -23.675 117.057 1.00 25.30 ? 191 GLU A CB  1 
ATOM   332  C CG  . GLU A 1 48  ? 60.798 -24.049 118.528 1.00 29.16 ? 191 GLU A CG  1 
ATOM   333  C CD  . GLU A 1 48  ? 59.472 -24.455 119.168 1.00 32.99 ? 191 GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 48  ? 58.563 -24.922 118.441 1.00 33.07 ? 191 GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 48  ? 59.345 -24.315 120.406 1.00 33.40 ? 191 GLU A OE2 1 
ATOM   336  N N   . THR A 1 49  ? 60.883 -20.535 117.019 1.00 20.24 ? 192 THR A N   1 
ATOM   337  C CA  . THR A 1 49  ? 61.302 -19.303 117.669 1.00 20.34 ? 192 THR A CA  1 
ATOM   338  C C   . THR A 1 49  ? 60.164 -18.294 117.783 1.00 19.76 ? 192 THR A C   1 
ATOM   339  O O   . THR A 1 49  ? 59.967 -17.679 118.832 1.00 17.75 ? 192 THR A O   1 
ATOM   340  C CB  . THR A 1 49  ? 62.469 -18.649 116.905 1.00 21.95 ? 192 THR A CB  1 
ATOM   341  O OG1 . THR A 1 49  ? 63.626 -19.489 116.996 1.00 24.49 ? 192 THR A OG1 1 
ATOM   342  C CG2 . THR A 1 49  ? 62.789 -17.277 117.477 1.00 21.70 ? 192 THR A CG2 1 
ATOM   343  N N   . PHE A 1 50  ? 59.400 -18.126 116.712 1.00 19.20 ? 193 PHE A N   1 
ATOM   344  C CA  . PHE A 1 50  ? 58.311 -17.168 116.760 1.00 20.08 ? 193 PHE A CA  1 
ATOM   345  C C   . PHE A 1 50  ? 57.061 -17.671 117.469 1.00 21.08 ? 193 PHE A C   1 
ATOM   346  O O   . PHE A 1 50  ? 56.209 -16.877 117.875 1.00 20.97 ? 193 PHE A O   1 
ATOM   347  C CB  . PHE A 1 50  ? 58.008 -16.657 115.355 1.00 18.34 ? 193 PHE A CB  1 
ATOM   348  C CG  . PHE A 1 50  ? 58.971 -15.600 114.894 1.00 19.38 ? 193 PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 50  ? 58.869 -14.296 115.369 1.00 18.62 ? 193 PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 50  ? 60.010 -15.910 114.023 1.00 19.76 ? 193 PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 50  ? 59.792 -13.316 114.982 1.00 19.33 ? 193 PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 50  ? 60.942 -14.934 113.630 1.00 18.72 ? 193 PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 50  ? 60.833 -13.640 114.109 1.00 16.69 ? 193 PHE A CZ  1 
ATOM   354  N N   . ARG A 1 51  ? 56.956 -18.985 117.643 1.00 22.07 ? 194 ARG A N   1 
ATOM   355  C CA  . ARG A 1 51  ? 55.814 -19.537 118.355 1.00 24.11 ? 194 ARG A CA  1 
ATOM   356  C C   . ARG A 1 51  ? 56.036 -19.195 119.822 1.00 25.23 ? 194 ARG A C   1 
ATOM   357  O O   . ARG A 1 51  ? 55.105 -18.809 120.522 1.00 24.82 ? 194 ARG A O   1 
ATOM   358  C CB  . ARG A 1 51  ? 55.734 -21.054 118.175 1.00 25.82 ? 194 ARG A CB  1 
ATOM   359  C CG  . ARG A 1 51  ? 54.496 -21.706 118.807 1.00 26.30 ? 194 ARG A CG  1 
ATOM   360  C CD  . ARG A 1 51  ? 54.589 -23.223 118.714 1.00 27.21 ? 194 ARG A CD  1 
ATOM   361  N NE  . ARG A 1 51  ? 55.718 -23.738 119.487 1.00 28.60 ? 194 ARG A NE  1 
ATOM   362  C CZ  . ARG A 1 51  ? 55.716 -23.850 120.812 1.00 28.57 ? 194 ARG A CZ  1 
ATOM   363  N NH1 . ARG A 1 51  ? 54.640 -23.494 121.508 1.00 28.49 ? 194 ARG A NH1 1 
ATOM   364  N NH2 . ARG A 1 51  ? 56.788 -24.304 121.448 1.00 28.40 ? 194 ARG A NH2 1 
ATOM   365  N N   . ASN A 1 52  ? 57.277 -19.325 120.285 1.00 27.09 ? 195 ASN A N   1 
ATOM   366  C CA  . ASN A 1 52  ? 57.590 -18.994 121.673 1.00 28.93 ? 195 ASN A CA  1 
ATOM   367  C C   . ASN A 1 52  ? 57.447 -17.510 121.926 1.00 28.56 ? 195 ASN A C   1 
ATOM   368  O O   . ASN A 1 52  ? 57.348 -17.086 123.073 1.00 29.91 ? 195 ASN A O   1 
ATOM   369  C CB  . ASN A 1 52  ? 59.004 -19.430 122.049 1.00 31.20 ? 195 ASN A CB  1 
ATOM   370  C CG  . ASN A 1 52  ? 59.105 -20.921 122.265 1.00 36.32 ? 195 ASN A CG  1 
ATOM   371  O OD1 . ASN A 1 52  ? 58.517 -21.466 123.206 1.00 37.68 ? 195 ASN A OD1 1 
ATOM   372  N ND2 . ASN A 1 52  ? 59.842 -21.599 121.386 1.00 37.47 ? 195 ASN A ND2 1 
ATOM   373  N N   . LEU A 1 53  ? 57.444 -16.715 120.862 1.00 27.80 ? 196 LEU A N   1 
ATOM   374  C CA  . LEU A 1 53  ? 57.276 -15.279 121.026 1.00 27.72 ? 196 LEU A CA  1 
ATOM   375  C C   . LEU A 1 53  ? 55.796 -14.913 120.935 1.00 27.50 ? 196 LEU A C   1 
ATOM   376  O O   . LEU A 1 53  ? 55.434 -13.742 121.013 1.00 27.50 ? 196 LEU A O   1 
ATOM   377  C CB  . LEU A 1 53  ? 58.095 -14.508 119.983 1.00 27.22 ? 196 LEU A CB  1 
ATOM   378  C CG  . LEU A 1 53  ? 59.615 -14.616 120.182 1.00 26.85 ? 196 LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 53  ? 60.333 -13.847 119.089 1.00 25.94 ? 196 LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 53  ? 60.001 -14.093 121.554 1.00 23.11 ? 196 LEU A CD2 1 
ATOM   381  N N   . LYS A 1 54  ? 54.954 -15.933 120.777 1.00 27.70 ? 197 LYS A N   1 
ATOM   382  C CA  . LYS A 1 54  ? 53.502 -15.771 120.700 1.00 28.00 ? 197 LYS A CA  1 
ATOM   383  C C   . LYS A 1 54  ? 53.003 -15.239 119.367 1.00 26.88 ? 197 LYS A C   1 
ATOM   384  O O   . LYS A 1 54  ? 51.984 -14.553 119.300 1.00 26.04 ? 197 LYS A O   1 
ATOM   385  C CB  . LYS A 1 54  ? 53.005 -14.851 121.815 1.00 30.93 ? 197 LYS A CB  1 
ATOM   386  C CG  . LYS A 1 54  ? 53.437 -15.253 123.221 1.00 35.60 ? 197 LYS A CG  1 
ATOM   387  C CD  . LYS A 1 54  ? 52.623 -16.408 123.777 1.00 39.12 ? 197 LYS A CD  1 
ATOM   388  C CE  . LYS A 1 54  ? 52.914 -16.597 125.267 1.00 43.18 ? 197 LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 54  ? 52.111 -17.689 125.899 1.00 44.79 ? 197 LYS A NZ  1 
ATOM   390  N N   . TYR A 1 55  ? 53.725 -15.545 118.301 1.00 25.59 ? 198 TYR A N   1 
ATOM   391  C CA  . TYR A 1 55  ? 53.300 -15.106 116.983 1.00 25.90 ? 198 TYR A CA  1 
ATOM   392  C C   . TYR A 1 55  ? 52.525 -16.238 116.347 1.00 26.16 ? 198 TYR A C   1 
ATOM   393  O O   . TYR A 1 55  ? 52.809 -17.404 116.603 1.00 27.20 ? 198 TYR A O   1 
ATOM   394  C CB  . TYR A 1 55  ? 54.502 -14.760 116.095 1.00 23.74 ? 198 TYR A CB  1 
ATOM   395  C CG  . TYR A 1 55  ? 55.023 -13.364 116.294 1.00 22.20 ? 198 TYR A CG  1 
ATOM   396  C CD1 . TYR A 1 55  ? 55.940 -13.078 117.302 1.00 21.31 ? 198 TYR A CD1 1 
ATOM   397  C CD2 . TYR A 1 55  ? 54.562 -12.316 115.504 1.00 21.71 ? 198 TYR A CD2 1 
ATOM   398  C CE1 . TYR A 1 55  ? 56.384 -11.776 117.521 1.00 21.37 ? 198 TYR A CE1 1 
ATOM   399  C CE2 . TYR A 1 55  ? 54.998 -11.010 115.714 1.00 22.00 ? 198 TYR A CE2 1 
ATOM   400  C CZ  . TYR A 1 55  ? 55.908 -10.746 116.724 1.00 21.24 ? 198 TYR A CZ  1 
ATOM   401  O OH  . TYR A 1 55  ? 56.331 -9.455  116.935 1.00 18.81 ? 198 TYR A OH  1 
ATOM   402  N N   . GLU A 1 56  ? 51.532 -15.895 115.538 1.00 27.06 ? 199 GLU A N   1 
ATOM   403  C CA  . GLU A 1 56  ? 50.753 -16.899 114.837 1.00 27.24 ? 199 GLU A CA  1 
ATOM   404  C C   . GLU A 1 56  ? 51.567 -17.173 113.584 1.00 26.76 ? 199 GLU A C   1 
ATOM   405  O O   . GLU A 1 56  ? 51.543 -16.381 112.646 1.00 27.40 ? 199 GLU A O   1 
ATOM   406  C CB  . GLU A 1 56  ? 49.386 -16.340 114.454 1.00 29.35 ? 199 GLU A CB  1 
ATOM   407  C CG  . GLU A 1 56  ? 48.441 -17.364 113.849 1.00 32.34 ? 199 GLU A CG  1 
ATOM   408  C CD  . GLU A 1 56  ? 47.262 -16.715 113.149 1.00 35.88 ? 199 GLU A CD  1 
ATOM   409  O OE1 . GLU A 1 56  ? 46.626 -15.825 113.757 1.00 37.41 ? 199 GLU A OE1 1 
ATOM   410  O OE2 . GLU A 1 56  ? 46.968 -17.093 111.991 1.00 37.92 ? 199 GLU A OE2 1 
ATOM   411  N N   . VAL A 1 57  ? 52.299 -18.282 113.573 1.00 27.03 ? 200 VAL A N   1 
ATOM   412  C CA  . VAL A 1 57  ? 53.142 -18.632 112.433 1.00 27.58 ? 200 VAL A CA  1 
ATOM   413  C C   . VAL A 1 57  ? 52.427 -19.409 111.334 1.00 27.54 ? 200 VAL A C   1 
ATOM   414  O O   . VAL A 1 57  ? 51.637 -20.305 111.607 1.00 28.91 ? 200 VAL A O   1 
ATOM   415  C CB  . VAL A 1 57  ? 54.344 -19.481 112.884 1.00 27.68 ? 200 VAL A CB  1 
ATOM   416  C CG1 . VAL A 1 57  ? 55.335 -19.640 111.739 1.00 30.06 ? 200 VAL A CG1 1 
ATOM   417  C CG2 . VAL A 1 57  ? 55.005 -18.849 114.092 1.00 29.30 ? 200 VAL A CG2 1 
ATOM   418  N N   . ARG A 1 58  ? 52.709 -19.055 110.086 1.00 28.28 ? 201 ARG A N   1 
ATOM   419  C CA  . ARG A 1 58  ? 52.141 -19.745 108.930 1.00 28.22 ? 201 ARG A CA  1 
ATOM   420  C C   . ARG A 1 58  ? 53.294 -20.025 107.968 1.00 29.49 ? 201 ARG A C   1 
ATOM   421  O O   . ARG A 1 58  ? 53.880 -19.101 107.416 1.00 30.38 ? 201 ARG A O   1 
ATOM   422  C CB  . ARG A 1 58  ? 51.103 -18.876 108.232 1.00 25.48 ? 201 ARG A CB  1 
ATOM   423  C CG  . ARG A 1 58  ? 49.960 -18.430 109.108 1.00 25.14 ? 201 ARG A CG  1 
ATOM   424  C CD  . ARG A 1 58  ? 49.009 -17.580 108.294 1.00 24.44 ? 201 ARG A CD  1 
ATOM   425  N NE  . ARG A 1 58  ? 47.978 -16.940 109.104 1.00 25.64 ? 201 ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 58  ? 47.078 -16.091 108.613 1.00 26.25 ? 201 ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 58  ? 46.164 -15.536 109.407 1.00 25.94 ? 201 ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 58  ? 47.092 -15.796 107.319 1.00 25.62 ? 201 ARG A NH2 1 
ATOM   429  N N   . ASN A 1 59  ? 53.638 -21.295 107.789 1.00 31.46 ? 202 ASN A N   1 
ATOM   430  C CA  . ASN A 1 59  ? 54.728 -21.660 106.894 1.00 32.84 ? 202 ASN A CA  1 
ATOM   431  C C   . ASN A 1 59  ? 54.227 -21.993 105.509 1.00 33.75 ? 202 ASN A C   1 
ATOM   432  O O   . ASN A 1 59  ? 53.196 -22.647 105.350 1.00 33.45 ? 202 ASN A O   1 
ATOM   433  C CB  . ASN A 1 59  ? 55.506 -22.858 107.443 1.00 33.10 ? 202 ASN A CB  1 
ATOM   434  C CG  . ASN A 1 59  ? 56.431 -22.478 108.581 1.00 36.76 ? 202 ASN A CG  1 
ATOM   435  O OD1 . ASN A 1 59  ? 55.985 -21.986 109.623 1.00 37.52 ? 202 ASN A OD1 1 
ATOM   436  N ND2 . ASN A 1 59  ? 57.734 -22.699 108.389 1.00 35.99 ? 202 ASN A ND2 1 
ATOM   437  N N   . LYS A 1 60  ? 54.965 -21.530 104.508 1.00 35.14 ? 203 LYS A N   1 
ATOM   438  C CA  . LYS A 1 60  ? 54.629 -21.781 103.113 1.00 35.53 ? 203 LYS A CA  1 
ATOM   439  C C   . LYS A 1 60  ? 55.885 -22.235 102.404 1.00 35.51 ? 203 LYS A C   1 
ATOM   440  O O   . LYS A 1 60  ? 56.953 -21.652 102.589 1.00 35.37 ? 203 LYS A O   1 
ATOM   441  C CB  . LYS A 1 60  ? 54.103 -20.511 102.454 1.00 36.27 ? 203 LYS A CB  1 
ATOM   442  C CG  . LYS A 1 60  ? 52.768 -20.057 102.990 1.00 38.49 ? 203 LYS A CG  1 
ATOM   443  C CD  . LYS A 1 60  ? 51.694 -21.080 102.678 1.00 40.89 ? 203 LYS A CD  1 
ATOM   444  C CE  . LYS A 1 60  ? 50.356 -20.649 103.244 1.00 43.75 ? 203 LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 60  ? 49.282 -21.630 102.928 1.00 47.63 ? 203 LYS A NZ  1 
ATOM   446  N N   . ASN A 1 61  ? 55.764 -23.281 101.596 1.00 36.57 ? 204 ASN A N   1 
ATOM   447  C CA  . ASN A 1 61  ? 56.922 -23.788 100.875 1.00 35.54 ? 204 ASN A CA  1 
ATOM   448  C C   . ASN A 1 61  ? 56.733 -23.711 99.372  1.00 34.61 ? 204 ASN A C   1 
ATOM   449  O O   . ASN A 1 61  ? 55.611 -23.749 98.872  1.00 33.96 ? 204 ASN A O   1 
ATOM   450  C CB  . ASN A 1 61  ? 57.214 -25.232 101.296 1.00 36.24 ? 204 ASN A CB  1 
ATOM   451  C CG  . ASN A 1 61  ? 57.406 -25.372 102.801 1.00 36.80 ? 204 ASN A CG  1 
ATOM   452  O OD1 . ASN A 1 61  ? 58.301 -24.758 103.392 1.00 38.56 ? 204 ASN A OD1 1 
ATOM   453  N ND2 . ASN A 1 61  ? 56.558 -26.173 103.428 1.00 35.96 ? 204 ASN A ND2 1 
ATOM   454  N N   . ASP A 1 62  ? 57.853 -23.575 98.670  1.00 34.52 ? 205 ASP A N   1 
ATOM   455  C CA  . ASP A 1 62  ? 57.900 -23.497 97.216  1.00 34.53 ? 205 ASP A CA  1 
ATOM   456  C C   . ASP A 1 62  ? 56.734 -22.765 96.553  1.00 33.79 ? 205 ASP A C   1 
ATOM   457  O O   . ASP A 1 62  ? 55.858 -23.392 95.959  1.00 33.93 ? 205 ASP A O   1 
ATOM   458  C CB  . ASP A 1 62  ? 58.018 -24.909 96.626  1.00 36.45 ? 205 ASP A CB  1 
ATOM   459  C CG  . ASP A 1 62  ? 59.214 -25.678 97.171  1.00 39.27 ? 205 ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 62  ? 60.321 -25.102 97.246  1.00 41.15 ? 205 ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 62  ? 59.054 -26.869 97.515  1.00 42.13 ? 205 ASP A OD2 1 
ATOM   462  N N   . LEU A 1 63  ? 56.729 -21.438 96.645  1.00 32.69 ? 206 LEU A N   1 
ATOM   463  C CA  . LEU A 1 63  ? 55.676 -20.637 96.031  1.00 31.92 ? 206 LEU A CA  1 
ATOM   464  C C   . LEU A 1 63  ? 56.186 -19.934 94.774  1.00 32.85 ? 206 LEU A C   1 
ATOM   465  O O   . LEU A 1 63  ? 57.365 -19.576 94.683  1.00 31.41 ? 206 LEU A O   1 
ATOM   466  C CB  . LEU A 1 63  ? 55.158 -19.574 97.007  1.00 31.13 ? 206 LEU A CB  1 
ATOM   467  C CG  . LEU A 1 63  ? 54.450 -20.004 98.292  1.00 31.65 ? 206 LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 63  ? 53.829 -18.777 98.961  1.00 29.89 ? 206 LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 63  ? 53.372 -21.015 97.978  1.00 31.58 ? 206 LEU A CD2 1 
ATOM   470  N N   . THR A 1 64  ? 55.297 -19.738 93.805  1.00 32.98 ? 207 THR A N   1 
ATOM   471  C CA  . THR A 1 64  ? 55.672 -19.045 92.578  1.00 34.44 ? 207 THR A CA  1 
ATOM   472  C C   . THR A 1 64  ? 55.576 -17.555 92.891  1.00 35.00 ? 207 THR A C   1 
ATOM   473  O O   . THR A 1 64  ? 54.945 -17.165 93.879  1.00 32.43 ? 207 THR A O   1 
ATOM   474  C CB  . THR A 1 64  ? 54.711 -19.361 91.407  1.00 34.04 ? 207 THR A CB  1 
ATOM   475  O OG1 . THR A 1 64  ? 53.387 -18.929 91.744  1.00 35.05 ? 207 THR A OG1 1 
ATOM   476  C CG2 . THR A 1 64  ? 54.697 -20.849 91.104  1.00 32.20 ? 207 THR A CG2 1 
ATOM   477  N N   . ARG A 1 65  ? 56.190 -16.722 92.055  1.00 35.98 ? 208 ARG A N   1 
ATOM   478  C CA  . ARG A 1 65  ? 56.142 -15.295 92.303  1.00 36.73 ? 208 ARG A CA  1 
ATOM   479  C C   . ARG A 1 65  ? 54.704 -14.820 92.339  1.00 36.25 ? 208 ARG A C   1 
ATOM   480  O O   . ARG A 1 65  ? 54.379 -13.885 93.063  1.00 37.53 ? 208 ARG A O   1 
ATOM   481  C CB  . ARG A 1 65  ? 56.940 -14.525 91.251  1.00 38.19 ? 208 ARG A CB  1 
ATOM   482  C CG  . ARG A 1 65  ? 56.554 -14.777 89.813  1.00 40.96 ? 208 ARG A CG  1 
ATOM   483  C CD  . ARG A 1 65  ? 57.496 -13.991 88.909  1.00 44.36 ? 208 ARG A CD  1 
ATOM   484  N NE  . ARG A 1 65  ? 57.448 -14.421 87.516  1.00 46.38 ? 208 ARG A NE  1 
ATOM   485  C CZ  . ARG A 1 65  ? 58.320 -14.036 86.588  1.00 49.27 ? 208 ARG A CZ  1 
ATOM   486  N NH1 . ARG A 1 65  ? 59.311 -13.212 86.902  1.00 49.83 ? 208 ARG A NH1 1 
ATOM   487  N NH2 . ARG A 1 65  ? 58.208 -14.479 85.343  1.00 51.93 ? 208 ARG A NH2 1 
ATOM   488  N N   . GLU A 1 66  ? 53.840 -15.478 91.571  1.00 35.68 ? 209 GLU A N   1 
ATOM   489  C CA  . GLU A 1 66  ? 52.427 -15.116 91.543  1.00 34.41 ? 209 GLU A CA  1 
ATOM   490  C C   . GLU A 1 66  ? 51.788 -15.379 92.905  1.00 33.65 ? 209 GLU A C   1 
ATOM   491  O O   . GLU A 1 66  ? 51.076 -14.530 93.446  1.00 32.56 ? 209 GLU A O   1 
ATOM   492  C CB  . GLU A 1 66  ? 51.678 -15.925 90.482  1.00 34.96 ? 209 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 66  ? 52.018 -15.598 89.039  1.00 37.22 ? 209 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 66  ? 53.377 -16.119 88.614  1.00 38.61 ? 209 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 66  ? 53.746 -17.234 89.045  1.00 39.09 ? 209 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 66  ? 54.064 -15.422 87.835  1.00 37.22 ? 209 GLU A OE2 1 
ATOM   497  N N   . GLU A 1 67  ? 52.051 -16.565 93.446  1.00 32.98 ? 210 GLU A N   1 
ATOM   498  C CA  . GLU A 1 67  ? 51.505 -16.975 94.734  1.00 32.54 ? 210 GLU A CA  1 
ATOM   499  C C   . GLU A 1 67  ? 51.964 -16.084 95.867  1.00 31.50 ? 210 GLU A C   1 
ATOM   500  O O   . GLU A 1 67  ? 51.191 -15.762 96.770  1.00 32.02 ? 210 GLU A O   1 
ATOM   501  C CB  . GLU A 1 67  ? 51.888 -18.426 95.026  1.00 33.54 ? 210 GLU A CB  1 
ATOM   502  C CG  . GLU A 1 67  ? 51.125 -19.432 94.180  1.00 35.74 ? 210 GLU A CG  1 
ATOM   503  C CD  . GLU A 1 67  ? 51.808 -20.779 94.122  1.00 37.67 ? 210 GLU A CD  1 
ATOM   504  O OE1 . GLU A 1 67  ? 52.843 -20.880 93.437  1.00 39.16 ? 210 GLU A OE1 1 
ATOM   505  O OE2 . GLU A 1 67  ? 51.318 -21.735 94.762  1.00 40.43 ? 210 GLU A OE2 1 
ATOM   506  N N   . ILE A 1 68  ? 53.228 -15.687 95.819  1.00 30.62 ? 211 ILE A N   1 
ATOM   507  C CA  . ILE A 1 68  ? 53.788 -14.816 96.844  1.00 28.66 ? 211 ILE A CA  1 
ATOM   508  C C   . ILE A 1 68  ? 53.048 -13.479 96.857  1.00 29.50 ? 211 ILE A C   1 
ATOM   509  O O   . ILE A 1 68  ? 52.618 -13.013 97.912  1.00 30.14 ? 211 ILE A O   1 
ATOM   510  C CB  . ILE A 1 68  ? 55.294 -14.594 96.593  1.00 26.93 ? 211 ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 68  ? 56.070 -15.846 97.015  1.00 25.27 ? 211 ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 68  ? 55.780 -13.364 97.328  1.00 25.89 ? 211 ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 68  ? 57.509 -15.855 96.569  1.00 25.40 ? 211 ILE A CD1 1 
ATOM   514  N N   . VAL A 1 69  ? 52.878 -12.878 95.683  1.00 29.74 ? 212 VAL A N   1 
ATOM   515  C CA  . VAL A 1 69  ? 52.184 -11.601 95.575  1.00 31.38 ? 212 VAL A CA  1 
ATOM   516  C C   . VAL A 1 69  ? 50.728 -11.701 96.045  1.00 33.25 ? 212 VAL A C   1 
ATOM   517  O O   . VAL A 1 69  ? 50.223 -10.828 96.754  1.00 33.45 ? 212 VAL A O   1 
ATOM   518  C CB  . VAL A 1 69  ? 52.199 -11.096 94.120  1.00 31.58 ? 212 VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 69  ? 51.465 -9.771  94.022  1.00 30.12 ? 212 VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 69  ? 53.636 -10.945 93.641  1.00 31.34 ? 212 VAL A CG2 1 
ATOM   521  N N   . GLU A 1 70  ? 50.059 -12.770 95.634  1.00 34.82 ? 213 GLU A N   1 
ATOM   522  C CA  . GLU A 1 70  ? 48.669 -13.004 95.989  1.00 35.61 ? 213 GLU A CA  1 
ATOM   523  C C   . GLU A 1 70  ? 48.540 -13.172 97.500  1.00 33.47 ? 213 GLU A C   1 
ATOM   524  O O   . GLU A 1 70  ? 47.645 -12.604 98.131  1.00 31.98 ? 213 GLU A O   1 
ATOM   525  C CB  . GLU A 1 70  ? 48.189 -14.267 95.282  1.00 40.69 ? 213 GLU A CB  1 
ATOM   526  C CG  . GLU A 1 70  ? 46.694 -14.372 95.057  1.00 46.72 ? 213 GLU A CG  1 
ATOM   527  C CD  . GLU A 1 70  ? 46.324 -15.692 94.395  1.00 51.36 ? 213 GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 70  ? 45.312 -15.735 93.653  1.00 53.69 ? 213 GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 70  ? 47.048 -16.691 94.625  1.00 53.05 ? 213 GLU A OE2 1 
ATOM   530  N N   . LEU A 1 71  ? 49.447 -13.957 98.072  1.00 31.76 ? 214 LEU A N   1 
ATOM   531  C CA  . LEU A 1 71  ? 49.450 -14.215 99.505  1.00 31.77 ? 214 LEU A CA  1 
ATOM   532  C C   . LEU A 1 71  ? 49.618 -12.933 100.299 1.00 33.00 ? 214 LEU A C   1 
ATOM   533  O O   . LEU A 1 71  ? 48.870 -12.674 101.243 1.00 33.27 ? 214 LEU A O   1 
ATOM   534  C CB  . LEU A 1 71  ? 50.576 -15.185 99.868  1.00 30.96 ? 214 LEU A CB  1 
ATOM   535  C CG  . LEU A 1 71  ? 50.822 -15.373 101.366 1.00 29.66 ? 214 LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 71  ? 49.561 -15.875 102.040 1.00 30.03 ? 214 LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 71  ? 51.959 -16.344 101.576 1.00 29.08 ? 214 LEU A CD2 1 
ATOM   538  N N   . MET A 1 72  ? 50.610 -12.134 99.918  1.00 33.69 ? 215 MET A N   1 
ATOM   539  C CA  . MET A 1 72  ? 50.867 -10.874 100.600 1.00 34.34 ? 215 MET A CA  1 
ATOM   540  C C   . MET A 1 72  ? 49.636 -9.992  100.490 1.00 34.29 ? 215 MET A C   1 
ATOM   541  O O   . MET A 1 72  ? 49.195 -9.409  101.477 1.00 34.38 ? 215 MET A O   1 
ATOM   542  C CB  . MET A 1 72  ? 52.080 -10.179 99.979  1.00 34.30 ? 215 MET A CB  1 
ATOM   543  C CG  . MET A 1 72  ? 53.374 -10.963 100.128 1.00 35.46 ? 215 MET A CG  1 
ATOM   544  S SD  . MET A 1 72  ? 53.942 -11.106 101.843 1.00 38.52 ? 215 MET A SD  1 
ATOM   545  C CE  . MET A 1 72  ? 53.140 -12.611 102.358 1.00 36.59 ? 215 MET A CE  1 
ATOM   546  N N   . ARG A 1 73  ? 49.083 -9.905  99.283  1.00 35.18 ? 216 ARG A N   1 
ATOM   547  C CA  . ARG A 1 73  ? 47.888 -9.112  99.038  1.00 36.13 ? 216 ARG A CA  1 
ATOM   548  C C   . ARG A 1 73  ? 46.809 -9.553  100.012 1.00 35.77 ? 216 ARG A C   1 
ATOM   549  O O   . ARG A 1 73  ? 46.196 -8.737  100.697 1.00 34.69 ? 216 ARG A O   1 
ATOM   550  C CB  . ARG A 1 73  ? 47.398 -9.324  97.608  1.00 39.31 ? 216 ARG A CB  1 
ATOM   551  C CG  . ARG A 1 73  ? 46.049 -8.682  97.312  1.00 43.02 ? 216 ARG A CG  1 
ATOM   552  C CD  . ARG A 1 73  ? 45.664 -8.828  95.845  1.00 47.20 ? 216 ARG A CD  1 
ATOM   553  N NE  . ARG A 1 73  ? 46.757 -8.396  94.973  1.00 52.24 ? 216 ARG A NE  1 
ATOM   554  C CZ  . ARG A 1 73  ? 46.596 -7.735  93.828  1.00 53.00 ? 216 ARG A CZ  1 
ATOM   555  N NH1 . ARG A 1 73  ? 45.377 -7.421  93.402  1.00 53.87 ? 216 ARG A NH1 1 
ATOM   556  N NH2 . ARG A 1 73  ? 47.658 -7.379  93.112  1.00 52.74 ? 216 ARG A NH2 1 
ATOM   557  N N   . ASP A 1 74  ? 46.587 -10.859 100.073 1.00 35.68 ? 217 ASP A N   1 
ATOM   558  C CA  . ASP A 1 74  ? 45.583 -11.411 100.966 1.00 36.86 ? 217 ASP A CA  1 
ATOM   559  C C   . ASP A 1 74  ? 45.882 -11.095 102.417 1.00 37.30 ? 217 ASP A C   1 
ATOM   560  O O   . ASP A 1 74  ? 44.980 -10.724 103.171 1.00 39.02 ? 217 ASP A O   1 
ATOM   561  C CB  . ASP A 1 74  ? 45.485 -12.925 100.782 1.00 37.24 ? 217 ASP A CB  1 
ATOM   562  C CG  . ASP A 1 74  ? 44.582 -13.312 99.631  1.00 37.97 ? 217 ASP A CG  1 
ATOM   563  O OD1 . ASP A 1 74  ? 44.282 -12.443 98.777  1.00 37.93 ? 217 ASP A OD1 1 
ATOM   564  O OD2 . ASP A 1 74  ? 44.174 -14.491 99.581  1.00 38.63 ? 217 ASP A OD2 1 
ATOM   565  N N   . VAL A 1 75  ? 47.141 -11.246 102.813 1.00 36.01 ? 218 VAL A N   1 
ATOM   566  C CA  . VAL A 1 75  ? 47.522 -10.969 104.189 1.00 36.76 ? 218 VAL A CA  1 
ATOM   567  C C   . VAL A 1 75  ? 47.375 -9.490  104.517 1.00 37.21 ? 218 VAL A C   1 
ATOM   568  O O   . VAL A 1 75  ? 47.006 -9.136  105.635 1.00 37.42 ? 218 VAL A O   1 
ATOM   569  C CB  . VAL A 1 75  ? 48.970 -11.399 104.468 1.00 37.17 ? 218 VAL A CB  1 
ATOM   570  C CG1 . VAL A 1 75  ? 49.394 -10.941 105.856 1.00 37.22 ? 218 VAL A CG1 1 
ATOM   571  C CG2 . VAL A 1 75  ? 49.084 -12.914 104.363 1.00 37.72 ? 218 VAL A CG2 1 
ATOM   572  N N   . SER A 1 76  ? 47.652 -8.628  103.544 1.00 37.15 ? 219 SER A N   1 
ATOM   573  C CA  . SER A 1 76  ? 47.536 -7.192  103.773 1.00 37.11 ? 219 SER A CA  1 
ATOM   574  C C   . SER A 1 76  ? 46.074 -6.815  103.954 1.00 37.18 ? 219 SER A C   1 
ATOM   575  O O   . SER A 1 76  ? 45.764 -5.786  104.553 1.00 36.27 ? 219 SER A O   1 
ATOM   576  C CB  . SER A 1 76  ? 48.122 -6.401  102.600 1.00 37.35 ? 219 SER A CB  1 
ATOM   577  O OG  . SER A 1 76  ? 47.183 -6.276  101.547 1.00 39.03 ? 219 SER A OG  1 
ATOM   578  N N   . LYS A 1 77  ? 45.178 -7.651  103.434 1.00 37.76 ? 220 LYS A N   1 
ATOM   579  C CA  . LYS A 1 77  ? 43.749 -7.382  103.546 1.00 37.72 ? 220 LYS A CA  1 
ATOM   580  C C   . LYS A 1 77  ? 43.099 -7.912  104.823 1.00 36.06 ? 220 LYS A C   1 
ATOM   581  O O   . LYS A 1 77  ? 41.967 -7.558  105.129 1.00 35.90 ? 220 LYS A O   1 
ATOM   582  C CB  . LYS A 1 77  ? 43.007 -7.897  102.303 1.00 40.11 ? 220 LYS A CB  1 
ATOM   583  C CG  . LYS A 1 77  ? 43.087 -6.924  101.116 1.00 43.95 ? 220 LYS A CG  1 
ATOM   584  C CD  . LYS A 1 77  ? 42.169 -7.311  99.951  1.00 46.91 ? 220 LYS A CD  1 
ATOM   585  C CE  . LYS A 1 77  ? 42.631 -8.596  99.262  1.00 49.79 ? 220 LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 77  ? 41.744 -8.981  98.123  1.00 50.90 ? 220 LYS A NZ  1 
ATOM   587  N N   . GLU A 1 78  ? 43.804 -8.760  105.565 1.00 34.39 ? 221 GLU A N   1 
ATOM   588  C CA  . GLU A 1 78  ? 43.257 -9.265  106.819 1.00 34.33 ? 221 GLU A CA  1 
ATOM   589  C C   . GLU A 1 78  ? 43.159 -8.075  107.761 1.00 35.75 ? 221 GLU A C   1 
ATOM   590  O O   . GLU A 1 78  ? 43.772 -7.035  107.505 1.00 37.40 ? 221 GLU A O   1 
ATOM   591  C CB  . GLU A 1 78  ? 44.181 -10.306 107.439 1.00 32.49 ? 221 GLU A CB  1 
ATOM   592  C CG  . GLU A 1 78  ? 44.036 -11.690 106.873 1.00 32.62 ? 221 GLU A CG  1 
ATOM   593  C CD  . GLU A 1 78  ? 44.958 -12.681 107.556 1.00 33.65 ? 221 GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 78  ? 44.988 -12.709 108.804 1.00 32.30 ? 221 GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 78  ? 45.650 -13.437 106.846 1.00 34.46 ? 221 GLU A OE2 1 
ATOM   596  N N   . ASP A 1 79  ? 42.393 -8.218  108.840 1.00 36.02 ? 222 ASP A N   1 
ATOM   597  C CA  . ASP A 1 79  ? 42.256 -7.141  109.818 1.00 36.36 ? 222 ASP A CA  1 
ATOM   598  C C   . ASP A 1 79  ? 43.246 -7.367  110.953 1.00 35.12 ? 222 ASP A C   1 
ATOM   599  O O   . ASP A 1 79  ? 43.171 -8.370  111.663 1.00 35.10 ? 222 ASP A O   1 
ATOM   600  C CB  . ASP A 1 79  ? 40.831 -7.092  110.372 1.00 39.34 ? 222 ASP A CB  1 
ATOM   601  C CG  . ASP A 1 79  ? 40.742 -6.331  111.685 1.00 42.38 ? 222 ASP A CG  1 
ATOM   602  O OD1 . ASP A 1 79  ? 41.299 -5.215  111.772 1.00 43.83 ? 222 ASP A OD1 1 
ATOM   603  O OD2 . ASP A 1 79  ? 40.113 -6.853  112.635 1.00 43.96 ? 222 ASP A OD2 1 
ATOM   604  N N   . HIS A 1 80  ? 44.160 -6.421  111.134 1.00 33.85 ? 224 HIS A N   1 
ATOM   605  C CA  . HIS A 1 80  ? 45.188 -6.538  112.160 1.00 33.27 ? 224 HIS A CA  1 
ATOM   606  C C   . HIS A 1 80  ? 44.951 -5.671  113.392 1.00 33.63 ? 224 HIS A C   1 
ATOM   607  O O   . HIS A 1 80  ? 45.851 -5.515  114.225 1.00 33.95 ? 224 HIS A O   1 
ATOM   608  C CB  . HIS A 1 80  ? 46.548 -6.188  111.554 1.00 32.04 ? 224 HIS A CB  1 
ATOM   609  C CG  . HIS A 1 80  ? 46.914 -7.023  110.367 1.00 30.84 ? 224 HIS A CG  1 
ATOM   610  N ND1 . HIS A 1 80  ? 47.695 -8.156  110.465 1.00 30.26 ? 224 HIS A ND1 1 
ATOM   611  C CD2 . HIS A 1 80  ? 46.589 -6.901  109.059 1.00 29.87 ? 224 HIS A CD2 1 
ATOM   612  C CE1 . HIS A 1 80  ? 47.834 -8.694  109.267 1.00 30.50 ? 224 HIS A CE1 1 
ATOM   613  N NE2 . HIS A 1 80  ? 47.173 -7.954  108.395 1.00 29.44 ? 224 HIS A NE2 1 
ATOM   614  N N   . SER A 1 81  ? 43.751 -5.116  113.518 1.00 33.50 ? 225 SER A N   1 
ATOM   615  C CA  . SER A 1 81  ? 43.439 -4.251  114.656 1.00 34.85 ? 225 SER A CA  1 
ATOM   616  C C   . SER A 1 81  ? 43.791 -4.815  116.040 1.00 33.61 ? 225 SER A C   1 
ATOM   617  O O   . SER A 1 81  ? 44.220 -4.067  116.916 1.00 32.88 ? 225 SER A O   1 
ATOM   618  C CB  . SER A 1 81  ? 41.962 -3.842  114.615 1.00 36.24 ? 225 SER A CB  1 
ATOM   619  O OG  . SER A 1 81  ? 41.127 -4.971  114.434 1.00 43.22 ? 225 SER A OG  1 
ATOM   620  N N   . LYS A 1 82  ? 43.611 -6.117  116.244 1.00 33.37 ? 226 LYS A N   1 
ATOM   621  C CA  . LYS A 1 82  ? 43.936 -6.722  117.534 1.00 34.84 ? 226 LYS A CA  1 
ATOM   622  C C   . LYS A 1 82  ? 45.378 -7.220  117.579 1.00 34.02 ? 226 LYS A C   1 
ATOM   623  O O   . LYS A 1 82  ? 45.811 -7.803  118.575 1.00 33.65 ? 226 LYS A O   1 
ATOM   624  C CB  . LYS A 1 82  ? 42.996 -7.897  117.851 1.00 39.30 ? 226 LYS A CB  1 
ATOM   625  C CG  . LYS A 1 82  ? 41.621 -7.516  118.394 1.00 43.45 ? 226 LYS A CG  1 
ATOM   626  C CD  . LYS A 1 82  ? 40.809 -6.788  117.339 1.00 50.47 ? 226 LYS A CD  1 
ATOM   627  C CE  . LYS A 1 82  ? 39.425 -6.390  117.840 1.00 51.98 ? 226 LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 82  ? 38.750 -5.487  116.849 1.00 54.07 ? 226 LYS A NZ  1 
ATOM   629  N N   . ARG A 1 83  ? 46.123 -6.990  116.503 1.00 32.57 ? 227 ARG A N   1 
ATOM   630  C CA  . ARG A 1 83  ? 47.512 -7.431  116.437 1.00 31.35 ? 227 ARG A CA  1 
ATOM   631  C C   . ARG A 1 83  ? 48.514 -6.311  116.699 1.00 30.04 ? 227 ARG A C   1 
ATOM   632  O O   . ARG A 1 83  ? 48.290 -5.165  116.313 1.00 29.69 ? 227 ARG A O   1 
ATOM   633  C CB  . ARG A 1 83  ? 47.771 -8.072  115.079 1.00 31.17 ? 227 ARG A CB  1 
ATOM   634  C CG  . ARG A 1 83  ? 46.989 -9.353  114.897 1.00 32.69 ? 227 ARG A CG  1 
ATOM   635  C CD  . ARG A 1 83  ? 46.977 -9.801  113.458 1.00 33.96 ? 227 ARG A CD  1 
ATOM   636  N NE  . ARG A 1 83  ? 46.128 -10.970 113.277 1.00 35.87 ? 227 ARG A NE  1 
ATOM   637  C CZ  . ARG A 1 83  ? 45.672 -11.385 112.099 1.00 37.04 ? 227 ARG A CZ  1 
ATOM   638  N NH1 . ARG A 1 83  ? 45.982 -10.723 110.991 1.00 36.92 ? 227 ARG A NH1 1 
ATOM   639  N NH2 . ARG A 1 83  ? 44.908 -12.467 112.027 1.00 38.14 ? 227 ARG A NH2 1 
ATOM   640  N N   . SER A 1 84  ? 49.618 -6.655  117.359 1.00 28.73 ? 228 SER A N   1 
ATOM   641  C CA  . SER A 1 84  ? 50.662 -5.685  117.687 1.00 28.51 ? 228 SER A CA  1 
ATOM   642  C C   . SER A 1 84  ? 51.618 -5.389  116.536 1.00 28.21 ? 228 SER A C   1 
ATOM   643  O O   . SER A 1 84  ? 51.984 -4.237  116.306 1.00 29.26 ? 228 SER A O   1 
ATOM   644  C CB  . SER A 1 84  ? 51.490 -6.172  118.883 1.00 28.07 ? 228 SER A CB  1 
ATOM   645  O OG  . SER A 1 84  ? 50.725 -6.230  120.073 1.00 28.45 ? 228 SER A OG  1 
ATOM   646  N N   . SER A 1 85  ? 52.014 -6.429  115.812 1.00 26.94 ? 229 SER A N   1 
ATOM   647  C CA  . SER A 1 85  ? 52.960 -6.270  114.716 1.00 25.64 ? 229 SER A CA  1 
ATOM   648  C C   . SER A 1 85  ? 52.744 -7.254  113.578 1.00 25.02 ? 229 SER A C   1 
ATOM   649  O O   . SER A 1 85  ? 51.771 -8.001  113.561 1.00 26.07 ? 229 SER A O   1 
ATOM   650  C CB  . SER A 1 85  ? 54.368 -6.461  115.255 1.00 25.80 ? 229 SER A CB  1 
ATOM   651  O OG  . SER A 1 85  ? 54.442 -7.703  115.931 1.00 26.54 ? 229 SER A OG  1 
ATOM   652  N N   . PHE A 1 86  ? 53.679 -7.249  112.634 1.00 23.40 ? 230 PHE A N   1 
ATOM   653  C CA  . PHE A 1 86  ? 53.640 -8.140  111.482 1.00 21.98 ? 230 PHE A CA  1 
ATOM   654  C C   . PHE A 1 86  ? 55.061 -8.552  111.131 1.00 21.04 ? 230 PHE A C   1 
ATOM   655  O O   . PHE A 1 86  ? 55.960 -7.714  111.047 1.00 21.87 ? 230 PHE A O   1 
ATOM   656  C CB  . PHE A 1 86  ? 53.006 -7.452  110.269 1.00 22.05 ? 230 PHE A CB  1 
ATOM   657  C CG  . PHE A 1 86  ? 53.069 -8.278  109.013 1.00 20.76 ? 230 PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 86  ? 52.334 -9.448  108.903 1.00 19.82 ? 230 PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 86  ? 53.894 -7.905  107.957 1.00 20.30 ? 230 PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 86  ? 52.425 -10.236 107.761 1.00 22.24 ? 230 PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 86  ? 53.991 -8.683  106.814 1.00 18.63 ? 230 PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 86  ? 53.257 -9.848  106.713 1.00 19.93 ? 230 PHE A CZ  1 
ATOM   663  N N   . VAL A 1 87  ? 55.261 -9.842  110.914 1.00 19.80 ? 231 VAL A N   1 
ATOM   664  C CA  . VAL A 1 87  ? 56.586 -10.344 110.587 1.00 18.72 ? 231 VAL A CA  1 
ATOM   665  C C   . VAL A 1 87  ? 56.520 -11.244 109.375 1.00 19.96 ? 231 VAL A C   1 
ATOM   666  O O   . VAL A 1 87  ? 55.694 -12.150 109.314 1.00 22.40 ? 231 VAL A O   1 
ATOM   667  C CB  . VAL A 1 87  ? 57.169 -11.151 111.754 1.00 15.54 ? 231 VAL A CB  1 
ATOM   668  C CG1 . VAL A 1 87  ? 58.510 -11.734 111.360 1.00 13.66 ? 231 VAL A CG1 1 
ATOM   669  C CG2 . VAL A 1 87  ? 57.295 -10.271 112.977 1.00 13.02 ? 231 VAL A CG2 1 
ATOM   670  N N   . CYS A 1 88  ? 57.385 -10.992 108.404 1.00 19.70 ? 232 CYS A N   1 
ATOM   671  C CA  . CYS A 1 88  ? 57.409 -11.804 107.204 1.00 19.90 ? 232 CYS A CA  1 
ATOM   672  C C   . CYS A 1 88  ? 58.834 -12.242 106.908 1.00 20.24 ? 232 CYS A C   1 
ATOM   673  O O   . CYS A 1 88  ? 59.712 -11.412 106.694 1.00 22.42 ? 232 CYS A O   1 
ATOM   674  C CB  . CYS A 1 88  ? 56.841 -11.019 106.021 1.00 20.03 ? 232 CYS A CB  1 
ATOM   675  S SG  . CYS A 1 88  ? 56.973 -11.910 104.456 1.00 22.80 ? 232 CYS A SG  1 
ATOM   676  N N   . VAL A 1 89  ? 59.064 -13.548 106.901 1.00 19.24 ? 233 VAL A N   1 
ATOM   677  C CA  . VAL A 1 89  ? 60.388 -14.076 106.636 1.00 18.69 ? 233 VAL A CA  1 
ATOM   678  C C   . VAL A 1 89  ? 60.446 -14.637 105.230 1.00 20.26 ? 233 VAL A C   1 
ATOM   679  O O   . VAL A 1 89  ? 59.612 -15.446 104.832 1.00 22.73 ? 233 VAL A O   1 
ATOM   680  C CB  . VAL A 1 89  ? 60.746 -15.187 107.626 1.00 17.71 ? 233 VAL A CB  1 
ATOM   681  C CG1 . VAL A 1 89  ? 62.152 -15.688 107.365 1.00 18.34 ? 233 VAL A CG1 1 
ATOM   682  C CG2 . VAL A 1 89  ? 60.619 -14.674 109.038 1.00 16.69 ? 233 VAL A CG2 1 
ATOM   683  N N   . LEU A 1 90  ? 61.433 -14.196 104.472 1.00 20.82 ? 234 LEU A N   1 
ATOM   684  C CA  . LEU A 1 90  ? 61.591 -14.663 103.113 1.00 22.22 ? 234 LEU A CA  1 
ATOM   685  C C   . LEU A 1 90  ? 62.870 -15.467 102.985 1.00 23.16 ? 234 LEU A C   1 
ATOM   686  O O   . LEU A 1 90  ? 63.975 -14.938 103.169 1.00 23.67 ? 234 LEU A O   1 
ATOM   687  C CB  . LEU A 1 90  ? 61.601 -13.471 102.152 1.00 23.37 ? 234 LEU A CB  1 
ATOM   688  C CG  . LEU A 1 90  ? 60.259 -12.734 102.116 1.00 23.48 ? 234 LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 90  ? 60.419 -11.382 101.459 1.00 23.61 ? 234 LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 90  ? 59.238 -13.587 101.384 1.00 22.42 ? 234 LEU A CD2 1 
ATOM   691  N N   . LEU A 1 91  ? 62.706 -16.753 102.685 1.00 22.41 ? 235 LEU A N   1 
ATOM   692  C CA  . LEU A 1 91  ? 63.833 -17.655 102.514 1.00 22.67 ? 235 LEU A CA  1 
ATOM   693  C C   . LEU A 1 91  ? 63.841 -18.043 101.048 1.00 23.25 ? 235 LEU A C   1 
ATOM   694  O O   . LEU A 1 91  ? 62.942 -18.749 100.589 1.00 23.57 ? 235 LEU A O   1 
ATOM   695  C CB  . LEU A 1 91  ? 63.653 -18.904 103.374 1.00 22.02 ? 235 LEU A CB  1 
ATOM   696  C CG  . LEU A 1 91  ? 63.444 -18.676 104.872 1.00 21.46 ? 235 LEU A CG  1 
ATOM   697  C CD1 . LEU A 1 91  ? 63.249 -20.015 105.560 1.00 19.36 ? 235 LEU A CD1 1 
ATOM   698  C CD2 . LEU A 1 91  ? 64.646 -17.942 105.464 1.00 20.73 ? 235 LEU A CD2 1 
ATOM   699  N N   . SER A 1 92  ? 64.852 -17.583 100.316 1.00 23.91 ? 236 SER A N   1 
ATOM   700  C CA  . SER A 1 92  ? 64.949 -17.883 98.892  1.00 24.60 ? 236 SER A CA  1 
ATOM   701  C C   . SER A 1 92  ? 66.206 -17.304 98.258  1.00 23.87 ? 236 SER A C   1 
ATOM   702  O O   . SER A 1 92  ? 67.120 -16.861 98.949  1.00 22.86 ? 236 SER A O   1 
ATOM   703  C CB  . SER A 1 92  ? 63.726 -17.313 98.173  1.00 24.54 ? 236 SER A CB  1 
ATOM   704  O OG  . SER A 1 92  ? 63.823 -17.506 96.778  1.00 27.67 ? 236 SER A OG  1 
ATOM   705  N N   . HIS A 1 93  ? 66.243 -17.325 96.930  1.00 24.42 ? 237 HIS A N   1 
ATOM   706  C CA  . HIS A 1 93  ? 67.353 -16.758 96.172  1.00 25.08 ? 237 HIS A CA  1 
ATOM   707  C C   . HIS A 1 93  ? 66.983 -15.305 95.884  1.00 24.62 ? 237 HIS A C   1 
ATOM   708  O O   . HIS A 1 93  ? 65.853 -14.883 96.129  1.00 23.10 ? 237 HIS A O   1 
ATOM   709  C CB  . HIS A 1 93  ? 67.540 -17.483 94.833  1.00 24.10 ? 237 HIS A CB  1 
ATOM   710  C CG  . HIS A 1 93  ? 68.209 -18.814 94.947  1.00 26.24 ? 237 HIS A CG  1 
ATOM   711  N ND1 . HIS A 1 93  ? 69.474 -18.972 95.471  1.00 26.27 ? 237 HIS A ND1 1 
ATOM   712  C CD2 . HIS A 1 93  ? 67.808 -20.050 94.562  1.00 25.63 ? 237 HIS A CD2 1 
ATOM   713  C CE1 . HIS A 1 93  ? 69.826 -20.243 95.401  1.00 27.07 ? 237 HIS A CE1 1 
ATOM   714  N NE2 . HIS A 1 93  ? 68.830 -20.918 94.851  1.00 26.96 ? 237 HIS A NE2 1 
ATOM   715  N N   . GLY A 1 94  ? 67.932 -14.543 95.355  1.00 24.74 ? 238 GLY A N   1 
ATOM   716  C CA  . GLY A 1 94  ? 67.648 -13.161 95.024  1.00 24.94 ? 238 GLY A CA  1 
ATOM   717  C C   . GLY A 1 94  ? 68.857 -12.412 94.516  1.00 25.24 ? 238 GLY A C   1 
ATOM   718  O O   . GLY A 1 94  ? 69.940 -12.984 94.385  1.00 26.42 ? 238 GLY A O   1 
ATOM   719  N N   . GLU A 1 95  ? 68.648 -11.138 94.200  1.00 25.25 ? 239 GLU A N   1 
ATOM   720  C CA  . GLU A 1 95  ? 69.699 -10.232 93.743  1.00 26.45 ? 239 GLU A CA  1 
ATOM   721  C C   . GLU A 1 95  ? 69.274 -8.929  94.382  1.00 25.98 ? 239 GLU A C   1 
ATOM   722  O O   . GLU A 1 95  ? 68.220 -8.874  95.012  1.00 27.60 ? 239 GLU A O   1 
ATOM   723  C CB  . GLU A 1 95  ? 69.708 -10.091 92.218  1.00 28.87 ? 239 GLU A CB  1 
ATOM   724  C CG  . GLU A 1 95  ? 68.704 -10.967 91.482  1.00 35.24 ? 239 GLU A CG  1 
ATOM   725  C CD  . GLU A 1 95  ? 68.928 -10.983 89.976  1.00 38.51 ? 239 GLU A CD  1 
ATOM   726  O OE1 . GLU A 1 95  ? 70.053 -11.323 89.555  1.00 40.04 ? 239 GLU A OE1 1 
ATOM   727  O OE2 . GLU A 1 95  ? 67.983 -10.662 89.214  1.00 42.28 ? 239 GLU A OE2 1 
ATOM   728  N N   . GLU A 1 96  ? 70.065 -7.877  94.241  1.00 25.75 ? 240 GLU A N   1 
ATOM   729  C CA  . GLU A 1 96  ? 69.674 -6.620  94.859  1.00 25.88 ? 240 GLU A CA  1 
ATOM   730  C C   . GLU A 1 96  ? 68.231 -6.254  94.532  1.00 24.01 ? 240 GLU A C   1 
ATOM   731  O O   . GLU A 1 96  ? 67.813 -6.298  93.376  1.00 25.07 ? 240 GLU A O   1 
ATOM   732  C CB  . GLU A 1 96  ? 70.593 -5.488  94.415  1.00 28.57 ? 240 GLU A CB  1 
ATOM   733  C CG  . GLU A 1 96  ? 70.351 -4.179  95.159  1.00 29.96 ? 240 GLU A CG  1 
ATOM   734  C CD  . GLU A 1 96  ? 70.417 -4.338  96.669  1.00 32.43 ? 240 GLU A CD  1 
ATOM   735  O OE1 . GLU A 1 96  ? 71.344 -5.019  97.163  1.00 33.44 ? 240 GLU A OE1 1 
ATOM   736  O OE2 . GLU A 1 96  ? 69.546 -3.773  97.367  1.00 33.70 ? 240 GLU A OE2 1 
ATOM   737  N N   . GLY A 1 97  ? 67.477 -5.925  95.573  1.00 23.74 ? 241 GLY A N   1 
ATOM   738  C CA  . GLY A 1 97  ? 66.086 -5.528  95.426  1.00 24.67 ? 241 GLY A CA  1 
ATOM   739  C C   . GLY A 1 97  ? 65.098 -6.547  94.889  1.00 23.96 ? 241 GLY A C   1 
ATOM   740  O O   . GLY A 1 97  ? 63.962 -6.190  94.570  1.00 22.90 ? 241 GLY A O   1 
ATOM   741  N N   . ILE A 1 98  ? 65.506 -7.809  94.807  1.00 23.64 ? 242 ILE A N   1 
ATOM   742  C CA  . ILE A 1 98  ? 64.628 -8.852  94.283  1.00 23.86 ? 242 ILE A CA  1 
ATOM   743  C C   . ILE A 1 98  ? 64.717 -10.174 95.041  1.00 24.50 ? 242 ILE A C   1 
ATOM   744  O O   . ILE A 1 98  ? 65.756 -10.511 95.604  1.00 25.66 ? 242 ILE A O   1 
ATOM   745  C CB  . ILE A 1 98  ? 64.959 -9.152  92.802  1.00 22.66 ? 242 ILE A CB  1 
ATOM   746  C CG1 . ILE A 1 98  ? 64.863 -7.880  91.967  1.00 23.35 ? 242 ILE A CG1 1 
ATOM   747  C CG2 . ILE A 1 98  ? 64.003 -10.188 92.250  1.00 22.60 ? 242 ILE A CG2 1 
ATOM   748  C CD1 . ILE A 1 98  ? 65.034 -8.122  90.484  1.00 22.84 ? 242 ILE A CD1 1 
ATOM   749  N N   . ILE A 1 99  ? 63.615 -10.914 95.063  1.00 24.55 ? 243 ILE A N   1 
ATOM   750  C CA  . ILE A 1 99  ? 63.603 -12.222 95.691  1.00 27.11 ? 243 ILE A CA  1 
ATOM   751  C C   . ILE A 1 99  ? 62.899 -13.165 94.720  1.00 26.16 ? 243 ILE A C   1 
ATOM   752  O O   . ILE A 1 99  ? 61.976 -12.763 94.025  1.00 25.11 ? 243 ILE A O   1 
ATOM   753  C CB  . ILE A 1 99  ? 62.908 -12.202 97.079  1.00 29.11 ? 243 ILE A CB  1 
ATOM   754  C CG1 . ILE A 1 99  ? 61.419 -11.907 96.940  1.00 29.63 ? 243 ILE A CG1 1 
ATOM   755  C CG2 . ILE A 1 99  ? 63.597 -11.191 97.985  1.00 30.75 ? 243 ILE A CG2 1 
ATOM   756  C CD1 . ILE A 1 99  ? 60.575 -13.151 96.840  1.00 30.72 ? 243 ILE A CD1 1 
ATOM   757  N N   . PHE A 1 100 ? 63.362 -14.409 94.655  1.00 27.39 ? 244 PHE A N   1 
ATOM   758  C CA  . PHE A 1 100 ? 62.802 -15.391 93.732  1.00 28.18 ? 244 PHE A CA  1 
ATOM   759  C C   . PHE A 1 100 ? 61.669 -16.286 94.192  1.00 27.99 ? 244 PHE A C   1 
ATOM   760  O O   . PHE A 1 100 ? 61.673 -16.819 95.299  1.00 28.53 ? 244 PHE A O   1 
ATOM   761  C CB  . PHE A 1 100 ? 63.896 -16.320 93.216  1.00 28.29 ? 244 PHE A CB  1 
ATOM   762  C CG  . PHE A 1 100 ? 64.782 -15.705 92.193  1.00 30.53 ? 244 PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 100 ? 65.720 -14.750 92.553  1.00 32.04 ? 244 PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 100 ? 64.686 -16.084 90.863  1.00 30.89 ? 244 PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 100 ? 66.554 -14.180 91.600  1.00 33.48 ? 244 PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 100 ? 65.513 -15.522 89.904  1.00 32.60 ? 244 PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 100 ? 66.449 -14.568 90.270  1.00 32.79 ? 244 PHE A CZ  1 
ATOM   768  N N   . GLY A 1 101 ? 60.694 -16.445 93.310  1.00 28.65 ? 245 GLY A N   1 
ATOM   769  C CA  . GLY A 1 101 ? 59.604 -17.352 93.575  1.00 27.82 ? 245 GLY A CA  1 
ATOM   770  C C   . GLY A 1 101 ? 60.160 -18.580 92.874  1.00 28.01 ? 245 GLY A C   1 
ATOM   771  O O   . GLY A 1 101 ? 61.131 -18.468 92.124  1.00 26.31 ? 245 GLY A O   1 
ATOM   772  N N   . THR A 1 102 ? 59.577 -19.745 93.108  1.00 28.60 ? 246 THR A N   1 
ATOM   773  C CA  . THR A 1 102 ? 60.056 -20.967 92.468  1.00 28.62 ? 246 THR A CA  1 
ATOM   774  C C   . THR A 1 102 ? 60.091 -20.840 90.952  1.00 29.07 ? 246 THR A C   1 
ATOM   775  O O   . THR A 1 102 ? 60.872 -21.516 90.293  1.00 29.62 ? 246 THR A O   1 
ATOM   776  C CB  . THR A 1 102 ? 59.149 -22.144 92.787  1.00 28.05 ? 246 THR A CB  1 
ATOM   777  O OG1 . THR A 1 102 ? 57.842 -21.870 92.269  1.00 28.88 ? 246 THR A OG1 1 
ATOM   778  C CG2 . THR A 1 102 ? 59.075 -22.370 94.293  1.00 25.37 ? 246 THR A CG2 1 
ATOM   779  N N   . ASN A 1 103 ? 59.254 -19.969 90.400  1.00 30.08 ? 247 ASN A N   1 
ATOM   780  C CA  . ASN A 1 103 ? 59.193 -19.804 88.951  1.00 32.85 ? 247 ASN A CA  1 
ATOM   781  C C   . ASN A 1 103 ? 59.772 -18.513 88.377  1.00 33.71 ? 247 ASN A C   1 
ATOM   782  O O   . ASN A 1 103 ? 59.527 -18.204 87.211  1.00 33.56 ? 247 ASN A O   1 
ATOM   783  C CB  . ASN A 1 103 ? 57.743 -19.936 88.486  1.00 34.35 ? 247 ASN A CB  1 
ATOM   784  C CG  . ASN A 1 103 ? 56.903 -18.742 88.875  1.00 36.72 ? 247 ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 103 ? 57.227 -18.018 89.818  1.00 38.61 ? 247 ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 103 ? 55.816 -18.530 88.155  1.00 37.68 ? 247 ASN A ND2 1 
ATOM   787  N N   . GLY A 1 104 ? 60.526 -17.756 89.168  1.00 34.37 ? 254 GLY A N   1 
ATOM   788  C CA  . GLY A 1 104 ? 61.085 -16.521 88.640  1.00 34.73 ? 254 GLY A CA  1 
ATOM   789  C C   . GLY A 1 104 ? 61.108 -15.345 89.602  1.00 35.41 ? 254 GLY A C   1 
ATOM   790  O O   . GLY A 1 104 ? 60.437 -15.361 90.632  1.00 35.59 ? 254 GLY A O   1 
ATOM   791  N N   . PRO A 1 105 ? 61.858 -14.287 89.266  1.00 35.34 ? 255 PRO A N   1 
ATOM   792  C CA  . PRO A 1 105 ? 62.003 -13.073 90.077  1.00 36.38 ? 255 PRO A CA  1 
ATOM   793  C C   . PRO A 1 105 ? 60.769 -12.202 90.295  1.00 36.72 ? 255 PRO A C   1 
ATOM   794  O O   . PRO A 1 105 ? 59.908 -12.080 89.429  1.00 37.96 ? 255 PRO A O   1 
ATOM   795  C CB  . PRO A 1 105 ? 63.099 -12.307 89.344  1.00 37.27 ? 255 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 105 ? 62.846 -12.672 87.914  1.00 36.12 ? 255 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 105 ? 62.619 -14.163 88.010  1.00 35.50 ? 255 PRO A CD  1 
ATOM   798  N N   . VAL A 1 106 ? 60.701 -11.601 91.476  1.00 36.33 ? 256 VAL A N   1 
ATOM   799  C CA  . VAL A 1 106 ? 59.617 -10.697 91.829  1.00 36.56 ? 256 VAL A CA  1 
ATOM   800  C C   . VAL A 1 106 ? 60.265 -9.541  92.593  1.00 36.39 ? 256 VAL A C   1 
ATOM   801  O O   . VAL A 1 106 ? 61.115 -9.751  93.456  1.00 36.03 ? 256 VAL A O   1 
ATOM   802  C CB  . VAL A 1 106 ? 58.528 -11.397 92.696  1.00 36.87 ? 256 VAL A CB  1 
ATOM   803  C CG1 . VAL A 1 106 ? 59.124 -11.941 93.971  1.00 36.31 ? 256 VAL A CG1 1 
ATOM   804  C CG2 . VAL A 1 106 ? 57.413 -10.416 93.015  1.00 37.47 ? 256 VAL A CG2 1 
ATOM   805  N N   . ASP A 1 107 ? 59.890 -8.316  92.250  1.00 37.16 ? 257 ASP A N   1 
ATOM   806  C CA  . ASP A 1 107 ? 60.474 -7.153  92.899  1.00 36.62 ? 257 ASP A CA  1 
ATOM   807  C C   . ASP A 1 107 ? 60.069 -7.072  94.363  1.00 34.65 ? 257 ASP A C   1 
ATOM   808  O O   . ASP A 1 107 ? 58.900 -7.241  94.705  1.00 34.61 ? 257 ASP A O   1 
ATOM   809  C CB  . ASP A 1 107 ? 60.052 -5.880  92.177  1.00 39.33 ? 257 ASP A CB  1 
ATOM   810  C CG  . ASP A 1 107 ? 61.013 -4.745  92.416  1.00 43.88 ? 257 ASP A CG  1 
ATOM   811  O OD1 . ASP A 1 107 ? 61.184 -4.329  93.587  1.00 45.18 ? 257 ASP A OD1 1 
ATOM   812  O OD2 . ASP A 1 107 ? 61.611 -4.279  91.425  1.00 47.23 ? 257 ASP A OD2 1 
ATOM   813  N N   . LEU A 1 108 ? 61.043 -6.808  95.224  1.00 32.92 ? 258 LEU A N   1 
ATOM   814  C CA  . LEU A 1 108 ? 60.797 -6.708  96.653  1.00 32.54 ? 258 LEU A CA  1 
ATOM   815  C C   . LEU A 1 108 ? 59.839 -5.553  96.980  1.00 32.54 ? 258 LEU A C   1 
ATOM   816  O O   . LEU A 1 108 ? 59.079 -5.616  97.948  1.00 31.24 ? 258 LEU A O   1 
ATOM   817  C CB  . LEU A 1 108 ? 62.126 -6.526  97.381  1.00 32.07 ? 258 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 108 ? 62.125 -6.900  98.860  1.00 32.88 ? 258 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 108 ? 61.790 -8.382  98.999  1.00 31.54 ? 258 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 108 ? 63.485 -6.591  99.464  1.00 32.20 ? 258 LEU A CD2 1 
ATOM   821  N N   . LYS A 1 109 ? 59.878 -4.504  96.162  1.00 34.15 ? 259 LYS A N   1 
ATOM   822  C CA  . LYS A 1 109 ? 59.017 -3.336  96.330  1.00 34.74 ? 259 LYS A CA  1 
ATOM   823  C C   . LYS A 1 109 ? 57.547 -3.725  96.224  1.00 34.47 ? 259 LYS A C   1 
ATOM   824  O O   . LYS A 1 109 ? 56.702 -3.237  96.978  1.00 33.67 ? 259 LYS A O   1 
ATOM   825  C CB  . LYS A 1 109 ? 59.337 -2.300  95.250  1.00 38.26 ? 259 LYS A CB  1 
ATOM   826  C CG  . LYS A 1 109 ? 60.009 -1.028  95.740  1.00 42.43 ? 259 LYS A CG  1 
ATOM   827  C CD  . LYS A 1 109 ? 59.004 -0.113  96.422  1.00 48.52 ? 259 LYS A CD  1 
ATOM   828  C CE  . LYS A 1 109 ? 59.620 1.241   96.768  1.00 51.55 ? 259 LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 109 ? 58.634 2.189   97.385  1.00 53.53 ? 259 LYS A NZ  1 
ATOM   830  N N   . LYS A 1 110 ? 57.247 -4.615  95.286  1.00 33.68 ? 260 LYS A N   1 
ATOM   831  C CA  . LYS A 1 110 ? 55.878 -5.048  95.073  1.00 34.31 ? 260 LYS A CA  1 
ATOM   832  C C   . LYS A 1 110 ? 55.268 -5.791  96.256  1.00 33.47 ? 260 LYS A C   1 
ATOM   833  O O   . LYS A 1 110 ? 54.058 -5.727  96.467  1.00 33.98 ? 260 LYS A O   1 
ATOM   834  C CB  . LYS A 1 110 ? 55.785 -5.917  93.818  1.00 35.28 ? 260 LYS A CB  1 
ATOM   835  C CG  . LYS A 1 110 ? 54.365 -6.052  93.320  1.00 39.50 ? 260 LYS A CG  1 
ATOM   836  C CD  . LYS A 1 110 ? 54.257 -6.899  92.071  1.00 43.90 ? 260 LYS A CD  1 
ATOM   837  C CE  . LYS A 1 110 ? 52.790 -7.017  91.642  1.00 46.83 ? 260 LYS A CE  1 
ATOM   838  N NZ  . LYS A 1 110 ? 52.571 -7.946  90.487  1.00 48.12 ? 260 LYS A NZ  1 
ATOM   839  N N   . ILE A 1 111 ? 56.095 -6.490  97.027  1.00 32.43 ? 261 ILE A N   1 
ATOM   840  C CA  . ILE A 1 111 ? 55.600 -7.238  98.182  1.00 31.47 ? 261 ILE A CA  1 
ATOM   841  C C   . ILE A 1 111 ? 55.306 -6.361  99.396  1.00 31.31 ? 261 ILE A C   1 
ATOM   842  O O   . ILE A 1 111 ? 54.246 -6.476  100.011 1.00 30.97 ? 261 ILE A O   1 
ATOM   843  C CB  . ILE A 1 111 ? 56.603 -8.337  98.626  1.00 32.26 ? 261 ILE A CB  1 
ATOM   844  C CG1 . ILE A 1 111 ? 56.706 -9.422  97.553  1.00 31.26 ? 261 ILE A CG1 1 
ATOM   845  C CG2 . ILE A 1 111 ? 56.156 -8.962  99.947  1.00 31.84 ? 261 ILE A CG2 1 
ATOM   846  C CD1 . ILE A 1 111 ? 57.709 -10.492 97.888  1.00 31.01 ? 261 ILE A CD1 1 
ATOM   847  N N   . THR A 1 112 ? 56.246 -5.486  99.739  1.00 30.16 ? 262 THR A N   1 
ATOM   848  C CA  . THR A 1 112 ? 56.094 -4.614  100.898 1.00 28.62 ? 262 THR A CA  1 
ATOM   849  C C   . THR A 1 112 ? 55.076 -3.482  100.703 1.00 29.15 ? 262 THR A C   1 
ATOM   850  O O   . THR A 1 112 ? 54.412 -3.068  101.654 1.00 27.53 ? 262 THR A O   1 
ATOM   851  C CB  . THR A 1 112 ? 57.464 -4.014  101.311 1.00 27.45 ? 262 THR A CB  1 
ATOM   852  O OG1 . THR A 1 112 ? 57.987 -3.208  100.245 1.00 27.14 ? 262 THR A OG1 1 
ATOM   853  C CG2 . THR A 1 112 ? 58.450 -5.125  101.617 1.00 24.85 ? 262 THR A CG2 1 
ATOM   854  N N   . ASN A 1 113 ? 54.948 -2.989  99.476  1.00 29.58 ? 263 ASN A N   1 
ATOM   855  C CA  . ASN A 1 113 ? 54.008 -1.910  99.192  1.00 31.72 ? 263 ASN A CA  1 
ATOM   856  C C   . ASN A 1 113 ? 52.603 -2.166  99.719  1.00 31.69 ? 263 ASN A C   1 
ATOM   857  O O   . ASN A 1 113 ? 51.865 -1.216  99.981  1.00 32.69 ? 263 ASN A O   1 
ATOM   858  C CB  . ASN A 1 113 ? 53.924 -1.643  97.685  1.00 35.36 ? 263 ASN A CB  1 
ATOM   859  C CG  . ASN A 1 113 ? 54.955 -0.630  97.204  1.00 38.67 ? 263 ASN A CG  1 
ATOM   860  O OD1 . ASN A 1 113 ? 55.725 -0.068  97.996  1.00 38.57 ? 263 ASN A OD1 1 
ATOM   861  N ND2 . ASN A 1 113 ? 54.971 -0.389  95.891  1.00 40.38 ? 263 ASN A ND2 1 
ATOM   862  N N   . PHE A 1 114 ? 52.218 -3.434  99.855  1.00 31.00 ? 264 PHE A N   1 
ATOM   863  C CA  . PHE A 1 114 ? 50.882 -3.758  100.360 1.00 31.02 ? 264 PHE A CA  1 
ATOM   864  C C   . PHE A 1 114 ? 50.731 -3.345  101.812 1.00 30.69 ? 264 PHE A C   1 
ATOM   865  O O   . PHE A 1 114 ? 49.622 -3.126  102.294 1.00 32.32 ? 264 PHE A O   1 
ATOM   866  C CB  . PHE A 1 114 ? 50.603 -5.261  100.275 1.00 32.11 ? 264 PHE A CB  1 
ATOM   867  C CG  . PHE A 1 114 ? 50.452 -5.777  98.879  1.00 33.68 ? 264 PHE A CG  1 
ATOM   868  C CD1 . PHE A 1 114 ? 49.453 -5.286  98.045  1.00 33.90 ? 264 PHE A CD1 1 
ATOM   869  C CD2 . PHE A 1 114 ? 51.304 -6.765  98.399  1.00 32.97 ? 264 PHE A CD2 1 
ATOM   870  C CE1 . PHE A 1 114 ? 49.305 -5.773  96.753  1.00 33.64 ? 264 PHE A CE1 1 
ATOM   871  C CE2 . PHE A 1 114 ? 51.164 -7.259  97.110  1.00 33.21 ? 264 PHE A CE2 1 
ATOM   872  C CZ  . PHE A 1 114 ? 50.160 -6.761  96.283  1.00 33.78 ? 264 PHE A CZ  1 
ATOM   873  N N   . PHE A 1 115 ? 51.854 -3.235  102.507 1.00 28.95 ? 265 PHE A N   1 
ATOM   874  C CA  . PHE A 1 115 ? 51.837 -2.898  103.919 1.00 26.80 ? 265 PHE A CA  1 
ATOM   875  C C   . PHE A 1 115 ? 52.139 -1.455  104.274 1.00 26.50 ? 265 PHE A C   1 
ATOM   876  O O   . PHE A 1 115 ? 52.325 -1.119  105.446 1.00 26.11 ? 265 PHE A O   1 
ATOM   877  C CB  . PHE A 1 115 ? 52.774 -3.851  104.643 1.00 24.57 ? 265 PHE A CB  1 
ATOM   878  C CG  . PHE A 1 115 ? 52.406 -5.284  104.445 1.00 22.93 ? 265 PHE A CG  1 
ATOM   879  C CD1 . PHE A 1 115 ? 51.515 -5.911  105.308 1.00 21.73 ? 265 PHE A CD1 1 
ATOM   880  C CD2 . PHE A 1 115 ? 52.918 -5.998  103.367 1.00 20.87 ? 265 PHE A CD2 1 
ATOM   881  C CE1 . PHE A 1 115 ? 51.142 -7.239  105.098 1.00 22.84 ? 265 PHE A CE1 1 
ATOM   882  C CE2 . PHE A 1 115 ? 52.556 -7.315  103.146 1.00 19.97 ? 265 PHE A CE2 1 
ATOM   883  C CZ  . PHE A 1 115 ? 51.667 -7.942  104.011 1.00 21.95 ? 265 PHE A CZ  1 
ATOM   884  N N   . ARG A 1 116 ? 52.181 -0.598  103.267 1.00 25.71 ? 266 ARG A N   1 
ATOM   885  C CA  . ARG A 1 116 ? 52.423 0.807   103.515 1.00 27.88 ? 266 ARG A CA  1 
ATOM   886  C C   . ARG A 1 116 ? 51.330 1.354   104.420 1.00 28.64 ? 266 ARG A C   1 
ATOM   887  O O   . ARG A 1 116 ? 50.227 0.805   104.479 1.00 28.25 ? 266 ARG A O   1 
ATOM   888  C CB  . ARG A 1 116 ? 52.437 1.576   102.206 1.00 29.15 ? 266 ARG A CB  1 
ATOM   889  C CG  . ARG A 1 116 ? 53.823 1.845   101.672 1.00 31.76 ? 266 ARG A CG  1 
ATOM   890  C CD  . ARG A 1 116 ? 53.735 2.453   100.289 1.00 35.15 ? 266 ARG A CD  1 
ATOM   891  N NE  . ARG A 1 116 ? 52.556 3.306   100.147 1.00 35.12 ? 266 ARG A NE  1 
ATOM   892  C CZ  . ARG A 1 116 ? 52.303 4.054   99.081  1.00 37.23 ? 266 ARG A CZ  1 
ATOM   893  N NH1 . ARG A 1 116 ? 53.152 4.055   98.062  1.00 38.36 ? 266 ARG A NH1 1 
ATOM   894  N NH2 . ARG A 1 116 ? 51.203 4.796   99.035  1.00 37.29 ? 266 ARG A NH2 1 
ATOM   895  N N   . GLY A 1 117 ? 51.643 2.439   105.121 1.00 30.11 ? 267 GLY A N   1 
ATOM   896  C CA  . GLY A 1 117 ? 50.689 3.050   106.029 1.00 31.17 ? 267 GLY A CA  1 
ATOM   897  C C   . GLY A 1 117 ? 49.302 3.295   105.465 1.00 32.57 ? 267 GLY A C   1 
ATOM   898  O O   . GLY A 1 117 ? 48.310 3.077   106.160 1.00 34.02 ? 267 GLY A O   1 
ATOM   899  N N   . ASP A 1 118 ? 49.233 3.738   104.212 1.00 32.68 ? 268 ASP A N   1 
ATOM   900  C CA  . ASP A 1 118 ? 47.967 4.038   103.551 1.00 33.27 ? 268 ASP A CA  1 
ATOM   901  C C   . ASP A 1 118 ? 47.323 2.866   102.803 1.00 33.87 ? 268 ASP A C   1 
ATOM   902  O O   . ASP A 1 118 ? 46.229 3.006   102.255 1.00 33.32 ? 268 ASP A O   1 
ATOM   903  C CB  . ASP A 1 118 ? 48.171 5.211   102.588 1.00 36.17 ? 268 ASP A CB  1 
ATOM   904  C CG  . ASP A 1 118 ? 49.137 4.883   101.460 1.00 38.32 ? 268 ASP A CG  1 
ATOM   905  O OD1 . ASP A 1 118 ? 50.027 4.028   101.662 1.00 40.63 ? 268 ASP A OD1 1 
ATOM   906  O OD2 . ASP A 1 118 ? 49.016 5.491   100.374 1.00 38.82 ? 268 ASP A OD2 1 
ATOM   907  N N   . ARG A 1 119 ? 47.996 1.719   102.771 1.00 35.23 ? 269 ARG A N   1 
ATOM   908  C CA  . ARG A 1 119 ? 47.460 0.539   102.092 1.00 35.37 ? 269 ARG A CA  1 
ATOM   909  C C   . ARG A 1 119 ? 46.875 -0.463  103.086 1.00 34.47 ? 269 ARG A C   1 
ATOM   910  O O   . ARG A 1 119 ? 45.832 -1.061  102.831 1.00 35.19 ? 269 ARG A O   1 
ATOM   911  C CB  . ARG A 1 119 ? 48.548 -0.152  101.254 1.00 37.71 ? 269 ARG A CB  1 
ATOM   912  C CG  . ARG A 1 119 ? 48.547 0.204   99.767  1.00 40.84 ? 269 ARG A CG  1 
ATOM   913  C CD  . ARG A 1 119 ? 48.951 1.648   99.520  1.00 45.49 ? 269 ARG A CD  1 
ATOM   914  N NE  . ARG A 1 119 ? 48.849 2.024   98.109  1.00 49.58 ? 269 ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 119 ? 49.662 1.594   97.144  1.00 51.43 ? 269 ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 119 ? 49.473 2.000   95.894  1.00 52.21 ? 269 ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 119 ? 50.668 0.768   97.420  1.00 52.15 ? 269 ARG A NH2 1 
ATOM   918  N N   . CYS A 1 120 ? 47.552 -0.642  104.215 1.00 32.73 ? 270 CYS A N   1 
ATOM   919  C CA  . CYS A 1 120 ? 47.100 -1.572  105.245 1.00 31.59 ? 270 CYS A CA  1 
ATOM   920  C C   . CYS A 1 120 ? 46.825 -0.813  106.551 1.00 32.28 ? 270 CYS A C   1 
ATOM   921  O O   . CYS A 1 120 ? 47.592 -0.896  107.511 1.00 31.09 ? 270 CYS A O   1 
ATOM   922  C CB  . CYS A 1 120 ? 48.167 -2.647  105.457 1.00 29.45 ? 270 CYS A CB  1 
ATOM   923  S SG  . CYS A 1 120 ? 47.734 -3.921  106.657 1.00 29.35 ? 270 CYS A SG  1 
ATOM   924  N N   . ARG A 1 121 ? 45.709 -0.087  106.572 1.00 33.37 ? 271 ARG A N   1 
ATOM   925  C CA  . ARG A 1 121 ? 45.300 0.743   107.708 1.00 33.01 ? 271 ARG A CA  1 
ATOM   926  C C   . ARG A 1 121 ? 45.372 0.175   109.123 1.00 31.35 ? 271 ARG A C   1 
ATOM   927  O O   . ARG A 1 121 ? 45.670 0.913   110.065 1.00 30.60 ? 271 ARG A O   1 
ATOM   928  C CB  . ARG A 1 121 ? 43.888 1.284   107.466 1.00 35.87 ? 271 ARG A CB  1 
ATOM   929  C CG  . ARG A 1 121 ? 43.762 2.168   106.229 1.00 41.00 ? 271 ARG A CG  1 
ATOM   930  C CD  . ARG A 1 121 ? 44.794 3.276   106.257 1.00 45.10 ? 271 ARG A CD  1 
ATOM   931  N NE  . ARG A 1 121 ? 44.674 4.103   107.455 1.00 49.52 ? 271 ARG A NE  1 
ATOM   932  C CZ  . ARG A 1 121 ? 43.810 5.105   107.591 1.00 51.71 ? 271 ARG A CZ  1 
ATOM   933  N NH1 . ARG A 1 121 ? 43.775 5.798   108.722 1.00 53.08 ? 271 ARG A NH1 1 
ATOM   934  N NH2 . ARG A 1 121 ? 42.992 5.424   106.592 1.00 51.78 ? 271 ARG A NH2 1 
ATOM   935  N N   . SER A 1 122 ? 45.092 -1.117  109.287 1.00 29.92 ? 272 SER A N   1 
ATOM   936  C CA  . SER A 1 122 ? 45.127 -1.729  110.616 1.00 28.71 ? 272 SER A CA  1 
ATOM   937  C C   . SER A 1 122 ? 46.541 -1.964  111.146 1.00 26.95 ? 272 SER A C   1 
ATOM   938  O O   . SER A 1 122 ? 46.716 -2.351  112.296 1.00 27.50 ? 272 SER A O   1 
ATOM   939  C CB  . SER A 1 122 ? 44.325 -3.042  110.632 1.00 28.86 ? 272 SER A CB  1 
ATOM   940  O OG  . SER A 1 122 ? 44.657 -3.872  109.532 1.00 31.78 ? 272 SER A OG  1 
ATOM   941  N N   . LEU A 1 123 ? 47.548 -1.736  110.309 1.00 24.80 ? 273 LEU A N   1 
ATOM   942  C CA  . LEU A 1 123 ? 48.930 -1.893  110.741 1.00 23.33 ? 273 LEU A CA  1 
ATOM   943  C C   . LEU A 1 123 ? 49.614 -0.535  110.872 1.00 22.97 ? 273 LEU A C   1 
ATOM   944  O O   . LEU A 1 123 ? 50.771 -0.455  111.280 1.00 23.83 ? 273 LEU A O   1 
ATOM   945  C CB  . LEU A 1 123 ? 49.718 -2.782  109.770 1.00 22.58 ? 273 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 123 ? 49.614 -4.294  109.988 1.00 21.99 ? 273 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 123 ? 50.487 -5.035  108.976 1.00 19.49 ? 273 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 123 ? 50.044 -4.628  111.406 1.00 19.78 ? 273 LEU A CD2 1 
ATOM   949  N N   . THR A 1 124 ? 48.894 0.534   110.542 1.00 21.83 ? 274 THR A N   1 
ATOM   950  C CA  . THR A 1 124 ? 49.460 1.875   110.635 1.00 21.12 ? 274 THR A CA  1 
ATOM   951  C C   . THR A 1 124 ? 49.947 2.139   112.052 1.00 20.99 ? 274 THR A C   1 
ATOM   952  O O   . THR A 1 124 ? 49.228 1.885   113.020 1.00 22.59 ? 274 THR A O   1 
ATOM   953  C CB  . THR A 1 124 ? 48.434 2.950   110.262 1.00 20.98 ? 274 THR A CB  1 
ATOM   954  O OG1 . THR A 1 124 ? 47.915 2.681   108.953 1.00 23.31 ? 274 THR A OG1 1 
ATOM   955  C CG2 . THR A 1 124 ? 49.090 4.320   110.248 1.00 19.81 ? 274 THR A CG2 1 
ATOM   956  N N   . GLY A 1 125 ? 51.175 2.635   112.172 1.00 19.44 ? 275 GLY A N   1 
ATOM   957  C CA  . GLY A 1 125 ? 51.729 2.915   113.484 1.00 18.14 ? 275 GLY A CA  1 
ATOM   958  C C   . GLY A 1 125 ? 52.220 1.677   114.213 1.00 18.63 ? 275 GLY A C   1 
ATOM   959  O O   . GLY A 1 125 ? 52.601 1.753   115.377 1.00 20.71 ? 275 GLY A O   1 
ATOM   960  N N   . LYS A 1 126 ? 52.208 0.533   113.537 1.00 19.36 ? 276 LYS A N   1 
ATOM   961  C CA  . LYS A 1 126 ? 52.661 -0.718  114.135 1.00 19.07 ? 276 LYS A CA  1 
ATOM   962  C C   . LYS A 1 126 ? 53.894 -1.227  113.382 1.00 18.98 ? 276 LYS A C   1 
ATOM   963  O O   . LYS A 1 126 ? 54.004 -1.078  112.162 1.00 19.18 ? 276 LYS A O   1 
ATOM   964  C CB  . LYS A 1 126 ? 51.547 -1.767  114.078 1.00 20.62 ? 276 LYS A CB  1 
ATOM   965  C CG  . LYS A 1 126 ? 50.298 -1.434  114.886 1.00 22.29 ? 276 LYS A CG  1 
ATOM   966  C CD  . LYS A 1 126 ? 49.215 -2.489  114.690 1.00 23.67 ? 276 LYS A CD  1 
ATOM   967  C CE  . LYS A 1 126 ? 48.001 -2.222  115.575 1.00 24.33 ? 276 LYS A CE  1 
ATOM   968  N NZ  . LYS A 1 126 ? 46.884 -3.189  115.295 1.00 24.34 ? 276 LYS A NZ  1 
ATOM   969  N N   . PRO A 1 127 ? 54.831 -1.858  114.101 1.00 18.07 ? 277 PRO A N   1 
ATOM   970  C CA  . PRO A 1 127 ? 56.047 -2.371  113.466 1.00 17.31 ? 277 PRO A CA  1 
ATOM   971  C C   . PRO A 1 127 ? 55.854 -3.513  112.461 1.00 17.47 ? 277 PRO A C   1 
ATOM   972  O O   . PRO A 1 127 ? 55.255 -4.546  112.771 1.00 16.06 ? 277 PRO A O   1 
ATOM   973  C CB  . PRO A 1 127 ? 56.896 -2.784  114.662 1.00 17.40 ? 277 PRO A CB  1 
ATOM   974  C CG  . PRO A 1 127 ? 55.869 -3.270  115.625 1.00 17.28 ? 277 PRO A CG  1 
ATOM   975  C CD  . PRO A 1 127 ? 54.797 -2.210  115.532 1.00 16.66 ? 277 PRO A CD  1 
ATOM   976  N N   . LYS A 1 128 ? 56.378 -3.310  111.256 1.00 16.14 ? 278 LYS A N   1 
ATOM   977  C CA  . LYS A 1 128 ? 56.308 -4.303  110.196 1.00 16.31 ? 278 LYS A CA  1 
ATOM   978  C C   . LYS A 1 128 ? 57.735 -4.776  109.919 1.00 16.75 ? 278 LYS A C   1 
ATOM   979  O O   . LYS A 1 128 ? 58.532 -4.046  109.324 1.00 16.54 ? 278 LYS A O   1 
ATOM   980  C CB  . LYS A 1 128 ? 55.711 -3.676  108.939 1.00 17.59 ? 278 LYS A CB  1 
ATOM   981  C CG  . LYS A 1 128 ? 54.463 -2.861  109.213 1.00 18.64 ? 278 LYS A CG  1 
ATOM   982  C CD  . LYS A 1 128 ? 54.150 -1.940  108.060 1.00 18.09 ? 278 LYS A CD  1 
ATOM   983  C CE  . LYS A 1 128 ? 53.035 -0.984  108.427 1.00 19.48 ? 278 LYS A CE  1 
ATOM   984  N NZ  . LYS A 1 128 ? 53.418 -0.085  109.544 1.00 14.84 ? 278 LYS A NZ  1 
ATOM   985  N N   . LEU A 1 129 ? 58.045 -5.998  110.345 1.00 16.14 ? 279 LEU A N   1 
ATOM   986  C CA  . LEU A 1 129 ? 59.382 -6.562  110.170 1.00 18.09 ? 279 LEU A CA  1 
ATOM   987  C C   . LEU A 1 129 ? 59.503 -7.553  109.015 1.00 18.73 ? 279 LEU A C   1 
ATOM   988  O O   . LEU A 1 129 ? 58.728 -8.507  108.909 1.00 18.43 ? 279 LEU A O   1 
ATOM   989  C CB  . LEU A 1 129 ? 59.831 -7.264  111.458 1.00 19.07 ? 279 LEU A CB  1 
ATOM   990  C CG  . LEU A 1 129 ? 59.434 -6.601  112.780 1.00 21.58 ? 279 LEU A CG  1 
ATOM   991  C CD1 . LEU A 1 129 ? 60.003 -7.395  113.944 1.00 21.12 ? 279 LEU A CD1 1 
ATOM   992  C CD2 . LEU A 1 129 ? 59.927 -5.158  112.810 1.00 22.24 ? 279 LEU A CD2 1 
ATOM   993  N N   . PHE A 1 130 ? 60.493 -7.323  108.159 1.00 19.70 ? 280 PHE A N   1 
ATOM   994  C CA  . PHE A 1 130 ? 60.764 -8.208  107.032 1.00 19.28 ? 280 PHE A CA  1 
ATOM   995  C C   . PHE A 1 130 ? 62.172 -8.760  107.200 1.00 18.31 ? 280 PHE A C   1 
ATOM   996  O O   . PHE A 1 130 ? 63.142 -8.001  107.247 1.00 19.11 ? 280 PHE A O   1 
ATOM   997  C CB  . PHE A 1 130 ? 60.651 -7.455  105.704 1.00 20.20 ? 280 PHE A CB  1 
ATOM   998  C CG  . PHE A 1 130 ? 59.245 -7.062  105.355 1.00 22.28 ? 280 PHE A CG  1 
ATOM   999  C CD1 . PHE A 1 130 ? 58.604 -6.033  106.039 1.00 22.77 ? 280 PHE A CD1 1 
ATOM   1000 C CD2 . PHE A 1 130 ? 58.545 -7.751  104.371 1.00 22.30 ? 280 PHE A CD2 1 
ATOM   1001 C CE1 . PHE A 1 130 ? 57.285 -5.695  105.752 1.00 24.01 ? 280 PHE A CE1 1 
ATOM   1002 C CE2 . PHE A 1 130 ? 57.221 -7.423  104.072 1.00 23.87 ? 280 PHE A CE2 1 
ATOM   1003 C CZ  . PHE A 1 130 ? 56.588 -6.393  104.765 1.00 22.76 ? 280 PHE A CZ  1 
ATOM   1004 N N   . ILE A 1 131 ? 62.273 -10.080 107.320 1.00 15.85 ? 281 ILE A N   1 
ATOM   1005 C CA  . ILE A 1 131 ? 63.558 -10.747 107.473 1.00 15.08 ? 281 ILE A CA  1 
ATOM   1006 C C   . ILE A 1 131 ? 63.830 -11.490 106.162 1.00 15.49 ? 281 ILE A C   1 
ATOM   1007 O O   . ILE A 1 131 ? 63.085 -12.389 105.782 1.00 14.80 ? 281 ILE A O   1 
ATOM   1008 C CB  . ILE A 1 131 ? 63.517 -11.734 108.664 1.00 13.41 ? 281 ILE A CB  1 
ATOM   1009 C CG1 . ILE A 1 131 ? 62.987 -11.009 109.896 1.00 13.93 ? 281 ILE A CG1 1 
ATOM   1010 C CG2 . ILE A 1 131 ? 64.918 -12.277 108.966 1.00 11.99 ? 281 ILE A CG2 1 
ATOM   1011 C CD1 . ILE A 1 131 ? 62.765 -11.898 111.093 1.00 16.18 ? 281 ILE A CD1 1 
ATOM   1012 N N   . ILE A 1 132 ? 64.900 -11.109 105.472 1.00 16.92 ? 282 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 132 ? 65.223 -11.718 104.189 1.00 18.01 ? 282 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 132 ? 66.529 -12.500 104.137 1.00 18.41 ? 282 ILE A C   1 
ATOM   1015 O O   . ILE A 1 132 ? 67.603 -11.937 104.333 1.00 20.12 ? 282 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 132 ? 65.303 -10.650 103.060 1.00 18.16 ? 282 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 132 ? 64.010 -9.836  102.980 1.00 17.94 ? 282 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 132 ? 65.585 -11.328 101.728 1.00 17.56 ? 282 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 132 ? 63.867 -8.806  104.058 1.00 17.37 ? 282 ILE A CD1 1 
ATOM   1020 N N   . GLN A 1 133 ? 66.432 -13.795 103.859 1.00 17.82 ? 283 GLN A N   1 
ATOM   1021 C CA  . GLN A 1 133 ? 67.613 -14.633 103.728 1.00 17.01 ? 283 GLN A CA  1 
ATOM   1022 C C   . GLN A 1 133 ? 67.798 -14.807 102.237 1.00 18.14 ? 283 GLN A C   1 
ATOM   1023 O O   . GLN A 1 133 ? 67.141 -15.636 101.613 1.00 19.80 ? 283 GLN A O   1 
ATOM   1024 C CB  . GLN A 1 133 ? 67.401 -15.984 104.402 1.00 16.01 ? 283 GLN A CB  1 
ATOM   1025 C CG  . GLN A 1 133 ? 68.436 -17.049 104.049 1.00 15.51 ? 283 GLN A CG  1 
ATOM   1026 C CD  . GLN A 1 133 ? 69.872 -16.580 104.202 1.00 13.84 ? 283 GLN A CD  1 
ATOM   1027 O OE1 . GLN A 1 133 ? 70.193 -15.797 105.098 1.00 12.71 ? 283 GLN A OE1 1 
ATOM   1028 N NE2 . GLN A 1 133 ? 70.751 -17.074 103.333 1.00 14.72 ? 283 GLN A NE2 1 
ATOM   1029 N N   . ALA A 1 134 ? 68.675 -13.991 101.665 1.00 19.41 ? 284 ALA A N   1 
ATOM   1030 C CA  . ALA A 1 134 ? 68.933 -14.045 100.236 1.00 21.67 ? 284 ALA A CA  1 
ATOM   1031 C C   . ALA A 1 134 ? 70.134 -13.223 99.770  1.00 22.32 ? 284 ALA A C   1 
ATOM   1032 O O   . ALA A 1 134 ? 70.665 -12.369 100.476 1.00 24.79 ? 284 ALA A O   1 
ATOM   1033 C CB  . ALA A 1 134 ? 67.684 -13.619 99.471  1.00 20.13 ? 284 ALA A CB  1 
ATOM   1034 N N   . CYS A 1 135 ? 70.516 -13.529 98.546  1.00 22.46 ? 285 CYS A N   1 
ATOM   1035 C CA  . CYS A 1 135 ? 71.622 -12.988 97.750  1.00 25.71 ? 285 CYS A CA  1 
ATOM   1036 C C   . CYS A 1 135 ? 71.137 -11.622 97.323  1.00 25.42 ? 285 CYS A C   1 
ATOM   1037 O O   . CYS A 1 135 ? 69.953 -11.420 97.042  1.00 24.74 ? 285 CYS A O   1 
ATOM   1038 C CB  . CYS A 1 135 ? 71.712 -14.025 96.635  1.00 28.74 ? 285 CYS A CB  1 
ATOM   1039 S SG  . CYS A 1 135 ? 72.160 -15.432 97.647  1.00 35.91 ? 285 CYS A SG  1 
ATOM   1040 N N   . ARG A 1 136 ? 72.050 -10.667 97.354  1.00 26.23 ? 286 ARG A N   1 
ATOM   1041 C CA  . ARG A 1 136 ? 71.744 -9.316  96.948  1.00 24.92 ? 286 ARG A CA  1 
ATOM   1042 C C   . ARG A 1 136 ? 72.781 -9.010  95.882  1.00 24.92 ? 286 ARG A C   1 
ATOM   1043 O O   . ARG A 1 136 ? 73.088 -7.855  95.604  1.00 26.08 ? 286 ARG A O   1 
ATOM   1044 C CB  . ARG A 1 136 ? 71.865 -8.370  98.144  1.00 23.39 ? 286 ARG A CB  1 
ATOM   1045 C CG  . ARG A 1 136 ? 70.958 -8.765  99.306  1.00 21.97 ? 286 ARG A CG  1 
ATOM   1046 C CD  . ARG A 1 136 ? 71.003 -7.741  100.418 1.00 22.75 ? 286 ARG A CD  1 
ATOM   1047 N NE  . ARG A 1 136 ? 70.406 -6.477  100.002 1.00 22.63 ? 286 ARG A NE  1 
ATOM   1048 C CZ  . ARG A 1 136 ? 70.483 -5.347  100.696 1.00 24.06 ? 286 ARG A CZ  1 
ATOM   1049 N NH1 . ARG A 1 136 ? 71.145 -5.312  101.849 1.00 22.26 ? 286 ARG A NH1 1 
ATOM   1050 N NH2 . ARG A 1 136 ? 69.875 -4.257  100.244 1.00 24.77 ? 286 ARG A NH2 1 
ATOM   1051 N N   . GLY A 1 137 ? 73.302 -10.075 95.279  1.00 23.54 ? 287 GLY A N   1 
ATOM   1052 C CA  . GLY A 1 137 ? 74.313 -9.933  94.250  1.00 24.30 ? 287 GLY A CA  1 
ATOM   1053 C C   . GLY A 1 137 ? 75.261 -11.113 94.259  1.00 25.21 ? 287 GLY A C   1 
ATOM   1054 O O   . GLY A 1 137 ? 75.039 -12.094 94.971  1.00 24.56 ? 287 GLY A O   1 
ATOM   1055 N N   . THR A 1 138 ? 76.325 -11.016 93.472  1.00 25.81 ? 288 THR A N   1 
ATOM   1056 C CA  . THR A 1 138 ? 77.317 -12.083 93.383  1.00 27.74 ? 288 THR A CA  1 
ATOM   1057 C C   . THR A 1 138 ? 78.721 -11.593 93.714  1.00 29.14 ? 288 THR A C   1 
ATOM   1058 O O   . THR A 1 138 ? 79.704 -12.073 93.156  1.00 30.56 ? 288 THR A O   1 
ATOM   1059 C CB  . THR A 1 138 ? 77.342 -12.681 91.982  1.00 26.04 ? 288 THR A CB  1 
ATOM   1060 O OG1 . THR A 1 138 ? 77.573 -11.637 91.026  1.00 27.92 ? 288 THR A OG1 1 
ATOM   1061 C CG2 . THR A 1 138 ? 76.026 -13.345 91.682  1.00 25.41 ? 288 THR A CG2 1 
ATOM   1062 N N   . GLU A 1 139 ? 78.807 -10.627 94.617  1.00 30.71 ? 289 GLU A N   1 
ATOM   1063 C CA  . GLU A 1 139 ? 80.087 -10.081 95.026  1.00 33.91 ? 289 GLU A CA  1 
ATOM   1064 C C   . GLU A 1 139 ? 80.551 -10.900 96.230  1.00 33.55 ? 289 GLU A C   1 
ATOM   1065 O O   . GLU A 1 139 ? 79.727 -11.355 97.021  1.00 34.43 ? 289 GLU A O   1 
ATOM   1066 C CB  . GLU A 1 139 ? 79.899 -8.614  95.392  1.00 37.97 ? 289 GLU A CB  1 
ATOM   1067 C CG  . GLU A 1 139 ? 81.160 -7.786  95.418  1.00 45.69 ? 289 GLU A CG  1 
ATOM   1068 C CD  . GLU A 1 139 ? 80.864 -6.331  95.101  1.00 51.45 ? 289 GLU A CD  1 
ATOM   1069 O OE1 . GLU A 1 139 ? 81.605 -5.442  95.583  1.00 53.91 ? 289 GLU A OE1 1 
ATOM   1070 O OE2 . GLU A 1 139 ? 79.883 -6.082  94.359  1.00 53.69 ? 289 GLU A OE2 1 
ATOM   1071 N N   . LEU A 1 140 ? 81.858 -11.099 96.367  1.00 32.62 ? 290 LEU A N   1 
ATOM   1072 C CA  . LEU A 1 140 ? 82.387 -11.897 97.471  1.00 31.24 ? 290 LEU A CA  1 
ATOM   1073 C C   . LEU A 1 140 ? 83.229 -11.092 98.452  1.00 31.10 ? 290 LEU A C   1 
ATOM   1074 O O   . LEU A 1 140 ? 84.103 -10.319 98.055  1.00 31.14 ? 290 LEU A O   1 
ATOM   1075 C CB  . LEU A 1 140 ? 83.230 -13.045 96.922  1.00 30.55 ? 290 LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 140 ? 82.580 -14.002 95.920  1.00 32.00 ? 290 LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 140 ? 83.666 -14.623 95.051  1.00 33.56 ? 290 LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 140 ? 81.783 -15.077 96.641  1.00 30.30 ? 290 LEU A CD2 1 
ATOM   1079 N N   . ASP A 1 141 ? 82.959 -11.293 99.737  1.00 30.61 ? 291 ASP A N   1 
ATOM   1080 C CA  . ASP A 1 141 ? 83.679 -10.616 100.810 1.00 30.18 ? 291 ASP A CA  1 
ATOM   1081 C C   . ASP A 1 141 ? 84.768 -11.574 101.294 1.00 30.94 ? 291 ASP A C   1 
ATOM   1082 O O   . ASP A 1 141 ? 84.476 -12.538 102.009 1.00 31.13 ? 291 ASP A O   1 
ATOM   1083 C CB  . ASP A 1 141 ? 82.716 -10.294 101.955 1.00 29.30 ? 291 ASP A CB  1 
ATOM   1084 C CG  . ASP A 1 141 ? 83.280 -9.282  102.928 1.00 29.47 ? 291 ASP A CG  1 
ATOM   1085 O OD1 . ASP A 1 141 ? 84.487 -9.352  103.246 1.00 29.30 ? 291 ASP A OD1 1 
ATOM   1086 O OD2 . ASP A 1 141 ? 82.504 -8.418  103.385 1.00 28.73 ? 291 ASP A OD2 1 
ATOM   1087 N N   . CYS A 1 142 ? 86.014 -11.311 100.899 1.00 31.80 ? 292 CYS A N   1 
ATOM   1088 C CA  . CYS A 1 142 ? 87.146 -12.163 101.269 1.00 32.81 ? 292 CYS A CA  1 
ATOM   1089 C C   . CYS A 1 142 ? 87.631 -12.001 102.712 1.00 33.12 ? 292 CYS A C   1 
ATOM   1090 O O   . CYS A 1 142 ? 88.384 -12.837 103.219 1.00 32.38 ? 292 CYS A O   1 
ATOM   1091 C CB  . CYS A 1 142 ? 88.315 -11.933 100.301 1.00 33.35 ? 292 CYS A CB  1 
ATOM   1092 S SG  . CYS A 1 142 ? 88.018 -12.515 98.597  1.00 37.75 ? 292 CYS A SG  1 
ATOM   1093 N N   . GLY A 1 143 ? 87.201 -10.932 103.373 1.00 33.47 ? 293 GLY A N   1 
ATOM   1094 C CA  . GLY A 1 143 ? 87.604 -10.716 104.748 1.00 34.10 ? 293 GLY A CA  1 
ATOM   1095 C C   . GLY A 1 143 ? 88.933 -10.007 104.890 1.00 35.35 ? 293 GLY A C   1 
ATOM   1096 O O   . GLY A 1 143 ? 89.683 -9.877  103.924 1.00 36.10 ? 293 GLY A O   1 
ATOM   1097 N N   . ILE A 1 144 ? 89.224 -9.560  106.108 1.00 36.06 ? 294 ILE A N   1 
ATOM   1098 C CA  . ILE A 1 144 ? 90.455 -8.843  106.410 1.00 37.70 ? 294 ILE A CA  1 
ATOM   1099 C C   . ILE A 1 144 ? 90.895 -9.126  107.851 1.00 40.36 ? 294 ILE A C   1 
ATOM   1100 O O   . ILE A 1 144 ? 90.136 -9.694  108.644 1.00 37.66 ? 294 ILE A O   1 
ATOM   1101 C CB  . ILE A 1 144 ? 90.253 -7.309  106.230 1.00 36.61 ? 294 ILE A CB  1 
ATOM   1102 C CG1 . ILE A 1 144 ? 91.571 -6.559  106.459 1.00 35.37 ? 294 ILE A CG1 1 
ATOM   1103 C CG2 . ILE A 1 144 ? 89.198 -6.801  107.206 1.00 35.54 ? 294 ILE A CG2 1 
ATOM   1104 C CD1 . ILE A 1 144 ? 92.652 -6.864  105.434 1.00 36.21 ? 294 ILE A CD1 1 
ATOM   1105 N N   . GLU A 1 145 ? 92.125 -8.712  108.164 1.00 44.68 ? 295 GLU A N   1 
ATOM   1106 C CA  . GLU A 1 145 ? 92.757 -8.880  109.477 1.00 46.43 ? 295 GLU A CA  1 
ATOM   1107 C C   . GLU A 1 145 ? 92.828 -10.351 109.857 1.00 46.88 ? 295 GLU A C   1 
ATOM   1108 O O   . GLU A 1 145 ? 92.179 -10.733 110.858 1.00 48.96 ? 295 GLU A O   1 
ATOM   1109 C CB  . GLU A 1 145 ? 92.007 -8.094  110.565 1.00 47.07 ? 295 GLU A CB  1 
ATOM   1110 C CG  . GLU A 1 145 ? 92.829 -7.901  111.830 1.00 50.09 ? 295 GLU A CG  1 
ATOM   1111 C CD  . GLU A 1 145 ? 92.100 -8.341  113.087 1.00 53.68 ? 295 GLU A CD  1 
ATOM   1112 O OE1 . GLU A 1 145 ? 92.728 -9.031  113.926 1.00 54.36 ? 295 GLU A OE1 1 
ATOM   1113 O OE2 . GLU A 1 145 ? 90.907 -7.991  113.243 1.00 54.04 ? 295 GLU A OE2 1 
ATOM   1114 N N   . LYS B 2 11  ? 49.517 12.849  111.691 1.00 29.70 ? 320 LYS B N   1 
ATOM   1115 C CA  . LYS B 2 11  ? 49.888 12.293  110.348 1.00 29.63 ? 320 LYS B CA  1 
ATOM   1116 C C   . LYS B 2 11  ? 51.360 11.815  110.278 1.00 28.34 ? 320 LYS B C   1 
ATOM   1117 O O   . LYS B 2 11  ? 52.272 12.519  110.732 1.00 27.31 ? 320 LYS B O   1 
ATOM   1118 C CB  . LYS B 2 11  ? 49.625 13.347  109.267 1.00 29.34 ? 320 LYS B CB  1 
ATOM   1119 C CG  . LYS B 2 11  ? 49.211 12.747  107.941 1.00 32.76 ? 320 LYS B CG  1 
ATOM   1120 C CD  . LYS B 2 11  ? 48.828 13.798  106.910 1.00 33.01 ? 320 LYS B CD  1 
ATOM   1121 C CE  . LYS B 2 11  ? 50.037 14.587  106.444 1.00 34.87 ? 320 LYS B CE  1 
ATOM   1122 N NZ  . LYS B 2 11  ? 49.710 15.423  105.251 1.00 35.33 ? 320 LYS B NZ  1 
ATOM   1123 N N   . ILE B 2 12  ? 51.579 10.621  109.715 1.00 25.49 ? 321 ILE B N   1 
ATOM   1124 C CA  . ILE B 2 12  ? 52.927 10.044  109.598 1.00 22.87 ? 321 ILE B CA  1 
ATOM   1125 C C   . ILE B 2 12  ? 53.312 9.536   108.202 1.00 21.57 ? 321 ILE B C   1 
ATOM   1126 O O   . ILE B 2 12  ? 52.457 9.299   107.351 1.00 21.67 ? 321 ILE B O   1 
ATOM   1127 C CB  . ILE B 2 12  ? 53.140 8.860   110.580 1.00 21.82 ? 321 ILE B CB  1 
ATOM   1128 C CG1 . ILE B 2 12  ? 52.215 7.695   110.224 1.00 19.42 ? 321 ILE B CG1 1 
ATOM   1129 C CG2 . ILE B 2 12  ? 52.933 9.320   111.999 1.00 18.36 ? 321 ILE B CG2 1 
ATOM   1130 C CD1 . ILE B 2 12  ? 52.580 6.395   110.927 1.00 16.81 ? 321 ILE B CD1 1 
ATOM   1131 N N   . PRO B 2 13  ? 54.618 9.351   107.958 1.00 20.63 ? 322 PRO B N   1 
ATOM   1132 C CA  . PRO B 2 13  ? 55.067 8.867   106.648 1.00 20.06 ? 322 PRO B CA  1 
ATOM   1133 C C   . PRO B 2 13  ? 54.525 7.464   106.382 1.00 20.99 ? 322 PRO B C   1 
ATOM   1134 O O   . PRO B 2 13  ? 54.547 6.615   107.267 1.00 22.65 ? 322 PRO B O   1 
ATOM   1135 C CB  . PRO B 2 13  ? 56.590 8.894   106.776 1.00 18.20 ? 322 PRO B CB  1 
ATOM   1136 C CG  . PRO B 2 13  ? 56.827 10.002  107.776 1.00 17.58 ? 322 PRO B CG  1 
ATOM   1137 C CD  . PRO B 2 13  ? 55.768 9.720   108.802 1.00 18.00 ? 322 PRO B CD  1 
ATOM   1138 N N   . VAL B 2 14  ? 54.031 7.224   105.173 1.00 22.32 ? 323 VAL B N   1 
ATOM   1139 C CA  . VAL B 2 14  ? 53.490 5.913   104.825 1.00 22.59 ? 323 VAL B CA  1 
ATOM   1140 C C   . VAL B 2 14  ? 54.580 4.846   104.682 1.00 23.65 ? 323 VAL B C   1 
ATOM   1141 O O   . VAL B 2 14  ? 54.277 3.665   104.536 1.00 24.99 ? 323 VAL B O   1 
ATOM   1142 C CB  . VAL B 2 14  ? 52.656 5.968   103.505 1.00 22.81 ? 323 VAL B CB  1 
ATOM   1143 C CG1 . VAL B 2 14  ? 51.487 6.926   103.665 1.00 22.84 ? 323 VAL B CG1 1 
ATOM   1144 C CG2 . VAL B 2 14  ? 53.524 6.411   102.346 1.00 20.67 ? 323 VAL B CG2 1 
ATOM   1145 N N   . GLU B 2 15  ? 55.845 5.258   104.724 1.00 22.90 ? 324 GLU B N   1 
ATOM   1146 C CA  . GLU B 2 15  ? 56.954 4.315   104.606 1.00 22.00 ? 324 GLU B CA  1 
ATOM   1147 C C   . GLU B 2 15  ? 57.603 4.068   105.961 1.00 22.47 ? 324 GLU B C   1 
ATOM   1148 O O   . GLU B 2 15  ? 58.640 3.410   106.055 1.00 23.83 ? 324 GLU B O   1 
ATOM   1149 C CB  . GLU B 2 15  ? 58.003 4.848   103.626 1.00 23.14 ? 324 GLU B CB  1 
ATOM   1150 C CG  . GLU B 2 15  ? 57.534 4.897   102.179 1.00 23.26 ? 324 GLU B CG  1 
ATOM   1151 C CD  . GLU B 2 15  ? 57.501 3.528   101.521 1.00 25.23 ? 324 GLU B CD  1 
ATOM   1152 O OE1 . GLU B 2 15  ? 57.372 2.509   102.243 1.00 24.44 ? 324 GLU B OE1 1 
ATOM   1153 O OE2 . GLU B 2 15  ? 57.593 3.473   100.272 1.00 26.24 ? 324 GLU B OE2 1 
ATOM   1154 N N   . ALA B 2 16  ? 56.984 4.591   107.012 1.00 21.87 ? 325 ALA B N   1 
ATOM   1155 C CA  . ALA B 2 16  ? 57.512 4.440   108.362 1.00 20.70 ? 325 ALA B CA  1 
ATOM   1156 C C   . ALA B 2 16  ? 57.120 3.132   109.039 1.00 19.75 ? 325 ALA B C   1 
ATOM   1157 O O   . ALA B 2 16  ? 56.205 2.430   108.606 1.00 19.93 ? 325 ALA B O   1 
ATOM   1158 C CB  . ALA B 2 16  ? 57.060 5.620   109.225 1.00 20.78 ? 325 ALA B CB  1 
ATOM   1159 N N   . ASP B 2 17  ? 57.832 2.821   110.113 1.00 17.72 ? 326 ASP B N   1 
ATOM   1160 C CA  . ASP B 2 17  ? 57.585 1.627   110.906 1.00 17.54 ? 326 ASP B CA  1 
ATOM   1161 C C   . ASP B 2 17  ? 57.876 0.316   110.204 1.00 17.22 ? 326 ASP B C   1 
ATOM   1162 O O   . ASP B 2 17  ? 57.334 -0.729  110.555 1.00 18.09 ? 326 ASP B O   1 
ATOM   1163 C CB  . ASP B 2 17  ? 56.155 1.657   111.448 1.00 17.03 ? 326 ASP B CB  1 
ATOM   1164 C CG  . ASP B 2 17  ? 55.879 2.924   112.247 1.00 19.67 ? 326 ASP B CG  1 
ATOM   1165 O OD1 . ASP B 2 17  ? 56.668 3.243   113.168 1.00 15.69 ? 326 ASP B OD1 1 
ATOM   1166 O OD2 . ASP B 2 17  ? 54.883 3.613   111.941 1.00 22.86 ? 326 ASP B OD2 1 
ATOM   1167 N N   . PHE B 2 18  ? 58.761 0.389   109.220 1.00 17.05 ? 327 PHE B N   1 
ATOM   1168 C CA  . PHE B 2 18  ? 59.192 -0.769  108.467 1.00 16.46 ? 327 PHE B CA  1 
ATOM   1169 C C   . PHE B 2 18  ? 60.595 -1.088  108.945 1.00 16.28 ? 327 PHE B C   1 
ATOM   1170 O O   . PHE B 2 18  ? 61.301 -0.211  109.427 1.00 14.00 ? 327 PHE B O   1 
ATOM   1171 C CB  . PHE B 2 18  ? 59.271 -0.435  106.988 1.00 18.39 ? 327 PHE B CB  1 
ATOM   1172 C CG  . PHE B 2 18  ? 58.016 -0.704  106.237 1.00 20.80 ? 327 PHE B CG  1 
ATOM   1173 C CD1 . PHE B 2 18  ? 57.731 -1.990  105.781 1.00 20.83 ? 327 PHE B CD1 1 
ATOM   1174 C CD2 . PHE B 2 18  ? 57.127 0.328   105.953 1.00 20.30 ? 327 PHE B CD2 1 
ATOM   1175 C CE1 . PHE B 2 18  ? 56.579 -2.247  105.042 1.00 21.34 ? 327 PHE B CE1 1 
ATOM   1176 C CE2 . PHE B 2 18  ? 55.970 0.082   105.215 1.00 20.50 ? 327 PHE B CE2 1 
ATOM   1177 C CZ  . PHE B 2 18  ? 55.696 -1.208  104.758 1.00 21.76 ? 327 PHE B CZ  1 
ATOM   1178 N N   . LEU B 2 19  ? 60.994 -2.345  108.819 1.00 16.37 ? 328 LEU B N   1 
ATOM   1179 C CA  . LEU B 2 19  ? 62.345 -2.744  109.182 1.00 16.64 ? 328 LEU B CA  1 
ATOM   1180 C C   . LEU B 2 19  ? 62.727 -3.929  108.329 1.00 16.84 ? 328 LEU B C   1 
ATOM   1181 O O   . LEU B 2 19  ? 61.996 -4.915  108.253 1.00 15.53 ? 328 LEU B O   1 
ATOM   1182 C CB  . LEU B 2 19  ? 62.461 -3.120  110.658 1.00 17.11 ? 328 LEU B CB  1 
ATOM   1183 C CG  . LEU B 2 19  ? 63.895 -3.381  111.153 1.00 18.47 ? 328 LEU B CG  1 
ATOM   1184 C CD1 . LEU B 2 19  ? 63.864 -3.554  112.644 1.00 20.04 ? 328 LEU B CD1 1 
ATOM   1185 C CD2 . LEU B 2 19  ? 64.497 -4.617  110.518 1.00 17.00 ? 328 LEU B CD2 1 
ATOM   1186 N N   . TYR B 2 20  ? 63.879 -3.823  107.682 1.00 17.65 ? 329 TYR B N   1 
ATOM   1187 C CA  . TYR B 2 20  ? 64.357 -4.896  106.841 1.00 19.15 ? 329 TYR B CA  1 
ATOM   1188 C C   . TYR B 2 20  ? 65.651 -5.462  107.382 1.00 19.45 ? 329 TYR B C   1 
ATOM   1189 O O   . TYR B 2 20  ? 66.685 -4.801  107.366 1.00 21.90 ? 329 TYR B O   1 
ATOM   1190 C CB  . TYR B 2 20  ? 64.584 -4.406  105.417 1.00 19.15 ? 329 TYR B CB  1 
ATOM   1191 C CG  . TYR B 2 20  ? 63.428 -3.630  104.838 1.00 22.49 ? 329 TYR B CG  1 
ATOM   1192 C CD1 . TYR B 2 20  ? 63.245 -2.288  105.147 1.00 23.35 ? 329 TYR B CD1 1 
ATOM   1193 C CD2 . TYR B 2 20  ? 62.523 -4.232  103.965 1.00 24.96 ? 329 TYR B CD2 1 
ATOM   1194 C CE1 . TYR B 2 20  ? 62.197 -1.561  104.602 1.00 25.33 ? 329 TYR B CE1 1 
ATOM   1195 C CE2 . TYR B 2 20  ? 61.462 -3.508  103.410 1.00 25.82 ? 329 TYR B CE2 1 
ATOM   1196 C CZ  . TYR B 2 20  ? 61.311 -2.174  103.737 1.00 25.97 ? 329 TYR B CZ  1 
ATOM   1197 O OH  . TYR B 2 20  ? 60.273 -1.445  103.205 1.00 30.54 ? 329 TYR B OH  1 
ATOM   1198 N N   . ALA B 2 21  ? 65.577 -6.689  107.875 1.00 18.02 ? 330 ALA B N   1 
ATOM   1199 C CA  . ALA B 2 21  ? 66.739 -7.381  108.386 1.00 17.76 ? 330 ALA B CA  1 
ATOM   1200 C C   . ALA B 2 21  ? 67.279 -8.217  107.218 1.00 18.47 ? 330 ALA B C   1 
ATOM   1201 O O   . ALA B 2 21  ? 66.677 -9.219  106.826 1.00 19.95 ? 330 ALA B O   1 
ATOM   1202 C CB  . ALA B 2 21  ? 66.333 -8.278  109.553 1.00 17.52 ? 330 ALA B CB  1 
ATOM   1203 N N   . TYR B 2 22  ? 68.395 -7.787  106.641 1.00 17.95 ? 331 TYR B N   1 
ATOM   1204 C CA  . TYR B 2 22  ? 68.995 -8.501  105.520 1.00 17.58 ? 331 TYR B CA  1 
ATOM   1205 C C   . TYR B 2 22  ? 70.096 -9.434  105.990 1.00 18.08 ? 331 TYR B C   1 
ATOM   1206 O O   . TYR B 2 22  ? 70.891 -9.085  106.859 1.00 19.87 ? 331 TYR B O   1 
ATOM   1207 C CB  . TYR B 2 22  ? 69.589 -7.516  104.515 1.00 18.00 ? 331 TYR B CB  1 
ATOM   1208 C CG  . TYR B 2 22  ? 68.567 -6.795  103.685 1.00 17.69 ? 331 TYR B CG  1 
ATOM   1209 C CD1 . TYR B 2 22  ? 67.911 -7.437  102.633 1.00 17.51 ? 331 TYR B CD1 1 
ATOM   1210 C CD2 . TYR B 2 22  ? 68.251 -5.468  103.949 1.00 20.24 ? 331 TYR B CD2 1 
ATOM   1211 C CE1 . TYR B 2 22  ? 66.963 -6.769  101.864 1.00 16.95 ? 331 TYR B CE1 1 
ATOM   1212 C CE2 . TYR B 2 22  ? 67.303 -4.788  103.186 1.00 20.18 ? 331 TYR B CE2 1 
ATOM   1213 C CZ  . TYR B 2 22  ? 66.667 -5.445  102.149 1.00 18.45 ? 331 TYR B CZ  1 
ATOM   1214 O OH  . TYR B 2 22  ? 65.742 -4.762  101.407 1.00 20.84 ? 331 TYR B OH  1 
ATOM   1215 N N   . SER B 2 23  ? 70.145 -10.618 105.400 1.00 17.56 ? 332 SER B N   1 
ATOM   1216 C CA  . SER B 2 23  ? 71.155 -11.602 105.751 1.00 17.83 ? 332 SER B CA  1 
ATOM   1217 C C   . SER B 2 23  ? 72.537 -11.114 105.348 1.00 18.33 ? 332 SER B C   1 
ATOM   1218 O O   . SER B 2 23  ? 73.529 -11.470 105.975 1.00 17.94 ? 332 SER B O   1 
ATOM   1219 C CB  . SER B 2 23  ? 70.885 -12.919 105.026 1.00 16.49 ? 332 SER B CB  1 
ATOM   1220 O OG  . SER B 2 23  ? 71.131 -12.775 103.636 1.00 15.07 ? 332 SER B OG  1 
ATOM   1221 N N   . THR B 2 24  ? 72.595 -10.297 104.300 1.00 19.02 ? 333 THR B N   1 
ATOM   1222 C CA  . THR B 2 24  ? 73.875 -9.808  103.799 1.00 19.72 ? 333 THR B CA  1 
ATOM   1223 C C   . THR B 2 24  ? 73.829 -8.363  103.309 1.00 21.07 ? 333 THR B C   1 
ATOM   1224 O O   . THR B 2 24  ? 72.762 -7.750  103.212 1.00 22.39 ? 333 THR B O   1 
ATOM   1225 C CB  . THR B 2 24  ? 74.369 -10.695 102.628 1.00 17.79 ? 333 THR B CB  1 
ATOM   1226 O OG1 . THR B 2 24  ? 75.730 -10.374 102.308 1.00 14.35 ? 333 THR B OG1 1 
ATOM   1227 C CG2 . THR B 2 24  ? 73.493 -10.473 101.393 1.00 15.21 ? 333 THR B CG2 1 
ATOM   1228 N N   . ALA B 2 25  ? 75.008 -7.841  102.988 1.00 22.33 ? 334 ALA B N   1 
ATOM   1229 C CA  . ALA B 2 25  ? 75.167 -6.478  102.498 1.00 22.00 ? 334 ALA B CA  1 
ATOM   1230 C C   . ALA B 2 25  ? 74.705 -6.369  101.049 1.00 22.44 ? 334 ALA B C   1 
ATOM   1231 O O   . ALA B 2 25  ? 74.613 -7.367  100.336 1.00 24.09 ? 334 ALA B O   1 
ATOM   1232 C CB  . ALA B 2 25  ? 76.619 -6.066  102.613 1.00 21.39 ? 334 ALA B CB  1 
ATOM   1233 N N   . PRO B 2 26  ? 74.421 -5.146  100.592 1.00 21.55 ? 335 PRO B N   1 
ATOM   1234 C CA  . PRO B 2 26  ? 73.965 -4.931  99.217  1.00 21.34 ? 335 PRO B CA  1 
ATOM   1235 C C   . PRO B 2 26  ? 74.993 -5.365  98.171  1.00 21.66 ? 335 PRO B C   1 
ATOM   1236 O O   . PRO B 2 26  ? 76.172 -5.014  98.258  1.00 18.91 ? 335 PRO B O   1 
ATOM   1237 C CB  . PRO B 2 26  ? 73.714 -3.424  99.169  1.00 21.25 ? 335 PRO B CB  1 
ATOM   1238 C CG  . PRO B 2 26  ? 73.446 -3.059  100.606 1.00 20.47 ? 335 PRO B CG  1 
ATOM   1239 C CD  . PRO B 2 26  ? 74.457 -3.877  101.339 1.00 21.80 ? 335 PRO B CD  1 
ATOM   1240 N N   . GLY B 2 27  ? 74.530 -6.131  97.186  1.00 23.11 ? 336 GLY B N   1 
ATOM   1241 C CA  . GLY B 2 27  ? 75.395 -6.589  96.114  1.00 24.34 ? 336 GLY B CA  1 
ATOM   1242 C C   . GLY B 2 27  ? 76.211 -7.831  96.407  1.00 25.92 ? 336 GLY B C   1 
ATOM   1243 O O   . GLY B 2 27  ? 76.982 -8.278  95.562  1.00 27.78 ? 336 GLY B O   1 
ATOM   1244 N N   . TYR B 2 28  ? 76.039 -8.400  97.593  1.00 26.02 ? 337 TYR B N   1 
ATOM   1245 C CA  . TYR B 2 28  ? 76.793 -9.581  97.983  1.00 25.97 ? 337 TYR B CA  1 
ATOM   1246 C C   . TYR B 2 28  ? 75.990 -10.862 98.079  1.00 26.78 ? 337 TYR B C   1 
ATOM   1247 O O   . TYR B 2 28  ? 74.759 -10.850 98.171  1.00 26.59 ? 337 TYR B O   1 
ATOM   1248 C CB  . TYR B 2 28  ? 77.459 -9.358  99.341  1.00 25.26 ? 337 TYR B CB  1 
ATOM   1249 C CG  . TYR B 2 28  ? 78.668 -8.468  99.309  1.00 24.88 ? 337 TYR B CG  1 
ATOM   1250 C CD1 . TYR B 2 28  ? 78.542 -7.080  99.300  1.00 24.69 ? 337 TYR B CD1 1 
ATOM   1251 C CD2 . TYR B 2 28  ? 79.942 -9.015  99.285  1.00 24.46 ? 337 TYR B CD2 1 
ATOM   1252 C CE1 . TYR B 2 28  ? 79.661 -6.261  99.269  1.00 25.38 ? 337 TYR B CE1 1 
ATOM   1253 C CE2 . TYR B 2 28  ? 81.063 -8.211  99.250  1.00 27.13 ? 337 TYR B CE2 1 
ATOM   1254 C CZ  . TYR B 2 28  ? 80.922 -6.834  99.242  1.00 26.82 ? 337 TYR B CZ  1 
ATOM   1255 O OH  . TYR B 2 28  ? 82.050 -6.044  99.199  1.00 29.46 ? 337 TYR B OH  1 
ATOM   1256 N N   . TYR B 2 29  ? 76.723 -11.970 98.071  1.00 26.89 ? 338 TYR B N   1 
ATOM   1257 C CA  . TYR B 2 29  ? 76.148 -13.301 98.222  1.00 26.97 ? 338 TYR B CA  1 
ATOM   1258 C C   . TYR B 2 29  ? 75.792 -13.453 99.703  1.00 25.97 ? 338 TYR B C   1 
ATOM   1259 O O   . TYR B 2 29  ? 76.307 -12.731 100.562 1.00 26.07 ? 338 TYR B O   1 
ATOM   1260 C CB  . TYR B 2 29  ? 77.190 -14.380 97.905  1.00 27.89 ? 338 TYR B CB  1 
ATOM   1261 C CG  . TYR B 2 29  ? 77.398 -14.741 96.451  1.00 28.31 ? 338 TYR B CG  1 
ATOM   1262 C CD1 . TYR B 2 29  ? 76.376 -15.312 95.697  1.00 29.54 ? 338 TYR B CD1 1 
ATOM   1263 C CD2 . TYR B 2 29  ? 78.654 -14.609 95.861  1.00 29.04 ? 338 TYR B CD2 1 
ATOM   1264 C CE1 . TYR B 2 29  ? 76.605 -15.752 94.391  1.00 30.77 ? 338 TYR B CE1 1 
ATOM   1265 C CE2 . TYR B 2 29  ? 78.893 -15.045 94.563  1.00 30.58 ? 338 TYR B CE2 1 
ATOM   1266 C CZ  . TYR B 2 29  ? 77.867 -15.618 93.833  1.00 30.52 ? 338 TYR B CZ  1 
ATOM   1267 O OH  . TYR B 2 29  ? 78.115 -16.065 92.556  1.00 30.34 ? 338 TYR B OH  1 
ATOM   1268 N N   . SER B 2 30  ? 74.914 -14.397 99.999  1.00 25.44 ? 339 SER B N   1 
ATOM   1269 C CA  . SER B 2 30  ? 74.549 -14.687 101.373 1.00 24.53 ? 339 SER B CA  1 
ATOM   1270 C C   . SER B 2 30  ? 74.873 -16.172 101.474 1.00 25.36 ? 339 SER B C   1 
ATOM   1271 O O   . SER B 2 30  ? 74.644 -16.914 100.522 1.00 24.50 ? 339 SER B O   1 
ATOM   1272 C CB  . SER B 2 30  ? 73.061 -14.448 101.605 1.00 23.71 ? 339 SER B CB  1 
ATOM   1273 O OG  . SER B 2 30  ? 72.701 -14.812 102.921 1.00 22.57 ? 339 SER B OG  1 
ATOM   1274 N N   . TRP B 2 31  ? 75.421 -16.612 102.599 1.00 26.34 ? 340 TRP B N   1 
ATOM   1275 C CA  . TRP B 2 31  ? 75.773 -18.017 102.732 1.00 26.15 ? 340 TRP B CA  1 
ATOM   1276 C C   . TRP B 2 31  ? 74.829 -18.880 103.553 1.00 26.59 ? 340 TRP B C   1 
ATOM   1277 O O   . TRP B 2 31  ? 74.193 -18.429 104.511 1.00 26.09 ? 340 TRP B O   1 
ATOM   1278 C CB  . TRP B 2 31  ? 77.189 -18.141 103.268 1.00 26.56 ? 340 TRP B CB  1 
ATOM   1279 C CG  . TRP B 2 31  ? 78.159 -17.557 102.333 1.00 28.88 ? 340 TRP B CG  1 
ATOM   1280 C CD1 . TRP B 2 31  ? 78.520 -16.250 102.239 1.00 29.19 ? 340 TRP B CD1 1 
ATOM   1281 C CD2 . TRP B 2 31  ? 78.877 -18.250 101.306 1.00 31.50 ? 340 TRP B CD2 1 
ATOM   1282 N NE1 . TRP B 2 31  ? 79.424 -16.082 101.218 1.00 31.85 ? 340 TRP B NE1 1 
ATOM   1283 C CE2 . TRP B 2 31  ? 79.660 -17.293 100.629 1.00 31.74 ? 340 TRP B CE2 1 
ATOM   1284 C CE3 . TRP B 2 31  ? 78.933 -19.588 100.894 1.00 32.50 ? 340 TRP B CE3 1 
ATOM   1285 C CZ2 . TRP B 2 31  ? 80.493 -17.632 99.558  1.00 32.37 ? 340 TRP B CZ2 1 
ATOM   1286 C CZ3 . TRP B 2 31  ? 79.759 -19.925 99.831  1.00 31.89 ? 340 TRP B CZ3 1 
ATOM   1287 C CH2 . TRP B 2 31  ? 80.528 -18.950 99.176  1.00 33.02 ? 340 TRP B CH2 1 
ATOM   1288 N N   . ARG B 2 32  ? 74.765 -20.144 103.159 1.00 26.42 ? 341 ARG B N   1 
ATOM   1289 C CA  . ARG B 2 32  ? 73.900 -21.120 103.791 1.00 27.57 ? 341 ARG B CA  1 
ATOM   1290 C C   . ARG B 2 32  ? 74.615 -22.470 103.885 1.00 28.34 ? 341 ARG B C   1 
ATOM   1291 O O   . ARG B 2 32  ? 75.328 -22.865 102.959 1.00 28.28 ? 341 ARG B O   1 
ATOM   1292 C CB  . ARG B 2 32  ? 72.645 -21.270 102.940 1.00 27.23 ? 341 ARG B CB  1 
ATOM   1293 C CG  . ARG B 2 32  ? 71.642 -22.271 103.452 1.00 29.95 ? 341 ARG B CG  1 
ATOM   1294 C CD  . ARG B 2 32  ? 70.674 -22.622 102.356 1.00 31.31 ? 341 ARG B CD  1 
ATOM   1295 N NE  . ARG B 2 32  ? 71.354 -23.312 101.261 1.00 34.89 ? 341 ARG B NE  1 
ATOM   1296 C CZ  . ARG B 2 32  ? 71.325 -22.914 99.995  1.00 33.67 ? 341 ARG B CZ  1 
ATOM   1297 N NH1 . ARG B 2 32  ? 70.648 -21.833 99.667  1.00 32.78 ? 341 ARG B NH1 1 
ATOM   1298 N NH2 . ARG B 2 32  ? 71.975 -23.593 99.063  1.00 34.14 ? 341 ARG B NH2 1 
ATOM   1299 N N   . ASN B 2 33  ? 74.433 -23.170 105.002 1.00 28.25 ? 342 ASN B N   1 
ATOM   1300 C CA  . ASN B 2 33  ? 75.043 -24.485 105.181 1.00 28.43 ? 342 ASN B CA  1 
ATOM   1301 C C   . ASN B 2 33  ? 73.928 -25.516 105.006 1.00 28.14 ? 342 ASN B C   1 
ATOM   1302 O O   . ASN B 2 33  ? 72.875 -25.409 105.628 1.00 27.08 ? 342 ASN B O   1 
ATOM   1303 C CB  . ASN B 2 33  ? 75.679 -24.591 106.573 1.00 28.83 ? 342 ASN B CB  1 
ATOM   1304 C CG  . ASN B 2 33  ? 76.373 -25.921 106.798 1.00 30.08 ? 342 ASN B CG  1 
ATOM   1305 O OD1 . ASN B 2 33  ? 75.738 -26.907 107.182 1.00 31.32 ? 342 ASN B OD1 1 
ATOM   1306 N ND2 . ASN B 2 33  ? 77.681 -25.961 106.544 1.00 27.67 ? 342 ASN B ND2 1 
ATOM   1307 N N   . SER B 2 34  ? 74.151 -26.510 104.152 1.00 29.76 ? 343 SER B N   1 
ATOM   1308 C CA  . SER B 2 34  ? 73.124 -27.523 103.885 1.00 32.01 ? 343 SER B CA  1 
ATOM   1309 C C   . SER B 2 34  ? 72.720 -28.369 105.081 1.00 33.05 ? 343 SER B C   1 
ATOM   1310 O O   . SER B 2 34  ? 71.665 -28.998 105.075 1.00 33.29 ? 343 SER B O   1 
ATOM   1311 C CB  . SER B 2 34  ? 73.568 -28.450 102.752 1.00 31.87 ? 343 SER B CB  1 
ATOM   1312 O OG  . SER B 2 34  ? 74.721 -29.179 103.124 1.00 32.83 ? 343 SER B OG  1 
ATOM   1313 N N   . LYS B 2 35  ? 73.552 -28.381 106.113 1.00 35.07 ? 344 LYS B N   1 
ATOM   1314 C CA  . LYS B 2 35  ? 73.254 -29.182 107.288 1.00 36.30 ? 344 LYS B CA  1 
ATOM   1315 C C   . LYS B 2 35  ? 72.623 -28.377 108.427 1.00 36.03 ? 344 LYS B C   1 
ATOM   1316 O O   . LYS B 2 35  ? 71.670 -28.829 109.060 1.00 35.76 ? 344 LYS B O   1 
ATOM   1317 C CB  . LYS B 2 35  ? 74.534 -29.870 107.777 1.00 37.84 ? 344 LYS B CB  1 
ATOM   1318 C CG  . LYS B 2 35  ? 74.324 -30.843 108.923 1.00 41.40 ? 344 LYS B CG  1 
ATOM   1319 C CD  . LYS B 2 35  ? 75.646 -31.306 109.531 1.00 43.66 ? 344 LYS B CD  1 
ATOM   1320 C CE  . LYS B 2 35  ? 76.366 -30.168 110.250 1.00 44.57 ? 344 LYS B CE  1 
ATOM   1321 N NZ  . LYS B 2 35  ? 77.611 -30.623 110.940 1.00 45.23 ? 344 LYS B NZ  1 
ATOM   1322 N N   . ASP B 2 36  ? 73.139 -27.176 108.674 1.00 35.27 ? 345 ASP B N   1 
ATOM   1323 C CA  . ASP B 2 36  ? 72.630 -26.349 109.762 1.00 34.46 ? 345 ASP B CA  1 
ATOM   1324 C C   . ASP B 2 36  ? 71.663 -25.235 109.375 1.00 33.35 ? 345 ASP B C   1 
ATOM   1325 O O   . ASP B 2 36  ? 70.922 -24.732 110.221 1.00 33.06 ? 345 ASP B O   1 
ATOM   1326 C CB  . ASP B 2 36  ? 73.805 -25.747 110.529 1.00 35.82 ? 345 ASP B CB  1 
ATOM   1327 C CG  . ASP B 2 36  ? 74.799 -26.795 110.968 1.00 36.89 ? 345 ASP B CG  1 
ATOM   1328 O OD1 . ASP B 2 36  ? 74.361 -27.794 111.574 1.00 37.95 ? 345 ASP B OD1 1 
ATOM   1329 O OD2 . ASP B 2 36  ? 76.011 -26.628 110.705 1.00 37.35 ? 345 ASP B OD2 1 
ATOM   1330 N N   . GLY B 2 37  ? 71.663 -24.857 108.101 1.00 32.22 ? 346 GLY B N   1 
ATOM   1331 C CA  . GLY B 2 37  ? 70.800 -23.781 107.646 1.00 30.12 ? 346 GLY B CA  1 
ATOM   1332 C C   . GLY B 2 37  ? 71.666 -22.565 107.346 1.00 29.16 ? 346 GLY B C   1 
ATOM   1333 O O   . GLY B 2 37  ? 72.900 -22.641 107.422 1.00 27.58 ? 346 GLY B O   1 
ATOM   1334 N N   . SER B 2 38  ? 71.038 -21.445 107.005 1.00 26.57 ? 347 SER B N   1 
ATOM   1335 C CA  . SER B 2 38  ? 71.792 -20.235 106.700 1.00 25.12 ? 347 SER B CA  1 
ATOM   1336 C C   . SER B 2 38  ? 72.434 -19.664 107.966 1.00 23.53 ? 347 SER B C   1 
ATOM   1337 O O   . SER B 2 38  ? 71.918 -19.846 109.066 1.00 23.83 ? 347 SER B O   1 
ATOM   1338 C CB  . SER B 2 38  ? 70.877 -19.199 106.051 1.00 24.39 ? 347 SER B CB  1 
ATOM   1339 O OG  . SER B 2 38  ? 69.691 -19.042 106.805 1.00 26.92 ? 347 SER B OG  1 
ATOM   1340 N N   . TRP B 2 39  ? 73.566 -18.984 107.811 1.00 21.55 ? 348 TRP B N   1 
ATOM   1341 C CA  . TRP B 2 39  ? 74.261 -18.403 108.955 1.00 19.17 ? 348 TRP B CA  1 
ATOM   1342 C C   . TRP B 2 39  ? 73.375 -17.368 109.627 1.00 19.08 ? 348 TRP B C   1 
ATOM   1343 O O   . TRP B 2 39  ? 73.211 -17.357 110.850 1.00 18.00 ? 348 TRP B O   1 
ATOM   1344 C CB  . TRP B 2 39  ? 75.557 -17.726 108.514 1.00 18.50 ? 348 TRP B CB  1 
ATOM   1345 C CG  . TRP B 2 39  ? 76.477 -18.601 107.738 1.00 17.34 ? 348 TRP B CG  1 
ATOM   1346 C CD1 . TRP B 2 39  ? 76.376 -19.950 107.560 1.00 17.14 ? 348 TRP B CD1 1 
ATOM   1347 C CD2 . TRP B 2 39  ? 77.648 -18.186 107.030 1.00 16.18 ? 348 TRP B CD2 1 
ATOM   1348 N NE1 . TRP B 2 39  ? 77.412 -20.402 106.778 1.00 19.35 ? 348 TRP B NE1 1 
ATOM   1349 C CE2 . TRP B 2 39  ? 78.208 -19.341 106.440 1.00 17.23 ? 348 TRP B CE2 1 
ATOM   1350 C CE3 . TRP B 2 39  ? 78.278 -16.952 106.837 1.00 16.64 ? 348 TRP B CE3 1 
ATOM   1351 C CZ2 . TRP B 2 39  ? 79.371 -19.295 105.667 1.00 16.37 ? 348 TRP B CZ2 1 
ATOM   1352 C CZ3 . TRP B 2 39  ? 79.438 -16.904 106.066 1.00 16.81 ? 348 TRP B CZ3 1 
ATOM   1353 C CH2 . TRP B 2 39  ? 79.971 -18.069 105.491 1.00 17.00 ? 348 TRP B CH2 1 
ATOM   1354 N N   . PHE B 2 40  ? 72.813 -16.491 108.809 1.00 17.68 ? 349 PHE B N   1 
ATOM   1355 C CA  . PHE B 2 40  ? 71.949 -15.441 109.305 1.00 18.42 ? 349 PHE B CA  1 
ATOM   1356 C C   . PHE B 2 40  ? 70.790 -15.968 110.156 1.00 18.43 ? 349 PHE B C   1 
ATOM   1357 O O   . PHE B 2 40  ? 70.599 -15.520 111.287 1.00 18.18 ? 349 PHE B O   1 
ATOM   1358 C CB  . PHE B 2 40  ? 71.406 -14.629 108.133 1.00 19.13 ? 349 PHE B CB  1 
ATOM   1359 C CG  . PHE B 2 40  ? 70.540 -13.484 108.545 1.00 19.61 ? 349 PHE B CG  1 
ATOM   1360 C CD1 . PHE B 2 40  ? 71.017 -12.517 109.429 1.00 19.63 ? 349 PHE B CD1 1 
ATOM   1361 C CD2 . PHE B 2 40  ? 69.261 -13.348 108.027 1.00 20.19 ? 349 PHE B CD2 1 
ATOM   1362 C CE1 . PHE B 2 40  ? 70.236 -11.426 109.789 1.00 19.21 ? 349 PHE B CE1 1 
ATOM   1363 C CE2 . PHE B 2 40  ? 68.464 -12.257 108.376 1.00 21.73 ? 349 PHE B CE2 1 
ATOM   1364 C CZ  . PHE B 2 40  ? 68.954 -11.292 109.261 1.00 21.43 ? 349 PHE B CZ  1 
ATOM   1365 N N   . ILE B 2 41  ? 70.023 -16.919 109.628 1.00 16.50 ? 350 ILE B N   1 
ATOM   1366 C CA  . ILE B 2 41  ? 68.899 -17.443 110.389 1.00 15.58 ? 350 ILE B CA  1 
ATOM   1367 C C   . ILE B 2 41  ? 69.309 -18.165 111.672 1.00 15.74 ? 350 ILE B C   1 
ATOM   1368 O O   . ILE B 2 41  ? 68.648 -18.021 112.701 1.00 12.65 ? 350 ILE B O   1 
ATOM   1369 C CB  . ILE B 2 41  ? 68.022 -18.379 109.537 1.00 16.42 ? 350 ILE B CB  1 
ATOM   1370 C CG1 . ILE B 2 41  ? 67.452 -17.602 108.350 1.00 17.00 ? 350 ILE B CG1 1 
ATOM   1371 C CG2 . ILE B 2 41  ? 66.861 -18.922 110.374 1.00 15.37 ? 350 ILE B CG2 1 
ATOM   1372 C CD1 . ILE B 2 41  ? 66.655 -16.372 108.759 1.00 16.95 ? 350 ILE B CD1 1 
ATOM   1373 N N   . GLN B 2 42  ? 70.393 -18.935 111.616 1.00 17.00 ? 351 GLN B N   1 
ATOM   1374 C CA  . GLN B 2 42  ? 70.865 -19.654 112.802 1.00 18.39 ? 351 GLN B CA  1 
ATOM   1375 C C   . GLN B 2 42  ? 71.073 -18.651 113.914 1.00 18.78 ? 351 GLN B C   1 
ATOM   1376 O O   . GLN B 2 42  ? 70.497 -18.767 114.993 1.00 20.51 ? 351 GLN B O   1 
ATOM   1377 C CB  . GLN B 2 42  ? 72.204 -20.344 112.548 1.00 19.15 ? 351 GLN B CB  1 
ATOM   1378 C CG  . GLN B 2 42  ? 72.186 -21.557 111.642 1.00 20.72 ? 351 GLN B CG  1 
ATOM   1379 C CD  . GLN B 2 42  ? 73.601 -22.066 111.362 1.00 23.72 ? 351 GLN B CD  1 
ATOM   1380 O OE1 . GLN B 2 42  ? 74.368 -22.356 112.293 1.00 22.38 ? 351 GLN B OE1 1 
ATOM   1381 N NE2 . GLN B 2 42  ? 73.955 -22.172 110.077 1.00 22.66 ? 351 GLN B NE2 1 
ATOM   1382 N N   . SER B 2 43  ? 71.914 -17.665 113.621 1.00 19.25 ? 352 SER B N   1 
ATOM   1383 C CA  . SER B 2 43  ? 72.269 -16.604 114.556 1.00 18.40 ? 352 SER B CA  1 
ATOM   1384 C C   . SER B 2 43  ? 71.074 -15.800 115.048 1.00 17.39 ? 352 SER B C   1 
ATOM   1385 O O   . SER B 2 43  ? 70.965 -15.508 116.235 1.00 16.92 ? 352 SER B O   1 
ATOM   1386 C CB  . SER B 2 43  ? 73.289 -15.667 113.905 1.00 17.51 ? 352 SER B CB  1 
ATOM   1387 O OG  . SER B 2 43  ? 74.462 -16.379 113.549 1.00 20.42 ? 352 SER B OG  1 
ATOM   1388 N N   . LEU B 2 44  ? 70.182 -15.440 114.134 1.00 15.90 ? 353 LEU B N   1 
ATOM   1389 C CA  . LEU B 2 44  ? 69.005 -14.673 114.504 1.00 15.82 ? 353 LEU B CA  1 
ATOM   1390 C C   . LEU B 2 44  ? 68.150 -15.422 115.531 1.00 16.98 ? 353 LEU B C   1 
ATOM   1391 O O   . LEU B 2 44  ? 67.769 -14.863 116.565 1.00 17.27 ? 353 LEU B O   1 
ATOM   1392 C CB  . LEU B 2 44  ? 68.163 -14.365 113.266 1.00 13.84 ? 353 LEU B CB  1 
ATOM   1393 C CG  . LEU B 2 44  ? 66.855 -13.622 113.547 1.00 13.81 ? 353 LEU B CG  1 
ATOM   1394 C CD1 . LEU B 2 44  ? 67.159 -12.220 114.037 1.00 12.49 ? 353 LEU B CD1 1 
ATOM   1395 C CD2 . LEU B 2 44  ? 66.018 -13.560 112.279 1.00 14.26 ? 353 LEU B CD2 1 
ATOM   1396 N N   . CYS B 2 45  ? 67.861 -16.689 115.248 1.00 16.81 ? 354 CYS B N   1 
ATOM   1397 C CA  . CYS B 2 45  ? 67.044 -17.490 116.138 1.00 17.40 ? 354 CYS B CA  1 
ATOM   1398 C C   . CYS B 2 45  ? 67.730 -17.654 117.477 1.00 19.25 ? 354 CYS B C   1 
ATOM   1399 O O   . CYS B 2 45  ? 67.080 -17.572 118.531 1.00 18.39 ? 354 CYS B O   1 
ATOM   1400 C CB  . CYS B 2 45  ? 66.765 -18.859 115.521 1.00 18.76 ? 354 CYS B CB  1 
ATOM   1401 S SG  . CYS B 2 45  ? 65.675 -18.801 114.072 1.00 21.78 ? 354 CYS B SG  1 
ATOM   1402 N N   . ALA B 2 46  ? 69.044 -17.875 117.439 1.00 17.96 ? 355 ALA B N   1 
ATOM   1403 C CA  . ALA B 2 46  ? 69.817 -18.042 118.668 1.00 16.99 ? 355 ALA B CA  1 
ATOM   1404 C C   . ALA B 2 46  ? 69.807 -16.765 119.517 1.00 17.58 ? 355 ALA B C   1 
ATOM   1405 O O   . ALA B 2 46  ? 69.558 -16.812 120.723 1.00 19.13 ? 355 ALA B O   1 
ATOM   1406 C CB  . ALA B 2 46  ? 71.242 -18.443 118.338 1.00 12.60 ? 355 ALA B CB  1 
ATOM   1407 N N   . MET B 2 47  ? 70.055 -15.621 118.887 1.00 15.89 ? 356 MET B N   1 
ATOM   1408 C CA  . MET B 2 47  ? 70.074 -14.364 119.614 1.00 15.82 ? 356 MET B CA  1 
ATOM   1409 C C   . MET B 2 47  ? 68.708 -14.040 120.190 1.00 16.98 ? 356 MET B C   1 
ATOM   1410 O O   . MET B 2 47  ? 68.610 -13.495 121.287 1.00 15.92 ? 356 MET B O   1 
ATOM   1411 C CB  . MET B 2 47  ? 70.560 -13.226 118.711 1.00 15.55 ? 356 MET B CB  1 
ATOM   1412 C CG  . MET B 2 47  ? 72.041 -13.293 118.379 1.00 16.95 ? 356 MET B CG  1 
ATOM   1413 S SD  . MET B 2 47  ? 73.098 -13.263 119.856 1.00 19.27 ? 356 MET B SD  1 
ATOM   1414 C CE  . MET B 2 47  ? 73.168 -14.965 120.283 1.00 17.35 ? 356 MET B CE  1 
ATOM   1415 N N   . LEU B 2 48  ? 67.657 -14.376 119.447 1.00 18.46 ? 357 LEU B N   1 
ATOM   1416 C CA  . LEU B 2 48  ? 66.294 -14.137 119.908 1.00 20.01 ? 357 LEU B CA  1 
ATOM   1417 C C   . LEU B 2 48  ? 65.972 -15.045 121.078 1.00 21.77 ? 357 LEU B C   1 
ATOM   1418 O O   . LEU B 2 48  ? 65.286 -14.636 122.004 1.00 22.73 ? 357 LEU B O   1 
ATOM   1419 C CB  . LEU B 2 48  ? 65.272 -14.382 118.787 1.00 18.41 ? 357 LEU B CB  1 
ATOM   1420 C CG  . LEU B 2 48  ? 64.967 -13.204 117.860 1.00 16.76 ? 357 LEU B CG  1 
ATOM   1421 C CD1 . LEU B 2 48  ? 64.053 -13.645 116.741 1.00 13.48 ? 357 LEU B CD1 1 
ATOM   1422 C CD2 . LEU B 2 48  ? 64.333 -12.083 118.660 1.00 14.98 ? 357 LEU B CD2 1 
ATOM   1423 N N   . LYS B 2 49  ? 66.463 -16.279 121.035 1.00 23.88 ? 358 LYS B N   1 
ATOM   1424 C CA  . LYS B 2 49  ? 66.205 -17.207 122.123 1.00 27.90 ? 358 LYS B CA  1 
ATOM   1425 C C   . LYS B 2 49  ? 66.717 -16.663 123.442 1.00 28.49 ? 358 LYS B C   1 
ATOM   1426 O O   . LYS B 2 49  ? 65.959 -16.524 124.394 1.00 30.67 ? 358 LYS B O   1 
ATOM   1427 C CB  . LYS B 2 49  ? 66.850 -18.572 121.861 1.00 30.55 ? 358 LYS B CB  1 
ATOM   1428 C CG  . LYS B 2 49  ? 66.073 -19.449 120.890 1.00 35.00 ? 358 LYS B CG  1 
ATOM   1429 C CD  . LYS B 2 49  ? 66.795 -20.763 120.626 1.00 38.13 ? 358 LYS B CD  1 
ATOM   1430 C CE  . LYS B 2 49  ? 66.034 -21.614 119.613 1.00 40.28 ? 358 LYS B CE  1 
ATOM   1431 N NZ  . LYS B 2 49  ? 65.811 -20.884 118.326 1.00 42.69 ? 358 LYS B NZ  1 
ATOM   1432 N N   . GLN B 2 50  ? 67.996 -16.325 123.498 1.00 28.70 ? 359 GLN B N   1 
ATOM   1433 C CA  . GLN B 2 50  ? 68.557 -15.834 124.744 1.00 29.44 ? 359 GLN B CA  1 
ATOM   1434 C C   . GLN B 2 50  ? 68.402 -14.357 125.064 1.00 27.84 ? 359 GLN B C   1 
ATOM   1435 O O   . GLN B 2 50  ? 68.719 -13.955 126.176 1.00 29.02 ? 359 GLN B O   1 
ATOM   1436 C CB  . GLN B 2 50  ? 70.037 -16.207 124.828 1.00 31.66 ? 359 GLN B CB  1 
ATOM   1437 C CG  . GLN B 2 50  ? 70.871 -15.706 123.671 1.00 37.50 ? 359 GLN B CG  1 
ATOM   1438 C CD  . GLN B 2 50  ? 72.306 -16.207 123.736 1.00 40.49 ? 359 GLN B CD  1 
ATOM   1439 O OE1 . GLN B 2 50  ? 73.049 -15.875 124.665 1.00 42.35 ? 359 GLN B OE1 1 
ATOM   1440 N NE2 . GLN B 2 50  ? 72.702 -17.015 122.752 1.00 39.79 ? 359 GLN B NE2 1 
ATOM   1441 N N   . TYR B 2 51  ? 67.895 -13.550 124.134 1.00 26.23 ? 360 TYR B N   1 
ATOM   1442 C CA  . TYR B 2 51  ? 67.773 -12.115 124.396 1.00 24.90 ? 360 TYR B CA  1 
ATOM   1443 C C   . TYR B 2 51  ? 66.429 -11.422 124.205 1.00 24.94 ? 360 TYR B C   1 
ATOM   1444 O O   . TYR B 2 51  ? 66.271 -10.276 124.624 1.00 24.34 ? 360 TYR B O   1 
ATOM   1445 C CB  . TYR B 2 51  ? 68.812 -11.355 123.579 1.00 24.06 ? 360 TYR B CB  1 
ATOM   1446 C CG  . TYR B 2 51  ? 70.236 -11.621 123.991 1.00 24.90 ? 360 TYR B CG  1 
ATOM   1447 C CD1 . TYR B 2 51  ? 70.636 -11.473 125.319 1.00 24.62 ? 360 TYR B CD1 1 
ATOM   1448 C CD2 . TYR B 2 51  ? 71.198 -11.979 123.047 1.00 25.75 ? 360 TYR B CD2 1 
ATOM   1449 C CE1 . TYR B 2 51  ? 71.963 -11.669 125.700 1.00 25.10 ? 360 TYR B CE1 1 
ATOM   1450 C CE2 . TYR B 2 51  ? 72.530 -12.178 123.414 1.00 26.43 ? 360 TYR B CE2 1 
ATOM   1451 C CZ  . TYR B 2 51  ? 72.909 -12.021 124.743 1.00 25.93 ? 360 TYR B CZ  1 
ATOM   1452 O OH  . TYR B 2 51  ? 74.225 -12.215 125.110 1.00 24.43 ? 360 TYR B OH  1 
ATOM   1453 N N   . ALA B 2 52  ? 65.470 -12.085 123.568 1.00 26.70 ? 361 ALA B N   1 
ATOM   1454 C CA  . ALA B 2 52  ? 64.161 -11.473 123.338 1.00 28.40 ? 361 ALA B CA  1 
ATOM   1455 C C   . ALA B 2 52  ? 63.508 -10.972 124.625 1.00 30.58 ? 361 ALA B C   1 
ATOM   1456 O O   . ALA B 2 52  ? 62.663 -10.083 124.588 1.00 31.03 ? 361 ALA B O   1 
ATOM   1457 C CB  . ALA B 2 52  ? 63.231 -12.457 122.635 1.00 25.94 ? 361 ALA B CB  1 
ATOM   1458 N N   . ASP B 2 53  ? 63.905 -11.539 125.758 1.00 34.19 ? 362 ASP B N   1 
ATOM   1459 C CA  . ASP B 2 53  ? 63.346 -11.136 127.043 1.00 38.32 ? 362 ASP B CA  1 
ATOM   1460 C C   . ASP B 2 53  ? 64.018 -9.937  127.713 1.00 38.34 ? 362 ASP B C   1 
ATOM   1461 O O   . ASP B 2 53  ? 63.538 -9.470  128.746 1.00 37.97 ? 362 ASP B O   1 
ATOM   1462 C CB  . ASP B 2 53  ? 63.341 -12.318 128.021 1.00 42.31 ? 362 ASP B CB  1 
ATOM   1463 C CG  . ASP B 2 53  ? 62.138 -13.224 127.833 1.00 48.15 ? 362 ASP B CG  1 
ATOM   1464 O OD1 . ASP B 2 53  ? 60.994 -12.743 128.018 1.00 50.15 ? 362 ASP B OD1 1 
ATOM   1465 O OD2 . ASP B 2 53  ? 62.333 -14.417 127.501 1.00 51.67 ? 362 ASP B OD2 1 
ATOM   1466 N N   . LYS B 2 54  ? 65.121 -9.436  127.158 1.00 38.29 ? 363 LYS B N   1 
ATOM   1467 C CA  . LYS B 2 54  ? 65.758 -8.276  127.774 1.00 38.02 ? 363 LYS B CA  1 
ATOM   1468 C C   . LYS B 2 54  ? 66.360 -7.190  126.880 1.00 34.80 ? 363 LYS B C   1 
ATOM   1469 O O   . LYS B 2 54  ? 66.426 -6.035  127.297 1.00 35.97 ? 363 LYS B O   1 
ATOM   1470 C CB  . LYS B 2 54  ? 66.796 -8.711  128.823 1.00 41.20 ? 363 LYS B CB  1 
ATOM   1471 C CG  . LYS B 2 54  ? 67.984 -9.517  128.328 1.00 45.49 ? 363 LYS B CG  1 
ATOM   1472 C CD  . LYS B 2 54  ? 68.973 -9.737  129.491 1.00 49.30 ? 363 LYS B CD  1 
ATOM   1473 C CE  . LYS B 2 54  ? 70.095 -10.731 129.158 1.00 51.31 ? 363 LYS B CE  1 
ATOM   1474 N NZ  . LYS B 2 54  ? 69.611 -12.133 128.935 1.00 52.54 ? 363 LYS B NZ  1 
ATOM   1475 N N   . LEU B 2 55  ? 66.788 -7.526  125.666 1.00 30.48 ? 364 LEU B N   1 
ATOM   1476 C CA  . LEU B 2 55  ? 67.371 -6.515  124.786 1.00 26.21 ? 364 LEU B CA  1 
ATOM   1477 C C   . LEU B 2 55  ? 66.361 -5.901  123.826 1.00 24.68 ? 364 LEU B C   1 
ATOM   1478 O O   . LEU B 2 55  ? 65.368 -6.525  123.477 1.00 25.14 ? 364 LEU B O   1 
ATOM   1479 C CB  . LEU B 2 55  ? 68.539 -7.103  123.985 1.00 25.61 ? 364 LEU B CB  1 
ATOM   1480 C CG  . LEU B 2 55  ? 69.771 -7.577  124.764 1.00 25.05 ? 364 LEU B CG  1 
ATOM   1481 C CD1 . LEU B 2 55  ? 70.914 -7.854  123.804 1.00 23.96 ? 364 LEU B CD1 1 
ATOM   1482 C CD2 . LEU B 2 55  ? 70.190 -6.515  125.759 1.00 25.39 ? 364 LEU B CD2 1 
ATOM   1483 N N   . GLU B 2 56  ? 66.607 -4.663  123.412 1.00 22.98 ? 365 GLU B N   1 
ATOM   1484 C CA  . GLU B 2 56  ? 65.717 -3.998  122.469 1.00 20.11 ? 365 GLU B CA  1 
ATOM   1485 C C   . GLU B 2 56  ? 66.090 -4.613  121.127 1.00 20.76 ? 365 GLU B C   1 
ATOM   1486 O O   . GLU B 2 56  ? 67.246 -4.984  120.915 1.00 20.30 ? 365 GLU B O   1 
ATOM   1487 C CB  . GLU B 2 56  ? 65.959 -2.487  122.493 1.00 19.57 ? 365 GLU B CB  1 
ATOM   1488 C CG  . GLU B 2 56  ? 65.047 -1.657  121.611 1.00 16.56 ? 365 GLU B CG  1 
ATOM   1489 C CD  . GLU B 2 56  ? 65.498 -1.658  120.174 1.00 17.65 ? 365 GLU B CD  1 
ATOM   1490 O OE1 . GLU B 2 56  ? 66.714 -1.515  119.944 1.00 17.08 ? 365 GLU B OE1 1 
ATOM   1491 O OE2 . GLU B 2 56  ? 64.645 -1.793  119.275 1.00 19.36 ? 365 GLU B OE2 1 
ATOM   1492 N N   . PHE B 2 57  ? 65.121 -4.720  120.226 1.00 20.01 ? 366 PHE B N   1 
ATOM   1493 C CA  . PHE B 2 57  ? 65.363 -5.358  118.943 1.00 19.04 ? 366 PHE B CA  1 
ATOM   1494 C C   . PHE B 2 57  ? 66.595 -4.962  118.118 1.00 18.33 ? 366 PHE B C   1 
ATOM   1495 O O   . PHE B 2 57  ? 67.245 -5.830  117.546 1.00 17.82 ? 366 PHE B O   1 
ATOM   1496 C CB  . PHE B 2 57  ? 64.111 -5.270  118.081 1.00 19.58 ? 366 PHE B CB  1 
ATOM   1497 C CG  . PHE B 2 57  ? 64.119 -6.225  116.934 1.00 21.96 ? 366 PHE B CG  1 
ATOM   1498 C CD1 . PHE B 2 57  ? 64.453 -7.563  117.131 1.00 23.19 ? 366 PHE B CD1 1 
ATOM   1499 C CD2 . PHE B 2 57  ? 63.811 -5.794  115.656 1.00 23.93 ? 366 PHE B CD2 1 
ATOM   1500 C CE1 . PHE B 2 57  ? 64.482 -8.460  116.071 1.00 22.84 ? 366 PHE B CE1 1 
ATOM   1501 C CE2 . PHE B 2 57  ? 63.835 -6.681  114.583 1.00 26.50 ? 366 PHE B CE2 1 
ATOM   1502 C CZ  . PHE B 2 57  ? 64.173 -8.019  114.794 1.00 25.49 ? 366 PHE B CZ  1 
ATOM   1503 N N   . MET B 2 58  ? 66.914 -3.676  118.031 1.00 17.58 ? 367 MET B N   1 
ATOM   1504 C CA  . MET B 2 58  ? 68.090 -3.253  117.272 1.00 17.93 ? 367 MET B CA  1 
ATOM   1505 C C   . MET B 2 58  ? 69.351 -3.879  117.852 1.00 17.66 ? 367 MET B C   1 
ATOM   1506 O O   . MET B 2 58  ? 70.227 -4.354  117.129 1.00 17.31 ? 367 MET B O   1 
ATOM   1507 C CB  . MET B 2 58  ? 68.238 -1.737  117.318 1.00 20.74 ? 367 MET B CB  1 
ATOM   1508 C CG  . MET B 2 58  ? 67.253 -0.987  116.463 1.00 27.05 ? 367 MET B CG  1 
ATOM   1509 S SD  . MET B 2 58  ? 67.469 -1.334  114.702 1.00 33.73 ? 367 MET B SD  1 
ATOM   1510 C CE  . MET B 2 58  ? 65.952 -2.186  114.399 1.00 32.48 ? 367 MET B CE  1 
ATOM   1511 N N   . HIS B 2 59  ? 69.437 -3.858  119.176 1.00 16.77 ? 368 HIS B N   1 
ATOM   1512 C CA  . HIS B 2 59  ? 70.576 -4.415  119.873 1.00 15.62 ? 368 HIS B CA  1 
ATOM   1513 C C   . HIS B 2 59  ? 70.680 -5.910  119.662 1.00 15.53 ? 368 HIS B C   1 
ATOM   1514 O O   . HIS B 2 59  ? 71.774 -6.452  119.597 1.00 17.67 ? 368 HIS B O   1 
ATOM   1515 C CB  . HIS B 2 59  ? 70.473 -4.091  121.354 1.00 17.56 ? 368 HIS B CB  1 
ATOM   1516 C CG  . HIS B 2 59  ? 70.648 -2.635  121.658 1.00 21.05 ? 368 HIS B CG  1 
ATOM   1517 N ND1 . HIS B 2 59  ? 70.374 -2.095  122.897 1.00 23.34 ? 368 HIS B ND1 1 
ATOM   1518 C CD2 . HIS B 2 59  ? 71.095 -1.611  120.891 1.00 21.07 ? 368 HIS B CD2 1 
ATOM   1519 C CE1 . HIS B 2 59  ? 70.646 -0.801  122.879 1.00 24.69 ? 368 HIS B CE1 1 
ATOM   1520 N NE2 . HIS B 2 59  ? 71.086 -0.482  121.674 1.00 23.37 ? 368 HIS B NE2 1 
ATOM   1521 N N   . ILE B 2 60  ? 69.547 -6.585  119.540 1.00 14.74 ? 369 ILE B N   1 
ATOM   1522 C CA  . ILE B 2 60  ? 69.582 -8.020  119.310 1.00 14.05 ? 369 ILE B CA  1 
ATOM   1523 C C   . ILE B 2 60  ? 70.147 -8.236  117.916 1.00 15.65 ? 369 ILE B C   1 
ATOM   1524 O O   . ILE B 2 60  ? 70.978 -9.124  117.700 1.00 16.04 ? 369 ILE B O   1 
ATOM   1525 C CB  . ILE B 2 60  ? 68.175 -8.651  119.370 1.00 13.77 ? 369 ILE B CB  1 
ATOM   1526 C CG1 . ILE B 2 60  ? 67.666 -8.671  120.818 1.00 14.44 ? 369 ILE B CG1 1 
ATOM   1527 C CG2 . ILE B 2 60  ? 68.214 -10.057 118.782 1.00 11.88 ? 369 ILE B CG2 1 
ATOM   1528 C CD1 . ILE B 2 60  ? 66.215 -9.107  120.959 1.00 11.68 ? 369 ILE B CD1 1 
ATOM   1529 N N   . LEU B 2 61  ? 69.701 -7.410  116.972 1.00 15.40 ? 370 LEU B N   1 
ATOM   1530 C CA  . LEU B 2 61  ? 70.161 -7.531  115.599 1.00 16.09 ? 370 LEU B CA  1 
ATOM   1531 C C   . LEU B 2 61  ? 71.643 -7.205  115.469 1.00 17.43 ? 370 LEU B C   1 
ATOM   1532 O O   . LEU B 2 61  ? 72.333 -7.762  114.613 1.00 17.82 ? 370 LEU B O   1 
ATOM   1533 C CB  . LEU B 2 61  ? 69.317 -6.654  114.676 1.00 14.18 ? 370 LEU B CB  1 
ATOM   1534 C CG  . LEU B 2 61  ? 67.906 -7.206  114.411 1.00 14.15 ? 370 LEU B CG  1 
ATOM   1535 C CD1 . LEU B 2 61  ? 67.110 -6.232  113.558 1.00 13.73 ? 370 LEU B CD1 1 
ATOM   1536 C CD2 . LEU B 2 61  ? 68.006 -8.545  113.699 1.00 12.45 ? 370 LEU B CD2 1 
ATOM   1537 N N   . THR B 2 62  ? 72.139 -6.324  116.330 1.00 17.49 ? 371 THR B N   1 
ATOM   1538 C CA  . THR B 2 62  ? 73.552 -5.968  116.317 1.00 17.95 ? 371 THR B CA  1 
ATOM   1539 C C   . THR B 2 62  ? 74.350 -7.194  116.772 1.00 20.50 ? 371 THR B C   1 
ATOM   1540 O O   . THR B 2 62  ? 75.442 -7.457  116.260 1.00 20.03 ? 371 THR B O   1 
ATOM   1541 C CB  . THR B 2 62  ? 73.819 -4.767  117.258 1.00 19.14 ? 371 THR B CB  1 
ATOM   1542 O OG1 . THR B 2 62  ? 73.053 -3.645  116.806 1.00 18.78 ? 371 THR B OG1 1 
ATOM   1543 C CG2 . THR B 2 62  ? 75.298 -4.391  117.284 1.00 17.02 ? 371 THR B CG2 1 
ATOM   1544 N N   . ARG B 2 63  ? 73.799 -7.944  117.731 1.00 22.34 ? 372 ARG B N   1 
ATOM   1545 C CA  . ARG B 2 63  ? 74.455 -9.159  118.229 1.00 23.66 ? 372 ARG B CA  1 
ATOM   1546 C C   . ARG B 2 63  ? 74.532 -10.163 117.093 1.00 23.18 ? 372 ARG B C   1 
ATOM   1547 O O   . ARG B 2 63  ? 75.511 -10.908 116.974 1.00 22.86 ? 372 ARG B O   1 
ATOM   1548 C CB  . ARG B 2 63  ? 73.671 -9.800  119.377 1.00 26.80 ? 372 ARG B CB  1 
ATOM   1549 C CG  . ARG B 2 63  ? 73.583 -8.981  120.651 1.00 32.47 ? 372 ARG B CG  1 
ATOM   1550 C CD  . ARG B 2 63  ? 74.941 -8.689  121.226 1.00 35.78 ? 372 ARG B CD  1 
ATOM   1551 N NE  . ARG B 2 63  ? 74.843 -7.819  122.395 1.00 42.22 ? 372 ARG B NE  1 
ATOM   1552 C CZ  . ARG B 2 63  ? 74.634 -8.240  123.639 1.00 42.77 ? 372 ARG B CZ  1 
ATOM   1553 N NH1 . ARG B 2 63  ? 74.500 -9.536  123.894 1.00 43.52 ? 372 ARG B NH1 1 
ATOM   1554 N NH2 . ARG B 2 63  ? 74.571 -7.360  124.632 1.00 41.77 ? 372 ARG B NH2 1 
ATOM   1555 N N   . VAL B 2 64  ? 73.488 -10.189 116.265 1.00 21.44 ? 373 VAL B N   1 
ATOM   1556 C CA  . VAL B 2 64  ? 73.453 -11.108 115.132 1.00 19.56 ? 373 VAL B CA  1 
ATOM   1557 C C   . VAL B 2 64  ? 74.571 -10.746 114.163 1.00 20.81 ? 373 VAL B C   1 
ATOM   1558 O O   . VAL B 2 64  ? 75.262 -11.629 113.643 1.00 21.86 ? 373 VAL B O   1 
ATOM   1559 C CB  . VAL B 2 64  ? 72.092 -11.056 114.389 1.00 17.62 ? 373 VAL B CB  1 
ATOM   1560 C CG1 . VAL B 2 64  ? 72.135 -11.927 113.138 1.00 10.39 ? 373 VAL B CG1 1 
ATOM   1561 C CG2 . VAL B 2 64  ? 70.978 -11.512 115.315 1.00 15.12 ? 373 VAL B CG2 1 
ATOM   1562 N N   . ASN B 2 65  ? 74.764 -9.448  113.946 1.00 19.30 ? 374 ASN B N   1 
ATOM   1563 C CA  . ASN B 2 65  ? 75.800 -8.983  113.039 1.00 21.20 ? 374 ASN B CA  1 
ATOM   1564 C C   . ASN B 2 65  ? 77.171 -9.467  113.482 1.00 23.30 ? 374 ASN B C   1 
ATOM   1565 O O   . ASN B 2 65  ? 77.948 -9.980  112.674 1.00 23.51 ? 374 ASN B O   1 
ATOM   1566 C CB  . ASN B 2 65  ? 75.794 -7.454  112.950 1.00 22.78 ? 374 ASN B CB  1 
ATOM   1567 C CG  . ASN B 2 65  ? 74.649 -6.916  112.093 1.00 22.74 ? 374 ASN B CG  1 
ATOM   1568 O OD1 . ASN B 2 65  ? 73.879 -7.678  111.509 1.00 21.94 ? 374 ASN B OD1 1 
ATOM   1569 N ND2 . ASN B 2 65  ? 74.547 -5.593  112.005 1.00 21.43 ? 374 ASN B ND2 1 
ATOM   1570 N N   . ARG B 2 66  ? 77.473 -9.312  114.768 1.00 24.58 ? 375 ARG B N   1 
ATOM   1571 C CA  . ARG B 2 66  ? 78.768 -9.747  115.276 1.00 23.74 ? 375 ARG B CA  1 
ATOM   1572 C C   . ARG B 2 66  ? 78.934 -11.256 115.130 1.00 22.40 ? 375 ARG B C   1 
ATOM   1573 O O   . ARG B 2 66  ? 79.973 -11.734 114.687 1.00 22.53 ? 375 ARG B O   1 
ATOM   1574 C CB  . ARG B 2 66  ? 78.945 -9.341  116.747 1.00 24.47 ? 375 ARG B CB  1 
ATOM   1575 C CG  . ARG B 2 66  ? 80.356 -9.615  117.254 1.00 27.36 ? 375 ARG B CG  1 
ATOM   1576 C CD  . ARG B 2 66  ? 80.763 -8.761  118.448 1.00 30.98 ? 375 ARG B CD  1 
ATOM   1577 N NE  . ARG B 2 66  ? 80.134 -9.188  119.691 1.00 37.00 ? 375 ARG B NE  1 
ATOM   1578 C CZ  . ARG B 2 66  ? 79.130 -8.548  120.289 1.00 39.63 ? 375 ARG B CZ  1 
ATOM   1579 N NH1 . ARG B 2 66  ? 78.627 -7.430  119.763 1.00 39.16 ? 375 ARG B NH1 1 
ATOM   1580 N NH2 . ARG B 2 66  ? 78.622 -9.032  121.418 1.00 39.11 ? 375 ARG B NH2 1 
ATOM   1581 N N   . LYS B 2 67  ? 77.901 -12.005 115.493 1.00 20.63 ? 376 LYS B N   1 
ATOM   1582 C CA  . LYS B 2 67  ? 77.970 -13.451 115.413 1.00 20.86 ? 376 LYS B CA  1 
ATOM   1583 C C   . LYS B 2 67  ? 78.237 -13.909 113.988 1.00 21.14 ? 376 LYS B C   1 
ATOM   1584 O O   . LYS B 2 67  ? 79.163 -14.679 113.738 1.00 23.95 ? 376 LYS B O   1 
ATOM   1585 C CB  . LYS B 2 67  ? 76.670 -14.065 115.937 1.00 22.04 ? 376 LYS B CB  1 
ATOM   1586 C CG  . LYS B 2 67  ? 76.674 -15.580 116.040 1.00 22.47 ? 376 LYS B CG  1 
ATOM   1587 C CD  . LYS B 2 67  ? 75.385 -16.060 116.700 1.00 26.71 ? 376 LYS B CD  1 
ATOM   1588 C CE  . LYS B 2 67  ? 75.317 -17.581 116.795 1.00 27.01 ? 376 LYS B CE  1 
ATOM   1589 N NZ  . LYS B 2 67  ? 76.386 -18.150 117.660 1.00 27.31 ? 376 LYS B NZ  1 
ATOM   1590 N N   . VAL B 2 68  ? 77.437 -13.430 113.047 1.00 19.22 ? 377 VAL B N   1 
ATOM   1591 C CA  . VAL B 2 68  ? 77.615 -13.819 111.660 1.00 18.08 ? 377 VAL B CA  1 
ATOM   1592 C C   . VAL B 2 68  ? 78.969 -13.401 111.104 1.00 20.02 ? 377 VAL B C   1 
ATOM   1593 O O   . VAL B 2 68  ? 79.599 -14.148 110.345 1.00 19.75 ? 377 VAL B O   1 
ATOM   1594 C CB  . VAL B 2 68  ? 76.520 -13.212 110.775 1.00 16.96 ? 377 VAL B CB  1 
ATOM   1595 C CG1 . VAL B 2 68  ? 76.836 -13.466 109.314 1.00 16.56 ? 377 VAL B CG1 1 
ATOM   1596 C CG2 . VAL B 2 68  ? 75.168 -13.807 111.141 1.00 15.63 ? 377 VAL B CG2 1 
ATOM   1597 N N   . ALA B 2 69  ? 79.415 -12.208 111.489 1.00 20.48 ? 378 ALA B N   1 
ATOM   1598 C CA  . ALA B 2 69  ? 80.689 -11.667 111.016 1.00 20.15 ? 378 ALA B CA  1 
ATOM   1599 C C   . ALA B 2 69  ? 81.922 -12.280 111.677 1.00 19.85 ? 378 ALA B C   1 
ATOM   1600 O O   . ALA B 2 69  ? 83.007 -12.292 111.100 1.00 18.48 ? 378 ALA B O   1 
ATOM   1601 C CB  . ALA B 2 69  ? 80.705 -10.148 111.214 1.00 19.65 ? 378 ALA B CB  1 
ATOM   1602 N N   . THR B 2 70  ? 81.753 -12.799 112.883 1.00 19.15 ? 379 THR B N   1 
ATOM   1603 C CA  . THR B 2 70  ? 82.874 -13.357 113.614 1.00 21.35 ? 379 THR B CA  1 
ATOM   1604 C C   . THR B 2 70  ? 83.015 -14.872 113.595 1.00 22.32 ? 379 THR B C   1 
ATOM   1605 O O   . THR B 2 70  ? 84.102 -15.387 113.367 1.00 23.07 ? 379 THR B O   1 
ATOM   1606 C CB  . THR B 2 70  ? 82.833 -12.892 115.085 1.00 21.31 ? 379 THR B CB  1 
ATOM   1607 O OG1 . THR B 2 70  ? 82.938 -11.468 115.132 1.00 21.55 ? 379 THR B OG1 1 
ATOM   1608 C CG2 . THR B 2 70  ? 83.983 -13.482 115.866 1.00 25.14 ? 379 THR B CG2 1 
ATOM   1609 N N   . GLU B 2 71  A 81.918 -15.581 113.822 1.00 23.73 ? 379 GLU B N   1 
ATOM   1610 C CA  . GLU B 2 71  A 81.949 -17.036 113.886 1.00 25.99 ? 379 GLU B CA  1 
ATOM   1611 C C   . GLU B 2 71  A 81.733 -17.850 112.609 1.00 26.60 ? 379 GLU B C   1 
ATOM   1612 O O   . GLU B 2 71  A 81.795 -19.087 112.649 1.00 26.60 ? 379 GLU B O   1 
ATOM   1613 C CB  . GLU B 2 71  A 80.950 -17.498 114.939 1.00 28.18 ? 379 GLU B CB  1 
ATOM   1614 C CG  . GLU B 2 71  A 81.326 -17.087 116.346 1.00 30.41 ? 379 GLU B CG  1 
ATOM   1615 C CD  . GLU B 2 71  A 80.117 -16.960 117.243 1.00 33.66 ? 379 GLU B CD  1 
ATOM   1616 O OE1 . GLU B 2 71  A 79.177 -17.782 117.102 1.00 32.29 ? 379 GLU B OE1 1 
ATOM   1617 O OE2 . GLU B 2 71  A 80.112 -16.037 118.091 1.00 35.22 ? 379 GLU B OE2 1 
ATOM   1618 N N   . PHE B 2 72  ? 81.468 -17.193 111.486 1.00 25.50 ? 380 PHE B N   1 
ATOM   1619 C CA  . PHE B 2 72  ? 81.262 -17.944 110.256 1.00 24.43 ? 380 PHE B CA  1 
ATOM   1620 C C   . PHE B 2 72  ? 82.270 -17.620 109.167 1.00 25.38 ? 380 PHE B C   1 
ATOM   1621 O O   . PHE B 2 72  ? 82.785 -16.502 109.077 1.00 23.95 ? 380 PHE B O   1 
ATOM   1622 C CB  . PHE B 2 72  ? 79.852 -17.735 109.717 1.00 22.48 ? 380 PHE B CB  1 
ATOM   1623 C CG  . PHE B 2 72  ? 78.776 -18.271 110.610 1.00 22.17 ? 380 PHE B CG  1 
ATOM   1624 C CD1 . PHE B 2 72  ? 78.377 -17.563 111.737 1.00 21.63 ? 380 PHE B CD1 1 
ATOM   1625 C CD2 . PHE B 2 72  ? 78.144 -19.479 110.317 1.00 22.83 ? 380 PHE B CD2 1 
ATOM   1626 C CE1 . PHE B 2 72  ? 77.358 -18.047 112.563 1.00 23.34 ? 380 PHE B CE1 1 
ATOM   1627 C CE2 . PHE B 2 72  ? 77.119 -19.976 111.138 1.00 21.69 ? 380 PHE B CE2 1 
ATOM   1628 C CZ  . PHE B 2 72  ? 76.726 -19.259 112.261 1.00 21.78 ? 380 PHE B CZ  1 
ATOM   1629 N N   . GLU B 2 73  ? 82.548 -18.630 108.350 1.00 25.90 ? 381 GLU B N   1 
ATOM   1630 C CA  . GLU B 2 73  ? 83.491 -18.526 107.248 1.00 26.48 ? 381 GLU B CA  1 
ATOM   1631 C C   . GLU B 2 73  ? 83.235 -19.736 106.357 1.00 25.02 ? 381 GLU B C   1 
ATOM   1632 O O   . GLU B 2 73  ? 83.281 -20.872 106.809 1.00 25.15 ? 381 GLU B O   1 
ATOM   1633 C CB  . GLU B 2 73  ? 84.918 -18.530 107.792 1.00 27.40 ? 381 GLU B CB  1 
ATOM   1634 C CG  . GLU B 2 73  ? 85.995 -18.413 106.740 1.00 32.46 ? 381 GLU B CG  1 
ATOM   1635 C CD  . GLU B 2 73  ? 87.356 -18.111 107.345 1.00 36.51 ? 381 GLU B CD  1 
ATOM   1636 O OE1 . GLU B 2 73  ? 88.378 -18.484 106.735 1.00 39.26 ? 381 GLU B OE1 1 
ATOM   1637 O OE2 . GLU B 2 73  ? 87.408 -17.486 108.428 1.00 39.55 ? 381 GLU B OE2 1 
ATOM   1638 N N   . SER B 2 74  A 82.945 -19.491 105.089 1.00 25.63 ? 381 SER B N   1 
ATOM   1639 C CA  . SER B 2 74  A 82.644 -20.581 104.171 1.00 25.57 ? 381 SER B CA  1 
ATOM   1640 C C   . SER B 2 74  A 83.777 -21.573 103.978 1.00 25.62 ? 381 SER B C   1 
ATOM   1641 O O   . SER B 2 74  A 84.958 -21.236 104.080 1.00 26.48 ? 381 SER B O   1 
ATOM   1642 C CB  . SER B 2 74  A 82.236 -20.037 102.797 1.00 25.05 ? 381 SER B CB  1 
ATOM   1643 O OG  . SER B 2 74  A 83.355 -19.533 102.082 1.00 23.86 ? 381 SER B OG  1 
ATOM   1644 N N   . PHE B 2 75  B 83.387 -22.810 103.706 1.00 25.24 ? 381 PHE B N   1 
ATOM   1645 C CA  . PHE B 2 75  B 84.327 -23.882 103.437 1.00 24.33 ? 381 PHE B CA  1 
ATOM   1646 C C   . PHE B 2 75  B 83.826 -24.452 102.122 1.00 23.73 ? 381 PHE B C   1 
ATOM   1647 O O   . PHE B 2 75  B 82.650 -24.816 101.990 1.00 20.72 ? 381 PHE B O   1 
ATOM   1648 C CB  . PHE B 2 75  B 84.290 -24.959 104.523 1.00 24.17 ? 381 PHE B CB  1 
ATOM   1649 C CG  . PHE B 2 75  B 85.268 -26.069 104.294 1.00 23.40 ? 381 PHE B CG  1 
ATOM   1650 C CD1 . PHE B 2 75  B 86.593 -25.938 104.685 1.00 24.20 ? 381 PHE B CD1 1 
ATOM   1651 C CD2 . PHE B 2 75  B 84.874 -27.238 103.645 1.00 25.18 ? 381 PHE B CD2 1 
ATOM   1652 C CE1 . PHE B 2 75  B 87.519 -26.963 104.432 1.00 24.69 ? 381 PHE B CE1 1 
ATOM   1653 C CE2 . PHE B 2 75  B 85.791 -28.266 103.388 1.00 24.34 ? 381 PHE B CE2 1 
ATOM   1654 C CZ  . PHE B 2 75  B 87.113 -28.126 103.782 1.00 23.66 ? 381 PHE B CZ  1 
ATOM   1655 N N   . SER B 2 76  C 84.722 -24.513 101.149 1.00 24.32 ? 381 SER B N   1 
ATOM   1656 C CA  . SER B 2 76  C 84.370 -25.001 99.834  1.00 24.54 ? 381 SER B CA  1 
ATOM   1657 C C   . SER B 2 76  C 85.579 -25.656 99.204  1.00 24.62 ? 381 SER B C   1 
ATOM   1658 O O   . SER B 2 76  C 86.708 -25.199 99.392  1.00 23.81 ? 381 SER B O   1 
ATOM   1659 C CB  . SER B 2 76  C 83.908 -23.825 98.963  1.00 23.90 ? 381 SER B CB  1 
ATOM   1660 O OG  . SER B 2 76  C 83.573 -24.244 97.652  1.00 26.20 ? 381 SER B OG  1 
ATOM   1661 N N   . PHE B 2 77  D 85.341 -26.735 98.465  1.00 26.17 ? 381 PHE B N   1 
ATOM   1662 C CA  . PHE B 2 77  D 86.421 -27.427 97.776  1.00 27.44 ? 381 PHE B CA  1 
ATOM   1663 C C   . PHE B 2 77  D 86.835 -26.514 96.630  1.00 27.92 ? 381 PHE B C   1 
ATOM   1664 O O   . PHE B 2 77  D 87.966 -26.554 96.157  1.00 28.80 ? 381 PHE B O   1 
ATOM   1665 C CB  . PHE B 2 77  D 85.941 -28.778 97.237  1.00 26.72 ? 381 PHE B CB  1 
ATOM   1666 C CG  . PHE B 2 77  D 85.489 -29.733 98.306  1.00 26.53 ? 381 PHE B CG  1 
ATOM   1667 C CD1 . PHE B 2 77  D 86.265 -29.942 99.446  1.00 26.63 ? 381 PHE B CD1 1 
ATOM   1668 C CD2 . PHE B 2 77  D 84.297 -30.439 98.170  1.00 27.73 ? 381 PHE B CD2 1 
ATOM   1669 C CE1 . PHE B 2 77  D 85.863 -30.842 100.440 1.00 27.00 ? 381 PHE B CE1 1 
ATOM   1670 C CE2 . PHE B 2 77  D 83.883 -31.347 99.163  1.00 29.25 ? 381 PHE B CE2 1 
ATOM   1671 C CZ  . PHE B 2 77  D 84.672 -31.545 100.299 1.00 27.30 ? 381 PHE B CZ  1 
ATOM   1672 N N   . ASP B 2 78  E 85.892 -25.684 96.200  1.00 29.13 ? 381 ASP B N   1 
ATOM   1673 C CA  . ASP B 2 78  E 86.107 -24.716 95.134  1.00 30.39 ? 381 ASP B CA  1 
ATOM   1674 C C   . ASP B 2 78  E 86.802 -23.509 95.776  1.00 30.32 ? 381 ASP B C   1 
ATOM   1675 O O   . ASP B 2 78  E 86.203 -22.795 96.582  1.00 30.78 ? 381 ASP B O   1 
ATOM   1676 C CB  . ASP B 2 78  E 84.758 -24.292 94.556  1.00 32.49 ? 381 ASP B CB  1 
ATOM   1677 C CG  . ASP B 2 78  E 84.896 -23.502 93.276  1.00 36.92 ? 381 ASP B CG  1 
ATOM   1678 O OD1 . ASP B 2 78  E 85.912 -22.782 93.117  1.00 36.46 ? 381 ASP B OD1 1 
ATOM   1679 O OD2 . ASP B 2 78  E 83.976 -23.600 92.430  1.00 40.03 ? 381 ASP B OD2 1 
ATOM   1680 N N   . ALA B 2 79  F 88.060 -23.286 95.411  1.00 30.44 ? 381 ALA B N   1 
ATOM   1681 C CA  . ALA B 2 79  F 88.862 -22.197 95.965  1.00 30.39 ? 381 ALA B CA  1 
ATOM   1682 C C   . ALA B 2 79  F 88.247 -20.810 95.867  1.00 31.28 ? 381 ALA B C   1 
ATOM   1683 O O   . ALA B 2 79  F 88.505 -19.946 96.707  1.00 31.51 ? 381 ALA B O   1 
ATOM   1684 C CB  . ALA B 2 79  F 90.233 -22.185 95.309  1.00 29.52 ? 381 ALA B CB  1 
ATOM   1685 N N   . THR B 2 80  G 87.434 -20.585 94.846  1.00 32.19 ? 381 THR B N   1 
ATOM   1686 C CA  . THR B 2 80  G 86.839 -19.272 94.677  1.00 34.29 ? 381 THR B CA  1 
ATOM   1687 C C   . THR B 2 80  G 85.703 -18.955 95.657  1.00 33.22 ? 381 THR B C   1 
ATOM   1688 O O   . THR B 2 80  G 85.409 -17.790 95.916  1.00 35.00 ? 381 THR B O   1 
ATOM   1689 C CB  . THR B 2 80  G 86.360 -19.077 93.227  1.00 35.70 ? 381 THR B CB  1 
ATOM   1690 O OG1 . THR B 2 80  G 85.817 -17.761 93.081  1.00 39.86 ? 381 THR B OG1 1 
ATOM   1691 C CG2 . THR B 2 80  G 85.307 -20.101 92.871  1.00 37.09 ? 381 THR B CG2 1 
ATOM   1692 N N   . PHE B 2 81  H 85.068 -19.979 96.212  1.00 31.77 ? 381 PHE B N   1 
ATOM   1693 C CA  . PHE B 2 81  H 83.983 -19.757 97.166  1.00 30.88 ? 381 PHE B CA  1 
ATOM   1694 C C   . PHE B 2 81  H 84.402 -20.161 98.569  1.00 29.83 ? 381 PHE B C   1 
ATOM   1695 O O   . PHE B 2 81  H 83.568 -20.303 99.461  1.00 30.10 ? 381 PHE B O   1 
ATOM   1696 C CB  . PHE B 2 81  H 82.756 -20.563 96.761  1.00 31.79 ? 381 PHE B CB  1 
ATOM   1697 C CG  . PHE B 2 81  H 82.128 -20.101 95.485  1.00 33.78 ? 381 PHE B CG  1 
ATOM   1698 C CD1 . PHE B 2 81  H 81.645 -18.801 95.368  1.00 33.94 ? 381 PHE B CD1 1 
ATOM   1699 C CD2 . PHE B 2 81  H 81.998 -20.966 94.408  1.00 34.04 ? 381 PHE B CD2 1 
ATOM   1700 C CE1 . PHE B 2 81  H 81.038 -18.370 94.196  1.00 33.47 ? 381 PHE B CE1 1 
ATOM   1701 C CE2 . PHE B 2 81  H 81.392 -20.546 93.232  1.00 34.20 ? 381 PHE B CE2 1 
ATOM   1702 C CZ  . PHE B 2 81  H 80.910 -19.243 93.127  1.00 33.89 ? 381 PHE B CZ  1 
ATOM   1703 N N   . HIS B 2 82  I 85.708 -20.329 98.753  1.00 27.95 ? 381 HIS B N   1 
ATOM   1704 C CA  . HIS B 2 82  I 86.270 -20.749 100.027 1.00 25.11 ? 381 HIS B CA  1 
ATOM   1705 C C   . HIS B 2 82  I 86.785 -19.617 100.898 1.00 23.59 ? 381 HIS B C   1 
ATOM   1706 O O   . HIS B 2 82  I 87.407 -18.677 100.406 1.00 22.52 ? 381 HIS B O   1 
ATOM   1707 C CB  . HIS B 2 82  I 87.411 -21.735 99.783  1.00 24.80 ? 381 HIS B CB  1 
ATOM   1708 C CG  . HIS B 2 82  I 88.097 -22.183 101.034 1.00 23.76 ? 381 HIS B CG  1 
ATOM   1709 N ND1 . HIS B 2 82  I 87.484 -22.987 101.971 1.00 23.71 ? 381 HIS B ND1 1 
ATOM   1710 C CD2 . HIS B 2 82  I 89.338 -21.925 101.509 1.00 22.03 ? 381 HIS B CD2 1 
ATOM   1711 C CE1 . HIS B 2 82  I 88.320 -23.205 102.971 1.00 25.03 ? 381 HIS B CE1 1 
ATOM   1712 N NE2 . HIS B 2 82  I 89.452 -22.572 102.715 1.00 24.10 ? 381 HIS B NE2 1 
ATOM   1713 N N   . ALA B 2 83  ? 86.536 -19.736 102.201 1.00 22.73 ? 382 ALA B N   1 
ATOM   1714 C CA  . ALA B 2 83  ? 86.983 -18.753 103.188 1.00 21.98 ? 382 ALA B CA  1 
ATOM   1715 C C   . ALA B 2 83  ? 86.412 -17.349 102.986 1.00 22.07 ? 382 ALA B C   1 
ATOM   1716 O O   . ALA B 2 83  ? 87.111 -16.352 103.174 1.00 21.29 ? 382 ALA B O   1 
ATOM   1717 C CB  . ALA B 2 83  ? 88.508 -18.699 103.212 1.00 17.49 ? 382 ALA B CB  1 
ATOM   1718 N N   . LYS B 2 84  ? 85.137 -17.278 102.612 1.00 22.09 ? 383 LYS B N   1 
ATOM   1719 C CA  . LYS B 2 84  ? 84.479 -15.994 102.402 1.00 22.86 ? 383 LYS B CA  1 
ATOM   1720 C C   . LYS B 2 84  ? 83.731 -15.599 103.670 1.00 22.46 ? 383 LYS B C   1 
ATOM   1721 O O   . LYS B 2 84  ? 83.385 -16.452 104.493 1.00 21.25 ? 383 LYS B O   1 
ATOM   1722 C CB  . LYS B 2 84  ? 83.502 -16.077 101.221 1.00 25.28 ? 383 LYS B CB  1 
ATOM   1723 C CG  . LYS B 2 84  ? 84.148 -16.528 99.920  1.00 28.68 ? 383 LYS B CG  1 
ATOM   1724 C CD  . LYS B 2 84  ? 85.415 -15.729 99.617  1.00 31.26 ? 383 LYS B CD  1 
ATOM   1725 C CE  . LYS B 2 84  ? 86.181 -16.327 98.444  1.00 32.36 ? 383 LYS B CE  1 
ATOM   1726 N NZ  . LYS B 2 84  ? 87.445 -15.583 98.166  1.00 35.36 ? 383 LYS B NZ  1 
ATOM   1727 N N   . LYS B 2 85  ? 83.476 -14.306 103.820 1.00 21.61 ? 384 LYS B N   1 
ATOM   1728 C CA  . LYS B 2 85  ? 82.785 -13.810 104.999 1.00 20.48 ? 384 LYS B CA  1 
ATOM   1729 C C   . LYS B 2 85  ? 81.435 -13.206 104.654 1.00 19.74 ? 384 LYS B C   1 
ATOM   1730 O O   . LYS B 2 85  ? 81.042 -13.162 103.489 1.00 20.86 ? 384 LYS B O   1 
ATOM   1731 C CB  . LYS B 2 85  ? 83.670 -12.785 105.691 1.00 20.23 ? 384 LYS B CB  1 
ATOM   1732 C CG  . LYS B 2 85  ? 85.029 -13.356 106.048 1.00 21.17 ? 384 LYS B CG  1 
ATOM   1733 C CD  . LYS B 2 85  ? 84.930 -14.288 107.241 1.00 19.83 ? 384 LYS B CD  1 
ATOM   1734 C CE  . LYS B 2 85  ? 84.619 -13.495 108.507 1.00 19.20 ? 384 LYS B CE  1 
ATOM   1735 N NZ  . LYS B 2 85  ? 84.693 -14.321 109.748 1.00 22.10 ? 384 LYS B NZ  1 
ATOM   1736 N N   . GLN B 2 86  ? 80.730 -12.730 105.672 1.00 18.78 ? 385 GLN B N   1 
ATOM   1737 C CA  . GLN B 2 86  ? 79.416 -12.151 105.468 1.00 16.95 ? 385 GLN B CA  1 
ATOM   1738 C C   . GLN B 2 86  ? 79.044 -11.220 106.608 1.00 17.31 ? 385 GLN B C   1 
ATOM   1739 O O   . GLN B 2 86  ? 79.342 -11.504 107.769 1.00 19.68 ? 385 GLN B O   1 
ATOM   1740 C CB  . GLN B 2 86  ? 78.384 -13.274 105.371 1.00 17.04 ? 385 GLN B CB  1 
ATOM   1741 C CG  . GLN B 2 86  ? 76.972 -12.801 105.117 1.00 17.05 ? 385 GLN B CG  1 
ATOM   1742 C CD  . GLN B 2 86  ? 75.981 -13.940 105.103 1.00 17.28 ? 385 GLN B CD  1 
ATOM   1743 O OE1 . GLN B 2 86  ? 76.168 -14.924 104.396 1.00 19.31 ? 385 GLN B OE1 1 
ATOM   1744 N NE2 . GLN B 2 86  ? 74.915 -13.813 105.883 1.00 17.87 ? 385 GLN B NE2 1 
ATOM   1745 N N   . ILE B 2 87  ? 78.402 -10.103 106.272 1.00 17.00 ? 386 ILE B N   1 
ATOM   1746 C CA  . ILE B 2 87  ? 77.940 -9.130  107.266 1.00 15.70 ? 386 ILE B CA  1 
ATOM   1747 C C   . ILE B 2 87  ? 76.465 -8.811  106.982 1.00 16.17 ? 386 ILE B C   1 
ATOM   1748 O O   . ILE B 2 87  ? 76.112 -8.357  105.885 1.00 16.08 ? 386 ILE B O   1 
ATOM   1749 C CB  . ILE B 2 87  ? 78.806 -7.807  107.243 1.00 16.43 ? 386 ILE B CB  1 
ATOM   1750 C CG1 . ILE B 2 87  ? 78.302 -6.826  108.297 1.00 15.43 ? 386 ILE B CG1 1 
ATOM   1751 C CG2 . ILE B 2 87  ? 78.758 -7.132  105.876 1.00 15.88 ? 386 ILE B CG2 1 
ATOM   1752 C CD1 . ILE B 2 87  ? 78.363 -7.357  109.706 1.00 18.29 ? 386 ILE B CD1 1 
ATOM   1753 N N   . PRO B 2 88  ? 75.573 -9.101  107.945 1.00 14.66 ? 387 PRO B N   1 
ATOM   1754 C CA  . PRO B 2 88  ? 74.147 -8.816  107.740 1.00 13.58 ? 387 PRO B CA  1 
ATOM   1755 C C   . PRO B 2 88  ? 73.936 -7.312  107.634 1.00 13.57 ? 387 PRO B C   1 
ATOM   1756 O O   . PRO B 2 88  ? 74.815 -6.539  107.978 1.00 13.96 ? 387 PRO B O   1 
ATOM   1757 C CB  . PRO B 2 88  ? 73.488 -9.414  108.975 1.00 13.99 ? 387 PRO B CB  1 
ATOM   1758 C CG  . PRO B 2 88  ? 74.417 -10.539 109.341 1.00 15.24 ? 387 PRO B CG  1 
ATOM   1759 C CD  . PRO B 2 88  ? 75.778 -9.920  109.150 1.00 14.07 ? 387 PRO B CD  1 
ATOM   1760 N N   . CYS B 2 89  ? 72.766 -6.899  107.166 1.00 15.33 ? 388 CYS B N   1 
ATOM   1761 C CA  . CYS B 2 89  ? 72.473 -5.483  106.973 1.00 16.57 ? 388 CYS B CA  1 
ATOM   1762 C C   . CYS B 2 89  ? 71.127 -5.094  107.564 1.00 17.20 ? 388 CYS B C   1 
ATOM   1763 O O   . CYS B 2 89  ? 70.085 -5.585  107.123 1.00 17.81 ? 388 CYS B O   1 
ATOM   1764 C CB  . CYS B 2 89  ? 72.477 -5.179  105.474 1.00 17.35 ? 388 CYS B CB  1 
ATOM   1765 S SG  . CYS B 2 89  ? 72.383 -3.444  105.028 1.00 21.65 ? 388 CYS B SG  1 
ATOM   1766 N N   . ILE B 2 90  ? 71.146 -4.204  108.551 1.00 16.01 ? 389 ILE B N   1 
ATOM   1767 C CA  . ILE B 2 90  ? 69.913 -3.758  109.188 1.00 14.77 ? 389 ILE B CA  1 
ATOM   1768 C C   . ILE B 2 90  ? 69.400 -2.478  108.542 1.00 14.34 ? 389 ILE B C   1 
ATOM   1769 O O   . ILE B 2 90  ? 70.130 -1.495  108.432 1.00 15.62 ? 389 ILE B O   1 
ATOM   1770 C CB  . ILE B 2 90  ? 70.129 -3.484  110.681 1.00 13.43 ? 389 ILE B CB  1 
ATOM   1771 C CG1 . ILE B 2 90  ? 70.828 -4.679  111.333 1.00 13.03 ? 389 ILE B CG1 1 
ATOM   1772 C CG2 . ILE B 2 90  ? 68.790 -3.217  111.353 1.00 13.34 ? 389 ILE B CG2 1 
ATOM   1773 C CD1 . ILE B 2 90  ? 71.144 -4.477  112.811 1.00 13.92 ? 389 ILE B CD1 1 
ATOM   1774 N N   . VAL B 2 91  ? 68.152 -2.489  108.096 1.00 13.92 ? 390 VAL B N   1 
ATOM   1775 C CA  . VAL B 2 91  ? 67.585 -1.298  107.487 1.00 15.49 ? 390 VAL B CA  1 
ATOM   1776 C C   . VAL B 2 91  ? 66.368 -0.895  108.303 1.00 16.54 ? 390 VAL B C   1 
ATOM   1777 O O   . VAL B 2 91  ? 65.272 -1.435  108.123 1.00 16.49 ? 390 VAL B O   1 
ATOM   1778 C CB  . VAL B 2 91  ? 67.170 -1.548  106.034 1.00 16.25 ? 390 VAL B CB  1 
ATOM   1779 C CG1 . VAL B 2 91  ? 66.757 -0.236  105.379 1.00 14.46 ? 390 VAL B CG1 1 
ATOM   1780 C CG2 . VAL B 2 91  ? 68.328 -2.184  105.268 1.00 18.84 ? 390 VAL B CG2 1 
ATOM   1781 N N   . SER B 2 92  ? 66.571 0.058   109.206 1.00 15.89 ? 392 SER B N   1 
ATOM   1782 C CA  . SER B 2 92  ? 65.494 0.518   110.063 1.00 16.24 ? 392 SER B CA  1 
ATOM   1783 C C   . SER B 2 92  ? 64.855 1.851   109.754 1.00 15.81 ? 392 SER B C   1 
ATOM   1784 O O   . SER B 2 92  ? 65.525 2.859   109.552 1.00 14.88 ? 392 SER B O   1 
ATOM   1785 C CB  . SER B 2 92  ? 65.943 0.561   111.513 1.00 16.14 ? 392 SER B CB  1 
ATOM   1786 O OG  . SER B 2 92  ? 64.878 1.058   112.310 1.00 18.05 ? 392 SER B OG  1 
ATOM   1787 N N   . MET B 2 93  ? 63.532 1.836   109.753 1.00 16.91 ? 393 MET B N   1 
ATOM   1788 C CA  . MET B 2 93  ? 62.749 3.032   109.530 1.00 18.78 ? 393 MET B CA  1 
ATOM   1789 C C   . MET B 2 93  ? 61.695 3.040   110.617 1.00 17.40 ? 393 MET B C   1 
ATOM   1790 O O   . MET B 2 93  ? 60.603 3.566   110.457 1.00 16.70 ? 393 MET B O   1 
ATOM   1791 C CB  . MET B 2 93  ? 62.127 3.006   108.140 1.00 23.46 ? 393 MET B CB  1 
ATOM   1792 C CG  . MET B 2 93  ? 63.156 3.306   107.067 1.00 28.90 ? 393 MET B CG  1 
ATOM   1793 S SD  . MET B 2 93  ? 62.574 3.010   105.416 1.00 35.85 ? 393 MET B SD  1 
ATOM   1794 C CE  . MET B 2 93  ? 63.439 1.525   105.068 1.00 32.62 ? 393 MET B CE  1 
ATOM   1795 N N   . LEU B 2 94  ? 62.047 2.421   111.734 1.00 17.09 ? 394 LEU B N   1 
ATOM   1796 C CA  . LEU B 2 94  ? 61.160 2.352   112.874 1.00 17.05 ? 394 LEU B CA  1 
ATOM   1797 C C   . LEU B 2 94  ? 61.198 3.707   113.580 1.00 16.89 ? 394 LEU B C   1 
ATOM   1798 O O   . LEU B 2 94  ? 62.137 4.483   113.412 1.00 17.62 ? 394 LEU B O   1 
ATOM   1799 C CB  . LEU B 2 94  ? 61.609 1.229   113.817 1.00 15.88 ? 394 LEU B CB  1 
ATOM   1800 C CG  . LEU B 2 94  ? 61.686 -0.172  113.193 1.00 16.42 ? 394 LEU B CG  1 
ATOM   1801 C CD1 . LEU B 2 94  ? 62.054 -1.207  114.259 1.00 14.62 ? 394 LEU B CD1 1 
ATOM   1802 C CD2 . LEU B 2 94  ? 60.348 -0.514  112.555 1.00 13.80 ? 394 LEU B CD2 1 
ATOM   1803 N N   . THR B 2 95  ? 60.170 3.999   114.360 1.00 16.66 ? 395 THR B N   1 
ATOM   1804 C CA  . THR B 2 95  ? 60.107 5.268   115.060 1.00 16.30 ? 395 THR B CA  1 
ATOM   1805 C C   . THR B 2 95  ? 60.167 5.074   116.557 1.00 16.66 ? 395 THR B C   1 
ATOM   1806 O O   . THR B 2 95  ? 60.304 6.038   117.301 1.00 18.74 ? 395 THR B O   1 
ATOM   1807 C CB  . THR B 2 95  ? 58.819 5.998   114.728 1.00 14.69 ? 395 THR B CB  1 
ATOM   1808 O OG1 . THR B 2 95  ? 57.712 5.137   115.012 1.00 12.57 ? 395 THR B OG1 1 
ATOM   1809 C CG2 . THR B 2 95  ? 58.798 6.395   113.257 1.00 13.56 ? 395 THR B CG2 1 
ATOM   1810 N N   . LYS B 2 96  ? 60.061 3.825   116.996 1.00 16.43 ? 396 LYS B N   1 
ATOM   1811 C CA  . LYS B 2 96  ? 60.098 3.519   118.414 1.00 17.34 ? 396 LYS B CA  1 
ATOM   1812 C C   . LYS B 2 96  ? 60.952 2.290   118.669 1.00 18.87 ? 396 LYS B C   1 
ATOM   1813 O O   . LYS B 2 96  ? 61.230 1.516   117.755 1.00 20.09 ? 396 LYS B O   1 
ATOM   1814 C CB  . LYS B 2 96  ? 58.680 3.274   118.951 1.00 17.39 ? 396 LYS B CB  1 
ATOM   1815 C CG  . LYS B 2 96  ? 57.663 4.395   118.680 1.00 15.47 ? 396 LYS B CG  1 
ATOM   1816 C CD  . LYS B 2 96  ? 56.697 4.534   119.855 1.00 18.39 ? 396 LYS B CD  1 
ATOM   1817 C CE  . LYS B 2 96  ? 55.500 5.435   119.552 1.00 20.49 ? 396 LYS B CE  1 
ATOM   1818 N NZ  . LYS B 2 96  ? 54.556 4.822   118.560 1.00 21.83 ? 396 LYS B NZ  1 
ATOM   1819 N N   . GLU B 2 97  ? 61.374 2.115   119.915 1.00 19.85 ? 397 GLU B N   1 
ATOM   1820 C CA  . GLU B 2 97  ? 62.183 0.963   120.285 1.00 20.92 ? 397 GLU B CA  1 
ATOM   1821 C C   . GLU B 2 97  ? 61.269 -0.258  120.299 1.00 21.66 ? 397 GLU B C   1 
ATOM   1822 O O   . GLU B 2 97  ? 60.075 -0.150  120.574 1.00 20.08 ? 397 GLU B O   1 
ATOM   1823 C CB  . GLU B 2 97  ? 62.792 1.188   121.660 1.00 23.15 ? 397 GLU B CB  1 
ATOM   1824 C CG  . GLU B 2 97  ? 63.491 2.526   121.755 1.00 27.27 ? 397 GLU B CG  1 
ATOM   1825 C CD  . GLU B 2 97  ? 64.095 2.777   123.111 1.00 30.11 ? 397 GLU B CD  1 
ATOM   1826 O OE1 . GLU B 2 97  ? 63.422 2.476   124.125 1.00 33.04 ? 397 GLU B OE1 1 
ATOM   1827 O OE2 . GLU B 2 97  ? 65.241 3.283   123.157 1.00 29.75 ? 397 GLU B OE2 1 
ATOM   1828 N N   . LEU B 2 98  ? 61.823 -1.425  120.002 1.00 23.93 ? 398 LEU B N   1 
ATOM   1829 C CA  . LEU B 2 98  ? 61.009 -2.630  119.967 1.00 24.07 ? 398 LEU B CA  1 
ATOM   1830 C C   . LEU B 2 98  ? 61.449 -3.673  120.975 1.00 24.23 ? 398 LEU B C   1 
ATOM   1831 O O   . LEU B 2 98  ? 62.584 -4.147  120.937 1.00 24.83 ? 398 LEU B O   1 
ATOM   1832 C CB  . LEU B 2 98  ? 61.043 -3.237  118.569 1.00 24.18 ? 398 LEU B CB  1 
ATOM   1833 C CG  . LEU B 2 98  ? 59.755 -3.884  118.065 1.00 24.71 ? 398 LEU B CG  1 
ATOM   1834 C CD1 . LEU B 2 98  ? 60.025 -4.456  116.683 1.00 23.79 ? 398 LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 2 98  ? 59.272 -4.965  119.014 1.00 23.41 ? 398 LEU B CD2 1 
ATOM   1836 N N   . TYR B 2 99  ? 60.531 -4.026  121.869 1.00 24.60 ? 399 TYR B N   1 
ATOM   1837 C CA  . TYR B 2 99  ? 60.770 -5.028  122.901 1.00 25.60 ? 399 TYR B CA  1 
ATOM   1838 C C   . TYR B 2 99  ? 59.705 -6.104  122.746 1.00 27.56 ? 399 TYR B C   1 
ATOM   1839 O O   . TYR B 2 99  ? 58.517 -5.796  122.716 1.00 28.91 ? 399 TYR B O   1 
ATOM   1840 C CB  . TYR B 2 99  ? 60.647 -4.400  124.287 1.00 24.32 ? 399 TYR B CB  1 
ATOM   1841 C CG  . TYR B 2 99  ? 61.717 -3.383  124.614 1.00 24.53 ? 399 TYR B CG  1 
ATOM   1842 C CD1 . TYR B 2 99  ? 62.991 -3.785  125.016 1.00 22.43 ? 399 TYR B CD1 1 
ATOM   1843 C CD2 . TYR B 2 99  ? 61.457 -2.014  124.516 1.00 21.84 ? 399 TYR B CD2 1 
ATOM   1844 C CE1 . TYR B 2 99  ? 63.976 -2.854  125.315 1.00 21.68 ? 399 TYR B CE1 1 
ATOM   1845 C CE2 . TYR B 2 99  ? 62.440 -1.074  124.808 1.00 21.62 ? 399 TYR B CE2 1 
ATOM   1846 C CZ  . TYR B 2 99  ? 63.697 -1.502  125.207 1.00 21.98 ? 399 TYR B CZ  1 
ATOM   1847 O OH  . TYR B 2 99  ? 64.682 -0.581  125.484 1.00 21.68 ? 399 TYR B OH  1 
ATOM   1848 N N   . PHE B 2 100 ? 60.117 -7.363  122.652 1.00 30.47 ? 400 PHE B N   1 
ATOM   1849 C CA  . PHE B 2 100 ? 59.150 -8.446  122.498 1.00 34.39 ? 400 PHE B CA  1 
ATOM   1850 C C   . PHE B 2 100 ? 58.457 -8.846  123.806 1.00 36.91 ? 400 PHE B C   1 
ATOM   1851 O O   . PHE B 2 100 ? 57.647 -9.771  123.826 1.00 37.78 ? 400 PHE B O   1 
ATOM   1852 C CB  . PHE B 2 100 ? 59.816 -9.669  121.855 1.00 31.24 ? 400 PHE B CB  1 
ATOM   1853 C CG  . PHE B 2 100 ? 60.186 -9.463  120.413 1.00 30.94 ? 400 PHE B CG  1 
ATOM   1854 C CD1 . PHE B 2 100 ? 59.201 -9.311  119.441 1.00 31.33 ? 400 PHE B CD1 1 
ATOM   1855 C CD2 . PHE B 2 100 ? 61.519 -9.395  120.024 1.00 31.26 ? 400 PHE B CD2 1 
ATOM   1856 C CE1 . PHE B 2 100 ? 59.545 -9.093  118.095 1.00 31.50 ? 400 PHE B CE1 1 
ATOM   1857 C CE2 . PHE B 2 100 ? 61.871 -9.177  118.685 1.00 29.45 ? 400 PHE B CE2 1 
ATOM   1858 C CZ  . PHE B 2 100 ? 60.884 -9.026  117.723 1.00 29.44 ? 400 PHE B CZ  1 
ATOM   1859 N N   . TYR B 2 101 ? 58.765 -8.150  124.896 1.00 39.57 ? 401 TYR B N   1 
ATOM   1860 C CA  . TYR B 2 101 ? 58.133 -8.458  126.176 1.00 42.68 ? 401 TYR B CA  1 
ATOM   1861 C C   . TYR B 2 101 ? 57.316 -7.289  126.724 1.00 44.16 ? 401 TYR B C   1 
ATOM   1862 O O   . TYR B 2 101 ? 57.352 -6.200  126.111 1.00 46.43 ? 401 TYR B O   1 
ATOM   1863 C CB  . TYR B 2 101 ? 59.188 -8.866  127.198 1.00 44.47 ? 401 TYR B CB  1 
ATOM   1864 C CG  . TYR B 2 101 ? 60.285 -7.845  127.403 1.00 47.07 ? 401 TYR B CG  1 
ATOM   1865 C CD1 . TYR B 2 101 ? 61.519 -7.981  126.762 1.00 47.76 ? 401 TYR B CD1 1 
ATOM   1866 C CD2 . TYR B 2 101 ? 60.108 -6.766  128.275 1.00 47.86 ? 401 TYR B CD2 1 
ATOM   1867 C CE1 . TYR B 2 101 ? 62.557 -7.074  126.993 1.00 48.37 ? 401 TYR B CE1 1 
ATOM   1868 C CE2 . TYR B 2 101 ? 61.135 -5.853  128.510 1.00 48.50 ? 401 TYR B CE2 1 
ATOM   1869 C CZ  . TYR B 2 101 ? 62.356 -6.015  127.871 1.00 49.01 ? 401 TYR B CZ  1 
ATOM   1870 O OH  . TYR B 2 101 ? 63.381 -5.135  128.136 1.00 49.79 ? 401 TYR B OH  1 
HETATM 1871 C C1  . 3CY C 3 .   ? 73.744 -15.472 90.453  1.00 52.34 ? 501 3CY A C1  1 
HETATM 1872 C C2  . 3CY C 3 .   ? 73.365 -14.738 89.295  1.00 53.14 ? 501 3CY A C2  1 
HETATM 1873 C C3  . 3CY C 3 .   ? 72.027 -14.277 89.153  1.00 53.47 ? 501 3CY A C3  1 
HETATM 1874 C C4  . 3CY C 3 .   ? 71.067 -14.554 90.161  1.00 52.22 ? 501 3CY A C4  1 
HETATM 1875 C C5  . 3CY C 3 .   ? 71.452 -15.285 91.311  1.00 50.99 ? 501 3CY A C5  1 
HETATM 1876 C C6  . 3CY C 3 .   ? 72.796 -15.756 91.475  1.00 50.57 ? 501 3CY A C6  1 
HETATM 1877 C C7  . 3CY C 3 .   ? 73.170 -16.548 92.727  1.00 46.46 ? 501 3CY A C7  1 
HETATM 1878 S S1  . 3CY C 3 .   ? 72.207 -16.031 94.156  1.00 38.96 ? 501 3CY A S1  1 
HETATM 1879 C C8  . 3CY C 3 .   ? 72.744 -17.196 95.422  1.00 36.88 ? 501 3CY A C8  1 
HETATM 1880 C C9  . 3CY C 3 .   ? 71.990 -16.980 96.754  1.00 35.34 ? 501 3CY A C9  1 
HETATM 1881 C C10 . 3CY C 3 .   ? 72.374 -18.013 97.845  1.00 33.51 ? 501 3CY A C10 1 
HETATM 1882 O O1  . 3CY C 3 .   ? 70.748 -17.050 96.440  1.00 34.22 ? 501 3CY A O1  1 
HETATM 1883 N N1  . 3CY C 3 .   ? 73.783 -18.142 98.093  1.00 33.59 ? 501 3CY A N1  1 
HETATM 1884 C C11 . 3CY C 3 .   ? 71.672 -17.707 99.213  1.00 32.46 ? 501 3CY A C11 1 
HETATM 1885 C C12 . 3CY C 3 .   ? 70.641 -18.741 99.663  1.00 32.98 ? 501 3CY A C12 1 
HETATM 1886 O O2  . 3CY C 3 .   ? 70.255 -18.753 100.812 1.00 34.29 ? 501 3CY A O2  1 
HETATM 1887 O O3  . 3CY C 3 .   ? 70.209 -19.543 98.881  1.00 34.01 ? 501 3CY A O3  1 
HETATM 1888 C C13 . 3CY C 3 .   ? 74.353 -19.307 97.824  1.00 32.21 ? 501 3CY A C13 1 
HETATM 1889 O O4  . 3CY C 3 .   ? 73.750 -20.315 97.349  1.00 32.14 ? 501 3CY A O4  1 
HETATM 1890 C C21 . 3CY C 3 .   ? 76.800 -21.077 96.944  1.00 33.18 ? 501 3CY A C21 1 
HETATM 1891 N N2  . 3CY C 3 .   ? 76.250 -20.824 98.176  1.00 33.53 ? 501 3CY A N2  1 
HETATM 1892 C C14 . 3CY C 3 .   ? 75.842 -19.409 98.170  1.00 32.12 ? 501 3CY A C14 1 
HETATM 1893 C C15 . 3CY C 3 .   ? 76.872 -18.742 97.167  1.00 32.36 ? 501 3CY A C15 1 
HETATM 1894 C C16 . 3CY C 3 .   ? 77.193 -19.920 96.325  1.00 33.31 ? 501 3CY A C16 1 
HETATM 1895 C C17 . 3CY C 3 .   ? 77.808 -19.954 95.056  1.00 34.13 ? 501 3CY A C17 1 
HETATM 1896 C C18 . 3CY C 3 .   ? 78.000 -21.207 94.423  1.00 35.19 ? 501 3CY A C18 1 
HETATM 1897 C C19 . 3CY C 3 .   ? 77.574 -22.413 95.056  1.00 34.27 ? 501 3CY A C19 1 
HETATM 1898 C C20 . 3CY C 3 .   ? 76.954 -22.379 96.340  1.00 33.36 ? 501 3CY A C20 1 
HETATM 1899 C C22 . 3CY C 3 .   ? 76.430 -23.643 97.053  1.00 32.48 ? 501 3CY A C22 1 
HETATM 1900 C C23 . 3CY C 3 .   ? 76.662 -23.933 98.553  1.00 32.74 ? 501 3CY A C23 1 
HETATM 1901 C C24 . 3CY C 3 .   ? 77.236 -22.790 99.368  1.00 34.26 ? 501 3CY A C24 1 
HETATM 1902 C C25 . 3CY C 3 .   ? 76.349 -21.531 99.355  1.00 33.30 ? 501 3CY A C25 1 
HETATM 1903 O O5  . 3CY C 3 .   ? 75.782 -21.193 100.433 1.00 33.42 ? 501 3CY A O5  1 
HETATM 1904 N N3  . 3CY C 3 .   ? 77.438 -23.166 100.770 1.00 35.56 ? 501 3CY A N3  1 
HETATM 1905 C C26 . 3CY C 3 .   ? 78.535 -23.826 101.154 1.00 38.02 ? 501 3CY A C26 1 
HETATM 1906 C C27 . 3CY C 3 .   ? 78.619 -24.106 102.662 1.00 38.54 ? 501 3CY A C27 1 
HETATM 1907 O O6  . 3CY C 3 .   ? 79.484 -24.197 100.392 1.00 40.16 ? 501 3CY A O6  1 
HETATM 1908 N N4  . 3CY C 3 .   ? 79.048 -25.500 102.889 1.00 40.34 ? 501 3CY A N4  1 
HETATM 1909 C C30 . 3CY C 3 .   ? 78.169 -26.537 102.922 1.00 42.82 ? 501 3CY A C30 1 
HETATM 1910 C C31 . 3CY C 3 .   ? 78.840 -27.894 103.173 1.00 43.20 ? 501 3CY A C31 1 
HETATM 1911 O O9  . 3CY C 3 .   ? 76.906 -26.438 102.766 1.00 43.23 ? 501 3CY A O9  1 
HETATM 1912 C C28 . 3CY C 3 .   ? 79.616 -23.097 103.283 1.00 37.96 ? 501 3CY A C28 1 
HETATM 1913 C C29 . 3CY C 3 .   ? 79.812 -23.242 104.786 1.00 38.15 ? 501 3CY A C29 1 
HETATM 1914 O O8  . 3CY C 3 .   ? 80.934 -23.308 105.241 1.00 36.98 ? 501 3CY A O8  1 
HETATM 1915 O O7  . 3CY C 3 .   ? 78.849 -23.280 105.526 1.00 39.27 ? 501 3CY A O7  1 
HETATM 1916 O O   . HOH D 4 .   ? 68.017 -6.770  98.139  1.00 25.62 ? 1   HOH A O   1 
HETATM 1917 O O   . HOH D 4 .   ? 66.926 -20.319 104.021 1.00 43.04 ? 2   HOH A O   1 
HETATM 1918 O O   . HOH D 4 .   ? 81.408 -13.295 100.576 1.00 43.34 ? 7   HOH A O   1 
HETATM 1919 O O   . HOH D 4 .   ? 56.912 -25.478 116.197 1.00 32.86 ? 8   HOH A O   1 
HETATM 1920 O O   . HOH D 4 .   ? 69.033 -22.472 111.274 1.00 16.58 ? 9   HOH A O   1 
HETATM 1921 O O   . HOH D 4 .   ? 57.289 -0.165  100.472 1.00 39.18 ? 11  HOH A O   1 
HETATM 1922 O O   . HOH D 4 .   ? 84.269 -9.939  94.934  1.00 41.53 ? 12  HOH A O   1 
HETATM 1923 O O   . HOH D 4 .   ? 69.568 -10.785 102.474 1.00 28.80 ? 14  HOH A O   1 
HETATM 1924 O O   . HOH D 4 .   ? 73.832 -21.321 94.672  1.00 67.43 ? 16  HOH A O   1 
HETATM 1925 O O   . HOH D 4 .   ? 57.861 -2.532  122.262 1.00 32.04 ? 17  HOH A O   1 
HETATM 1926 O O   . HOH D 4 .   ? 79.873 -8.128  102.655 1.00 27.07 ? 18  HOH A O   1 
HETATM 1927 O O   . HOH D 4 .   ? 72.274 -7.814  92.183  1.00 16.96 ? 20  HOH A O   1 
HETATM 1928 O O   . HOH D 4 .   ? 86.705 -8.861  99.594  1.00 37.78 ? 21  HOH A O   1 
HETATM 1929 O O   . HOH D 4 .   ? 51.105 0.372   117.877 1.00 24.07 ? 22  HOH A O   1 
HETATM 1930 O O   . HOH D 4 .   ? 44.368 -13.983 104.113 1.00 31.51 ? 24  HOH A O   1 
HETATM 1931 O O   . HOH D 4 .   ? 54.895 -18.484 124.516 1.00 42.62 ? 26  HOH A O   1 
HETATM 1932 O O   . HOH D 4 .   ? 50.524 -0.040  107.339 1.00 42.46 ? 28  HOH A O   1 
HETATM 1933 O O   . HOH D 4 .   ? 67.078 -24.828 88.034  1.00 46.65 ? 29  HOH A O   1 
HETATM 1934 O O   . HOH D 4 .   ? 66.827 -28.306 104.889 1.00 42.96 ? 30  HOH A O   1 
HETATM 1935 O O   . HOH D 4 .   ? 60.442 -25.990 100.546 1.00 48.62 ? 31  HOH A O   1 
HETATM 1936 O O   . HOH D 4 .   ? 47.378 -3.647  100.050 1.00 53.88 ? 32  HOH A O   1 
HETATM 1937 O O   . HOH D 4 .   ? 50.759 -8.629  121.841 1.00 38.88 ? 34  HOH A O   1 
HETATM 1938 O O   . HOH D 4 .   ? 52.689 -1.895  118.412 1.00 32.92 ? 36  HOH A O   1 
HETATM 1939 O O   . HOH D 4 .   ? 44.117 -2.862  106.985 1.00 64.81 ? 37  HOH A O   1 
HETATM 1940 O O   . HOH D 4 .   ? 65.975 -25.849 92.967  1.00 65.40 ? 38  HOH A O   1 
HETATM 1941 O O   . HOH D 4 .   ? 49.741 -9.193  111.783 1.00 28.51 ? 40  HOH A O   1 
HETATM 1942 O O   . HOH D 4 .   ? 67.140 -9.714  97.824  1.00 24.47 ? 41  HOH A O   1 
HETATM 1943 O O   . HOH D 4 .   ? 93.850 -7.766  115.964 1.00 48.56 ? 42  HOH A O   1 
HETATM 1944 O O   . HOH D 4 .   ? 67.248 -2.660  97.511  1.00 33.91 ? 45  HOH A O   1 
HETATM 1945 O O   . HOH D 4 .   ? 57.227 2.723   127.210 1.00 49.13 ? 46  HOH A O   1 
HETATM 1946 O O   . HOH D 4 .   ? 82.139 -24.151 107.641 1.00 39.24 ? 47  HOH A O   1 
HETATM 1947 O O   . HOH D 4 .   ? 49.064 2.100   117.454 1.00 58.05 ? 48  HOH A O   1 
HETATM 1948 O O   . HOH D 4 .   ? 59.654 -9.527  95.684  1.00 93.80 ? 50  HOH A O   1 
HETATM 1949 O O   . HOH D 4 .   ? 61.717 -27.445 86.733  1.00 34.67 ? 51  HOH A O   1 
HETATM 1950 O O   . HOH D 4 .   ? 79.387 -22.912 108.432 1.00 47.24 ? 55  HOH A O   1 
HETATM 1951 O O   . HOH D 4 .   ? 41.559 -11.520 99.506  1.00 48.71 ? 56  HOH A O   1 
HETATM 1952 O O   . HOH D 4 .   ? 45.090 -13.826 114.207 1.00 40.68 ? 59  HOH A O   1 
HETATM 1953 O O   . HOH D 4 .   ? 46.225 0.630   112.891 1.00 40.01 ? 60  HOH A O   1 
HETATM 1954 O O   . HOH D 4 .   ? 79.717 -13.222 98.644  1.00 69.25 ? 61  HOH A O   1 
HETATM 1955 O O   . HOH D 4 .   ? 54.532 -20.454 122.812 1.00 62.36 ? 62  HOH A O   1 
HETATM 1956 O O   . HOH D 4 .   ? 72.511 -12.518 93.377  1.00 65.22 ? 63  HOH A O   1 
HETATM 1957 O O   . HOH D 4 .   ? 44.643 -11.819 96.063  1.00 49.60 ? 65  HOH A O   1 
HETATM 1958 O O   . HOH D 4 .   ? 49.726 -13.501 120.806 1.00 35.18 ? 66  HOH A O   1 
HETATM 1959 O O   . HOH D 4 .   ? 55.260 -27.524 113.840 1.00 41.47 ? 67  HOH A O   1 
HETATM 1960 O O   . HOH D 4 .   ? 52.072 -18.375 105.427 1.00 75.37 ? 68  HOH A O   1 
HETATM 1961 O O   . HOH D 4 .   ? 47.063 -11.120 93.279  1.00 41.67 ? 73  HOH A O   1 
HETATM 1962 O O   . HOH D 4 .   ? 46.519 -15.781 98.261  1.00 48.69 ? 74  HOH A O   1 
HETATM 1963 O O   . HOH D 4 .   ? 66.281 -11.595 93.061  1.00 77.98 ? 75  HOH A O   1 
HETATM 1964 O O   . HOH D 4 .   ? 50.669 -19.455 90.443  1.00 50.95 ? 77  HOH A O   1 
HETATM 1965 O O   . HOH D 4 .   ? 54.884 8.699   122.050 1.00 41.86 ? 78  HOH A O   1 
HETATM 1966 O O   . HOH D 4 .   ? 57.318 -11.173 87.822  1.00 56.78 ? 79  HOH A O   1 
HETATM 1967 O O   . HOH D 4 .   ? 46.979 -4.233  127.376 1.00 41.64 ? 83  HOH A O   1 
HETATM 1968 O O   . HOH D 4 .   ? 57.839 -28.569 99.674  1.00 38.64 ? 87  HOH A O   1 
HETATM 1969 O O   . HOH D 4 .   ? 84.027 -6.523  96.358  1.00 51.15 ? 88  HOH A O   1 
HETATM 1970 O O   . HOH D 4 .   ? 60.539 2.375   126.566 1.00 47.01 ? 90  HOH A O   1 
HETATM 1971 O O   . HOH D 4 .   ? 52.819 -14.312 114.011 1.00 79.33 ? 91  HOH A O   1 
HETATM 1972 O O   . HOH D 4 .   ? 61.207 9.772   125.624 1.00 60.71 ? 93  HOH A O   1 
HETATM 1973 O O   . HOH D 4 .   ? 62.028 -18.070 120.935 1.00 44.93 ? 94  HOH A O   1 
HETATM 1974 O O   . HOH D 4 .   ? 60.209 -28.035 102.096 1.00 44.20 ? 98  HOH A O   1 
HETATM 1975 O O   . HOH D 4 .   ? 61.697 -18.917 84.803  1.00 44.22 ? 99  HOH A O   1 
HETATM 1976 O O   . HOH D 4 .   ? 43.021 -8.483  114.916 1.00 45.53 ? 100 HOH A O   1 
HETATM 1977 O O   . HOH E 4 .   ? 72.911 -16.276 105.963 1.00 20.63 ? 3   HOH B O   1 
HETATM 1978 O O   . HOH E 4 .   ? 63.743 0.203   117.320 1.00 24.75 ? 4   HOH B O   1 
HETATM 1979 O O   . HOH E 4 .   ? 53.168 4.102   107.837 1.00 28.42 ? 5   HOH B O   1 
HETATM 1980 O O   . HOH E 4 .   ? 78.702 -12.055 101.488 1.00 23.51 ? 6   HOH B O   1 
HETATM 1981 O O   . HOH E 4 .   ? 63.151 -7.435  122.945 1.00 17.93 ? 10  HOH B O   1 
HETATM 1982 O O   . HOH E 4 .   ? 53.293 2.815   110.336 1.00 17.19 ? 13  HOH B O   1 
HETATM 1983 O O   . HOH E 4 .   ? 78.092 -9.999  103.329 1.00 22.38 ? 15  HOH B O   1 
HETATM 1984 O O   . HOH E 4 .   ? 81.183 -14.145 108.040 1.00 16.55 ? 19  HOH B O   1 
HETATM 1985 O O   . HOH E 4 .   ? 76.782 -23.828 109.685 1.00 22.34 ? 23  HOH B O   1 
HETATM 1986 O O   . HOH E 4 .   ? 59.790 1.298   103.632 1.00 17.86 ? 25  HOH B O   1 
HETATM 1987 O O   . HOH E 4 .   ? 81.836 -21.280 109.966 1.00 31.67 ? 27  HOH B O   1 
HETATM 1988 O O   . HOH E 4 .   ? 75.404 -19.048 92.394  1.00 38.86 ? 33  HOH B O   1 
HETATM 1989 O O   . HOH E 4 .   ? 65.086 1.276   114.998 1.00 12.02 ? 35  HOH B O   1 
HETATM 1990 O O   . HOH E 4 .   ? 48.377 13.094  114.395 1.00 53.54 ? 43  HOH B O   1 
HETATM 1991 O O   . HOH E 4 .   ? 71.424 -8.379  111.884 1.00 29.60 ? 44  HOH B O   1 
HETATM 1992 O O   . HOH E 4 .   ? 86.220 -16.344 110.564 1.00 38.88 ? 49  HOH B O   1 
HETATM 1993 O O   . HOH E 4 .   ? 64.893 5.190   121.348 1.00 34.35 ? 52  HOH B O   1 
HETATM 1994 O O   . HOH E 4 .   ? 52.774 4.017   116.801 1.00 31.56 ? 53  HOH B O   1 
HETATM 1995 O O   . HOH E 4 .   ? 69.679 -21.595 116.101 1.00 23.42 ? 54  HOH B O   1 
HETATM 1996 O O   . HOH E 4 .   ? 76.946 -11.860 119.319 1.00 30.80 ? 57  HOH B O   1 
HETATM 1997 O O   . HOH E 4 .   ? 80.637 -24.328 97.124  1.00 34.19 ? 58  HOH B O   1 
HETATM 1998 O O   . HOH E 4 .   ? 66.182 -4.642  98.847  1.00 44.11 ? 64  HOH B O   1 
HETATM 1999 O O   . HOH E 4 .   ? 64.426 -8.729  131.098 1.00 40.47 ? 69  HOH B O   1 
HETATM 2000 O O   . HOH E 4 .   ? 66.811 3.290   125.543 1.00 27.39 ? 70  HOH B O   1 
HETATM 2001 O O   . HOH E 4 .   ? 71.233 -25.894 112.974 1.00 31.02 ? 71  HOH B O   1 
HETATM 2002 O O   . HOH E 4 .   ? 72.901 -25.073 97.217  1.00 46.31 ? 72  HOH B O   1 
HETATM 2003 O O   . HOH E 4 .   ? 55.786 3.020   98.478  1.00 57.33 ? 76  HOH B O   1 
HETATM 2004 O O   . HOH E 4 .   ? 76.562 -17.318 90.620  1.00 44.39 ? 80  HOH B O   1 
HETATM 2005 O O   . HOH E 4 .   ? 82.176 -14.763 110.759 1.00 78.98 ? 81  HOH B O   1 
HETATM 2006 O O   . HOH E 4 .   ? 55.718 -7.726  123.612 1.00 69.58 ? 82  HOH B O   1 
HETATM 2007 O O   . HOH E 4 .   ? 69.654 -7.879  109.675 1.00 39.29 ? 84  HOH B O   1 
HETATM 2008 O O   . HOH E 4 .   ? 89.069 -15.825 101.211 1.00 33.68 ? 85  HOH B O   1 
HETATM 2009 O O   . HOH E 4 .   ? 66.208 -12.292 127.979 1.00 59.76 ? 86  HOH B O   1 
HETATM 2010 O O   . HOH E 4 .   ? 66.382 -3.375  127.433 1.00 35.13 ? 89  HOH B O   1 
HETATM 2011 O O   . HOH E 4 .   ? 65.567 0.657   123.423 1.00 78.12 ? 92  HOH B O   1 
HETATM 2012 O O   . HOH E 4 .   ? 55.053 5.684   113.708 1.00 46.99 ? 95  HOH B O   1 
HETATM 2013 O O   . HOH E 4 .   ? 83.379 -17.931 92.312  1.00 57.96 ? 96  HOH B O   1 
HETATM 2014 O O   . HOH E 4 .   ? 86.822 -14.541 95.745  1.00 51.14 ? 97  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   145 ?   ?   ?   A . n 
A 1 2   GLY 2   146 ?   ?   ?   A . n 
A 1 3   ILE 3   147 ?   ?   ?   A . n 
A 1 4   SER 4   148 ?   ?   ?   A . n 
A 1 5   LEU 5   149 ?   ?   ?   A . n 
A 1 6   ASP 6   150 150 ASP ASP A . n 
A 1 7   ASN 7   151 151 ASN ASN A . n 
A 1 8   SER 8   152 152 SER SER A . n 
A 1 9   TYR 9   153 153 TYR TYR A . n 
A 1 10  LYS 10  154 154 LYS LYS A . n 
A 1 11  MET 11  155 155 MET MET A . n 
A 1 12  ASP 12  156 156 ASP ASP A . n 
A 1 13  TYR 13  156 156 TYR TYR A A n 
A 1 14  PRO 14  161 161 PRO PRO A . n 
A 1 15  GLU 15  162 162 GLU GLU A . n 
A 1 16  MET 16  162 162 MET MET A A n 
A 1 17  GLY 17  163 163 GLY GLY A . n 
A 1 18  LEU 18  164 164 LEU LEU A . n 
A 1 19  CYS 19  165 165 CYS CYS A . n 
A 1 20  ILE 20  166 166 ILE ILE A . n 
A 1 21  ILE 21  167 167 ILE ILE A . n 
A 1 22  ILE 22  168 168 ILE ILE A . n 
A 1 23  ASN 23  169 169 ASN ASN A . n 
A 1 24  ASN 24  170 170 ASN ASN A . n 
A 1 25  LYS 25  171 171 LYS LYS A . n 
A 1 26  ASN 26  172 172 ASN ASN A . n 
A 1 27  PHE 27  173 173 PHE PHE A . n 
A 1 28  HIS 28  174 174 HIS HIS A . n 
A 1 29  LYS 29  175 175 LYS LYS A . n 
A 1 30  SER 30  175 175 SER SER A A n 
A 1 31  THR 31  175 175 THR THR A B n 
A 1 32  GLY 32  175 175 GLY GLY A C n 
A 1 33  MET 33  176 176 MET MET A . n 
A 1 34  THR 34  177 177 THR THR A . n 
A 1 35  SER 35  178 178 SER SER A . n 
A 1 36  ARG 36  179 179 ARG ARG A . n 
A 1 37  SER 37  180 180 SER SER A . n 
A 1 38  GLY 38  181 181 GLY GLY A . n 
A 1 39  THR 39  182 182 THR THR A . n 
A 1 40  ASP 40  183 183 ASP ASP A . n 
A 1 41  VAL 41  184 184 VAL VAL A . n 
A 1 42  ASP 42  185 185 ASP ASP A . n 
A 1 43  ALA 43  186 186 ALA ALA A . n 
A 1 44  ALA 44  187 187 ALA ALA A . n 
A 1 45  ASN 45  188 188 ASN ASN A . n 
A 1 46  LEU 46  189 189 LEU LEU A . n 
A 1 47  ARG 47  190 190 ARG ARG A . n 
A 1 48  GLU 48  191 191 GLU GLU A . n 
A 1 49  THR 49  192 192 THR THR A . n 
A 1 50  PHE 50  193 193 PHE PHE A . n 
A 1 51  ARG 51  194 194 ARG ARG A . n 
A 1 52  ASN 52  195 195 ASN ASN A . n 
A 1 53  LEU 53  196 196 LEU LEU A . n 
A 1 54  LYS 54  197 197 LYS LYS A . n 
A 1 55  TYR 55  198 198 TYR TYR A . n 
A 1 56  GLU 56  199 199 GLU GLU A . n 
A 1 57  VAL 57  200 200 VAL VAL A . n 
A 1 58  ARG 58  201 201 ARG ARG A . n 
A 1 59  ASN 59  202 202 ASN ASN A . n 
A 1 60  LYS 60  203 203 LYS LYS A . n 
A 1 61  ASN 61  204 204 ASN ASN A . n 
A 1 62  ASP 62  205 205 ASP ASP A . n 
A 1 63  LEU 63  206 206 LEU LEU A . n 
A 1 64  THR 64  207 207 THR THR A . n 
A 1 65  ARG 65  208 208 ARG ARG A . n 
A 1 66  GLU 66  209 209 GLU GLU A . n 
A 1 67  GLU 67  210 210 GLU GLU A . n 
A 1 68  ILE 68  211 211 ILE ILE A . n 
A 1 69  VAL 69  212 212 VAL VAL A . n 
A 1 70  GLU 70  213 213 GLU GLU A . n 
A 1 71  LEU 71  214 214 LEU LEU A . n 
A 1 72  MET 72  215 215 MET MET A . n 
A 1 73  ARG 73  216 216 ARG ARG A . n 
A 1 74  ASP 74  217 217 ASP ASP A . n 
A 1 75  VAL 75  218 218 VAL VAL A . n 
A 1 76  SER 76  219 219 SER SER A . n 
A 1 77  LYS 77  220 220 LYS LYS A . n 
A 1 78  GLU 78  221 221 GLU GLU A . n 
A 1 79  ASP 79  222 222 ASP ASP A . n 
A 1 80  HIS 80  224 224 HIS HIS A . n 
A 1 81  SER 81  225 225 SER SER A . n 
A 1 82  LYS 82  226 226 LYS LYS A . n 
A 1 83  ARG 83  227 227 ARG ARG A . n 
A 1 84  SER 84  228 228 SER SER A . n 
A 1 85  SER 85  229 229 SER SER A . n 
A 1 86  PHE 86  230 230 PHE PHE A . n 
A 1 87  VAL 87  231 231 VAL VAL A . n 
A 1 88  CYS 88  232 232 CYS CYS A . n 
A 1 89  VAL 89  233 233 VAL VAL A . n 
A 1 90  LEU 90  234 234 LEU LEU A . n 
A 1 91  LEU 91  235 235 LEU LEU A . n 
A 1 92  SER 92  236 236 SER SER A . n 
A 1 93  HIS 93  237 237 HIS HIS A . n 
A 1 94  GLY 94  238 238 GLY GLY A . n 
A 1 95  GLU 95  239 239 GLU GLU A . n 
A 1 96  GLU 96  240 240 GLU GLU A . n 
A 1 97  GLY 97  241 241 GLY GLY A . n 
A 1 98  ILE 98  242 242 ILE ILE A . n 
A 1 99  ILE 99  243 243 ILE ILE A . n 
A 1 100 PHE 100 244 244 PHE PHE A . n 
A 1 101 GLY 101 245 245 GLY GLY A . n 
A 1 102 THR 102 246 246 THR THR A . n 
A 1 103 ASN 103 247 247 ASN ASN A . n 
A 1 104 GLY 104 254 254 GLY GLY A . n 
A 1 105 PRO 105 255 255 PRO PRO A . n 
A 1 106 VAL 106 256 256 VAL VAL A . n 
A 1 107 ASP 107 257 257 ASP ASP A . n 
A 1 108 LEU 108 258 258 LEU LEU A . n 
A 1 109 LYS 109 259 259 LYS LYS A . n 
A 1 110 LYS 110 260 260 LYS LYS A . n 
A 1 111 ILE 111 261 261 ILE ILE A . n 
A 1 112 THR 112 262 262 THR THR A . n 
A 1 113 ASN 113 263 263 ASN ASN A . n 
A 1 114 PHE 114 264 264 PHE PHE A . n 
A 1 115 PHE 115 265 265 PHE PHE A . n 
A 1 116 ARG 116 266 266 ARG ARG A . n 
A 1 117 GLY 117 267 267 GLY GLY A . n 
A 1 118 ASP 118 268 268 ASP ASP A . n 
A 1 119 ARG 119 269 269 ARG ARG A . n 
A 1 120 CYS 120 270 270 CYS CYS A . n 
A 1 121 ARG 121 271 271 ARG ARG A . n 
A 1 122 SER 122 272 272 SER SER A . n 
A 1 123 LEU 123 273 273 LEU LEU A . n 
A 1 124 THR 124 274 274 THR THR A . n 
A 1 125 GLY 125 275 275 GLY GLY A . n 
A 1 126 LYS 126 276 276 LYS LYS A . n 
A 1 127 PRO 127 277 277 PRO PRO A . n 
A 1 128 LYS 128 278 278 LYS LYS A . n 
A 1 129 LEU 129 279 279 LEU LEU A . n 
A 1 130 PHE 130 280 280 PHE PHE A . n 
A 1 131 ILE 131 281 281 ILE ILE A . n 
A 1 132 ILE 132 282 282 ILE ILE A . n 
A 1 133 GLN 133 283 283 GLN GLN A . n 
A 1 134 ALA 134 284 284 ALA ALA A . n 
A 1 135 CYS 135 285 285 CYS CYS A . n 
A 1 136 ARG 136 286 286 ARG ARG A . n 
A 1 137 GLY 137 287 287 GLY GLY A . n 
A 1 138 THR 138 288 288 THR THR A . n 
A 1 139 GLU 139 289 289 GLU GLU A . n 
A 1 140 LEU 140 290 290 LEU LEU A . n 
A 1 141 ASP 141 291 291 ASP ASP A . n 
A 1 142 CYS 142 292 292 CYS CYS A . n 
A 1 143 GLY 143 293 293 GLY GLY A . n 
A 1 144 ILE 144 294 294 ILE ILE A . n 
A 1 145 GLU 145 295 295 GLU GLU A . n 
A 1 146 THR 146 296 ?   ?   ?   A . n 
A 1 147 ASP 147 297 ?   ?   ?   A . n 
B 2 1   SER 1   310 ?   ?   ?   B . n 
B 2 2   GLY 2   311 ?   ?   ?   B . n 
B 2 3   VAL 3   312 ?   ?   ?   B . n 
B 2 4   ASP 4   313 ?   ?   ?   B . n 
B 2 5   ASP 5   314 ?   ?   ?   B . n 
B 2 6   ASP 6   315 ?   ?   ?   B . n 
B 2 7   MET 7   316 ?   ?   ?   B . n 
B 2 8   ALA 8   317 ?   ?   ?   B . n 
B 2 9   CYS 9   318 ?   ?   ?   B . n 
B 2 10  HIS 10  319 ?   ?   ?   B . n 
B 2 11  LYS 11  320 320 LYS LYS B . n 
B 2 12  ILE 12  321 321 ILE ILE B . n 
B 2 13  PRO 13  322 322 PRO PRO B . n 
B 2 14  VAL 14  323 323 VAL VAL B . n 
B 2 15  GLU 15  324 324 GLU GLU B . n 
B 2 16  ALA 16  325 325 ALA ALA B . n 
B 2 17  ASP 17  326 326 ASP ASP B . n 
B 2 18  PHE 18  327 327 PHE PHE B . n 
B 2 19  LEU 19  328 328 LEU LEU B . n 
B 2 20  TYR 20  329 329 TYR TYR B . n 
B 2 21  ALA 21  330 330 ALA ALA B . n 
B 2 22  TYR 22  331 331 TYR TYR B . n 
B 2 23  SER 23  332 332 SER SER B . n 
B 2 24  THR 24  333 333 THR THR B . n 
B 2 25  ALA 25  334 334 ALA ALA B . n 
B 2 26  PRO 26  335 335 PRO PRO B . n 
B 2 27  GLY 27  336 336 GLY GLY B . n 
B 2 28  TYR 28  337 337 TYR TYR B . n 
B 2 29  TYR 29  338 338 TYR TYR B . n 
B 2 30  SER 30  339 339 SER SER B . n 
B 2 31  TRP 31  340 340 TRP TRP B . n 
B 2 32  ARG 32  341 341 ARG ARG B . n 
B 2 33  ASN 33  342 342 ASN ASN B . n 
B 2 34  SER 34  343 343 SER SER B . n 
B 2 35  LYS 35  344 344 LYS LYS B . n 
B 2 36  ASP 36  345 345 ASP ASP B . n 
B 2 37  GLY 37  346 346 GLY GLY B . n 
B 2 38  SER 38  347 347 SER SER B . n 
B 2 39  TRP 39  348 348 TRP TRP B . n 
B 2 40  PHE 40  349 349 PHE PHE B . n 
B 2 41  ILE 41  350 350 ILE ILE B . n 
B 2 42  GLN 42  351 351 GLN GLN B . n 
B 2 43  SER 43  352 352 SER SER B . n 
B 2 44  LEU 44  353 353 LEU LEU B . n 
B 2 45  CYS 45  354 354 CYS CYS B . n 
B 2 46  ALA 46  355 355 ALA ALA B . n 
B 2 47  MET 47  356 356 MET MET B . n 
B 2 48  LEU 48  357 357 LEU LEU B . n 
B 2 49  LYS 49  358 358 LYS LYS B . n 
B 2 50  GLN 50  359 359 GLN GLN B . n 
B 2 51  TYR 51  360 360 TYR TYR B . n 
B 2 52  ALA 52  361 361 ALA ALA B . n 
B 2 53  ASP 53  362 362 ASP ASP B . n 
B 2 54  LYS 54  363 363 LYS LYS B . n 
B 2 55  LEU 55  364 364 LEU LEU B . n 
B 2 56  GLU 56  365 365 GLU GLU B . n 
B 2 57  PHE 57  366 366 PHE PHE B . n 
B 2 58  MET 58  367 367 MET MET B . n 
B 2 59  HIS 59  368 368 HIS HIS B . n 
B 2 60  ILE 60  369 369 ILE ILE B . n 
B 2 61  LEU 61  370 370 LEU LEU B . n 
B 2 62  THR 62  371 371 THR THR B . n 
B 2 63  ARG 63  372 372 ARG ARG B . n 
B 2 64  VAL 64  373 373 VAL VAL B . n 
B 2 65  ASN 65  374 374 ASN ASN B . n 
B 2 66  ARG 66  375 375 ARG ARG B . n 
B 2 67  LYS 67  376 376 LYS LYS B . n 
B 2 68  VAL 68  377 377 VAL VAL B . n 
B 2 69  ALA 69  378 378 ALA ALA B . n 
B 2 70  THR 70  379 379 THR THR B . n 
B 2 71  GLU 71  379 379 GLU GLU B A n 
B 2 72  PHE 72  380 380 PHE PHE B . n 
B 2 73  GLU 73  381 381 GLU GLU B . n 
B 2 74  SER 74  381 381 SER SER B A n 
B 2 75  PHE 75  381 381 PHE PHE B B n 
B 2 76  SER 76  381 381 SER SER B C n 
B 2 77  PHE 77  381 381 PHE PHE B D n 
B 2 78  ASP 78  381 381 ASP ASP B E n 
B 2 79  ALA 79  381 381 ALA ALA B F n 
B 2 80  THR 80  381 381 THR THR B G n 
B 2 81  PHE 81  381 381 PHE PHE B H n 
B 2 82  HIS 82  381 381 HIS HIS B I n 
B 2 83  ALA 83  382 382 ALA ALA B . n 
B 2 84  LYS 84  383 383 LYS LYS B . n 
B 2 85  LYS 85  384 384 LYS LYS B . n 
B 2 86  GLN 86  385 385 GLN GLN B . n 
B 2 87  ILE 87  386 386 ILE ILE B . n 
B 2 88  PRO 88  387 387 PRO PRO B . n 
B 2 89  CYS 89  388 388 CYS CYS B . n 
B 2 90  ILE 90  389 389 ILE ILE B . n 
B 2 91  VAL 91  390 390 VAL VAL B . n 
B 2 92  SER 92  392 392 SER SER B . n 
B 2 93  MET 93  393 393 MET MET B . n 
B 2 94  LEU 94  394 394 LEU LEU B . n 
B 2 95  THR 95  395 395 THR THR B . n 
B 2 96  LYS 96  396 396 LYS LYS B . n 
B 2 97  GLU 97  397 397 GLU GLU B . n 
B 2 98  LEU 98  398 398 LEU LEU B . n 
B 2 99  TYR 99  399 399 TYR TYR B . n 
B 2 100 PHE 100 400 400 PHE PHE B . n 
B 2 101 TYR 101 401 401 TYR TYR B . n 
B 2 102 HIS 102 402 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 3CY 1  501 501 3CY 3CY A . 
D 4 HOH 1  1   1   HOH HOH A . 
D 4 HOH 2  2   2   HOH HOH A . 
D 4 HOH 3  7   7   HOH HOH A . 
D 4 HOH 4  8   8   HOH HOH A . 
D 4 HOH 5  9   9   HOH HOH A . 
D 4 HOH 6  11  11  HOH HOH A . 
D 4 HOH 7  12  12  HOH HOH A . 
D 4 HOH 8  14  14  HOH HOH A . 
D 4 HOH 9  16  16  HOH HOH A . 
D 4 HOH 10 17  17  HOH HOH A . 
D 4 HOH 11 18  18  HOH HOH A . 
D 4 HOH 12 20  20  HOH HOH A . 
D 4 HOH 13 21  21  HOH HOH A . 
D 4 HOH 14 22  22  HOH HOH A . 
D 4 HOH 15 24  24  HOH HOH A . 
D 4 HOH 16 26  26  HOH HOH A . 
D 4 HOH 17 28  28  HOH HOH A . 
D 4 HOH 18 29  29  HOH HOH A . 
D 4 HOH 19 30  30  HOH HOH A . 
D 4 HOH 20 31  31  HOH HOH A . 
D 4 HOH 21 32  32  HOH HOH A . 
D 4 HOH 22 34  34  HOH HOH A . 
D 4 HOH 23 36  36  HOH HOH A . 
D 4 HOH 24 37  37  HOH HOH A . 
D 4 HOH 25 38  38  HOH HOH A . 
D 4 HOH 26 40  40  HOH HOH A . 
D 4 HOH 27 41  41  HOH HOH A . 
D 4 HOH 28 42  42  HOH HOH A . 
D 4 HOH 29 45  45  HOH HOH A . 
D 4 HOH 30 46  46  HOH HOH A . 
D 4 HOH 31 47  47  HOH HOH A . 
D 4 HOH 32 48  48  HOH HOH A . 
D 4 HOH 33 50  50  HOH HOH A . 
D 4 HOH 34 51  51  HOH HOH A . 
D 4 HOH 35 55  55  HOH HOH A . 
D 4 HOH 36 56  56  HOH HOH A . 
D 4 HOH 37 59  59  HOH HOH A . 
D 4 HOH 38 60  60  HOH HOH A . 
D 4 HOH 39 61  61  HOH HOH A . 
D 4 HOH 40 62  62  HOH HOH A . 
D 4 HOH 41 63  63  HOH HOH A . 
D 4 HOH 42 65  65  HOH HOH A . 
D 4 HOH 43 66  66  HOH HOH A . 
D 4 HOH 44 67  67  HOH HOH A . 
D 4 HOH 45 68  68  HOH HOH A . 
D 4 HOH 46 73  73  HOH HOH A . 
D 4 HOH 47 74  74  HOH HOH A . 
D 4 HOH 48 75  75  HOH HOH A . 
D 4 HOH 49 77  77  HOH HOH A . 
D 4 HOH 50 78  78  HOH HOH A . 
D 4 HOH 51 79  79  HOH HOH A . 
D 4 HOH 52 83  83  HOH HOH A . 
D 4 HOH 53 87  87  HOH HOH A . 
D 4 HOH 54 88  88  HOH HOH A . 
D 4 HOH 55 90  90  HOH HOH A . 
D 4 HOH 56 91  91  HOH HOH A . 
D 4 HOH 57 93  93  HOH HOH A . 
D 4 HOH 58 94  94  HOH HOH A . 
D 4 HOH 59 98  98  HOH HOH A . 
D 4 HOH 60 99  99  HOH HOH A . 
D 4 HOH 61 100 100 HOH HOH A . 
E 4 HOH 1  3   3   HOH HOH B . 
E 4 HOH 2  4   4   HOH HOH B . 
E 4 HOH 3  5   5   HOH HOH B . 
E 4 HOH 4  6   6   HOH HOH B . 
E 4 HOH 5  10  10  HOH HOH B . 
E 4 HOH 6  13  13  HOH HOH B . 
E 4 HOH 7  15  15  HOH HOH B . 
E 4 HOH 8  19  19  HOH HOH B . 
E 4 HOH 9  23  23  HOH HOH B . 
E 4 HOH 10 25  25  HOH HOH B . 
E 4 HOH 11 27  27  HOH HOH B . 
E 4 HOH 12 33  33  HOH HOH B . 
E 4 HOH 13 35  35  HOH HOH B . 
E 4 HOH 14 43  43  HOH HOH B . 
E 4 HOH 15 44  44  HOH HOH B . 
E 4 HOH 16 49  49  HOH HOH B . 
E 4 HOH 17 52  52  HOH HOH B . 
E 4 HOH 18 53  53  HOH HOH B . 
E 4 HOH 19 54  54  HOH HOH B . 
E 4 HOH 20 57  57  HOH HOH B . 
E 4 HOH 21 58  58  HOH HOH B . 
E 4 HOH 22 64  64  HOH HOH B . 
E 4 HOH 23 69  69  HOH HOH B . 
E 4 HOH 24 70  70  HOH HOH B . 
E 4 HOH 25 71  71  HOH HOH B . 
E 4 HOH 26 72  72  HOH HOH B . 
E 4 HOH 27 76  76  HOH HOH B . 
E 4 HOH 28 80  80  HOH HOH B . 
E 4 HOH 29 81  81  HOH HOH B . 
E 4 HOH 30 82  82  HOH HOH B . 
E 4 HOH 31 84  84  HOH HOH B . 
E 4 HOH 32 85  85  HOH HOH B . 
E 4 HOH 33 86  86  HOH HOH B . 
E 4 HOH 34 89  89  HOH HOH B . 
E 4 HOH 35 92  92  HOH HOH B . 
E 4 HOH 36 95  95  HOH HOH B . 
E 4 HOH 37 96  96  HOH HOH B . 
E 4 HOH 38 97  97  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15380 ? 
1 MORE         -74   ? 
1 'SSA (A^2)'  17220 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 139.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2022-12-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 5 'Structure model' database_2         
3 5 'Structure model' struct_conn        
4 5 'Structure model' struct_ref_seq_dif 
5 5 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'                      
2 5 'Structure model' '_database_2.pdbx_DOI'                
3 5 'Structure model' '_database_2.pdbx_database_accession' 
4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 5 'Structure model' '_struct_ref_seq_dif.details'         
6 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX    refinement       2002       ? 1 
X-GEN  'data reduction' .          ? 2 
SAINT  'data scaling'   'V. 4.050' ? 3 
X-PLOR phasing          .          ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             SG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                97.81 
_pdbx_validate_rmsd_angle.angle_target_value         114.00 
_pdbx_validate_rmsd_angle.angle_deviation            -16.19 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.80 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 205 ? ? 35.46   74.76   
2 1 SER A 236 ? ? -177.88 -168.21 
3 1 CYS A 270 ? ? -118.84 74.65   
4 1 LYS B 363 ? ? -141.72 -27.18  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 145 ? A SER 1   
2  1 Y 1 A GLY 146 ? A GLY 2   
3  1 Y 1 A ILE 147 ? A ILE 3   
4  1 Y 1 A SER 148 ? A SER 4   
5  1 Y 1 A LEU 149 ? A LEU 5   
6  1 Y 1 A THR 296 ? A THR 146 
7  1 Y 1 A ASP 297 ? A ASP 147 
8  1 Y 1 B SER 310 ? B SER 1   
9  1 Y 1 B GLY 311 ? B GLY 2   
10 1 Y 1 B VAL 312 ? B VAL 3   
11 1 Y 1 B ASP 313 ? B ASP 4   
12 1 Y 1 B ASP 314 ? B ASP 5   
13 1 Y 1 B ASP 315 ? B ASP 6   
14 1 Y 1 B MET 316 ? B MET 7   
15 1 Y 1 B ALA 317 ? B ALA 8   
16 1 Y 1 B CYS 318 ? B CYS 9   
17 1 Y 1 B HIS 319 ? B HIS 10  
18 1 Y 1 B HIS 402 ? B HIS 102 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;(3S)-3-[({(2S)-5-[(N-ACETYL-L-ALPHA-ASPARTYL)AMINO]-4-OXO-1,2,4,5,6,7-HEXAHYDROAZEPINO[3,2,1-HI]INDOL-2-YL}CARBONYL)AMINO]-5-(BENZYLSULFANYL)-4-OXOPENTANOIC ACID
;
3CY 
4 water HOH 
#