data_1RL3
# 
_entry.id   1RL3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RL3         
RCSB  RCSB020854   
WWPDB D_1000020854 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RGS 'Crystal structure of cAMP-bound R1a subunit of PKA'           unspecified 
PDB 1NE4 'Crystal structure of Rp-cAMP analog bound R1a subunit of PKA' unspecified 
PDB 1NE6 'Crystal structure of Sp-cAMP analog bound R1a subunit of PKA' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RL3 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, J.'       1 
'Brown, S.'    2 
'Xuong, N.-H.' 3 
'Taylor, S.S.' 4 
# 
_citation.id                        primary 
_citation.title                     
'RIalpha subunit of PKA: a cAMP-free structure reveals a hydrophobic capping mechanism for docking cAMP into site B.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            12 
_citation.page_first                1057 
_citation.page_last                 1065 
_citation.year                      2004 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15274925 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.03.022 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, J.'       1 
primary 'Brown, S.'    2 
primary 'Xuong, N.H.'  3 
primary 'Taylor, S.S.' 4 
# 
_cell.entry_id           1RL3 
_cell.length_a           90.3 
_cell.length_b           90.3 
_cell.length_c           177.6 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        120 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
# 
_symmetry.entry_id                         1RL3 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                170 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'cAMP-dependent protein kinase type I-alpha regulatory chain' 32493.854 2  ? ? ? ? 
2 non-polymer syn 'CYCLIC GUANOSINE MONOPHOSPHATE'                              345.205   2  ? ? ? ? 
3 non-polymer syn GLYCEROL                                                      92.094    3  ? ? ? ? 
4 water       nat water                                                         18.015    17 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDN
FYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKV
SILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDN
FYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKV
SILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   ARG n 
1 3   ARG n 
1 4   ARG n 
1 5   GLY n 
1 6   ALA n 
1 7   ILE n 
1 8   SER n 
1 9   ALA n 
1 10  GLU n 
1 11  VAL n 
1 12  TYR n 
1 13  THR n 
1 14  GLU n 
1 15  GLU n 
1 16  ASP n 
1 17  ALA n 
1 18  ALA n 
1 19  SER n 
1 20  TYR n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  VAL n 
1 25  ILE n 
1 26  PRO n 
1 27  LYS n 
1 28  ASP n 
1 29  TYR n 
1 30  LYS n 
1 31  THR n 
1 32  MET n 
1 33  ALA n 
1 34  ALA n 
1 35  LEU n 
1 36  ALA n 
1 37  LYS n 
1 38  ALA n 
1 39  ILE n 
1 40  GLU n 
1 41  LYS n 
1 42  ASN n 
1 43  VAL n 
1 44  LEU n 
1 45  PHE n 
1 46  SER n 
1 47  HIS n 
1 48  LEU n 
1 49  ASP n 
1 50  ASP n 
1 51  ASN n 
1 52  GLU n 
1 53  ARG n 
1 54  SER n 
1 55  ASP n 
1 56  ILE n 
1 57  PHE n 
1 58  ASP n 
1 59  ALA n 
1 60  MET n 
1 61  PHE n 
1 62  PRO n 
1 63  VAL n 
1 64  SER n 
1 65  PHE n 
1 66  ILE n 
1 67  ALA n 
1 68  GLY n 
1 69  GLU n 
1 70  THR n 
1 71  VAL n 
1 72  ILE n 
1 73  GLN n 
1 74  GLN n 
1 75  GLY n 
1 76  ASP n 
1 77  GLU n 
1 78  GLY n 
1 79  ASP n 
1 80  ASN n 
1 81  PHE n 
1 82  TYR n 
1 83  VAL n 
1 84  ILE n 
1 85  ASP n 
1 86  GLN n 
1 87  GLY n 
1 88  GLU n 
1 89  MET n 
1 90  ASP n 
1 91  VAL n 
1 92  TYR n 
1 93  VAL n 
1 94  ASN n 
1 95  ASN n 
1 96  GLU n 
1 97  TRP n 
1 98  ALA n 
1 99  THR n 
1 100 SER n 
1 101 VAL n 
1 102 GLY n 
1 103 GLU n 
1 104 GLY n 
1 105 GLY n 
1 106 SER n 
1 107 PHE n 
1 108 GLY n 
1 109 GLU n 
1 110 LEU n 
1 111 ALA n 
1 112 LEU n 
1 113 ILE n 
1 114 TYR n 
1 115 GLY n 
1 116 THR n 
1 117 PRO n 
1 118 ARG n 
1 119 ALA n 
1 120 ALA n 
1 121 THR n 
1 122 VAL n 
1 123 LYS n 
1 124 ALA n 
1 125 LYS n 
1 126 THR n 
1 127 ASN n 
1 128 VAL n 
1 129 LYS n 
1 130 LEU n 
1 131 TRP n 
1 132 GLY n 
1 133 ILE n 
1 134 ASP n 
1 135 ARG n 
1 136 ASP n 
1 137 SER n 
1 138 TYR n 
1 139 ARG n 
1 140 ARG n 
1 141 ILE n 
1 142 LEU n 
1 143 MET n 
1 144 GLY n 
1 145 SER n 
1 146 THR n 
1 147 LEU n 
1 148 ARG n 
1 149 LYS n 
1 150 ARG n 
1 151 LYS n 
1 152 MET n 
1 153 TYR n 
1 154 GLU n 
1 155 GLU n 
1 156 PHE n 
1 157 LEU n 
1 158 SER n 
1 159 LYS n 
1 160 VAL n 
1 161 SER n 
1 162 ILE n 
1 163 LEU n 
1 164 GLU n 
1 165 SER n 
1 166 LEU n 
1 167 ASP n 
1 168 LYS n 
1 169 TRP n 
1 170 GLU n 
1 171 ARG n 
1 172 LEU n 
1 173 THR n 
1 174 VAL n 
1 175 ALA n 
1 176 ASP n 
1 177 ALA n 
1 178 LEU n 
1 179 GLU n 
1 180 PRO n 
1 181 VAL n 
1 182 GLN n 
1 183 PHE n 
1 184 GLU n 
1 185 ASP n 
1 186 GLY n 
1 187 GLN n 
1 188 LYS n 
1 189 ILE n 
1 190 VAL n 
1 191 VAL n 
1 192 GLN n 
1 193 GLY n 
1 194 GLU n 
1 195 PRO n 
1 196 GLY n 
1 197 ASP n 
1 198 GLU n 
1 199 PHE n 
1 200 PHE n 
1 201 ILE n 
1 202 ILE n 
1 203 LEU n 
1 204 GLU n 
1 205 GLY n 
1 206 SER n 
1 207 ALA n 
1 208 ALA n 
1 209 VAL n 
1 210 LEU n 
1 211 GLN n 
1 212 ARG n 
1 213 ARG n 
1 214 SER n 
1 215 GLU n 
1 216 ASN n 
1 217 GLU n 
1 218 GLU n 
1 219 PHE n 
1 220 VAL n 
1 221 GLU n 
1 222 VAL n 
1 223 GLY n 
1 224 ARG n 
1 225 LEU n 
1 226 GLY n 
1 227 PRO n 
1 228 SER n 
1 229 ASP n 
1 230 TYR n 
1 231 PHE n 
1 232 GLY n 
1 233 GLU n 
1 234 ILE n 
1 235 ALA n 
1 236 LEU n 
1 237 LEU n 
1 238 MET n 
1 239 ASN n 
1 240 ARG n 
1 241 PRO n 
1 242 ARG n 
1 243 ALA n 
1 244 ALA n 
1 245 THR n 
1 246 VAL n 
1 247 VAL n 
1 248 ALA n 
1 249 ARG n 
1 250 GLY n 
1 251 PRO n 
1 252 LEU n 
1 253 LYS n 
1 254 CYS n 
1 255 VAL n 
1 256 LYS n 
1 257 LEU n 
1 258 ASP n 
1 259 ARG n 
1 260 PRO n 
1 261 ARG n 
1 262 PHE n 
1 263 GLU n 
1 264 ARG n 
1 265 VAL n 
1 266 LEU n 
1 267 GLY n 
1 268 PRO n 
1 269 CYS n 
1 270 SER n 
1 271 ASP n 
1 272 ILE n 
1 273 LEU n 
1 274 LYS n 
1 275 ARG n 
1 276 ASN n 
1 277 ILE n 
1 278 GLN n 
1 279 GLN n 
1 280 TYR n 
1 281 ASN n 
1 282 SER n 
1 283 PHE n 
1 284 VAL n 
1 285 SER n 
1 286 LEU n 
1 287 SER n 
1 288 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 PRKAR1A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KAP0_BOVIN 
_struct_ref.pdbx_db_accession          P00514 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDN
FYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKV
SILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
;
_struct_ref.pdbx_align_begin           92 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RL3 A 1 ? 288 ? P00514 92 ? 379 ? 92  379 
2 1 1RL3 B 1 ? 288 ? P00514 92 ? 379 ? 492 779 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                          ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                         ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                       ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                  ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                         ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                        ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                  ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                          ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                        ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                            ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                       ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                          ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                           ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                       ?                               'C5 H11 N O2 S'   149.211 
PCG non-polymer         . 'CYCLIC GUANOSINE MONOPHOSPHATE' ?                               'C10 H12 N5 O7 P' 345.205 
PHE 'L-peptide linking' y PHENYLALANINE                    ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                          ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                           ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                        ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                       ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                         ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                           ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RL3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.75 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.22 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295.5 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'NH4SO4, glycerol, DTT, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295.5K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double-crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     1RL3 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.7 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   22489 
_reflns.number_obs                   21075 
_reflns.percent_possible_obs         93.7 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        15.7 
_reflns.pdbx_redundancy              2.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   93.1 
_reflns_shell.Rmerge_I_obs           0.458 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2495 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1RL3 
_refine.ls_d_res_high                            2.70 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     22489 
_refine.ls_number_reflns_obs                     21075 
_refine.ls_number_reflns_R_free                  1642 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.24 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'PDB entry 1RGS' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -5.13 
_refine.aniso_B[1][2]                            11.15 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -5.13 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            10.26 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RL3 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3927 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             17 
_refine_hist.number_atoms_total               4008 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg        1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.18  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.80 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.345 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.418 
_refine_ls_shell.R_factor_R_free_error            0.043 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.number_reflns_obs                896 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1RL3 
_struct.title                     'Crystal structure of cAMP-free R1a subunit of PKA' 
_struct.pdbx_descriptor           'cAMP-dependent protein kinase type I-alpha regulatory chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RL3 
_struct_keywords.pdbx_keywords   KINASE 
_struct_keywords.text            'Type 1a regulatory subunit, cAMP-dependent protein kinase, cAMP-free, KINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 28  ? ASN A 42  ? ASP A 119 ASN A 133 1 ? 15 
HELX_P HELX_P2  2  ASP A 49  ? MET A 60  ? ASP A 140 MET A 151 1 ? 12 
HELX_P HELX_P3  3  GLY A 108 ? GLY A 115 ? GLY A 199 GLY A 206 1 ? 8  
HELX_P HELX_P4  4  ARG A 135 ? LEU A 142 ? ARG A 226 LEU A 233 1 ? 8  
HELX_P HELX_P5  5  LEU A 142 ? MET A 152 ? LEU A 233 MET A 243 1 ? 11 
HELX_P HELX_P6  6  TYR A 153 ? LYS A 159 ? TYR A 244 LYS A 250 1 ? 7  
HELX_P HELX_P7  7  VAL A 160 ? LEU A 166 ? VAL A 251 LEU A 257 5 ? 7  
HELX_P HELX_P8  8  ASP A 167 ? LEU A 178 ? ASP A 258 LEU A 269 1 ? 12 
HELX_P HELX_P9  9  GLY A 232 ? MET A 238 ? GLY A 323 MET A 329 1 ? 7  
HELX_P HELX_P10 10 ARG A 259 ? LEU A 266 ? ARG A 350 LEU A 357 1 ? 8  
HELX_P HELX_P11 11 ASP A 271 ? PHE A 283 ? ASP A 362 PHE A 374 1 ? 13 
HELX_P HELX_P12 12 TYR B 29  ? ASN B 42  ? TYR B 520 ASN B 533 1 ? 14 
HELX_P HELX_P13 13 VAL B 43  ? SER B 46  ? VAL B 534 SER B 537 5 ? 4  
HELX_P HELX_P14 14 ASN B 51  ? MET B 60  ? ASN B 542 MET B 551 1 ? 10 
HELX_P HELX_P15 15 GLY B 108 ? GLY B 115 ? GLY B 599 GLY B 606 1 ? 8  
HELX_P HELX_P16 16 ARG B 135 ? LEU B 142 ? ARG B 626 LEU B 633 1 ? 8  
HELX_P HELX_P17 17 LEU B 142 ? LYS B 159 ? LEU B 633 LYS B 650 1 ? 18 
HELX_P HELX_P18 18 VAL B 160 ? GLU B 164 ? VAL B 651 GLU B 655 5 ? 5  
HELX_P HELX_P19 19 ASP B 167 ? LEU B 178 ? ASP B 658 LEU B 669 1 ? 12 
HELX_P HELX_P20 20 ILE B 234 ? ASN B 239 ? ILE B 725 ASN B 730 1 ? 6  
HELX_P HELX_P21 21 ARG B 259 ? LEU B 266 ? ARG B 750 LEU B 757 1 ? 8  
HELX_P HELX_P22 22 CYS B 269 ? ARG B 275 ? CYS B 760 ARG B 766 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 61  ? PHE A 65  ? PHE A 152 PHE A 156 
A 2 VAL A 128 ? ASP A 134 ? VAL A 219 ASP A 225 
A 3 ASN A 80  ? GLN A 86  ? ASN A 171 GLN A 177 
A 4 SER A 106 ? PHE A 107 ? SER A 197 PHE A 198 
B 1 THR A 70  ? GLN A 74  ? THR A 161 GLN A 165 
B 2 ALA A 119 ? ALA A 124 ? ALA A 210 ALA A 215 
B 3 MET A 89  ? VAL A 93  ? MET A 180 VAL A 184 
B 4 GLU A 96  ? TRP A 97  ? GLU A 187 TRP A 188 
C 1 GLU A 179 ? PRO A 180 ? GLU A 270 PRO A 271 
C 2 LYS A 253 ? ASP A 258 ? LYS A 344 ASP A 349 
C 3 GLU A 198 ? GLU A 204 ? GLU A 289 GLU A 295 
C 4 TYR A 230 ? PHE A 231 ? TYR A 321 PHE A 322 
D 1 ARG A 224 ? LEU A 225 ? ARG A 315 LEU A 316 
D 2 ALA A 207 ? GLN A 211 ? ALA A 298 GLN A 302 
D 3 ALA A 244 ? VAL A 246 ? ALA A 335 VAL A 337 
E 1 PHE B 61  ? PHE B 65  ? PHE B 552 PHE B 556 
E 2 VAL B 128 ? ASP B 134 ? VAL B 619 ASP B 625 
E 3 ASN B 80  ? GLN B 86  ? ASN B 571 GLN B 577 
E 4 SER B 106 ? PHE B 107 ? SER B 597 PHE B 598 
F 1 THR B 70  ? ILE B 72  ? THR B 561 ILE B 563 
F 2 THR B 121 ? ALA B 124 ? THR B 612 ALA B 615 
F 3 MET B 89  ? TYR B 92  ? MET B 580 TYR B 583 
G 1 GLU B 179 ? PHE B 183 ? GLU B 670 PHE B 674 
G 2 LEU B 252 ? ASP B 258 ? LEU B 743 ASP B 749 
G 3 GLU B 198 ? GLU B 204 ? GLU B 689 GLU B 695 
G 4 TYR B 230 ? PHE B 231 ? TYR B 721 PHE B 722 
H 1 VAL B 220 ? LEU B 225 ? VAL B 711 LEU B 716 
H 2 ALA B 207 ? GLN B 211 ? ALA B 698 GLN B 702 
H 3 THR B 245 ? VAL B 247 ? THR B 736 VAL B 738 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 65  ? N PHE A 156 O VAL A 128 ? O VAL A 219 
A 2 3 O TRP A 131 ? O TRP A 222 N VAL A 83  ? N VAL A 174 
A 3 4 N TYR A 82  ? N TYR A 173 O PHE A 107 ? O PHE A 198 
B 1 2 N ILE A 72  ? N ILE A 163 O VAL A 122 ? O VAL A 213 
B 2 3 O LYS A 123 ? O LYS A 214 N ASP A 90  ? N ASP A 181 
B 3 4 N VAL A 93  ? N VAL A 184 O GLU A 96  ? O GLU A 187 
C 1 2 N GLU A 179 ? N GLU A 270 O LYS A 256 ? O LYS A 347 
C 2 3 O LYS A 253 ? O LYS A 344 N GLU A 204 ? N GLU A 295 
C 3 4 N PHE A 200 ? N PHE A 291 O PHE A 231 ? O PHE A 322 
D 1 2 O LEU A 225 ? O LEU A 316 N ALA A 207 ? N ALA A 298 
D 2 3 N LEU A 210 ? N LEU A 301 O THR A 245 ? O THR A 336 
E 1 2 N VAL B 63  ? N VAL B 554 O LEU B 130 ? O LEU B 621 
E 2 3 O TRP B 131 ? O TRP B 622 N VAL B 83  ? N VAL B 574 
E 3 4 N TYR B 82  ? N TYR B 573 O PHE B 107 ? O PHE B 598 
F 1 2 N ILE B 72  ? N ILE B 563 O VAL B 122 ? O VAL B 613 
F 2 3 O LYS B 123 ? O LYS B 614 N ASP B 90  ? N ASP B 581 
G 1 2 N VAL B 181 ? N VAL B 672 O CYS B 254 ? O CYS B 745 
G 2 3 O LYS B 253 ? O LYS B 744 N GLU B 204 ? N GLU B 695 
G 3 4 N PHE B 200 ? N PHE B 691 O PHE B 231 ? O PHE B 722 
H 1 2 O LEU B 225 ? O LEU B 716 N ALA B 207 ? N ALA B 698 
H 2 3 N LEU B 210 ? N LEU B 701 O THR B 245 ? O THR B 736 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PCG A 401' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PCG B 801' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 402' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL B 802' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL B 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  VAL A 91  ? VAL A 182 . ? 1_555 ? 
2  AC1 9  PHE A 107 ? PHE A 198 . ? 1_555 ? 
3  AC1 9  GLY A 108 ? GLY A 199 . ? 1_555 ? 
4  AC1 9  GLU A 109 ? GLU A 200 . ? 1_555 ? 
5  AC1 9  LEU A 110 ? LEU A 201 . ? 1_555 ? 
6  AC1 9  ALA A 111 ? ALA A 202 . ? 1_555 ? 
7  AC1 9  ARG A 118 ? ARG A 209 . ? 1_555 ? 
8  AC1 9  ALA A 119 ? ALA A 210 . ? 1_555 ? 
9  AC1 9  TRP A 169 ? TRP A 260 . ? 1_555 ? 
10 AC2 11 PHE A 283 ? PHE A 374 . ? 1_665 ? 
11 AC2 11 PHE B 107 ? PHE B 598 . ? 1_555 ? 
12 AC2 11 GLY B 108 ? GLY B 599 . ? 1_555 ? 
13 AC2 11 GLU B 109 ? GLU B 600 . ? 1_555 ? 
14 AC2 11 LEU B 110 ? LEU B 601 . ? 1_555 ? 
15 AC2 11 ALA B 111 ? ALA B 602 . ? 1_555 ? 
16 AC2 11 PRO B 117 ? PRO B 608 . ? 1_555 ? 
17 AC2 11 ARG B 118 ? ARG B 609 . ? 1_555 ? 
18 AC2 11 ALA B 119 ? ALA B 610 . ? 1_555 ? 
19 AC2 11 ALA B 120 ? ALA B 611 . ? 1_555 ? 
20 AC2 11 TRP B 169 ? TRP B 660 . ? 1_555 ? 
21 AC3 3  GLY A 232 ? GLY A 323 . ? 1_555 ? 
22 AC3 3  ILE A 234 ? ILE A 325 . ? 1_555 ? 
23 AC3 3  ALA A 235 ? ALA A 326 . ? 1_555 ? 
24 AC4 5  GLY B 232 ? GLY B 723 . ? 1_555 ? 
25 AC4 5  ILE B 234 ? ILE B 725 . ? 1_555 ? 
26 AC4 5  ALA B 235 ? ALA B 726 . ? 1_555 ? 
27 AC4 5  ALA B 243 ? ALA B 734 . ? 1_555 ? 
28 AC4 5  ALA B 244 ? ALA B 735 . ? 1_555 ? 
29 AC5 4  GLY B 68  ? GLY B 559 . ? 1_555 ? 
30 AC5 4  GLU B 69  ? GLU B 560 . ? 1_555 ? 
31 AC5 4  THR B 70  ? THR B 561 . ? 1_555 ? 
32 AC5 4  LYS B 123 ? LYS B 614 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1RL3 
_atom_sites.fract_transf_matrix[1][1]   0.011074 
_atom_sites.fract_transf_matrix[1][2]   0.006394 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012787 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005631 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 18  ? 31.860 79.318  -21.026 1.00 50.75  ? 109 ALA A N     1 
ATOM   2    C CA    . ALA A 1 18  ? 32.965 79.932  -20.237 1.00 50.25  ? 109 ALA A CA    1 
ATOM   3    C C     . ALA A 1 18  ? 32.887 79.564  -18.761 1.00 50.20  ? 109 ALA A C     1 
ATOM   4    O O     . ALA A 1 18  ? 32.151 80.163  -17.986 1.00 50.28  ? 109 ALA A O     1 
ATOM   5    C CB    . ALA A 1 18  ? 32.939 81.447  -20.396 1.00 50.55  ? 109 ALA A CB    1 
ATOM   6    N N     . SER A 1 19  ? 33.664 78.568  -18.373 1.00 51.96  ? 110 SER A N     1 
ATOM   7    C CA    . SER A 1 19  ? 33.694 78.118  -16.987 1.00 53.90  ? 110 SER A CA    1 
ATOM   8    C C     . SER A 1 19  ? 34.350 79.172  -16.113 1.00 56.23  ? 110 SER A C     1 
ATOM   9    O O     . SER A 1 19  ? 34.919 80.147  -16.616 1.00 57.37  ? 110 SER A O     1 
ATOM   10   C CB    . SER A 1 19  ? 34.564 76.852  -16.865 1.00 52.78  ? 110 SER A CB    1 
ATOM   11   O OG    . SER A 1 19  ? 35.842 77.016  -17.472 1.00 46.80  ? 110 SER A OG    1 
ATOM   12   N N     . TYR A 1 20  ? 34.258 78.992  -14.803 1.00 57.07  ? 111 TYR A N     1 
ATOM   13   C CA    . TYR A 1 20  ? 34.919 79.910  -13.901 1.00 59.07  ? 111 TYR A CA    1 
ATOM   14   C C     . TYR A 1 20  ? 35.569 79.015  -12.858 1.00 59.56  ? 111 TYR A C     1 
ATOM   15   O O     . TYR A 1 20  ? 34.912 78.456  -11.990 1.00 60.28  ? 111 TYR A O     1 
ATOM   16   C CB    . TYR A 1 20  ? 33.866 80.958  -13.430 1.00 60.11  ? 111 TYR A CB    1 
ATOM   17   C CG    . TYR A 1 20  ? 32.941 80.616  -12.279 1.00 62.51  ? 111 TYR A CG    1 
ATOM   18   C CD1   . TYR A 1 20  ? 33.362 80.760  -10.956 1.00 64.03  ? 111 TYR A CD1   1 
ATOM   19   C CD2   . TYR A 1 20  ? 31.614 80.250  -12.507 1.00 64.27  ? 111 TYR A CD2   1 
ATOM   20   C CE1   . TYR A 1 20  ? 32.487 80.559  -9.884  1.00 65.32  ? 111 TYR A CE1   1 
ATOM   21   C CE2   . TYR A 1 20  ? 30.721 80.043  -11.437 1.00 65.73  ? 111 TYR A CE2   1 
ATOM   22   C CZ    . TYR A 1 20  ? 31.168 80.205  -10.123 1.00 66.30  ? 111 TYR A CZ    1 
ATOM   23   O OH    . TYR A 1 20  ? 30.305 80.044  -9.048  1.00 66.05  ? 111 TYR A OH    1 
ATOM   24   N N     . VAL A 1 21  ? 36.886 78.844  -12.991 1.00 60.51  ? 112 VAL A N     1 
ATOM   25   C CA    . VAL A 1 21  ? 37.663 77.984  -12.088 1.00 61.74  ? 112 VAL A CA    1 
ATOM   26   C C     . VAL A 1 21  ? 37.897 78.711  -10.754 1.00 62.17  ? 112 VAL A C     1 
ATOM   27   O O     . VAL A 1 21  ? 38.960 78.588  -10.132 1.00 62.44  ? 112 VAL A O     1 
ATOM   28   C CB    . VAL A 1 21  ? 39.067 77.591  -12.666 1.00 61.31  ? 112 VAL A CB    1 
ATOM   29   C CG1   . VAL A 1 21  ? 38.888 76.753  -13.937 1.00 61.54  ? 112 VAL A CG1   1 
ATOM   30   C CG2   . VAL A 1 21  ? 39.912 78.826  -12.924 1.00 60.32  ? 112 VAL A CG2   1 
ATOM   31   N N     . ARG A 1 22  ? 36.884 79.444  -10.313 1.00 61.36  ? 113 ARG A N     1 
ATOM   32   C CA    . ARG A 1 22  ? 36.979 80.171  -9.070  1.00 59.97  ? 113 ARG A CA    1 
ATOM   33   C C     . ARG A 1 22  ? 35.776 79.916  -8.189  1.00 59.75  ? 113 ARG A C     1 
ATOM   34   O O     . ARG A 1 22  ? 34.768 79.345  -8.604  1.00 59.76  ? 113 ARG A O     1 
ATOM   35   C CB    . ARG A 1 22  ? 37.084 81.637  -9.348  1.00 60.54  ? 113 ARG A CB    1 
ATOM   36   N N     . LYS A 1 23  ? 35.927 80.371  -6.957  1.00 59.27  ? 114 LYS A N     1 
ATOM   37   C CA    . LYS A 1 23  ? 34.936 80.265  -5.902  1.00 58.68  ? 114 LYS A CA    1 
ATOM   38   C C     . LYS A 1 23  ? 35.809 80.462  -4.676  1.00 59.49  ? 114 LYS A C     1 
ATOM   39   O O     . LYS A 1 23  ? 35.356 80.397  -3.524  1.00 60.97  ? 114 LYS A O     1 
ATOM   40   C CB    . LYS A 1 23  ? 34.288 78.887  -5.880  1.00 56.04  ? 114 LYS A CB    1 
ATOM   41   C CG    . LYS A 1 23  ? 32.776 78.954  -5.780  1.00 53.67  ? 114 LYS A CG    1 
ATOM   42   C CD    . LYS A 1 23  ? 32.314 79.692  -4.531  1.00 51.89  ? 114 LYS A CD    1 
ATOM   43   C CE    . LYS A 1 23  ? 30.801 79.805  -4.505  1.00 49.72  ? 114 LYS A CE    1 
ATOM   44   N NZ    . LYS A 1 23  ? 30.286 80.370  -3.245  1.00 49.19  ? 114 LYS A NZ    1 
ATOM   45   N N     . VAL A 1 24  ? 37.081 80.716  -4.972  1.00 57.19  ? 115 VAL A N     1 
ATOM   46   C CA    . VAL A 1 24  ? 38.107 80.958  -3.979  1.00 54.49  ? 115 VAL A CA    1 
ATOM   47   C C     . VAL A 1 24  ? 37.561 81.568  -2.680  1.00 51.81  ? 115 VAL A C     1 
ATOM   48   O O     . VAL A 1 24  ? 37.103 82.701  -2.664  1.00 50.36  ? 115 VAL A O     1 
ATOM   49   C CB    . VAL A 1 24  ? 39.201 81.867  -4.591  1.00 53.18  ? 115 VAL A CB    1 
ATOM   50   N N     . ILE A 1 25  ? 37.610 80.790  -1.604  1.00 50.03  ? 116 ILE A N     1 
ATOM   51   C CA    . ILE A 1 25  ? 37.164 81.235  -0.293  1.00 48.80  ? 116 ILE A CA    1 
ATOM   52   C C     . ILE A 1 25  ? 38.270 80.946  0.774   1.00 48.75  ? 116 ILE A C     1 
ATOM   53   O O     . ILE A 1 25  ? 38.384 79.845  1.310   1.00 47.32  ? 116 ILE A O     1 
ATOM   54   C CB    . ILE A 1 25  ? 35.767 80.593  0.060   1.00 47.39  ? 116 ILE A CB    1 
ATOM   55   C CG1   . ILE A 1 25  ? 35.732 80.110  1.515   1.00 47.12  ? 116 ILE A CG1   1 
ATOM   56   C CG2   . ILE A 1 25  ? 35.444 79.477  -0.910  1.00 44.98  ? 116 ILE A CG2   1 
ATOM   57   C CD1   . ILE A 1 25  ? 34.380 79.618  1.959   1.00 45.29  ? 116 ILE A CD1   1 
ATOM   58   N N     . PRO A 1 26  ? 39.058 81.988  1.124   1.00 49.20  ? 117 PRO A N     1 
ATOM   59   C CA    . PRO A 1 26  ? 40.171 82.072  2.074   1.00 48.21  ? 117 PRO A CA    1 
ATOM   60   C C     . PRO A 1 26  ? 40.585 80.909  2.978   1.00 47.99  ? 117 PRO A C     1 
ATOM   61   O O     . PRO A 1 26  ? 41.608 80.265  2.721   1.00 46.93  ? 117 PRO A O     1 
ATOM   62   C CB    . PRO A 1 26  ? 39.827 83.320  2.851   1.00 47.43  ? 117 PRO A CB    1 
ATOM   63   C CG    . PRO A 1 26  ? 39.457 84.227  1.727   1.00 49.36  ? 117 PRO A CG    1 
ATOM   64   C CD    . PRO A 1 26  ? 38.624 83.358  0.780   1.00 50.00  ? 117 PRO A CD    1 
ATOM   65   N N     . LYS A 1 27  ? 39.832 80.650  4.041   1.00 47.40  ? 118 LYS A N     1 
ATOM   66   C CA    . LYS A 1 27  ? 40.209 79.568  4.960   1.00 47.22  ? 118 LYS A CA    1 
ATOM   67   C C     . LYS A 1 27  ? 41.568 79.784  5.673   1.00 46.36  ? 118 LYS A C     1 
ATOM   68   O O     . LYS A 1 27  ? 42.622 79.884  5.019   1.00 44.60  ? 118 LYS A O     1 
ATOM   69   C CB    . LYS A 1 27  ? 40.333 78.235  4.184   1.00 47.59  ? 118 LYS A CB    1 
ATOM   70   C CG    . LYS A 1 27  ? 38.997 77.557  3.864   1.00 45.65  ? 118 LYS A CG    1 
ATOM   71   C CD    . LYS A 1 27  ? 39.134 76.408  2.882   1.00 44.50  ? 118 LYS A CD    1 
ATOM   72   C CE    . LYS A 1 27  ? 39.221 76.884  1.440   1.00 44.64  ? 118 LYS A CE    1 
ATOM   73   N NZ    . LYS A 1 27  ? 40.394 77.779  1.206   1.00 45.40  ? 118 LYS A NZ    1 
ATOM   74   N N     . ASP A 1 28  ? 41.544 79.870  7.005   1.00 44.10  ? 119 ASP A N     1 
ATOM   75   C CA    . ASP A 1 28  ? 42.777 80.079  7.749   1.00 44.02  ? 119 ASP A CA    1 
ATOM   76   C C     . ASP A 1 28  ? 43.737 78.871  7.723   1.00 45.00  ? 119 ASP A C     1 
ATOM   77   O O     . ASP A 1 28  ? 43.605 77.997  6.854   1.00 46.29  ? 119 ASP A O     1 
ATOM   78   C CB    . ASP A 1 28  ? 42.432 80.401  9.206   1.00 42.38  ? 119 ASP A CB    1 
ATOM   79   C CG    . ASP A 1 28  ? 42.075 79.173  10.001  1.00 43.85  ? 119 ASP A CG    1 
ATOM   80   O OD1   . ASP A 1 28  ? 41.723 79.330  11.190  1.00 45.27  ? 119 ASP A OD1   1 
ATOM   81   O OD2   . ASP A 1 28  ? 42.150 78.052  9.459   1.00 43.72  ? 119 ASP A OD2   1 
ATOM   82   N N     . TYR A 1 29  ? 44.702 78.809  8.646   1.00 43.08  ? 120 TYR A N     1 
ATOM   83   C CA    . TYR A 1 29  ? 45.637 77.690  8.682   1.00 40.20  ? 120 TYR A CA    1 
ATOM   84   C C     . TYR A 1 29  ? 45.117 76.357  9.155   1.00 41.44  ? 120 TYR A C     1 
ATOM   85   O O     . TYR A 1 29  ? 45.104 75.389  8.405   1.00 43.78  ? 120 TYR A O     1 
ATOM   86   C CB    . TYR A 1 29  ? 46.877 78.069  9.451   1.00 39.68  ? 120 TYR A CB    1 
ATOM   87   C CG    . TYR A 1 29  ? 47.942 76.985  9.509   1.00 38.34  ? 120 TYR A CG    1 
ATOM   88   C CD1   . TYR A 1 29  ? 48.529 76.490  8.343   1.00 39.67  ? 120 TYR A CD1   1 
ATOM   89   C CD2   . TYR A 1 29  ? 48.343 76.438  10.721  1.00 38.06  ? 120 TYR A CD2   1 
ATOM   90   C CE1   . TYR A 1 29  ? 49.487 75.477  8.381   1.00 37.66  ? 120 TYR A CE1   1 
ATOM   91   C CE2   . TYR A 1 29  ? 49.300 75.424  10.774  1.00 39.23  ? 120 TYR A CE2   1 
ATOM   92   C CZ    . TYR A 1 29  ? 49.869 74.950  9.599   1.00 38.67  ? 120 TYR A CZ    1 
ATOM   93   O OH    . TYR A 1 29  ? 50.827 73.964  9.642   1.00 37.48  ? 120 TYR A OH    1 
ATOM   94   N N     . LYS A 1 30  ? 44.706 76.294  10.424  1.00 40.58  ? 121 LYS A N     1 
ATOM   95   C CA    . LYS A 1 30  ? 44.171 75.038  10.968  1.00 39.31  ? 121 LYS A CA    1 
ATOM   96   C C     . LYS A 1 30  ? 43.116 74.506  9.980   1.00 39.27  ? 121 LYS A C     1 
ATOM   97   O O     . LYS A 1 30  ? 43.146 73.337  9.583   1.00 38.60  ? 121 LYS A O     1 
ATOM   98   C CB    . LYS A 1 30  ? 43.504 75.265  12.324  1.00 38.59  ? 121 LYS A CB    1 
ATOM   99   C CG    . LYS A 1 30  ? 44.379 75.853  13.393  1.00 40.63  ? 121 LYS A CG    1 
ATOM   100  C CD    . LYS A 1 30  ? 45.429 74.886  13.858  1.00 41.97  ? 121 LYS A CD    1 
ATOM   101  C CE    . LYS A 1 30  ? 46.265 75.519  14.955  1.00 43.61  ? 121 LYS A CE    1 
ATOM   102  N NZ    . LYS A 1 30  ? 47.503 74.729  15.212  1.00 46.21  ? 121 LYS A NZ    1 
ATOM   103  N N     . THR A 1 31  ? 42.190 75.384  9.595   1.00 37.36  ? 122 THR A N     1 
ATOM   104  C CA    . THR A 1 31  ? 41.144 75.041  8.654   1.00 36.34  ? 122 THR A CA    1 
ATOM   105  C C     . THR A 1 31  ? 41.802 74.477  7.394   1.00 34.67  ? 122 THR A C     1 
ATOM   106  O O     . THR A 1 31  ? 41.534 73.346  6.980   1.00 35.44  ? 122 THR A O     1 
ATOM   107  C CB    . THR A 1 31  ? 40.277 76.301  8.312   1.00 39.10  ? 122 THR A CB    1 
ATOM   108  O OG1   . THR A 1 31  ? 38.959 76.157  8.867   1.00 39.91  ? 122 THR A OG1   1 
ATOM   109  C CG2   . THR A 1 31  ? 40.161 76.502  6.811   1.00 41.50  ? 122 THR A CG2   1 
ATOM   110  N N     . MET A 1 32  ? 42.680 75.258  6.790   1.00 32.24  ? 123 MET A N     1 
ATOM   111  C CA    . MET A 1 32  ? 43.354 74.814  5.583   1.00 30.45  ? 123 MET A CA    1 
ATOM   112  C C     . MET A 1 32  ? 43.982 73.432  5.751   1.00 29.08  ? 123 MET A C     1 
ATOM   113  O O     . MET A 1 32  ? 43.868 72.576  4.878   1.00 29.29  ? 123 MET A O     1 
ATOM   114  C CB    . MET A 1 32  ? 44.428 75.813  5.202   1.00 30.23  ? 123 MET A CB    1 
ATOM   115  C CG    . MET A 1 32  ? 45.021 75.527  3.874   1.00 33.02  ? 123 MET A CG    1 
ATOM   116  S SD    . MET A 1 32  ? 43.755 75.603  2.647   1.00 40.15  ? 123 MET A SD    1 
ATOM   117  C CE    . MET A 1 32  ? 44.131 77.154  1.839   1.00 36.64  ? 123 MET A CE    1 
ATOM   118  N N     . ALA A 1 33  ? 44.652 73.220  6.875   1.00 27.20  ? 124 ALA A N     1 
ATOM   119  C CA    . ALA A 1 33  ? 45.295 71.951  7.139   1.00 27.02  ? 124 ALA A CA    1 
ATOM   120  C C     . ALA A 1 33  ? 44.176 70.926  7.213   1.00 28.73  ? 124 ALA A C     1 
ATOM   121  O O     . ALA A 1 33  ? 44.187 69.895  6.523   1.00 28.83  ? 124 ALA A O     1 
ATOM   122  C CB    . ALA A 1 33  ? 46.058 72.010  8.454   1.00 23.78  ? 124 ALA A CB    1 
ATOM   123  N N     . ALA A 1 34  ? 43.195 71.236  8.048   1.00 28.62  ? 125 ALA A N     1 
ATOM   124  C CA    . ALA A 1 34  ? 42.053 70.369  8.221   1.00 27.00  ? 125 ALA A CA    1 
ATOM   125  C C     . ALA A 1 34  ? 41.611 69.820  6.868   1.00 26.78  ? 125 ALA A C     1 
ATOM   126  O O     . ALA A 1 34  ? 41.604 68.613  6.634   1.00 26.59  ? 125 ALA A O     1 
ATOM   127  C CB    . ALA A 1 34  ? 40.944 71.138  8.843   1.00 25.22  ? 125 ALA A CB    1 
ATOM   128  N N     . LEU A 1 35  ? 41.249 70.718  5.971   1.00 25.10  ? 126 LEU A N     1 
ATOM   129  C CA    . LEU A 1 35  ? 40.790 70.307  4.666   1.00 24.91  ? 126 LEU A CA    1 
ATOM   130  C C     . LEU A 1 35  ? 41.766 69.346  4.001   1.00 28.01  ? 126 LEU A C     1 
ATOM   131  O O     . LEU A 1 35  ? 41.362 68.311  3.465   1.00 29.01  ? 126 LEU A O     1 
ATOM   132  C CB    . LEU A 1 35  ? 40.602 71.535  3.791   1.00 23.25  ? 126 LEU A CB    1 
ATOM   133  C CG    . LEU A 1 35  ? 40.037 71.226  2.420   1.00 23.28  ? 126 LEU A CG    1 
ATOM   134  C CD1   . LEU A 1 35  ? 38.696 70.563  2.647   1.00 24.12  ? 126 LEU A CD1   1 
ATOM   135  C CD2   . LEU A 1 35  ? 39.921 72.482  1.555   1.00 19.81  ? 126 LEU A CD2   1 
ATOM   136  N N     . ALA A 1 36  ? 43.057 69.684  4.043   1.00 29.16  ? 127 ALA A N     1 
ATOM   137  C CA    . ALA A 1 36  ? 44.084 68.859  3.406   1.00 27.17  ? 127 ALA A CA    1 
ATOM   138  C C     . ALA A 1 36  ? 44.216 67.458  4.008   1.00 25.37  ? 127 ALA A C     1 
ATOM   139  O O     . ALA A 1 36  ? 44.491 66.497  3.303   1.00 24.61  ? 127 ALA A O     1 
ATOM   140  C CB    . ALA A 1 36  ? 45.397 69.576  3.446   1.00 27.69  ? 127 ALA A CB    1 
ATOM   141  N N     . LYS A 1 37  ? 44.037 67.344  5.314   1.00 24.00  ? 128 LYS A N     1 
ATOM   142  C CA    . LYS A 1 37  ? 44.093 66.044  5.962   1.00 23.70  ? 128 LYS A CA    1 
ATOM   143  C C     . LYS A 1 37  ? 42.993 65.220  5.281   1.00 23.99  ? 128 LYS A C     1 
ATOM   144  O O     . LYS A 1 37  ? 43.249 64.144  4.736   1.00 25.70  ? 128 LYS A O     1 
ATOM   145  C CB    . LYS A 1 37  ? 43.793 66.192  7.457   1.00 22.64  ? 128 LYS A CB    1 
ATOM   146  C CG    . LYS A 1 37  ? 44.260 65.056  8.363   1.00 22.92  ? 128 LYS A CG    1 
ATOM   147  C CD    . LYS A 1 37  ? 43.648 65.233  9.758   1.00 24.64  ? 128 LYS A CD    1 
ATOM   148  C CE    . LYS A 1 37  ? 44.460 64.585  10.864  1.00 25.94  ? 128 LYS A CE    1 
ATOM   149  N NZ    . LYS A 1 37  ? 44.701 63.142  10.622  1.00 28.50  ? 128 LYS A NZ    1 
ATOM   150  N N     . ALA A 1 38  ? 41.774 65.752  5.302   1.00 23.11  ? 129 ALA A N     1 
ATOM   151  C CA    . ALA A 1 38  ? 40.619 65.099  4.697   1.00 22.63  ? 129 ALA A CA    1 
ATOM   152  C C     . ALA A 1 38  ? 40.868 64.764  3.226   1.00 21.99  ? 129 ALA A C     1 
ATOM   153  O O     . ALA A 1 38  ? 40.894 63.593  2.850   1.00 22.92  ? 129 ALA A O     1 
ATOM   154  C CB    . ALA A 1 38  ? 39.367 65.989  4.838   1.00 22.11  ? 129 ALA A CB    1 
ATOM   155  N N     . ILE A 1 39  ? 41.048 65.778  2.391   1.00 20.20  ? 130 ILE A N     1 
ATOM   156  C CA    . ILE A 1 39  ? 41.299 65.516  0.991   1.00 20.80  ? 130 ILE A CA    1 
ATOM   157  C C     . ILE A 1 39  ? 42.344 64.413  0.775   1.00 24.02  ? 130 ILE A C     1 
ATOM   158  O O     . ILE A 1 39  ? 42.201 63.574  -0.109  1.00 25.56  ? 130 ILE A O     1 
ATOM   159  C CB    . ILE A 1 39  ? 41.752 66.800  0.260   1.00 18.74  ? 130 ILE A CB    1 
ATOM   160  C CG1   . ILE A 1 39  ? 40.529 67.618  -0.142  1.00 18.48  ? 130 ILE A CG1   1 
ATOM   161  C CG2   . ILE A 1 39  ? 42.576 66.464  -0.977  1.00 16.85  ? 130 ILE A CG2   1 
ATOM   162  C CD1   . ILE A 1 39  ? 40.859 68.793  -1.028  1.00 16.85  ? 130 ILE A CD1   1 
ATOM   163  N N     . GLU A 1 40  ? 43.378 64.390  1.599   1.00 26.98  ? 131 GLU A N     1 
ATOM   164  C CA    . GLU A 1 40  ? 44.445 63.419  1.433   1.00 29.98  ? 131 GLU A CA    1 
ATOM   165  C C     . GLU A 1 40  ? 44.045 61.967  1.613   1.00 31.13  ? 131 GLU A C     1 
ATOM   166  O O     . GLU A 1 40  ? 44.693 61.076  1.070   1.00 31.40  ? 131 GLU A O     1 
ATOM   167  C CB    . GLU A 1 40  ? 45.601 63.771  2.372   1.00 32.52  ? 131 GLU A CB    1 
ATOM   168  C CG    . GLU A 1 40  ? 45.816 62.821  3.542   1.00 39.11  ? 131 GLU A CG    1 
ATOM   169  C CD    . GLU A 1 40  ? 46.546 61.559  3.126   1.00 41.34  ? 131 GLU A CD    1 
ATOM   170  O OE1   . GLU A 1 40  ? 47.535 61.689  2.371   1.00 43.74  ? 131 GLU A OE1   1 
ATOM   171  O OE2   . GLU A 1 40  ? 46.142 60.451  3.554   1.00 42.61  ? 131 GLU A OE2   1 
ATOM   172  N N     . LYS A 1 41  ? 42.986 61.710  2.371   1.00 32.13  ? 132 LYS A N     1 
ATOM   173  C CA    . LYS A 1 41  ? 42.576 60.328  2.584   1.00 31.99  ? 132 LYS A CA    1 
ATOM   174  C C     . LYS A 1 41  ? 41.337 59.917  1.774   1.00 31.45  ? 132 LYS A C     1 
ATOM   175  O O     . LYS A 1 41  ? 41.006 58.739  1.651   1.00 31.10  ? 132 LYS A O     1 
ATOM   176  C CB    . LYS A 1 41  ? 42.357 60.089  4.073   1.00 30.94  ? 132 LYS A CB    1 
ATOM   177  C CG    . LYS A 1 41  ? 41.216 60.847  4.677   1.00 30.08  ? 132 LYS A CG    1 
ATOM   178  C CD    . LYS A 1 41  ? 41.182 60.563  6.157   1.00 31.11  ? 132 LYS A CD    1 
ATOM   179  C CE    . LYS A 1 41  ? 39.844 60.892  6.765   1.00 33.19  ? 132 LYS A CE    1 
ATOM   180  N NZ    . LYS A 1 41  ? 39.888 60.798  8.254   1.00 36.81  ? 132 LYS A NZ    1 
ATOM   181  N N     . ASN A 1 42  ? 40.659 60.888  1.201   1.00 31.05  ? 133 ASN A N     1 
ATOM   182  C CA    . ASN A 1 42  ? 39.495 60.570  0.418   1.00 32.48  ? 133 ASN A CA    1 
ATOM   183  C C     . ASN A 1 42  ? 39.938 60.192  -0.999  1.00 33.01  ? 133 ASN A C     1 
ATOM   184  O O     . ASN A 1 42  ? 40.589 60.964  -1.702  1.00 34.29  ? 133 ASN A O     1 
ATOM   185  C CB    . ASN A 1 42  ? 38.551 61.767  0.420   1.00 33.14  ? 133 ASN A CB    1 
ATOM   186  C CG    . ASN A 1 42  ? 37.133 61.390  0.061   1.00 35.16  ? 133 ASN A CG    1 
ATOM   187  O OD1   . ASN A 1 42  ? 36.841 61.047  -1.081  1.00 36.73  ? 133 ASN A OD1   1 
ATOM   188  N ND2   . ASN A 1 42  ? 36.239 61.448  1.042   1.00 37.11  ? 133 ASN A ND2   1 
ATOM   189  N N     . VAL A 1 43  ? 39.598 58.977  -1.404  1.00 33.94  ? 134 VAL A N     1 
ATOM   190  C CA    . VAL A 1 43  ? 39.958 58.467  -2.722  1.00 32.70  ? 134 VAL A CA    1 
ATOM   191  C C     . VAL A 1 43  ? 39.191 59.232  -3.787  1.00 32.32  ? 134 VAL A C     1 
ATOM   192  O O     . VAL A 1 43  ? 39.442 59.069  -4.977  1.00 32.62  ? 134 VAL A O     1 
ATOM   193  C CB    . VAL A 1 43  ? 39.639 56.927  -2.825  1.00 32.57  ? 134 VAL A CB    1 
ATOM   194  C CG1   . VAL A 1 43  ? 39.655 56.464  -4.274  1.00 32.46  ? 134 VAL A CG1   1 
ATOM   195  C CG2   . VAL A 1 43  ? 40.641 56.129  -2.016  1.00 28.56  ? 134 VAL A CG2   1 
ATOM   196  N N     . LEU A 1 44  ? 38.252 60.064  -3.361  1.00 32.32  ? 135 LEU A N     1 
ATOM   197  C CA    . LEU A 1 44  ? 37.454 60.828  -4.316  1.00 35.40  ? 135 LEU A CA    1 
ATOM   198  C C     . LEU A 1 44  ? 38.261 61.937  -4.966  1.00 36.34  ? 135 LEU A C     1 
ATOM   199  O O     . LEU A 1 44  ? 37.831 62.536  -5.957  1.00 36.53  ? 135 LEU A O     1 
ATOM   200  C CB    . LEU A 1 44  ? 36.215 61.424  -3.636  1.00 35.46  ? 135 LEU A CB    1 
ATOM   201  C CG    . LEU A 1 44  ? 34.883 60.742  -3.956  1.00 35.49  ? 135 LEU A CG    1 
ATOM   202  C CD1   . LEU A 1 44  ? 34.505 61.034  -5.392  1.00 36.46  ? 135 LEU A CD1   1 
ATOM   203  C CD2   . LEU A 1 44  ? 34.995 59.242  -3.742  1.00 36.03  ? 135 LEU A CD2   1 
ATOM   204  N N     . PHE A 1 45  ? 39.435 62.196  -4.403  1.00 37.17  ? 136 PHE A N     1 
ATOM   205  C CA    . PHE A 1 45  ? 40.321 63.237  -4.901  1.00 37.87  ? 136 PHE A CA    1 
ATOM   206  C C     . PHE A 1 45  ? 41.577 62.653  -5.545  1.00 39.63  ? 136 PHE A C     1 
ATOM   207  O O     . PHE A 1 45  ? 42.346 63.375  -6.159  1.00 40.80  ? 136 PHE A O     1 
ATOM   208  C CB    . PHE A 1 45  ? 40.712 64.156  -3.749  1.00 35.34  ? 136 PHE A CB    1 
ATOM   209  C CG    . PHE A 1 45  ? 39.538 64.731  -3.006  1.00 33.08  ? 136 PHE A CG    1 
ATOM   210  C CD1   . PHE A 1 45  ? 38.811 65.788  -3.533  1.00 31.40  ? 136 PHE A CD1   1 
ATOM   211  C CD2   . PHE A 1 45  ? 39.154 64.211  -1.779  1.00 31.65  ? 136 PHE A CD2   1 
ATOM   212  C CE1   . PHE A 1 45  ? 37.727 66.313  -2.851  1.00 29.96  ? 136 PHE A CE1   1 
ATOM   213  C CE2   . PHE A 1 45  ? 38.065 64.739  -1.093  1.00 29.82  ? 136 PHE A CE2   1 
ATOM   214  C CZ    . PHE A 1 45  ? 37.356 65.785  -1.629  1.00 29.37  ? 136 PHE A CZ    1 
ATOM   215  N N     . SER A 1 46  ? 41.776 61.345  -5.400  1.00 42.46  ? 137 SER A N     1 
ATOM   216  C CA    . SER A 1 46  ? 42.937 60.646  -5.966  1.00 44.36  ? 137 SER A CA    1 
ATOM   217  C C     . SER A 1 46  ? 43.170 60.969  -7.427  1.00 46.65  ? 137 SER A C     1 
ATOM   218  O O     . SER A 1 46  ? 44.299 61.057  -7.874  1.00 46.71  ? 137 SER A O     1 
ATOM   219  C CB    . SER A 1 46  ? 42.763 59.126  -5.875  1.00 42.52  ? 137 SER A CB    1 
ATOM   220  O OG    . SER A 1 46  ? 42.415 58.702  -4.576  1.00 42.98  ? 137 SER A OG    1 
ATOM   221  N N     . HIS A 1 47  ? 42.089 61.142  -8.172  1.00 51.22  ? 138 HIS A N     1 
ATOM   222  C CA    . HIS A 1 47  ? 42.191 61.390  -9.601  1.00 54.87  ? 138 HIS A CA    1 
ATOM   223  C C     . HIS A 1 47  ? 42.212 62.854  -10.014 1.00 55.69  ? 138 HIS A C     1 
ATOM   224  O O     . HIS A 1 47  ? 41.441 63.248  -10.895 1.00 56.08  ? 138 HIS A O     1 
ATOM   225  C CB    . HIS A 1 47  ? 41.053 60.652  -10.323 1.00 57.86  ? 138 HIS A CB    1 
ATOM   226  C CG    . HIS A 1 47  ? 40.658 59.366  -9.666  1.00 59.97  ? 138 HIS A CG    1 
ATOM   227  N ND1   . HIS A 1 47  ? 41.567 58.374  -9.365  1.00 62.30  ? 138 HIS A ND1   1 
ATOM   228  C CD2   . HIS A 1 47  ? 39.462 58.930  -9.206  1.00 61.70  ? 138 HIS A CD2   1 
ATOM   229  C CE1   . HIS A 1 47  ? 40.948 57.385  -8.744  1.00 62.32  ? 138 HIS A CE1   1 
ATOM   230  N NE2   . HIS A 1 47  ? 39.670 57.698  -8.634  1.00 62.39  ? 138 HIS A NE2   1 
ATOM   231  N N     . LEU A 1 48  ? 43.003 63.673  -9.324  1.00 56.51  ? 139 LEU A N     1 
ATOM   232  C CA    . LEU A 1 48  ? 43.090 65.097  -9.662  1.00 56.41  ? 139 LEU A CA    1 
ATOM   233  C C     . LEU A 1 48  ? 44.470 65.542  -10.038 1.00 56.95  ? 139 LEU A C     1 
ATOM   234  O O     . LEU A 1 48  ? 45.445 64.934  -9.594  1.00 56.46  ? 139 LEU A O     1 
ATOM   235  C CB    . LEU A 1 48  ? 42.555 65.956  -8.506  1.00 54.69  ? 139 LEU A CB    1 
ATOM   236  C CG    . LEU A 1 48  ? 41.135 65.667  -8.015  1.00 53.53  ? 139 LEU A CG    1 
ATOM   237  C CD1   . LEU A 1 48  ? 40.726 66.714  -7.003  1.00 51.83  ? 139 LEU A CD1   1 
ATOM   238  C CD2   . LEU A 1 48  ? 40.176 65.660  -9.192  1.00 52.29  ? 139 LEU A CD2   1 
ATOM   239  N N     . ASP A 1 49  ? 44.584 66.585  -10.856 1.00 58.08  ? 140 ASP A N     1 
ATOM   240  C CA    . ASP A 1 49  ? 45.904 67.092  -11.218 1.00 59.16  ? 140 ASP A CA    1 
ATOM   241  C C     . ASP A 1 49  ? 46.245 68.292  -10.332 1.00 59.70  ? 140 ASP A C     1 
ATOM   242  O O     . ASP A 1 49  ? 45.366 68.873  -9.682  1.00 60.09  ? 140 ASP A O     1 
ATOM   243  C CB    . ASP A 1 49  ? 45.972 67.477  -12.708 1.00 58.67  ? 140 ASP A CB    1 
ATOM   244  C CG    . ASP A 1 49  ? 45.160 68.720  -13.048 1.00 58.86  ? 140 ASP A CG    1 
ATOM   245  O OD1   . ASP A 1 49  ? 45.316 69.756  -12.372 1.00 59.00  ? 140 ASP A OD1   1 
ATOM   246  O OD2   . ASP A 1 49  ? 44.376 68.668  -14.016 1.00 58.18  ? 140 ASP A OD2   1 
ATOM   247  N N     . ASP A 1 50  ? 47.520 68.654  -10.297 1.00 60.38  ? 141 ASP A N     1 
ATOM   248  C CA    . ASP A 1 50  ? 47.966 69.778  -9.479  1.00 61.02  ? 141 ASP A CA    1 
ATOM   249  C C     . ASP A 1 50  ? 47.004 70.949  -9.605  1.00 58.71  ? 141 ASP A C     1 
ATOM   250  O O     . ASP A 1 50  ? 46.524 71.485  -8.607  1.00 59.81  ? 141 ASP A O     1 
ATOM   251  C CB    . ASP A 1 50  ? 49.369 70.205  -9.906  1.00 64.07  ? 141 ASP A CB    1 
ATOM   252  C CG    . ASP A 1 50  ? 50.273 69.016  -10.173 1.00 68.30  ? 141 ASP A CG    1 
ATOM   253  O OD1   . ASP A 1 50  ? 50.225 68.478  -11.308 1.00 70.12  ? 141 ASP A OD1   1 
ATOM   254  O OD2   . ASP A 1 50  ? 51.009 68.604  -9.243  1.00 70.16  ? 141 ASP A OD2   1 
ATOM   255  N N     . ASN A 1 51  ? 46.706 71.328  -10.840 1.00 55.40  ? 142 ASN A N     1 
ATOM   256  C CA    . ASN A 1 51  ? 45.800 72.436  -11.095 1.00 51.98  ? 142 ASN A CA    1 
ATOM   257  C C     . ASN A 1 51  ? 44.407 72.208  -10.501 1.00 49.29  ? 142 ASN A C     1 
ATOM   258  O O     . ASN A 1 51  ? 43.889 73.063  -9.772  1.00 45.57  ? 142 ASN A O     1 
ATOM   259  C CB    . ASN A 1 51  ? 45.727 72.678  -12.603 1.00 52.53  ? 142 ASN A CB    1 
ATOM   260  C CG    . ASN A 1 51  ? 47.092 72.994  -13.203 1.00 53.48  ? 142 ASN A CG    1 
ATOM   261  O OD1   . ASN A 1 51  ? 47.245 73.099  -14.419 1.00 53.28  ? 142 ASN A OD1   1 
ATOM   262  N ND2   . ASN A 1 51  ? 48.093 73.152  -12.340 1.00 54.13  ? 142 ASN A ND2   1 
ATOM   263  N N     . GLU A 1 52  ? 43.814 71.054  -10.805 1.00 47.19  ? 143 GLU A N     1 
ATOM   264  C CA    . GLU A 1 52  ? 42.485 70.716  -10.301 1.00 46.24  ? 143 GLU A CA    1 
ATOM   265  C C     . GLU A 1 52  ? 42.493 70.670  -8.777  1.00 46.13  ? 143 GLU A C     1 
ATOM   266  O O     . GLU A 1 52  ? 41.532 71.094  -8.119  1.00 45.38  ? 143 GLU A O     1 
ATOM   267  C CB    . GLU A 1 52  ? 42.026 69.358  -10.842 1.00 46.61  ? 143 GLU A CB    1 
ATOM   268  C CG    . GLU A 1 52  ? 41.777 69.299  -12.343 1.00 48.00  ? 143 GLU A CG    1 
ATOM   269  C CD    . GLU A 1 52  ? 41.316 67.914  -12.825 1.00 48.81  ? 143 GLU A CD    1 
ATOM   270  O OE1   . GLU A 1 52  ? 42.092 66.935  -12.685 1.00 47.82  ? 143 GLU A OE1   1 
ATOM   271  O OE2   . GLU A 1 52  ? 40.178 67.811  -13.343 1.00 47.99  ? 143 GLU A OE2   1 
ATOM   272  N N     . ARG A 1 53  ? 43.581 70.149  -8.213  1.00 44.77  ? 144 ARG A N     1 
ATOM   273  C CA    . ARG A 1 53  ? 43.690 70.056  -6.765  1.00 42.63  ? 144 ARG A CA    1 
ATOM   274  C C     . ARG A 1 53  ? 43.586 71.445  -6.143  1.00 39.58  ? 144 ARG A C     1 
ATOM   275  O O     . ARG A 1 53  ? 42.929 71.625  -5.126  1.00 37.62  ? 144 ARG A O     1 
ATOM   276  C CB    . ARG A 1 53  ? 45.016 69.405  -6.368  1.00 45.99  ? 144 ARG A CB    1 
ATOM   277  C CG    . ARG A 1 53  ? 45.023 68.848  -4.944  1.00 49.74  ? 144 ARG A CG    1 
ATOM   278  C CD    . ARG A 1 53  ? 46.365 69.074  -4.246  1.00 52.96  ? 144 ARG A CD    1 
ATOM   279  N NE    . ARG A 1 53  ? 46.511 68.293  -3.010  1.00 54.06  ? 144 ARG A NE    1 
ATOM   280  C CZ    . ARG A 1 53  ? 46.433 66.964  -2.949  1.00 53.50  ? 144 ARG A CZ    1 
ATOM   281  N NH1   . ARG A 1 53  ? 46.589 66.344  -1.787  1.00 53.41  ? 144 ARG A NH1   1 
ATOM   282  N NH2   . ARG A 1 53  ? 46.185 66.255  -4.047  1.00 51.13  ? 144 ARG A NH2   1 
ATOM   283  N N     . SER A 1 54  ? 44.238 72.424  -6.764  1.00 38.13  ? 145 SER A N     1 
ATOM   284  C CA    . SER A 1 54  ? 44.215 73.803  -6.271  1.00 38.51  ? 145 SER A CA    1 
ATOM   285  C C     . SER A 1 54  ? 42.787 74.316  -6.133  1.00 37.79  ? 145 SER A C     1 
ATOM   286  O O     . SER A 1 54  ? 42.428 74.929  -5.123  1.00 35.79  ? 145 SER A O     1 
ATOM   287  C CB    . SER A 1 54  ? 45.001 74.727  -7.218  1.00 40.10  ? 145 SER A CB    1 
ATOM   288  O OG    . SER A 1 54  ? 44.981 76.075  -6.767  1.00 38.10  ? 145 SER A OG    1 
ATOM   289  N N     . ASP A 1 55  ? 41.981 74.057  -7.162  1.00 38.68  ? 146 ASP A N     1 
ATOM   290  C CA    . ASP A 1 55  ? 40.584 74.467  -7.172  1.00 39.23  ? 146 ASP A CA    1 
ATOM   291  C C     . ASP A 1 55  ? 39.760 73.854  -6.038  1.00 37.37  ? 146 ASP A C     1 
ATOM   292  O O     . ASP A 1 55  ? 39.123 74.577  -5.284  1.00 35.99  ? 146 ASP A O     1 
ATOM   293  C CB    . ASP A 1 55  ? 39.944 74.116  -8.511  1.00 42.72  ? 146 ASP A CB    1 
ATOM   294  C CG    . ASP A 1 55  ? 40.450 74.987  -9.645  1.00 46.17  ? 146 ASP A CG    1 
ATOM   295  O OD1   . ASP A 1 55  ? 40.492 76.222  -9.463  1.00 48.82  ? 146 ASP A OD1   1 
ATOM   296  O OD2   . ASP A 1 55  ? 40.787 74.449  -10.722 1.00 46.92  ? 146 ASP A OD2   1 
ATOM   297  N N     . ILE A 1 56  ? 39.768 72.532  -5.910  1.00 35.43  ? 147 ILE A N     1 
ATOM   298  C CA    . ILE A 1 56  ? 38.986 71.917  -4.846  1.00 36.33  ? 147 ILE A CA    1 
ATOM   299  C C     . ILE A 1 56  ? 39.325 72.546  -3.499  1.00 37.13  ? 147 ILE A C     1 
ATOM   300  O O     . ILE A 1 56  ? 38.426 72.938  -2.743  1.00 37.11  ? 147 ILE A O     1 
ATOM   301  C CB    . ILE A 1 56  ? 39.204 70.373  -4.757  1.00 35.91  ? 147 ILE A CB    1 
ATOM   302  C CG1   . ILE A 1 56  ? 38.626 69.679  -5.992  1.00 35.08  ? 147 ILE A CG1   1 
ATOM   303  C CG2   . ILE A 1 56  ? 38.509 69.818  -3.506  1.00 36.17  ? 147 ILE A CG2   1 
ATOM   304  C CD1   . ILE A 1 56  ? 37.136 69.879  -6.169  1.00 31.42  ? 147 ILE A CD1   1 
ATOM   305  N N     . PHE A 1 57  ? 40.620 72.632  -3.189  1.00 36.55  ? 148 PHE A N     1 
ATOM   306  C CA    . PHE A 1 57  ? 41.051 73.232  -1.930  1.00 33.83  ? 148 PHE A CA    1 
ATOM   307  C C     . PHE A 1 57  ? 40.460 74.622  -1.860  1.00 32.82  ? 148 PHE A C     1 
ATOM   308  O O     . PHE A 1 57  ? 39.861 75.007  -0.856  1.00 32.22  ? 148 PHE A O     1 
ATOM   309  C CB    . PHE A 1 57  ? 42.572 73.348  -1.872  1.00 33.60  ? 148 PHE A CB    1 
ATOM   310  C CG    . PHE A 1 57  ? 43.243 72.213  -1.186  1.00 31.03  ? 148 PHE A CG    1 
ATOM   311  C CD1   . PHE A 1 57  ? 43.031 71.987  0.160   1.00 29.38  ? 148 PHE A CD1   1 
ATOM   312  C CD2   . PHE A 1 57  ? 44.059 71.343  -1.900  1.00 31.32  ? 148 PHE A CD2   1 
ATOM   313  C CE1   . PHE A 1 57  ? 43.615 70.906  0.791   1.00 31.08  ? 148 PHE A CE1   1 
ATOM   314  C CE2   . PHE A 1 57  ? 44.647 70.259  -1.277  1.00 31.38  ? 148 PHE A CE2   1 
ATOM   315  C CZ    . PHE A 1 57  ? 44.421 70.041  0.074   1.00 30.78  ? 148 PHE A CZ    1 
ATOM   316  N N     . ASP A 1 58  ? 40.632 75.374  -2.943  1.00 31.15  ? 149 ASP A N     1 
ATOM   317  C CA    . ASP A 1 58  ? 40.122 76.730  -2.990  1.00 31.71  ? 149 ASP A CA    1 
ATOM   318  C C     . ASP A 1 58  ? 38.599 76.750  -2.913  1.00 30.78  ? 149 ASP A C     1 
ATOM   319  O O     . ASP A 1 58  ? 38.023 77.413  -2.053  1.00 29.35  ? 149 ASP A O     1 
ATOM   320  C CB    . ASP A 1 58  ? 40.629 77.426  -4.264  1.00 32.75  ? 149 ASP A CB    1 
ATOM   321  C CG    . ASP A 1 58  ? 41.711 78.459  -3.967  1.00 34.27  ? 149 ASP A CG    1 
ATOM   322  O OD1   . ASP A 1 58  ? 42.485 78.838  -4.879  1.00 31.89  ? 149 ASP A OD1   1 
ATOM   323  O OD2   . ASP A 1 58  ? 41.772 78.893  -2.796  1.00 35.48  ? 149 ASP A OD2   1 
ATOM   324  N N     . ALA A 1 59  ? 37.969 75.986  -3.802  1.00 30.49  ? 150 ALA A N     1 
ATOM   325  C CA    . ALA A 1 59  ? 36.512 75.867  -3.908  1.00 29.90  ? 150 ALA A CA    1 
ATOM   326  C C     . ALA A 1 59  ? 35.789 75.289  -2.691  1.00 29.07  ? 150 ALA A C     1 
ATOM   327  O O     . ALA A 1 59  ? 34.631 75.595  -2.452  1.00 28.00  ? 150 ALA A O     1 
ATOM   328  C CB    . ALA A 1 59  ? 36.174 75.035  -5.129  1.00 30.38  ? 150 ALA A CB    1 
ATOM   329  N N     . MET A 1 60  ? 36.461 74.436  -1.935  1.00 29.97  ? 151 MET A N     1 
ATOM   330  C CA    . MET A 1 60  ? 35.844 73.833  -0.769  1.00 31.03  ? 151 MET A CA    1 
ATOM   331  C C     . MET A 1 60  ? 35.779 74.781  0.403   1.00 31.31  ? 151 MET A C     1 
ATOM   332  O O     . MET A 1 60  ? 36.523 75.758  0.478   1.00 32.24  ? 151 MET A O     1 
ATOM   333  C CB    . MET A 1 60  ? 36.600 72.571  -0.366  1.00 33.36  ? 151 MET A CB    1 
ATOM   334  C CG    . MET A 1 60  ? 36.433 71.413  -1.342  1.00 36.76  ? 151 MET A CG    1 
ATOM   335  S SD    . MET A 1 60  ? 35.772 69.960  -0.512  1.00 41.13  ? 151 MET A SD    1 
ATOM   336  C CE    . MET A 1 60  ? 37.324 69.101  -0.058  1.00 39.15  ? 151 MET A CE    1 
ATOM   337  N N     . PHE A 1 61  ? 34.886 74.475  1.326   1.00 31.28  ? 152 PHE A N     1 
ATOM   338  C CA    . PHE A 1 61  ? 34.696 75.296  2.504   1.00 32.36  ? 152 PHE A CA    1 
ATOM   339  C C     . PHE A 1 61  ? 34.223 74.421  3.655   1.00 33.97  ? 152 PHE A C     1 
ATOM   340  O O     . PHE A 1 61  ? 33.832 73.276  3.455   1.00 35.12  ? 152 PHE A O     1 
ATOM   341  C CB    . PHE A 1 61  ? 33.671 76.406  2.209   1.00 32.05  ? 152 PHE A CB    1 
ATOM   342  C CG    . PHE A 1 61  ? 32.276 75.904  1.852   1.00 31.43  ? 152 PHE A CG    1 
ATOM   343  C CD1   . PHE A 1 61  ? 31.375 75.516  2.853   1.00 26.75  ? 152 PHE A CD1   1 
ATOM   344  C CD2   . PHE A 1 61  ? 31.863 75.841  0.507   1.00 30.80  ? 152 PHE A CD2   1 
ATOM   345  C CE1   . PHE A 1 61  ? 30.093 75.078  2.528   1.00 26.54  ? 152 PHE A CE1   1 
ATOM   346  C CE2   . PHE A 1 61  ? 30.567 75.399  0.170   1.00 28.21  ? 152 PHE A CE2   1 
ATOM   347  C CZ    . PHE A 1 61  ? 29.684 75.018  1.188   1.00 26.93  ? 152 PHE A CZ    1 
ATOM   348  N N     . PRO A 1 62  ? 34.296 74.935  4.885   1.00 34.43  ? 153 PRO A N     1 
ATOM   349  C CA    . PRO A 1 62  ? 33.844 74.118  6.008   1.00 34.69  ? 153 PRO A CA    1 
ATOM   350  C C     . PRO A 1 62  ? 32.403 74.460  6.342   1.00 35.27  ? 153 PRO A C     1 
ATOM   351  O O     . PRO A 1 62  ? 31.882 75.459  5.855   1.00 35.86  ? 153 PRO A O     1 
ATOM   352  C CB    . PRO A 1 62  ? 34.830 74.486  7.120   1.00 34.33  ? 153 PRO A CB    1 
ATOM   353  C CG    . PRO A 1 62  ? 35.096 75.916  6.860   1.00 33.75  ? 153 PRO A CG    1 
ATOM   354  C CD    . PRO A 1 62  ? 35.179 76.025  5.342   1.00 33.74  ? 153 PRO A CD    1 
ATOM   355  N N     . VAL A 1 63  ? 31.773 73.622  7.163   1.00 35.50  ? 154 VAL A N     1 
ATOM   356  C CA    . VAL A 1 63  ? 30.384 73.789  7.580   1.00 36.39  ? 154 VAL A CA    1 
ATOM   357  C C     . VAL A 1 63  ? 30.108 72.924  8.795   1.00 38.38  ? 154 VAL A C     1 
ATOM   358  O O     . VAL A 1 63  ? 30.784 71.925  9.021   1.00 40.22  ? 154 VAL A O     1 
ATOM   359  C CB    . VAL A 1 63  ? 29.406 73.361  6.481   1.00 36.82  ? 154 VAL A CB    1 
ATOM   360  C CG1   . VAL A 1 63  ? 29.183 74.500  5.491   1.00 34.84  ? 154 VAL A CG1   1 
ATOM   361  C CG2   . VAL A 1 63  ? 29.963 72.131  5.765   1.00 39.01  ? 154 VAL A CG2   1 
ATOM   362  N N     . SER A 1 64  ? 29.111 73.298  9.579   1.00 38.59  ? 155 SER A N     1 
ATOM   363  C CA    . SER A 1 64  ? 28.812 72.529  10.758  1.00 39.65  ? 155 SER A CA    1 
ATOM   364  C C     . SER A 1 64  ? 27.338 72.570  11.055  1.00 40.58  ? 155 SER A C     1 
ATOM   365  O O     . SER A 1 64  ? 26.678 73.576  10.775  1.00 41.43  ? 155 SER A O     1 
ATOM   366  C CB    . SER A 1 64  ? 29.620 73.059  11.950  1.00 41.17  ? 155 SER A CB    1 
ATOM   367  O OG    . SER A 1 64  ? 29.434 72.248  13.103  1.00 44.02  ? 155 SER A OG    1 
ATOM   368  N N     . PHE A 1 65  ? 26.824 71.465  11.601  1.00 38.87  ? 156 PHE A N     1 
ATOM   369  C CA    . PHE A 1 65  ? 25.415 71.311  11.952  1.00 37.48  ? 156 PHE A CA    1 
ATOM   370  C C     . PHE A 1 65  ? 25.374 70.487  13.216  1.00 36.75  ? 156 PHE A C     1 
ATOM   371  O O     . PHE A 1 65  ? 26.270 69.696  13.457  1.00 36.20  ? 156 PHE A O     1 
ATOM   372  C CB    . PHE A 1 65  ? 24.640 70.564  10.850  1.00 37.20  ? 156 PHE A CB    1 
ATOM   373  C CG    . PHE A 1 65  ? 24.583 71.296  9.537   1.00 35.82  ? 156 PHE A CG    1 
ATOM   374  C CD1   . PHE A 1 65  ? 25.617 71.178  8.610   1.00 37.35  ? 156 PHE A CD1   1 
ATOM   375  C CD2   . PHE A 1 65  ? 23.521 72.139  9.249   1.00 34.82  ? 156 PHE A CD2   1 
ATOM   376  C CE1   . PHE A 1 65  ? 25.595 71.900  7.410   1.00 37.23  ? 156 PHE A CE1   1 
ATOM   377  C CE2   . PHE A 1 65  ? 23.485 72.860  8.064   1.00 35.84  ? 156 PHE A CE2   1 
ATOM   378  C CZ    . PHE A 1 65  ? 24.526 72.743  7.140   1.00 36.34  ? 156 PHE A CZ    1 
ATOM   379  N N     . ILE A 1 66  ? 24.344 70.665  14.033  1.00 38.06  ? 157 ILE A N     1 
ATOM   380  C CA    . ILE A 1 66  ? 24.255 69.876  15.257  1.00 38.96  ? 157 ILE A CA    1 
ATOM   381  C C     . ILE A 1 66  ? 23.152 68.824  15.188  1.00 38.67  ? 157 ILE A C     1 
ATOM   382  O O     . ILE A 1 66  ? 22.137 69.005  14.507  1.00 35.76  ? 157 ILE A O     1 
ATOM   383  C CB    . ILE A 1 66  ? 24.058 70.768  16.520  1.00 39.54  ? 157 ILE A CB    1 
ATOM   384  C CG1   . ILE A 1 66  ? 23.590 72.168  16.127  1.00 39.07  ? 157 ILE A CG1   1 
ATOM   385  C CG2   . ILE A 1 66  ? 25.368 70.840  17.310  1.00 40.16  ? 157 ILE A CG2   1 
ATOM   386  C CD1   . ILE A 1 66  ? 23.404 73.086  17.323  1.00 42.10  ? 157 ILE A CD1   1 
ATOM   387  N N     . ALA A 1 67  ? 23.385 67.715  15.885  1.00 39.31  ? 158 ALA A N     1 
ATOM   388  C CA    . ALA A 1 67  ? 22.447 66.605  15.921  1.00 41.90  ? 158 ALA A CA    1 
ATOM   389  C C     . ALA A 1 67  ? 20.996 67.090  15.874  1.00 43.27  ? 158 ALA A C     1 
ATOM   390  O O     . ALA A 1 67  ? 20.524 67.790  16.776  1.00 43.43  ? 158 ALA A O     1 
ATOM   391  C CB    . ALA A 1 67  ? 22.695 65.748  17.177  1.00 40.89  ? 158 ALA A CB    1 
ATOM   392  N N     . GLY A 1 68  ? 20.306 66.720  14.798  1.00 44.09  ? 159 GLY A N     1 
ATOM   393  C CA    . GLY A 1 68  ? 18.920 67.103  14.623  1.00 45.11  ? 159 GLY A CA    1 
ATOM   394  C C     . GLY A 1 68  ? 18.744 67.973  13.403  1.00 45.83  ? 159 GLY A C     1 
ATOM   395  O O     . GLY A 1 68  ? 17.814 67.812  12.623  1.00 46.76  ? 159 GLY A O     1 
ATOM   396  N N     . GLU A 1 69  ? 19.647 68.917  13.238  1.00 47.75  ? 160 GLU A N     1 
ATOM   397  C CA    . GLU A 1 69  ? 19.580 69.809  12.097  1.00 49.81  ? 160 GLU A CA    1 
ATOM   398  C C     . GLU A 1 69  ? 19.682 69.045  10.770  1.00 50.28  ? 160 GLU A C     1 
ATOM   399  O O     . GLU A 1 69  ? 20.300 67.970  10.696  1.00 51.04  ? 160 GLU A O     1 
ATOM   400  C CB    . GLU A 1 69  ? 20.812 70.707  12.093  1.00 51.65  ? 160 GLU A CB    1 
ATOM   401  C CG    . GLU A 1 69  ? 20.589 72.073  11.488  1.00 53.32  ? 160 GLU A CG    1 
ATOM   402  C CD    . GLU A 1 69  ? 21.546 73.094  12.063  1.00 54.04  ? 160 GLU A CD    1 
ATOM   403  O OE1   . GLU A 1 69  ? 21.656 74.195  11.486  1.00 55.67  ? 160 GLU A OE1   1 
ATOM   404  O OE2   . GLU A 1 69  ? 22.182 72.791  13.097  1.00 53.43  ? 160 GLU A OE2   1 
ATOM   405  N N     . THR A 1 70  ? 19.082 69.601  9.726   1.00 49.19  ? 161 THR A N     1 
ATOM   406  C CA    . THR A 1 70  ? 19.093 68.960  8.421   1.00 48.39  ? 161 THR A CA    1 
ATOM   407  C C     . THR A 1 70  ? 19.914 69.684  7.387   1.00 49.64  ? 161 THR A C     1 
ATOM   408  O O     . THR A 1 70  ? 19.826 70.905  7.240   1.00 50.76  ? 161 THR A O     1 
ATOM   409  C CB    . THR A 1 70  ? 17.589 68.950  7.953   1.00 48.40  ? 161 THR A CB    1 
ATOM   410  O OG1   . THR A 1 70  ? 17.048 67.637  8.154   1.00 46.89  ? 161 THR A OG1   1 
ATOM   411  C CG2   . THR A 1 70  ? 17.455 69.349  6.481   1.00 46.39  ? 161 THR A CG2   1 
ATOM   412  N N     . VAL A 1 71  ? 20.736 68.916  6.675   1.00 49.94  ? 162 VAL A N     1 
ATOM   413  C CA    . VAL A 1 71  ? 21.583 69.486  5.634   1.00 49.07  ? 162 VAL A CA    1 
ATOM   414  C C     . VAL A 1 71  ? 20.850 69.324  4.327   1.00 49.36  ? 162 VAL A C     1 
ATOM   415  O O     . VAL A 1 71  ? 20.710 70.274  3.562   1.00 49.12  ? 162 VAL A O     1 
ATOM   416  C CB    . VAL A 1 71  ? 22.931 68.761  5.506   1.00 48.30  ? 162 VAL A CB    1 
ATOM   417  C CG1   . VAL A 1 71  ? 23.803 69.487  4.474   1.00 46.12  ? 162 VAL A CG1   1 
ATOM   418  C CG2   . VAL A 1 71  ? 23.607 68.671  6.868   1.00 45.67  ? 162 VAL A CG2   1 
ATOM   419  N N     . ILE A 1 72  ? 20.379 68.109  4.074   1.00 50.21  ? 163 ILE A N     1 
ATOM   420  C CA    . ILE A 1 72  ? 19.643 67.837  2.850   1.00 51.51  ? 163 ILE A CA    1 
ATOM   421  C C     . ILE A 1 72  ? 18.228 67.362  3.180   1.00 51.55  ? 163 ILE A C     1 
ATOM   422  O O     . ILE A 1 72  ? 18.022 66.555  4.094   1.00 50.32  ? 163 ILE A O     1 
ATOM   423  C CB    . ILE A 1 72  ? 20.350 66.756  1.983   1.00 52.51  ? 163 ILE A CB    1 
ATOM   424  C CG1   . ILE A 1 72  ? 21.744 67.236  1.567   1.00 52.14  ? 163 ILE A CG1   1 
ATOM   425  C CG2   . ILE A 1 72  ? 19.521 66.456  0.736   1.00 52.28  ? 163 ILE A CG2   1 
ATOM   426  C CD1   . ILE A 1 72  ? 22.617 66.148  0.971   1.00 51.53  ? 163 ILE A CD1   1 
ATOM   427  N N     . GLN A 1 73  ? 17.270 67.892  2.425   1.00 51.19  ? 164 GLN A N     1 
ATOM   428  C CA    . GLN A 1 73  ? 15.851 67.560  2.550   1.00 51.39  ? 164 GLN A CA    1 
ATOM   429  C C     . GLN A 1 73  ? 15.490 66.669  1.355   1.00 51.04  ? 164 GLN A C     1 
ATOM   430  O O     . GLN A 1 73  ? 16.281 66.531  0.420   1.00 51.32  ? 164 GLN A O     1 
ATOM   431  C CB    . GLN A 1 73  ? 15.018 68.847  2.497   1.00 51.45  ? 164 GLN A CB    1 
ATOM   432  C CG    . GLN A 1 73  ? 13.556 68.661  2.786   1.00 51.32  ? 164 GLN A CG    1 
ATOM   433  C CD    . GLN A 1 73  ? 13.346 67.918  4.083   1.00 52.90  ? 164 GLN A CD    1 
ATOM   434  O OE1   . GLN A 1 73  ? 13.371 66.682  4.117   1.00 53.54  ? 164 GLN A OE1   1 
ATOM   435  N NE2   . GLN A 1 73  ? 13.166 68.665  5.170   1.00 51.95  ? 164 GLN A NE2   1 
ATOM   436  N N     . GLN A 1 74  ? 14.311 66.058  1.376   1.00 50.35  ? 165 GLN A N     1 
ATOM   437  C CA    . GLN A 1 74  ? 13.909 65.227  0.246   1.00 49.50  ? 165 GLN A CA    1 
ATOM   438  C C     . GLN A 1 74  ? 13.228 66.145  -0.752  1.00 48.73  ? 165 GLN A C     1 
ATOM   439  O O     . GLN A 1 74  ? 12.468 67.024  -0.362  1.00 48.89  ? 165 GLN A O     1 
ATOM   440  C CB    . GLN A 1 74  ? 12.969 64.109  0.696   1.00 49.40  ? 165 GLN A CB    1 
ATOM   441  C CG    . GLN A 1 74  ? 13.488 62.733  0.307   1.00 49.08  ? 165 GLN A CG    1 
ATOM   442  C CD    . GLN A 1 74  ? 12.754 61.602  0.982   1.00 50.09  ? 165 GLN A CD    1 
ATOM   443  O OE1   . GLN A 1 74  ? 12.607 61.579  2.211   1.00 47.76  ? 165 GLN A OE1   1 
ATOM   444  N NE2   . GLN A 1 74  ? 12.298 60.641  0.183   1.00 48.48  ? 165 GLN A NE2   1 
ATOM   445  N N     . GLY A 1 75  ? 13.507 65.954  -2.035  1.00 48.73  ? 166 GLY A N     1 
ATOM   446  C CA    . GLY A 1 75  ? 12.921 66.827  -3.038  1.00 51.41  ? 166 GLY A CA    1 
ATOM   447  C C     . GLY A 1 75  ? 13.363 68.252  -2.744  1.00 53.10  ? 166 GLY A C     1 
ATOM   448  O O     . GLY A 1 75  ? 12.790 68.922  -1.879  1.00 52.58  ? 166 GLY A O     1 
ATOM   449  N N     . ASP A 1 76  ? 14.393 68.714  -3.449  1.00 55.16  ? 167 ASP A N     1 
ATOM   450  C CA    . ASP A 1 76  ? 14.934 70.055  -3.239  1.00 57.22  ? 167 ASP A CA    1 
ATOM   451  C C     . ASP A 1 76  ? 15.674 70.460  -4.507  1.00 58.03  ? 167 ASP A C     1 
ATOM   452  O O     . ASP A 1 76  ? 15.263 70.144  -5.615  1.00 59.91  ? 167 ASP A O     1 
ATOM   453  C CB    . ASP A 1 76  ? 15.971 70.048  -2.103  1.00 57.73  ? 167 ASP A CB    1 
ATOM   454  C CG    . ASP A 1 76  ? 15.375 69.688  -0.754  1.00 58.87  ? 167 ASP A CG    1 
ATOM   455  O OD1   . ASP A 1 76  ? 14.916 68.538  -0.595  1.00 58.92  ? 167 ASP A OD1   1 
ATOM   456  O OD2   . ASP A 1 76  ? 15.373 70.560  0.148   1.00 60.03  ? 167 ASP A OD2   1 
ATOM   457  N N     . GLU A 1 77  ? 16.771 71.176  -4.318  1.00 58.70  ? 168 GLU A N     1 
ATOM   458  C CA    . GLU A 1 77  ? 17.603 71.649  -5.405  1.00 59.18  ? 168 GLU A CA    1 
ATOM   459  C C     . GLU A 1 77  ? 19.092 71.331  -5.133  1.00 59.80  ? 168 GLU A C     1 
ATOM   460  O O     . GLU A 1 77  ? 19.513 71.133  -3.988  1.00 58.94  ? 168 GLU A O     1 
ATOM   461  C CB    . GLU A 1 77  ? 17.414 73.151  -5.447  1.00 60.04  ? 168 GLU A CB    1 
ATOM   462  C CG    . GLU A 1 77  ? 16.351 73.556  -6.414  1.00 62.55  ? 168 GLU A CG    1 
ATOM   463  C CD    . GLU A 1 77  ? 16.694 73.109  -7.814  1.00 64.97  ? 168 GLU A CD    1 
ATOM   464  O OE1   . GLU A 1 77  ? 17.852 73.344  -8.223  1.00 65.43  ? 168 GLU A OE1   1 
ATOM   465  O OE2   . GLU A 1 77  ? 15.819 72.531  -8.504  1.00 65.73  ? 168 GLU A OE2   1 
ATOM   466  N N     . GLY A 1 78  ? 19.869 71.303  -6.212  1.00 60.27  ? 169 GLY A N     1 
ATOM   467  C CA    . GLY A 1 78  ? 21.279 70.978  -6.104  1.00 59.91  ? 169 GLY A CA    1 
ATOM   468  C C     . GLY A 1 78  ? 22.244 72.095  -5.760  1.00 59.41  ? 169 GLY A C     1 
ATOM   469  O O     . GLY A 1 78  ? 22.855 72.698  -6.651  1.00 60.74  ? 169 GLY A O     1 
ATOM   470  N N     . ASP A 1 79  ? 22.400 72.369  -4.467  1.00 57.12  ? 170 ASP A N     1 
ATOM   471  C CA    . ASP A 1 79  ? 23.330 73.405  -4.037  1.00 53.50  ? 170 ASP A CA    1 
ATOM   472  C C     . ASP A 1 79  ? 24.796 72.951  -3.961  1.00 51.64  ? 170 ASP A C     1 
ATOM   473  O O     . ASP A 1 79  ? 25.682 73.541  -4.584  1.00 51.38  ? 170 ASP A O     1 
ATOM   474  C CB    . ASP A 1 79  ? 22.989 73.875  -2.620  1.00 51.31  ? 170 ASP A CB    1 
ATOM   475  C CG    . ASP A 1 79  ? 22.774 72.729  -1.669  1.00 51.44  ? 170 ASP A CG    1 
ATOM   476  O OD1   . ASP A 1 79  ? 23.004 72.901  -0.451  1.00 51.48  ? 170 ASP A OD1   1 
ATOM   477  O OD2   . ASP A 1 79  ? 22.365 71.650  -2.147  1.00 51.15  ? 170 ASP A OD2   1 
ATOM   478  N N     . ASN A 1 80  ? 25.047 71.873  -3.237  1.00 49.83  ? 171 ASN A N     1 
ATOM   479  C CA    . ASN A 1 80  ? 26.415 71.415  -3.088  1.00 47.81  ? 171 ASN A CA    1 
ATOM   480  C C     . ASN A 1 80  ? 26.658 70.052  -2.508  1.00 45.52  ? 171 ASN A C     1 
ATOM   481  O O     . ASN A 1 80  ? 25.821 69.523  -1.780  1.00 43.96  ? 171 ASN A O     1 
ATOM   482  C CB    . ASN A 1 80  ? 27.348 72.483  -2.421  1.00 47.50  ? 171 ASN A CB    1 
ATOM   483  C CG    . ASN A 1 80  ? 26.628 73.266  -1.311  1.00 45.76  ? 171 ASN A CG    1 
ATOM   484  O OD1   . ASN A 1 80  ? 26.749 74.492  -1.240  1.00 42.02  ? 171 ASN A OD1   1 
ATOM   485  N ND2   . ASN A 1 80  ? 25.890 72.560  -0.444  1.00 41.87  ? 171 ASN A ND2   1 
ATOM   486  N N     . PHE A 1 81  ? 27.818 69.490  -2.830  1.00 43.73  ? 172 PHE A N     1 
ATOM   487  C CA    . PHE A 1 81  ? 28.257 68.172  -2.387  1.00 41.20  ? 172 PHE A CA    1 
ATOM   488  C C     . PHE A 1 81  ? 28.745 68.291  -0.952  1.00 39.12  ? 172 PHE A C     1 
ATOM   489  O O     . PHE A 1 81  ? 29.018 69.387  -0.497  1.00 40.45  ? 172 PHE A O     1 
ATOM   490  C CB    . PHE A 1 81  ? 29.377 67.716  -3.329  1.00 41.95  ? 172 PHE A CB    1 
ATOM   491  C CG    . PHE A 1 81  ? 29.927 66.360  -3.025  1.00 42.60  ? 172 PHE A CG    1 
ATOM   492  C CD1   . PHE A 1 81  ? 31.269 66.209  -2.668  1.00 41.37  ? 172 PHE A CD1   1 
ATOM   493  C CD2   . PHE A 1 81  ? 29.118 65.234  -3.103  1.00 40.56  ? 172 PHE A CD2   1 
ATOM   494  C CE1   . PHE A 1 81  ? 31.793 64.964  -2.393  1.00 41.52  ? 172 PHE A CE1   1 
ATOM   495  C CE2   . PHE A 1 81  ? 29.630 63.986  -2.830  1.00 41.34  ? 172 PHE A CE2   1 
ATOM   496  C CZ    . PHE A 1 81  ? 30.976 63.848  -2.473  1.00 42.83  ? 172 PHE A CZ    1 
ATOM   497  N N     . TYR A 1 82  ? 28.852 67.176  -0.235  1.00 37.92  ? 173 TYR A N     1 
ATOM   498  C CA    . TYR A 1 82  ? 29.290 67.200  1.168   1.00 36.02  ? 173 TYR A CA    1 
ATOM   499  C C     . TYR A 1 82  ? 30.142 66.007  1.565   1.00 34.90  ? 173 TYR A C     1 
ATOM   500  O O     . TYR A 1 82  ? 29.789 64.860  1.288   1.00 34.88  ? 173 TYR A O     1 
ATOM   501  C CB    . TYR A 1 82  ? 28.084 67.233  2.126   1.00 37.94  ? 173 TYR A CB    1 
ATOM   502  C CG    . TYR A 1 82  ? 27.364 68.552  2.196   1.00 40.95  ? 173 TYR A CG    1 
ATOM   503  C CD1   . TYR A 1 82  ? 27.600 69.441  3.246   1.00 42.34  ? 173 TYR A CD1   1 
ATOM   504  C CD2   . TYR A 1 82  ? 26.534 68.961  1.159   1.00 40.98  ? 173 TYR A CD2   1 
ATOM   505  C CE1   . TYR A 1 82  ? 27.034 70.710  3.249   1.00 43.46  ? 173 TYR A CE1   1 
ATOM   506  C CE2   . TYR A 1 82  ? 25.967 70.225  1.147   1.00 43.75  ? 173 TYR A CE2   1 
ATOM   507  C CZ    . TYR A 1 82  ? 26.220 71.103  2.191   1.00 43.94  ? 173 TYR A CZ    1 
ATOM   508  O OH    . TYR A 1 82  ? 25.684 72.377  2.153   1.00 43.09  ? 173 TYR A OH    1 
ATOM   509  N N     . VAL A 1 83  ? 31.255 66.290  2.238   1.00 31.97  ? 174 VAL A N     1 
ATOM   510  C CA    . VAL A 1 83  ? 32.148 65.261  2.727   1.00 27.75  ? 174 VAL A CA    1 
ATOM   511  C C     . VAL A 1 83  ? 32.075 65.412  4.229   1.00 27.20  ? 174 VAL A C     1 
ATOM   512  O O     . VAL A 1 83  ? 32.001 66.516  4.725   1.00 26.81  ? 174 VAL A O     1 
ATOM   513  C CB    . VAL A 1 83  ? 33.571 65.501  2.238   1.00 28.15  ? 174 VAL A CB    1 
ATOM   514  C CG1   . VAL A 1 83  ? 34.504 64.443  2.784   1.00 29.78  ? 174 VAL A CG1   1 
ATOM   515  C CG2   . VAL A 1 83  ? 33.597 65.478  0.728   1.00 25.58  ? 174 VAL A CG2   1 
ATOM   516  N N     . ILE A 1 84  ? 32.061 64.301  4.946   1.00 28.21  ? 175 ILE A N     1 
ATOM   517  C CA    . ILE A 1 84  ? 31.969 64.304  6.400   1.00 30.23  ? 175 ILE A CA    1 
ATOM   518  C C     . ILE A 1 84  ? 33.358 64.386  7.009   1.00 32.83  ? 175 ILE A C     1 
ATOM   519  O O     . ILE A 1 84  ? 34.134 63.442  6.920   1.00 33.60  ? 175 ILE A O     1 
ATOM   520  C CB    . ILE A 1 84  ? 31.278 63.006  6.920   1.00 31.56  ? 175 ILE A CB    1 
ATOM   521  C CG1   . ILE A 1 84  ? 29.796 62.991  6.517   1.00 33.89  ? 175 ILE A CG1   1 
ATOM   522  C CG2   . ILE A 1 84  ? 31.408 62.902  8.424   1.00 29.98  ? 175 ILE A CG2   1 
ATOM   523  C CD1   . ILE A 1 84  ? 29.071 61.680  6.815   1.00 33.16  ? 175 ILE A CD1   1 
ATOM   524  N N     . ASP A 1 85  ? 33.688 65.512  7.630   1.00 34.53  ? 176 ASP A N     1 
ATOM   525  C CA    . ASP A 1 85  ? 35.000 65.616  8.220   1.00 35.58  ? 176 ASP A CA    1 
ATOM   526  C C     . ASP A 1 85  ? 34.975 64.824  9.499   1.00 36.42  ? 176 ASP A C     1 
ATOM   527  O O     . ASP A 1 85  ? 35.853 64.012  9.732   1.00 39.17  ? 176 ASP A O     1 
ATOM   528  C CB    . ASP A 1 85  ? 35.383 67.068  8.475   1.00 36.78  ? 176 ASP A CB    1 
ATOM   529  C CG    . ASP A 1 85  ? 36.851 67.223  8.796   1.00 38.59  ? 176 ASP A CG    1 
ATOM   530  O OD1   . ASP A 1 85  ? 37.253 66.789  9.899   1.00 39.17  ? 176 ASP A OD1   1 
ATOM   531  O OD2   . ASP A 1 85  ? 37.602 67.757  7.944   1.00 37.47  ? 176 ASP A OD2   1 
ATOM   532  N N     . GLN A 1 86  ? 33.957 65.045  10.322  1.00 38.61  ? 177 GLN A N     1 
ATOM   533  C CA    . GLN A 1 86  ? 33.820 64.303  11.573  1.00 39.97  ? 177 GLN A CA    1 
ATOM   534  C C     . GLN A 1 86  ? 32.348 64.169  11.976  1.00 40.87  ? 177 GLN A C     1 
ATOM   535  O O     . GLN A 1 86  ? 31.541 65.065  11.702  1.00 40.09  ? 177 GLN A O     1 
ATOM   536  C CB    . GLN A 1 86  ? 34.600 64.988  12.692  1.00 41.13  ? 177 GLN A CB    1 
ATOM   537  C CG    . GLN A 1 86  ? 34.671 64.168  13.966  1.00 44.10  ? 177 GLN A CG    1 
ATOM   538  C CD    . GLN A 1 86  ? 35.228 64.949  15.135  1.00 46.67  ? 177 GLN A CD    1 
ATOM   539  O OE1   . GLN A 1 86  ? 35.322 64.439  16.253  1.00 48.67  ? 177 GLN A OE1   1 
ATOM   540  N NE2   . GLN A 1 86  ? 35.596 66.200  14.887  1.00 48.02  ? 177 GLN A NE2   1 
ATOM   541  N N     . GLY A 1 87  ? 32.011 63.039  12.607  1.00 41.33  ? 178 GLY A N     1 
ATOM   542  C CA    . GLY A 1 87  ? 30.646 62.792  13.054  1.00 43.14  ? 178 GLY A CA    1 
ATOM   543  C C     . GLY A 1 87  ? 29.870 61.764  12.247  1.00 44.81  ? 178 GLY A C     1 
ATOM   544  O O     . GLY A 1 87  ? 30.465 60.966  11.520  1.00 43.06  ? 178 GLY A O     1 
ATOM   545  N N     . GLU A 1 88  ? 28.538 61.786  12.391  1.00 47.09  ? 179 GLU A N     1 
ATOM   546  C CA    . GLU A 1 88  ? 27.625 60.873  11.681  1.00 48.84  ? 179 GLU A CA    1 
ATOM   547  C C     . GLU A 1 88  ? 26.385 61.538  11.107  1.00 49.65  ? 179 GLU A C     1 
ATOM   548  O O     . GLU A 1 88  ? 25.801 62.439  11.719  1.00 49.43  ? 179 GLU A O     1 
ATOM   549  C CB    . GLU A 1 88  ? 27.167 59.738  12.587  1.00 48.80  ? 179 GLU A CB    1 
ATOM   550  C CG    . GLU A 1 88  ? 28.139 58.590  12.663  1.00 52.30  ? 179 GLU A CG    1 
ATOM   551  C CD    . GLU A 1 88  ? 27.805 57.629  13.776  1.00 54.86  ? 179 GLU A CD    1 
ATOM   552  O OE1   . GLU A 1 88  ? 27.795 58.078  14.951  1.00 54.74  ? 179 GLU A OE1   1 
ATOM   553  O OE2   . GLU A 1 88  ? 27.555 56.435  13.478  1.00 55.21  ? 179 GLU A OE2   1 
ATOM   554  N N     . MET A 1 89  ? 25.989 61.071  9.925   1.00 51.50  ? 180 MET A N     1 
ATOM   555  C CA    . MET A 1 89  ? 24.810 61.581  9.220   1.00 53.05  ? 180 MET A CA    1 
ATOM   556  C C     . MET A 1 89  ? 23.726 60.510  9.173   1.00 54.55  ? 180 MET A C     1 
ATOM   557  O O     . MET A 1 89  ? 23.981 59.333  9.453   1.00 55.16  ? 180 MET A O     1 
ATOM   558  C CB    . MET A 1 89  ? 25.149 61.970  7.776   1.00 50.71  ? 180 MET A CB    1 
ATOM   559  C CG    . MET A 1 89  ? 26.175 63.058  7.629   1.00 49.90  ? 180 MET A CG    1 
ATOM   560  S SD    . MET A 1 89  ? 25.706 64.517  8.521   1.00 48.11  ? 180 MET A SD    1 
ATOM   561  C CE    . MET A 1 89  ? 24.496 65.211  7.432   1.00 49.10  ? 180 MET A CE    1 
ATOM   562  N N     . ASP A 1 90  ? 22.514 60.929  8.827   1.00 55.63  ? 181 ASP A N     1 
ATOM   563  C CA    . ASP A 1 90  ? 21.398 60.005  8.701   1.00 55.80  ? 181 ASP A CA    1 
ATOM   564  C C     . ASP A 1 90  ? 20.587 60.329  7.472   1.00 55.65  ? 181 ASP A C     1 
ATOM   565  O O     . ASP A 1 90  ? 20.197 61.475  7.238   1.00 55.15  ? 181 ASP A O     1 
ATOM   566  C CB    . ASP A 1 90  ? 20.511 60.004  9.943   1.00 56.16  ? 181 ASP A CB    1 
ATOM   567  C CG    . ASP A 1 90  ? 20.922 58.930  10.933  1.00 57.13  ? 181 ASP A CG    1 
ATOM   568  O OD1   . ASP A 1 90  ? 21.662 58.006  10.531  1.00 56.09  ? 181 ASP A OD1   1 
ATOM   569  O OD2   . ASP A 1 90  ? 20.499 58.997  12.105  1.00 58.97  ? 181 ASP A OD2   1 
ATOM   570  N N     . VAL A 1 91  ? 20.359 59.291  6.678   1.00 55.95  ? 182 VAL A N     1 
ATOM   571  C CA    . VAL A 1 91  ? 19.627 59.416  5.443   1.00 55.83  ? 182 VAL A CA    1 
ATOM   572  C C     . VAL A 1 91  ? 18.215 58.891  5.592   1.00 55.73  ? 182 VAL A C     1 
ATOM   573  O O     . VAL A 1 91  ? 17.984 57.810  6.141   1.00 55.99  ? 182 VAL A O     1 
ATOM   574  C CB    . VAL A 1 91  ? 20.346 58.661  4.318   1.00 56.40  ? 182 VAL A CB    1 
ATOM   575  C CG1   . VAL A 1 91  ? 19.670 58.939  2.983   1.00 57.27  ? 182 VAL A CG1   1 
ATOM   576  C CG2   . VAL A 1 91  ? 21.805 59.083  4.275   1.00 56.25  ? 182 VAL A CG2   1 
ATOM   577  N N     . TYR A 1 92  ? 17.271 59.684  5.103   1.00 55.10  ? 183 TYR A N     1 
ATOM   578  C CA    . TYR A 1 92  ? 15.868 59.330  5.152   1.00 54.63  ? 183 TYR A CA    1 
ATOM   579  C C     . TYR A 1 92  ? 15.284 59.393  3.756   1.00 54.15  ? 183 TYR A C     1 
ATOM   580  O O     . TYR A 1 92  ? 15.462 60.379  3.039   1.00 53.81  ? 183 TYR A O     1 
ATOM   581  C CB    . TYR A 1 92  ? 15.108 60.278  6.090   1.00 54.68  ? 183 TYR A CB    1 
ATOM   582  C CG    . TYR A 1 92  ? 15.248 59.915  7.556   1.00 54.10  ? 183 TYR A CG    1 
ATOM   583  C CD1   . TYR A 1 92  ? 15.793 60.817  8.478   1.00 54.39  ? 183 TYR A CD1   1 
ATOM   584  C CD2   . TYR A 1 92  ? 14.844 58.666  8.016   1.00 52.22  ? 183 TYR A CD2   1 
ATOM   585  C CE1   . TYR A 1 92  ? 15.930 60.474  9.824   1.00 53.46  ? 183 TYR A CE1   1 
ATOM   586  C CE2   . TYR A 1 92  ? 14.976 58.311  9.352   1.00 52.54  ? 183 TYR A CE2   1 
ATOM   587  C CZ    . TYR A 1 92  ? 15.516 59.214  10.254  1.00 53.82  ? 183 TYR A CZ    1 
ATOM   588  O OH    . TYR A 1 92  ? 15.627 58.851  11.581  1.00 53.56  ? 183 TYR A OH    1 
ATOM   589  N N     . VAL A 1 93  ? 14.622 58.311  3.363   1.00 53.44  ? 184 VAL A N     1 
ATOM   590  C CA    . VAL A 1 93  ? 13.975 58.237  2.064   1.00 53.17  ? 184 VAL A CA    1 
ATOM   591  C C     . VAL A 1 93  ? 12.505 58.091  2.389   1.00 52.99  ? 184 VAL A C     1 
ATOM   592  O O     . VAL A 1 93  ? 12.135 57.241  3.201   1.00 53.80  ? 184 VAL A O     1 
ATOM   593  C CB    . VAL A 1 93  ? 14.449 57.018  1.259   1.00 53.68  ? 184 VAL A CB    1 
ATOM   594  C CG1   . VAL A 1 93  ? 13.526 56.798  0.070   1.00 53.65  ? 184 VAL A CG1   1 
ATOM   595  C CG2   . VAL A 1 93  ? 15.875 57.246  0.767   1.00 52.27  ? 184 VAL A CG2   1 
ATOM   596  N N     . ASN A 1 94  ? 11.670 58.917  1.767   1.00 51.70  ? 185 ASN A N     1 
ATOM   597  C CA    . ASN A 1 94  ? 10.236 58.892  2.036   1.00 50.96  ? 185 ASN A CA    1 
ATOM   598  C C     . ASN A 1 94  ? 10.078 58.814  3.550   1.00 52.52  ? 185 ASN A C     1 
ATOM   599  O O     . ASN A 1 94  ? 9.662  57.790  4.087   1.00 52.08  ? 185 ASN A O     1 
ATOM   600  C CB    . ASN A 1 94  ? 9.580  57.681  1.374   1.00 47.68  ? 185 ASN A CB    1 
ATOM   601  C CG    . ASN A 1 94  ? 9.855  57.611  -0.109  1.00 45.10  ? 185 ASN A CG    1 
ATOM   602  O OD1   . ASN A 1 94  ? 9.818  58.619  -0.807  1.00 45.16  ? 185 ASN A OD1   1 
ATOM   603  N ND2   . ASN A 1 94  ? 10.117 56.417  -0.601  1.00 44.16  ? 185 ASN A ND2   1 
ATOM   604  N N     . ASN A 1 95  ? 10.446 59.900  4.224   1.00 55.15  ? 186 ASN A N     1 
ATOM   605  C CA    . ASN A 1 95  ? 10.385 60.002  5.679   1.00 58.88  ? 186 ASN A CA    1 
ATOM   606  C C     . ASN A 1 95  ? 10.568 58.643  6.352   1.00 61.40  ? 186 ASN A C     1 
ATOM   607  O O     . ASN A 1 95  ? 9.938  58.352  7.373   1.00 61.36  ? 186 ASN A O     1 
ATOM   608  C CB    . ASN A 1 95  ? 9.041  60.584  6.098   1.00 59.35  ? 186 ASN A CB    1 
ATOM   609  C CG    . ASN A 1 95  ? 8.872  62.020  5.635   1.00 61.49  ? 186 ASN A CG    1 
ATOM   610  O OD1   . ASN A 1 95  ? 9.108  62.339  4.463   1.00 60.01  ? 186 ASN A OD1   1 
ATOM   611  N ND2   . ASN A 1 95  ? 8.462  62.897  6.553   1.00 61.39  ? 186 ASN A ND2   1 
ATOM   612  N N     . GLU A 1 96  ? 11.452 57.831  5.777   1.00 63.52  ? 187 GLU A N     1 
ATOM   613  C CA    . GLU A 1 96  ? 11.758 56.498  6.287   1.00 65.35  ? 187 GLU A CA    1 
ATOM   614  C C     . GLU A 1 96  ? 13.268 56.268  6.189   1.00 66.23  ? 187 GLU A C     1 
ATOM   615  O O     . GLU A 1 96  ? 13.911 56.659  5.199   1.00 65.63  ? 187 GLU A O     1 
ATOM   616  C CB    . GLU A 1 96  ? 10.983 55.394  5.549   1.00 65.16  ? 187 GLU A CB    1 
ATOM   617  N N     . TRP A 1 97  ? 13.827 55.630  7.216   1.00 66.14  ? 188 TRP A N     1 
ATOM   618  C CA    . TRP A 1 97  ? 15.259 55.357  7.301   1.00 66.01  ? 188 TRP A CA    1 
ATOM   619  C C     . TRP A 1 97  ? 15.947 54.553  6.202   1.00 65.21  ? 188 TRP A C     1 
ATOM   620  O O     . TRP A 1 97  ? 15.351 53.665  5.585   1.00 65.83  ? 188 TRP A O     1 
ATOM   621  C CB    . TRP A 1 97  ? 15.544 54.511  8.542   1.00 67.62  ? 188 TRP A CB    1 
ATOM   622  C CG    . TRP A 1 97  ? 16.966 54.037  8.649   1.00 69.47  ? 188 TRP A CG    1 
ATOM   623  C CD1   . TRP A 1 97  ? 17.510 52.925  8.071   1.00 69.69  ? 188 TRP A CD1   1 
ATOM   624  C CD2   . TRP A 1 97  ? 18.023 54.669  9.373   1.00 69.50  ? 188 TRP A CD2   1 
ATOM   625  N NE1   . TRP A 1 97  ? 18.845 52.823  8.397   1.00 68.71  ? 188 TRP A NE1   1 
ATOM   626  C CE2   . TRP A 1 97  ? 19.183 53.881  9.194   1.00 68.95  ? 188 TRP A CE2   1 
ATOM   627  C CE3   . TRP A 1 97  ? 18.103 55.822  10.157  1.00 69.20  ? 188 TRP A CE3   1 
ATOM   628  C CZ2   . TRP A 1 97  ? 20.403 54.211  9.769   1.00 69.97  ? 188 TRP A CZ2   1 
ATOM   629  C CZ3   . TRP A 1 97  ? 19.317 56.149  10.729  1.00 70.83  ? 188 TRP A CZ3   1 
ATOM   630  C CH2   . TRP A 1 97  ? 20.453 55.347  10.533  1.00 71.46  ? 188 TRP A CH2   1 
ATOM   631  N N     . ALA A 1 98  ? 17.212 54.895  5.974   1.00 63.00  ? 189 ALA A N     1 
ATOM   632  C CA    . ALA A 1 98  ? 18.055 54.239  4.984   1.00 61.90  ? 189 ALA A CA    1 
ATOM   633  C C     . ALA A 1 98  ? 19.431 53.772  5.404   1.00 61.09  ? 189 ALA A C     1 
ATOM   634  O O     . ALA A 1 98  ? 19.638 52.582  5.621   1.00 59.66  ? 189 ALA A O     1 
ATOM   635  C CB    . ALA A 1 98  ? 18.279 55.307  3.873   1.00 61.12  ? 189 ALA A CB    1 
ATOM   636  N N     . THR A 1 99  ? 20.383 54.686  5.534   1.00 60.53  ? 190 THR A N     1 
ATOM   637  C CA    . THR A 1 99  ? 21.715 54.304  5.969   1.00 59.34  ? 190 THR A CA    1 
ATOM   638  C C     . THR A 1 99  ? 22.146 55.387  6.942   1.00 60.15  ? 190 THR A C     1 
ATOM   639  O O     . THR A 1 99  ? 21.480 56.420  7.073   1.00 58.79  ? 190 THR A O     1 
ATOM   640  C CB    . THR A 1 99  ? 22.790 54.124  4.904   1.00 58.29  ? 190 THR A CB    1 
ATOM   641  O OG1   . THR A 1 99  ? 22.865 55.312  4.110   1.00 58.62  ? 190 THR A OG1   1 
ATOM   642  C CG2   . THR A 1 99  ? 22.470 52.955  4.013   1.00 59.42  ? 190 THR A CG2   1 
ATOM   643  N N     . SER A 1 100 ? 23.272 55.140  7.601   1.00 60.87  ? 191 SER A N     1 
ATOM   644  C CA    . SER A 1 100 ? 23.855 56.068  8.553   1.00 61.03  ? 191 SER A CA    1 
ATOM   645  C C     . SER A 1 100 ? 25.221 56.410  7.938   1.00 60.07  ? 191 SER A C     1 
ATOM   646  O O     . SER A 1 100 ? 26.187 55.659  8.086   1.00 60.43  ? 191 SER A O     1 
ATOM   647  C CB    . SER A 1 100 ? 23.969 55.378  9.919   1.00 62.38  ? 191 SER A CB    1 
ATOM   648  O OG    . SER A 1 100 ? 24.301 56.290  10.956  1.00 65.58  ? 191 SER A OG    1 
ATOM   649  N N     . VAL A 1 101 ? 25.295 57.540  7.244   1.00 58.18  ? 192 VAL A N     1 
ATOM   650  C CA    . VAL A 1 101 ? 26.535 57.956  6.603   1.00 56.56  ? 192 VAL A CA    1 
ATOM   651  C C     . VAL A 1 101 ? 27.541 58.373  7.670   1.00 55.66  ? 192 VAL A C     1 
ATOM   652  O O     . VAL A 1 101 ? 27.334 59.361  8.359   1.00 57.06  ? 192 VAL A O     1 
ATOM   653  C CB    . VAL A 1 101 ? 26.319 59.151  5.700   1.00 56.32  ? 192 VAL A CB    1 
ATOM   654  C CG1   . VAL A 1 101 ? 27.561 59.381  4.871   1.00 57.57  ? 192 VAL A CG1   1 
ATOM   655  C CG2   . VAL A 1 101 ? 25.100 58.924  4.821   1.00 56.27  ? 192 VAL A CG2   1 
ATOM   656  N N     . GLY A 1 102 ? 28.637 57.633  7.784   1.00 54.26  ? 193 GLY A N     1 
ATOM   657  C CA    . GLY A 1 102 ? 29.645 57.955  8.778   1.00 51.50  ? 193 GLY A CA    1 
ATOM   658  C C     . GLY A 1 102 ? 30.787 58.847  8.317   1.00 50.10  ? 193 GLY A C     1 
ATOM   659  O O     . GLY A 1 102 ? 30.869 59.236  7.157   1.00 49.24  ? 193 GLY A O     1 
ATOM   660  N N     . GLU A 1 103 ? 31.686 59.163  9.245   1.00 49.58  ? 194 GLU A N     1 
ATOM   661  C CA    . GLU A 1 103 ? 32.830 60.026  8.966   1.00 47.46  ? 194 GLU A CA    1 
ATOM   662  C C     . GLU A 1 103 ? 33.767 59.452  7.923   1.00 44.19  ? 194 GLU A C     1 
ATOM   663  O O     . GLU A 1 103 ? 34.237 58.327  8.045   1.00 45.54  ? 194 GLU A O     1 
ATOM   664  C CB    . GLU A 1 103 ? 33.615 60.288  10.246  1.00 50.02  ? 194 GLU A CB    1 
ATOM   665  C CG    . GLU A 1 103 ? 34.885 61.074  10.006  1.00 53.76  ? 194 GLU A CG    1 
ATOM   666  C CD    . GLU A 1 103 ? 35.745 61.182  11.238  1.00 55.49  ? 194 GLU A CD    1 
ATOM   667  O OE1   . GLU A 1 103 ? 35.278 61.773  12.235  1.00 56.68  ? 194 GLU A OE1   1 
ATOM   668  O OE2   . GLU A 1 103 ? 36.886 60.671  11.205  1.00 57.28  ? 194 GLU A OE2   1 
ATOM   669  N N     . GLY A 1 104 ? 34.062 60.250  6.915   1.00 39.95  ? 195 GLY A N     1 
ATOM   670  C CA    . GLY A 1 104 ? 34.919 59.796  5.844   1.00 36.64  ? 195 GLY A CA    1 
ATOM   671  C C     . GLY A 1 104 ? 34.035 59.652  4.625   1.00 35.15  ? 195 GLY A C     1 
ATOM   672  O O     . GLY A 1 104 ? 34.489 59.698  3.479   1.00 34.77  ? 195 GLY A O     1 
ATOM   673  N N     . GLY A 1 105 ? 32.744 59.496  4.888   1.00 33.21  ? 196 GLY A N     1 
ATOM   674  C CA    . GLY A 1 105 ? 31.793 59.339  3.811   1.00 32.62  ? 196 GLY A CA    1 
ATOM   675  C C     . GLY A 1 105 ? 31.484 60.668  3.184   1.00 31.30  ? 196 GLY A C     1 
ATOM   676  O O     . GLY A 1 105 ? 32.134 61.645  3.503   1.00 30.87  ? 196 GLY A O     1 
ATOM   677  N N     . SER A 1 106 ? 30.516 60.699  2.278   1.00 30.35  ? 197 SER A N     1 
ATOM   678  C CA    . SER A 1 106 ? 30.125 61.944  1.639   1.00 31.83  ? 197 SER A CA    1 
ATOM   679  C C     . SER A 1 106 ? 28.713 61.765  1.111   1.00 32.25  ? 197 SER A C     1 
ATOM   680  O O     . SER A 1 106 ? 28.176 60.665  1.164   1.00 34.30  ? 197 SER A O     1 
ATOM   681  C CB    . SER A 1 106 ? 31.067 62.285  0.493   1.00 32.65  ? 197 SER A CB    1 
ATOM   682  O OG    . SER A 1 106 ? 30.753 61.532  -0.657  1.00 35.72  ? 197 SER A OG    1 
ATOM   683  N N     . PHE A 1 107 ? 28.102 62.836  0.615   1.00 31.52  ? 198 PHE A N     1 
ATOM   684  C CA    . PHE A 1 107 ? 26.746 62.752  0.083   1.00 30.88  ? 198 PHE A CA    1 
ATOM   685  C C     . PHE A 1 107 ? 26.383 63.993  -0.713  1.00 31.43  ? 198 PHE A C     1 
ATOM   686  O O     . PHE A 1 107 ? 27.133 64.969  -0.727  1.00 31.16  ? 198 PHE A O     1 
ATOM   687  C CB    . PHE A 1 107 ? 25.749 62.547  1.216   1.00 28.88  ? 198 PHE A CB    1 
ATOM   688  C CG    . PHE A 1 107 ? 25.905 63.521  2.331   1.00 32.06  ? 198 PHE A CG    1 
ATOM   689  C CD1   . PHE A 1 107 ? 25.385 64.809  2.228   1.00 32.97  ? 198 PHE A CD1   1 
ATOM   690  C CD2   . PHE A 1 107 ? 26.567 63.151  3.505   1.00 33.14  ? 198 PHE A CD2   1 
ATOM   691  C CE1   . PHE A 1 107 ? 25.519 65.718  3.281   1.00 33.10  ? 198 PHE A CE1   1 
ATOM   692  C CE2   . PHE A 1 107 ? 26.711 64.046  4.566   1.00 31.60  ? 198 PHE A CE2   1 
ATOM   693  C CZ    . PHE A 1 107 ? 26.186 65.330  4.455   1.00 34.01  ? 198 PHE A CZ    1 
ATOM   694  N N     . GLY A 1 108 ? 25.249 63.945  -1.406  1.00 30.86  ? 199 GLY A N     1 
ATOM   695  C CA    . GLY A 1 108 ? 24.832 65.095  -2.183  1.00 29.43  ? 199 GLY A CA    1 
ATOM   696  C C     . GLY A 1 108 ? 25.262 65.154  -3.640  1.00 29.33  ? 199 GLY A C     1 
ATOM   697  O O     . GLY A 1 108 ? 25.035 66.164  -4.298  1.00 28.28  ? 199 GLY A O     1 
ATOM   698  N N     . GLU A 1 109 ? 25.856 64.091  -4.173  1.00 30.21  ? 200 GLU A N     1 
ATOM   699  C CA    . GLU A 1 109 ? 26.308 64.141  -5.563  1.00 31.16  ? 200 GLU A CA    1 
ATOM   700  C C     . GLU A 1 109 ? 25.194 63.971  -6.588  1.00 33.16  ? 200 GLU A C     1 
ATOM   701  O O     . GLU A 1 109 ? 25.143 64.711  -7.582  1.00 32.88  ? 200 GLU A O     1 
ATOM   702  C CB    . GLU A 1 109 ? 27.387 63.082  -5.830  1.00 29.76  ? 200 GLU A CB    1 
ATOM   703  C CG    . GLU A 1 109 ? 26.845 61.686  -6.143  1.00 29.28  ? 200 GLU A CG    1 
ATOM   704  C CD    . GLU A 1 109 ? 26.379 60.953  -4.914  1.00 29.28  ? 200 GLU A CD    1 
ATOM   705  O OE1   . GLU A 1 109 ? 25.916 61.631  -3.978  1.00 31.37  ? 200 GLU A OE1   1 
ATOM   706  O OE2   . GLU A 1 109 ? 26.464 59.704  -4.884  1.00 28.18  ? 200 GLU A OE2   1 
ATOM   707  N N     . LEU A 1 110 ? 24.307 63.001  -6.335  1.00 34.73  ? 201 LEU A N     1 
ATOM   708  C CA    . LEU A 1 110 ? 23.198 62.664  -7.248  1.00 36.07  ? 201 LEU A CA    1 
ATOM   709  C C     . LEU A 1 110 ? 22.454 63.848  -7.886  1.00 37.32  ? 201 LEU A C     1 
ATOM   710  O O     . LEU A 1 110 ? 22.344 63.924  -9.122  1.00 37.27  ? 201 LEU A O     1 
ATOM   711  C CB    . LEU A 1 110 ? 22.207 61.703  -6.550  1.00 33.49  ? 201 LEU A CB    1 
ATOM   712  C CG    . LEU A 1 110 ? 22.454 60.173  -6.612  1.00 30.47  ? 201 LEU A CG    1 
ATOM   713  C CD1   . LEU A 1 110 ? 23.920 59.848  -6.848  1.00 29.95  ? 201 LEU A CD1   1 
ATOM   714  C CD2   . LEU A 1 110 ? 21.977 59.519  -5.321  1.00 27.51  ? 201 LEU A CD2   1 
ATOM   715  N N     . ALA A 1 111 ? 21.946 64.773  -7.075  1.00 36.88  ? 202 ALA A N     1 
ATOM   716  C CA    . ALA A 1 111 ? 21.260 65.905  -7.667  1.00 37.53  ? 202 ALA A CA    1 
ATOM   717  C C     . ALA A 1 111 ? 22.213 66.596  -8.638  1.00 39.01  ? 202 ALA A C     1 
ATOM   718  O O     . ALA A 1 111 ? 22.012 66.547  -9.856  1.00 39.27  ? 202 ALA A O     1 
ATOM   719  C CB    . ALA A 1 111 ? 20.824 66.906  -6.599  1.00 36.15  ? 202 ALA A CB    1 
ATOM   720  N N     . LEU A 1 112 ? 23.275 67.189  -8.089  1.00 40.31  ? 203 LEU A N     1 
ATOM   721  C CA    . LEU A 1 112 ? 24.275 67.915  -8.867  1.00 40.16  ? 203 LEU A CA    1 
ATOM   722  C C     . LEU A 1 112 ? 24.666 67.188  -10.146 1.00 41.61  ? 203 LEU A C     1 
ATOM   723  O O     . LEU A 1 112 ? 24.870 67.843  -11.180 1.00 41.82  ? 203 LEU A O     1 
ATOM   724  C CB    . LEU A 1 112 ? 25.552 68.104  -8.010  1.00 39.40  ? 203 LEU A CB    1 
ATOM   725  C CG    . LEU A 1 112 ? 25.408 68.445  -6.522  1.00 41.05  ? 203 LEU A CG    1 
ATOM   726  C CD1   . LEU A 1 112 ? 26.774 68.821  -5.973  1.00 39.92  ? 203 LEU A CD1   1 
ATOM   727  C CD2   . LEU A 1 112 ? 24.431 69.587  -6.315  1.00 42.12  ? 203 LEU A CD2   1 
ATOM   728  N N     . ILE A 1 113 ? 24.754 65.856  -10.102 1.00 42.31  ? 204 ILE A N     1 
ATOM   729  C CA    . ILE A 1 113 ? 25.117 65.085  -11.296 1.00 43.39  ? 204 ILE A CA    1 
ATOM   730  C C     . ILE A 1 113 ? 23.983 64.849  -12.281 1.00 44.95  ? 204 ILE A C     1 
ATOM   731  O O     . ILE A 1 113 ? 24.166 65.008  -13.491 1.00 44.58  ? 204 ILE A O     1 
ATOM   732  C CB    . ILE A 1 113 ? 25.680 63.703  -10.942 1.00 42.78  ? 204 ILE A CB    1 
ATOM   733  C CG1   . ILE A 1 113 ? 27.059 63.848  -10.305 1.00 43.70  ? 204 ILE A CG1   1 
ATOM   734  C CG2   . ILE A 1 113 ? 25.778 62.850  -12.197 1.00 41.81  ? 204 ILE A CG2   1 
ATOM   735  C CD1   . ILE A 1 113 ? 27.581 62.564  -9.686  1.00 42.74  ? 204 ILE A CD1   1 
ATOM   736  N N     . TYR A 1 114 ? 22.819 64.461  -11.767 1.00 46.46  ? 205 TYR A N     1 
ATOM   737  C CA    . TYR A 1 114 ? 21.672 64.172  -12.620 1.00 48.37  ? 205 TYR A CA    1 
ATOM   738  C C     . TYR A 1 114 ? 20.637 65.305  -12.656 1.00 50.56  ? 205 TYR A C     1 
ATOM   739  O O     . TYR A 1 114 ? 19.578 65.179  -13.299 1.00 51.64  ? 205 TYR A O     1 
ATOM   740  C CB    . TYR A 1 114 ? 21.018 62.861  -12.162 1.00 46.25  ? 205 TYR A CB    1 
ATOM   741  C CG    . TYR A 1 114 ? 21.966 61.701  -12.205 1.00 43.71  ? 205 TYR A CG    1 
ATOM   742  C CD1   . TYR A 1 114 ? 22.463 61.242  -13.421 1.00 42.78  ? 205 TYR A CD1   1 
ATOM   743  C CD2   . TYR A 1 114 ? 22.477 61.150  -11.031 1.00 44.29  ? 205 TYR A CD2   1 
ATOM   744  C CE1   . TYR A 1 114 ? 23.462 60.271  -13.476 1.00 42.66  ? 205 TYR A CE1   1 
ATOM   745  C CE2   . TYR A 1 114 ? 23.487 60.173  -11.069 1.00 43.86  ? 205 TYR A CE2   1 
ATOM   746  C CZ    . TYR A 1 114 ? 23.975 59.747  -12.300 1.00 43.81  ? 205 TYR A CZ    1 
ATOM   747  O OH    . TYR A 1 114 ? 25.007 58.845  -12.363 1.00 43.26  ? 205 TYR A OH    1 
ATOM   748  N N     . GLY A 1 115 ? 20.947 66.415  -11.992 1.00 50.43  ? 206 GLY A N     1 
ATOM   749  C CA    . GLY A 1 115 ? 20.006 67.519  -11.965 1.00 51.14  ? 206 GLY A CA    1 
ATOM   750  C C     . GLY A 1 115 ? 18.629 66.970  -11.643 1.00 51.07  ? 206 GLY A C     1 
ATOM   751  O O     . GLY A 1 115 ? 17.668 67.208  -12.366 1.00 51.48  ? 206 GLY A O     1 
ATOM   752  N N     . THR A 1 116 ? 18.548 66.224  -10.550 1.00 50.69  ? 207 THR A N     1 
ATOM   753  C CA    . THR A 1 116 ? 17.312 65.598  -10.117 1.00 51.09  ? 207 THR A CA    1 
ATOM   754  C C     . THR A 1 116 ? 17.199 65.752  -8.608  1.00 50.23  ? 207 THR A C     1 
ATOM   755  O O     . THR A 1 116 ? 18.004 65.188  -7.868  1.00 50.02  ? 207 THR A O     1 
ATOM   756  C CB    . THR A 1 116 ? 17.330 64.098  -10.485 1.00 52.87  ? 207 THR A CB    1 
ATOM   757  O OG1   . THR A 1 116 ? 16.404 63.369  -9.662  1.00 53.17  ? 207 THR A OG1   1 
ATOM   758  C CG2   . THR A 1 116 ? 18.730 63.540  -10.290 1.00 53.14  ? 207 THR A CG2   1 
ATOM   759  N N     . PRO A 1 117 ? 16.174 66.488  -8.137  1.00 50.23  ? 208 PRO A N     1 
ATOM   760  C CA    . PRO A 1 117 ? 15.879 66.776  -6.727  1.00 49.98  ? 208 PRO A CA    1 
ATOM   761  C C     . PRO A 1 117 ? 16.546 65.846  -5.729  1.00 50.65  ? 208 PRO A C     1 
ATOM   762  O O     . PRO A 1 117 ? 16.747 64.663  -6.002  1.00 50.88  ? 208 PRO A O     1 
ATOM   763  C CB    . PRO A 1 117 ? 14.349 66.715  -6.667  1.00 50.94  ? 208 PRO A CB    1 
ATOM   764  C CG    . PRO A 1 117 ? 13.948 66.016  -7.961  1.00 51.30  ? 208 PRO A CG    1 
ATOM   765  C CD    . PRO A 1 117 ? 14.940 66.584  -8.926  1.00 50.63  ? 208 PRO A CD    1 
ATOM   766  N N     . ARG A 1 118 ? 16.889 66.391  -4.566  1.00 51.84  ? 209 ARG A N     1 
ATOM   767  C CA    . ARG A 1 118 ? 17.574 65.618  -3.536  1.00 53.86  ? 209 ARG A CA    1 
ATOM   768  C C     . ARG A 1 118 ? 16.747 64.426  -3.069  1.00 53.47  ? 209 ARG A C     1 
ATOM   769  O O     . ARG A 1 118 ? 16.000 64.504  -2.104  1.00 53.94  ? 209 ARG A O     1 
ATOM   770  C CB    . ARG A 1 118 ? 17.967 66.539  -2.372  1.00 54.87  ? 209 ARG A CB    1 
ATOM   771  C CG    . ARG A 1 118 ? 18.769 67.752  -2.858  1.00 58.45  ? 209 ARG A CG    1 
ATOM   772  C CD    . ARG A 1 118 ? 19.333 68.631  -1.732  1.00 60.64  ? 209 ARG A CD    1 
ATOM   773  N NE    . ARG A 1 118 ? 20.608 68.136  -1.208  1.00 62.41  ? 209 ARG A NE    1 
ATOM   774  C CZ    . ARG A 1 118 ? 21.691 67.898  -1.949  1.00 62.81  ? 209 ARG A CZ    1 
ATOM   775  N NH1   . ARG A 1 118 ? 21.673 68.101  -3.263  1.00 62.33  ? 209 ARG A NH1   1 
ATOM   776  N NH2   . ARG A 1 118 ? 22.802 67.461  -1.372  1.00 61.71  ? 209 ARG A NH2   1 
ATOM   777  N N     . ALA A 1 119 ? 16.921 63.314  -3.778  1.00 53.92  ? 210 ALA A N     1 
ATOM   778  C CA    . ALA A 1 119 ? 16.207 62.066  -3.533  1.00 53.36  ? 210 ALA A CA    1 
ATOM   779  C C     . ALA A 1 119 ? 16.215 61.521  -2.108  1.00 52.80  ? 210 ALA A C     1 
ATOM   780  O O     . ALA A 1 119 ? 15.919 60.345  -1.893  1.00 53.37  ? 210 ALA A O     1 
ATOM   781  C CB    . ALA A 1 119 ? 16.723 61.000  -4.495  1.00 55.21  ? 210 ALA A CB    1 
ATOM   782  N N     . ALA A 1 120 ? 16.555 62.360  -1.138  1.00 51.83  ? 211 ALA A N     1 
ATOM   783  C CA    . ALA A 1 120 ? 16.559 61.937  0.258   1.00 51.69  ? 211 ALA A CA    1 
ATOM   784  C C     . ALA A 1 120 ? 16.826 63.123  1.174   1.00 52.17  ? 211 ALA A C     1 
ATOM   785  O O     . ALA A 1 120 ? 17.090 64.235  0.715   1.00 50.79  ? 211 ALA A O     1 
ATOM   786  C CB    . ALA A 1 120 ? 17.598 60.857  0.485   1.00 50.50  ? 211 ALA A CB    1 
ATOM   787  N N     . THR A 1 121 ? 16.733 62.870  2.475   1.00 52.25  ? 212 THR A N     1 
ATOM   788  C CA    . THR A 1 121 ? 16.968 63.893  3.485   1.00 51.80  ? 212 THR A CA    1 
ATOM   789  C C     . THR A 1 121 ? 18.063 63.363  4.395   1.00 52.16  ? 212 THR A C     1 
ATOM   790  O O     . THR A 1 121 ? 17.961 62.273  4.959   1.00 52.41  ? 212 THR A O     1 
ATOM   791  C CB    . THR A 1 121 ? 15.669 64.149  4.342   1.00 51.46  ? 212 THR A CB    1 
ATOM   792  O OG1   . THR A 1 121 ? 14.633 64.670  3.500   1.00 49.69  ? 212 THR A OG1   1 
ATOM   793  C CG2   . THR A 1 121 ? 15.954 65.156  5.454   1.00 48.95  ? 212 THR A CG2   1 
ATOM   794  N N     . VAL A 1 122 ? 19.129 64.140  4.522   1.00 52.12  ? 213 VAL A N     1 
ATOM   795  C CA    . VAL A 1 122 ? 20.254 63.736  5.350   1.00 51.30  ? 213 VAL A CA    1 
ATOM   796  C C     . VAL A 1 122 ? 20.263 64.586  6.623   1.00 50.96  ? 213 VAL A C     1 
ATOM   797  O O     . VAL A 1 122 ? 20.343 65.820  6.564   1.00 51.55  ? 213 VAL A O     1 
ATOM   798  C CB    . VAL A 1 122 ? 21.586 63.915  4.579   1.00 51.65  ? 213 VAL A CB    1 
ATOM   799  C CG1   . VAL A 1 122 ? 22.571 62.839  4.986   1.00 51.26  ? 213 VAL A CG1   1 
ATOM   800  C CG2   . VAL A 1 122 ? 21.334 63.873  3.080   1.00 49.92  ? 213 VAL A CG2   1 
ATOM   801  N N     . LYS A 1 123 ? 20.169 63.921  7.768   1.00 49.54  ? 214 LYS A N     1 
ATOM   802  C CA    . LYS A 1 123 ? 20.147 64.607  9.054   1.00 49.65  ? 214 LYS A CA    1 
ATOM   803  C C     . LYS A 1 123 ? 21.339 64.239  9.932   1.00 50.07  ? 214 LYS A C     1 
ATOM   804  O O     . LYS A 1 123 ? 21.706 63.066  10.036  1.00 50.17  ? 214 LYS A O     1 
ATOM   805  C CB    . LYS A 1 123 ? 18.850 64.280  9.817   1.00 49.10  ? 214 LYS A CB    1 
ATOM   806  C CG    . LYS A 1 123 ? 17.699 65.255  9.589   1.00 47.17  ? 214 LYS A CG    1 
ATOM   807  C CD    . LYS A 1 123 ? 16.496 64.946  10.487  1.00 44.99  ? 214 LYS A CD    1 
ATOM   808  C CE    . LYS A 1 123 ? 15.350 65.946  10.261  1.00 43.69  ? 214 LYS A CE    1 
ATOM   809  N NZ    . LYS A 1 123 ? 15.665 67.326  10.742  1.00 42.31  ? 214 LYS A NZ    1 
ATOM   810  N N     . ALA A 1 124 ? 21.924 65.249  10.578  1.00 48.49  ? 215 ALA A N     1 
ATOM   811  C CA    . ALA A 1 124 ? 23.066 65.039  11.456  1.00 46.42  ? 215 ALA A CA    1 
ATOM   812  C C     . ALA A 1 124 ? 22.688 64.150  12.630  1.00 46.13  ? 215 ALA A C     1 
ATOM   813  O O     . ALA A 1 124 ? 21.916 64.549  13.487  1.00 45.65  ? 215 ALA A O     1 
ATOM   814  C CB    . ALA A 1 124 ? 23.569 66.373  11.964  1.00 45.89  ? 215 ALA A CB    1 
ATOM   815  N N     . LYS A 1 125 ? 23.229 62.942  12.678  1.00 46.40  ? 216 LYS A N     1 
ATOM   816  C CA    . LYS A 1 125 ? 22.908 62.048  13.786  1.00 47.67  ? 216 LYS A CA    1 
ATOM   817  C C     . LYS A 1 125 ? 23.515 62.659  15.052  1.00 47.92  ? 216 LYS A C     1 
ATOM   818  O O     . LYS A 1 125 ? 22.897 62.678  16.122  1.00 47.85  ? 216 LYS A O     1 
ATOM   819  C CB    . LYS A 1 125 ? 23.501 60.657  13.531  1.00 48.37  ? 216 LYS A CB    1 
ATOM   820  C CG    . LYS A 1 125 ? 22.934 59.546  14.404  1.00 47.98  ? 216 LYS A CG    1 
ATOM   821  C CD    . LYS A 1 125 ? 23.784 58.281  14.317  1.00 48.76  ? 216 LYS A CD    1 
ATOM   822  C CE    . LYS A 1 125 ? 23.049 57.048  14.860  1.00 50.10  ? 216 LYS A CE    1 
ATOM   823  N NZ    . LYS A 1 125 ? 22.022 56.519  13.901  1.00 49.11  ? 216 LYS A NZ    1 
ATOM   824  N N     . THR A 1 126 ? 24.738 63.159  14.905  1.00 47.92  ? 217 THR A N     1 
ATOM   825  C CA    . THR A 1 126 ? 25.480 63.797  15.987  1.00 47.23  ? 217 THR A CA    1 
ATOM   826  C C     . THR A 1 126 ? 25.947 65.129  15.425  1.00 46.90  ? 217 THR A C     1 
ATOM   827  O O     . THR A 1 126 ? 25.933 65.318  14.216  1.00 47.03  ? 217 THR A O     1 
ATOM   828  C CB    . THR A 1 126 ? 26.717 62.968  16.375  1.00 47.47  ? 217 THR A CB    1 
ATOM   829  O OG1   . THR A 1 126 ? 27.590 62.855  15.246  1.00 49.57  ? 217 THR A OG1   1 
ATOM   830  C CG2   . THR A 1 126 ? 26.312 61.570  16.809  1.00 47.72  ? 217 THR A CG2   1 
ATOM   831  N N     . ASN A 1 127 ? 26.336 66.068  16.282  1.00 47.13  ? 218 ASN A N     1 
ATOM   832  C CA    . ASN A 1 127 ? 26.818 67.355  15.782  1.00 45.63  ? 218 ASN A CA    1 
ATOM   833  C C     . ASN A 1 127 ? 27.945 66.972  14.822  1.00 44.45  ? 218 ASN A C     1 
ATOM   834  O O     . ASN A 1 127 ? 28.692 66.017  15.087  1.00 44.17  ? 218 ASN A O     1 
ATOM   835  C CB    . ASN A 1 127 ? 27.370 68.194  16.924  1.00 47.40  ? 218 ASN A CB    1 
ATOM   836  C CG    . ASN A 1 127 ? 26.736 67.852  18.244  1.00 47.63  ? 218 ASN A CG    1 
ATOM   837  O OD1   . ASN A 1 127 ? 25.539 68.059  18.447  1.00 49.48  ? 218 ASN A OD1   1 
ATOM   838  N ND2   . ASN A 1 127 ? 27.534 67.308  19.154  1.00 47.80  ? 218 ASN A ND2   1 
ATOM   839  N N     . VAL A 1 128 ? 28.083 67.700  13.718  1.00 40.82  ? 219 VAL A N     1 
ATOM   840  C CA    . VAL A 1 128 ? 29.099 67.337  12.742  1.00 37.79  ? 219 VAL A CA    1 
ATOM   841  C C     . VAL A 1 128 ? 29.723 68.456  11.928  1.00 38.14  ? 219 VAL A C     1 
ATOM   842  O O     . VAL A 1 128 ? 29.054 69.391  11.498  1.00 37.21  ? 219 VAL A O     1 
ATOM   843  C CB    . VAL A 1 128 ? 28.534 66.340  11.710  1.00 36.41  ? 219 VAL A CB    1 
ATOM   844  C CG1   . VAL A 1 128 ? 28.010 65.079  12.393  1.00 32.47  ? 219 VAL A CG1   1 
ATOM   845  C CG2   . VAL A 1 128 ? 27.447 67.026  10.906  1.00 33.25  ? 219 VAL A CG2   1 
ATOM   846  N N     . LYS A 1 129 ? 31.023 68.330  11.695  1.00 38.54  ? 220 LYS A N     1 
ATOM   847  C CA    . LYS A 1 129 ? 31.729 69.295  10.869  1.00 37.10  ? 220 LYS A CA    1 
ATOM   848  C C     . LYS A 1 129 ? 31.752 68.643  9.491   1.00 33.62  ? 220 LYS A C     1 
ATOM   849  O O     . LYS A 1 129 ? 31.927 67.427  9.384   1.00 31.25  ? 220 LYS A O     1 
ATOM   850  C CB    . LYS A 1 129 ? 33.168 69.504  11.369  1.00 40.84  ? 220 LYS A CB    1 
ATOM   851  C CG    . LYS A 1 129 ? 33.937 70.606  10.618  1.00 42.86  ? 220 LYS A CG    1 
ATOM   852  C CD    . LYS A 1 129 ? 35.394 70.217  10.381  1.00 44.11  ? 220 LYS A CD    1 
ATOM   853  C CE    . LYS A 1 129 ? 36.142 71.326  9.689   1.00 43.32  ? 220 LYS A CE    1 
ATOM   854  N NZ    . LYS A 1 129 ? 35.343 71.798  8.532   1.00 45.13  ? 220 LYS A NZ    1 
ATOM   855  N N     . LEU A 1 130 ? 31.572 69.438  8.446   1.00 29.91  ? 221 LEU A N     1 
ATOM   856  C CA    . LEU A 1 130 ? 31.587 68.896  7.105   1.00 29.99  ? 221 LEU A CA    1 
ATOM   857  C C     . LEU A 1 130 ? 32.377 69.798  6.160   1.00 29.39  ? 221 LEU A C     1 
ATOM   858  O O     . LEU A 1 130 ? 32.962 70.783  6.580   1.00 28.17  ? 221 LEU A O     1 
ATOM   859  C CB    . LEU A 1 130 ? 30.148 68.733  6.582   1.00 31.20  ? 221 LEU A CB    1 
ATOM   860  C CG    . LEU A 1 130 ? 29.081 67.991  7.397   1.00 30.03  ? 221 LEU A CG    1 
ATOM   861  C CD1   . LEU A 1 130 ? 27.799 67.987  6.602   1.00 31.58  ? 221 LEU A CD1   1 
ATOM   862  C CD2   . LEU A 1 130 ? 29.494 66.568  7.711   1.00 31.17  ? 221 LEU A CD2   1 
ATOM   863  N N     . TRP A 1 131 ? 32.391 69.428  4.882   1.00 29.73  ? 222 TRP A N     1 
ATOM   864  C CA    . TRP A 1 131 ? 33.069 70.163  3.813   1.00 29.76  ? 222 TRP A CA    1 
ATOM   865  C C     . TRP A 1 131 ? 32.033 70.191  2.719   1.00 30.01  ? 222 TRP A C     1 
ATOM   866  O O     . TRP A 1 131 ? 31.469 69.155  2.382   1.00 31.43  ? 222 TRP A O     1 
ATOM   867  C CB    . TRP A 1 131 ? 34.317 69.410  3.280   1.00 30.13  ? 222 TRP A CB    1 
ATOM   868  C CG    . TRP A 1 131 ? 35.436 69.267  4.270   1.00 29.14  ? 222 TRP A CG    1 
ATOM   869  C CD1   . TRP A 1 131 ? 35.857 68.118  4.883   1.00 28.99  ? 222 TRP A CD1   1 
ATOM   870  C CD2   . TRP A 1 131 ? 36.188 70.331  4.854   1.00 27.85  ? 222 TRP A CD2   1 
ATOM   871  N NE1   . TRP A 1 131 ? 36.815 68.406  5.821   1.00 27.18  ? 222 TRP A NE1   1 
ATOM   872  C CE2   . TRP A 1 131 ? 37.034 69.759  5.824   1.00 28.09  ? 222 TRP A CE2   1 
ATOM   873  C CE3   . TRP A 1 131 ? 36.219 71.719  4.658   1.00 28.03  ? 222 TRP A CE3   1 
ATOM   874  C CZ2   . TRP A 1 131 ? 37.899 70.529  6.598   1.00 27.05  ? 222 TRP A CZ2   1 
ATOM   875  C CZ3   . TRP A 1 131 ? 37.076 72.481  5.427   1.00 26.24  ? 222 TRP A CZ3   1 
ATOM   876  C CH2   . TRP A 1 131 ? 37.902 71.886  6.385   1.00 27.54  ? 222 TRP A CH2   1 
ATOM   877  N N     . GLY A 1 132 ? 31.768 71.358  2.156   1.00 30.45  ? 223 GLY A N     1 
ATOM   878  C CA    . GLY A 1 132 ? 30.779 71.421  1.101   1.00 30.00  ? 223 GLY A CA    1 
ATOM   879  C C     . GLY A 1 132 ? 31.427 72.041  -0.101  1.00 29.69  ? 223 GLY A C     1 
ATOM   880  O O     . GLY A 1 132 ? 32.522 72.555  0.011   1.00 28.96  ? 223 GLY A O     1 
ATOM   881  N N     . ILE A 1 133 ? 30.753 72.013  -1.241  1.00 30.47  ? 224 ILE A N     1 
ATOM   882  C CA    . ILE A 1 133 ? 31.313 72.590  -2.439  1.00 33.20  ? 224 ILE A CA    1 
ATOM   883  C C     . ILE A 1 133 ? 30.176 72.890  -3.428  1.00 37.53  ? 224 ILE A C     1 
ATOM   884  O O     . ILE A 1 133 ? 29.244 72.096  -3.607  1.00 39.68  ? 224 ILE A O     1 
ATOM   885  C CB    . ILE A 1 133 ? 32.474 71.693  -2.952  1.00 32.66  ? 224 ILE A CB    1 
ATOM   886  C CG1   . ILE A 1 133 ? 33.025 72.243  -4.265  1.00 31.68  ? 224 ILE A CG1   1 
ATOM   887  C CG2   . ILE A 1 133 ? 32.015 70.256  -3.083  1.00 30.60  ? 224 ILE A CG2   1 
ATOM   888  C CD1   . ILE A 1 133 ? 34.254 71.534  -4.751  1.00 32.96  ? 224 ILE A CD1   1 
ATOM   889  N N     . ASP A 1 134 ? 30.263 74.052  -4.066  1.00 40.34  ? 225 ASP A N     1 
ATOM   890  C CA    . ASP A 1 134 ? 29.277 74.493  -5.044  1.00 42.52  ? 225 ASP A CA    1 
ATOM   891  C C     . ASP A 1 134 ? 29.149 73.440  -6.174  1.00 45.42  ? 225 ASP A C     1 
ATOM   892  O O     . ASP A 1 134 ? 30.162 72.920  -6.677  1.00 42.79  ? 225 ASP A O     1 
ATOM   893  C CB    . ASP A 1 134 ? 29.695 75.830  -5.641  1.00 42.15  ? 225 ASP A CB    1 
ATOM   894  C CG    . ASP A 1 134 ? 31.098 75.791  -6.271  1.00 41.74  ? 225 ASP A CG    1 
ATOM   895  O OD1   . ASP A 1 134 ? 32.087 75.656  -5.509  1.00 35.18  ? 225 ASP A OD1   1 
ATOM   896  O OD2   . ASP A 1 134 ? 31.198 75.901  -7.523  1.00 39.03  ? 225 ASP A OD2   1 
ATOM   897  N N     . ARG A 1 135 ? 27.903 73.169  -6.573  1.00 48.84  ? 226 ARG A N     1 
ATOM   898  C CA    . ARG A 1 135 ? 27.619 72.190  -7.619  1.00 52.34  ? 226 ARG A CA    1 
ATOM   899  C C     . ARG A 1 135 ? 28.383 72.438  -8.910  1.00 52.70  ? 226 ARG A C     1 
ATOM   900  O O     . ARG A 1 135 ? 28.630 71.504  -9.680  1.00 53.32  ? 226 ARG A O     1 
ATOM   901  C CB    . ARG A 1 135 ? 26.113 72.117  -7.915  1.00 54.21  ? 226 ARG A CB    1 
ATOM   902  C CG    . ARG A 1 135 ? 25.427 73.455  -8.093  1.00 58.17  ? 226 ARG A CG    1 
ATOM   903  C CD    . ARG A 1 135 ? 24.185 73.326  -8.969  1.00 59.50  ? 226 ARG A CD    1 
ATOM   904  N NE    . ARG A 1 135 ? 24.510 73.342  -10.394 1.00 61.09  ? 226 ARG A NE    1 
ATOM   905  C CZ    . ARG A 1 135 ? 24.917 74.424  -11.055 1.00 61.40  ? 226 ARG A CZ    1 
ATOM   906  N NH1   . ARG A 1 135 ? 25.045 75.580  -10.420 1.00 61.91  ? 226 ARG A NH1   1 
ATOM   907  N NH2   . ARG A 1 135 ? 25.193 74.353  -12.351 1.00 61.62  ? 226 ARG A NH2   1 
ATOM   908  N N     . ASP A 1 136 ? 28.771 73.684  -9.149  1.00 52.86  ? 227 ASP A N     1 
ATOM   909  C CA    . ASP A 1 136 ? 29.510 73.990  -10.364 1.00 54.03  ? 227 ASP A CA    1 
ATOM   910  C C     . ASP A 1 136 ? 30.950 73.484  -10.321 1.00 53.70  ? 227 ASP A C     1 
ATOM   911  O O     . ASP A 1 136 ? 31.479 73.007  -11.332 1.00 53.79  ? 227 ASP A O     1 
ATOM   912  C CB    . ASP A 1 136 ? 29.494 75.489  -10.620 1.00 56.49  ? 227 ASP A CB    1 
ATOM   913  C CG    . ASP A 1 136 ? 28.136 75.984  -11.034 1.00 57.93  ? 227 ASP A CG    1 
ATOM   914  O OD1   . ASP A 1 136 ? 27.739 75.701  -12.188 1.00 58.50  ? 227 ASP A OD1   1 
ATOM   915  O OD2   . ASP A 1 136 ? 27.469 76.640  -10.202 1.00 57.47  ? 227 ASP A OD2   1 
ATOM   916  N N     . SER A 1 137 ? 31.590 73.592  -9.159  1.00 51.59  ? 228 SER A N     1 
ATOM   917  C CA    . SER A 1 137 ? 32.965 73.124  -9.035  1.00 49.10  ? 228 SER A CA    1 
ATOM   918  C C     . SER A 1 137 ? 32.943 71.599  -9.025  1.00 47.47  ? 228 SER A C     1 
ATOM   919  O O     . SER A 1 137 ? 33.850 70.941  -9.554  1.00 44.44  ? 228 SER A O     1 
ATOM   920  C CB    . SER A 1 137 ? 33.612 73.664  -7.747  1.00 48.92  ? 228 SER A CB    1 
ATOM   921  O OG    . SER A 1 137 ? 33.993 75.021  -7.882  1.00 45.34  ? 228 SER A OG    1 
ATOM   922  N N     . TYR A 1 138 ? 31.894 71.048  -8.418  1.00 46.86  ? 229 TYR A N     1 
ATOM   923  C CA    . TYR A 1 138 ? 31.744 69.607  -8.346  1.00 46.55  ? 229 TYR A CA    1 
ATOM   924  C C     . TYR A 1 138 ? 31.609 69.020  -9.742  1.00 46.54  ? 229 TYR A C     1 
ATOM   925  O O     . TYR A 1 138 ? 32.337 68.098  -10.098 1.00 46.94  ? 229 TYR A O     1 
ATOM   926  C CB    . TYR A 1 138 ? 30.521 69.215  -7.530  1.00 45.74  ? 229 TYR A CB    1 
ATOM   927  C CG    . TYR A 1 138 ? 30.368 67.707  -7.422  1.00 48.13  ? 229 TYR A CG    1 
ATOM   928  C CD1   . TYR A 1 138 ? 30.813 67.015  -6.291  1.00 46.24  ? 229 TYR A CD1   1 
ATOM   929  C CD2   . TYR A 1 138 ? 29.815 66.962  -8.473  1.00 48.06  ? 229 TYR A CD2   1 
ATOM   930  C CE1   . TYR A 1 138 ? 30.712 65.633  -6.212  1.00 45.64  ? 229 TYR A CE1   1 
ATOM   931  C CE2   . TYR A 1 138 ? 29.716 65.576  -8.400  1.00 46.96  ? 229 TYR A CE2   1 
ATOM   932  C CZ    . TYR A 1 138 ? 30.166 64.920  -7.269  1.00 45.66  ? 229 TYR A CZ    1 
ATOM   933  O OH    . TYR A 1 138 ? 30.074 63.549  -7.202  1.00 44.74  ? 229 TYR A OH    1 
ATOM   934  N N     . ARG A 1 139 ? 30.678 69.541  -10.535 1.00 45.65  ? 230 ARG A N     1 
ATOM   935  C CA    . ARG A 1 139 ? 30.509 69.015  -11.875 1.00 45.59  ? 230 ARG A CA    1 
ATOM   936  C C     . ARG A 1 139 ? 31.784 69.230  -12.669 1.00 45.80  ? 230 ARG A C     1 
ATOM   937  O O     . ARG A 1 139 ? 32.252 68.330  -13.359 1.00 47.00  ? 230 ARG A O     1 
ATOM   938  C CB    . ARG A 1 139 ? 29.321 69.678  -12.582 1.00 45.16  ? 230 ARG A CB    1 
ATOM   939  C CG    . ARG A 1 139 ? 27.990 69.443  -11.861 1.00 48.41  ? 230 ARG A CG    1 
ATOM   940  C CD    . ARG A 1 139 ? 26.721 69.676  -12.730 1.00 50.06  ? 230 ARG A CD    1 
ATOM   941  N NE    . ARG A 1 139 ? 26.316 68.519  -13.543 1.00 47.98  ? 230 ARG A NE    1 
ATOM   942  C CZ    . ARG A 1 139 ? 26.570 68.386  -14.843 1.00 47.70  ? 230 ARG A CZ    1 
ATOM   943  N NH1   . ARG A 1 139 ? 27.231 69.326  -15.508 1.00 47.60  ? 230 ARG A NH1   1 
ATOM   944  N NH2   . ARG A 1 139 ? 26.159 67.310  -15.489 1.00 48.12  ? 230 ARG A NH2   1 
ATOM   945  N N     . ARG A 1 140 ? 32.372 70.412  -12.533 1.00 45.87  ? 231 ARG A N     1 
ATOM   946  C CA    . ARG A 1 140 ? 33.583 70.754  -13.274 1.00 44.27  ? 231 ARG A CA    1 
ATOM   947  C C     . ARG A 1 140 ? 34.837 70.016  -12.820 1.00 44.80  ? 231 ARG A C     1 
ATOM   948  O O     . ARG A 1 140 ? 35.774 69.840  -13.607 1.00 46.16  ? 231 ARG A O     1 
ATOM   949  C CB    . ARG A 1 140 ? 33.813 72.264  -13.199 1.00 43.20  ? 231 ARG A CB    1 
ATOM   950  C CG    . ARG A 1 140 ? 34.847 72.820  -14.175 1.00 42.64  ? 231 ARG A CG    1 
ATOM   951  C CD    . ARG A 1 140 ? 34.741 74.341  -14.236 1.00 40.54  ? 231 ARG A CD    1 
ATOM   952  N NE    . ARG A 1 140 ? 34.654 74.919  -12.898 1.00 39.07  ? 231 ARG A NE    1 
ATOM   953  C CZ    . ARG A 1 140 ? 35.683 75.039  -12.068 1.00 40.38  ? 231 ARG A CZ    1 
ATOM   954  N NH1   . ARG A 1 140 ? 36.894 74.628  -12.445 1.00 39.87  ? 231 ARG A NH1   1 
ATOM   955  N NH2   . ARG A 1 140 ? 35.495 75.546  -10.850 1.00 40.19  ? 231 ARG A NH2   1 
ATOM   956  N N     . ILE A 1 141 ? 34.860 69.566  -11.567 1.00 44.01  ? 232 ILE A N     1 
ATOM   957  C CA    . ILE A 1 141 ? 36.040 68.871  -11.061 1.00 41.83  ? 232 ILE A CA    1 
ATOM   958  C C     . ILE A 1 141 ? 35.844 67.440  -10.537 1.00 39.96  ? 232 ILE A C     1 
ATOM   959  O O     . ILE A 1 141 ? 36.672 66.562  -10.801 1.00 39.69  ? 232 ILE A O     1 
ATOM   960  C CB    . ILE A 1 141 ? 36.717 69.702  -9.947  1.00 42.48  ? 232 ILE A CB    1 
ATOM   961  C CG1   . ILE A 1 141 ? 36.881 71.152  -10.406 1.00 41.90  ? 232 ILE A CG1   1 
ATOM   962  C CG2   . ILE A 1 141 ? 38.070 69.103  -9.602  1.00 40.56  ? 232 ILE A CG2   1 
ATOM   963  C CD1   . ILE A 1 141 ? 37.457 72.073  -9.347  1.00 43.18  ? 232 ILE A CD1   1 
ATOM   964  N N     . LEU A 1 142 ? 34.763 67.192  -9.806  1.00 36.71  ? 233 LEU A N     1 
ATOM   965  C CA    . LEU A 1 142 ? 34.558 65.860  -9.244  1.00 34.60  ? 233 LEU A CA    1 
ATOM   966  C C     . LEU A 1 142 ? 33.747 64.832  -10.054 1.00 34.23  ? 233 LEU A C     1 
ATOM   967  O O     . LEU A 1 142 ? 34.060 63.636  -10.044 1.00 34.14  ? 233 LEU A O     1 
ATOM   968  C CB    . LEU A 1 142 ? 33.986 65.999  -7.832  1.00 31.23  ? 233 LEU A CB    1 
ATOM   969  C CG    . LEU A 1 142 ? 34.995 66.595  -6.850  1.00 27.60  ? 233 LEU A CG    1 
ATOM   970  C CD1   . LEU A 1 142 ? 34.368 66.777  -5.503  1.00 26.02  ? 233 LEU A CD1   1 
ATOM   971  C CD2   . LEU A 1 142 ? 36.189 65.684  -6.752  1.00 27.85  ? 233 LEU A CD2   1 
ATOM   972  N N     . MET A 1 143 ? 32.730 65.296  -10.768 1.00 33.08  ? 234 MET A N     1 
ATOM   973  C CA    . MET A 1 143 ? 31.870 64.433  -11.564 1.00 31.81  ? 234 MET A CA    1 
ATOM   974  C C     . MET A 1 143 ? 32.501 63.388  -12.476 1.00 32.12  ? 234 MET A C     1 
ATOM   975  O O     . MET A 1 143 ? 32.362 62.181  -12.249 1.00 31.95  ? 234 MET A O     1 
ATOM   976  C CB    . MET A 1 143 ? 30.984 65.290  -12.439 1.00 31.18  ? 234 MET A CB    1 
ATOM   977  C CG    . MET A 1 143 ? 29.895 64.525  -13.097 1.00 31.90  ? 234 MET A CG    1 
ATOM   978  S SD    . MET A 1 143 ? 28.557 65.628  -13.357 1.00 33.85  ? 234 MET A SD    1 
ATOM   979  C CE    . MET A 1 143 ? 29.049 66.279  -14.908 1.00 34.98  ? 234 MET A CE    1 
ATOM   980  N N     . GLY A 1 144 ? 33.182 63.864  -13.515 1.00 31.93  ? 235 GLY A N     1 
ATOM   981  C CA    . GLY A 1 144 ? 33.825 62.982  -14.471 1.00 29.67  ? 235 GLY A CA    1 
ATOM   982  C C     . GLY A 1 144 ? 34.522 61.797  -13.812 1.00 31.86  ? 235 GLY A C     1 
ATOM   983  O O     . GLY A 1 144 ? 34.192 60.652  -14.106 1.00 32.07  ? 235 GLY A O     1 
ATOM   984  N N     . SER A 1 145 ? 35.464 62.058  -12.918 1.00 32.95  ? 236 SER A N     1 
ATOM   985  C CA    . SER A 1 145 ? 36.182 60.989  -12.267 1.00 33.33  ? 236 SER A CA    1 
ATOM   986  C C     . SER A 1 145 ? 35.255 60.109  -11.430 1.00 34.48  ? 236 SER A C     1 
ATOM   987  O O     . SER A 1 145 ? 35.543 58.936  -11.227 1.00 35.11  ? 236 SER A O     1 
ATOM   988  C CB    . SER A 1 145 ? 37.288 61.576  -11.387 1.00 33.77  ? 236 SER A CB    1 
ATOM   989  O OG    . SER A 1 145 ? 36.959 61.480  -10.005 1.00 37.82  ? 236 SER A OG    1 
ATOM   990  N N     . THR A 1 146 ? 34.149 60.670  -10.945 1.00 34.58  ? 237 THR A N     1 
ATOM   991  C CA    . THR A 1 146 ? 33.216 59.916  -10.111 1.00 35.85  ? 237 THR A CA    1 
ATOM   992  C C     . THR A 1 146 ? 32.244 59.067  -10.925 1.00 37.00  ? 237 THR A C     1 
ATOM   993  O O     . THR A 1 146 ? 32.058 57.873  -10.655 1.00 38.44  ? 237 THR A O     1 
ATOM   994  C CB    . THR A 1 146 ? 32.425 60.860  -9.165  1.00 35.71  ? 237 THR A CB    1 
ATOM   995  O OG1   . THR A 1 146 ? 33.174 61.062  -7.959  1.00 35.10  ? 237 THR A OG1   1 
ATOM   996  C CG2   . THR A 1 146 ? 31.070 60.278  -8.812  1.00 36.49  ? 237 THR A CG2   1 
ATOM   997  N N     . LEU A 1 147 ? 31.615 59.680  -11.914 1.00 36.19  ? 238 LEU A N     1 
ATOM   998  C CA    . LEU A 1 147 ? 30.706 58.942  -12.751 1.00 35.77  ? 238 LEU A CA    1 
ATOM   999  C C     . LEU A 1 147 ? 31.481 57.796  -13.382 1.00 37.94  ? 238 LEU A C     1 
ATOM   1000 O O     . LEU A 1 147 ? 31.015 56.656  -13.375 1.00 41.25  ? 238 LEU A O     1 
ATOM   1001 C CB    . LEU A 1 147 ? 30.139 59.839  -13.839 1.00 35.26  ? 238 LEU A CB    1 
ATOM   1002 C CG    . LEU A 1 147 ? 29.260 60.994  -13.379 1.00 35.14  ? 238 LEU A CG    1 
ATOM   1003 C CD1   . LEU A 1 147 ? 28.877 61.829  -14.583 1.00 36.57  ? 238 LEU A CD1   1 
ATOM   1004 C CD2   . LEU A 1 147 ? 28.024 60.458  -12.673 1.00 35.78  ? 238 LEU A CD2   1 
ATOM   1005 N N     . ARG A 1 148 ? 32.664 58.082  -13.925 1.00 37.67  ? 239 ARG A N     1 
ATOM   1006 C CA    . ARG A 1 148 ? 33.462 57.027  -14.545 1.00 37.59  ? 239 ARG A CA    1 
ATOM   1007 C C     . ARG A 1 148 ? 33.736 55.863  -13.606 1.00 36.03  ? 239 ARG A C     1 
ATOM   1008 O O     . ARG A 1 148 ? 33.453 54.723  -13.944 1.00 37.49  ? 239 ARG A O     1 
ATOM   1009 C CB    . ARG A 1 148 ? 34.788 57.573  -15.105 1.00 39.23  ? 239 ARG A CB    1 
ATOM   1010 C CG    . ARG A 1 148 ? 34.646 58.128  -16.530 1.00 42.33  ? 239 ARG A CG    1 
ATOM   1011 C CD    . ARG A 1 148 ? 35.975 58.369  -17.258 1.00 43.51  ? 239 ARG A CD    1 
ATOM   1012 N NE    . ARG A 1 148 ? 36.571 59.667  -16.965 1.00 45.71  ? 239 ARG A NE    1 
ATOM   1013 C CZ    . ARG A 1 148 ? 37.518 59.870  -16.056 1.00 46.80  ? 239 ARG A CZ    1 
ATOM   1014 N NH1   . ARG A 1 148 ? 37.986 58.849  -15.349 1.00 48.24  ? 239 ARG A NH1   1 
ATOM   1015 N NH2   . ARG A 1 148 ? 37.994 61.094  -15.849 1.00 46.64  ? 239 ARG A NH2   1 
ATOM   1016 N N     . LYS A 1 149 ? 34.269 56.142  -12.426 1.00 34.06  ? 240 LYS A N     1 
ATOM   1017 C CA    . LYS A 1 149 ? 34.572 55.089  -11.462 1.00 33.52  ? 240 LYS A CA    1 
ATOM   1018 C C     . LYS A 1 149 ? 33.401 54.109  -11.238 1.00 34.24  ? 240 LYS A C     1 
ATOM   1019 O O     . LYS A 1 149 ? 33.567 52.888  -11.240 1.00 32.51  ? 240 LYS A O     1 
ATOM   1020 C CB    . LYS A 1 149 ? 34.966 55.723  -10.128 1.00 30.40  ? 240 LYS A CB    1 
ATOM   1021 C CG    . LYS A 1 149 ? 35.286 54.728  -9.038  1.00 25.74  ? 240 LYS A CG    1 
ATOM   1022 C CD    . LYS A 1 149 ? 36.638 54.112  -9.257  1.00 19.95  ? 240 LYS A CD    1 
ATOM   1023 C CE    . LYS A 1 149 ? 37.611 54.565  -8.198  1.00 17.23  ? 240 LYS A CE    1 
ATOM   1024 N NZ    . LYS A 1 149 ? 37.559 53.795  -6.948  1.00 11.06  ? 240 LYS A NZ    1 
ATOM   1025 N N     . ARG A 1 150 ? 32.217 54.658  -11.032 1.00 35.29  ? 241 ARG A N     1 
ATOM   1026 C CA    . ARG A 1 150 ? 31.042 53.838  -10.795 1.00 37.13  ? 241 ARG A CA    1 
ATOM   1027 C C     . ARG A 1 150 ? 30.694 53.038  -12.046 1.00 40.11  ? 241 ARG A C     1 
ATOM   1028 O O     . ARG A 1 150 ? 30.475 51.834  -11.985 1.00 40.07  ? 241 ARG A O     1 
ATOM   1029 C CB    . ARG A 1 150 ? 29.879 54.744  -10.382 1.00 33.99  ? 241 ARG A CB    1 
ATOM   1030 C CG    . ARG A 1 150 ? 30.214 55.596  -9.175  1.00 28.47  ? 241 ARG A CG    1 
ATOM   1031 C CD    . ARG A 1 150 ? 29.088 56.494  -8.806  1.00 25.15  ? 241 ARG A CD    1 
ATOM   1032 N NE    . ARG A 1 150 ? 29.222 56.969  -7.434  1.00 22.39  ? 241 ARG A NE    1 
ATOM   1033 C CZ    . ARG A 1 150 ? 28.305 57.712  -6.826  1.00 19.44  ? 241 ARG A CZ    1 
ATOM   1034 N NH1   . ARG A 1 150 ? 27.200 58.063  -7.472  1.00 18.95  ? 241 ARG A NH1   1 
ATOM   1035 N NH2   . ARG A 1 150 ? 28.482 58.084  -5.576  1.00 14.73  ? 241 ARG A NH2   1 
ATOM   1036 N N     . LYS A 1 151 ? 30.645 53.721  -13.184 1.00 43.24  ? 242 LYS A N     1 
ATOM   1037 C CA    . LYS A 1 151 ? 30.341 53.077  -14.452 1.00 45.76  ? 242 LYS A CA    1 
ATOM   1038 C C     . LYS A 1 151 ? 31.338 51.954  -14.700 1.00 47.30  ? 242 LYS A C     1 
ATOM   1039 O O     . LYS A 1 151 ? 31.118 51.096  -15.548 1.00 48.90  ? 242 LYS A O     1 
ATOM   1040 C CB    . LYS A 1 151 ? 30.430 54.097  -15.592 1.00 45.94  ? 242 LYS A CB    1 
ATOM   1041 C CG    . LYS A 1 151 ? 30.176 53.531  -16.992 1.00 47.22  ? 242 LYS A CG    1 
ATOM   1042 C CD    . LYS A 1 151 ? 28.720 53.102  -17.182 1.00 48.88  ? 242 LYS A CD    1 
ATOM   1043 C CE    . LYS A 1 151 ? 28.453 52.625  -18.610 1.00 50.44  ? 242 LYS A CE    1 
ATOM   1044 N NZ    . LYS A 1 151 ? 27.134 51.946  -18.780 1.00 48.23  ? 242 LYS A NZ    1 
ATOM   1045 N N     . MET A 1 152 ? 32.426 51.957  -13.945 1.00 48.66  ? 243 MET A N     1 
ATOM   1046 C CA    . MET A 1 152 ? 33.473 50.963  -14.116 1.00 50.45  ? 243 MET A CA    1 
ATOM   1047 C C     . MET A 1 152 ? 33.398 49.821  -13.121 1.00 52.05  ? 243 MET A C     1 
ATOM   1048 O O     . MET A 1 152 ? 34.174 48.864  -13.201 1.00 51.63  ? 243 MET A O     1 
ATOM   1049 C CB    . MET A 1 152 ? 34.841 51.639  -13.997 1.00 51.37  ? 243 MET A CB    1 
ATOM   1050 C CG    . MET A 1 152 ? 36.010 50.705  -14.239 1.00 53.43  ? 243 MET A CG    1 
ATOM   1051 S SD    . MET A 1 152 ? 37.600 51.503  -14.056 1.00 54.87  ? 243 MET A SD    1 
ATOM   1052 C CE    . MET A 1 152 ? 38.424 50.373  -12.917 1.00 53.65  ? 243 MET A CE    1 
ATOM   1053 N N     . TYR A 1 153 ? 32.463 49.916  -12.186 1.00 53.59  ? 244 TYR A N     1 
ATOM   1054 C CA    . TYR A 1 153 ? 32.335 48.892  -11.166 1.00 54.55  ? 244 TYR A CA    1 
ATOM   1055 C C     . TYR A 1 153 ? 30.892 48.561  -10.816 1.00 55.44  ? 244 TYR A C     1 
ATOM   1056 O O     . TYR A 1 153 ? 30.627 47.568  -10.145 1.00 55.31  ? 244 TYR A O     1 
ATOM   1057 C CB    . TYR A 1 153 ? 33.065 49.346  -9.909  1.00 56.06  ? 244 TYR A CB    1 
ATOM   1058 C CG    . TYR A 1 153 ? 34.573 49.416  -10.022 1.00 57.41  ? 244 TYR A CG    1 
ATOM   1059 C CD1   . TYR A 1 153 ? 35.341 48.256  -10.129 1.00 57.70  ? 244 TYR A CD1   1 
ATOM   1060 C CD2   . TYR A 1 153 ? 35.235 50.640  -9.944  1.00 58.23  ? 244 TYR A CD2   1 
ATOM   1061 C CE1   . TYR A 1 153 ? 36.729 48.315  -10.144 1.00 59.21  ? 244 TYR A CE1   1 
ATOM   1062 C CE2   . TYR A 1 153 ? 36.623 50.713  -9.961  1.00 59.23  ? 244 TYR A CE2   1 
ATOM   1063 C CZ    . TYR A 1 153 ? 37.364 49.549  -10.059 1.00 60.86  ? 244 TYR A CZ    1 
ATOM   1064 O OH    . TYR A 1 153 ? 38.741 49.629  -10.083 1.00 62.27  ? 244 TYR A OH    1 
ATOM   1065 N N     . GLU A 1 154 ? 29.965 49.403  -11.259 1.00 57.15  ? 245 GLU A N     1 
ATOM   1066 C CA    . GLU A 1 154 ? 28.544 49.201  -10.990 1.00 58.14  ? 245 GLU A CA    1 
ATOM   1067 C C     . GLU A 1 154 ? 28.157 47.732  -11.186 1.00 57.54  ? 245 GLU A C     1 
ATOM   1068 O O     . GLU A 1 154 ? 27.808 47.043  -10.228 1.00 57.13  ? 245 GLU A O     1 
ATOM   1069 C CB    . GLU A 1 154 ? 27.699 50.088  -11.920 1.00 60.53  ? 245 GLU A CB    1 
ATOM   1070 C CG    . GLU A 1 154 ? 26.189 49.922  -11.765 1.00 63.40  ? 245 GLU A CG    1 
ATOM   1071 C CD    . GLU A 1 154 ? 25.535 51.007  -10.907 1.00 65.12  ? 245 GLU A CD    1 
ATOM   1072 O OE1   . GLU A 1 154 ? 25.429 52.166  -11.375 1.00 64.09  ? 245 GLU A OE1   1 
ATOM   1073 O OE2   . GLU A 1 154 ? 25.123 50.695  -9.765  1.00 64.95  ? 245 GLU A OE2   1 
ATOM   1074 N N     . GLU A 1 155 ? 28.231 47.252  -12.426 1.00 56.19  ? 246 GLU A N     1 
ATOM   1075 C CA    . GLU A 1 155 ? 27.876 45.872  -12.719 1.00 53.82  ? 246 GLU A CA    1 
ATOM   1076 C C     . GLU A 1 155 ? 28.679 44.925  -11.855 1.00 52.60  ? 246 GLU A C     1 
ATOM   1077 O O     . GLU A 1 155 ? 28.121 44.163  -11.074 1.00 52.93  ? 246 GLU A O     1 
ATOM   1078 C CB    . GLU A 1 155 ? 28.129 45.533  -14.191 1.00 54.95  ? 246 GLU A CB    1 
ATOM   1079 C CG    . GLU A 1 155 ? 27.054 46.007  -15.171 1.00 55.88  ? 246 GLU A CG    1 
ATOM   1080 C CD    . GLU A 1 155 ? 26.370 44.855  -15.915 1.00 57.86  ? 246 GLU A CD    1 
ATOM   1081 O OE1   . GLU A 1 155 ? 25.693 44.029  -15.261 1.00 57.58  ? 246 GLU A OE1   1 
ATOM   1082 O OE2   . GLU A 1 155 ? 26.509 44.774  -17.157 1.00 57.81  ? 246 GLU A OE2   1 
ATOM   1083 N N     . PHE A 1 156 ? 29.997 44.991  -11.995 1.00 50.68  ? 247 PHE A N     1 
ATOM   1084 C CA    . PHE A 1 156 ? 30.896 44.117  -11.260 1.00 48.65  ? 247 PHE A CA    1 
ATOM   1085 C C     . PHE A 1 156 ? 30.526 43.848  -9.814  1.00 48.19  ? 247 PHE A C     1 
ATOM   1086 O O     . PHE A 1 156 ? 30.643 42.724  -9.349  1.00 47.74  ? 247 PHE A O     1 
ATOM   1087 C CB    . PHE A 1 156 ? 32.314 44.669  -11.309 1.00 49.89  ? 247 PHE A CB    1 
ATOM   1088 C CG    . PHE A 1 156 ? 33.309 43.860  -10.518 1.00 51.93  ? 247 PHE A CG    1 
ATOM   1089 C CD1   . PHE A 1 156 ? 33.558 42.530  -10.835 1.00 52.03  ? 247 PHE A CD1   1 
ATOM   1090 C CD2   . PHE A 1 156 ? 33.997 44.430  -9.454  1.00 51.66  ? 247 PHE A CD2   1 
ATOM   1091 C CE1   . PHE A 1 156 ? 34.478 41.783  -10.102 1.00 52.10  ? 247 PHE A CE1   1 
ATOM   1092 C CE2   . PHE A 1 156 ? 34.916 43.687  -8.721  1.00 51.97  ? 247 PHE A CE2   1 
ATOM   1093 C CZ    . PHE A 1 156 ? 35.154 42.366  -9.046  1.00 50.97  ? 247 PHE A CZ    1 
ATOM   1094 N N     . LEU A 1 157 ? 30.082 44.877  -9.103  1.00 48.04  ? 248 LEU A N     1 
ATOM   1095 C CA    . LEU A 1 157 ? 29.737 44.731  -7.694  1.00 47.67  ? 248 LEU A CA    1 
ATOM   1096 C C     . LEU A 1 157 ? 28.334 44.198  -7.433  1.00 47.87  ? 248 LEU A C     1 
ATOM   1097 O O     . LEU A 1 157 ? 28.093 43.560  -6.406  1.00 47.52  ? 248 LEU A O     1 
ATOM   1098 C CB    . LEU A 1 157 ? 29.930 46.066  -6.970  1.00 47.95  ? 248 LEU A CB    1 
ATOM   1099 C CG    . LEU A 1 157 ? 31.347 46.652  -6.934  1.00 47.79  ? 248 LEU A CG    1 
ATOM   1100 C CD1   . LEU A 1 157 ? 31.311 47.957  -6.194  1.00 48.38  ? 248 LEU A CD1   1 
ATOM   1101 C CD2   . LEU A 1 157 ? 32.308 45.705  -6.245  1.00 48.26  ? 248 LEU A CD2   1 
ATOM   1102 N N     . SER A 1 158 ? 27.414 44.455  -8.358  1.00 47.78  ? 249 SER A N     1 
ATOM   1103 C CA    . SER A 1 158 ? 26.039 43.979  -8.222  1.00 47.50  ? 249 SER A CA    1 
ATOM   1104 C C     . SER A 1 158 ? 26.030 42.452  -8.184  1.00 47.64  ? 249 SER A C     1 
ATOM   1105 O O     . SER A 1 158 ? 24.996 41.825  -7.929  1.00 47.49  ? 249 SER A O     1 
ATOM   1106 C CB    . SER A 1 158 ? 25.175 44.462  -9.398  1.00 46.80  ? 249 SER A CB    1 
ATOM   1107 O OG    . SER A 1 158 ? 25.438 43.718  -10.576 1.00 45.17  ? 249 SER A OG    1 
ATOM   1108 N N     . LYS A 1 159 ? 27.194 41.862  -8.432  1.00 47.43  ? 250 LYS A N     1 
ATOM   1109 C CA    . LYS A 1 159 ? 27.330 40.416  -8.440  1.00 47.30  ? 250 LYS A CA    1 
ATOM   1110 C C     . LYS A 1 159 ? 28.534 39.961  -7.615  1.00 48.00  ? 250 LYS A C     1 
ATOM   1111 O O     . LYS A 1 159 ? 29.384 39.213  -8.107  1.00 48.44  ? 250 LYS A O     1 
ATOM   1112 C CB    . LYS A 1 159 ? 27.480 39.942  -9.883  1.00 47.42  ? 250 LYS A CB    1 
ATOM   1113 C CG    . LYS A 1 159 ? 26.634 40.725  -10.874 1.00 47.68  ? 250 LYS A CG    1 
ATOM   1114 C CD    . LYS A 1 159 ? 26.555 40.021  -12.221 1.00 49.94  ? 250 LYS A CD    1 
ATOM   1115 C CE    . LYS A 1 159 ? 26.032 40.946  -13.300 1.00 51.12  ? 250 LYS A CE    1 
ATOM   1116 N NZ    . LYS A 1 159 ? 24.774 41.623  -12.862 1.00 54.56  ? 250 LYS A NZ    1 
ATOM   1117 N N     . VAL A 1 160 ? 28.615 40.416  -6.366  1.00 48.43  ? 251 VAL A N     1 
ATOM   1118 C CA    . VAL A 1 160 ? 29.733 40.038  -5.504  1.00 47.45  ? 251 VAL A CA    1 
ATOM   1119 C C     . VAL A 1 160 ? 29.321 39.676  -4.081  1.00 47.61  ? 251 VAL A C     1 
ATOM   1120 O O     . VAL A 1 160 ? 29.443 40.484  -3.161  1.00 47.54  ? 251 VAL A O     1 
ATOM   1121 C CB    . VAL A 1 160 ? 30.813 41.154  -5.425  1.00 46.93  ? 251 VAL A CB    1 
ATOM   1122 C CG1   . VAL A 1 160 ? 31.984 40.681  -4.572  1.00 45.40  ? 251 VAL A CG1   1 
ATOM   1123 C CG2   . VAL A 1 160 ? 31.310 41.512  -6.817  1.00 45.77  ? 251 VAL A CG2   1 
ATOM   1124 N N     . SER A 1 161 ? 28.844 38.443  -3.925  1.00 47.78  ? 252 SER A N     1 
ATOM   1125 C CA    . SER A 1 161 ? 28.423 37.877  -2.644  1.00 47.44  ? 252 SER A CA    1 
ATOM   1126 C C     . SER A 1 161 ? 28.050 38.769  -1.466  1.00 47.91  ? 252 SER A C     1 
ATOM   1127 O O     . SER A 1 161 ? 26.926 39.268  -1.372  1.00 48.64  ? 252 SER A O     1 
ATOM   1128 C CB    . SER A 1 161 ? 29.501 36.920  -2.137  1.00 45.48  ? 252 SER A CB    1 
ATOM   1129 O OG    . SER A 1 161 ? 29.881 36.024  -3.156  1.00 44.33  ? 252 SER A OG    1 
ATOM   1130 N N     . ILE A 1 162 ? 29.013 38.927  -0.566  1.00 46.75  ? 253 ILE A N     1 
ATOM   1131 C CA    . ILE A 1 162 ? 28.887 39.738  0.630   1.00 46.72  ? 253 ILE A CA    1 
ATOM   1132 C C     . ILE A 1 162 ? 28.105 41.040  0.387   1.00 46.19  ? 253 ILE A C     1 
ATOM   1133 O O     . ILE A 1 162 ? 27.155 41.361  1.110   1.00 46.45  ? 253 ILE A O     1 
ATOM   1134 C CB    . ILE A 1 162 ? 30.270 40.086  1.105   1.00 47.91  ? 253 ILE A CB    1 
ATOM   1135 C CG1   . ILE A 1 162 ? 31.082 40.555  -0.104  1.00 48.80  ? 253 ILE A CG1   1 
ATOM   1136 C CG2   . ILE A 1 162 ? 30.908 38.871  1.771   1.00 47.20  ? 253 ILE A CG2   1 
ATOM   1137 C CD1   . ILE A 1 162 ? 32.567 40.473  0.067   1.00 52.06  ? 253 ILE A CD1   1 
ATOM   1138 N N     . LEU A 1 163 ? 28.527 41.780  -0.634  1.00 44.77  ? 254 LEU A N     1 
ATOM   1139 C CA    . LEU A 1 163 ? 27.907 43.064  -0.971  1.00 44.49  ? 254 LEU A CA    1 
ATOM   1140 C C     . LEU A 1 163 ? 26.487 42.911  -1.524  1.00 43.61  ? 254 LEU A C     1 
ATOM   1141 O O     . LEU A 1 163 ? 25.958 43.818  -2.171  1.00 42.49  ? 254 LEU A O     1 
ATOM   1142 C CB    . LEU A 1 163 ? 28.781 43.829  -1.983  1.00 43.53  ? 254 LEU A CB    1 
ATOM   1143 C CG    . LEU A 1 163 ? 30.310 43.761  -1.858  1.00 42.71  ? 254 LEU A CG    1 
ATOM   1144 C CD1   . LEU A 1 163 ? 30.900 44.745  -2.841  1.00 42.23  ? 254 LEU A CD1   1 
ATOM   1145 C CD2   . LEU A 1 163 ? 30.784 44.079  -0.443  1.00 43.12  ? 254 LEU A CD2   1 
ATOM   1146 N N     . GLU A 1 164 ? 25.879 41.757  -1.270  1.00 43.37  ? 255 GLU A N     1 
ATOM   1147 C CA    . GLU A 1 164 ? 24.531 41.497  -1.748  1.00 43.75  ? 255 GLU A CA    1 
ATOM   1148 C C     . GLU A 1 164 ? 23.533 42.302  -0.924  1.00 44.17  ? 255 GLU A C     1 
ATOM   1149 O O     . GLU A 1 164 ? 22.567 42.888  -1.438  1.00 43.49  ? 255 GLU A O     1 
ATOM   1150 C CB    . GLU A 1 164 ? 24.234 40.031  -1.684  1.00 42.67  ? 255 GLU A CB    1 
ATOM   1151 N N     . SER A 1 165 ? 23.788 42.330  0.377   1.00 43.48  ? 256 SER A N     1 
ATOM   1152 C CA    . SER A 1 165 ? 22.919 43.028  1.299   1.00 43.59  ? 256 SER A CA    1 
ATOM   1153 C C     . SER A 1 165 ? 23.145 44.527  1.292   1.00 43.91  ? 256 SER A C     1 
ATOM   1154 O O     . SER A 1 165 ? 23.098 45.163  2.344   1.00 45.24  ? 256 SER A O     1 
ATOM   1155 C CB    . SER A 1 165 ? 23.119 42.467  2.710   1.00 44.11  ? 256 SER A CB    1 
ATOM   1156 O OG    . SER A 1 165 ? 24.479 42.135  2.946   1.00 44.25  ? 256 SER A OG    1 
ATOM   1157 N N     . LEU A 1 166 ? 23.391 45.096  0.114   1.00 44.19  ? 257 LEU A N     1 
ATOM   1158 C CA    . LEU A 1 166 ? 23.623 46.543  -0.006  1.00 43.10  ? 257 LEU A CA    1 
ATOM   1159 C C     . LEU A 1 166 ? 22.730 47.226  -1.040  1.00 42.41  ? 257 LEU A C     1 
ATOM   1160 O O     . LEU A 1 166 ? 22.598 46.753  -2.171  1.00 43.23  ? 257 LEU A O     1 
ATOM   1161 C CB    . LEU A 1 166 ? 25.095 46.822  -0.342  1.00 42.05  ? 257 LEU A CB    1 
ATOM   1162 C CG    . LEU A 1 166 ? 26.017 47.298  0.797   1.00 43.44  ? 257 LEU A CG    1 
ATOM   1163 C CD1   . LEU A 1 166 ? 25.974 46.332  1.970   1.00 42.64  ? 257 LEU A CD1   1 
ATOM   1164 C CD2   . LEU A 1 166 ? 27.440 47.432  0.277   1.00 42.77  ? 257 LEU A CD2   1 
ATOM   1165 N N     . ASP A 1 167 ? 22.108 48.332  -0.641  1.00 41.92  ? 258 ASP A N     1 
ATOM   1166 C CA    . ASP A 1 167 ? 21.255 49.099  -1.541  1.00 41.76  ? 258 ASP A CA    1 
ATOM   1167 C C     . ASP A 1 167 ? 22.151 49.588  -2.686  1.00 41.81  ? 258 ASP A C     1 
ATOM   1168 O O     . ASP A 1 167 ? 23.379 49.548  -2.585  1.00 40.84  ? 258 ASP A O     1 
ATOM   1169 C CB    . ASP A 1 167 ? 20.666 50.327  -0.825  1.00 43.95  ? 258 ASP A CB    1 
ATOM   1170 C CG    . ASP A 1 167 ? 19.938 49.978  0.486   1.00 46.55  ? 258 ASP A CG    1 
ATOM   1171 O OD1   . ASP A 1 167 ? 20.363 50.486  1.553   1.00 47.15  ? 258 ASP A OD1   1 
ATOM   1172 O OD2   . ASP A 1 167 ? 18.937 49.218  0.455   1.00 44.57  ? 258 ASP A OD2   1 
ATOM   1173 N N     . LYS A 1 168 ? 21.535 50.068  -3.763  1.00 41.22  ? 259 LYS A N     1 
ATOM   1174 C CA    . LYS A 1 168 ? 22.263 50.576  -4.925  1.00 40.31  ? 259 LYS A CA    1 
ATOM   1175 C C     . LYS A 1 168 ? 23.292 51.692  -4.637  1.00 41.09  ? 259 LYS A C     1 
ATOM   1176 O O     . LYS A 1 168 ? 24.319 51.771  -5.323  1.00 40.49  ? 259 LYS A O     1 
ATOM   1177 C CB    . LYS A 1 168 ? 21.272 51.083  -5.973  1.00 39.03  ? 259 LYS A CB    1 
ATOM   1178 C CG    . LYS A 1 168 ? 21.933 51.498  -7.267  1.00 40.39  ? 259 LYS A CG    1 
ATOM   1179 C CD    . LYS A 1 168 ? 20.935 52.097  -8.246  1.00 41.96  ? 259 LYS A CD    1 
ATOM   1180 C CE    . LYS A 1 168 ? 21.582 52.346  -9.618  1.00 42.88  ? 259 LYS A CE    1 
ATOM   1181 N NZ    . LYS A 1 168 ? 22.887 53.081  -9.528  1.00 45.32  ? 259 LYS A NZ    1 
ATOM   1182 N N     . TRP A 1 169 ? 23.010 52.549  -3.643  1.00 41.21  ? 260 TRP A N     1 
ATOM   1183 C CA    . TRP A 1 169 ? 23.898 53.664  -3.270  1.00 40.12  ? 260 TRP A CA    1 
ATOM   1184 C C     . TRP A 1 169 ? 25.059 53.214  -2.408  1.00 39.29  ? 260 TRP A C     1 
ATOM   1185 O O     . TRP A 1 169 ? 26.175 53.707  -2.554  1.00 38.74  ? 260 TRP A O     1 
ATOM   1186 C CB    . TRP A 1 169 ? 23.140 54.748  -2.501  1.00 41.66  ? 260 TRP A CB    1 
ATOM   1187 C CG    . TRP A 1 169 ? 23.984 55.961  -2.144  1.00 43.81  ? 260 TRP A CG    1 
ATOM   1188 C CD1   . TRP A 1 169 ? 24.234 57.049  -2.938  1.00 44.72  ? 260 TRP A CD1   1 
ATOM   1189 C CD2   . TRP A 1 169 ? 24.675 56.209  -0.901  1.00 43.57  ? 260 TRP A CD2   1 
ATOM   1190 N NE1   . TRP A 1 169 ? 25.028 57.957  -2.266  1.00 44.34  ? 260 TRP A NE1   1 
ATOM   1191 C CE2   . TRP A 1 169 ? 25.312 57.466  -1.018  1.00 43.33  ? 260 TRP A CE2   1 
ATOM   1192 C CE3   . TRP A 1 169 ? 24.814 55.493  0.297   1.00 44.27  ? 260 TRP A CE3   1 
ATOM   1193 C CZ2   . TRP A 1 169 ? 26.073 58.020  0.017   1.00 42.24  ? 260 TRP A CZ2   1 
ATOM   1194 C CZ3   . TRP A 1 169 ? 25.578 56.049  1.333   1.00 42.06  ? 260 TRP A CZ3   1 
ATOM   1195 C CH2   . TRP A 1 169 ? 26.193 57.298  1.180   1.00 42.86  ? 260 TRP A CH2   1 
ATOM   1196 N N     . GLU A 1 170 ? 24.789 52.290  -1.494  1.00 38.88  ? 261 GLU A N     1 
ATOM   1197 C CA    . GLU A 1 170 ? 25.829 51.781  -0.622  1.00 39.02  ? 261 GLU A CA    1 
ATOM   1198 C C     . GLU A 1 170 ? 26.936 51.134  -1.471  1.00 40.00  ? 261 GLU A C     1 
ATOM   1199 O O     . GLU A 1 170 ? 28.114 51.162  -1.109  1.00 40.54  ? 261 GLU A O     1 
ATOM   1200 C CB    . GLU A 1 170 ? 25.238 50.756  0.340   1.00 38.89  ? 261 GLU A CB    1 
ATOM   1201 C CG    . GLU A 1 170 ? 24.022 51.238  1.127   1.00 40.26  ? 261 GLU A CG    1 
ATOM   1202 C CD    . GLU A 1 170 ? 23.478 50.170  2.096   1.00 41.85  ? 261 GLU A CD    1 
ATOM   1203 O OE1   . GLU A 1 170 ? 22.972 49.122  1.619   1.00 41.39  ? 261 GLU A OE1   1 
ATOM   1204 O OE2   . GLU A 1 170 ? 23.564 50.376  3.335   1.00 40.60  ? 261 GLU A OE2   1 
ATOM   1205 N N     . ARG A 1 171 ? 26.555 50.563  -2.611  1.00 40.04  ? 262 ARG A N     1 
ATOM   1206 C CA    . ARG A 1 171 ? 27.519 49.909  -3.482  1.00 38.51  ? 262 ARG A CA    1 
ATOM   1207 C C     . ARG A 1 171 ? 28.350 50.928  -4.246  1.00 36.52  ? 262 ARG A C     1 
ATOM   1208 O O     . ARG A 1 171 ? 29.547 50.730  -4.450  1.00 35.83  ? 262 ARG A O     1 
ATOM   1209 C CB    . ARG A 1 171 ? 26.806 48.927  -4.431  1.00 39.80  ? 262 ARG A CB    1 
ATOM   1210 C CG    . ARG A 1 171 ? 26.367 47.637  -3.719  1.00 40.55  ? 262 ARG A CG    1 
ATOM   1211 C CD    . ARG A 1 171 ? 26.012 46.481  -4.657  1.00 42.34  ? 262 ARG A CD    1 
ATOM   1212 N NE    . ARG A 1 171 ? 24.740 46.653  -5.361  1.00 44.54  ? 262 ARG A NE    1 
ATOM   1213 C CZ    . ARG A 1 171 ? 24.560 47.456  -6.409  1.00 45.31  ? 262 ARG A CZ    1 
ATOM   1214 N NH1   . ARG A 1 171 ? 25.572 48.171  -6.894  1.00 43.52  ? 262 ARG A NH1   1 
ATOM   1215 N NH2   . ARG A 1 171 ? 23.361 47.547  -6.974  1.00 44.18  ? 262 ARG A NH2   1 
ATOM   1216 N N     . LEU A 1 172 ? 27.716 52.011  -4.674  1.00 33.92  ? 263 LEU A N     1 
ATOM   1217 C CA    . LEU A 1 172 ? 28.440 53.072  -5.358  1.00 32.58  ? 263 LEU A CA    1 
ATOM   1218 C C     . LEU A 1 172 ? 29.436 53.572  -4.305  1.00 32.54  ? 263 LEU A C     1 
ATOM   1219 O O     . LEU A 1 172 ? 30.613 53.827  -4.575  1.00 33.14  ? 263 LEU A O     1 
ATOM   1220 C CB    . LEU A 1 172 ? 27.469 54.174  -5.774  1.00 30.57  ? 263 LEU A CB    1 
ATOM   1221 C CG    . LEU A 1 172 ? 26.477 53.637  -6.812  1.00 30.74  ? 263 LEU A CG    1 
ATOM   1222 C CD1   . LEU A 1 172 ? 25.400 54.652  -7.141  1.00 27.68  ? 263 LEU A CD1   1 
ATOM   1223 C CD2   . LEU A 1 172 ? 27.246 53.246  -8.049  1.00 29.19  ? 263 LEU A CD2   1 
ATOM   1224 N N     . THR A 1 173 ? 28.951 53.684  -3.081  1.00 31.86  ? 264 THR A N     1 
ATOM   1225 C CA    . THR A 1 173 ? 29.799 54.088  -1.982  1.00 30.59  ? 264 THR A CA    1 
ATOM   1226 C C     . THR A 1 173 ? 30.996 53.144  -1.992  1.00 29.36  ? 264 THR A C     1 
ATOM   1227 O O     . THR A 1 173 ? 32.116 53.543  -1.718  1.00 29.20  ? 264 THR A O     1 
ATOM   1228 C CB    . THR A 1 173 ? 29.060 53.933  -0.664  1.00 29.38  ? 264 THR A CB    1 
ATOM   1229 O OG1   . THR A 1 173 ? 27.868 54.708  -0.710  1.00 30.86  ? 264 THR A OG1   1 
ATOM   1230 C CG2   . THR A 1 173 ? 29.895 54.404  0.473   1.00 32.38  ? 264 THR A CG2   1 
ATOM   1231 N N     . VAL A 1 174 ? 30.748 51.878  -2.301  1.00 29.43  ? 265 VAL A N     1 
ATOM   1232 C CA    . VAL A 1 174 ? 31.833 50.906  -2.351  1.00 29.13  ? 265 VAL A CA    1 
ATOM   1233 C C     . VAL A 1 174 ? 32.703 51.188  -3.564  1.00 29.12  ? 265 VAL A C     1 
ATOM   1234 O O     . VAL A 1 174 ? 33.935 51.130  -3.502  1.00 28.83  ? 265 VAL A O     1 
ATOM   1235 C CB    . VAL A 1 174 ? 31.308 49.474  -2.445  1.00 26.30  ? 265 VAL A CB    1 
ATOM   1236 C CG1   . VAL A 1 174 ? 32.344 48.601  -3.081  1.00 25.40  ? 265 VAL A CG1   1 
ATOM   1237 C CG2   . VAL A 1 174 ? 30.993 48.951  -1.051  1.00 26.90  ? 265 VAL A CG2   1 
ATOM   1238 N N     . ALA A 1 175 ? 32.044 51.479  -4.674  1.00 28.37  ? 266 ALA A N     1 
ATOM   1239 C CA    . ALA A 1 175 ? 32.755 51.788  -5.887  1.00 27.58  ? 266 ALA A CA    1 
ATOM   1240 C C     . ALA A 1 175 ? 33.684 52.945  -5.526  1.00 28.27  ? 266 ALA A C     1 
ATOM   1241 O O     . ALA A 1 175 ? 34.903 52.824  -5.631  1.00 29.44  ? 266 ALA A O     1 
ATOM   1242 C CB    . ALA A 1 175 ? 31.766 52.199  -6.983  1.00 23.68  ? 266 ALA A CB    1 
ATOM   1243 N N     . ASP A 1 176 ? 33.106 54.044  -5.048  1.00 26.92  ? 267 ASP A N     1 
ATOM   1244 C CA    . ASP A 1 176 ? 33.876 55.233  -4.705  1.00 25.35  ? 267 ASP A CA    1 
ATOM   1245 C C     . ASP A 1 176 ? 35.156 54.932  -3.930  1.00 24.71  ? 267 ASP A C     1 
ATOM   1246 O O     . ASP A 1 176 ? 36.242 55.261  -4.365  1.00 27.10  ? 267 ASP A O     1 
ATOM   1247 C CB    . ASP A 1 176 ? 33.002 56.226  -3.923  1.00 23.37  ? 267 ASP A CB    1 
ATOM   1248 C CG    . ASP A 1 176 ? 31.843 56.802  -4.759  1.00 24.24  ? 267 ASP A CG    1 
ATOM   1249 O OD1   . ASP A 1 176 ? 31.720 56.525  -5.981  1.00 21.44  ? 267 ASP A OD1   1 
ATOM   1250 O OD2   . ASP A 1 176 ? 31.038 57.557  -4.181  1.00 23.76  ? 267 ASP A OD2   1 
ATOM   1251 N N     . ALA A 1 177 ? 35.042 54.284  -2.790  1.00 24.68  ? 268 ALA A N     1 
ATOM   1252 C CA    . ALA A 1 177 ? 36.216 53.992  -1.992  1.00 24.94  ? 268 ALA A CA    1 
ATOM   1253 C C     . ALA A 1 177 ? 37.153 52.923  -2.530  1.00 27.87  ? 268 ALA A C     1 
ATOM   1254 O O     . ALA A 1 177 ? 38.145 52.615  -1.882  1.00 28.35  ? 268 ALA A O     1 
ATOM   1255 C CB    . ALA A 1 177 ? 35.792 53.624  -0.592  1.00 23.44  ? 268 ALA A CB    1 
ATOM   1256 N N     . LEU A 1 178 ? 36.862 52.348  -3.691  1.00 31.19  ? 269 LEU A N     1 
ATOM   1257 C CA    . LEU A 1 178 ? 37.740 51.302  -4.228  1.00 35.35  ? 269 LEU A CA    1 
ATOM   1258 C C     . LEU A 1 178 ? 39.127 51.788  -4.694  1.00 37.82  ? 269 LEU A C     1 
ATOM   1259 O O     . LEU A 1 178 ? 39.275 52.878  -5.259  1.00 36.97  ? 269 LEU A O     1 
ATOM   1260 C CB    . LEU A 1 178 ? 37.033 50.525  -5.358  1.00 34.21  ? 269 LEU A CB    1 
ATOM   1261 C CG    . LEU A 1 178 ? 36.040 49.420  -4.954  1.00 32.10  ? 269 LEU A CG    1 
ATOM   1262 C CD1   . LEU A 1 178 ? 35.441 48.807  -6.204  1.00 33.22  ? 269 LEU A CD1   1 
ATOM   1263 C CD2   . LEU A 1 178 ? 36.729 48.349  -4.128  1.00 29.30  ? 269 LEU A CD2   1 
ATOM   1264 N N     . GLU A 1 179 ? 40.134 50.951  -4.452  1.00 41.81  ? 270 GLU A N     1 
ATOM   1265 C CA    . GLU A 1 179 ? 41.520 51.268  -4.792  1.00 46.79  ? 270 GLU A CA    1 
ATOM   1266 C C     . GLU A 1 179 ? 42.206 50.114  -5.529  1.00 49.47  ? 270 GLU A C     1 
ATOM   1267 O O     . GLU A 1 179 ? 42.623 49.140  -4.912  1.00 49.75  ? 270 GLU A O     1 
ATOM   1268 C CB    . GLU A 1 179 ? 42.280 51.575  -3.501  1.00 46.85  ? 270 GLU A CB    1 
ATOM   1269 C CG    . GLU A 1 179 ? 43.684 52.095  -3.684  1.00 50.18  ? 270 GLU A CG    1 
ATOM   1270 C CD    . GLU A 1 179 ? 44.325 52.475  -2.355  1.00 53.33  ? 270 GLU A CD    1 
ATOM   1271 O OE1   . GLU A 1 179 ? 43.706 53.261  -1.605  1.00 53.86  ? 270 GLU A OE1   1 
ATOM   1272 O OE2   . GLU A 1 179 ? 45.443 51.993  -2.061  1.00 54.02  ? 270 GLU A OE2   1 
ATOM   1273 N N     . PRO A 1 180 ? 42.342 50.221  -6.861  1.00 53.08  ? 271 PRO A N     1 
ATOM   1274 C CA    . PRO A 1 180 ? 42.955 49.202  -7.714  1.00 56.41  ? 271 PRO A CA    1 
ATOM   1275 C C     . PRO A 1 180 ? 44.397 48.864  -7.304  1.00 59.48  ? 271 PRO A C     1 
ATOM   1276 O O     . PRO A 1 180 ? 45.229 49.759  -7.149  1.00 59.13  ? 271 PRO A O     1 
ATOM   1277 C CB    . PRO A 1 180 ? 42.885 49.812  -9.115  1.00 55.75  ? 271 PRO A CB    1 
ATOM   1278 C CG    . PRO A 1 180 ? 41.670 50.694  -9.049  1.00 54.43  ? 271 PRO A CG    1 
ATOM   1279 C CD    . PRO A 1 180 ? 41.846 51.352  -7.704  1.00 54.10  ? 271 PRO A CD    1 
ATOM   1280 N N     . VAL A 1 181 ? 44.693 47.575  -7.142  1.00 63.24  ? 272 VAL A N     1 
ATOM   1281 C CA    . VAL A 1 181 ? 46.036 47.155  -6.744  1.00 67.10  ? 272 VAL A CA    1 
ATOM   1282 C C     . VAL A 1 181 ? 46.479 45.855  -7.423  1.00 70.32  ? 272 VAL A C     1 
ATOM   1283 O O     . VAL A 1 181 ? 46.398 44.772  -6.835  1.00 71.05  ? 272 VAL A O     1 
ATOM   1284 C CB    . VAL A 1 181 ? 46.124 46.993  -5.192  1.00 66.52  ? 272 VAL A CB    1 
ATOM   1285 C CG1   . VAL A 1 181 ? 45.235 45.846  -4.719  1.00 66.29  ? 272 VAL A CG1   1 
ATOM   1286 C CG2   . VAL A 1 181 ? 47.568 46.784  -4.767  1.00 66.78  ? 272 VAL A CG2   1 
ATOM   1287 N N     . GLN A 1 182 ? 46.949 45.963  -8.664  1.00 73.90  ? 273 GLN A N     1 
ATOM   1288 C CA    . GLN A 1 182 ? 47.401 44.781  -9.399  1.00 77.58  ? 273 GLN A CA    1 
ATOM   1289 C C     . GLN A 1 182 ? 48.785 44.343  -8.929  1.00 80.25  ? 273 GLN A C     1 
ATOM   1290 O O     . GLN A 1 182 ? 49.609 45.169  -8.524  1.00 80.13  ? 273 GLN A O     1 
ATOM   1291 C CB    . GLN A 1 182 ? 47.399 45.046  -10.909 1.00 77.31  ? 273 GLN A CB    1 
ATOM   1292 C CG    . GLN A 1 182 ? 48.162 46.282  -11.351 1.00 77.58  ? 273 GLN A CG    1 
ATOM   1293 C CD    . GLN A 1 182 ? 47.883 46.638  -12.800 1.00 76.99  ? 273 GLN A CD    1 
ATOM   1294 O OE1   . GLN A 1 182 ? 48.129 45.841  -13.703 1.00 76.09  ? 273 GLN A OE1   1 
ATOM   1295 N NE2   . GLN A 1 182 ? 47.361 47.840  -13.027 1.00 76.62  ? 273 GLN A NE2   1 
ATOM   1296 N N     . PHE A 1 183 ? 49.030 43.036  -8.985  1.00 83.24  ? 274 PHE A N     1 
ATOM   1297 C CA    . PHE A 1 183 ? 50.294 42.473  -8.524  1.00 85.98  ? 274 PHE A CA    1 
ATOM   1298 C C     . PHE A 1 183 ? 51.096 41.688  -9.563  1.00 87.83  ? 274 PHE A C     1 
ATOM   1299 O O     . PHE A 1 183 ? 50.869 41.788  -10.775 1.00 87.98  ? 274 PHE A O     1 
ATOM   1300 C CB    . PHE A 1 183 ? 50.032 41.562  -7.321  1.00 85.88  ? 274 PHE A CB    1 
ATOM   1301 C CG    . PHE A 1 183 ? 49.348 42.246  -6.181  1.00 85.74  ? 274 PHE A CG    1 
ATOM   1302 C CD1   . PHE A 1 183 ? 49.917 43.366  -5.584  1.00 86.16  ? 274 PHE A CD1   1 
ATOM   1303 C CD2   . PHE A 1 183 ? 48.147 41.760  -5.685  1.00 85.59  ? 274 PHE A CD2   1 
ATOM   1304 C CE1   . PHE A 1 183 ? 49.298 43.990  -4.504  1.00 86.02  ? 274 PHE A CE1   1 
ATOM   1305 C CE2   . PHE A 1 183 ? 47.520 42.375  -4.608  1.00 85.58  ? 274 PHE A CE2   1 
ATOM   1306 C CZ    . PHE A 1 183 ? 48.097 43.491  -4.015  1.00 86.04  ? 274 PHE A CZ    1 
ATOM   1307 N N     . GLU A 1 184 ? 52.044 40.904  -9.051  1.00 89.31  ? 275 GLU A N     1 
ATOM   1308 C CA    . GLU A 1 184 ? 52.910 40.066  -9.864  1.00 90.34  ? 275 GLU A CA    1 
ATOM   1309 C C     . GLU A 1 184 ? 52.208 38.743  -10.160 1.00 90.84  ? 275 GLU A C     1 
ATOM   1310 O O     . GLU A 1 184 ? 51.029 38.573  -9.853  1.00 91.05  ? 275 GLU A O     1 
ATOM   1311 C CB    . GLU A 1 184 ? 54.227 39.814  -9.131  1.00 90.14  ? 275 GLU A CB    1 
ATOM   1312 N N     . ASP A 1 185 ? 52.943 37.807  -10.749 1.00 91.33  ? 276 ASP A N     1 
ATOM   1313 C CA    . ASP A 1 185 ? 52.389 36.511  -11.101 1.00 91.60  ? 276 ASP A CA    1 
ATOM   1314 C C     . ASP A 1 185 ? 53.036 35.390  -10.306 1.00 91.95  ? 276 ASP A C     1 
ATOM   1315 O O     . ASP A 1 185 ? 54.191 35.043  -10.538 1.00 92.19  ? 276 ASP A O     1 
ATOM   1316 C CB    . ASP A 1 185 ? 52.585 36.255  -12.598 1.00 91.24  ? 276 ASP A CB    1 
ATOM   1317 C CG    . ASP A 1 185 ? 51.804 37.228  -13.467 1.00 90.89  ? 276 ASP A CG    1 
ATOM   1318 O OD1   . ASP A 1 185 ? 51.721 38.422  -13.111 1.00 90.27  ? 276 ASP A OD1   1 
ATOM   1319 O OD2   . ASP A 1 185 ? 51.283 36.800  -14.518 1.00 90.40  ? 276 ASP A OD2   1 
ATOM   1320 N N     . GLY A 1 186 ? 52.283 34.833  -9.363  1.00 92.76  ? 277 GLY A N     1 
ATOM   1321 C CA    . GLY A 1 186 ? 52.786 33.734  -8.555  1.00 93.83  ? 277 GLY A CA    1 
ATOM   1322 C C     . GLY A 1 186 ? 53.575 34.137  -7.325  1.00 94.15  ? 277 GLY A C     1 
ATOM   1323 O O     . GLY A 1 186 ? 53.166 33.862  -6.194  1.00 93.99  ? 277 GLY A O     1 
ATOM   1324 N N     . GLN A 1 187 ? 54.713 34.783  -7.550  1.00 95.11  ? 278 GLN A N     1 
ATOM   1325 C CA    . GLN A 1 187 ? 55.586 35.235  -6.470  1.00 95.47  ? 278 GLN A CA    1 
ATOM   1326 C C     . GLN A 1 187 ? 54.820 36.116  -5.479  1.00 95.71  ? 278 GLN A C     1 
ATOM   1327 O O     . GLN A 1 187 ? 55.321 36.436  -4.399  1.00 95.76  ? 278 GLN A O     1 
ATOM   1328 C CB    . GLN A 1 187 ? 56.863 35.840  -7.064  1.00 95.09  ? 278 GLN A CB    1 
ATOM   1329 C CG    . GLN A 1 187 ? 56.618 37.028  -7.988  1.00 94.80  ? 278 GLN A CG    1 
ATOM   1330 C CD    . GLN A 1 187 ? 57.607 37.090  -9.139  1.00 94.65  ? 278 GLN A CD    1 
ATOM   1331 O OE1   . GLN A 1 187 ? 57.561 36.268  -10.058 1.00 93.82  ? 278 GLN A OE1   1 
ATOM   1332 N NE2   . GLN A 1 187 ? 58.512 38.062  -9.092  1.00 94.06  ? 278 GLN A NE2   1 
ATOM   1333 N N     . LYS A 1 188 ? 53.603 36.503  -5.858  1.00 96.00  ? 279 LYS A N     1 
ATOM   1334 C CA    . LYS A 1 188 ? 52.749 37.341  -5.021  1.00 95.52  ? 279 LYS A CA    1 
ATOM   1335 C C     . LYS A 1 188 ? 51.937 36.588  -3.984  1.00 94.97  ? 279 LYS A C     1 
ATOM   1336 O O     . LYS A 1 188 ? 51.588 35.429  -4.219  1.00 94.82  ? 279 LYS A O     1 
ATOM   1337 C CB    . LYS A 1 188 ? 51.883 38.193  -5.923  1.00 94.66  ? 279 LYS A CB    1 
ATOM   1338 N N     . ILE A 1 189 ? 51.611 37.225  -2.862  1.00 94.63  ? 280 ILE A N     1 
ATOM   1339 C CA    . ILE A 1 189 ? 50.802 36.575  -1.834  1.00 94.34  ? 280 ILE A CA    1 
ATOM   1340 C C     . ILE A 1 189 ? 50.498 37.475  -0.632  1.00 94.12  ? 280 ILE A C     1 
ATOM   1341 O O     . ILE A 1 189 ? 51.295 37.568  0.304   1.00 94.34  ? 280 ILE A O     1 
ATOM   1342 C CB    . ILE A 1 189 ? 51.495 35.298  -1.362  1.00 93.85  ? 280 ILE A CB    1 
ATOM   1343 N N     . VAL A 1 190 ? 49.341 38.130  -0.656  1.00 93.35  ? 281 VAL A N     1 
ATOM   1344 C CA    . VAL A 1 190 ? 48.939 38.997  0.446   1.00 93.06  ? 281 VAL A CA    1 
ATOM   1345 C C     . VAL A 1 190 ? 48.418 38.113  1.576   1.00 93.13  ? 281 VAL A C     1 
ATOM   1346 O O     . VAL A 1 190 ? 47.455 38.460  2.259   1.00 92.77  ? 281 VAL A O     1 
ATOM   1347 C CB    . VAL A 1 190 ? 47.853 39.956  -0.014  1.00 92.70  ? 281 VAL A CB    1 
ATOM   1348 N N     . VAL A 1 191 ? 49.076 36.971  1.765   1.00 93.31  ? 282 VAL A N     1 
ATOM   1349 C CA    . VAL A 1 191 ? 48.695 35.991  2.778   1.00 93.51  ? 282 VAL A CA    1 
ATOM   1350 C C     . VAL A 1 191 ? 49.409 36.144  4.120   1.00 94.05  ? 282 VAL A C     1 
ATOM   1351 O O     . VAL A 1 191 ? 49.470 37.238  4.684   1.00 94.95  ? 282 VAL A O     1 
ATOM   1352 C CB    . VAL A 1 191 ? 48.932 34.601  2.235   1.00 93.30  ? 282 VAL A CB    1 
ATOM   1353 N N     . GLN A 1 192 ? 49.931 35.026  4.626   1.00 94.11  ? 283 GLN A N     1 
ATOM   1354 C CA    . GLN A 1 192 ? 50.656 34.970  5.899   1.00 93.75  ? 283 GLN A CA    1 
ATOM   1355 C C     . GLN A 1 192 ? 49.754 34.915  7.134   1.00 93.23  ? 283 GLN A C     1 
ATOM   1356 O O     . GLN A 1 192 ? 48.552 34.671  7.027   1.00 93.63  ? 283 GLN A O     1 
ATOM   1357 C CB    . GLN A 1 192 ? 51.708 36.088  5.962   1.00 93.23  ? 283 GLN A CB    1 
ATOM   1358 N N     . GLY A 1 193 ? 50.349 35.133  8.304   1.00 92.33  ? 284 GLY A N     1 
ATOM   1359 C CA    . GLY A 1 193 ? 49.594 35.116  9.544   1.00 91.16  ? 284 GLY A CA    1 
ATOM   1360 C C     . GLY A 1 193 ? 49.685 36.525  10.164  1.00 90.68  ? 284 GLY A C     1 
ATOM   1361 O O     . GLY A 1 193 ? 49.584 36.674  11.388  1.00 90.34  ? 284 GLY A O     1 
ATOM   1362 N N     . GLU A 1 194 ? 49.927 37.527  9.320   1.00 89.75  ? 285 GLU A N     1 
ATOM   1363 C CA    . GLU A 1 194 ? 50.107 38.905  9.764   1.00 88.35  ? 285 GLU A CA    1 
ATOM   1364 C C     . GLU A 1 194 ? 48.766 39.568  10.040  1.00 87.09  ? 285 GLU A C     1 
ATOM   1365 O O     . GLU A 1 194 ? 47.760 39.245  9.409   1.00 86.46  ? 285 GLU A O     1 
ATOM   1366 C CB    . GLU A 1 194 ? 50.872 39.695  8.701   1.00 88.34  ? 285 GLU A CB    1 
ATOM   1367 C CG    . GLU A 1 194 ? 51.187 41.135  9.068   1.00 88.93  ? 285 GLU A CG    1 
ATOM   1368 C CD    . GLU A 1 194 ? 52.163 41.776  8.090   1.00 89.87  ? 285 GLU A CD    1 
ATOM   1369 O OE1   . GLU A 1 194 ? 52.447 42.984  8.224   1.00 89.73  ? 285 GLU A OE1   1 
ATOM   1370 O OE2   . GLU A 1 194 ? 52.655 41.065  7.187   1.00 90.16  ? 285 GLU A OE2   1 
ATOM   1371 N N     . PRO A 1 195 ? 48.735 40.495  11.008  1.00 86.29  ? 286 PRO A N     1 
ATOM   1372 C CA    . PRO A 1 195 ? 47.528 41.230  11.405  1.00 85.42  ? 286 PRO A CA    1 
ATOM   1373 C C     . PRO A 1 195 ? 47.058 42.301  10.412  1.00 84.17  ? 286 PRO A C     1 
ATOM   1374 O O     . PRO A 1 195 ? 46.339 43.228  10.793  1.00 84.25  ? 286 PRO A O     1 
ATOM   1375 C CB    . PRO A 1 195 ? 47.926 41.838  12.753  1.00 85.61  ? 286 PRO A CB    1 
ATOM   1376 C CG    . PRO A 1 195 ? 48.959 40.882  13.273  1.00 85.75  ? 286 PRO A CG    1 
ATOM   1377 C CD    . PRO A 1 195 ? 49.779 40.628  12.039  1.00 85.84  ? 286 PRO A CD    1 
ATOM   1378 N N     . GLY A 1 196 ? 47.451 42.165  9.147   1.00 82.55  ? 287 GLY A N     1 
ATOM   1379 C CA    . GLY A 1 196 ? 47.065 43.137  8.132   1.00 80.23  ? 287 GLY A CA    1 
ATOM   1380 C C     . GLY A 1 196 ? 45.601 43.559  8.126   1.00 78.43  ? 287 GLY A C     1 
ATOM   1381 O O     . GLY A 1 196 ? 44.757 42.922  8.768   1.00 78.51  ? 287 GLY A O     1 
ATOM   1382 N N     . ASP A 1 197 ? 45.297 44.633  7.396   1.00 75.28  ? 288 ASP A N     1 
ATOM   1383 C CA    . ASP A 1 197 ? 43.932 45.142  7.308   1.00 71.99  ? 288 ASP A CA    1 
ATOM   1384 C C     . ASP A 1 197 ? 43.615 45.663  5.911   1.00 69.85  ? 288 ASP A C     1 
ATOM   1385 O O     . ASP A 1 197 ? 43.595 46.869  5.689   1.00 69.66  ? 288 ASP A O     1 
ATOM   1386 C CB    . ASP A 1 197 ? 43.720 46.276  8.308   1.00 71.90  ? 288 ASP A CB    1 
ATOM   1387 C CG    . ASP A 1 197 ? 44.728 46.258  9.429   1.00 72.51  ? 288 ASP A CG    1 
ATOM   1388 O OD1   . ASP A 1 197 ? 45.941 46.343  9.133   1.00 72.15  ? 288 ASP A OD1   1 
ATOM   1389 O OD2   . ASP A 1 197 ? 44.310 46.164  10.604  1.00 72.60  ? 288 ASP A OD2   1 
ATOM   1390 N N     . GLU A 1 198 ? 43.367 44.754  4.972   1.00 67.44  ? 289 GLU A N     1 
ATOM   1391 C CA    . GLU A 1 198 ? 43.041 45.134  3.598   1.00 64.18  ? 289 GLU A CA    1 
ATOM   1392 C C     . GLU A 1 198 ? 42.161 44.067  2.945   1.00 62.68  ? 289 GLU A C     1 
ATOM   1393 O O     . GLU A 1 198 ? 42.548 42.903  2.822   1.00 63.04  ? 289 GLU A O     1 
ATOM   1394 C CB    . GLU A 1 198 ? 44.317 45.374  2.783   1.00 62.80  ? 289 GLU A CB    1 
ATOM   1395 C CG    . GLU A 1 198 ? 45.213 46.462  3.353   1.00 61.28  ? 289 GLU A CG    1 
ATOM   1396 C CD    . GLU A 1 198 ? 46.330 46.857  2.412   1.00 61.58  ? 289 GLU A CD    1 
ATOM   1397 O OE1   . GLU A 1 198 ? 47.076 45.964  1.951   1.00 61.29  ? 289 GLU A OE1   1 
ATOM   1398 O OE2   . GLU A 1 198 ? 46.465 48.067  2.134   1.00 61.59  ? 289 GLU A OE2   1 
ATOM   1399 N N     . PHE A 1 199 ? 40.974 44.490  2.529   1.00 60.45  ? 290 PHE A N     1 
ATOM   1400 C CA    . PHE A 1 199 ? 40.001 43.619  1.893   1.00 58.94  ? 290 PHE A CA    1 
ATOM   1401 C C     . PHE A 1 199 ? 40.200 43.624  0.374   1.00 59.29  ? 290 PHE A C     1 
ATOM   1402 O O     . PHE A 1 199 ? 40.413 44.682  -0.226  1.00 58.73  ? 290 PHE A O     1 
ATOM   1403 C CB    . PHE A 1 199 ? 38.594 44.075  2.248   1.00 58.06  ? 290 PHE A CB    1 
ATOM   1404 C CG    . PHE A 1 199 ? 37.505 43.299  1.567   1.00 58.37  ? 290 PHE A CG    1 
ATOM   1405 C CD1   . PHE A 1 199 ? 37.378 41.927  1.766   1.00 58.37  ? 290 PHE A CD1   1 
ATOM   1406 C CD2   . PHE A 1 199 ? 36.608 43.938  0.719   1.00 57.27  ? 290 PHE A CD2   1 
ATOM   1407 C CE1   . PHE A 1 199 ? 36.379 41.207  1.131   1.00 57.30  ? 290 PHE A CE1   1 
ATOM   1408 C CE2   . PHE A 1 199 ? 35.606 43.228  0.082   1.00 57.41  ? 290 PHE A CE2   1 
ATOM   1409 C CZ    . PHE A 1 199 ? 35.492 41.858  0.288   1.00 58.00  ? 290 PHE A CZ    1 
ATOM   1410 N N     . PHE A 1 200 ? 40.119 42.449  -0.247  1.00 59.39  ? 291 PHE A N     1 
ATOM   1411 C CA    . PHE A 1 200 ? 40.280 42.351  -1.693  1.00 59.74  ? 291 PHE A CA    1 
ATOM   1412 C C     . PHE A 1 200 ? 39.063 41.766  -2.417  1.00 61.09  ? 291 PHE A C     1 
ATOM   1413 O O     . PHE A 1 200 ? 38.183 41.152  -1.808  1.00 61.48  ? 291 PHE A O     1 
ATOM   1414 C CB    . PHE A 1 200 ? 41.518 41.521  -2.036  1.00 57.62  ? 291 PHE A CB    1 
ATOM   1415 C CG    . PHE A 1 200 ? 42.790 42.050  -1.440  1.00 56.21  ? 291 PHE A CG    1 
ATOM   1416 C CD1   . PHE A 1 200 ? 43.053 41.903  -0.072  1.00 55.51  ? 291 PHE A CD1   1 
ATOM   1417 C CD2   . PHE A 1 200 ? 43.735 42.686  -2.242  1.00 54.63  ? 291 PHE A CD2   1 
ATOM   1418 C CE1   . PHE A 1 200 ? 44.237 42.378  0.486   1.00 53.49  ? 291 PHE A CE1   1 
ATOM   1419 C CE2   . PHE A 1 200 ? 44.923 43.166  -1.697  1.00 53.92  ? 291 PHE A CE2   1 
ATOM   1420 C CZ    . PHE A 1 200 ? 45.175 43.011  -0.326  1.00 53.97  ? 291 PHE A CZ    1 
ATOM   1421 N N     . ILE A 1 201 ? 39.034 41.982  -3.730  1.00 61.82  ? 292 ILE A N     1 
ATOM   1422 C CA    . ILE A 1 201 ? 37.973 41.512  -4.615  1.00 62.60  ? 292 ILE A CA    1 
ATOM   1423 C C     . ILE A 1 201 ? 38.639 41.352  -5.984  1.00 63.72  ? 292 ILE A C     1 
ATOM   1424 O O     . ILE A 1 201 ? 39.200 42.313  -6.519  1.00 63.51  ? 292 ILE A O     1 
ATOM   1425 C CB    . ILE A 1 201 ? 36.811 42.539  -4.707  1.00 61.94  ? 292 ILE A CB    1 
ATOM   1426 C CG1   . ILE A 1 201 ? 36.115 42.673  -3.352  1.00 61.50  ? 292 ILE A CG1   1 
ATOM   1427 C CG2   . ILE A 1 201 ? 35.807 42.102  -5.774  1.00 61.99  ? 292 ILE A CG2   1 
ATOM   1428 C CD1   . ILE A 1 201 ? 34.903 43.588  -3.374  1.00 61.14  ? 292 ILE A CD1   1 
ATOM   1429 N N     . ILE A 1 202 ? 38.581 40.151  -6.553  1.00 64.56  ? 293 ILE A N     1 
ATOM   1430 C CA    . ILE A 1 202 ? 39.220 39.908  -7.845  1.00 66.01  ? 293 ILE A CA    1 
ATOM   1431 C C     . ILE A 1 202 ? 38.479 40.606  -8.973  1.00 66.81  ? 293 ILE A C     1 
ATOM   1432 O O     . ILE A 1 202 ? 37.255 40.676  -8.978  1.00 66.76  ? 293 ILE A O     1 
ATOM   1433 C CB    . ILE A 1 202 ? 39.288 38.404  -8.120  1.00 66.82  ? 293 ILE A CB    1 
ATOM   1434 N N     . LEU A 1 203 ? 39.239 41.129  -9.932  1.00 68.14  ? 294 LEU A N     1 
ATOM   1435 C CA    . LEU A 1 203 ? 38.661 41.837  -11.071 1.00 69.80  ? 294 LEU A CA    1 
ATOM   1436 C C     . LEU A 1 203 ? 38.930 41.141  -12.411 1.00 70.53  ? 294 LEU A C     1 
ATOM   1437 O O     . LEU A 1 203 ? 38.153 41.277  -13.359 1.00 69.98  ? 294 LEU A O     1 
ATOM   1438 C CB    . LEU A 1 203 ? 39.229 43.259  -11.145 1.00 69.78  ? 294 LEU A CB    1 
ATOM   1439 N N     . GLU A 1 204 ? 40.029 40.398  -12.473 1.00 71.64  ? 295 GLU A N     1 
ATOM   1440 C CA    . GLU A 1 204 ? 40.432 39.672  -13.675 1.00 72.92  ? 295 GLU A CA    1 
ATOM   1441 C C     . GLU A 1 204 ? 41.727 38.914  -13.386 1.00 74.66  ? 295 GLU A C     1 
ATOM   1442 O O     . GLU A 1 204 ? 42.823 39.481  -13.476 1.00 74.27  ? 295 GLU A O     1 
ATOM   1443 C CB    . GLU A 1 204 ? 40.605 40.621  -14.868 1.00 72.06  ? 295 GLU A CB    1 
ATOM   1444 C CG    . GLU A 1 204 ? 39.402 40.649  -15.817 1.00 70.68  ? 295 GLU A CG    1 
ATOM   1445 C CD    . GLU A 1 204 ? 39.135 42.016  -16.422 1.00 70.15  ? 295 GLU A CD    1 
ATOM   1446 O OE1   . GLU A 1 204 ? 38.243 42.122  -17.291 1.00 69.23  ? 295 GLU A OE1   1 
ATOM   1447 O OE2   . GLU A 1 204 ? 39.807 42.987  -16.024 1.00 70.52  ? 295 GLU A OE2   1 
ATOM   1448 N N     . GLY A 1 205 ? 41.585 37.637  -13.022 1.00 76.50  ? 296 GLY A N     1 
ATOM   1449 C CA    . GLY A 1 205 ? 42.734 36.800  -12.701 1.00 78.14  ? 296 GLY A CA    1 
ATOM   1450 C C     . GLY A 1 205 ? 42.401 35.663  -11.742 1.00 79.22  ? 296 GLY A C     1 
ATOM   1451 O O     . GLY A 1 205 ? 41.253 35.521  -11.312 1.00 79.32  ? 296 GLY A O     1 
ATOM   1452 N N     . SER A 1 206 ? 43.404 34.859  -11.392 1.00 80.59  ? 297 SER A N     1 
ATOM   1453 C CA    . SER A 1 206 ? 43.202 33.723  -10.493 1.00 81.93  ? 297 SER A CA    1 
ATOM   1454 C C     . SER A 1 206 ? 44.164 33.646  -9.304  1.00 83.02  ? 297 SER A C     1 
ATOM   1455 O O     . SER A 1 206 ? 45.264 34.205  -9.331  1.00 82.85  ? 297 SER A O     1 
ATOM   1456 C CB    . SER A 1 206 ? 43.288 32.416  -11.286 1.00 82.15  ? 297 SER A CB    1 
ATOM   1457 O OG    . SER A 1 206 ? 43.171 31.293  -10.430 1.00 82.02  ? 297 SER A OG    1 
ATOM   1458 N N     . ALA A 1 207 ? 43.733 32.931  -8.266  1.00 84.33  ? 298 ALA A N     1 
ATOM   1459 C CA    . ALA A 1 207 ? 44.517 32.748  -7.048  1.00 85.33  ? 298 ALA A CA    1 
ATOM   1460 C C     . ALA A 1 207 ? 43.946 31.580  -6.243  1.00 86.37  ? 298 ALA A C     1 
ATOM   1461 O O     . ALA A 1 207 ? 43.032 30.896  -6.705  1.00 86.35  ? 298 ALA A O     1 
ATOM   1462 C CB    . ALA A 1 207 ? 44.485 34.016  -6.219  1.00 85.31  ? 298 ALA A CB    1 
ATOM   1463 N N     . ALA A 1 208 ? 44.485 31.355  -5.044  1.00 87.89  ? 299 ALA A N     1 
ATOM   1464 C CA    . ALA A 1 208 ? 44.028 30.264  -4.179  1.00 88.90  ? 299 ALA A CA    1 
ATOM   1465 C C     . ALA A 1 208 ? 44.396 30.466  -2.708  1.00 89.45  ? 299 ALA A C     1 
ATOM   1466 O O     . ALA A 1 208 ? 45.422 31.064  -2.380  1.00 88.79  ? 299 ALA A O     1 
ATOM   1467 C CB    . ALA A 1 208 ? 44.592 28.936  -4.669  1.00 88.72  ? 299 ALA A CB    1 
ATOM   1468 N N     . VAL A 1 209 ? 43.552 29.934  -1.830  1.00 90.65  ? 300 VAL A N     1 
ATOM   1469 C CA    . VAL A 1 209 ? 43.744 30.051  -0.389  1.00 91.87  ? 300 VAL A CA    1 
ATOM   1470 C C     . VAL A 1 209 ? 44.363 28.815  0.258   1.00 92.92  ? 300 VAL A C     1 
ATOM   1471 O O     . VAL A 1 209 ? 43.651 27.862  0.569   1.00 93.85  ? 300 VAL A O     1 
ATOM   1472 C CB    . VAL A 1 209 ? 42.397 30.316  0.331   1.00 91.60  ? 300 VAL A CB    1 
ATOM   1473 C CG1   . VAL A 1 209 ? 42.597 30.291  1.840   1.00 91.52  ? 300 VAL A CG1   1 
ATOM   1474 C CG2   . VAL A 1 209 ? 41.820 31.652  -0.109  1.00 91.68  ? 300 VAL A CG2   1 
ATOM   1475 N N     . LEU A 1 210 ? 45.677 28.823  0.467   1.00 93.39  ? 301 LEU A N     1 
ATOM   1476 C CA    . LEU A 1 210 ? 46.332 27.695  1.124   1.00 93.08  ? 301 LEU A CA    1 
ATOM   1477 C C     . LEU A 1 210 ? 45.913 27.838  2.588   1.00 93.36  ? 301 LEU A C     1 
ATOM   1478 O O     . LEU A 1 210 ? 45.018 28.623  2.891   1.00 93.40  ? 301 LEU A O     1 
ATOM   1479 C CB    . LEU A 1 210 ? 47.840 27.846  1.044   1.00 92.68  ? 301 LEU A CB    1 
ATOM   1480 N N     . GLN A 1 211 ? 46.540 27.108  3.505   1.00 94.03  ? 302 GLN A N     1 
ATOM   1481 C CA    . GLN A 1 211 ? 46.145 27.230  4.907   1.00 94.69  ? 302 GLN A CA    1 
ATOM   1482 C C     . GLN A 1 211 ? 47.122 26.668  5.922   1.00 95.42  ? 302 GLN A C     1 
ATOM   1483 O O     . GLN A 1 211 ? 47.975 25.841  5.599   1.00 95.29  ? 302 GLN A O     1 
ATOM   1484 C CB    . GLN A 1 211 ? 44.791 26.457  5.040   1.00 93.85  ? 302 GLN A CB    1 
ATOM   1485 N N     . ARG A 1 212 ? 46.994 27.139  7.162   1.00 96.15  ? 303 ARG A N     1 
ATOM   1486 C CA    . ARG A 1 212 ? 47.864 26.711  8.255   1.00 96.91  ? 303 ARG A CA    1 
ATOM   1487 C C     . ARG A 1 212 ? 47.757 25.202  8.487   1.00 97.35  ? 303 ARG A C     1 
ATOM   1488 O O     . ARG A 1 212 ? 46.682 24.615  8.330   1.00 97.52  ? 303 ARG A O     1 
ATOM   1489 C CB    . ARG A 1 212 ? 47.497 27.460  9.533   1.00 96.52  ? 303 ARG A CB    1 
ATOM   1490 N N     . ARG A 1 213 ? 48.871 24.579  8.867   1.00 97.67  ? 304 ARG A N     1 
ATOM   1491 C CA    . ARG A 1 213 ? 48.892 23.140  9.114   1.00 98.13  ? 304 ARG A CA    1 
ATOM   1492 C C     . ARG A 1 213 ? 49.231 22.763  10.560  1.00 98.43  ? 304 ARG A C     1 
ATOM   1493 O O     . ARG A 1 213 ? 48.816 21.706  11.041  1.00 98.38  ? 304 ARG A O     1 
ATOM   1494 C CB    . ARG A 1 213 ? 49.915 22.469  8.197   1.00 97.87  ? 304 ARG A CB    1 
ATOM   1495 N N     . SER A 1 214 ? 49.983 23.623  11.247  1.00 98.92  ? 305 SER A N     1 
ATOM   1496 C CA    . SER A 1 214 ? 50.367 23.379  12.641  1.00 99.20  ? 305 SER A CA    1 
ATOM   1497 C C     . SER A 1 214 ? 51.329 24.432  13.182  1.00 99.50  ? 305 SER A C     1 
ATOM   1498 O O     . SER A 1 214 ? 50.973 25.269  14.018  1.00 99.67  ? 305 SER A O     1 
ATOM   1499 C CB    . SER A 1 214 ? 50.924 21.987  12.835  1.00 98.90  ? 305 SER A CB    1 
ATOM   1500 N N     . GLU A 1 215 ? 52.568 24.368  12.697  1.00 99.77  ? 306 GLU A N     1 
ATOM   1501 C CA    . GLU A 1 215 ? 53.626 25.294  13.107  1.00 99.75  ? 306 GLU A CA    1 
ATOM   1502 C C     . GLU A 1 215 ? 54.760 25.276  12.084  1.00 99.59  ? 306 GLU A C     1 
ATOM   1503 O O     . GLU A 1 215 ? 54.994 26.263  11.382  1.00 99.21  ? 306 GLU A O     1 
ATOM   1504 C CB    . GLU A 1 215 ? 54.160 24.911  14.490  1.00 99.72  ? 306 GLU A CB    1 
ATOM   1505 N N     . ASN A 1 216 ? 55.463 24.150  12.011  1.00 99.62  ? 307 ASN A N     1 
ATOM   1506 C CA    . ASN A 1 216 ? 56.561 23.993  11.065  1.00 99.83  ? 307 ASN A CA    1 
ATOM   1507 C C     . ASN A 1 216 ? 55.987 23.599  9.702   1.00 100.22 ? 307 ASN A C     1 
ATOM   1508 O O     . ASN A 1 216 ? 56.196 22.483  9.219   1.00 100.17 ? 307 ASN A O     1 
ATOM   1509 C CB    . ASN A 1 216 ? 57.536 22.930  11.564  1.00 99.35  ? 307 ASN A CB    1 
ATOM   1510 N N     . GLU A 1 217 ? 55.257 24.532  9.096   1.00 100.68 ? 308 GLU A N     1 
ATOM   1511 C CA    . GLU A 1 217 ? 54.630 24.321  7.795   1.00 100.35 ? 308 GLU A CA    1 
ATOM   1512 C C     . GLU A 1 217 ? 53.918 25.604  7.358   1.00 100.56 ? 308 GLU A C     1 
ATOM   1513 O O     . GLU A 1 217 ? 53.241 26.249  8.163   1.00 100.64 ? 308 GLU A O     1 
ATOM   1514 C CB    . GLU A 1 217 ? 53.632 23.164  7.881   1.00 100.30 ? 308 GLU A CB    1 
ATOM   1515 N N     . GLU A 1 218 ? 54.066 25.966  6.085   1.00 100.42 ? 309 GLU A N     1 
ATOM   1516 C CA    . GLU A 1 218 ? 53.450 27.181  5.549   1.00 100.41 ? 309 GLU A CA    1 
ATOM   1517 C C     . GLU A 1 218 ? 51.917 27.143  5.544   1.00 100.46 ? 309 GLU A C     1 
ATOM   1518 O O     . GLU A 1 218 ? 51.274 27.206  6.596   1.00 100.39 ? 309 GLU A O     1 
ATOM   1519 C CB    . GLU A 1 218 ? 53.972 27.443  4.135   1.00 100.88 ? 309 GLU A CB    1 
ATOM   1520 N N     . PHE A 1 219 ? 51.344 27.060  4.345   1.00 100.38 ? 310 PHE A N     1 
ATOM   1521 C CA    . PHE A 1 219 ? 49.896 27.010  4.167   1.00 100.59 ? 310 PHE A CA    1 
ATOM   1522 C C     . PHE A 1 219 ? 49.571 26.105  2.978   1.00 100.46 ? 310 PHE A C     1 
ATOM   1523 O O     . PHE A 1 219 ? 50.105 26.303  1.882   1.00 100.43 ? 310 PHE A O     1 
ATOM   1524 C CB    . PHE A 1 219 ? 49.357 28.407  3.930   1.00 100.55 ? 310 PHE A CB    1 
ATOM   1525 N N     . VAL A 1 220 ? 48.692 25.123  3.190   1.00 99.89  ? 311 VAL A N     1 
ATOM   1526 C CA    . VAL A 1 220 ? 48.330 24.175  2.131   1.00 98.71  ? 311 VAL A CA    1 
ATOM   1527 C C     . VAL A 1 220 ? 46.843 24.039  1.774   1.00 98.08  ? 311 VAL A C     1 
ATOM   1528 O O     . VAL A 1 220 ? 46.063 23.436  2.518   1.00 98.09  ? 311 VAL A O     1 
ATOM   1529 C CB    . VAL A 1 220 ? 48.868 22.759  2.461   1.00 98.23  ? 311 VAL A CB    1 
ATOM   1530 C CG1   . VAL A 1 220 ? 48.357 22.308  3.831   1.00 97.25  ? 311 VAL A CG1   1 
ATOM   1531 C CG2   . VAL A 1 220 ? 48.448 21.780  1.371   1.00 97.34  ? 311 VAL A CG2   1 
ATOM   1532 N N     . GLU A 1 221 ? 46.477 24.592  0.619   1.00 96.80  ? 312 GLU A N     1 
ATOM   1533 C CA    . GLU A 1 221 ? 45.115 24.540  0.084   1.00 95.37  ? 312 GLU A CA    1 
ATOM   1534 C C     . GLU A 1 221 ? 43.965 24.764  1.061   1.00 94.35  ? 312 GLU A C     1 
ATOM   1535 O O     . GLU A 1 221 ? 44.171 24.927  2.265   1.00 94.80  ? 312 GLU A O     1 
ATOM   1536 C CB    . GLU A 1 221 ? 44.884 23.203  -0.628  1.00 95.96  ? 312 GLU A CB    1 
ATOM   1537 C CG    . GLU A 1 221 ? 45.877 22.890  -1.733  1.00 96.69  ? 312 GLU A CG    1 
ATOM   1538 C CD    . GLU A 1 221 ? 45.988 24.005  -2.748  1.00 96.56  ? 312 GLU A CD    1 
ATOM   1539 O OE1   . GLU A 1 221 ? 46.507 25.084  -2.386  1.00 96.97  ? 312 GLU A OE1   1 
ATOM   1540 O OE2   . GLU A 1 221 ? 45.552 23.805  -3.903  1.00 96.32  ? 312 GLU A OE2   1 
ATOM   1541 N N     . VAL A 1 222 ? 42.752 24.754  0.500   1.00 92.69  ? 313 VAL A N     1 
ATOM   1542 C CA    . VAL A 1 222 ? 41.482 24.940  1.212   1.00 91.07  ? 313 VAL A CA    1 
ATOM   1543 C C     . VAL A 1 222 ? 40.479 25.453  0.181   1.00 90.04  ? 313 VAL A C     1 
ATOM   1544 O O     . VAL A 1 222 ? 39.268 25.427  0.406   1.00 89.88  ? 313 VAL A O     1 
ATOM   1545 C CB    . VAL A 1 222 ? 41.681 25.703  2.528   1.00 91.07  ? 313 VAL A CB    1 
ATOM   1546 N N     . GLY A 1 223 ? 40.994 25.929  -0.950  1.00 88.72  ? 314 GLY A N     1 
ATOM   1547 C CA    . GLY A 1 223 ? 40.125 26.438  -1.993  1.00 86.97  ? 314 GLY A CA    1 
ATOM   1548 C C     . GLY A 1 223 ? 40.857 27.312  -2.984  1.00 85.89  ? 314 GLY A C     1 
ATOM   1549 O O     . GLY A 1 223 ? 42.089 27.269  -3.013  1.00 85.16  ? 314 GLY A O     1 
ATOM   1550 N N     . ARG A 1 224 ? 40.123 27.968  -3.881  1.00 84.91  ? 315 ARG A N     1 
ATOM   1551 C CA    . ARG A 1 224 ? 40.703 28.696  -5.008  1.00 83.71  ? 315 ARG A CA    1 
ATOM   1552 C C     . ARG A 1 224 ? 39.908 29.999  -5.204  1.00 82.81  ? 315 ARG A C     1 
ATOM   1553 O O     . ARG A 1 224 ? 38.993 30.274  -4.426  1.00 83.45  ? 315 ARG A O     1 
ATOM   1554 C CB    . ARG A 1 224 ? 40.628 27.815  -6.260  1.00 83.45  ? 315 ARG A CB    1 
ATOM   1555 C CG    . ARG A 1 224 ? 41.520 28.245  -7.406  1.00 83.15  ? 315 ARG A CG    1 
ATOM   1556 C CD    . ARG A 1 224 ? 40.745 28.979  -8.473  1.00 82.71  ? 315 ARG A CD    1 
ATOM   1557 N NE    . ARG A 1 224 ? 41.527 29.070  -9.698  1.00 84.00  ? 315 ARG A NE    1 
ATOM   1558 C CZ    . ARG A 1 224 ? 41.037 29.434  -10.879 1.00 84.90  ? 315 ARG A CZ    1 
ATOM   1559 N NH1   . ARG A 1 224 ? 39.754 29.751  -11.005 1.00 85.26  ? 315 ARG A NH1   1 
ATOM   1560 N NH2   . ARG A 1 224 ? 41.829 29.464  -11.944 1.00 85.29  ? 315 ARG A NH2   1 
ATOM   1561 N N     . LEU A 1 225 ? 40.252 30.794  -6.224  1.00 80.88  ? 316 LEU A N     1 
ATOM   1562 C CA    . LEU A 1 225 ? 39.555 32.062  -6.495  1.00 78.08  ? 316 LEU A CA    1 
ATOM   1563 C C     . LEU A 1 225 ? 39.845 32.661  -7.872  1.00 77.16  ? 316 LEU A C     1 
ATOM   1564 O O     . LEU A 1 225 ? 40.909 32.446  -8.451  1.00 76.91  ? 316 LEU A O     1 
ATOM   1565 C CB    . LEU A 1 225 ? 39.910 33.117  -5.442  1.00 76.69  ? 316 LEU A CB    1 
ATOM   1566 C CG    . LEU A 1 225 ? 39.505 32.923  -3.983  1.00 75.05  ? 316 LEU A CG    1 
ATOM   1567 C CD1   . LEU A 1 225 ? 40.048 34.076  -3.173  1.00 73.86  ? 316 LEU A CD1   1 
ATOM   1568 C CD2   . LEU A 1 225 ? 37.997 32.833  -3.861  1.00 73.47  ? 316 LEU A CD2   1 
ATOM   1569 N N     . GLY A 1 226 ? 38.883 33.440  -8.365  1.00 76.31  ? 317 GLY A N     1 
ATOM   1570 C CA    . GLY A 1 226 ? 38.990 34.105  -9.656  1.00 74.05  ? 317 GLY A CA    1 
ATOM   1571 C C     . GLY A 1 226 ? 38.106 35.348  -9.690  1.00 72.89  ? 317 GLY A C     1 
ATOM   1572 O O     . GLY A 1 226 ? 37.761 35.884  -8.636  1.00 72.28  ? 317 GLY A O     1 
ATOM   1573 N N     . PRO A 1 227 ? 37.711 35.829  -10.881 1.00 71.90  ? 318 PRO A N     1 
ATOM   1574 C CA    . PRO A 1 227 ? 36.862 37.018  -11.051 1.00 70.69  ? 318 PRO A CA    1 
ATOM   1575 C C     . PRO A 1 227 ? 35.522 36.997  -10.317 1.00 70.19  ? 318 PRO A C     1 
ATOM   1576 O O     . PRO A 1 227 ? 34.651 36.185  -10.632 1.00 69.56  ? 318 PRO A O     1 
ATOM   1577 C CB    . PRO A 1 227 ? 36.677 37.092  -12.563 1.00 70.70  ? 318 PRO A CB    1 
ATOM   1578 C CG    . PRO A 1 227 ? 37.980 36.568  -13.072 1.00 71.71  ? 318 PRO A CG    1 
ATOM   1579 C CD    . PRO A 1 227 ? 38.185 35.346  -12.190 1.00 72.05  ? 318 PRO A CD    1 
ATOM   1580 N N     . SER A 1 228 ? 35.375 37.912  -9.357  1.00 69.23  ? 319 SER A N     1 
ATOM   1581 C CA    . SER A 1 228 ? 34.171 38.080  -8.539  1.00 68.02  ? 319 SER A CA    1 
ATOM   1582 C C     . SER A 1 228 ? 34.241 37.264  -7.260  1.00 67.60  ? 319 SER A C     1 
ATOM   1583 O O     . SER A 1 228 ? 33.214 36.925  -6.666  1.00 67.91  ? 319 SER A O     1 
ATOM   1584 C CB    . SER A 1 228 ? 32.916 37.606  -9.281  1.00 69.47  ? 319 SER A CB    1 
ATOM   1585 O OG    . SER A 1 228 ? 32.551 38.506  -10.319 1.00 70.37  ? 319 SER A OG    1 
ATOM   1586 N N     . ASP A 1 229 ? 35.452 36.940  -6.835  1.00 66.77  ? 320 ASP A N     1 
ATOM   1587 C CA    . ASP A 1 229 ? 35.622 36.188  -5.605  1.00 66.65  ? 320 ASP A CA    1 
ATOM   1588 C C     . ASP A 1 229 ? 36.146 37.262  -4.683  1.00 66.22  ? 320 ASP A C     1 
ATOM   1589 O O     . ASP A 1 229 ? 36.284 38.407  -5.103  1.00 66.65  ? 320 ASP A O     1 
ATOM   1590 C CB    . ASP A 1 229 ? 36.613 35.035  -5.718  1.00 69.32  ? 320 ASP A CB    1 
ATOM   1591 C CG    . ASP A 1 229 ? 36.104 33.873  -6.571  1.00 70.28  ? 320 ASP A CG    1 
ATOM   1592 O OD1   . ASP A 1 229 ? 35.107 33.228  -6.187  1.00 70.61  ? 320 ASP A OD1   1 
ATOM   1593 O OD2   . ASP A 1 229 ? 36.707 33.599  -7.627  1.00 70.11  ? 320 ASP A OD2   1 
ATOM   1594 N N     . TYR A 1 230 ? 36.466 36.902  -3.444  1.00 65.82  ? 321 TYR A N     1 
ATOM   1595 C CA    . TYR A 1 230 ? 37.001 37.859  -2.478  1.00 64.65  ? 321 TYR A CA    1 
ATOM   1596 C C     . TYR A 1 230 ? 37.673 37.144  -1.308  1.00 63.36  ? 321 TYR A C     1 
ATOM   1597 O O     . TYR A 1 230 ? 37.466 35.950  -1.103  1.00 62.88  ? 321 TYR A O     1 
ATOM   1598 C CB    . TYR A 1 230 ? 35.873 38.747  -1.955  1.00 66.07  ? 321 TYR A CB    1 
ATOM   1599 C CG    . TYR A 1 230 ? 34.848 38.005  -1.134  1.00 66.86  ? 321 TYR A CG    1 
ATOM   1600 C CD1   . TYR A 1 230 ? 35.139 37.581  0.161   1.00 67.10  ? 321 TYR A CD1   1 
ATOM   1601 C CD2   . TYR A 1 230 ? 33.592 37.711  -1.656  1.00 68.36  ? 321 TYR A CD2   1 
ATOM   1602 C CE1   . TYR A 1 230 ? 34.209 36.883  0.921   1.00 68.35  ? 321 TYR A CE1   1 
ATOM   1603 C CE2   . TYR A 1 230 ? 32.647 37.010  -0.904  1.00 69.94  ? 321 TYR A CE2   1 
ATOM   1604 C CZ    . TYR A 1 230 ? 32.965 36.599  0.385   1.00 69.59  ? 321 TYR A CZ    1 
ATOM   1605 O OH    . TYR A 1 230 ? 32.036 35.911  1.137   1.00 70.52  ? 321 TYR A OH    1 
ATOM   1606 N N     . PHE A 1 231 ? 38.466 37.883  -0.535  1.00 61.93  ? 322 PHE A N     1 
ATOM   1607 C CA    . PHE A 1 231 ? 39.166 37.311  0.613   1.00 60.82  ? 322 PHE A CA    1 
ATOM   1608 C C     . PHE A 1 231 ? 39.567 38.440  1.557   1.00 61.33  ? 322 PHE A C     1 
ATOM   1609 O O     . PHE A 1 231 ? 39.801 39.572  1.134   1.00 61.89  ? 322 PHE A O     1 
ATOM   1610 C CB    . PHE A 1 231 ? 40.305 36.416  0.144   1.00 57.48  ? 322 PHE A CB    1 
ATOM   1611 C CG    . PHE A 1 231 ? 41.258 37.096  -0.781  1.00 53.20  ? 322 PHE A CG    1 
ATOM   1612 C CD1   . PHE A 1 231 ? 40.991 37.165  -2.141  1.00 52.53  ? 322 PHE A CD1   1 
ATOM   1613 C CD2   . PHE A 1 231 ? 42.426 37.660  -0.297  1.00 52.89  ? 322 PHE A CD2   1 
ATOM   1614 C CE1   . PHE A 1 231 ? 41.875 37.782  -3.015  1.00 52.22  ? 322 PHE A CE1   1 
ATOM   1615 C CE2   . PHE A 1 231 ? 43.325 38.283  -1.158  1.00 53.72  ? 322 PHE A CE2   1 
ATOM   1616 C CZ    . PHE A 1 231 ? 43.050 38.344  -2.524  1.00 52.85  ? 322 PHE A CZ    1 
ATOM   1617 N N     . GLY A 1 232 ? 39.669 38.114  2.838   1.00 61.20  ? 323 GLY A N     1 
ATOM   1618 C CA    . GLY A 1 232 ? 40.042 39.107  3.821   1.00 61.76  ? 323 GLY A CA    1 
ATOM   1619 C C     . GLY A 1 232 ? 38.970 39.352  4.872   1.00 62.74  ? 323 GLY A C     1 
ATOM   1620 O O     . GLY A 1 232 ? 39.263 39.659  6.025   1.00 63.40  ? 323 GLY A O     1 
ATOM   1621 N N     . GLU A 1 233 ? 37.718 39.226  4.450   1.00 63.43  ? 324 GLU A N     1 
ATOM   1622 C CA    . GLU A 1 233 ? 36.584 39.481  5.323   1.00 63.87  ? 324 GLU A CA    1 
ATOM   1623 C C     . GLU A 1 233 ? 36.903 39.128  6.769   1.00 63.49  ? 324 GLU A C     1 
ATOM   1624 O O     . GLU A 1 233 ? 36.866 39.989  7.647   1.00 63.27  ? 324 GLU A O     1 
ATOM   1625 C CB    . GLU A 1 233 ? 35.334 38.717  4.822   1.00 64.32  ? 324 GLU A CB    1 
ATOM   1626 C CG    . GLU A 1 233 ? 35.549 37.246  4.446   1.00 66.22  ? 324 GLU A CG    1 
ATOM   1627 C CD    . GLU A 1 233 ? 36.370 37.066  3.176   1.00 67.41  ? 324 GLU A CD    1 
ATOM   1628 O OE1   . GLU A 1 233 ? 36.790 35.924  2.878   1.00 68.29  ? 324 GLU A OE1   1 
ATOM   1629 O OE2   . GLU A 1 233 ? 36.593 38.066  2.467   1.00 67.70  ? 324 GLU A OE2   1 
ATOM   1630 N N     . ILE A 1 234 ? 37.255 37.870  7.002   1.00 63.97  ? 325 ILE A N     1 
ATOM   1631 C CA    . ILE A 1 234 ? 37.568 37.385  8.342   1.00 64.21  ? 325 ILE A CA    1 
ATOM   1632 C C     . ILE A 1 234 ? 38.514 38.267  9.162   1.00 64.05  ? 325 ILE A C     1 
ATOM   1633 O O     . ILE A 1 234 ? 38.127 38.808  10.204  1.00 62.90  ? 325 ILE A O     1 
ATOM   1634 C CB    . ILE A 1 234 ? 38.172 35.975  8.251   1.00 64.01  ? 325 ILE A CB    1 
ATOM   1635 N N     . ALA A 1 235 ? 39.748 38.397  8.678   1.00 64.60  ? 326 ALA A N     1 
ATOM   1636 C CA    . ALA A 1 235 ? 40.801 39.189  9.317   1.00 65.74  ? 326 ALA A CA    1 
ATOM   1637 C C     . ALA A 1 235 ? 40.298 40.523  9.867   1.00 66.41  ? 326 ALA A C     1 
ATOM   1638 O O     . ALA A 1 235 ? 40.643 40.938  10.978  1.00 66.25  ? 326 ALA A O     1 
ATOM   1639 C CB    . ALA A 1 235 ? 41.947 39.406  8.343   1.00 64.87  ? 326 ALA A CB    1 
ATOM   1640 N N     . LEU A 1 236 ? 39.487 41.200  9.059   1.00 66.97  ? 327 LEU A N     1 
ATOM   1641 C CA    . LEU A 1 236 ? 38.939 42.495  9.433   1.00 67.06  ? 327 LEU A CA    1 
ATOM   1642 C C     . LEU A 1 236 ? 37.634 42.333  10.210  1.00 67.25  ? 327 LEU A C     1 
ATOM   1643 O O     . LEU A 1 236 ? 37.516 42.788  11.350  1.00 66.40  ? 327 LEU A O     1 
ATOM   1644 C CB    . LEU A 1 236 ? 38.701 43.337  8.178   1.00 66.29  ? 327 LEU A CB    1 
ATOM   1645 N N     . LEU A 1 237 ? 36.676 41.663  9.579   1.00 67.19  ? 328 LEU A N     1 
ATOM   1646 C CA    . LEU A 1 237 ? 35.358 41.434  10.150  1.00 67.56  ? 328 LEU A CA    1 
ATOM   1647 C C     . LEU A 1 237 ? 35.254 40.868  11.567  1.00 69.31  ? 328 LEU A C     1 
ATOM   1648 O O     . LEU A 1 237 ? 34.470 41.380  12.366  1.00 69.14  ? 328 LEU A O     1 
ATOM   1649 C CB    . LEU A 1 237 ? 34.539 40.574  9.197   1.00 65.85  ? 328 LEU A CB    1 
ATOM   1650 C CG    . LEU A 1 237 ? 33.792 41.329  8.097   1.00 64.35  ? 328 LEU A CG    1 
ATOM   1651 C CD1   . LEU A 1 237 ? 33.284 40.377  7.038   1.00 62.50  ? 328 LEU A CD1   1 
ATOM   1652 C CD2   . LEU A 1 237 ? 32.641 42.089  8.733   1.00 64.38  ? 328 LEU A CD2   1 
ATOM   1653 N N     . MET A 1 238 ? 36.015 39.820  11.888  1.00 71.75  ? 329 MET A N     1 
ATOM   1654 C CA    . MET A 1 238 ? 35.928 39.212  13.226  1.00 73.69  ? 329 MET A CA    1 
ATOM   1655 C C     . MET A 1 238 ? 37.142 39.429  14.140  1.00 75.09  ? 329 MET A C     1 
ATOM   1656 O O     . MET A 1 238 ? 37.145 38.962  15.283  1.00 74.96  ? 329 MET A O     1 
ATOM   1657 C CB    . MET A 1 238 ? 35.629 37.703  13.103  1.00 72.86  ? 329 MET A CB    1 
ATOM   1658 N N     . ASN A 1 239 ? 38.158 40.130  13.631  1.00 76.34  ? 330 ASN A N     1 
ATOM   1659 C CA    . ASN A 1 239 ? 39.383 40.438  14.380  1.00 77.39  ? 330 ASN A CA    1 
ATOM   1660 C C     . ASN A 1 239 ? 40.468 39.395  14.670  1.00 78.40  ? 330 ASN A C     1 
ATOM   1661 O O     . ASN A 1 239 ? 40.492 38.795  15.745  1.00 78.64  ? 330 ASN A O     1 
ATOM   1662 C CB    . ASN A 1 239 ? 39.028 41.037  15.747  1.00 76.35  ? 330 ASN A CB    1 
ATOM   1663 N N     . ARG A 1 240 ? 41.369 39.206  13.706  1.00 79.24  ? 331 ARG A N     1 
ATOM   1664 C CA    . ARG A 1 240 ? 42.479 38.253  13.813  1.00 80.52  ? 331 ARG A CA    1 
ATOM   1665 C C     . ARG A 1 240 ? 43.283 38.243  12.554  1.00 81.73  ? 331 ARG A C     1 
ATOM   1666 O O     . ARG A 1 240 ? 42.828 38.757  11.531  1.00 82.52  ? 331 ARG A O     1 
ATOM   1667 C CB    . ARG A 1 240 ? 41.800 36.833  14.009  1.00 79.32  ? 331 ARG A CB    1 
ATOM   1668 N N     . PRO A 1 241 ? 44.519 37.712  12.589  1.00 82.04  ? 332 PRO A N     1 
ATOM   1669 C CA    . PRO A 1 241 ? 45.366 37.710  11.390  1.00 81.92  ? 332 PRO A CA    1 
ATOM   1670 C C     . PRO A 1 241 ? 44.790 36.860  10.263  1.00 82.19  ? 332 PRO A C     1 
ATOM   1671 O O     . PRO A 1 241 ? 43.684 36.325  10.377  1.00 81.97  ? 332 PRO A O     1 
ATOM   1672 C CB    . PRO A 1 241 ? 46.690 37.157  11.903  1.00 82.18  ? 332 PRO A CB    1 
ATOM   1673 C CG    . PRO A 1 241 ? 46.715 37.624  13.320  1.00 82.89  ? 332 PRO A CG    1 
ATOM   1674 C CD    . PRO A 1 241 ? 45.302 37.341  13.779  1.00 82.26  ? 332 PRO A CD    1 
ATOM   1675 N N     . ARG A 1 242 ? 45.554 36.736  9.180   1.00 82.76  ? 333 ARG A N     1 
ATOM   1676 C CA    . ARG A 1 242 ? 45.132 35.957  8.019   1.00 83.40  ? 333 ARG A CA    1 
ATOM   1677 C C     . ARG A 1 242 ? 45.379 34.473  8.288   1.00 84.31  ? 333 ARG A C     1 
ATOM   1678 O O     . ARG A 1 242 ? 46.512 33.994  8.200   1.00 84.20  ? 333 ARG A O     1 
ATOM   1679 C CB    . ARG A 1 242 ? 45.870 36.436  6.773   1.00 82.45  ? 333 ARG A CB    1 
ATOM   1680 N N     . ALA A 1 243 ? 44.308 33.751  8.614   1.00 85.36  ? 334 ALA A N     1 
ATOM   1681 C CA    . ALA A 1 243 ? 44.388 32.322  8.899   1.00 85.37  ? 334 ALA A CA    1 
ATOM   1682 C C     . ALA A 1 243 ? 44.517 31.547  7.587   1.00 85.89  ? 334 ALA A C     1 
ATOM   1683 O O     . ALA A 1 243 ? 44.755 30.338  7.589   1.00 86.11  ? 334 ALA A O     1 
ATOM   1684 C CB    . ALA A 1 243 ? 43.167 31.861  9.662   1.00 84.86  ? 334 ALA A CB    1 
ATOM   1685 N N     . ALA A 1 244 ? 44.349 32.254  6.472   1.00 86.65  ? 335 ALA A N     1 
ATOM   1686 C CA    . ALA A 1 244 ? 44.437 31.644  5.146   1.00 87.25  ? 335 ALA A CA    1 
ATOM   1687 C C     . ALA A 1 244 ? 45.714 32.081  4.426   1.00 87.54  ? 335 ALA A C     1 
ATOM   1688 O O     . ALA A 1 244 ? 46.603 32.691  5.030   1.00 87.57  ? 335 ALA A O     1 
ATOM   1689 C CB    . ALA A 1 244 ? 43.208 32.019  4.319   1.00 86.82  ? 335 ALA A CB    1 
ATOM   1690 N N     . THR A 1 245 ? 45.807 31.765  3.137   1.00 87.60  ? 336 THR A N     1 
ATOM   1691 C CA    . THR A 1 245 ? 46.984 32.137  2.359   1.00 87.78  ? 336 THR A CA    1 
ATOM   1692 C C     . THR A 1 245 ? 46.594 32.481  0.924   1.00 87.97  ? 336 THR A C     1 
ATOM   1693 O O     . THR A 1 245 ? 46.174 31.614  0.152   1.00 88.20  ? 336 THR A O     1 
ATOM   1694 C CB    . THR A 1 245 ? 48.020 31.025  2.411   1.00 87.65  ? 336 THR A CB    1 
ATOM   1695 N N     . VAL A 1 246 ? 46.741 33.756  0.576   1.00 87.80  ? 337 VAL A N     1 
ATOM   1696 C CA    . VAL A 1 246 ? 46.417 34.238  -0.757  1.00 87.43  ? 337 VAL A CA    1 
ATOM   1697 C C     . VAL A 1 246 ? 47.577 33.960  -1.681  1.00 87.69  ? 337 VAL A C     1 
ATOM   1698 O O     . VAL A 1 246 ? 48.727 34.256  -1.356  1.00 87.48  ? 337 VAL A O     1 
ATOM   1699 C CB    . VAL A 1 246 ? 46.108 35.728  -0.722  1.00 86.85  ? 337 VAL A CB    1 
ATOM   1700 N N     . VAL A 1 247 ? 47.280 33.381  -2.838  1.00 88.16  ? 338 VAL A N     1 
ATOM   1701 C CA    . VAL A 1 247 ? 48.306 33.064  -3.820  1.00 88.34  ? 338 VAL A CA    1 
ATOM   1702 C C     . VAL A 1 247 ? 47.999 33.793  -5.118  1.00 88.39  ? 338 VAL A C     1 
ATOM   1703 O O     . VAL A 1 247 ? 47.008 34.513  -5.213  1.00 87.93  ? 338 VAL A O     1 
ATOM   1704 C CB    . VAL A 1 247 ? 48.346 31.571  -4.061  1.00 88.11  ? 338 VAL A CB    1 
ATOM   1705 N N     . ALA A 1 248 ? 48.857 33.607  -6.113  1.00 88.82  ? 339 ALA A N     1 
ATOM   1706 C CA    . ALA A 1 248 ? 48.668 34.239  -7.412  1.00 89.07  ? 339 ALA A CA    1 
ATOM   1707 C C     . ALA A 1 248 ? 48.607 33.162  -8.487  1.00 89.21  ? 339 ALA A C     1 
ATOM   1708 O O     . ALA A 1 248 ? 48.656 31.967  -8.186  1.00 89.19  ? 339 ALA A O     1 
ATOM   1709 C CB    . ALA A 1 248 ? 49.809 35.207  -7.699  1.00 88.87  ? 339 ALA A CB    1 
ATOM   1710 N N     . ARG A 1 249 ? 48.500 33.593  -9.738  1.00 89.35  ? 340 ARG A N     1 
ATOM   1711 C CA    . ARG A 1 249 ? 48.428 32.679  -10.875 1.00 89.46  ? 340 ARG A CA    1 
ATOM   1712 C C     . ARG A 1 249 ? 48.119 33.511  -12.112 1.00 88.96  ? 340 ARG A C     1 
ATOM   1713 O O     . ARG A 1 249 ? 46.972 33.580  -12.560 1.00 89.53  ? 340 ARG A O     1 
ATOM   1714 C CB    . ARG A 1 249 ? 47.328 31.632  -10.650 1.00 89.51  ? 340 ARG A CB    1 
ATOM   1715 N N     . GLY A 1 250 ? 49.153 34.132  -12.665 1.00 87.57  ? 341 GLY A N     1 
ATOM   1716 C CA    . GLY A 1 250 ? 48.962 34.981  -13.821 1.00 86.85  ? 341 GLY A CA    1 
ATOM   1717 C C     . GLY A 1 250 ? 48.670 36.380  -13.302 1.00 86.45  ? 341 GLY A C     1 
ATOM   1718 O O     . GLY A 1 250 ? 48.783 36.616  -12.091 1.00 86.25  ? 341 GLY A O     1 
ATOM   1719 N N     . PRO A 1 251 ? 48.301 37.333  -14.179 1.00 85.38  ? 342 PRO A N     1 
ATOM   1720 C CA    . PRO A 1 251 ? 48.000 38.707  -13.756 1.00 83.95  ? 342 PRO A CA    1 
ATOM   1721 C C     . PRO A 1 251 ? 46.664 38.849  -13.006 1.00 83.12  ? 342 PRO A C     1 
ATOM   1722 O O     . PRO A 1 251 ? 45.605 38.995  -13.630 1.00 83.28  ? 342 PRO A O     1 
ATOM   1723 C CB    . PRO A 1 251 ? 48.012 39.474  -15.077 1.00 83.82  ? 342 PRO A CB    1 
ATOM   1724 C CG    . PRO A 1 251 ? 47.501 38.458  -16.052 1.00 83.83  ? 342 PRO A CG    1 
ATOM   1725 C CD    . PRO A 1 251 ? 48.257 37.214  -15.649 1.00 84.18  ? 342 PRO A CD    1 
ATOM   1726 N N     . LEU A 1 252 ? 46.717 38.804  -11.673 1.00 81.26  ? 343 LEU A N     1 
ATOM   1727 C CA    . LEU A 1 252 ? 45.511 38.930  -10.846 1.00 78.84  ? 343 LEU A CA    1 
ATOM   1728 C C     . LEU A 1 252 ? 45.181 40.408  -10.622 1.00 77.55  ? 343 LEU A C     1 
ATOM   1729 O O     . LEU A 1 252 ? 45.834 41.095  -9.824  1.00 77.09  ? 343 LEU A O     1 
ATOM   1730 C CB    . LEU A 1 252 ? 45.694 38.196  -9.514  1.00 77.49  ? 343 LEU A CB    1 
ATOM   1731 N N     . LYS A 1 253 ? 44.165 40.889  -11.337 1.00 75.07  ? 344 LYS A N     1 
ATOM   1732 C CA    . LYS A 1 253 ? 43.725 42.274  -11.216 1.00 72.37  ? 344 LYS A CA    1 
ATOM   1733 C C     . LYS A 1 253 ? 42.621 42.327  -10.152 1.00 70.05  ? 344 LYS A C     1 
ATOM   1734 O O     . LYS A 1 253 ? 41.755 41.449  -10.106 1.00 68.88  ? 344 LYS A O     1 
ATOM   1735 C CB    . LYS A 1 253 ? 43.208 42.793  -12.549 1.00 72.97  ? 344 LYS A CB    1 
ATOM   1736 N N     . CYS A 1 254 ? 42.649 43.355  -9.307  1.00 67.78  ? 345 CYS A N     1 
ATOM   1737 C CA    . CYS A 1 254 ? 41.652 43.488  -8.251  1.00 64.51  ? 345 CYS A CA    1 
ATOM   1738 C C     . CYS A 1 254 ? 41.714 44.854  -7.573  1.00 61.63  ? 345 CYS A C     1 
ATOM   1739 O O     . CYS A 1 254 ? 42.621 45.652  -7.830  1.00 60.37  ? 345 CYS A O     1 
ATOM   1740 C CB    . CYS A 1 254 ? 41.807 42.332  -7.278  1.00 65.98  ? 345 CYS A CB    1 
ATOM   1741 S SG    . CYS A 1 254 ? 43.446 42.316  -6.544  1.00 68.60  ? 345 CYS A SG    1 
ATOM   1742 N N     . VAL A 1 255 ? 40.753 45.086  -6.675  1.00 58.26  ? 346 VAL A N     1 
ATOM   1743 C CA    . VAL A 1 255 ? 40.634 46.329  -5.916  1.00 53.76  ? 346 VAL A CA    1 
ATOM   1744 C C     . VAL A 1 255 ? 40.683 46.099  -4.410  1.00 51.70  ? 346 VAL A C     1 
ATOM   1745 O O     . VAL A 1 255 ? 39.971 45.248  -3.886  1.00 49.55  ? 346 VAL A O     1 
ATOM   1746 C CB    . VAL A 1 255 ? 39.361 47.084  -6.208  1.00 53.45  ? 346 VAL A CB    1 
ATOM   1747 C CG1   . VAL A 1 255 ? 39.471 47.816  -7.545  1.00 53.81  ? 346 VAL A CG1   1 
ATOM   1748 C CG2   . VAL A 1 255 ? 38.207 46.100  -6.209  1.00 50.68  ? 346 VAL A CG2   1 
ATOM   1749 N N     . LYS A 1 256 ? 41.502 46.893  -3.723  1.00 50.77  ? 347 LYS A N     1 
ATOM   1750 C CA    . LYS A 1 256 ? 41.661 46.815  -2.270  1.00 49.81  ? 347 LYS A CA    1 
ATOM   1751 C C     . LYS A 1 256 ? 40.786 47.814  -1.501  1.00 49.03  ? 347 LYS A C     1 
ATOM   1752 O O     . LYS A 1 256 ? 40.260 48.780  -2.062  1.00 48.47  ? 347 LYS A O     1 
ATOM   1753 C CB    . LYS A 1 256 ? 43.138 47.029  -1.893  1.00 49.24  ? 347 LYS A CB    1 
ATOM   1754 N N     . LEU A 1 257 ? 40.661 47.565  -0.202  1.00 48.16  ? 348 LEU A N     1 
ATOM   1755 C CA    . LEU A 1 257 ? 39.872 48.392  0.705   1.00 48.10  ? 348 LEU A CA    1 
ATOM   1756 C C     . LEU A 1 257 ? 40.642 48.323  2.007   1.00 49.92  ? 348 LEU A C     1 
ATOM   1757 O O     . LEU A 1 257 ? 41.197 47.278  2.322   1.00 50.97  ? 348 LEU A O     1 
ATOM   1758 C CB    . LEU A 1 257 ? 38.493 47.767  0.896   1.00 46.36  ? 348 LEU A CB    1 
ATOM   1759 C CG    . LEU A 1 257 ? 37.270 48.664  1.007   1.00 44.20  ? 348 LEU A CG    1 
ATOM   1760 C CD1   . LEU A 1 257 ? 37.187 49.574  -0.201  1.00 44.81  ? 348 LEU A CD1   1 
ATOM   1761 C CD2   . LEU A 1 257 ? 36.040 47.800  1.087   1.00 42.60  ? 348 LEU A CD2   1 
ATOM   1762 N N     . ASP A 1 258 ? 40.699 49.410  2.767   1.00 51.58  ? 349 ASP A N     1 
ATOM   1763 C CA    . ASP A 1 258 ? 41.446 49.371  4.021   1.00 53.06  ? 349 ASP A CA    1 
ATOM   1764 C C     . ASP A 1 258 ? 40.520 49.497  5.221   1.00 53.61  ? 349 ASP A C     1 
ATOM   1765 O O     . ASP A 1 258 ? 39.326 49.758  5.073   1.00 54.11  ? 349 ASP A O     1 
ATOM   1766 C CB    . ASP A 1 258 ? 42.506 50.474  4.054   1.00 53.93  ? 349 ASP A CB    1 
ATOM   1767 C CG    . ASP A 1 258 ? 41.909 51.835  4.262   1.00 55.46  ? 349 ASP A CG    1 
ATOM   1768 O OD1   . ASP A 1 258 ? 40.898 52.143  3.590   1.00 55.87  ? 349 ASP A OD1   1 
ATOM   1769 O OD2   . ASP A 1 258 ? 42.449 52.594  5.095   1.00 54.70  ? 349 ASP A OD2   1 
ATOM   1770 N N     . ARG A 1 259 ? 41.079 49.321  6.411   1.00 53.42  ? 350 ARG A N     1 
ATOM   1771 C CA    . ARG A 1 259 ? 40.288 49.363  7.625   1.00 54.72  ? 350 ARG A CA    1 
ATOM   1772 C C     . ARG A 1 259 ? 39.234 50.475  7.629   1.00 54.30  ? 350 ARG A C     1 
ATOM   1773 O O     . ARG A 1 259 ? 38.039 50.200  7.571   1.00 55.24  ? 350 ARG A O     1 
ATOM   1774 C CB    . ARG A 1 259 ? 41.212 49.466  8.843   1.00 57.39  ? 350 ARG A CB    1 
ATOM   1775 C CG    . ARG A 1 259 ? 40.539 49.227  10.189  1.00 60.93  ? 350 ARG A CG    1 
ATOM   1776 C CD    . ARG A 1 259 ? 40.009 47.810  10.309  1.00 65.54  ? 350 ARG A CD    1 
ATOM   1777 N NE    . ARG A 1 259 ? 41.058 46.805  10.154  1.00 69.73  ? 350 ARG A NE    1 
ATOM   1778 C CZ    . ARG A 1 259 ? 40.874 45.496  10.318  1.00 70.67  ? 350 ARG A CZ    1 
ATOM   1779 N NH1   . ARG A 1 259 ? 41.888 44.655  10.153  1.00 71.53  ? 350 ARG A NH1   1 
ATOM   1780 N NH2   . ARG A 1 259 ? 39.679 45.028  10.653  1.00 70.56  ? 350 ARG A NH2   1 
ATOM   1781 N N     . PRO A 1 260 ? 39.657 51.744  7.672   1.00 53.12  ? 351 PRO A N     1 
ATOM   1782 C CA    . PRO A 1 260 ? 38.683 52.838  7.684   1.00 51.24  ? 351 PRO A CA    1 
ATOM   1783 C C     . PRO A 1 260 ? 37.638 52.748  6.585   1.00 49.54  ? 351 PRO A C     1 
ATOM   1784 O O     . PRO A 1 260 ? 36.443 52.787  6.865   1.00 49.22  ? 351 PRO A O     1 
ATOM   1785 C CB    . PRO A 1 260 ? 39.555 54.075  7.537   1.00 51.37  ? 351 PRO A CB    1 
ATOM   1786 C CG    . PRO A 1 260 ? 40.813 53.661  8.215   1.00 52.80  ? 351 PRO A CG    1 
ATOM   1787 C CD    . PRO A 1 260 ? 41.028 52.277  7.670   1.00 53.44  ? 351 PRO A CD    1 
ATOM   1788 N N     . ARG A 1 261 ? 38.091 52.643  5.338   1.00 47.73  ? 352 ARG A N     1 
ATOM   1789 C CA    . ARG A 1 261 ? 37.178 52.556  4.204   1.00 46.85  ? 352 ARG A CA    1 
ATOM   1790 C C     . ARG A 1 261 ? 36.289 51.308  4.319   1.00 45.79  ? 352 ARG A C     1 
ATOM   1791 O O     . ARG A 1 261 ? 35.066 51.387  4.187   1.00 44.06  ? 352 ARG A O     1 
ATOM   1792 C CB    . ARG A 1 261 ? 37.963 52.518  2.886   1.00 47.95  ? 352 ARG A CB    1 
ATOM   1793 C CG    . ARG A 1 261 ? 38.446 53.869  2.349   1.00 47.60  ? 352 ARG A CG    1 
ATOM   1794 C CD    . ARG A 1 261 ? 39.087 53.701  0.966   1.00 47.96  ? 352 ARG A CD    1 
ATOM   1795 N NE    . ARG A 1 261 ? 40.311 52.903  1.029   1.00 50.83  ? 352 ARG A NE    1 
ATOM   1796 C CZ    . ARG A 1 261 ? 40.788 52.164  0.029   1.00 52.07  ? 352 ARG A CZ    1 
ATOM   1797 N NH1   . ARG A 1 261 ? 40.141 52.119  -1.123  1.00 51.85  ? 352 ARG A NH1   1 
ATOM   1798 N NH2   . ARG A 1 261 ? 41.909 51.458  0.181   1.00 51.35  ? 352 ARG A NH2   1 
ATOM   1799 N N     . PHE A 1 262 ? 36.915 50.157  4.557   1.00 44.08  ? 353 PHE A N     1 
ATOM   1800 C CA    . PHE A 1 262 ? 36.189 48.904  4.711   1.00 41.82  ? 353 PHE A CA    1 
ATOM   1801 C C     . PHE A 1 262 ? 35.150 49.141  5.787   1.00 39.73  ? 353 PHE A C     1 
ATOM   1802 O O     . PHE A 1 262 ? 33.954 49.178  5.525   1.00 40.36  ? 353 PHE A O     1 
ATOM   1803 C CB    . PHE A 1 262 ? 37.146 47.801  5.167   1.00 44.17  ? 353 PHE A CB    1 
ATOM   1804 C CG    . PHE A 1 262 ? 36.466 46.489  5.500   1.00 45.88  ? 353 PHE A CG    1 
ATOM   1805 C CD1   . PHE A 1 262 ? 36.220 45.541  4.509   1.00 45.40  ? 353 PHE A CD1   1 
ATOM   1806 C CD2   . PHE A 1 262 ? 36.070 46.207  6.812   1.00 46.40  ? 353 PHE A CD2   1 
ATOM   1807 C CE1   . PHE A 1 262 ? 35.590 44.332  4.818   1.00 45.33  ? 353 PHE A CE1   1 
ATOM   1808 C CE2   . PHE A 1 262 ? 35.440 45.006  7.128   1.00 45.46  ? 353 PHE A CE2   1 
ATOM   1809 C CZ    . PHE A 1 262 ? 35.200 44.067  6.126   1.00 45.39  ? 353 PHE A CZ    1 
ATOM   1810 N N     . GLU A 1 263 ? 35.634 49.318  7.005   1.00 37.05  ? 354 GLU A N     1 
ATOM   1811 C CA    . GLU A 1 263 ? 34.776 49.559  8.140   1.00 35.17  ? 354 GLU A CA    1 
ATOM   1812 C C     . GLU A 1 263 ? 33.591 50.410  7.739   1.00 34.54  ? 354 GLU A C     1 
ATOM   1813 O O     . GLU A 1 263 ? 32.478 50.165  8.173   1.00 36.09  ? 354 GLU A O     1 
ATOM   1814 C CB    . GLU A 1 263 ? 35.579 50.067  9.317   1.00 35.94  ? 354 GLU A CB    1 
ATOM   1815 C CG    . GLU A 1 263 ? 36.441 49.000  9.956   1.00 38.95  ? 354 GLU A CG    1 
ATOM   1816 C CD    . GLU A 1 263 ? 36.899 49.367  11.353  1.00 40.73  ? 354 GLU A CD    1 
ATOM   1817 O OE1   . GLU A 1 263 ? 36.275 50.252  11.989  1.00 41.52  ? 354 GLU A OE1   1 
ATOM   1818 O OE2   . GLU A 1 263 ? 37.876 48.751  11.824  1.00 41.11  ? 354 GLU A OE2   1 
ATOM   1819 N N     . ARG A 1 264 ? 33.811 51.415  6.908   1.00 35.29  ? 355 ARG A N     1 
ATOM   1820 C CA    . ARG A 1 264 ? 32.697 52.274  6.530   1.00 35.39  ? 355 ARG A CA    1 
ATOM   1821 C C     . ARG A 1 264 ? 31.732 51.875  5.421   1.00 36.76  ? 355 ARG A C     1 
ATOM   1822 O O     . ARG A 1 264 ? 30.517 51.956  5.568   1.00 36.92  ? 355 ARG A O     1 
ATOM   1823 C CB    . ARG A 1 264 ? 33.215 53.668  6.292   1.00 32.49  ? 355 ARG A CB    1 
ATOM   1824 C CG    . ARG A 1 264 ? 32.154 54.730  6.436   1.00 30.50  ? 355 ARG A CG    1 
ATOM   1825 C CD    . ARG A 1 264 ? 32.595 56.071  5.928   1.00 29.33  ? 355 ARG A CD    1 
ATOM   1826 N NE    . ARG A 1 264 ? 32.751 56.081  4.483   1.00 28.44  ? 355 ARG A NE    1 
ATOM   1827 C CZ    . ARG A 1 264 ? 33.922 56.025  3.864   1.00 28.51  ? 355 ARG A CZ    1 
ATOM   1828 N NH1   . ARG A 1 264 ? 35.036 55.954  4.580   1.00 27.57  ? 355 ARG A NH1   1 
ATOM   1829 N NH2   . ARG A 1 264 ? 33.973 56.045  2.537   1.00 25.03  ? 355 ARG A NH2   1 
ATOM   1830 N N     . VAL A 1 265 ? 32.289 51.464  4.284   1.00 38.23  ? 356 VAL A N     1 
ATOM   1831 C CA    . VAL A 1 265 ? 31.457 51.101  3.144   1.00 39.93  ? 356 VAL A CA    1 
ATOM   1832 C C     . VAL A 1 265 ? 30.771 49.768  3.367   1.00 40.97  ? 356 VAL A C     1 
ATOM   1833 O O     . VAL A 1 265 ? 29.699 49.517  2.826   1.00 41.35  ? 356 VAL A O     1 
ATOM   1834 C CB    . VAL A 1 265 ? 32.268 51.030  1.828   1.00 41.52  ? 356 VAL A CB    1 
ATOM   1835 C CG1   . VAL A 1 265 ? 32.818 52.415  1.475   1.00 41.19  ? 356 VAL A CG1   1 
ATOM   1836 C CG2   . VAL A 1 265 ? 33.383 49.997  1.951   1.00 40.43  ? 356 VAL A CG2   1 
ATOM   1837 N N     . LEU A 1 266 ? 31.393 48.912  4.165   1.00 42.02  ? 357 LEU A N     1 
ATOM   1838 C CA    . LEU A 1 266 ? 30.815 47.613  4.461   1.00 42.52  ? 357 LEU A CA    1 
ATOM   1839 C C     . LEU A 1 266 ? 30.155 47.622  5.834   1.00 42.96  ? 357 LEU A C     1 
ATOM   1840 O O     . LEU A 1 266 ? 29.747 46.586  6.352   1.00 44.42  ? 357 LEU A O     1 
ATOM   1841 C CB    . LEU A 1 266 ? 31.890 46.532  4.372   1.00 42.11  ? 357 LEU A CB    1 
ATOM   1842 C CG    . LEU A 1 266 ? 31.904 45.758  3.052   1.00 42.09  ? 357 LEU A CG    1 
ATOM   1843 C CD1   . LEU A 1 266 ? 31.559 46.654  1.876   1.00 42.43  ? 357 LEU A CD1   1 
ATOM   1844 C CD2   . LEU A 1 266 ? 33.270 45.153  2.870   1.00 42.70  ? 357 LEU A CD2   1 
ATOM   1845 N N     . GLY A 1 267 ? 30.056 48.805  6.424   1.00 42.74  ? 358 GLY A N     1 
ATOM   1846 C CA    . GLY A 1 267 ? 29.409 48.923  7.712   1.00 42.52  ? 358 GLY A CA    1 
ATOM   1847 C C     . GLY A 1 267 ? 27.985 48.431  7.586   1.00 43.12  ? 358 GLY A C     1 
ATOM   1848 O O     . GLY A 1 267 ? 27.496 47.739  8.479   1.00 42.76  ? 358 GLY A O     1 
ATOM   1849 N N     . PRO A 1 268 ? 27.294 48.765  6.479   1.00 44.05  ? 359 PRO A N     1 
ATOM   1850 C CA    . PRO A 1 268 ? 25.912 48.340  6.253   1.00 46.35  ? 359 PRO A CA    1 
ATOM   1851 C C     . PRO A 1 268 ? 25.758 46.845  6.519   1.00 49.28  ? 359 PRO A C     1 
ATOM   1852 O O     . PRO A 1 268 ? 24.909 46.429  7.307   1.00 50.26  ? 359 PRO A O     1 
ATOM   1853 C CB    . PRO A 1 268 ? 25.685 48.705  4.793   1.00 44.70  ? 359 PRO A CB    1 
ATOM   1854 C CG    . PRO A 1 268 ? 26.469 49.941  4.659   1.00 44.31  ? 359 PRO A CG    1 
ATOM   1855 C CD    . PRO A 1 268 ? 27.760 49.580  5.345   1.00 43.86  ? 359 PRO A CD    1 
ATOM   1856 N N     . CYS A 1 269 ? 26.570 46.040  5.842   1.00 51.54  ? 360 CYS A N     1 
ATOM   1857 C CA    . CYS A 1 269 ? 26.561 44.602  6.051   1.00 53.14  ? 360 CYS A CA    1 
ATOM   1858 C C     . CYS A 1 269 ? 27.430 44.443  7.297   1.00 53.18  ? 360 CYS A C     1 
ATOM   1859 O O     . CYS A 1 269 ? 27.181 45.099  8.308   1.00 52.75  ? 360 CYS A O     1 
ATOM   1860 C CB    . CYS A 1 269 ? 27.180 43.893  4.842   1.00 54.15  ? 360 CYS A CB    1 
ATOM   1861 S SG    . CYS A 1 269 ? 28.763 44.583  4.258   1.00 60.15  ? 360 CYS A SG    1 
ATOM   1862 N N     . SER A 1 270 ? 28.443 43.590  7.236   1.00 54.16  ? 361 SER A N     1 
ATOM   1863 C CA    . SER A 1 270 ? 29.347 43.424  8.372   1.00 56.43  ? 361 SER A CA    1 
ATOM   1864 C C     . SER A 1 270 ? 28.848 42.927  9.736   1.00 57.26  ? 361 SER A C     1 
ATOM   1865 O O     . SER A 1 270 ? 29.643 42.578  10.613  1.00 56.34  ? 361 SER A O     1 
ATOM   1866 C CB    . SER A 1 270 ? 29.808 44.811  8.848   1.00 56.11  ? 361 SER A CB    1 
ATOM   1867 O OG    . SER A 1 270 ? 30.663 44.727  9.971   1.00 56.72  ? 361 SER A OG    1 
ATOM   1868 N N     . ASP A 1 271 ? 27.532 42.921  9.922   1.00 58.38  ? 362 ASP A N     1 
ATOM   1869 C CA    . ASP A 1 271 ? 26.943 42.455  11.174  1.00 59.03  ? 362 ASP A CA    1 
ATOM   1870 C C     . ASP A 1 271 ? 26.503 41.103  10.639  1.00 59.11  ? 362 ASP A C     1 
ATOM   1871 O O     . ASP A 1 271 ? 26.518 40.063  11.307  1.00 59.19  ? 362 ASP A O     1 
ATOM   1872 C CB    . ASP A 1 271 ? 25.819 43.270  11.699  1.00 59.82  ? 362 ASP A CB    1 
ATOM   1873 C CG    . ASP A 1 271 ? 26.174 44.738  11.825  1.00 60.61  ? 362 ASP A CG    1 
ATOM   1874 O OD1   . ASP A 1 271 ? 26.877 45.095  12.794  1.00 60.83  ? 362 ASP A OD1   1 
ATOM   1875 O OD2   . ASP A 1 271 ? 25.766 45.529  10.943  1.00 60.31  ? 362 ASP A OD2   1 
ATOM   1876 N N     . ILE A 1 272 ? 26.069 41.170  9.382   1.00 58.37  ? 363 ILE A N     1 
ATOM   1877 C CA    . ILE A 1 272 ? 25.576 40.019  8.645   1.00 56.22  ? 363 ILE A CA    1 
ATOM   1878 C C     . ILE A 1 272 ? 26.762 39.158  8.234   1.00 54.11  ? 363 ILE A C     1 
ATOM   1879 O O     . ILE A 1 272 ? 26.716 37.937  8.347   1.00 54.27  ? 363 ILE A O     1 
ATOM   1880 C CB    . ILE A 1 272 ? 24.806 40.468  7.379   1.00 57.89  ? 363 ILE A CB    1 
ATOM   1881 C CG1   . ILE A 1 272 ? 23.462 41.086  7.786   1.00 58.08  ? 363 ILE A CG1   1 
ATOM   1882 C CG2   . ILE A 1 272 ? 24.619 39.288  6.420   1.00 57.28  ? 363 ILE A CG2   1 
ATOM   1883 C CD1   . ILE A 1 272 ? 22.571 41.464  6.609   1.00 56.86  ? 363 ILE A CD1   1 
ATOM   1884 N N     . LEU A 1 273 ? 27.825 39.802  7.760   1.00 51.56  ? 364 LEU A N     1 
ATOM   1885 C CA    . LEU A 1 273 ? 29.020 39.086  7.339   1.00 49.19  ? 364 LEU A CA    1 
ATOM   1886 C C     . LEU A 1 273 ? 29.633 38.387  8.539   1.00 48.43  ? 364 LEU A C     1 
ATOM   1887 O O     . LEU A 1 273 ? 30.365 37.419  8.392   1.00 48.03  ? 364 LEU A O     1 
ATOM   1888 C CB    . LEU A 1 273 ? 30.042 40.048  6.724   1.00 49.00  ? 364 LEU A CB    1 
ATOM   1889 C CG    . LEU A 1 273 ? 29.612 41.018  5.611   1.00 48.78  ? 364 LEU A CG    1 
ATOM   1890 C CD1   . LEU A 1 273 ? 30.849 41.684  5.051   1.00 49.26  ? 364 LEU A CD1   1 
ATOM   1891 C CD2   . LEU A 1 273 ? 28.870 40.298  4.491   1.00 47.99  ? 364 LEU A CD2   1 
ATOM   1892 N N     . LYS A 1 274 ? 29.328 38.886  9.731   1.00 49.15  ? 365 LYS A N     1 
ATOM   1893 C CA    . LYS A 1 274 ? 29.839 38.298  10.966  1.00 49.31  ? 365 LYS A CA    1 
ATOM   1894 C C     . LYS A 1 274 ? 28.947 37.112  11.322  1.00 48.75  ? 365 LYS A C     1 
ATOM   1895 O O     . LYS A 1 274 ? 29.442 36.064  11.724  1.00 47.51  ? 365 LYS A O     1 
ATOM   1896 C CB    . LYS A 1 274 ? 29.845 39.347  12.103  1.00 49.81  ? 365 LYS A CB    1 
ATOM   1897 N N     . ARG A 1 275 ? 27.632 37.288  11.175  1.00 50.04  ? 366 ARG A N     1 
ATOM   1898 C CA    . ARG A 1 275 ? 26.662 36.211  11.430  1.00 51.08  ? 366 ARG A CA    1 
ATOM   1899 C C     . ARG A 1 275 ? 27.155 35.002  10.639  1.00 50.83  ? 366 ARG A C     1 
ATOM   1900 O O     . ARG A 1 275 ? 27.316 33.907  11.178  1.00 50.98  ? 366 ARG A O     1 
ATOM   1901 C CB    . ARG A 1 275 ? 25.258 36.603  10.925  1.00 51.53  ? 366 ARG A CB    1 
ATOM   1902 C CG    . ARG A 1 275 ? 24.441 37.464  11.874  1.00 51.36  ? 366 ARG A CG    1 
ATOM   1903 C CD    . ARG A 1 275 ? 23.984 36.630  13.045  1.00 52.43  ? 366 ARG A CD    1 
ATOM   1904 N NE    . ARG A 1 275 ? 24.073 37.309  14.340  1.00 54.10  ? 366 ARG A NE    1 
ATOM   1905 C CZ    . ARG A 1 275 ? 25.097 38.062  14.741  1.00 53.88  ? 366 ARG A CZ    1 
ATOM   1906 N NH1   . ARG A 1 275 ? 26.141 38.267  13.942  1.00 52.95  ? 366 ARG A NH1   1 
ATOM   1907 N NH2   . ARG A 1 275 ? 25.104 38.565  15.971  1.00 52.98  ? 366 ARG A NH2   1 
ATOM   1908 N N     . ASN A 1 276 ? 27.395 35.236  9.352   1.00 50.03  ? 367 ASN A N     1 
ATOM   1909 C CA    . ASN A 1 276 ? 27.888 34.223  8.440   1.00 49.67  ? 367 ASN A CA    1 
ATOM   1910 C C     . ASN A 1 276 ? 29.107 33.556  9.033   1.00 50.52  ? 367 ASN A C     1 
ATOM   1911 O O     . ASN A 1 276 ? 29.191 32.335  9.098   1.00 52.48  ? 367 ASN A O     1 
ATOM   1912 C CB    . ASN A 1 276 ? 28.302 34.850  7.115   1.00 49.80  ? 367 ASN A CB    1 
ATOM   1913 C CG    . ASN A 1 276 ? 27.158 35.551  6.406   1.00 50.49  ? 367 ASN A CG    1 
ATOM   1914 O OD1   . ASN A 1 276 ? 26.003 35.533  6.865   1.00 48.53  ? 367 ASN A OD1   1 
ATOM   1915 N ND2   . ASN A 1 276 ? 27.474 36.172  5.267   1.00 49.06  ? 367 ASN A ND2   1 
ATOM   1916 N N     . ILE A 1 277 ? 30.074 34.359  9.448   1.00 50.98  ? 368 ILE A N     1 
ATOM   1917 C CA    . ILE A 1 277 ? 31.290 33.804  10.017  1.00 51.61  ? 368 ILE A CA    1 
ATOM   1918 C C     . ILE A 1 277 ? 30.992 32.682  11.021  1.00 52.14  ? 368 ILE A C     1 
ATOM   1919 O O     . ILE A 1 277 ? 31.526 31.578  10.900  1.00 53.90  ? 368 ILE A O     1 
ATOM   1920 C CB    . ILE A 1 277 ? 32.133 34.902  10.696  1.00 51.46  ? 368 ILE A CB    1 
ATOM   1921 C CG1   . ILE A 1 277 ? 32.647 35.897  9.642   1.00 51.81  ? 368 ILE A CG1   1 
ATOM   1922 C CG2   . ILE A 1 277 ? 33.278 34.274  11.472  1.00 51.63  ? 368 ILE A CG2   1 
ATOM   1923 C CD1   . ILE A 1 277 ? 33.544 35.290  8.573   1.00 50.38  ? 368 ILE A CD1   1 
ATOM   1924 N N     . GLN A 1 278 ? 30.131 32.962  11.997  1.00 51.50  ? 369 GLN A N     1 
ATOM   1925 C CA    . GLN A 1 278 ? 29.774 31.979  13.016  1.00 50.69  ? 369 GLN A CA    1 
ATOM   1926 C C     . GLN A 1 278 ? 28.988 30.808  12.424  1.00 48.97  ? 369 GLN A C     1 
ATOM   1927 O O     . GLN A 1 278 ? 29.129 29.658  12.853  1.00 46.89  ? 369 GLN A O     1 
ATOM   1928 C CB    . GLN A 1 278 ? 28.968 32.664  14.123  1.00 53.65  ? 369 GLN A CB    1 
ATOM   1929 C CG    . GLN A 1 278 ? 28.244 31.718  15.088  1.00 58.02  ? 369 GLN A CG    1 
ATOM   1930 C CD    . GLN A 1 278 ? 27.002 31.081  14.467  1.00 59.61  ? 369 GLN A CD    1 
ATOM   1931 O OE1   . GLN A 1 278 ? 26.209 31.759  13.807  1.00 59.66  ? 369 GLN A OE1   1 
ATOM   1932 N NE2   . GLN A 1 278 ? 26.827 29.781  14.685  1.00 60.25  ? 369 GLN A NE2   1 
ATOM   1933 N N     . GLN A 1 279 ? 28.152 31.119  11.441  1.00 47.27  ? 370 GLN A N     1 
ATOM   1934 C CA    . GLN A 1 279 ? 27.351 30.114  10.763  1.00 45.97  ? 370 GLN A CA    1 
ATOM   1935 C C     . GLN A 1 279 ? 28.232 29.008  10.214  1.00 45.74  ? 370 GLN A C     1 
ATOM   1936 O O     . GLN A 1 279 ? 28.077 27.849  10.581  1.00 46.12  ? 370 GLN A O     1 
ATOM   1937 C CB    . GLN A 1 279 ? 26.595 30.739  9.600   1.00 44.92  ? 370 GLN A CB    1 
ATOM   1938 C CG    . GLN A 1 279 ? 25.102 30.752  9.756   1.00 46.97  ? 370 GLN A CG    1 
ATOM   1939 C CD    . GLN A 1 279 ? 24.663 31.529  10.962  1.00 47.92  ? 370 GLN A CD    1 
ATOM   1940 O OE1   . GLN A 1 279 ? 24.831 31.079  12.091  1.00 49.09  ? 370 GLN A OE1   1 
ATOM   1941 N NE2   . GLN A 1 279 ? 24.103 32.717  10.735  1.00 48.58  ? 370 GLN A NE2   1 
ATOM   1942 N N     . TYR A 1 280 ? 29.157 29.373  9.330   1.00 45.71  ? 371 TYR A N     1 
ATOM   1943 C CA    . TYR A 1 280 ? 30.029 28.387  8.710   1.00 45.26  ? 371 TYR A CA    1 
ATOM   1944 C C     . TYR A 1 280 ? 30.821 27.610  9.741   1.00 45.61  ? 371 TYR A C     1 
ATOM   1945 O O     . TYR A 1 280 ? 30.934 26.385  9.649   1.00 45.03  ? 371 TYR A O     1 
ATOM   1946 C CB    . TYR A 1 280 ? 30.974 29.050  7.698   1.00 44.06  ? 371 TYR A CB    1 
ATOM   1947 C CG    . TYR A 1 280 ? 31.784 28.057  6.883   1.00 42.67  ? 371 TYR A CG    1 
ATOM   1948 C CD1   . TYR A 1 280 ? 32.996 27.556  7.356   1.00 43.14  ? 371 TYR A CD1   1 
ATOM   1949 C CD2   . TYR A 1 280 ? 31.331 27.605  5.647   1.00 42.42  ? 371 TYR A CD2   1 
ATOM   1950 C CE1   . TYR A 1 280 ? 33.747 26.624  6.613   1.00 43.19  ? 371 TYR A CE1   1 
ATOM   1951 C CE2   . TYR A 1 280 ? 32.069 26.675  4.896   1.00 43.97  ? 371 TYR A CE2   1 
ATOM   1952 C CZ    . TYR A 1 280 ? 33.281 26.186  5.384   1.00 44.02  ? 371 TYR A CZ    1 
ATOM   1953 O OH    . TYR A 1 280 ? 34.021 25.270  4.648   1.00 40.84  ? 371 TYR A OH    1 
ATOM   1954 N N     . ASN A 1 281 ? 31.373 28.310  10.726  1.00 46.29  ? 372 ASN A N     1 
ATOM   1955 C CA    . ASN A 1 281 ? 32.138 27.620  11.755  1.00 46.71  ? 372 ASN A CA    1 
ATOM   1956 C C     . ASN A 1 281 ? 31.194 26.647  12.465  1.00 46.04  ? 372 ASN A C     1 
ATOM   1957 O O     . ASN A 1 281 ? 31.516 25.469  12.648  1.00 46.99  ? 372 ASN A O     1 
ATOM   1958 C CB    . ASN A 1 281 ? 32.744 28.624  12.739  1.00 47.62  ? 372 ASN A CB    1 
ATOM   1959 C CG    . ASN A 1 281 ? 33.757 29.554  12.077  1.00 49.31  ? 372 ASN A CG    1 
ATOM   1960 O OD1   . ASN A 1 281 ? 34.700 30.022  12.719  1.00 50.31  ? 372 ASN A OD1   1 
ATOM   1961 N ND2   . ASN A 1 281 ? 33.561 29.832  10.792  1.00 50.43  ? 372 ASN A ND2   1 
ATOM   1962 N N     . SER A 1 282 ? 30.021 27.140  12.843  1.00 43.57  ? 373 SER A N     1 
ATOM   1963 C CA    . SER A 1 282 ? 29.024 26.311  13.495  1.00 41.89  ? 373 SER A CA    1 
ATOM   1964 C C     . SER A 1 282 ? 28.770 25.052  12.661  1.00 41.98  ? 373 SER A C     1 
ATOM   1965 O O     . SER A 1 282 ? 28.684 23.945  13.203  1.00 42.32  ? 373 SER A O     1 
ATOM   1966 C CB    . SER A 1 282 ? 27.738 27.111  13.647  1.00 43.19  ? 373 SER A CB    1 
ATOM   1967 O OG    . SER A 1 282 ? 26.615 26.269  13.806  1.00 45.35  ? 373 SER A OG    1 
ATOM   1968 N N     . PHE A 1 283 ? 28.667 25.237  11.342  1.00 41.05  ? 374 PHE A N     1 
ATOM   1969 C CA    . PHE A 1 283 ? 28.429 24.161  10.373  1.00 39.50  ? 374 PHE A CA    1 
ATOM   1970 C C     . PHE A 1 283 ? 29.480 23.045  10.431  1.00 40.18  ? 374 PHE A C     1 
ATOM   1971 O O     . PHE A 1 283 ? 29.433 22.098  9.666   1.00 41.02  ? 374 PHE A O     1 
ATOM   1972 C CB    . PHE A 1 283 ? 28.300 24.756  8.955   1.00 38.17  ? 374 PHE A CB    1 
ATOM   1973 C CG    . PHE A 1 283 ? 27.912 23.753  7.878   1.00 34.71  ? 374 PHE A CG    1 
ATOM   1974 C CD1   . PHE A 1 283 ? 26.625 23.228  7.813   1.00 34.73  ? 374 PHE A CD1   1 
ATOM   1975 C CD2   . PHE A 1 283 ? 28.831 23.353  6.919   1.00 33.51  ? 374 PHE A CD2   1 
ATOM   1976 C CE1   . PHE A 1 283 ? 26.268 22.327  6.810   1.00 32.14  ? 374 PHE A CE1   1 
ATOM   1977 C CE2   . PHE A 1 283 ? 28.471 22.446  5.913   1.00 33.19  ? 374 PHE A CE2   1 
ATOM   1978 C CZ    . PHE A 1 283 ? 27.193 21.940  5.864   1.00 30.51  ? 374 PHE A CZ    1 
ATOM   1979 N N     . VAL A 1 284 ? 30.446 23.154  11.326  1.00 42.19  ? 375 VAL A N     1 
ATOM   1980 C CA    . VAL A 1 284 ? 31.432 22.092  11.455  1.00 43.89  ? 375 VAL A CA    1 
ATOM   1981 C C     . VAL A 1 284 ? 31.447 21.786  12.947  1.00 46.34  ? 375 VAL A C     1 
ATOM   1982 O O     . VAL A 1 284 ? 32.169 22.421  13.743  1.00 47.20  ? 375 VAL A O     1 
ATOM   1983 C CB    . VAL A 1 284 ? 32.794 22.587  10.959  1.00 43.81  ? 375 VAL A CB    1 
ATOM   1984 C CG1   . VAL A 1 284 ? 33.644 21.391  10.577  1.00 43.73  ? 375 VAL A CG1   1 
ATOM   1985 C CG2   . VAL A 1 284 ? 32.613 23.543  9.776   1.00 42.83  ? 375 VAL A CG2   1 
ATOM   1986 N N     . SER A 1 285 ? 30.601 20.815  13.306  1.00 46.53  ? 376 SER A N     1 
ATOM   1987 C CA    . SER A 1 285 ? 30.407 20.348  14.677  1.00 44.30  ? 376 SER A CA    1 
ATOM   1988 C C     . SER A 1 285 ? 29.077 19.512  14.745  1.00 42.47  ? 376 SER A C     1 
ATOM   1989 O O     . SER A 1 285 ? 28.567 18.998  13.745  1.00 38.34  ? 376 SER A O     1 
ATOM   1990 C CB    . SER A 1 285 ? 30.299 21.485  15.658  1.00 45.98  ? 376 SER A CB    1 
ATOM   1991 O OG    . SER A 1 285 ? 29.119 22.243  15.449  1.00 46.63  ? 376 SER A OG    1 
ATOM   1992 N N     . ALA B 1 18  ? 44.458 92.806  28.689  1.00 59.04  ? 509 ALA B N     1 
ATOM   1993 C CA    . ALA B 1 18  ? 45.684 92.047  28.882  1.00 58.59  ? 509 ALA B CA    1 
ATOM   1994 C C     . ALA B 1 18  ? 45.908 91.088  27.721  1.00 57.93  ? 509 ALA B C     1 
ATOM   1995 O O     . ALA B 1 18  ? 44.971 90.495  27.204  1.00 56.80  ? 509 ALA B O     1 
ATOM   1996 C CB    . ALA B 1 18  ? 45.614 91.273  30.204  1.00 58.53  ? 509 ALA B CB    1 
ATOM   1997 N N     . SER B 1 19  ? 47.160 90.962  27.303  1.00 59.02  ? 510 SER B N     1 
ATOM   1998 C CA    . SER B 1 19  ? 47.530 90.062  26.215  1.00 58.90  ? 510 SER B CA    1 
ATOM   1999 C C     . SER B 1 19  ? 46.770 90.288  24.904  1.00 57.93  ? 510 SER B C     1 
ATOM   2000 O O     . SER B 1 19  ? 46.046 91.271  24.742  1.00 56.99  ? 510 SER B O     1 
ATOM   2001 C CB    . SER B 1 19  ? 47.620 88.642  26.762  1.00 59.83  ? 510 SER B CB    1 
ATOM   2002 O OG    . SER B 1 19  ? 48.135 88.655  28.086  1.00 60.66  ? 510 SER B OG    1 
ATOM   2003 N N     . TYR B 1 20  ? 46.960 89.362  23.970  1.00 57.40  ? 511 TYR B N     1 
ATOM   2004 C CA    . TYR B 1 20  ? 46.319 89.408  22.652  1.00 58.14  ? 511 TYR B CA    1 
ATOM   2005 C C     . TYR B 1 20  ? 47.197 88.862  21.542  1.00 57.64  ? 511 TYR B C     1 
ATOM   2006 O O     . TYR B 1 20  ? 48.403 89.080  21.568  1.00 58.41  ? 511 TYR B O     1 
ATOM   2007 C CB    . TYR B 1 20  ? 45.791 90.762  22.240  1.00 58.20  ? 511 TYR B CB    1 
ATOM   2008 C CG    . TYR B 1 20  ? 45.820 90.920  20.740  1.00 56.98  ? 511 TYR B CG    1 
ATOM   2009 C CD1   . TYR B 1 20  ? 44.883 90.286  19.937  1.00 52.86  ? 511 TYR B CD1   1 
ATOM   2010 C CD2   . TYR B 1 20  ? 46.851 91.632  20.123  1.00 57.28  ? 511 TYR B CD2   1 
ATOM   2011 C CE1   . TYR B 1 20  ? 44.976 90.349  18.566  1.00 53.86  ? 511 TYR B CE1   1 
ATOM   2012 C CE2   . TYR B 1 20  ? 46.948 91.700  18.749  1.00 56.39  ? 511 TYR B CE2   1 
ATOM   2013 C CZ    . TYR B 1 20  ? 46.010 91.055  17.978  1.00 54.22  ? 511 TYR B CZ    1 
ATOM   2014 O OH    . TYR B 1 20  ? 46.119 91.115  16.614  1.00 55.98  ? 511 TYR B OH    1 
ATOM   2015 N N     . VAL B 1 21  ? 46.609 88.208  20.544  1.00 56.29  ? 512 VAL B N     1 
ATOM   2016 C CA    . VAL B 1 21  ? 47.407 87.661  19.461  1.00 56.23  ? 512 VAL B CA    1 
ATOM   2017 C C     . VAL B 1 21  ? 46.627 86.857  18.413  1.00 56.30  ? 512 VAL B C     1 
ATOM   2018 O O     . VAL B 1 21  ? 46.134 85.766  18.705  1.00 56.45  ? 512 VAL B O     1 
ATOM   2019 C CB    . VAL B 1 21  ? 48.487 86.793  20.054  1.00 58.40  ? 512 VAL B CB    1 
ATOM   2020 N N     . ARG B 1 22  ? 46.545 87.387  17.191  1.00 54.93  ? 513 ARG B N     1 
ATOM   2021 C CA    . ARG B 1 22  ? 45.853 86.722  16.091  1.00 53.54  ? 513 ARG B CA    1 
ATOM   2022 C C     . ARG B 1 22  ? 45.549 87.705  14.975  1.00 53.99  ? 513 ARG B C     1 
ATOM   2023 O O     . ARG B 1 22  ? 44.503 88.344  14.970  1.00 56.06  ? 513 ARG B O     1 
ATOM   2024 C CB    . ARG B 1 22  ? 44.571 86.096  16.583  1.00 52.46  ? 513 ARG B CB    1 
ATOM   2025 N N     . LYS B 1 23  ? 46.458 87.839  14.023  1.00 53.32  ? 514 LYS B N     1 
ATOM   2026 C CA    . LYS B 1 23  ? 46.224 88.758  12.917  1.00 53.24  ? 514 LYS B CA    1 
ATOM   2027 C C     . LYS B 1 23  ? 45.626 87.965  11.759  1.00 54.03  ? 514 LYS B C     1 
ATOM   2028 O O     . LYS B 1 23  ? 45.641 88.401  10.599  1.00 55.08  ? 514 LYS B O     1 
ATOM   2029 C CB    . LYS B 1 23  ? 47.529 89.437  12.512  1.00 51.50  ? 514 LYS B CB    1 
ATOM   2030 C CG    . LYS B 1 23  ? 47.458 90.951  12.453  1.00 49.48  ? 514 LYS B CG    1 
ATOM   2031 C CD    . LYS B 1 23  ? 46.940 91.466  11.121  1.00 46.29  ? 514 LYS B CD    1 
ATOM   2032 C CE    . LYS B 1 23  ? 47.185 92.962  11.014  1.00 42.97  ? 514 LYS B CE    1 
ATOM   2033 N NZ    . LYS B 1 23  ? 46.857 93.515  9.678   1.00 41.75  ? 514 LYS B NZ    1 
ATOM   2034 N N     . VAL B 1 24  ? 45.095 86.797  12.102  1.00 51.88  ? 515 VAL B N     1 
ATOM   2035 C CA    . VAL B 1 24  ? 44.486 85.894  11.142  1.00 50.36  ? 515 VAL B CA    1 
ATOM   2036 C C     . VAL B 1 24  ? 44.074 86.557  9.830   1.00 50.06  ? 515 VAL B C     1 
ATOM   2037 O O     . VAL B 1 24  ? 43.038 87.184  9.763   1.00 50.44  ? 515 VAL B O     1 
ATOM   2038 C CB    . VAL B 1 24  ? 43.296 85.200  11.754  1.00 49.97  ? 515 VAL B CB    1 
ATOM   2039 N N     . ILE B 1 25  ? 44.899 86.399  8.799   1.00 50.81  ? 516 ILE B N     1 
ATOM   2040 C CA    . ILE B 1 25  ? 44.626 86.944  7.477   1.00 51.11  ? 516 ILE B CA    1 
ATOM   2041 C C     . ILE B 1 25  ? 44.604 85.849  6.381   1.00 53.29  ? 516 ILE B C     1 
ATOM   2042 O O     . ILE B 1 25  ? 45.643 85.299  6.002   1.00 53.38  ? 516 ILE B O     1 
ATOM   2043 C CB    . ILE B 1 25  ? 45.660 87.994  7.098   1.00 49.68  ? 516 ILE B CB    1 
ATOM   2044 C CG1   . ILE B 1 25  ? 45.749 88.107  5.573   1.00 48.97  ? 516 ILE B CG1   1 
ATOM   2045 C CG2   . ILE B 1 25  ? 46.988 87.623  7.682   1.00 50.03  ? 516 ILE B CG2   1 
ATOM   2046 C CD1   . ILE B 1 25  ? 46.680 89.175  5.084   1.00 47.01  ? 516 ILE B CD1   1 
ATOM   2047 N N     . PRO B 1 26  ? 43.404 85.556  5.844   1.00 53.94  ? 517 PRO B N     1 
ATOM   2048 C CA    . PRO B 1 26  ? 42.972 84.607  4.815   1.00 53.00  ? 517 PRO B CA    1 
ATOM   2049 C C     . PRO B 1 26  ? 43.950 83.812  3.942   1.00 52.41  ? 517 PRO B C     1 
ATOM   2050 O O     . PRO B 1 26  ? 44.257 82.651  4.246   1.00 51.41  ? 517 PRO B O     1 
ATOM   2051 C CB    . PRO B 1 26  ? 42.034 85.454  3.985   1.00 53.84  ? 517 PRO B CB    1 
ATOM   2052 C CG    . PRO B 1 26  ? 41.269 86.155  5.053   1.00 54.65  ? 517 PRO B CG    1 
ATOM   2053 C CD    . PRO B 1 26  ? 42.319 86.528  6.097   1.00 54.66  ? 517 PRO B CD    1 
ATOM   2054 N N     . LYS B 1 27  ? 44.404 84.412  2.840   1.00 50.45  ? 518 LYS B N     1 
ATOM   2055 C CA    . LYS B 1 27  ? 45.307 83.709  1.906   1.00 49.21  ? 518 LYS B CA    1 
ATOM   2056 C C     . LYS B 1 27  ? 44.705 82.465  1.239   1.00 46.92  ? 518 LYS B C     1 
ATOM   2057 O O     . LYS B 1 27  ? 44.557 81.425  1.879   1.00 45.38  ? 518 LYS B O     1 
ATOM   2058 C CB    . LYS B 1 27  ? 46.587 83.211  2.618   1.00 47.31  ? 518 LYS B CB    1 
ATOM   2059 C CG    . LYS B 1 27  ? 47.654 84.277  2.833   1.00 40.26  ? 518 LYS B CG    1 
ATOM   2060 C CD    . LYS B 1 27  ? 48.796 83.779  3.695   1.00 39.33  ? 518 LYS B CD    1 
ATOM   2061 C CE    . LYS B 1 27  ? 48.687 84.225  5.159   1.00 36.73  ? 518 LYS B CE    1 
ATOM   2062 N NZ    . LYS B 1 27  ? 47.622 83.541  5.936   1.00 34.39  ? 518 LYS B NZ    1 
ATOM   2063 N N     . ASP B 1 28  ? 44.354 82.587  -0.039  1.00 45.23  ? 519 ASP B N     1 
ATOM   2064 C CA    . ASP B 1 28  ? 43.743 81.491  -0.777  1.00 42.81  ? 519 ASP B CA    1 
ATOM   2065 C C     . ASP B 1 28  ? 44.371 80.110  -0.519  1.00 42.44  ? 519 ASP B C     1 
ATOM   2066 O O     . ASP B 1 28  ? 44.560 79.690  0.609   1.00 42.41  ? 519 ASP B O     1 
ATOM   2067 C CB    . ASP B 1 28  ? 43.596 81.795  -2.215  1.00 43.66  ? 519 ASP B CB    1 
ATOM   2068 C CG    . ASP B 1 28  ? 44.931 81.757  -2.930  1.00 45.53  ? 519 ASP B CG    1 
ATOM   2069 O OD1   . ASP B 1 28  ? 45.978 81.675  -2.254  1.00 46.01  ? 519 ASP B OD1   1 
ATOM   2070 O OD2   . ASP B 1 28  ? 44.932 81.813  -4.181  1.00 46.28  ? 519 ASP B OD2   1 
ATOM   2071 N N     . TYR B 1 29  ? 44.729 79.422  -1.596  1.00 41.71  ? 520 TYR B N     1 
ATOM   2072 C CA    . TYR B 1 29  ? 45.348 78.142  -1.479  1.00 40.19  ? 520 TYR B CA    1 
ATOM   2073 C C     . TYR B 1 29  ? 46.768 78.110  -1.998  1.00 38.56  ? 520 TYR B C     1 
ATOM   2074 O O     . TYR B 1 29  ? 47.668 77.569  -1.361  1.00 38.33  ? 520 TYR B O     1 
ATOM   2075 C CB    . TYR B 1 29  ? 44.567 77.035  -2.192  1.00 41.48  ? 520 TYR B CB    1 
ATOM   2076 C CG    . TYR B 1 29  ? 45.350 75.757  -2.312  1.00 42.01  ? 520 TYR B CG    1 
ATOM   2077 C CD1   . TYR B 1 29  ? 45.632 74.991  -1.190  1.00 42.05  ? 520 TYR B CD1   1 
ATOM   2078 C CD2   . TYR B 1 29  ? 45.933 75.387  -3.526  1.00 44.11  ? 520 TYR B CD2   1 
ATOM   2079 C CE1   . TYR B 1 29  ? 46.489 73.901  -1.264  1.00 43.26  ? 520 TYR B CE1   1 
ATOM   2080 C CE2   . TYR B 1 29  ? 46.794 74.291  -3.616  1.00 43.12  ? 520 TYR B CE2   1 
ATOM   2081 C CZ    . TYR B 1 29  ? 47.073 73.562  -2.478  1.00 44.42  ? 520 TYR B CZ    1 
ATOM   2082 O OH    . TYR B 1 29  ? 47.993 72.538  -2.527  1.00 47.25  ? 520 TYR B OH    1 
ATOM   2083 N N     . LYS B 1 30  ? 46.968 78.669  -3.180  1.00 37.42  ? 521 LYS B N     1 
ATOM   2084 C CA    . LYS B 1 30  ? 48.289 78.685  -3.765  1.00 35.73  ? 521 LYS B CA    1 
ATOM   2085 C C     . LYS B 1 30  ? 49.195 79.597  -2.951  1.00 34.96  ? 521 LYS B C     1 
ATOM   2086 O O     . LYS B 1 30  ? 50.424 79.413  -2.924  1.00 32.78  ? 521 LYS B O     1 
ATOM   2087 C CB    . LYS B 1 30  ? 48.211 79.170  -5.220  1.00 33.97  ? 521 LYS B CB    1 
ATOM   2088 C CG    . LYS B 1 30  ? 49.053 78.319  -6.141  1.00 35.72  ? 521 LYS B CG    1 
ATOM   2089 C CD    . LYS B 1 30  ? 48.801 76.830  -5.869  1.00 36.10  ? 521 LYS B CD    1 
ATOM   2090 C CE    . LYS B 1 30  ? 50.015 75.950  -6.220  1.00 37.34  ? 521 LYS B CE    1 
ATOM   2091 N NZ    . LYS B 1 30  ? 51.206 76.168  -5.338  1.00 33.44  ? 521 LYS B NZ    1 
ATOM   2092 N N     . THR B 1 31  ? 48.584 80.557  -2.257  1.00 33.75  ? 522 THR B N     1 
ATOM   2093 C CA    . THR B 1 31  ? 49.368 81.470  -1.441  1.00 33.83  ? 522 THR B CA    1 
ATOM   2094 C C     . THR B 1 31  ? 49.663 80.876  -0.067  1.00 33.90  ? 522 THR B C     1 
ATOM   2095 O O     . THR B 1 31  ? 50.481 81.408  0.685   1.00 35.74  ? 522 THR B O     1 
ATOM   2096 C CB    . THR B 1 31  ? 48.687 82.864  -1.297  1.00 33.93  ? 522 THR B CB    1 
ATOM   2097 O OG1   . THR B 1 31  ? 47.445 82.743  -0.583  1.00 37.11  ? 522 THR B OG1   1 
ATOM   2098 C CG2   . THR B 1 31  ? 48.446 83.470  -2.667  1.00 30.40  ? 522 THR B CG2   1 
ATOM   2099 N N     . MET B 1 32  ? 49.003 79.774  0.274   1.00 32.11  ? 523 MET B N     1 
ATOM   2100 C CA    . MET B 1 32  ? 49.271 79.137  1.551   1.00 29.27  ? 523 MET B CA    1 
ATOM   2101 C C     . MET B 1 32  ? 50.381 78.150  1.251   1.00 30.58  ? 523 MET B C     1 
ATOM   2102 O O     . MET B 1 32  ? 51.230 77.856  2.086   1.00 29.77  ? 523 MET B O     1 
ATOM   2103 C CB    . MET B 1 32  ? 48.062 78.379  2.039   1.00 27.06  ? 523 MET B CB    1 
ATOM   2104 C CG    . MET B 1 32  ? 48.196 77.956  3.450   1.00 25.61  ? 523 MET B CG    1 
ATOM   2105 S SD    . MET B 1 32  ? 47.866 79.346  4.470   1.00 28.21  ? 523 MET B SD    1 
ATOM   2106 C CE    . MET B 1 32  ? 47.125 78.569  5.886   1.00 25.16  ? 523 MET B CE    1 
ATOM   2107 N N     . ALA B 1 33  ? 50.354 77.634  0.029   1.00 31.89  ? 524 ALA B N     1 
ATOM   2108 C CA    . ALA B 1 33  ? 51.351 76.677  -0.422  1.00 32.49  ? 524 ALA B CA    1 
ATOM   2109 C C     . ALA B 1 33  ? 52.666 77.419  -0.606  1.00 33.35  ? 524 ALA B C     1 
ATOM   2110 O O     . ALA B 1 33  ? 53.736 76.887  -0.307  1.00 33.65  ? 524 ALA B O     1 
ATOM   2111 C CB    . ALA B 1 33  ? 50.907 76.038  -1.744  1.00 29.78  ? 524 ALA B CB    1 
ATOM   2112 N N     . ALA B 1 34  ? 52.571 78.655  -1.101  1.00 33.11  ? 525 ALA B N     1 
ATOM   2113 C CA    . ALA B 1 34  ? 53.743 79.484  -1.333  1.00 31.37  ? 525 ALA B CA    1 
ATOM   2114 C C     . ALA B 1 34  ? 54.309 79.957  -0.010  1.00 31.59  ? 525 ALA B C     1 
ATOM   2115 O O     . ALA B 1 34  ? 55.521 80.117  0.135   1.00 32.24  ? 525 ALA B O     1 
ATOM   2116 C CB    . ALA B 1 34  ? 53.378 80.668  -2.180  1.00 32.11  ? 525 ALA B CB    1 
ATOM   2117 N N     . LEU B 1 35  ? 53.434 80.197  0.953   1.00 29.25  ? 526 LEU B N     1 
ATOM   2118 C CA    . LEU B 1 35  ? 53.900 80.646  2.252   1.00 29.49  ? 526 LEU B CA    1 
ATOM   2119 C C     . LEU B 1 35  ? 54.632 79.505  2.955   1.00 31.08  ? 526 LEU B C     1 
ATOM   2120 O O     . LEU B 1 35  ? 55.763 79.663  3.424   1.00 32.22  ? 526 LEU B O     1 
ATOM   2121 C CB    . LEU B 1 35  ? 52.722 81.120  3.119   1.00 25.20  ? 526 LEU B CB    1 
ATOM   2122 C CG    . LEU B 1 35  ? 53.082 81.412  4.576   1.00 21.36  ? 526 LEU B CG    1 
ATOM   2123 C CD1   . LEU B 1 35  ? 54.154 82.474  4.592   1.00 20.97  ? 526 LEU B CD1   1 
ATOM   2124 C CD2   . LEU B 1 35  ? 51.867 81.845  5.374   1.00 19.72  ? 526 LEU B CD2   1 
ATOM   2125 N N     . ALA B 1 36  ? 53.974 78.355  3.036   1.00 32.34  ? 527 ALA B N     1 
ATOM   2126 C CA    . ALA B 1 36  ? 54.556 77.198  3.694   1.00 33.32  ? 527 ALA B CA    1 
ATOM   2127 C C     . ALA B 1 36  ? 55.863 76.770  3.028   1.00 33.58  ? 527 ALA B C     1 
ATOM   2128 O O     . ALA B 1 36  ? 56.797 76.348  3.703   1.00 34.61  ? 527 ALA B O     1 
ATOM   2129 C CB    . ALA B 1 36  ? 53.569 76.057  3.696   1.00 31.93  ? 527 ALA B CB    1 
ATOM   2130 N N     . LYS B 1 37  ? 55.943 76.878  1.710   1.00 33.30  ? 528 LYS B N     1 
ATOM   2131 C CA    . LYS B 1 37  ? 57.171 76.485  1.034   1.00 33.11  ? 528 LYS B CA    1 
ATOM   2132 C C     . LYS B 1 37  ? 58.288 77.401  1.521   1.00 31.75  ? 528 LYS B C     1 
ATOM   2133 O O     . LYS B 1 37  ? 59.384 76.947  1.840   1.00 34.02  ? 528 LYS B O     1 
ATOM   2134 C CB    . LYS B 1 37  ? 57.017 76.592  -0.490  1.00 33.47  ? 528 LYS B CB    1 
ATOM   2135 C CG    . LYS B 1 37  ? 58.134 75.905  -1.294  1.00 34.51  ? 528 LYS B CG    1 
ATOM   2136 C CD    . LYS B 1 37  ? 57.989 76.193  -2.793  1.00 36.38  ? 528 LYS B CD    1 
ATOM   2137 C CE    . LYS B 1 37  ? 59.136 75.622  -3.616  1.00 36.44  ? 528 LYS B CE    1 
ATOM   2138 N NZ    . LYS B 1 37  ? 59.047 75.996  -5.064  1.00 35.13  ? 528 LYS B NZ    1 
ATOM   2139 N N     . ALA B 1 38  ? 57.991 78.690  1.592   1.00 29.81  ? 529 ALA B N     1 
ATOM   2140 C CA    . ALA B 1 38  ? 58.946 79.685  2.050   1.00 27.46  ? 529 ALA B CA    1 
ATOM   2141 C C     . ALA B 1 38  ? 59.286 79.486  3.520   1.00 27.52  ? 529 ALA B C     1 
ATOM   2142 O O     . ALA B 1 38  ? 60.444 79.527  3.907   1.00 26.13  ? 529 ALA B O     1 
ATOM   2143 C CB    . ALA B 1 38  ? 58.380 81.068  1.839   1.00 27.58  ? 529 ALA B CB    1 
ATOM   2144 N N     . ILE B 1 39  ? 58.274 79.288  4.352   1.00 28.94  ? 530 ILE B N     1 
ATOM   2145 C CA    . ILE B 1 39  ? 58.546 79.084  5.758   1.00 30.27  ? 530 ILE B CA    1 
ATOM   2146 C C     . ILE B 1 39  ? 59.462 77.881  5.955   1.00 33.00  ? 530 ILE B C     1 
ATOM   2147 O O     . ILE B 1 39  ? 60.480 77.967  6.638   1.00 35.22  ? 530 ILE B O     1 
ATOM   2148 C CB    . ILE B 1 39  ? 57.248 78.903  6.548   1.00 28.78  ? 530 ILE B CB    1 
ATOM   2149 C CG1   . ILE B 1 39  ? 56.710 80.280  6.927   1.00 26.64  ? 530 ILE B CG1   1 
ATOM   2150 C CG2   . ILE B 1 39  ? 57.475 78.039  7.789   1.00 24.48  ? 530 ILE B CG2   1 
ATOM   2151 C CD1   . ILE B 1 39  ? 55.516 80.224  7.868   1.00 29.12  ? 530 ILE B CD1   1 
ATOM   2152 N N     . GLU B 1 40  ? 59.114 76.764  5.335   1.00 35.32  ? 531 GLU B N     1 
ATOM   2153 C CA    . GLU B 1 40  ? 59.907 75.554  5.459   1.00 35.85  ? 531 GLU B CA    1 
ATOM   2154 C C     . GLU B 1 40  ? 61.377 75.706  5.094   1.00 35.42  ? 531 GLU B C     1 
ATOM   2155 O O     . GLU B 1 40  ? 62.200 74.892  5.504   1.00 35.48  ? 531 GLU B O     1 
ATOM   2156 C CB    . GLU B 1 40  ? 59.280 74.442  4.632   1.00 37.15  ? 531 GLU B CB    1 
ATOM   2157 C CG    . GLU B 1 40  ? 58.755 73.312  5.504   1.00 45.46  ? 531 GLU B CG    1 
ATOM   2158 C CD    . GLU B 1 40  ? 58.413 73.765  6.943   1.00 50.26  ? 531 GLU B CD    1 
ATOM   2159 O OE1   . GLU B 1 40  ? 57.548 74.664  7.116   1.00 52.43  ? 531 GLU B OE1   1 
ATOM   2160 O OE2   . GLU B 1 40  ? 59.012 73.213  7.904   1.00 51.60  ? 531 GLU B OE2   1 
ATOM   2161 N N     . LYS B 1 41  ? 61.728 76.746  4.351   1.00 34.94  ? 532 LYS B N     1 
ATOM   2162 C CA    . LYS B 1 41  ? 63.127 76.910  3.973   1.00 34.94  ? 532 LYS B CA    1 
ATOM   2163 C C     . LYS B 1 41  ? 63.867 78.014  4.737   1.00 35.42  ? 532 LYS B C     1 
ATOM   2164 O O     . LYS B 1 41  ? 65.065 78.220  4.530   1.00 36.71  ? 532 LYS B O     1 
ATOM   2165 C CB    . LYS B 1 41  ? 63.249 77.133  2.455   1.00 32.91  ? 532 LYS B CB    1 
ATOM   2166 C CG    . LYS B 1 41  ? 62.985 78.545  1.950   1.00 31.91  ? 532 LYS B CG    1 
ATOM   2167 C CD    . LYS B 1 41  ? 63.125 78.590  0.431   1.00 34.30  ? 532 LYS B CD    1 
ATOM   2168 C CE    . LYS B 1 41  ? 63.389 80.001  -0.118  1.00 36.34  ? 532 LYS B CE    1 
ATOM   2169 N NZ    . LYS B 1 41  ? 63.558 80.043  -1.621  1.00 35.48  ? 532 LYS B NZ    1 
ATOM   2170 N N     . ASN B 1 42  ? 63.177 78.688  5.649   1.00 34.58  ? 533 ASN B N     1 
ATOM   2171 C CA    . ASN B 1 42  ? 63.801 79.769  6.401   1.00 36.68  ? 533 ASN B CA    1 
ATOM   2172 C C     . ASN B 1 42  ? 64.087 79.385  7.859   1.00 36.65  ? 533 ASN B C     1 
ATOM   2173 O O     . ASN B 1 42  ? 63.173 79.208  8.656   1.00 39.02  ? 533 ASN B O     1 
ATOM   2174 C CB    . ASN B 1 42  ? 62.895 81.007  6.341   1.00 38.09  ? 533 ASN B CB    1 
ATOM   2175 C CG    . ASN B 1 42  ? 63.641 82.301  6.612   1.00 38.61  ? 533 ASN B CG    1 
ATOM   2176 O OD1   . ASN B 1 42  ? 63.991 82.608  7.749   1.00 39.30  ? 533 ASN B OD1   1 
ATOM   2177 N ND2   . ASN B 1 42  ? 63.889 83.065  5.557   1.00 38.62  ? 533 ASN B ND2   1 
ATOM   2178 N N     . VAL B 1 43  ? 65.364 79.263  8.202   1.00 36.02  ? 534 VAL B N     1 
ATOM   2179 C CA    . VAL B 1 43  ? 65.767 78.901  9.555   1.00 35.17  ? 534 VAL B CA    1 
ATOM   2180 C C     . VAL B 1 43  ? 65.130 79.802  10.595  1.00 36.12  ? 534 VAL B C     1 
ATOM   2181 O O     . VAL B 1 43  ? 64.886 79.377  11.716  1.00 37.74  ? 534 VAL B O     1 
ATOM   2182 C CB    . VAL B 1 43  ? 67.312 78.958  9.728   1.00 34.36  ? 534 VAL B CB    1 
ATOM   2183 C CG1   . VAL B 1 43  ? 67.675 78.996  11.203  1.00 31.99  ? 534 VAL B CG1   1 
ATOM   2184 C CG2   . VAL B 1 43  ? 67.961 77.737  9.066   1.00 35.43  ? 534 VAL B CG2   1 
ATOM   2185 N N     . LEU B 1 44  ? 64.864 81.046  10.234  1.00 36.02  ? 535 LEU B N     1 
ATOM   2186 C CA    . LEU B 1 44  ? 64.262 81.966  11.178  1.00 37.44  ? 535 LEU B CA    1 
ATOM   2187 C C     . LEU B 1 44  ? 62.956 81.412  11.743  1.00 38.93  ? 535 LEU B C     1 
ATOM   2188 O O     . LEU B 1 44  ? 62.498 81.837  12.810  1.00 38.69  ? 535 LEU B O     1 
ATOM   2189 C CB    . LEU B 1 44  ? 63.999 83.309  10.499  1.00 38.71  ? 535 LEU B CB    1 
ATOM   2190 C CG    . LEU B 1 44  ? 65.221 84.172  10.168  1.00 39.02  ? 535 LEU B CG    1 
ATOM   2191 C CD1   . LEU B 1 44  ? 64.776 85.389  9.364   1.00 39.46  ? 535 LEU B CD1   1 
ATOM   2192 C CD2   . LEU B 1 44  ? 65.911 84.603  11.450  1.00 37.81  ? 535 LEU B CD2   1 
ATOM   2193 N N     . PHE B 1 45  ? 62.368 80.456  11.026  1.00 39.59  ? 536 PHE B N     1 
ATOM   2194 C CA    . PHE B 1 45  ? 61.101 79.853  11.421  1.00 39.87  ? 536 PHE B CA    1 
ATOM   2195 C C     . PHE B 1 45  ? 61.267 78.468  12.033  1.00 42.57  ? 536 PHE B C     1 
ATOM   2196 O O     . PHE B 1 45  ? 60.287 77.853  12.457  1.00 43.93  ? 536 PHE B O     1 
ATOM   2197 C CB    . PHE B 1 45  ? 60.164 79.791  10.204  1.00 37.48  ? 536 PHE B CB    1 
ATOM   2198 C CG    . PHE B 1 45  ? 59.708 81.147  9.715   1.00 35.43  ? 536 PHE B CG    1 
ATOM   2199 C CD1   . PHE B 1 45  ? 58.801 81.900  10.451  1.00 33.21  ? 536 PHE B CD1   1 
ATOM   2200 C CD2   . PHE B 1 45  ? 60.220 81.689  8.546   1.00 34.84  ? 536 PHE B CD2   1 
ATOM   2201 C CE1   . PHE B 1 45  ? 58.424 83.154  10.035  1.00 32.01  ? 536 PHE B CE1   1 
ATOM   2202 C CE2   . PHE B 1 45  ? 59.836 82.962  8.123   1.00 33.02  ? 536 PHE B CE2   1 
ATOM   2203 C CZ    . PHE B 1 45  ? 58.940 83.690  8.872   1.00 31.55  ? 536 PHE B CZ    1 
ATOM   2204 N N     . SER B 1 46  ? 62.508 77.985  12.084  1.00 44.60  ? 537 SER B N     1 
ATOM   2205 C CA    . SER B 1 46  ? 62.823 76.669  12.651  1.00 45.90  ? 537 SER B CA    1 
ATOM   2206 C C     . SER B 1 46  ? 62.515 76.588  14.133  1.00 47.53  ? 537 SER B C     1 
ATOM   2207 O O     . SER B 1 46  ? 62.401 75.500  14.689  1.00 47.25  ? 537 SER B O     1 
ATOM   2208 C CB    . SER B 1 46  ? 64.309 76.342  12.477  1.00 45.17  ? 537 SER B CB    1 
ATOM   2209 O OG    . SER B 1 46  ? 64.660 76.130  11.126  1.00 44.96  ? 537 SER B OG    1 
ATOM   2210 N N     . HIS B 1 47  ? 62.374 77.743  14.770  1.00 50.50  ? 538 HIS B N     1 
ATOM   2211 C CA    . HIS B 1 47  ? 62.149 77.784  16.202  1.00 52.95  ? 538 HIS B CA    1 
ATOM   2212 C C     . HIS B 1 47  ? 60.743 77.800  16.767  1.00 54.33  ? 538 HIS B C     1 
ATOM   2213 O O     . HIS B 1 47  ? 60.556 78.117  17.941  1.00 55.74  ? 538 HIS B O     1 
ATOM   2214 C CB    . HIS B 1 47  ? 63.028 78.879  16.794  1.00 53.53  ? 538 HIS B CB    1 
ATOM   2215 C CG    . HIS B 1 47  ? 64.482 78.676  16.514  1.00 57.06  ? 538 HIS B CG    1 
ATOM   2216 N ND1   . HIS B 1 47  ? 65.475 79.209  17.305  1.00 58.37  ? 538 HIS B ND1   1 
ATOM   2217 C CD2   . HIS B 1 47  ? 65.109 77.966  15.546  1.00 58.12  ? 538 HIS B CD2   1 
ATOM   2218 C CE1   . HIS B 1 47  ? 66.653 78.832  16.839  1.00 60.03  ? 538 HIS B CE1   1 
ATOM   2219 N NE2   . HIS B 1 47  ? 66.458 78.076  15.772  1.00 60.46  ? 538 HIS B NE2   1 
ATOM   2220 N N     . LEU B 1 48  ? 59.760 77.427  15.957  1.00 54.44  ? 539 LEU B N     1 
ATOM   2221 C CA    . LEU B 1 48  ? 58.379 77.435  16.423  1.00 55.34  ? 539 LEU B CA    1 
ATOM   2222 C C     . LEU B 1 48  ? 57.836 76.126  16.983  1.00 57.49  ? 539 LEU B C     1 
ATOM   2223 O O     . LEU B 1 48  ? 58.252 75.044  16.570  1.00 57.83  ? 539 LEU B O     1 
ATOM   2224 C CB    . LEU B 1 48  ? 57.531 77.854  15.194  1.00 51.98  ? 539 LEU B CB    1 
ATOM   2225 C CG    . LEU B 1 48  ? 57.999 79.008  14.296  1.00 49.69  ? 539 LEU B CG    1 
ATOM   2226 C CD1   . LEU B 1 48  ? 57.086 79.104  13.096  1.00 47.60  ? 539 LEU B CD1   1 
ATOM   2227 C CD2   . LEU B 1 48  ? 57.997 80.317  15.053  1.00 48.08  ? 539 LEU B CD2   1 
ATOM   2228 N N     . ASP B 1 49  ? 56.935 76.209  17.960  1.00 59.42  ? 540 ASP B N     1 
ATOM   2229 C CA    . ASP B 1 49  ? 56.335 74.987  18.489  1.00 61.51  ? 540 ASP B CA    1 
ATOM   2230 C C     . ASP B 1 49  ? 55.281 74.657  17.428  1.00 62.34  ? 540 ASP B C     1 
ATOM   2231 O O     . ASP B 1 49  ? 55.253 75.308  16.375  1.00 63.69  ? 540 ASP B O     1 
ATOM   2232 C CB    . ASP B 1 49  ? 55.685 75.219  19.869  1.00 61.96  ? 540 ASP B CB    1 
ATOM   2233 C CG    . ASP B 1 49  ? 54.998 76.581  19.991  1.00 63.49  ? 540 ASP B CG    1 
ATOM   2234 O OD1   . ASP B 1 49  ? 54.111 76.901  19.168  1.00 61.21  ? 540 ASP B OD1   1 
ATOM   2235 O OD2   . ASP B 1 49  ? 55.346 77.333  20.931  1.00 64.12  ? 540 ASP B OD2   1 
ATOM   2236 N N     . ASP B 1 50  ? 54.414 73.675  17.657  1.00 61.22  ? 541 ASP B N     1 
ATOM   2237 C CA    . ASP B 1 50  ? 53.430 73.399  16.619  1.00 60.01  ? 541 ASP B CA    1 
ATOM   2238 C C     . ASP B 1 50  ? 52.276 74.390  16.638  1.00 58.53  ? 541 ASP B C     1 
ATOM   2239 O O     . ASP B 1 50  ? 51.531 74.505  15.665  1.00 58.53  ? 541 ASP B O     1 
ATOM   2240 C CB    . ASP B 1 50  ? 52.880 71.983  16.728  1.00 59.79  ? 541 ASP B CB    1 
ATOM   2241 C CG    . ASP B 1 50  ? 52.667 71.358  15.370  1.00 59.57  ? 541 ASP B CG    1 
ATOM   2242 O OD1   . ASP B 1 50  ? 53.670 70.924  14.769  1.00 60.48  ? 541 ASP B OD1   1 
ATOM   2243 O OD2   . ASP B 1 50  ? 51.514 71.321  14.887  1.00 59.41  ? 541 ASP B OD2   1 
ATOM   2244 N N     . ASN B 1 51  ? 52.148 75.115  17.744  1.00 57.40  ? 542 ASN B N     1 
ATOM   2245 C CA    . ASN B 1 51  ? 51.084 76.100  17.917  1.00 55.10  ? 542 ASN B CA    1 
ATOM   2246 C C     . ASN B 1 51  ? 51.435 77.477  17.358  1.00 53.39  ? 542 ASN B C     1 
ATOM   2247 O O     . ASN B 1 51  ? 50.564 78.157  16.817  1.00 52.01  ? 542 ASN B O     1 
ATOM   2248 C CB    . ASN B 1 51  ? 50.720 76.211  19.400  1.00 55.64  ? 542 ASN B CB    1 
ATOM   2249 C CG    . ASN B 1 51  ? 50.304 74.881  19.991  1.00 56.36  ? 542 ASN B CG    1 
ATOM   2250 O OD1   . ASN B 1 51  ? 49.926 74.795  21.154  1.00 58.06  ? 542 ASN B OD1   1 
ATOM   2251 N ND2   . ASN B 1 51  ? 50.375 73.830  19.186  1.00 57.82  ? 542 ASN B ND2   1 
ATOM   2252 N N     . GLU B 1 52  ? 52.701 77.878  17.495  1.00 51.71  ? 543 GLU B N     1 
ATOM   2253 C CA    . GLU B 1 52  ? 53.192 79.165  16.982  1.00 49.99  ? 543 GLU B CA    1 
ATOM   2254 C C     . GLU B 1 52  ? 53.192 79.168  15.453  1.00 48.01  ? 543 GLU B C     1 
ATOM   2255 O O     . GLU B 1 52  ? 52.853 80.170  14.808  1.00 47.51  ? 543 GLU B O     1 
ATOM   2256 C CB    . GLU B 1 52  ? 54.630 79.412  17.430  1.00 50.60  ? 543 GLU B CB    1 
ATOM   2257 C CG    . GLU B 1 52  ? 54.845 79.543  18.909  1.00 51.83  ? 543 GLU B CG    1 
ATOM   2258 C CD    . GLU B 1 52  ? 56.319 79.628  19.246  1.00 51.44  ? 543 GLU B CD    1 
ATOM   2259 O OE1   . GLU B 1 52  ? 57.057 78.681  18.886  1.00 50.21  ? 543 GLU B OE1   1 
ATOM   2260 O OE2   . GLU B 1 52  ? 56.733 80.638  19.862  1.00 49.98  ? 543 GLU B OE2   1 
ATOM   2261 N N     . ARG B 1 53  ? 53.614 78.037  14.895  1.00 45.30  ? 544 ARG B N     1 
ATOM   2262 C CA    . ARG B 1 53  ? 53.693 77.842  13.464  1.00 43.36  ? 544 ARG B CA    1 
ATOM   2263 C C     . ARG B 1 53  ? 52.387 78.311  12.834  1.00 41.84  ? 544 ARG B C     1 
ATOM   2264 O O     . ARG B 1 53  ? 52.365 78.947  11.781  1.00 41.75  ? 544 ARG B O     1 
ATOM   2265 C CB    . ARG B 1 53  ? 53.922 76.358  13.201  1.00 45.62  ? 544 ARG B CB    1 
ATOM   2266 C CG    . ARG B 1 53  ? 54.097 75.958  11.752  1.00 49.39  ? 544 ARG B CG    1 
ATOM   2267 C CD    . ARG B 1 53  ? 53.669 74.520  11.595  1.00 53.65  ? 544 ARG B CD    1 
ATOM   2268 N NE    . ARG B 1 53  ? 52.303 74.376  12.092  1.00 60.27  ? 544 ARG B NE    1 
ATOM   2269 C CZ    . ARG B 1 53  ? 51.596 73.251  12.076  1.00 62.65  ? 544 ARG B CZ    1 
ATOM   2270 N NH1   . ARG B 1 53  ? 52.127 72.135  11.579  1.00 64.43  ? 544 ARG B NH1   1 
ATOM   2271 N NH2   . ARG B 1 53  ? 50.352 73.248  12.553  1.00 62.32  ? 544 ARG B NH2   1 
ATOM   2272 N N     . SER B 1 54  ? 51.297 78.004  13.519  1.00 40.46  ? 545 SER B N     1 
ATOM   2273 C CA    . SER B 1 54  ? 49.954 78.343  13.083  1.00 39.12  ? 545 SER B CA    1 
ATOM   2274 C C     . SER B 1 54  ? 49.633 79.837  13.082  1.00 38.34  ? 545 SER B C     1 
ATOM   2275 O O     . SER B 1 54  ? 48.954 80.339  12.170  1.00 34.33  ? 545 SER B O     1 
ATOM   2276 C CB    . SER B 1 54  ? 48.958 77.612  13.975  1.00 40.20  ? 545 SER B CB    1 
ATOM   2277 O OG    . SER B 1 54  ? 47.651 78.111  13.775  1.00 44.09  ? 545 SER B OG    1 
ATOM   2278 N N     . ASP B 1 55  ? 50.123 80.537  14.107  1.00 39.25  ? 546 ASP B N     1 
ATOM   2279 C CA    . ASP B 1 55  ? 49.879 81.973  14.266  1.00 39.12  ? 546 ASP B CA    1 
ATOM   2280 C C     . ASP B 1 55  ? 50.654 82.750  13.231  1.00 38.97  ? 546 ASP B C     1 
ATOM   2281 O O     . ASP B 1 55  ? 50.197 83.777  12.745  1.00 39.15  ? 546 ASP B O     1 
ATOM   2282 C CB    . ASP B 1 55  ? 50.298 82.450  15.654  1.00 40.79  ? 546 ASP B CB    1 
ATOM   2283 C CG    . ASP B 1 55  ? 49.971 81.441  16.751  1.00 44.64  ? 546 ASP B CG    1 
ATOM   2284 O OD1   . ASP B 1 55  ? 50.048 81.807  17.953  1.00 46.15  ? 546 ASP B OD1   1 
ATOM   2285 O OD2   . ASP B 1 55  ? 49.646 80.278  16.420  1.00 45.55  ? 546 ASP B OD2   1 
ATOM   2286 N N     . ILE B 1 56  ? 51.839 82.264  12.896  1.00 37.90  ? 547 ILE B N     1 
ATOM   2287 C CA    . ILE B 1 56  ? 52.639 82.954  11.910  1.00 38.17  ? 547 ILE B CA    1 
ATOM   2288 C C     . ILE B 1 56  ? 51.958 82.841  10.556  1.00 38.76  ? 547 ILE B C     1 
ATOM   2289 O O     . ILE B 1 56  ? 51.767 83.849  9.876   1.00 37.33  ? 547 ILE B O     1 
ATOM   2290 C CB    . ILE B 1 56  ? 54.056 82.363  11.840  1.00 38.77  ? 547 ILE B CB    1 
ATOM   2291 C CG1   . ILE B 1 56  ? 54.694 82.422  13.231  1.00 37.70  ? 547 ILE B CG1   1 
ATOM   2292 C CG2   . ILE B 1 56  ? 54.886 83.109  10.781  1.00 36.71  ? 547 ILE B CG2   1 
ATOM   2293 C CD1   . ILE B 1 56  ? 54.913 83.831  13.754  1.00 37.25  ? 547 ILE B CD1   1 
ATOM   2294 N N     . PHE B 1 57  ? 51.599 81.611  10.172  1.00 39.17  ? 548 PHE B N     1 
ATOM   2295 C CA    . PHE B 1 57  ? 50.912 81.358  8.903   1.00 38.54  ? 548 PHE B CA    1 
ATOM   2296 C C     . PHE B 1 57  ? 49.683 82.268  8.882   1.00 38.58  ? 548 PHE B C     1 
ATOM   2297 O O     . PHE B 1 57  ? 49.392 82.933  7.879   1.00 38.90  ? 548 PHE B O     1 
ATOM   2298 C CB    . PHE B 1 57  ? 50.444 79.899  8.827   1.00 38.77  ? 548 PHE B CB    1 
ATOM   2299 C CG    . PHE B 1 57  ? 51.375 78.982  8.090   1.00 37.65  ? 548 PHE B CG    1 
ATOM   2300 C CD1   . PHE B 1 57  ? 51.392 78.952  6.708   1.00 37.54  ? 548 PHE B CD1   1 
ATOM   2301 C CD2   . PHE B 1 57  ? 52.242 78.147  8.785   1.00 38.06  ? 548 PHE B CD2   1 
ATOM   2302 C CE1   . PHE B 1 57  ? 52.262 78.107  6.025   1.00 36.17  ? 548 PHE B CE1   1 
ATOM   2303 C CE2   . PHE B 1 57  ? 53.112 77.304  8.109   1.00 35.86  ? 548 PHE B CE2   1 
ATOM   2304 C CZ    . PHE B 1 57  ? 53.121 77.287  6.730   1.00 36.22  ? 548 PHE B CZ    1 
ATOM   2305 N N     . ASP B 1 58  ? 48.962 82.283  10.001  1.00 36.68  ? 549 ASP B N     1 
ATOM   2306 C CA    . ASP B 1 58  ? 47.770 83.109  10.115  1.00 37.35  ? 549 ASP B CA    1 
ATOM   2307 C C     . ASP B 1 58  ? 48.128 84.577  9.956   1.00 36.07  ? 549 ASP B C     1 
ATOM   2308 O O     . ASP B 1 58  ? 47.564 85.272  9.115   1.00 36.83  ? 549 ASP B O     1 
ATOM   2309 C CB    . ASP B 1 58  ? 47.085 82.882  11.476  1.00 38.22  ? 549 ASP B CB    1 
ATOM   2310 C CG    . ASP B 1 58  ? 45.986 81.808  11.428  1.00 36.92  ? 549 ASP B CG    1 
ATOM   2311 O OD1   . ASP B 1 58  ? 45.573 81.347  12.507  1.00 36.20  ? 549 ASP B OD1   1 
ATOM   2312 O OD2   . ASP B 1 58  ? 45.530 81.438  10.326  1.00 34.43  ? 549 ASP B OD2   1 
ATOM   2313 N N     . ALA B 1 59  ? 49.099 85.021  10.749  1.00 36.01  ? 550 ALA B N     1 
ATOM   2314 C CA    . ALA B 1 59  ? 49.576 86.413  10.773  1.00 33.52  ? 550 ALA B CA    1 
ATOM   2315 C C     . ALA B 1 59  ? 50.370 86.976  9.579   1.00 31.38  ? 550 ALA B C     1 
ATOM   2316 O O     . ALA B 1 59  ? 50.340 88.175  9.342   1.00 31.03  ? 550 ALA B O     1 
ATOM   2317 C CB    . ALA B 1 59  ? 50.373 86.629  12.038  1.00 32.75  ? 550 ALA B CB    1 
ATOM   2318 N N     . MET B 1 60  ? 51.089 86.147  8.834   1.00 30.31  ? 551 MET B N     1 
ATOM   2319 C CA    . MET B 1 60  ? 51.859 86.675  7.719   1.00 29.90  ? 551 MET B CA    1 
ATOM   2320 C C     . MET B 1 60  ? 50.934 87.121  6.619   1.00 32.10  ? 551 MET B C     1 
ATOM   2321 O O     . MET B 1 60  ? 49.730 86.919  6.715   1.00 35.34  ? 551 MET B O     1 
ATOM   2322 C CB    . MET B 1 60  ? 52.788 85.611  7.163   1.00 30.45  ? 551 MET B CB    1 
ATOM   2323 C CG    . MET B 1 60  ? 53.886 85.210  8.121   1.00 33.76  ? 551 MET B CG    1 
ATOM   2324 S SD    . MET B 1 60  ? 55.478 85.328  7.334   1.00 40.26  ? 551 MET B SD    1 
ATOM   2325 C CE    . MET B 1 60  ? 55.963 83.582  7.186   1.00 35.16  ? 551 MET B CE    1 
ATOM   2326 N N     . PHE B 1 61  ? 51.481 87.725  5.568   1.00 33.04  ? 552 PHE B N     1 
ATOM   2327 C CA    . PHE B 1 61  ? 50.651 88.191  4.467   1.00 32.62  ? 552 PHE B CA    1 
ATOM   2328 C C     . PHE B 1 61  ? 51.455 88.566  3.223   1.00 32.76  ? 552 PHE B C     1 
ATOM   2329 O O     . PHE B 1 61  ? 52.414 89.317  3.282   1.00 35.08  ? 552 PHE B O     1 
ATOM   2330 C CB    . PHE B 1 61  ? 49.880 89.414  4.951   1.00 33.83  ? 552 PHE B CB    1 
ATOM   2331 C CG    . PHE B 1 61  ? 50.724 90.617  5.259   1.00 32.27  ? 552 PHE B CG    1 
ATOM   2332 C CD1   . PHE B 1 61  ? 51.079 91.511  4.255   1.00 32.20  ? 552 PHE B CD1   1 
ATOM   2333 C CD2   . PHE B 1 61  ? 51.160 90.858  6.559   1.00 33.62  ? 552 PHE B CD2   1 
ATOM   2334 C CE1   . PHE B 1 61  ? 51.860 92.632  4.541   1.00 33.11  ? 552 PHE B CE1   1 
ATOM   2335 C CE2   . PHE B 1 61  ? 51.943 91.977  6.860   1.00 33.86  ? 552 PHE B CE2   1 
ATOM   2336 C CZ    . PHE B 1 61  ? 52.294 92.865  5.845   1.00 34.09  ? 552 PHE B CZ    1 
ATOM   2337 N N     . PRO B 1 62  ? 51.050 88.048  2.065   1.00 33.00  ? 553 PRO B N     1 
ATOM   2338 C CA    . PRO B 1 62  ? 51.787 88.377  0.839   1.00 33.75  ? 553 PRO B CA    1 
ATOM   2339 C C     . PRO B 1 62  ? 51.720 89.857  0.475   1.00 34.49  ? 553 PRO B C     1 
ATOM   2340 O O     . PRO B 1 62  ? 50.742 90.514  0.811   1.00 36.68  ? 553 PRO B O     1 
ATOM   2341 C CB    . PRO B 1 62  ? 51.106 87.495  -0.203  1.00 34.84  ? 553 PRO B CB    1 
ATOM   2342 C CG    . PRO B 1 62  ? 49.694 87.362  0.329   1.00 30.71  ? 553 PRO B CG    1 
ATOM   2343 C CD    . PRO B 1 62  ? 49.908 87.159  1.788   1.00 30.77  ? 553 PRO B CD    1 
ATOM   2344 N N     . VAL B 1 63  ? 52.766 90.377  -0.178  1.00 34.40  ? 554 VAL B N     1 
ATOM   2345 C CA    . VAL B 1 63  ? 52.824 91.779  -0.647  1.00 34.10  ? 554 VAL B CA    1 
ATOM   2346 C C     . VAL B 1 63  ? 53.753 91.921  -1.835  1.00 36.02  ? 554 VAL B C     1 
ATOM   2347 O O     . VAL B 1 63  ? 54.806 91.292  -1.890  1.00 35.28  ? 554 VAL B O     1 
ATOM   2348 C CB    . VAL B 1 63  ? 53.330 92.791  0.399   1.00 32.53  ? 554 VAL B CB    1 
ATOM   2349 C CG1   . VAL B 1 63  ? 52.343 92.916  1.536   1.00 32.96  ? 554 VAL B CG1   1 
ATOM   2350 C CG2   . VAL B 1 63  ? 54.690 92.392  0.882   1.00 34.26  ? 554 VAL B CG2   1 
ATOM   2351 N N     . SER B 1 64  ? 53.367 92.769  -2.781  1.00 39.10  ? 555 SER B N     1 
ATOM   2352 C CA    . SER B 1 64  ? 54.170 92.977  -3.976  1.00 41.03  ? 555 SER B CA    1 
ATOM   2353 C C     . SER B 1 64  ? 54.590 94.445  -4.128  1.00 41.30  ? 555 SER B C     1 
ATOM   2354 O O     . SER B 1 64  ? 53.905 95.351  -3.652  1.00 41.26  ? 555 SER B O     1 
ATOM   2355 C CB    . SER B 1 64  ? 53.381 92.507  -5.205  1.00 43.21  ? 555 SER B CB    1 
ATOM   2356 O OG    . SER B 1 64  ? 54.199 92.445  -6.368  1.00 46.02  ? 555 SER B OG    1 
ATOM   2357 N N     . PHE B 1 65  ? 55.728 94.668  -4.782  1.00 41.08  ? 556 PHE B N     1 
ATOM   2358 C CA    . PHE B 1 65  ? 56.249 96.016  -4.996  1.00 43.00  ? 556 PHE B CA    1 
ATOM   2359 C C     . PHE B 1 65  ? 57.000 96.052  -6.305  1.00 43.69  ? 556 PHE B C     1 
ATOM   2360 O O     . PHE B 1 65  ? 57.802 95.157  -6.585  1.00 46.94  ? 556 PHE B O     1 
ATOM   2361 C CB    . PHE B 1 65  ? 57.212 96.432  -3.864  1.00 42.74  ? 556 PHE B CB    1 
ATOM   2362 C CG    . PHE B 1 65  ? 56.523 96.748  -2.562  1.00 41.35  ? 556 PHE B CG    1 
ATOM   2363 C CD1   . PHE B 1 65  ? 56.323 95.758  -1.602  1.00 39.68  ? 556 PHE B CD1   1 
ATOM   2364 C CD2   . PHE B 1 65  ? 56.015 98.023  -2.326  1.00 40.40  ? 556 PHE B CD2   1 
ATOM   2365 C CE1   . PHE B 1 65  ? 55.621 96.034  -0.431  1.00 39.31  ? 556 PHE B CE1   1 
ATOM   2366 C CE2   . PHE B 1 65  ? 55.310 98.308  -1.156  1.00 40.24  ? 556 PHE B CE2   1 
ATOM   2367 C CZ    . PHE B 1 65  ? 55.112 97.311  -0.208  1.00 38.63  ? 556 PHE B CZ    1 
ATOM   2368 N N     . ILE B 1 66  ? 56.763 97.079  -7.110  1.00 42.11  ? 557 ILE B N     1 
ATOM   2369 C CA    . ILE B 1 66  ? 57.458 97.161  -8.378  1.00 42.43  ? 557 ILE B CA    1 
ATOM   2370 C C     . ILE B 1 66  ? 58.795 97.870  -8.166  1.00 42.15  ? 557 ILE B C     1 
ATOM   2371 O O     . ILE B 1 66  ? 58.914 98.712  -7.280  1.00 42.14  ? 557 ILE B O     1 
ATOM   2372 C CB    . ILE B 1 66  ? 56.613 97.906  -9.425  1.00 43.87  ? 557 ILE B CB    1 
ATOM   2373 C CG1   . ILE B 1 66  ? 56.922 99.402  -9.389  1.00 43.49  ? 557 ILE B CG1   1 
ATOM   2374 C CG2   . ILE B 1 66  ? 55.128 97.662  -9.153  1.00 42.75  ? 557 ILE B CG2   1 
ATOM   2375 C CD1   . ILE B 1 66  ? 56.529 100.109 -10.667 1.00 45.91  ? 557 ILE B CD1   1 
ATOM   2376 N N     . ALA B 1 67  ? 59.796 97.522  -8.969  1.00 40.00  ? 558 ALA B N     1 
ATOM   2377 C CA    . ALA B 1 67  ? 61.120 98.120  -8.841  1.00 41.09  ? 558 ALA B CA    1 
ATOM   2378 C C     . ALA B 1 67  ? 61.145 99.648  -8.710  1.00 43.10  ? 558 ALA B C     1 
ATOM   2379 O O     . ALA B 1 67  ? 60.453 100.363 -9.444  1.00 44.74  ? 558 ALA B O     1 
ATOM   2380 C CB    . ALA B 1 67  ? 61.978 97.752  -10.046 1.00 39.44  ? 558 ALA B CB    1 
ATOM   2381 N N     . GLY B 1 68  ? 61.958 100.140 -7.774  1.00 43.03  ? 559 GLY B N     1 
ATOM   2382 C CA    . GLY B 1 68  ? 62.067 101.568 -7.546  1.00 40.61  ? 559 GLY B CA    1 
ATOM   2383 C C     . GLY B 1 68  ? 61.080 101.980 -6.461  1.00 40.14  ? 559 GLY B C     1 
ATOM   2384 O O     . GLY B 1 68  ? 61.132 103.090 -5.923  1.00 39.80  ? 559 GLY B O     1 
ATOM   2385 N N     . GLU B 1 69  ? 60.176 101.076 -6.126  1.00 39.85  ? 560 GLU B N     1 
ATOM   2386 C CA    . GLU B 1 69  ? 59.187 101.377 -5.114  1.00 41.98  ? 560 GLU B CA    1 
ATOM   2387 C C     . GLU B 1 69  ? 59.746 101.145 -3.709  1.00 43.56  ? 560 GLU B C     1 
ATOM   2388 O O     . GLU B 1 69  ? 60.539 100.225 -3.488  1.00 44.37  ? 560 GLU B O     1 
ATOM   2389 C CB    . GLU B 1 69  ? 57.958 100.525 -5.362  1.00 42.12  ? 560 GLU B CB    1 
ATOM   2390 C CG    . GLU B 1 69  ? 56.739 100.977 -4.633  1.00 44.50  ? 560 GLU B CG    1 
ATOM   2391 C CD    . GLU B 1 69  ? 55.486 100.459 -5.283  1.00 45.54  ? 560 GLU B CD    1 
ATOM   2392 O OE1   . GLU B 1 69  ? 54.389 100.675 -4.729  1.00 47.96  ? 560 GLU B OE1   1 
ATOM   2393 O OE2   . GLU B 1 69  ? 55.600 99.838  -6.359  1.00 47.87  ? 560 GLU B OE2   1 
ATOM   2394 N N     . THR B 1 70  ? 59.331 101.991 -2.767  1.00 43.34  ? 561 THR B N     1 
ATOM   2395 C CA    . THR B 1 70  ? 59.790 101.917 -1.381  1.00 42.67  ? 561 THR B CA    1 
ATOM   2396 C C     . THR B 1 70  ? 58.837 101.176 -0.451  1.00 43.50  ? 561 THR B C     1 
ATOM   2397 O O     . THR B 1 70  ? 57.659 101.523 -0.347  1.00 44.64  ? 561 THR B O     1 
ATOM   2398 C CB    . THR B 1 70  ? 60.029 103.340 -0.799  1.00 42.11  ? 561 THR B CB    1 
ATOM   2399 O OG1   . THR B 1 70  ? 61.404 103.709 -0.971  1.00 41.16  ? 561 THR B OG1   1 
ATOM   2400 C CG2   . THR B 1 70  ? 59.648 103.399 0.673   1.00 37.58  ? 561 THR B CG2   1 
ATOM   2401 N N     . VAL B 1 71  ? 59.368 100.170 0.239   1.00 43.10  ? 562 VAL B N     1 
ATOM   2402 C CA    . VAL B 1 71  ? 58.591 99.379  1.179   1.00 42.25  ? 562 VAL B CA    1 
ATOM   2403 C C     . VAL B 1 71  ? 58.653 100.012 2.572   1.00 44.69  ? 562 VAL B C     1 
ATOM   2404 O O     . VAL B 1 71  ? 57.643 100.052 3.297   1.00 44.42  ? 562 VAL B O     1 
ATOM   2405 C CB    . VAL B 1 71  ? 59.141 97.945  1.270   1.00 40.88  ? 562 VAL B CB    1 
ATOM   2406 C CG1   . VAL B 1 71  ? 58.251 97.098  2.187   1.00 40.56  ? 562 VAL B CG1   1 
ATOM   2407 C CG2   . VAL B 1 71  ? 59.248 97.343  -0.116  1.00 38.05  ? 562 VAL B CG2   1 
ATOM   2408 N N     . ILE B 1 72  ? 59.845 100.491 2.941   1.00 45.80  ? 563 ILE B N     1 
ATOM   2409 C CA    . ILE B 1 72  ? 60.068 101.124 4.242   1.00 48.15  ? 563 ILE B CA    1 
ATOM   2410 C C     . ILE B 1 72  ? 60.949 102.382 4.116   1.00 49.71  ? 563 ILE B C     1 
ATOM   2411 O O     . ILE B 1 72  ? 62.069 102.326 3.582   1.00 49.24  ? 563 ILE B O     1 
ATOM   2412 C CB    . ILE B 1 72  ? 60.719 100.126 5.250   1.00 49.08  ? 563 ILE B CB    1 
ATOM   2413 C CG1   . ILE B 1 72  ? 60.602 100.684 6.671   1.00 49.84  ? 563 ILE B CG1   1 
ATOM   2414 C CG2   . ILE B 1 72  ? 62.186 99.872  4.902   1.00 48.70  ? 563 ILE B CG2   1 
ATOM   2415 C CD1   . ILE B 1 72  ? 59.165 100.740 7.209   1.00 47.84  ? 563 ILE B CD1   1 
ATOM   2416 N N     . GLN B 1 73  ? 60.433 103.510 4.616   1.00 50.09  ? 564 GLN B N     1 
ATOM   2417 C CA    . GLN B 1 73  ? 61.137 104.797 4.540   1.00 50.71  ? 564 GLN B CA    1 
ATOM   2418 C C     . GLN B 1 73  ? 61.975 105.108 5.780   1.00 50.46  ? 564 GLN B C     1 
ATOM   2419 O O     . GLN B 1 73  ? 61.469 105.083 6.905   1.00 51.85  ? 564 GLN B O     1 
ATOM   2420 C CB    . GLN B 1 73  ? 60.129 105.932 4.320   1.00 51.09  ? 564 GLN B CB    1 
ATOM   2421 C CG    . GLN B 1 73  ? 60.765 107.288 4.065   1.00 51.86  ? 564 GLN B CG    1 
ATOM   2422 C CD    . GLN B 1 73  ? 61.643 107.295 2.826   1.00 53.41  ? 564 GLN B CD    1 
ATOM   2423 O OE1   . GLN B 1 73  ? 61.167 107.119 1.704   1.00 54.67  ? 564 GLN B OE1   1 
ATOM   2424 N NE2   . GLN B 1 73  ? 62.934 107.501 3.025   1.00 55.35  ? 564 GLN B NE2   1 
ATOM   2425 N N     . GLN B 1 74  ? 63.248 105.428 5.558   1.00 48.13  ? 565 GLN B N     1 
ATOM   2426 C CA    . GLN B 1 74  ? 64.182 105.737 6.633   1.00 46.85  ? 565 GLN B CA    1 
ATOM   2427 C C     . GLN B 1 74  ? 63.690 106.679 7.708   1.00 46.54  ? 565 GLN B C     1 
ATOM   2428 O O     . GLN B 1 74  ? 63.074 107.698 7.422   1.00 46.26  ? 565 GLN B O     1 
ATOM   2429 C CB    . GLN B 1 74  ? 65.422 106.397 6.070   1.00 46.31  ? 565 GLN B CB    1 
ATOM   2430 C CG    . GLN B 1 74  ? 66.546 106.544 7.060   1.00 44.72  ? 565 GLN B CG    1 
ATOM   2431 C CD    . GLN B 1 74  ? 67.764 107.141 6.409   1.00 43.69  ? 565 GLN B CD    1 
ATOM   2432 O OE1   . GLN B 1 74  ? 68.833 107.211 7.005   1.00 43.74  ? 565 GLN B OE1   1 
ATOM   2433 N NE2   . GLN B 1 74  ? 67.606 107.576 5.166   1.00 42.79  ? 565 GLN B NE2   1 
ATOM   2434 N N     . GLY B 1 75  ? 63.994 106.340 8.952   1.00 46.67  ? 566 GLY B N     1 
ATOM   2435 C CA    . GLY B 1 75  ? 63.562 107.160 10.058  1.00 47.97  ? 566 GLY B CA    1 
ATOM   2436 C C     . GLY B 1 75  ? 62.026 107.230 10.007  1.00 48.67  ? 566 GLY B C     1 
ATOM   2437 O O     . GLY B 1 75  ? 61.446 108.140 9.412   1.00 49.31  ? 566 GLY B O     1 
ATOM   2438 N N     . ASP B 1 76  ? 61.382 106.256 10.637  1.00 49.47  ? 567 ASP B N     1 
ATOM   2439 C CA    . ASP B 1 76  ? 59.931 106.216 10.647  1.00 50.66  ? 567 ASP B CA    1 
ATOM   2440 C C     . ASP B 1 76  ? 59.470 105.175 11.652  1.00 50.93  ? 567 ASP B C     1 
ATOM   2441 O O     . ASP B 1 76  ? 60.258 104.336 12.076  1.00 51.70  ? 567 ASP B O     1 
ATOM   2442 C CB    . ASP B 1 76  ? 59.423 105.983 9.222   1.00 50.62  ? 567 ASP B CB    1 
ATOM   2443 C CG    . ASP B 1 76  ? 57.996 106.458 9.027   1.00 50.92  ? 567 ASP B CG    1 
ATOM   2444 O OD1   . ASP B 1 76  ? 57.547 106.519 7.859   1.00 51.11  ? 567 ASP B OD1   1 
ATOM   2445 O OD2   . ASP B 1 76  ? 57.329 106.768 10.040  1.00 50.60  ? 567 ASP B OD2   1 
ATOM   2446 N N     . GLU B 1 77  ? 58.196 105.241 12.029  1.00 51.60  ? 568 GLU B N     1 
ATOM   2447 C CA    . GLU B 1 77  ? 57.588 104.289 12.971  1.00 53.41  ? 568 GLU B CA    1 
ATOM   2448 C C     . GLU B 1 77  ? 57.587 102.905 12.339  1.00 52.99  ? 568 GLU B C     1 
ATOM   2449 O O     . GLU B 1 77  ? 57.155 102.707 11.192  1.00 53.77  ? 568 GLU B O     1 
ATOM   2450 C CB    . GLU B 1 77  ? 56.110 104.753 13.193  1.00 55.65  ? 568 GLU B CB    1 
ATOM   2451 C CG    . GLU B 1 77  ? 55.326 103.927 14.190  1.00 57.10  ? 568 GLU B CG    1 
ATOM   2452 C CD    . GLU B 1 77  ? 55.625 104.317 15.623  1.00 58.05  ? 568 GLU B CD    1 
ATOM   2453 O OE1   . GLU B 1 77  ? 54.757 104.064 16.495  1.00 58.31  ? 568 GLU B OE1   1 
ATOM   2454 O OE2   . GLU B 1 77  ? 56.723 104.868 15.870  1.00 56.71  ? 568 GLU B OE2   1 
ATOM   2455 N N     . GLY B 1 78  ? 58.072 101.924 13.096  1.00 51.97  ? 569 GLY B N     1 
ATOM   2456 C CA    . GLY B 1 78  ? 58.176 100.562 12.583  1.00 50.52  ? 569 GLY B CA    1 
ATOM   2457 C C     . GLY B 1 78  ? 56.913 99.722  12.451  1.00 49.43  ? 569 GLY B C     1 
ATOM   2458 O O     . GLY B 1 78  ? 56.209 99.484  13.437  1.00 49.21  ? 569 GLY B O     1 
ATOM   2459 N N     . ASP B 1 79  ? 56.649 99.232  11.239  1.00 47.82  ? 570 ASP B N     1 
ATOM   2460 C CA    . ASP B 1 79  ? 55.459 98.419  10.979  1.00 45.29  ? 570 ASP B CA    1 
ATOM   2461 C C     . ASP B 1 79  ? 55.601 96.877  10.914  1.00 43.61  ? 570 ASP B C     1 
ATOM   2462 O O     . ASP B 1 79  ? 55.138 96.162  11.811  1.00 42.28  ? 570 ASP B O     1 
ATOM   2463 C CB    . ASP B 1 79  ? 54.771 98.931  9.703   1.00 44.57  ? 570 ASP B CB    1 
ATOM   2464 C CG    . ASP B 1 79  ? 55.599 98.711  8.437   1.00 44.63  ? 570 ASP B CG    1 
ATOM   2465 O OD1   . ASP B 1 79  ? 55.156 99.184  7.377   1.00 45.59  ? 570 ASP B OD1   1 
ATOM   2466 O OD2   . ASP B 1 79  ? 56.670 98.073  8.471   1.00 44.33  ? 570 ASP B OD2   1 
ATOM   2467 N N     . ASN B 1 80  ? 56.240 96.368  9.864   1.00 42.56  ? 571 ASN B N     1 
ATOM   2468 C CA    . ASN B 1 80  ? 56.379 94.922  9.683   1.00 42.97  ? 571 ASN B CA    1 
ATOM   2469 C C     . ASN B 1 80  ? 57.797 94.399  9.437   1.00 43.05  ? 571 ASN B C     1 
ATOM   2470 O O     . ASN B 1 80  ? 58.725 95.159  9.134   1.00 45.04  ? 571 ASN B O     1 
ATOM   2471 C CB    . ASN B 1 80  ? 55.522 94.469  8.496   1.00 41.49  ? 571 ASN B CB    1 
ATOM   2472 C CG    . ASN B 1 80  ? 54.139 95.086  8.498   1.00 42.02  ? 571 ASN B CG    1 
ATOM   2473 O OD1   . ASN B 1 80  ? 53.379 94.947  9.463   1.00 41.03  ? 571 ASN B OD1   1 
ATOM   2474 N ND2   . ASN B 1 80  ? 53.799 95.767  7.406   1.00 38.78  ? 571 ASN B ND2   1 
ATOM   2475 N N     . PHE B 1 81  ? 57.943 93.084  9.569   1.00 40.42  ? 572 PHE B N     1 
ATOM   2476 C CA    . PHE B 1 81  ? 59.198 92.410  9.298   1.00 38.20  ? 572 PHE B CA    1 
ATOM   2477 C C     . PHE B 1 81  ? 58.944 91.843  7.899   1.00 37.96  ? 572 PHE B C     1 
ATOM   2478 O O     . PHE B 1 81  ? 57.852 91.367  7.621   1.00 39.77  ? 572 PHE B O     1 
ATOM   2479 C CB    . PHE B 1 81  ? 59.420 91.287  10.307  1.00 38.27  ? 572 PHE B CB    1 
ATOM   2480 C CG    . PHE B 1 81  ? 60.494 90.321  9.906   1.00 39.69  ? 572 PHE B CG    1 
ATOM   2481 C CD1   . PHE B 1 81  ? 60.307 88.953  10.057  1.00 39.56  ? 572 PHE B CD1   1 
ATOM   2482 C CD2   . PHE B 1 81  ? 61.686 90.776  9.349   1.00 38.99  ? 572 PHE B CD2   1 
ATOM   2483 C CE1   . PHE B 1 81  ? 61.290 88.055  9.657   1.00 40.79  ? 572 PHE B CE1   1 
ATOM   2484 C CE2   . PHE B 1 81  ? 62.671 89.889  8.947   1.00 37.84  ? 572 PHE B CE2   1 
ATOM   2485 C CZ    . PHE B 1 81  ? 62.476 88.526  9.100   1.00 39.96  ? 572 PHE B CZ    1 
ATOM   2486 N N     . TYR B 1 82  ? 59.924 91.897  7.011   1.00 37.23  ? 573 TYR B N     1 
ATOM   2487 C CA    . TYR B 1 82  ? 59.720 91.411  5.648   1.00 36.37  ? 573 TYR B CA    1 
ATOM   2488 C C     . TYR B 1 82  ? 60.669 90.316  5.203   1.00 34.98  ? 573 TYR B C     1 
ATOM   2489 O O     . TYR B 1 82  ? 61.871 90.442  5.350   1.00 36.06  ? 573 TYR B O     1 
ATOM   2490 C CB    . TYR B 1 82  ? 59.824 92.584  4.661   1.00 39.37  ? 573 TYR B CB    1 
ATOM   2491 C CG    . TYR B 1 82  ? 58.687 93.571  4.786   1.00 43.15  ? 573 TYR B CG    1 
ATOM   2492 C CD1   . TYR B 1 82  ? 57.542 93.461  3.986   1.00 44.18  ? 573 TYR B CD1   1 
ATOM   2493 C CD2   . TYR B 1 82  ? 58.700 94.546  5.778   1.00 44.29  ? 573 TYR B CD2   1 
ATOM   2494 C CE1   . TYR B 1 82  ? 56.434 94.297  4.188   1.00 44.72  ? 573 TYR B CE1   1 
ATOM   2495 C CE2   . TYR B 1 82  ? 57.597 95.381  5.987   1.00 46.53  ? 573 TYR B CE2   1 
ATOM   2496 C CZ    . TYR B 1 82  ? 56.469 95.248  5.195   1.00 44.82  ? 573 TYR B CZ    1 
ATOM   2497 O OH    . TYR B 1 82  ? 55.373 96.034  5.458   1.00 44.42  ? 573 TYR B OH    1 
ATOM   2498 N N     . VAL B 1 83  ? 60.126 89.240  4.642   1.00 34.22  ? 574 VAL B N     1 
ATOM   2499 C CA    . VAL B 1 83  ? 60.958 88.140  4.150   1.00 32.39  ? 574 VAL B CA    1 
ATOM   2500 C C     . VAL B 1 83  ? 60.866 88.140  2.623   1.00 33.29  ? 574 VAL B C     1 
ATOM   2501 O O     . VAL B 1 83  ? 59.788 88.009  2.067   1.00 33.88  ? 574 VAL B O     1 
ATOM   2502 C CB    . VAL B 1 83  ? 60.495 86.763  4.728   1.00 28.56  ? 574 VAL B CB    1 
ATOM   2503 C CG1   . VAL B 1 83  ? 61.253 85.638  4.064   1.00 27.24  ? 574 VAL B CG1   1 
ATOM   2504 C CG2   . VAL B 1 83  ? 60.749 86.710  6.221   1.00 22.50  ? 574 VAL B CG2   1 
ATOM   2505 N N     . ILE B 1 84  ? 62.001 88.312  1.956   1.00 34.52  ? 575 ILE B N     1 
ATOM   2506 C CA    . ILE B 1 84  ? 62.047 88.359  0.496   1.00 35.81  ? 575 ILE B CA    1 
ATOM   2507 C C     . ILE B 1 84  ? 61.848 86.985  -0.128  1.00 38.13  ? 575 ILE B C     1 
ATOM   2508 O O     . ILE B 1 84  ? 62.707 86.109  -0.011  1.00 37.81  ? 575 ILE B O     1 
ATOM   2509 C CB    . ILE B 1 84  ? 63.403 88.900  -0.012  1.00 34.89  ? 575 ILE B CB    1 
ATOM   2510 C CG1   . ILE B 1 84  ? 63.728 90.226  0.665   1.00 33.62  ? 575 ILE B CG1   1 
ATOM   2511 C CG2   . ILE B 1 84  ? 63.383 89.048  -1.526  1.00 32.92  ? 575 ILE B CG2   1 
ATOM   2512 C CD1   . ILE B 1 84  ? 65.124 90.701  0.361   1.00 34.53  ? 575 ILE B CD1   1 
ATOM   2513 N N     . ASP B 1 85  ? 60.717 86.815  -0.805  1.00 40.14  ? 576 ASP B N     1 
ATOM   2514 C CA    . ASP B 1 85  ? 60.397 85.567  -1.467  1.00 41.86  ? 576 ASP B CA    1 
ATOM   2515 C C     . ASP B 1 85  ? 61.018 85.572  -2.860  1.00 43.38  ? 576 ASP B C     1 
ATOM   2516 O O     . ASP B 1 85  ? 61.608 84.581  -3.278  1.00 45.60  ? 576 ASP B O     1 
ATOM   2517 C CB    . ASP B 1 85  ? 58.883 85.393  -1.547  1.00 42.80  ? 576 ASP B CB    1 
ATOM   2518 C CG    . ASP B 1 85  ? 58.483 84.070  -2.160  1.00 44.09  ? 576 ASP B CG    1 
ATOM   2519 O OD1   . ASP B 1 85  ? 58.814 83.849  -3.343  1.00 45.46  ? 576 ASP B OD1   1 
ATOM   2520 O OD2   . ASP B 1 85  ? 57.839 83.253  -1.463  1.00 45.45  ? 576 ASP B OD2   1 
ATOM   2521 N N     . GLN B 1 86  ? 60.894 86.672  -3.590  1.00 44.15  ? 577 GLN B N     1 
ATOM   2522 C CA    . GLN B 1 86  ? 61.506 86.730  -4.913  1.00 46.31  ? 577 GLN B CA    1 
ATOM   2523 C C     . GLN B 1 86  ? 61.919 88.128  -5.301  1.00 45.92  ? 577 GLN B C     1 
ATOM   2524 O O     . GLN B 1 86  ? 61.146 89.066  -5.140  1.00 45.86  ? 577 GLN B O     1 
ATOM   2525 C CB    . GLN B 1 86  ? 60.582 86.166  -5.988  1.00 48.85  ? 577 GLN B CB    1 
ATOM   2526 C CG    . GLN B 1 86  ? 61.011 86.594  -7.390  1.00 53.66  ? 577 GLN B CG    1 
ATOM   2527 C CD    . GLN B 1 86  ? 60.417 85.750  -8.508  1.00 57.17  ? 577 GLN B CD    1 
ATOM   2528 O OE1   . GLN B 1 86  ? 60.544 86.093  -9.703  1.00 56.73  ? 577 GLN B OE1   1 
ATOM   2529 N NE2   . GLN B 1 86  ? 59.766 84.635  -8.134  1.00 57.85  ? 577 GLN B NE2   1 
ATOM   2530 N N     . GLY B 1 87  ? 63.145 88.254  -5.820  1.00 47.02  ? 578 GLY B N     1 
ATOM   2531 C CA    . GLY B 1 87  ? 63.686 89.545  -6.238  1.00 48.13  ? 578 GLY B CA    1 
ATOM   2532 C C     . GLY B 1 87  ? 64.749 90.073  -5.284  1.00 47.85  ? 578 GLY B C     1 
ATOM   2533 O O     . GLY B 1 87  ? 64.985 89.473  -4.240  1.00 48.70  ? 578 GLY B O     1 
ATOM   2534 N N     . GLU B 1 88  ? 65.379 91.193  -5.630  1.00 47.18  ? 579 GLU B N     1 
ATOM   2535 C CA    . GLU B 1 88  ? 66.419 91.795  -4.791  1.00 47.18  ? 579 GLU B CA    1 
ATOM   2536 C C     . GLU B 1 88  ? 66.056 93.181  -4.258  1.00 47.77  ? 579 GLU B C     1 
ATOM   2537 O O     . GLU B 1 88  ? 65.514 94.016  -4.986  1.00 48.47  ? 579 GLU B O     1 
ATOM   2538 C CB    . GLU B 1 88  ? 67.719 91.886  -5.577  1.00 47.10  ? 579 GLU B CB    1 
ATOM   2539 C CG    . GLU B 1 88  ? 68.338 90.532  -5.840  1.00 48.85  ? 579 GLU B CG    1 
ATOM   2540 C CD    . GLU B 1 88  ? 69.188 90.509  -7.089  1.00 47.72  ? 579 GLU B CD    1 
ATOM   2541 O OE1   . GLU B 1 88  ? 68.633 90.693  -8.196  1.00 46.41  ? 579 GLU B OE1   1 
ATOM   2542 O OE2   . GLU B 1 88  ? 70.407 90.299  -6.959  1.00 48.88  ? 579 GLU B OE2   1 
ATOM   2543 N N     . MET B 1 89  ? 66.363 93.419  -2.984  1.00 46.88  ? 580 MET B N     1 
ATOM   2544 C CA    . MET B 1 89  ? 66.077 94.704  -2.339  1.00 45.43  ? 580 MET B CA    1 
ATOM   2545 C C     . MET B 1 89  ? 67.250 95.674  -2.389  1.00 44.49  ? 580 MET B C     1 
ATOM   2546 O O     . MET B 1 89  ? 68.400 95.260  -2.495  1.00 44.62  ? 580 MET B O     1 
ATOM   2547 C CB    . MET B 1 89  ? 65.699 94.501  -0.871  1.00 44.30  ? 580 MET B CB    1 
ATOM   2548 C CG    . MET B 1 89  ? 64.429 93.760  -0.682  1.00 41.48  ? 580 MET B CG    1 
ATOM   2549 S SD    . MET B 1 89  ? 63.235 94.471  -1.748  1.00 42.59  ? 580 MET B SD    1 
ATOM   2550 C CE    . MET B 1 89  ? 62.197 95.420  -0.612  1.00 39.60  ? 580 MET B CE    1 
ATOM   2551 N N     . ASP B 1 90  ? 66.945 96.967  -2.309  1.00 43.03  ? 581 ASP B N     1 
ATOM   2552 C CA    . ASP B 1 90  ? 67.972 97.996  -2.304  1.00 41.59  ? 581 ASP B CA    1 
ATOM   2553 C C     . ASP B 1 90  ? 67.896 98.797  -1.008  1.00 41.39  ? 581 ASP B C     1 
ATOM   2554 O O     . ASP B 1 90  ? 66.818 99.146  -0.521  1.00 36.87  ? 581 ASP B O     1 
ATOM   2555 C CB    . ASP B 1 90  ? 67.832 98.905  -3.519  1.00 43.36  ? 581 ASP B CB    1 
ATOM   2556 C CG    . ASP B 1 90  ? 68.832 98.569  -4.612  1.00 44.83  ? 581 ASP B CG    1 
ATOM   2557 O OD1   . ASP B 1 90  ? 69.416 97.468  -4.584  1.00 45.90  ? 581 ASP B OD1   1 
ATOM   2558 O OD2   . ASP B 1 90  ? 69.034 99.404  -5.509  1.00 45.53  ? 581 ASP B OD2   1 
ATOM   2559 N N     . VAL B 1 91  ? 69.071 99.050  -0.441  1.00 44.07  ? 582 VAL B N     1 
ATOM   2560 C CA    . VAL B 1 91  ? 69.196 99.769  0.823   1.00 45.01  ? 582 VAL B CA    1 
ATOM   2561 C C     . VAL B 1 91  ? 69.733 101.167 0.631   1.00 44.67  ? 582 VAL B C     1 
ATOM   2562 O O     . VAL B 1 91  ? 70.722 101.372 -0.082  1.00 42.80  ? 582 VAL B O     1 
ATOM   2563 C CB    . VAL B 1 91  ? 70.132 99.024  1.795   1.00 44.86  ? 582 VAL B CB    1 
ATOM   2564 C CG1   . VAL B 1 91  ? 70.039 99.642  3.175   1.00 43.95  ? 582 VAL B CG1   1 
ATOM   2565 C CG2   . VAL B 1 91  ? 69.754 97.550  1.843   1.00 46.48  ? 582 VAL B CG2   1 
ATOM   2566 N N     . TYR B 1 92  ? 69.072 102.121 1.279   1.00 45.09  ? 583 TYR B N     1 
ATOM   2567 C CA    . TYR B 1 92  ? 69.480 103.511 1.188   1.00 48.01  ? 583 TYR B CA    1 
ATOM   2568 C C     . TYR B 1 92  ? 69.620 104.190 2.543   1.00 49.02  ? 583 TYR B C     1 
ATOM   2569 O O     . TYR B 1 92  ? 68.723 104.108 3.380   1.00 49.26  ? 583 TYR B O     1 
ATOM   2570 C CB    . TYR B 1 92  ? 68.487 104.304 0.321   1.00 47.14  ? 583 TYR B CB    1 
ATOM   2571 C CG    . TYR B 1 92  ? 68.570 103.979 -1.156  1.00 47.51  ? 583 TYR B CG    1 
ATOM   2572 C CD1   . TYR B 1 92  ? 67.604 103.171 -1.773  1.00 46.51  ? 583 TYR B CD1   1 
ATOM   2573 C CD2   . TYR B 1 92  ? 69.631 104.458 -1.934  1.00 46.00  ? 583 TYR B CD2   1 
ATOM   2574 C CE1   . TYR B 1 92  ? 67.691 102.850 -3.128  1.00 45.65  ? 583 TYR B CE1   1 
ATOM   2575 C CE2   . TYR B 1 92  ? 69.732 104.142 -3.288  1.00 45.91  ? 583 TYR B CE2   1 
ATOM   2576 C CZ    . TYR B 1 92  ? 68.757 103.341 -3.881  1.00 46.70  ? 583 TYR B CZ    1 
ATOM   2577 O OH    . TYR B 1 92  ? 68.838 103.054 -5.225  1.00 45.20  ? 583 TYR B OH    1 
ATOM   2578 N N     . VAL B 1 93  ? 70.756 104.850 2.754   1.00 51.18  ? 584 VAL B N     1 
ATOM   2579 C CA    . VAL B 1 93  ? 70.997 105.580 3.996   1.00 53.31  ? 584 VAL B CA    1 
ATOM   2580 C C     . VAL B 1 93  ? 71.169 107.074 3.707   1.00 55.04  ? 584 VAL B C     1 
ATOM   2581 O O     . VAL B 1 93  ? 72.038 107.478 2.920   1.00 54.44  ? 584 VAL B O     1 
ATOM   2582 C CB    . VAL B 1 93  ? 72.260 105.097 4.722   1.00 53.04  ? 584 VAL B CB    1 
ATOM   2583 C CG1   . VAL B 1 93  ? 72.301 105.702 6.110   1.00 52.61  ? 584 VAL B CG1   1 
ATOM   2584 C CG2   . VAL B 1 93  ? 72.280 103.595 4.792   1.00 52.44  ? 584 VAL B CG2   1 
ATOM   2585 N N     . ASN B 1 94  ? 70.333 107.884 4.351   1.00 56.53  ? 585 ASN B N     1 
ATOM   2586 C CA    . ASN B 1 94  ? 70.356 109.335 4.191   1.00 57.42  ? 585 ASN B CA    1 
ATOM   2587 C C     . ASN B 1 94  ? 69.939 109.743 2.792   1.00 58.29  ? 585 ASN B C     1 
ATOM   2588 O O     . ASN B 1 94  ? 69.801 110.935 2.508   1.00 60.02  ? 585 ASN B O     1 
ATOM   2589 C CB    . ASN B 1 94  ? 71.746 109.881 4.502   1.00 57.71  ? 585 ASN B CB    1 
ATOM   2590 C CG    . ASN B 1 94  ? 72.151 109.628 5.928   1.00 58.70  ? 585 ASN B CG    1 
ATOM   2591 O OD1   . ASN B 1 94  ? 71.474 110.070 6.862   1.00 58.09  ? 585 ASN B OD1   1 
ATOM   2592 N ND2   . ASN B 1 94  ? 73.256 108.906 6.114   1.00 58.86  ? 585 ASN B ND2   1 
ATOM   2593 N N     . ASN B 1 95  ? 69.746 108.740 1.937   1.00 57.88  ? 586 ASN B N     1 
ATOM   2594 C CA    . ASN B 1 95  ? 69.310 108.954 0.558   1.00 57.96  ? 586 ASN B CA    1 
ATOM   2595 C C     . ASN B 1 95  ? 70.533 108.672 -0.295  1.00 58.00  ? 586 ASN B C     1 
ATOM   2596 O O     . ASN B 1 95  ? 70.833 109.420 -1.218  1.00 57.32  ? 586 ASN B O     1 
ATOM   2597 C CB    . ASN B 1 95  ? 69.159 110.353 0.163   1.00 58.24  ? 586 ASN B CB    1 
ATOM   2598 C CG    . ASN B 1 95  ? 67.715 110.447 -0.267  1.00 58.12  ? 586 ASN B CG    1 
ATOM   2599 O OD1   . ASN B 1 95  ? 67.326 109.852 -1.267  1.00 58.37  ? 586 ASN B OD1   1 
ATOM   2600 N ND2   . ASN B 1 95  ? 66.909 111.193 0.488   1.00 57.34  ? 586 ASN B ND2   1 
ATOM   2601 N N     . GLU B 1 96  ? 71.232 107.591 0.012   1.00 57.84  ? 587 GLU B N     1 
ATOM   2602 C CA    . GLU B 1 96  ? 72.411 107.200 -0.741  1.00 59.04  ? 587 GLU B CA    1 
ATOM   2603 C C     . GLU B 1 96  ? 72.559 105.667 -0.880  1.00 59.90  ? 587 GLU B C     1 
ATOM   2604 O O     . GLU B 1 96  ? 72.376 105.212 0.256   1.00 60.61  ? 587 GLU B O     1 
ATOM   2605 C CB    . GLU B 1 96  ? 73.923 107.648 -0.397  1.00 59.78  ? 587 GLU B CB    1 
ATOM   2606 N N     . TRP B 1 97  ? 72.805 104.899 -1.942  1.00 59.72  ? 588 TRP B N     1 
ATOM   2607 C CA    . TRP B 1 97  ? 72.872 103.447 -1.825  1.00 58.63  ? 588 TRP B CA    1 
ATOM   2608 C C     . TRP B 1 97  ? 73.869 102.903 -0.755  1.00 57.74  ? 588 TRP B C     1 
ATOM   2609 O O     . TRP B 1 97  ? 75.010 103.373 -0.728  1.00 57.70  ? 588 TRP B O     1 
ATOM   2610 C CB    . TRP B 1 97  ? 73.261 102.791 -3.140  1.00 59.72  ? 588 TRP B CB    1 
ATOM   2611 C CG    . TRP B 1 97  ? 73.776 101.363 -3.094  1.00 61.98  ? 588 TRP B CG    1 
ATOM   2612 C CD1   . TRP B 1 97  ? 74.888 100.901 -2.429  1.00 63.00  ? 588 TRP B CD1   1 
ATOM   2613 C CD2   . TRP B 1 97  ? 73.246 100.237 -3.800  1.00 63.08  ? 588 TRP B CD2   1 
ATOM   2614 N NE1   . TRP B 1 97  ? 75.079 99.565  -2.684  1.00 62.99  ? 588 TRP B NE1   1 
ATOM   2615 C CE2   . TRP B 1 97  ? 74.088 99.132  -3.524  1.00 63.59  ? 588 TRP B CE2   1 
ATOM   2616 C CE3   . TRP B 1 97  ? 72.146 100.054 -4.645  1.00 65.04  ? 588 TRP B CE3   1 
ATOM   2617 C CZ2   . TRP B 1 97  ? 73.863 97.869  -4.065  1.00 64.95  ? 588 TRP B CZ2   1 
ATOM   2618 C CZ3   . TRP B 1 97  ? 71.922 98.790  -5.189  1.00 66.10  ? 588 TRP B CZ3   1 
ATOM   2619 C CH2   . TRP B 1 97  ? 72.779 97.716  -4.895  1.00 66.72  ? 588 TRP B CH2   1 
ATOM   2620 N N     . ALA B 1 98  ? 73.422 101.962 0.075   1.00 56.87  ? 589 ALA B N     1 
ATOM   2621 C CA    . ALA B 1 98  ? 74.238 101.374 1.126   1.00 54.21  ? 589 ALA B CA    1 
ATOM   2622 C C     . ALA B 1 98  ? 74.476 99.903  0.803   1.00 52.95  ? 589 ALA B C     1 
ATOM   2623 O O     . ALA B 1 98  ? 75.612 99.477  0.626   1.00 52.58  ? 589 ALA B O     1 
ATOM   2624 C CB    . ALA B 1 98  ? 73.537 101.517 2.456   1.00 53.53  ? 589 ALA B CB    1 
ATOM   2625 N N     . THR B 1 99  ? 73.396 99.133  0.714   1.00 52.47  ? 590 THR B N     1 
ATOM   2626 C CA    . THR B 1 99  ? 73.488 97.704  0.409   1.00 51.42  ? 590 THR B CA    1 
ATOM   2627 C C     . THR B 1 99  ? 72.389 97.333  -0.574  1.00 51.48  ? 590 THR B C     1 
ATOM   2628 O O     . THR B 1 99  ? 71.896 98.171  -1.324  1.00 50.53  ? 590 THR B O     1 
ATOM   2629 C CB    . THR B 1 99  ? 73.255 96.819  1.652   1.00 49.72  ? 590 THR B CB    1 
ATOM   2630 O OG1   . THR B 1 99  ? 73.665 97.516  2.832   1.00 49.73  ? 590 THR B OG1   1 
ATOM   2631 C CG2   . THR B 1 99  ? 74.012 95.519  1.519   1.00 46.66  ? 590 THR B CG2   1 
ATOM   2632 N N     . SER B 1 100 ? 71.997 96.063  -0.518  1.00 51.01  ? 591 SER B N     1 
ATOM   2633 C CA    . SER B 1 100 ? 70.961 95.513  -1.366  1.00 49.40  ? 591 SER B CA    1 
ATOM   2634 C C     . SER B 1 100 ? 70.741 94.074  -0.921  1.00 48.86  ? 591 SER B C     1 
ATOM   2635 O O     . SER B 1 100 ? 71.510 93.183  -1.290  1.00 48.56  ? 591 SER B O     1 
ATOM   2636 C CB    . SER B 1 100 ? 71.410 95.545  -2.830  1.00 49.78  ? 591 SER B CB    1 
ATOM   2637 O OG    . SER B 1 100 ? 70.420 95.040  -3.711  1.00 49.58  ? 591 SER B OG    1 
ATOM   2638 N N     . VAL B 1 101 ? 69.698 93.862  -0.121  1.00 47.45  ? 592 VAL B N     1 
ATOM   2639 C CA    . VAL B 1 101 ? 69.344 92.538  0.385   1.00 45.19  ? 592 VAL B CA    1 
ATOM   2640 C C     . VAL B 1 101 ? 68.925 91.610  -0.747  1.00 45.53  ? 592 VAL B C     1 
ATOM   2641 O O     . VAL B 1 101 ? 68.287 92.042  -1.702  1.00 45.63  ? 592 VAL B O     1 
ATOM   2642 C CB    . VAL B 1 101 ? 68.179 92.613  1.361   1.00 44.43  ? 592 VAL B CB    1 
ATOM   2643 C CG1   . VAL B 1 101 ? 67.984 91.269  2.016   1.00 44.15  ? 592 VAL B CG1   1 
ATOM   2644 C CG2   . VAL B 1 101 ? 68.429 93.698  2.398   1.00 43.21  ? 592 VAL B CG2   1 
ATOM   2645 N N     . GLY B 1 102 ? 69.266 90.331  -0.623  1.00 45.59  ? 593 GLY B N     1 
ATOM   2646 C CA    . GLY B 1 102 ? 68.932 89.364  -1.657  1.00 45.08  ? 593 GLY B CA    1 
ATOM   2647 C C     . GLY B 1 102 ? 67.742 88.449  -1.400  1.00 44.94  ? 593 GLY B C     1 
ATOM   2648 O O     . GLY B 1 102 ? 67.152 88.450  -0.318  1.00 42.99  ? 593 GLY B O     1 
ATOM   2649 N N     . GLU B 1 103 ? 67.411 87.649  -2.416  1.00 45.53  ? 594 GLU B N     1 
ATOM   2650 C CA    . GLU B 1 103 ? 66.284 86.715  -2.374  1.00 46.33  ? 594 GLU B CA    1 
ATOM   2651 C C     . GLU B 1 103 ? 66.468 85.623  -1.331  1.00 45.82  ? 594 GLU B C     1 
ATOM   2652 O O     . GLU B 1 103 ? 67.451 84.893  -1.365  1.00 47.91  ? 594 GLU B O     1 
ATOM   2653 C CB    . GLU B 1 103 ? 66.100 86.071  -3.743  1.00 47.74  ? 594 GLU B CB    1 
ATOM   2654 C CG    . GLU B 1 103 ? 64.779 85.367  -3.927  1.00 51.93  ? 594 GLU B CG    1 
ATOM   2655 C CD    . GLU B 1 103 ? 64.656 84.753  -5.311  1.00 56.51  ? 594 GLU B CD    1 
ATOM   2656 O OE1   . GLU B 1 103 ? 65.259 83.675  -5.550  1.00 58.41  ? 594 GLU B OE1   1 
ATOM   2657 O OE2   . GLU B 1 103 ? 63.968 85.359  -6.165  1.00 58.49  ? 594 GLU B OE2   1 
ATOM   2658 N N     . GLY B 1 104 ? 65.503 85.498  -0.427  1.00 43.53  ? 595 GLY B N     1 
ATOM   2659 C CA    . GLY B 1 104 ? 65.597 84.501  0.619   1.00 40.42  ? 595 GLY B CA    1 
ATOM   2660 C C     . GLY B 1 104 ? 65.898 85.227  1.916   1.00 40.15  ? 595 GLY B C     1 
ATOM   2661 O O     . GLY B 1 104 ? 65.612 84.749  3.027   1.00 38.83  ? 595 GLY B O     1 
ATOM   2662 N N     . GLY B 1 105 ? 66.471 86.414  1.767   1.00 38.16  ? 596 GLY B N     1 
ATOM   2663 C CA    . GLY B 1 105 ? 66.813 87.192  2.933   1.00 37.41  ? 596 GLY B CA    1 
ATOM   2664 C C     . GLY B 1 105 ? 65.615 87.869  3.558   1.00 35.94  ? 596 GLY B C     1 
ATOM   2665 O O     . GLY B 1 105 ? 64.483 87.641  3.149   1.00 36.51  ? 596 GLY B O     1 
ATOM   2666 N N     . SER B 1 106 ? 65.873 88.693  4.568   1.00 34.38  ? 597 SER B N     1 
ATOM   2667 C CA    . SER B 1 106 ? 64.821 89.422  5.237   1.00 32.60  ? 597 SER B CA    1 
ATOM   2668 C C     . SER B 1 106 ? 65.325 90.821  5.628   1.00 31.70  ? 597 SER B C     1 
ATOM   2669 O O     . SER B 1 106 ? 66.488 91.161  5.403   1.00 30.02  ? 597 SER B O     1 
ATOM   2670 C CB    . SER B 1 106 ? 64.369 88.649  6.470   1.00 33.94  ? 597 SER B CB    1 
ATOM   2671 O OG    . SER B 1 106 ? 65.189 88.934  7.589   1.00 37.01  ? 597 SER B OG    1 
ATOM   2672 N N     . PHE B 1 107 ? 64.439 91.633  6.190   1.00 30.85  ? 598 PHE B N     1 
ATOM   2673 C CA    . PHE B 1 107 ? 64.794 92.971  6.616   1.00 30.92  ? 598 PHE B CA    1 
ATOM   2674 C C     . PHE B 1 107 ? 63.677 93.557  7.455   1.00 29.59  ? 598 PHE B C     1 
ATOM   2675 O O     . PHE B 1 107 ? 62.633 92.943  7.620   1.00 27.62  ? 598 PHE B O     1 
ATOM   2676 C CB    . PHE B 1 107 ? 65.186 93.830  5.412   1.00 32.96  ? 598 PHE B CB    1 
ATOM   2677 C CG    . PHE B 1 107 ? 64.063 94.086  4.449   1.00 36.68  ? 598 PHE B CG    1 
ATOM   2678 C CD1   . PHE B 1 107 ? 62.986 94.907  4.808   1.00 38.38  ? 598 PHE B CD1   1 
ATOM   2679 C CD2   . PHE B 1 107 ? 64.084 93.530  3.173   1.00 36.69  ? 598 PHE B CD2   1 
ATOM   2680 C CE1   . PHE B 1 107 ? 61.944 95.175  3.911   1.00 38.48  ? 598 PHE B CE1   1 
ATOM   2681 C CE2   . PHE B 1 107 ? 63.055 93.787  2.269   1.00 38.46  ? 598 PHE B CE2   1 
ATOM   2682 C CZ    . PHE B 1 107 ? 61.979 94.614  2.639   1.00 39.03  ? 598 PHE B CZ    1 
ATOM   2683 N N     . GLY B 1 108 ? 63.911 94.755  7.982   1.00 30.61  ? 599 GLY B N     1 
ATOM   2684 C CA    . GLY B 1 108 ? 62.919 95.429  8.804   1.00 28.54  ? 599 GLY B CA    1 
ATOM   2685 C C     . GLY B 1 108 ? 62.756 94.993  10.242  1.00 27.97  ? 599 GLY B C     1 
ATOM   2686 O O     . GLY B 1 108 ? 61.917 95.526  10.952  1.00 27.55  ? 599 GLY B O     1 
ATOM   2687 N N     . GLU B 1 109 ? 63.586 94.062  10.701  1.00 27.23  ? 600 GLU B N     1 
ATOM   2688 C CA    . GLU B 1 109 ? 63.476 93.583  12.079  1.00 28.36  ? 600 GLU B CA    1 
ATOM   2689 C C     . GLU B 1 109 ? 63.940 94.569  13.167  1.00 29.24  ? 600 GLU B C     1 
ATOM   2690 O O     . GLU B 1 109 ? 63.354 94.647  14.263  1.00 27.23  ? 600 GLU B O     1 
ATOM   2691 C CB    . GLU B 1 109 ? 64.220 92.240  12.232  1.00 25.76  ? 600 GLU B CB    1 
ATOM   2692 C CG    . GLU B 1 109 ? 65.715 92.306  12.557  1.00 26.68  ? 600 GLU B CG    1 
ATOM   2693 C CD    . GLU B 1 109 ? 66.602 92.654  11.364  1.00 26.60  ? 600 GLU B CD    1 
ATOM   2694 O OE1   . GLU B 1 109 ? 66.180 92.431  10.206  1.00 26.37  ? 600 GLU B OE1   1 
ATOM   2695 O OE2   . GLU B 1 109 ? 67.740 93.123  11.593  1.00 23.23  ? 600 GLU B OE2   1 
ATOM   2696 N N     . LEU B 1 110 ? 64.978 95.331  12.843  1.00 29.80  ? 601 LEU B N     1 
ATOM   2697 C CA    . LEU B 1 110 ? 65.550 96.279  13.778  1.00 31.06  ? 601 LEU B CA    1 
ATOM   2698 C C     . LEU B 1 110 ? 64.579 97.291  14.386  1.00 32.38  ? 601 LEU B C     1 
ATOM   2699 O O     . LEU B 1 110 ? 64.444 97.381  15.611  1.00 32.58  ? 601 LEU B O     1 
ATOM   2700 C CB    . LEU B 1 110 ? 66.741 96.988  13.119  1.00 30.80  ? 601 LEU B CB    1 
ATOM   2701 C CG    . LEU B 1 110 ? 68.154 96.396  13.323  1.00 30.52  ? 601 LEU B CG    1 
ATOM   2702 C CD1   . LEU B 1 110 ? 68.060 94.955  13.741  1.00 31.90  ? 601 LEU B CD1   1 
ATOM   2703 C CD2   . LEU B 1 110 ? 68.979 96.509  12.039  1.00 27.92  ? 601 LEU B CD2   1 
ATOM   2704 N N     . ALA B 1 111 ? 63.897 98.062  13.558  1.00 31.90  ? 602 ALA B N     1 
ATOM   2705 C CA    . ALA B 1 111 ? 62.990 99.036  14.122  1.00 32.78  ? 602 ALA B CA    1 
ATOM   2706 C C     . ALA B 1 111 ? 61.992 98.345  15.049  1.00 34.35  ? 602 ALA B C     1 
ATOM   2707 O O     . ALA B 1 111 ? 61.651 98.853  16.121  1.00 34.30  ? 602 ALA B O     1 
ATOM   2708 C CB    . ALA B 1 111 ? 62.264 99.764  13.013  1.00 33.08  ? 602 ALA B CB    1 
ATOM   2709 N N     . LEU B 1 112 ? 61.549 97.160  14.645  1.00 35.92  ? 603 LEU B N     1 
ATOM   2710 C CA    . LEU B 1 112 ? 60.561 96.423  15.416  1.00 35.46  ? 603 LEU B CA    1 
ATOM   2711 C C     . LEU B 1 112 ? 61.111 95.900  16.735  1.00 36.07  ? 603 LEU B C     1 
ATOM   2712 O O     . LEU B 1 112 ? 60.504 96.120  17.786  1.00 35.88  ? 603 LEU B O     1 
ATOM   2713 C CB    . LEU B 1 112 ? 59.994 95.288  14.560  1.00 34.67  ? 603 LEU B CB    1 
ATOM   2714 C CG    . LEU B 1 112 ? 59.505 95.722  13.161  1.00 35.67  ? 603 LEU B CG    1 
ATOM   2715 C CD1   . LEU B 1 112 ? 58.899 94.523  12.417  1.00 34.50  ? 603 LEU B CD1   1 
ATOM   2716 C CD2   . LEU B 1 112 ? 58.488 96.840  13.280  1.00 30.71  ? 603 LEU B CD2   1 
ATOM   2717 N N     . ILE B 1 113 ? 62.270 95.239  16.683  1.00 36.07  ? 604 ILE B N     1 
ATOM   2718 C CA    . ILE B 1 113 ? 62.908 94.678  17.886  1.00 35.31  ? 604 ILE B CA    1 
ATOM   2719 C C     . ILE B 1 113 ? 63.349 95.685  18.953  1.00 34.77  ? 604 ILE B C     1 
ATOM   2720 O O     . ILE B 1 113 ? 63.142 95.446  20.140  1.00 35.42  ? 604 ILE B O     1 
ATOM   2721 C CB    . ILE B 1 113 ? 64.158 93.841  17.532  1.00 35.19  ? 604 ILE B CB    1 
ATOM   2722 C CG1   . ILE B 1 113 ? 63.779 92.655  16.654  1.00 32.79  ? 604 ILE B CG1   1 
ATOM   2723 C CG2   . ILE B 1 113 ? 64.842 93.353  18.803  1.00 33.42  ? 604 ILE B CG2   1 
ATOM   2724 C CD1   . ILE B 1 113 ? 64.975 91.831  16.247  1.00 31.73  ? 604 ILE B CD1   1 
ATOM   2725 N N     . TYR B 1 114 ? 63.953 96.797  18.538  1.00 34.90  ? 605 TYR B N     1 
ATOM   2726 C CA    . TYR B 1 114 ? 64.450 97.807  19.477  1.00 35.32  ? 605 TYR B CA    1 
ATOM   2727 C C     . TYR B 1 114 ? 63.587 99.052  19.648  1.00 37.84  ? 605 TYR B C     1 
ATOM   2728 O O     . TYR B 1 114 ? 63.769 99.803  20.601  1.00 38.11  ? 605 TYR B O     1 
ATOM   2729 C CB    . TYR B 1 114 ? 65.859 98.234  19.072  1.00 32.34  ? 605 TYR B CB    1 
ATOM   2730 C CG    . TYR B 1 114 ? 66.825 97.085  19.027  1.00 28.76  ? 605 TYR B CG    1 
ATOM   2731 C CD1   . TYR B 1 114 ? 67.350 96.554  20.191  1.00 26.64  ? 605 TYR B CD1   1 
ATOM   2732 C CD2   . TYR B 1 114 ? 67.145 96.471  17.818  1.00 29.51  ? 605 TYR B CD2   1 
ATOM   2733 C CE1   . TYR B 1 114 ? 68.160 95.442  20.163  1.00 25.82  ? 605 TYR B CE1   1 
ATOM   2734 C CE2   . TYR B 1 114 ? 67.951 95.357  17.779  1.00 28.36  ? 605 TYR B CE2   1 
ATOM   2735 C CZ    . TYR B 1 114 ? 68.453 94.845  18.960  1.00 28.72  ? 605 TYR B CZ    1 
ATOM   2736 O OH    . TYR B 1 114 ? 69.233 93.711  18.938  1.00 32.45  ? 605 TYR B OH    1 
ATOM   2737 N N     . GLY B 1 115 ? 62.658 99.287  18.732  1.00 40.08  ? 606 GLY B N     1 
ATOM   2738 C CA    . GLY B 1 115 ? 61.802 100.452 18.869  1.00 42.52  ? 606 GLY B CA    1 
ATOM   2739 C C     . GLY B 1 115 ? 62.458 101.726 18.388  1.00 45.01  ? 606 GLY B C     1 
ATOM   2740 O O     . GLY B 1 115 ? 62.048 102.826 18.749  1.00 46.11  ? 606 GLY B O     1 
ATOM   2741 N N     . THR B 1 116 ? 63.492 101.574 17.572  1.00 47.07  ? 607 THR B N     1 
ATOM   2742 C CA    . THR B 1 116 ? 64.204 102.713 17.018  1.00 47.83  ? 607 THR B CA    1 
ATOM   2743 C C     . THR B 1 116 ? 63.532 103.040 15.692  1.00 48.26  ? 607 THR B C     1 
ATOM   2744 O O     . THR B 1 116 ? 62.591 102.368 15.280  1.00 48.68  ? 607 THR B O     1 
ATOM   2745 C CB    . THR B 1 116 ? 65.645 102.363 16.731  1.00 48.37  ? 607 THR B CB    1 
ATOM   2746 O OG1   . THR B 1 116 ? 65.698 101.594 15.523  1.00 53.38  ? 607 THR B OG1   1 
ATOM   2747 C CG2   . THR B 1 116 ? 66.228 101.541 17.872  1.00 49.29  ? 607 THR B CG2   1 
ATOM   2748 N N     . PRO B 1 117 ? 64.026 104.063 14.987  1.00 48.74  ? 608 PRO B N     1 
ATOM   2749 C CA    . PRO B 1 117 ? 63.392 104.370 13.707  1.00 48.61  ? 608 PRO B CA    1 
ATOM   2750 C C     . PRO B 1 117 ? 63.959 103.444 12.624  1.00 48.49  ? 608 PRO B C     1 
ATOM   2751 O O     . PRO B 1 117 ? 64.832 102.612 12.893  1.00 48.53  ? 608 PRO B O     1 
ATOM   2752 C CB    . PRO B 1 117 ? 63.773 105.827 13.493  1.00 49.25  ? 608 PRO B CB    1 
ATOM   2753 C CG    . PRO B 1 117 ? 65.169 105.853 14.036  1.00 49.39  ? 608 PRO B CG    1 
ATOM   2754 C CD    . PRO B 1 117 ? 65.021 105.093 15.336  1.00 49.02  ? 608 PRO B CD    1 
ATOM   2755 N N     . ARG B 1 118 ? 63.465 103.571 11.403  1.00 46.89  ? 609 ARG B N     1 
ATOM   2756 C CA    . ARG B 1 118 ? 63.986 102.725 10.359  1.00 46.80  ? 609 ARG B CA    1 
ATOM   2757 C C     . ARG B 1 118 ? 65.418 103.168 10.121  1.00 46.78  ? 609 ARG B C     1 
ATOM   2758 O O     . ARG B 1 118 ? 65.676 104.291 9.689   1.00 47.50  ? 609 ARG B O     1 
ATOM   2759 C CB    . ARG B 1 118 ? 63.121 102.823 9.102   1.00 48.04  ? 609 ARG B CB    1 
ATOM   2760 C CG    . ARG B 1 118 ? 61.723 102.224 9.264   1.00 49.58  ? 609 ARG B CG    1 
ATOM   2761 C CD    . ARG B 1 118 ? 61.754 100.727 9.588   1.00 48.78  ? 609 ARG B CD    1 
ATOM   2762 N NE    . ARG B 1 118 ? 60.408 100.159 9.627   1.00 48.89  ? 609 ARG B NE    1 
ATOM   2763 C CZ    . ARG B 1 118 ? 60.139 98.875  9.834   1.00 48.79  ? 609 ARG B CZ    1 
ATOM   2764 N NH1   . ARG B 1 118 ? 61.123 98.010  10.026  1.00 48.76  ? 609 ARG B NH1   1 
ATOM   2765 N NH2   . ARG B 1 118 ? 58.887 98.451  9.840   1.00 47.64  ? 609 ARG B NH2   1 
ATOM   2766 N N     . ALA B 1 119 ? 66.349 102.274 10.424  1.00 46.82  ? 610 ALA B N     1 
ATOM   2767 C CA    . ALA B 1 119 ? 67.762 102.567 10.251  1.00 46.71  ? 610 ALA B CA    1 
ATOM   2768 C C     . ALA B 1 119 ? 67.965 103.199 8.899   1.00 47.28  ? 610 ALA B C     1 
ATOM   2769 O O     . ALA B 1 119 ? 68.483 104.304 8.796   1.00 49.74  ? 610 ALA B O     1 
ATOM   2770 C CB    . ALA B 1 119 ? 68.565 101.290 10.342  1.00 47.53  ? 610 ALA B CB    1 
ATOM   2771 N N     . ALA B 1 120 ? 67.535 102.495 7.861   1.00 47.34  ? 611 ALA B N     1 
ATOM   2772 C CA    . ALA B 1 120 ? 67.688 102.971 6.491   1.00 46.19  ? 611 ALA B CA    1 
ATOM   2773 C C     . ALA B 1 120 ? 66.362 102.905 5.761   1.00 44.82  ? 611 ALA B C     1 
ATOM   2774 O O     . ALA B 1 120 ? 65.320 102.665 6.370   1.00 43.39  ? 611 ALA B O     1 
ATOM   2775 C CB    . ALA B 1 120 ? 68.725 102.110 5.755   1.00 45.63  ? 611 ALA B CB    1 
ATOM   2776 N N     . THR B 1 121 ? 66.420 103.141 4.455   1.00 42.99  ? 612 THR B N     1 
ATOM   2777 C CA    . THR B 1 121 ? 65.247 103.074 3.604   1.00 42.97  ? 612 THR B CA    1 
ATOM   2778 C C     . THR B 1 121 ? 65.503 101.945 2.633   1.00 43.43  ? 612 THR B C     1 
ATOM   2779 O O     . THR B 1 121 ? 66.613 101.811 2.106   1.00 43.24  ? 612 THR B O     1 
ATOM   2780 C CB    . THR B 1 121 ? 65.030 104.361 2.790   1.00 42.10  ? 612 THR B CB    1 
ATOM   2781 O OG1   . THR B 1 121 ? 64.616 105.409 3.666   1.00 41.80  ? 612 THR B OG1   1 
ATOM   2782 C CG2   . THR B 1 121 ? 63.948 104.155 1.735   1.00 41.95  ? 612 THR B CG2   1 
ATOM   2783 N N     . VAL B 1 122 ? 64.480 101.133 2.403   1.00 43.76  ? 613 VAL B N     1 
ATOM   2784 C CA    . VAL B 1 122 ? 64.614 100.014 1.488   1.00 44.53  ? 613 VAL B CA    1 
ATOM   2785 C C     . VAL B 1 122 ? 63.567 100.049 0.355   1.00 44.49  ? 613 VAL B C     1 
ATOM   2786 O O     . VAL B 1 122 ? 62.353 100.147 0.585   1.00 42.28  ? 613 VAL B O     1 
ATOM   2787 C CB    . VAL B 1 122 ? 64.526 98.651  2.245   1.00 45.06  ? 613 VAL B CB    1 
ATOM   2788 C CG1   . VAL B 1 122 ? 65.094 97.541  1.375   1.00 46.07  ? 613 VAL B CG1   1 
ATOM   2789 C CG2   . VAL B 1 122 ? 65.268 98.728  3.563   1.00 43.37  ? 613 VAL B CG2   1 
ATOM   2790 N N     . LYS B 1 123 ? 64.085 99.980  -0.869  1.00 44.36  ? 614 LYS B N     1 
ATOM   2791 C CA    . LYS B 1 123 ? 63.299 99.981  -2.090  1.00 44.97  ? 614 LYS B CA    1 
ATOM   2792 C C     . LYS B 1 123 ? 63.562 98.645  -2.788  1.00 45.35  ? 614 LYS B C     1 
ATOM   2793 O O     . LYS B 1 123 ? 64.391 97.860  -2.329  1.00 45.75  ? 614 LYS B O     1 
ATOM   2794 C CB    . LYS B 1 123 ? 63.780 101.105 -3.017  1.00 44.61  ? 614 LYS B CB    1 
ATOM   2795 C CG    . LYS B 1 123 ? 63.524 102.504 -2.465  1.00 45.45  ? 614 LYS B CG    1 
ATOM   2796 C CD    . LYS B 1 123 ? 63.981 103.599 -3.424  1.00 44.74  ? 614 LYS B CD    1 
ATOM   2797 C CE    . LYS B 1 123 ? 63.655 104.983 -2.867  1.00 42.86  ? 614 LYS B CE    1 
ATOM   2798 N NZ    . LYS B 1 123 ? 64.216 106.066 -3.721  1.00 41.69  ? 614 LYS B NZ    1 
ATOM   2799 N N     . ALA B 1 124 ? 62.863 98.387  -3.890  1.00 44.33  ? 615 ALA B N     1 
ATOM   2800 C CA    . ALA B 1 124 ? 63.050 97.148  -4.624  1.00 43.21  ? 615 ALA B CA    1 
ATOM   2801 C C     . ALA B 1 124 ? 64.061 97.325  -5.736  1.00 43.87  ? 615 ALA B C     1 
ATOM   2802 O O     . ALA B 1 124 ? 63.981 98.291  -6.484  1.00 45.14  ? 615 ALA B O     1 
ATOM   2803 C CB    . ALA B 1 124 ? 61.736 96.725  -5.188  1.00 42.59  ? 615 ALA B CB    1 
ATOM   2804 N N     . LYS B 1 125 ? 65.026 96.413  -5.840  1.00 44.42  ? 616 LYS B N     1 
ATOM   2805 C CA    . LYS B 1 125 ? 66.033 96.504  -6.895  1.00 44.75  ? 616 LYS B CA    1 
ATOM   2806 C C     . LYS B 1 125 ? 65.405 95.933  -8.147  1.00 44.60  ? 616 LYS B C     1 
ATOM   2807 O O     . LYS B 1 125 ? 65.783 96.266  -9.267  1.00 44.91  ? 616 LYS B O     1 
ATOM   2808 C CB    . LYS B 1 125 ? 67.274 95.684  -6.545  1.00 46.12  ? 616 LYS B CB    1 
ATOM   2809 C CG    . LYS B 1 125 ? 68.390 95.771  -7.588  1.00 47.05  ? 616 LYS B CG    1 
ATOM   2810 C CD    . LYS B 1 125 ? 69.401 94.644  -7.408  1.00 49.85  ? 616 LYS B CD    1 
ATOM   2811 C CE    . LYS B 1 125 ? 70.789 95.026  -7.911  1.00 52.32  ? 616 LYS B CE    1 
ATOM   2812 N NZ    . LYS B 1 125 ? 71.458 96.033  -7.009  1.00 53.60  ? 616 LYS B NZ    1 
ATOM   2813 N N     . THR B 1 126 ? 64.440 95.052  -7.929  1.00 43.78  ? 617 THR B N     1 
ATOM   2814 C CA    . THR B 1 126 ? 63.707 94.402  -8.996  1.00 42.89  ? 617 THR B CA    1 
ATOM   2815 C C     . THR B 1 126 ? 62.302 94.268  -8.469  1.00 43.33  ? 617 THR B C     1 
ATOM   2816 O O     . THR B 1 126 ? 62.054 94.511  -7.298  1.00 44.35  ? 617 THR B O     1 
ATOM   2817 C CB    . THR B 1 126 ? 64.235 92.991  -9.263  1.00 41.49  ? 617 THR B CB    1 
ATOM   2818 O OG1   . THR B 1 126 ? 63.660 92.073  -8.322  1.00 40.26  ? 617 THR B OG1   1 
ATOM   2819 C CG2   . THR B 1 126 ? 65.738 92.968  -9.125  1.00 40.59  ? 617 THR B CG2   1 
ATOM   2820 N N     . ASN B 1 127 ? 61.373 93.877  -9.321  1.00 44.56  ? 618 ASN B N     1 
ATOM   2821 C CA    . ASN B 1 127 ? 60.012 93.710  -8.851  1.00 45.64  ? 618 ASN B CA    1 
ATOM   2822 C C     . ASN B 1 127 ? 60.053 92.549  -7.867  1.00 46.50  ? 618 ASN B C     1 
ATOM   2823 O O     . ASN B 1 127 ? 60.400 91.420  -8.238  1.00 48.44  ? 618 ASN B O     1 
ATOM   2824 C CB    . ASN B 1 127 ? 59.104 93.388  -10.031 1.00 45.80  ? 618 ASN B CB    1 
ATOM   2825 C CG    . ASN B 1 127 ? 59.011 94.527  -11.000 1.00 44.63  ? 618 ASN B CG    1 
ATOM   2826 O OD1   . ASN B 1 127 ? 58.501 95.594  -10.665 1.00 45.76  ? 618 ASN B OD1   1 
ATOM   2827 N ND2   . ASN B 1 127 ? 59.516 94.322  -12.204 1.00 43.29  ? 618 ASN B ND2   1 
ATOM   2828 N N     . VAL B 1 128 ? 59.715 92.805  -6.612  1.00 44.10  ? 619 VAL B N     1 
ATOM   2829 C CA    . VAL B 1 128 ? 59.761 91.724  -5.645  1.00 42.66  ? 619 VAL B CA    1 
ATOM   2830 C C     . VAL B 1 128 ? 58.409 91.325  -5.090  1.00 42.54  ? 619 VAL B C     1 
ATOM   2831 O O     . VAL B 1 128 ? 57.465 92.104  -5.130  1.00 44.51  ? 619 VAL B O     1 
ATOM   2832 C CB    . VAL B 1 128 ? 60.651 92.096  -4.466  1.00 42.78  ? 619 VAL B CB    1 
ATOM   2833 C CG1   . VAL B 1 128 ? 62.090 92.328  -4.941  1.00 41.11  ? 619 VAL B CG1   1 
ATOM   2834 C CG2   . VAL B 1 128 ? 60.077 93.320  -3.772  1.00 41.48  ? 619 VAL B CG2   1 
ATOM   2835 N N     . LYS B 1 129 ? 58.315 90.094  -4.596  1.00 41.64  ? 620 LYS B N     1 
ATOM   2836 C CA    . LYS B 1 129 ? 57.088 89.602  -3.967  1.00 40.79  ? 620 LYS B CA    1 
ATOM   2837 C C     . LYS B 1 129 ? 57.617 89.328  -2.564  1.00 39.29  ? 620 LYS B C     1 
ATOM   2838 O O     . LYS B 1 129 ? 58.634 88.663  -2.421  1.00 38.70  ? 620 LYS B O     1 
ATOM   2839 C CB    . LYS B 1 129 ? 56.597 88.297  -4.619  1.00 41.24  ? 620 LYS B CB    1 
ATOM   2840 C CG    . LYS B 1 129 ? 55.085 88.004  -4.446  1.00 41.31  ? 620 LYS B CG    1 
ATOM   2841 C CD    . LYS B 1 129 ? 54.664 87.696  -2.998  1.00 40.52  ? 620 LYS B CD    1 
ATOM   2842 C CE    . LYS B 1 129 ? 55.017 86.272  -2.559  1.00 42.09  ? 620 LYS B CE    1 
ATOM   2843 N NZ    . LYS B 1 129 ? 54.327 85.192  -3.346  1.00 41.43  ? 620 LYS B NZ    1 
ATOM   2844 N N     . LEU B 1 130 ? 56.955 89.847  -1.536  1.00 36.93  ? 621 LEU B N     1 
ATOM   2845 C CA    . LEU B 1 130 ? 57.454 89.659  -0.191  1.00 35.26  ? 621 LEU B CA    1 
ATOM   2846 C C     . LEU B 1 130 ? 56.457 89.025  0.735   1.00 35.78  ? 621 LEU B C     1 
ATOM   2847 O O     . LEU B 1 130 ? 55.309 88.835  0.388   1.00 36.86  ? 621 LEU B O     1 
ATOM   2848 C CB    . LEU B 1 130 ? 57.876 91.004  0.418   1.00 34.59  ? 621 LEU B CB    1 
ATOM   2849 C CG    . LEU B 1 130 ? 58.789 92.035  -0.255  1.00 30.06  ? 621 LEU B CG    1 
ATOM   2850 C CD1   . LEU B 1 130 ? 58.921 93.159  0.726   1.00 31.58  ? 621 LEU B CD1   1 
ATOM   2851 C CD2   . LEU B 1 130 ? 60.156 91.493  -0.593  1.00 27.96  ? 621 LEU B CD2   1 
ATOM   2852 N N     . TRP B 1 131 ? 56.925 88.718  1.937   1.00 36.51  ? 622 TRP B N     1 
ATOM   2853 C CA    . TRP B 1 131 ? 56.118 88.122  2.982   1.00 37.17  ? 622 TRP B CA    1 
ATOM   2854 C C     . TRP B 1 131 ? 56.281 89.071  4.148   1.00 37.40  ? 622 TRP B C     1 
ATOM   2855 O O     . TRP B 1 131 ? 57.358 89.136  4.727   1.00 38.53  ? 622 TRP B O     1 
ATOM   2856 C CB    . TRP B 1 131 ? 56.661 86.734  3.361   1.00 38.85  ? 622 TRP B CB    1 
ATOM   2857 C CG    . TRP B 1 131 ? 56.368 85.677  2.340   1.00 39.74  ? 622 TRP B CG    1 
ATOM   2858 C CD1   . TRP B 1 131 ? 57.266 85.039  1.528   1.00 40.76  ? 622 TRP B CD1   1 
ATOM   2859 C CD2   . TRP B 1 131 ? 55.076 85.193  1.964   1.00 39.52  ? 622 TRP B CD2   1 
ATOM   2860 N NE1   . TRP B 1 131 ? 56.609 84.190  0.663   1.00 39.94  ? 622 TRP B NE1   1 
ATOM   2861 C CE2   . TRP B 1 131 ? 55.263 84.266  0.909   1.00 40.68  ? 622 TRP B CE2   1 
ATOM   2862 C CE3   . TRP B 1 131 ? 53.777 85.459  2.408   1.00 37.76  ? 622 TRP B CE3   1 
ATOM   2863 C CZ2   . TRP B 1 131 ? 54.195 83.604  0.291   1.00 40.58  ? 622 TRP B CZ2   1 
ATOM   2864 C CZ3   . TRP B 1 131 ? 52.719 84.807  1.792   1.00 39.33  ? 622 TRP B CZ3   1 
ATOM   2865 C CH2   . TRP B 1 131 ? 52.934 83.889  0.743   1.00 39.60  ? 622 TRP B CH2   1 
ATOM   2866 N N     . GLY B 1 132 ? 55.230 89.816  4.477   1.00 37.57  ? 623 GLY B N     1 
ATOM   2867 C CA    . GLY B 1 132 ? 55.304 90.771  5.573   1.00 37.43  ? 623 GLY B CA    1 
ATOM   2868 C C     . GLY B 1 132 ? 54.605 90.216  6.790   1.00 38.26  ? 623 GLY B C     1 
ATOM   2869 O O     . GLY B 1 132 ? 53.977 89.175  6.696   1.00 38.65  ? 623 GLY B O     1 
ATOM   2870 N N     . ILE B 1 133 ? 54.709 90.899  7.925   1.00 38.77  ? 624 ILE B N     1 
ATOM   2871 C CA    . ILE B 1 133 ? 54.069 90.444  9.159   1.00 40.79  ? 624 ILE B CA    1 
ATOM   2872 C C     . ILE B 1 133 ? 54.045 91.625  10.145  1.00 43.22  ? 624 ILE B C     1 
ATOM   2873 O O     . ILE B 1 133 ? 54.915 92.494  10.093  1.00 44.09  ? 624 ILE B O     1 
ATOM   2874 C CB    . ILE B 1 133 ? 54.782 89.186  9.696   1.00 39.06  ? 624 ILE B CB    1 
ATOM   2875 C CG1   . ILE B 1 133 ? 54.146 88.724  10.999  1.00 38.59  ? 624 ILE B CG1   1 
ATOM   2876 C CG2   . ILE B 1 133 ? 56.230 89.472  9.907   1.00 37.94  ? 624 ILE B CG2   1 
ATOM   2877 C CD1   . ILE B 1 133 ? 54.732 87.427  11.490  1.00 39.13  ? 624 ILE B CD1   1 
ATOM   2878 N N     . ASP B 1 134 ? 53.052 91.666  11.031  1.00 44.14  ? 625 ASP B N     1 
ATOM   2879 C CA    . ASP B 1 134 ? 52.931 92.777  11.971  1.00 44.75  ? 625 ASP B CA    1 
ATOM   2880 C C     . ASP B 1 134 ? 53.854 92.615  13.176  1.00 46.50  ? 625 ASP B C     1 
ATOM   2881 O O     . ASP B 1 134 ? 54.005 91.521  13.731  1.00 44.68  ? 625 ASP B O     1 
ATOM   2882 C CB    . ASP B 1 134 ? 51.504 92.972  12.466  1.00 44.23  ? 625 ASP B CB    1 
ATOM   2883 C CG    . ASP B 1 134 ? 51.001 91.797  13.262  1.00 45.09  ? 625 ASP B CG    1 
ATOM   2884 O OD1   . ASP B 1 134 ? 50.712 90.749  12.636  1.00 44.14  ? 625 ASP B OD1   1 
ATOM   2885 O OD2   . ASP B 1 134 ? 50.903 91.919  14.506  1.00 42.76  ? 625 ASP B OD2   1 
ATOM   2886 N N     . ARG B 1 135 ? 54.439 93.738  13.583  1.00 49.24  ? 626 ARG B N     1 
ATOM   2887 C CA    . ARG B 1 135 ? 55.364 93.768  14.702  1.00 51.64  ? 626 ARG B CA    1 
ATOM   2888 C C     . ARG B 1 135 ? 54.844 93.101  15.957  1.00 50.85  ? 626 ARG B C     1 
ATOM   2889 O O     . ARG B 1 135 ? 55.587 92.402  16.640  1.00 51.43  ? 626 ARG B O     1 
ATOM   2890 C CB    . ARG B 1 135 ? 55.773 95.208  15.013  1.00 55.20  ? 626 ARG B CB    1 
ATOM   2891 C CG    . ARG B 1 135 ? 54.623 96.199  15.038  1.00 59.14  ? 626 ARG B CG    1 
ATOM   2892 C CD    . ARG B 1 135 ? 55.131 97.587  15.421  1.00 60.95  ? 626 ARG B CD    1 
ATOM   2893 N NE    . ARG B 1 135 ? 55.431 97.686  16.843  1.00 61.00  ? 626 ARG B NE    1 
ATOM   2894 C CZ    . ARG B 1 135 ? 54.523 97.946  17.776  1.00 62.60  ? 626 ARG B CZ    1 
ATOM   2895 N NH1   . ARG B 1 135 ? 53.254 98.138  17.431  1.00 61.90  ? 626 ARG B NH1   1 
ATOM   2896 N NH2   . ARG B 1 135 ? 54.884 98.015  19.054  1.00 64.09  ? 626 ARG B NH2   1 
ATOM   2897 N N     . ASP B 1 136 ? 53.579 93.307  16.278  1.00 49.95  ? 627 ASP B N     1 
ATOM   2898 C CA    . ASP B 1 136 ? 53.049 92.678  17.477  1.00 49.57  ? 627 ASP B CA    1 
ATOM   2899 C C     . ASP B 1 136 ? 53.345 91.190  17.377  1.00 48.75  ? 627 ASP B C     1 
ATOM   2900 O O     . ASP B 1 136 ? 53.912 90.596  18.294  1.00 47.40  ? 627 ASP B O     1 
ATOM   2901 C CB    . ASP B 1 136 ? 51.539 92.913  17.586  1.00 50.60  ? 627 ASP B CB    1 
ATOM   2902 C CG    . ASP B 1 136 ? 51.183 94.385  17.621  1.00 50.41  ? 627 ASP B CG    1 
ATOM   2903 O OD1   . ASP B 1 136 ? 51.457 95.031  18.659  1.00 51.88  ? 627 ASP B OD1   1 
ATOM   2904 O OD2   . ASP B 1 136 ? 50.646 94.894  16.607  1.00 48.71  ? 627 ASP B OD2   1 
ATOM   2905 N N     . SER B 1 137 ? 52.981 90.604  16.239  1.00 47.72  ? 628 SER B N     1 
ATOM   2906 C CA    . SER B 1 137 ? 53.190 89.183  16.007  1.00 47.53  ? 628 SER B CA    1 
ATOM   2907 C C     . SER B 1 137 ? 54.669 88.855  15.991  1.00 46.79  ? 628 SER B C     1 
ATOM   2908 O O     . SER B 1 137 ? 55.092 87.840  16.566  1.00 45.68  ? 628 SER B O     1 
ATOM   2909 C CB    . SER B 1 137 ? 52.563 88.769  14.683  1.00 49.96  ? 628 SER B CB    1 
ATOM   2910 O OG    . SER B 1 137 ? 51.181 89.073  14.667  1.00 51.93  ? 628 SER B OG    1 
ATOM   2911 N N     . TYR B 1 138 ? 55.450 89.708  15.321  1.00 45.12  ? 629 TYR B N     1 
ATOM   2912 C CA    . TYR B 1 138 ? 56.895 89.517  15.248  1.00 43.36  ? 629 TYR B CA    1 
ATOM   2913 C C     . TYR B 1 138 ? 57.468 89.575  16.657  1.00 42.66  ? 629 TYR B C     1 
ATOM   2914 O O     . TYR B 1 138 ? 58.128 88.648  17.110  1.00 42.59  ? 629 TYR B O     1 
ATOM   2915 C CB    . TYR B 1 138 ? 57.569 90.604  14.402  1.00 42.82  ? 629 TYR B CB    1 
ATOM   2916 C CG    . TYR B 1 138 ? 59.076 90.390  14.246  1.00 43.99  ? 629 TYR B CG    1 
ATOM   2917 C CD1   . TYR B 1 138 ? 59.587 89.546  13.252  1.00 41.75  ? 629 TYR B CD1   1 
ATOM   2918 C CD2   . TYR B 1 138 ? 59.985 90.960  15.151  1.00 41.87  ? 629 TYR B CD2   1 
ATOM   2919 C CE1   . TYR B 1 138 ? 60.954 89.271  13.170  1.00 40.23  ? 629 TYR B CE1   1 
ATOM   2920 C CE2   . TYR B 1 138 ? 61.359 90.683  15.075  1.00 39.77  ? 629 TYR B CE2   1 
ATOM   2921 C CZ    . TYR B 1 138 ? 61.832 89.835  14.089  1.00 39.76  ? 629 TYR B CZ    1 
ATOM   2922 O OH    . TYR B 1 138 ? 63.163 89.490  14.058  1.00 36.82  ? 629 TYR B OH    1 
ATOM   2923 N N     . ARG B 1 139 ? 57.197 90.672  17.349  1.00 42.37  ? 630 ARG B N     1 
ATOM   2924 C CA    . ARG B 1 139 ? 57.706 90.862  18.695  1.00 43.18  ? 630 ARG B CA    1 
ATOM   2925 C C     . ARG B 1 139 ? 57.182 89.797  19.621  1.00 43.16  ? 630 ARG B C     1 
ATOM   2926 O O     . ARG B 1 139 ? 57.784 89.518  20.649  1.00 43.59  ? 630 ARG B O     1 
ATOM   2927 C CB    . ARG B 1 139 ? 57.311 92.240  19.245  1.00 44.43  ? 630 ARG B CB    1 
ATOM   2928 C CG    . ARG B 1 139 ? 57.836 93.448  18.455  1.00 45.40  ? 630 ARG B CG    1 
ATOM   2929 C CD    . ARG B 1 139 ? 57.621 94.782  19.192  1.00 45.38  ? 630 ARG B CD    1 
ATOM   2930 N NE    . ARG B 1 139 ? 58.566 94.983  20.294  1.00 47.00  ? 630 ARG B NE    1 
ATOM   2931 C CZ    . ARG B 1 139 ? 58.535 94.321  21.449  1.00 47.31  ? 630 ARG B CZ    1 
ATOM   2932 N NH1   . ARG B 1 139 ? 57.607 93.408  21.680  1.00 49.17  ? 630 ARG B NH1   1 
ATOM   2933 N NH2   . ARG B 1 139 ? 59.437 94.567  22.380  1.00 47.90  ? 630 ARG B NH2   1 
ATOM   2934 N N     . ARG B 1 140 ? 56.059 89.195  19.253  1.00 43.71  ? 631 ARG B N     1 
ATOM   2935 C CA    . ARG B 1 140 ? 55.451 88.171  20.094  1.00 44.07  ? 631 ARG B CA    1 
ATOM   2936 C C     . ARG B 1 140 ? 56.028 86.773  19.883  1.00 43.64  ? 631 ARG B C     1 
ATOM   2937 O O     . ARG B 1 140 ? 56.281 86.044  20.845  1.00 42.50  ? 631 ARG B O     1 
ATOM   2938 C CB    . ARG B 1 140 ? 53.939 88.117  19.842  1.00 45.58  ? 631 ARG B CB    1 
ATOM   2939 C CG    . ARG B 1 140 ? 53.113 87.479  20.976  1.00 47.02  ? 631 ARG B CG    1 
ATOM   2940 C CD    . ARG B 1 140 ? 51.932 86.669  20.437  1.00 48.56  ? 631 ARG B CD    1 
ATOM   2941 N NE    . ARG B 1 140 ? 51.345 87.255  19.229  1.00 50.57  ? 631 ARG B NE    1 
ATOM   2942 C CZ    . ARG B 1 140 ? 50.743 86.538  18.280  1.00 50.94  ? 631 ARG B CZ    1 
ATOM   2943 N NH1   . ARG B 1 140 ? 50.661 85.217  18.421  1.00 48.59  ? 631 ARG B NH1   1 
ATOM   2944 N NH2   . ARG B 1 140 ? 50.229 87.132  17.199  1.00 49.49  ? 631 ARG B NH2   1 
ATOM   2945 N N     . ILE B 1 141 ? 56.257 86.414  18.623  1.00 43.34  ? 632 ILE B N     1 
ATOM   2946 C CA    . ILE B 1 141 ? 56.736 85.071  18.290  1.00 41.86  ? 632 ILE B CA    1 
ATOM   2947 C C     . ILE B 1 141 ? 58.115 84.894  17.649  1.00 40.66  ? 632 ILE B C     1 
ATOM   2948 O O     . ILE B 1 141 ? 58.744 83.846  17.816  1.00 39.58  ? 632 ILE B O     1 
ATOM   2949 C CB    . ILE B 1 141 ? 55.740 84.404  17.320  1.00 41.42  ? 632 ILE B CB    1 
ATOM   2950 C CG1   . ILE B 1 141 ? 54.329 84.938  17.586  1.00 38.79  ? 632 ILE B CG1   1 
ATOM   2951 C CG2   . ILE B 1 141 ? 55.789 82.900  17.478  1.00 40.11  ? 632 ILE B CG2   1 
ATOM   2952 C CD1   . ILE B 1 141 ? 53.391 84.753  16.420  1.00 40.00  ? 632 ILE B CD1   1 
ATOM   2953 N N     . LEU B 1 142 ? 58.573 85.904  16.908  1.00 39.91  ? 633 LEU B N     1 
ATOM   2954 C CA    . LEU B 1 142 ? 59.858 85.828  16.217  1.00 38.58  ? 633 LEU B CA    1 
ATOM   2955 C C     . LEU B 1 142 ? 61.058 86.489  16.869  1.00 37.90  ? 633 LEU B C     1 
ATOM   2956 O O     . LEU B 1 142 ? 62.170 85.985  16.765  1.00 37.52  ? 633 LEU B O     1 
ATOM   2957 C CB    . LEU B 1 142 ? 59.732 86.339  14.781  1.00 38.09  ? 633 LEU B CB    1 
ATOM   2958 C CG    . LEU B 1 142 ? 59.126 85.421  13.727  1.00 37.04  ? 633 LEU B CG    1 
ATOM   2959 C CD1   . LEU B 1 142 ? 59.570 85.924  12.358  1.00 37.12  ? 633 LEU B CD1   1 
ATOM   2960 C CD2   . LEU B 1 142 ? 59.616 84.004  13.908  1.00 36.11  ? 633 LEU B CD2   1 
ATOM   2961 N N     . MET B 1 143 ? 60.842 87.627  17.523  1.00 37.79  ? 634 MET B N     1 
ATOM   2962 C CA    . MET B 1 143 ? 61.920 88.367  18.185  1.00 36.51  ? 634 MET B CA    1 
ATOM   2963 C C     . MET B 1 143 ? 62.791 87.518  19.126  1.00 37.25  ? 634 MET B C     1 
ATOM   2964 O O     . MET B 1 143 ? 63.998 87.380  18.915  1.00 36.70  ? 634 MET B O     1 
ATOM   2965 C CB    . MET B 1 143 ? 61.338 89.556  18.962  1.00 34.18  ? 634 MET B CB    1 
ATOM   2966 C CG    . MET B 1 143 ? 62.330 90.249  19.905  1.00 32.71  ? 634 MET B CG    1 
ATOM   2967 S SD    . MET B 1 143 ? 61.832 91.933  20.353  1.00 31.19  ? 634 MET B SD    1 
ATOM   2968 C CE    . MET B 1 143 ? 60.789 91.643  21.736  1.00 28.52  ? 634 MET B CE    1 
ATOM   2969 N N     . GLY B 1 144 ? 62.180 86.956  20.161  1.00 35.49  ? 635 GLY B N     1 
ATOM   2970 C CA    . GLY B 1 144 ? 62.935 86.156  21.100  1.00 35.27  ? 635 GLY B CA    1 
ATOM   2971 C C     . GLY B 1 144 ? 63.960 85.218  20.492  1.00 35.79  ? 635 GLY B C     1 
ATOM   2972 O O     . GLY B 1 144 ? 65.143 85.285  20.825  1.00 37.41  ? 635 GLY B O     1 
ATOM   2973 N N     . SER B 1 145 ? 63.526 84.334  19.601  1.00 35.22  ? 636 SER B N     1 
ATOM   2974 C CA    . SER B 1 145 ? 64.455 83.384  18.996  1.00 33.81  ? 636 SER B CA    1 
ATOM   2975 C C     . SER B 1 145 ? 65.530 84.121  18.178  1.00 33.79  ? 636 SER B C     1 
ATOM   2976 O O     . SER B 1 145 ? 66.702 83.737  18.187  1.00 32.44  ? 636 SER B O     1 
ATOM   2977 C CB    . SER B 1 145 ? 63.685 82.391  18.113  1.00 31.70  ? 636 SER B CB    1 
ATOM   2978 O OG    . SER B 1 145 ? 63.230 83.002  16.918  1.00 31.56  ? 636 SER B OG    1 
ATOM   2979 N N     . THR B 1 146 ? 65.109 85.178  17.482  1.00 32.25  ? 637 THR B N     1 
ATOM   2980 C CA    . THR B 1 146 ? 65.996 85.999  16.665  1.00 32.36  ? 637 THR B CA    1 
ATOM   2981 C C     . THR B 1 146 ? 67.156 86.590  17.508  1.00 33.09  ? 637 THR B C     1 
ATOM   2982 O O     . THR B 1 146 ? 68.334 86.414  17.183  1.00 32.94  ? 637 THR B O     1 
ATOM   2983 C CB    . THR B 1 146 ? 65.192 87.151  15.980  1.00 31.79  ? 637 THR B CB    1 
ATOM   2984 O OG1   . THR B 1 146 ? 64.518 86.661  14.818  1.00 30.96  ? 637 THR B OG1   1 
ATOM   2985 C CG2   . THR B 1 146 ? 66.094 88.275  15.573  1.00 31.78  ? 637 THR B CG2   1 
ATOM   2986 N N     . LEU B 1 147 ? 66.827 87.288  18.586  1.00 32.27  ? 638 LEU B N     1 
ATOM   2987 C CA    . LEU B 1 147 ? 67.855 87.873  19.424  1.00 32.50  ? 638 LEU B CA    1 
ATOM   2988 C C     . LEU B 1 147 ? 68.683 86.766  20.035  1.00 35.63  ? 638 LEU B C     1 
ATOM   2989 O O     . LEU B 1 147 ? 69.918 86.804  20.028  1.00 36.14  ? 638 LEU B O     1 
ATOM   2990 C CB    . LEU B 1 147 ? 67.221 88.707  20.522  1.00 29.88  ? 638 LEU B CB    1 
ATOM   2991 C CG    . LEU B 1 147 ? 66.583 89.988  20.010  1.00 31.51  ? 638 LEU B CG    1 
ATOM   2992 C CD1   . LEU B 1 147 ? 65.668 90.565  21.057  1.00 30.18  ? 638 LEU B CD1   1 
ATOM   2993 C CD2   . LEU B 1 147 ? 67.666 90.970  19.625  1.00 30.97  ? 638 LEU B CD2   1 
ATOM   2994 N N     . ARG B 1 148 ? 67.985 85.775  20.573  1.00 37.79  ? 639 ARG B N     1 
ATOM   2995 C CA    . ARG B 1 148 ? 68.625 84.632  21.192  1.00 37.74  ? 639 ARG B CA    1 
ATOM   2996 C C     . ARG B 1 148 ? 69.656 84.055  20.224  1.00 35.65  ? 639 ARG B C     1 
ATOM   2997 O O     . ARG B 1 148 ? 70.848 84.128  20.474  1.00 37.65  ? 639 ARG B O     1 
ATOM   2998 C CB    . ARG B 1 148 ? 67.557 83.593  21.514  1.00 41.69  ? 639 ARG B CB    1 
ATOM   2999 C CG    . ARG B 1 148 ? 67.979 82.475  22.446  1.00 45.53  ? 639 ARG B CG    1 
ATOM   3000 C CD    . ARG B 1 148 ? 66.750 81.702  22.923  1.00 49.32  ? 639 ARG B CD    1 
ATOM   3001 N NE    . ARG B 1 148 ? 65.889 82.528  23.773  1.00 52.92  ? 639 ARG B NE    1 
ATOM   3002 C CZ    . ARG B 1 148 ? 64.554 82.512  23.740  1.00 55.00  ? 639 ARG B CZ    1 
ATOM   3003 N NH1   . ARG B 1 148 ? 63.907 81.703  22.891  1.00 53.46  ? 639 ARG B NH1   1 
ATOM   3004 N NH2   . ARG B 1 148 ? 63.862 83.321  24.547  1.00 53.90  ? 639 ARG B NH2   1 
ATOM   3005 N N     . LYS B 1 149 ? 69.199 83.520  19.103  1.00 33.94  ? 640 LYS B N     1 
ATOM   3006 C CA    . LYS B 1 149 ? 70.092 82.933  18.103  1.00 33.63  ? 640 LYS B CA    1 
ATOM   3007 C C     . LYS B 1 149 ? 71.286 83.832  17.751  1.00 34.66  ? 640 LYS B C     1 
ATOM   3008 O O     . LYS B 1 149 ? 72.352 83.343  17.386  1.00 34.11  ? 640 LYS B O     1 
ATOM   3009 C CB    . LYS B 1 149 ? 69.304 82.628  16.844  1.00 31.65  ? 640 LYS B CB    1 
ATOM   3010 C CG    . LYS B 1 149 ? 70.115 82.112  15.686  1.00 29.75  ? 640 LYS B CG    1 
ATOM   3011 C CD    . LYS B 1 149 ? 70.426 80.661  15.847  1.00 30.31  ? 640 LYS B CD    1 
ATOM   3012 C CE    . LYS B 1 149 ? 70.910 80.071  14.533  1.00 31.89  ? 640 LYS B CE    1 
ATOM   3013 N NZ    . LYS B 1 149 ? 69.855 80.125  13.482  1.00 30.10  ? 640 LYS B NZ    1 
ATOM   3014 N N     . ARG B 1 150 ? 71.094 85.146  17.847  1.00 35.72  ? 641 ARG B N     1 
ATOM   3015 C CA    . ARG B 1 150 ? 72.139 86.117  17.525  1.00 34.94  ? 641 ARG B CA    1 
ATOM   3016 C C     . ARG B 1 150 ? 73.197 86.297  18.603  1.00 36.63  ? 641 ARG B C     1 
ATOM   3017 O O     . ARG B 1 150 ? 74.383 86.118  18.355  1.00 37.39  ? 641 ARG B O     1 
ATOM   3018 C CB    . ARG B 1 150 ? 71.519 87.497  17.279  1.00 31.29  ? 641 ARG B CB    1 
ATOM   3019 C CG    . ARG B 1 150 ? 70.802 87.606  15.952  1.00 27.90  ? 641 ARG B CG    1 
ATOM   3020 C CD    . ARG B 1 150 ? 70.215 88.982  15.718  1.00 24.62  ? 641 ARG B CD    1 
ATOM   3021 N NE    . ARG B 1 150 ? 69.725 89.131  14.347  1.00 23.76  ? 641 ARG B NE    1 
ATOM   3022 C CZ    . ARG B 1 150 ? 69.241 90.266  13.846  1.00 24.57  ? 641 ARG B CZ    1 
ATOM   3023 N NH1   . ARG B 1 150 ? 69.178 91.357  14.603  1.00 24.81  ? 641 ARG B NH1   1 
ATOM   3024 N NH2   . ARG B 1 150 ? 68.841 90.323  12.587  1.00 21.86  ? 641 ARG B NH2   1 
ATOM   3025 N N     . LYS B 1 151 ? 72.748 86.658  19.799  1.00 39.46  ? 642 LYS B N     1 
ATOM   3026 C CA    . LYS B 1 151 ? 73.610 86.870  20.955  1.00 40.77  ? 642 LYS B CA    1 
ATOM   3027 C C     . LYS B 1 151 ? 74.412 85.599  21.182  1.00 41.90  ? 642 LYS B C     1 
ATOM   3028 O O     . LYS B 1 151 ? 75.431 85.602  21.866  1.00 41.92  ? 642 LYS B O     1 
ATOM   3029 C CB    . LYS B 1 151 ? 72.748 87.157  22.185  1.00 41.40  ? 642 LYS B CB    1 
ATOM   3030 C CG    . LYS B 1 151 ? 73.499 87.577  23.450  1.00 44.94  ? 642 LYS B CG    1 
ATOM   3031 C CD    . LYS B 1 151 ? 74.063 89.001  23.315  1.00 48.71  ? 642 LYS B CD    1 
ATOM   3032 C CE    . LYS B 1 151 ? 74.518 89.594  24.654  1.00 49.13  ? 642 LYS B CE    1 
ATOM   3033 N NZ    . LYS B 1 151 ? 73.376 89.884  25.579  1.00 48.62  ? 642 LYS B NZ    1 
ATOM   3034 N N     . MET B 1 152 ? 73.950 84.506  20.596  1.00 43.68  ? 643 MET B N     1 
ATOM   3035 C CA    . MET B 1 152 ? 74.622 83.232  20.778  1.00 45.99  ? 643 MET B CA    1 
ATOM   3036 C C     . MET B 1 152 ? 75.757 82.952  19.796  1.00 46.26  ? 643 MET B C     1 
ATOM   3037 O O     . MET B 1 152 ? 76.691 82.219  20.117  1.00 46.43  ? 643 MET B O     1 
ATOM   3038 C CB    . MET B 1 152 ? 73.598 82.106  20.709  1.00 48.13  ? 643 MET B CB    1 
ATOM   3039 C CG    . MET B 1 152 ? 74.017 80.868  21.470  1.00 50.24  ? 643 MET B CG    1 
ATOM   3040 S SD    . MET B 1 152 ? 73.009 79.487  20.987  1.00 53.92  ? 643 MET B SD    1 
ATOM   3041 C CE    . MET B 1 152 ? 74.261 78.405  20.189  1.00 51.76  ? 643 MET B CE    1 
ATOM   3042 N N     . TYR B 1 153 ? 75.682 83.530  18.602  1.00 47.47  ? 644 TYR B N     1 
ATOM   3043 C CA    . TYR B 1 153 ? 76.717 83.315  17.600  1.00 49.25  ? 644 TYR B CA    1 
ATOM   3044 C C     . TYR B 1 153 ? 77.551 84.559  17.346  1.00 51.47  ? 644 TYR B C     1 
ATOM   3045 O O     . TYR B 1 153 ? 78.454 84.541  16.509  1.00 52.69  ? 644 TYR B O     1 
ATOM   3046 C CB    . TYR B 1 153 ? 76.094 82.836  16.291  1.00 47.69  ? 644 TYR B CB    1 
ATOM   3047 C CG    . TYR B 1 153 ? 75.606 81.411  16.334  1.00 47.40  ? 644 TYR B CG    1 
ATOM   3048 C CD1   . TYR B 1 153 ? 76.493 80.350  16.215  1.00 46.68  ? 644 TYR B CD1   1 
ATOM   3049 C CD2   . TYR B 1 153 ? 74.255 81.122  16.502  1.00 46.68  ? 644 TYR B CD2   1 
ATOM   3050 C CE1   . TYR B 1 153 ? 76.047 79.037  16.259  1.00 46.11  ? 644 TYR B CE1   1 
ATOM   3051 C CE2   . TYR B 1 153 ? 73.800 79.815  16.548  1.00 46.17  ? 644 TYR B CE2   1 
ATOM   3052 C CZ    . TYR B 1 153 ? 74.701 78.780  16.426  1.00 47.48  ? 644 TYR B CZ    1 
ATOM   3053 O OH    . TYR B 1 153 ? 74.253 77.482  16.473  1.00 50.07  ? 644 TYR B OH    1 
ATOM   3054 N N     . GLU B 1 154 ? 77.247 85.638  18.062  1.00 53.11  ? 645 GLU B N     1 
ATOM   3055 C CA    . GLU B 1 154 ? 77.984 86.896  17.929  1.00 54.34  ? 645 GLU B CA    1 
ATOM   3056 C C     . GLU B 1 154 ? 79.503 86.764  17.853  1.00 55.30  ? 645 GLU B C     1 
ATOM   3057 O O     . GLU B 1 154 ? 80.123 87.019  16.809  1.00 54.57  ? 645 GLU B O     1 
ATOM   3058 C CB    . GLU B 1 154 ? 77.716 87.777  19.145  1.00 54.77  ? 645 GLU B CB    1 
ATOM   3059 C CG    . GLU B 1 154 ? 76.882 89.007  18.887  1.00 57.92  ? 645 GLU B CG    1 
ATOM   3060 C CD    . GLU B 1 154 ? 76.293 89.556  20.178  1.00 59.21  ? 645 GLU B CD    1 
ATOM   3061 O OE1   . GLU B 1 154 ? 77.048 89.652  21.168  1.00 59.03  ? 645 GLU B OE1   1 
ATOM   3062 O OE2   . GLU B 1 154 ? 75.085 89.887  20.207  1.00 59.05  ? 645 GLU B OE2   1 
ATOM   3063 N N     . GLU B 1 155 ? 80.080 86.354  18.983  1.00 55.81  ? 646 GLU B N     1 
ATOM   3064 C CA    . GLU B 1 155 ? 81.520 86.181  19.145  1.00 56.81  ? 646 GLU B CA    1 
ATOM   3065 C C     . GLU B 1 155 ? 82.070 85.086  18.250  1.00 55.52  ? 646 GLU B C     1 
ATOM   3066 O O     . GLU B 1 155 ? 83.007 85.328  17.496  1.00 54.95  ? 646 GLU B O     1 
ATOM   3067 C CB    . GLU B 1 155 ? 81.811 85.822  20.633  1.00 58.44  ? 646 GLU B CB    1 
ATOM   3068 C CG    . GLU B 1 155 ? 81.337 86.880  21.628  1.00 60.39  ? 646 GLU B CG    1 
ATOM   3069 C CD    . GLU B 1 155 ? 82.116 88.182  21.538  1.00 61.88  ? 646 GLU B CD    1 
ATOM   3070 O OE1   . GLU B 1 155 ? 82.619 88.522  20.442  1.00 62.34  ? 646 GLU B OE1   1 
ATOM   3071 O OE2   . GLU B 1 155 ? 82.212 88.877  22.571  1.00 62.44  ? 646 GLU B OE2   1 
ATOM   3072 N N     . PHE B 1 156 ? 81.504 83.891  18.315  1.00 54.59  ? 647 PHE B N     1 
ATOM   3073 C CA    . PHE B 1 156 ? 81.968 82.808  17.469  1.00 53.84  ? 647 PHE B CA    1 
ATOM   3074 C C     . PHE B 1 156 ? 82.115 83.269  16.025  1.00 55.29  ? 647 PHE B C     1 
ATOM   3075 O O     . PHE B 1 156 ? 82.949 82.753  15.289  1.00 56.70  ? 647 PHE B O     1 
ATOM   3076 C CB    . PHE B 1 156 ? 80.986 81.648  17.506  1.00 51.86  ? 647 PHE B CB    1 
ATOM   3077 C CG    . PHE B 1 156 ? 81.393 80.492  16.651  1.00 50.15  ? 647 PHE B CG    1 
ATOM   3078 C CD1   . PHE B 1 156 ? 82.245 79.515  17.143  1.00 49.41  ? 647 PHE B CD1   1 
ATOM   3079 C CD2   . PHE B 1 156 ? 80.944 80.392  15.343  1.00 49.79  ? 647 PHE B CD2   1 
ATOM   3080 C CE1   . PHE B 1 156 ? 82.644 78.456  16.347  1.00 48.52  ? 647 PHE B CE1   1 
ATOM   3081 C CE2   . PHE B 1 156 ? 81.340 79.339  14.541  1.00 48.90  ? 647 PHE B CE2   1 
ATOM   3082 C CZ    . PHE B 1 156 ? 82.193 78.368  15.047  1.00 49.10  ? 647 PHE B CZ    1 
ATOM   3083 N N     . LEU B 1 157 ? 81.303 84.235  15.611  1.00 56.08  ? 648 LEU B N     1 
ATOM   3084 C CA    . LEU B 1 157 ? 81.386 84.711  14.238  1.00 57.14  ? 648 LEU B CA    1 
ATOM   3085 C C     . LEU B 1 157 ? 82.360 85.864  14.058  1.00 58.50  ? 648 LEU B C     1 
ATOM   3086 O O     . LEU B 1 157 ? 82.950 86.011  12.987  1.00 58.65  ? 648 LEU B O     1 
ATOM   3087 C CB    . LEU B 1 157 ? 80.000 85.101  13.721  1.00 56.23  ? 648 LEU B CB    1 
ATOM   3088 C CG    . LEU B 1 157 ? 79.057 83.921  13.448  1.00 54.48  ? 648 LEU B CG    1 
ATOM   3089 C CD1   . LEU B 1 157 ? 77.738 84.430  12.886  1.00 52.56  ? 648 LEU B CD1   1 
ATOM   3090 C CD2   . LEU B 1 157 ? 79.716 82.955  12.483  1.00 51.65  ? 648 LEU B CD2   1 
ATOM   3091 N N     . SER B 1 158 ? 82.536 86.681  15.094  1.00 60.22  ? 649 SER B N     1 
ATOM   3092 C CA    . SER B 1 158 ? 83.476 87.797  15.001  1.00 60.96  ? 649 SER B CA    1 
ATOM   3093 C C     . SER B 1 158 ? 84.896 87.242  14.954  1.00 61.78  ? 649 SER B C     1 
ATOM   3094 O O     . SER B 1 158 ? 85.779 87.832  14.335  1.00 62.85  ? 649 SER B O     1 
ATOM   3095 C CB    . SER B 1 158 ? 83.316 88.772  16.186  1.00 60.87  ? 649 SER B CB    1 
ATOM   3096 O OG    . SER B 1 158 ? 83.523 88.156  17.446  1.00 59.24  ? 649 SER B OG    1 
ATOM   3097 N N     . LYS B 1 159 ? 85.107 86.097  15.600  1.00 62.14  ? 650 LYS B N     1 
ATOM   3098 C CA    . LYS B 1 159 ? 86.418 85.457  15.614  1.00 62.93  ? 650 LYS B CA    1 
ATOM   3099 C C     . LYS B 1 159 ? 86.551 84.453  14.471  1.00 63.74  ? 650 LYS B C     1 
ATOM   3100 O O     . LYS B 1 159 ? 87.414 83.573  14.499  1.00 63.67  ? 650 LYS B O     1 
ATOM   3101 C CB    . LYS B 1 159 ? 86.691 84.809  16.974  1.00 62.34  ? 650 LYS B CB    1 
ATOM   3102 C CG    . LYS B 1 159 ? 86.489 85.723  18.171  1.00 62.23  ? 650 LYS B CG    1 
ATOM   3103 C CD    . LYS B 1 159 ? 86.891 85.016  19.461  1.00 62.65  ? 650 LYS B CD    1 
ATOM   3104 C CE    . LYS B 1 159 ? 86.326 85.703  20.707  1.00 63.74  ? 650 LYS B CE    1 
ATOM   3105 N NZ    . LYS B 1 159 ? 84.849 85.501  20.892  1.00 61.57  ? 650 LYS B NZ    1 
ATOM   3106 N N     . VAL B 1 160 ? 85.689 84.584  13.470  1.00 65.00  ? 651 VAL B N     1 
ATOM   3107 C CA    . VAL B 1 160 ? 85.711 83.687  12.324  1.00 66.84  ? 651 VAL B CA    1 
ATOM   3108 C C     . VAL B 1 160 ? 86.388 84.236  11.085  1.00 67.83  ? 651 VAL B C     1 
ATOM   3109 O O     . VAL B 1 160 ? 86.000 83.940  9.955   1.00 67.69  ? 651 VAL B O     1 
ATOM   3110 C CB    . VAL B 1 160 ? 84.255 83.300  12.019  1.00 66.93  ? 651 VAL B CB    1 
ATOM   3111 N N     . SER B 1 161 ? 87.405 85.064  11.316  1.00 68.82  ? 652 SER B N     1 
ATOM   3112 C CA    . SER B 1 161 ? 88.223 85.658  10.258  1.00 69.49  ? 652 SER B CA    1 
ATOM   3113 C C     . SER B 1 161 ? 87.739 85.887  8.830   1.00 69.55  ? 652 SER B C     1 
ATOM   3114 O O     . SER B 1 161 ? 87.788 87.015  8.331   1.00 70.34  ? 652 SER B O     1 
ATOM   3115 C CB    . SER B 1 161 ? 89.473 84.790  10.060  1.00 69.65  ? 652 SER B CB    1 
ATOM   3116 O OG    . SER B 1 161 ? 89.093 83.475  9.677   1.00 70.51  ? 652 SER B OG    1 
ATOM   3117 N N     . ILE B 1 162 ? 87.307 84.809  8.170   1.00 67.39  ? 653 ILE B N     1 
ATOM   3118 C CA    . ILE B 1 162 ? 86.824 84.862  6.792   1.00 66.10  ? 653 ILE B CA    1 
ATOM   3119 C C     . ILE B 1 162 ? 85.589 85.740  6.741   1.00 65.87  ? 653 ILE B C     1 
ATOM   3120 O O     . ILE B 1 162 ? 85.241 86.275  5.683   1.00 65.03  ? 653 ILE B O     1 
ATOM   3121 C CB    . ILE B 1 162 ? 86.444 83.431  6.363   1.00 66.22  ? 653 ILE B CB    1 
ATOM   3122 N N     . LEU B 1 163 ? 84.946 85.920  7.888   1.00 65.44  ? 654 LEU B N     1 
ATOM   3123 C CA    . LEU B 1 163 ? 83.758 86.753  7.982   1.00 64.64  ? 654 LEU B CA    1 
ATOM   3124 C C     . LEU B 1 163 ? 84.089 88.222  8.271   1.00 64.41  ? 654 LEU B C     1 
ATOM   3125 O O     . LEU B 1 163 ? 83.221 89.090  8.128   1.00 63.58  ? 654 LEU B O     1 
ATOM   3126 C CB    . LEU B 1 163 ? 82.835 86.207  9.079   1.00 64.51  ? 654 LEU B CB    1 
ATOM   3127 C CG    . LEU B 1 163 ? 82.594 84.691  9.096   1.00 64.32  ? 654 LEU B CG    1 
ATOM   3128 C CD1   . LEU B 1 163 ? 81.751 84.325  10.308  1.00 63.88  ? 654 LEU B CD1   1 
ATOM   3129 C CD2   . LEU B 1 163 ? 81.910 84.246  7.811   1.00 64.23  ? 654 LEU B CD2   1 
ATOM   3130 N N     . GLU B 1 164 ? 85.335 88.495  8.676   1.00 64.18  ? 655 GLU B N     1 
ATOM   3131 C CA    . GLU B 1 164 ? 85.781 89.862  8.998   1.00 63.54  ? 655 GLU B CA    1 
ATOM   3132 C C     . GLU B 1 164 ? 85.404 90.819  7.871   1.00 61.54  ? 655 GLU B C     1 
ATOM   3133 O O     . GLU B 1 164 ? 85.224 92.023  8.076   1.00 59.56  ? 655 GLU B O     1 
ATOM   3134 C CB    . GLU B 1 164 ? 87.299 89.908  9.191   1.00 65.61  ? 655 GLU B CB    1 
ATOM   3135 C CG    . GLU B 1 164 ? 88.083 89.789  7.887   1.00 68.04  ? 655 GLU B CG    1 
ATOM   3136 C CD    . GLU B 1 164 ? 89.535 90.227  8.024   1.00 69.31  ? 655 GLU B CD    1 
ATOM   3137 O OE1   . GLU B 1 164 ? 90.291 89.578  8.786   1.00 68.84  ? 655 GLU B OE1   1 
ATOM   3138 O OE2   . GLU B 1 164 ? 89.914 91.226  7.370   1.00 69.99  ? 655 GLU B OE2   1 
ATOM   3139 N N     . SER B 1 165 ? 85.298 90.258  6.673   1.00 59.22  ? 656 SER B N     1 
ATOM   3140 C CA    . SER B 1 165 ? 84.934 91.017  5.500   1.00 56.64  ? 656 SER B CA    1 
ATOM   3141 C C     . SER B 1 165 ? 83.529 91.593  5.642   1.00 54.69  ? 656 SER B C     1 
ATOM   3142 O O     . SER B 1 165 ? 83.253 92.680  5.148   1.00 54.55  ? 656 SER B O     1 
ATOM   3143 C CB    . SER B 1 165 ? 85.005 90.113  4.273   1.00 57.60  ? 656 SER B CB    1 
ATOM   3144 O OG    . SER B 1 165 ? 84.537 90.789  3.116   1.00 58.91  ? 656 SER B OG    1 
ATOM   3145 N N     . LEU B 1 166 ? 82.644 90.864  6.320   1.00 52.98  ? 657 LEU B N     1 
ATOM   3146 C CA    . LEU B 1 166 ? 81.262 91.310  6.506   1.00 49.92  ? 657 LEU B CA    1 
ATOM   3147 C C     . LEU B 1 166 ? 81.095 92.395  7.550   1.00 48.10  ? 657 LEU B C     1 
ATOM   3148 O O     . LEU B 1 166 ? 81.946 92.581  8.428   1.00 47.40  ? 657 LEU B O     1 
ATOM   3149 C CB    . LEU B 1 166 ? 80.348 90.138  6.878   1.00 48.63  ? 657 LEU B CB    1 
ATOM   3150 C CG    . LEU B 1 166 ? 79.846 89.208  5.773   1.00 48.11  ? 657 LEU B CG    1 
ATOM   3151 C CD1   . LEU B 1 166 ? 80.995 88.443  5.178   1.00 47.80  ? 657 LEU B CD1   1 
ATOM   3152 C CD2   . LEU B 1 166 ? 78.825 88.245  6.346   1.00 49.08  ? 657 LEU B CD2   1 
ATOM   3153 N N     . ASP B 1 167 ? 79.976 93.106  7.436   1.00 46.55  ? 658 ASP B N     1 
ATOM   3154 C CA    . ASP B 1 167 ? 79.622 94.184  8.357   1.00 45.49  ? 658 ASP B CA    1 
ATOM   3155 C C     . ASP B 1 167 ? 78.797 93.602  9.501   1.00 43.89  ? 658 ASP B C     1 
ATOM   3156 O O     . ASP B 1 167 ? 78.364 92.455  9.440   1.00 44.75  ? 658 ASP B O     1 
ATOM   3157 C CB    . ASP B 1 167 ? 78.788 95.244  7.634   1.00 45.59  ? 658 ASP B CB    1 
ATOM   3158 C CG    . ASP B 1 167 ? 77.504 94.672  7.044   1.00 46.48  ? 658 ASP B CG    1 
ATOM   3159 O OD1   . ASP B 1 167 ? 76.678 94.118  7.807   1.00 45.28  ? 658 ASP B OD1   1 
ATOM   3160 O OD2   . ASP B 1 167 ? 77.323 94.774  5.813   1.00 46.63  ? 658 ASP B OD2   1 
ATOM   3161 N N     . LYS B 1 168 ? 78.571 94.400  10.533  1.00 42.16  ? 659 LYS B N     1 
ATOM   3162 C CA    . LYS B 1 168 ? 77.796 93.960  11.681  1.00 41.86  ? 659 LYS B CA    1 
ATOM   3163 C C     . LYS B 1 168 ? 76.556 93.192  11.252  1.00 42.31  ? 659 LYS B C     1 
ATOM   3164 O O     . LYS B 1 168 ? 76.391 92.022  11.613  1.00 43.09  ? 659 LYS B O     1 
ATOM   3165 C CB    . LYS B 1 168 ? 77.370 95.165  12.508  1.00 42.78  ? 659 LYS B CB    1 
ATOM   3166 C CG    . LYS B 1 168 ? 76.581 94.821  13.747  1.00 44.89  ? 659 LYS B CG    1 
ATOM   3167 C CD    . LYS B 1 168 ? 77.421 94.033  14.725  1.00 47.34  ? 659 LYS B CD    1 
ATOM   3168 C CE    . LYS B 1 168 ? 76.839 94.129  16.136  1.00 49.08  ? 659 LYS B CE    1 
ATOM   3169 N NZ    . LYS B 1 168 ? 76.787 95.538  16.646  1.00 47.86  ? 659 LYS B NZ    1 
ATOM   3170 N N     . TRP B 1 169 ? 75.696 93.854  10.472  1.00 41.46  ? 660 TRP B N     1 
ATOM   3171 C CA    . TRP B 1 169 ? 74.449 93.259  9.998   1.00 39.52  ? 660 TRP B CA    1 
ATOM   3172 C C     . TRP B 1 169 ? 74.629 91.974  9.197   1.00 39.76  ? 660 TRP B C     1 
ATOM   3173 O O     . TRP B 1 169 ? 73.924 90.992  9.417   1.00 39.69  ? 660 TRP B O     1 
ATOM   3174 C CB    . TRP B 1 169 ? 73.661 94.258  9.153   1.00 35.99  ? 660 TRP B CB    1 
ATOM   3175 C CG    . TRP B 1 169 ? 72.199 93.910  9.057   1.00 33.57  ? 660 TRP B CG    1 
ATOM   3176 C CD1   . TRP B 1 169 ? 71.256 94.072  10.032  1.00 32.35  ? 660 TRP B CD1   1 
ATOM   3177 C CD2   . TRP B 1 169 ? 71.517 93.331  7.932   1.00 32.36  ? 660 TRP B CD2   1 
ATOM   3178 N NE1   . TRP B 1 169 ? 70.029 93.632  9.587   1.00 31.23  ? 660 TRP B NE1   1 
ATOM   3179 C CE2   . TRP B 1 169 ? 70.158 93.174  8.303   1.00 31.15  ? 660 TRP B CE2   1 
ATOM   3180 C CE3   . TRP B 1 169 ? 71.918 92.934  6.647   1.00 32.93  ? 660 TRP B CE3   1 
ATOM   3181 C CZ2   . TRP B 1 169 ? 69.199 92.640  7.437   1.00 30.21  ? 660 TRP B CZ2   1 
ATOM   3182 C CZ3   . TRP B 1 169 ? 70.959 92.401  5.783   1.00 32.11  ? 660 TRP B CZ3   1 
ATOM   3183 C CH2   . TRP B 1 169 ? 69.613 92.261  6.189   1.00 31.18  ? 660 TRP B CH2   1 
ATOM   3184 N N     . GLU B 1 170 ? 75.556 91.979  8.252   1.00 39.66  ? 661 GLU B N     1 
ATOM   3185 C CA    . GLU B 1 170 ? 75.775 90.787  7.462   1.00 40.32  ? 661 GLU B CA    1 
ATOM   3186 C C     . GLU B 1 170 ? 76.151 89.632  8.383   1.00 41.11  ? 661 GLU B C     1 
ATOM   3187 O O     . GLU B 1 170 ? 75.827 88.478  8.104   1.00 42.42  ? 661 GLU B O     1 
ATOM   3188 C CB    . GLU B 1 170 ? 76.875 91.037  6.437   1.00 39.70  ? 661 GLU B CB    1 
ATOM   3189 C CG    . GLU B 1 170 ? 76.478 92.049  5.388   1.00 39.58  ? 661 GLU B CG    1 
ATOM   3190 C CD    . GLU B 1 170 ? 77.537 92.254  4.326   1.00 39.15  ? 661 GLU B CD    1 
ATOM   3191 O OE1   . GLU B 1 170 ? 78.670 92.633  4.697   1.00 38.07  ? 661 GLU B OE1   1 
ATOM   3192 O OE2   . GLU B 1 170 ? 77.229 92.040  3.129   1.00 38.50  ? 661 GLU B OE2   1 
ATOM   3193 N N     . ARG B 1 171 ? 76.825 89.950  9.486   1.00 41.06  ? 662 ARG B N     1 
ATOM   3194 C CA    . ARG B 1 171 ? 77.244 88.938  10.446  1.00 40.80  ? 662 ARG B CA    1 
ATOM   3195 C C     . ARG B 1 171 ? 76.005 88.259  11.003  1.00 38.85  ? 662 ARG B C     1 
ATOM   3196 O O     . ARG B 1 171 ? 75.838 87.042  10.859  1.00 38.80  ? 662 ARG B O     1 
ATOM   3197 C CB    . ARG B 1 171 ? 78.050 89.578  11.573  1.00 44.97  ? 662 ARG B CB    1 
ATOM   3198 C CG    . ARG B 1 171 ? 78.660 88.554  12.517  1.00 50.63  ? 662 ARG B CG    1 
ATOM   3199 C CD    . ARG B 1 171 ? 80.064 88.950  12.965  1.00 54.22  ? 662 ARG B CD    1 
ATOM   3200 N NE    . ARG B 1 171 ? 80.934 89.311  11.845  1.00 55.05  ? 662 ARG B NE    1 
ATOM   3201 C CZ    . ARG B 1 171 ? 81.245 90.564  11.529  1.00 56.32  ? 662 ARG B CZ    1 
ATOM   3202 N NH1   . ARG B 1 171 ? 80.755 91.565  12.247  1.00 56.43  ? 662 ARG B NH1   1 
ATOM   3203 N NH2   . ARG B 1 171 ? 82.053 90.818  10.506  1.00 57.73  ? 662 ARG B NH2   1 
ATOM   3204 N N     . LEU B 1 172 ? 75.151 89.064  11.642  1.00 35.69  ? 663 LEU B N     1 
ATOM   3205 C CA    . LEU B 1 172 ? 73.870 88.621  12.196  1.00 29.98  ? 663 LEU B CA    1 
ATOM   3206 C C     . LEU B 1 172 ? 73.210 87.762  11.129  1.00 30.39  ? 663 LEU B C     1 
ATOM   3207 O O     . LEU B 1 172 ? 72.795 86.641  11.373  1.00 32.69  ? 663 LEU B O     1 
ATOM   3208 C CB    . LEU B 1 172 ? 72.991 89.830  12.452  1.00 22.43  ? 663 LEU B CB    1 
ATOM   3209 C CG    . LEU B 1 172 ? 73.605 90.856  13.385  1.00 20.90  ? 663 LEU B CG    1 
ATOM   3210 C CD1   . LEU B 1 172 ? 72.915 92.187  13.214  1.00 20.63  ? 663 LEU B CD1   1 
ATOM   3211 C CD2   . LEU B 1 172 ? 73.486 90.376  14.803  1.00 19.87  ? 663 LEU B CD2   1 
ATOM   3212 N N     . THR B 1 173 ? 73.119 88.319  9.935   1.00 31.01  ? 664 THR B N     1 
ATOM   3213 C CA    . THR B 1 173 ? 72.541 87.638  8.802   1.00 32.28  ? 664 THR B CA    1 
ATOM   3214 C C     . THR B 1 173 ? 73.036 86.204  8.654   1.00 33.55  ? 664 THR B C     1 
ATOM   3215 O O     . THR B 1 173 ? 72.248 85.297  8.358   1.00 33.55  ? 664 THR B O     1 
ATOM   3216 C CB    . THR B 1 173 ? 72.829 88.427  7.533   1.00 32.54  ? 664 THR B CB    1 
ATOM   3217 O OG1   . THR B 1 173 ? 72.011 89.600  7.535   1.00 33.38  ? 664 THR B OG1   1 
ATOM   3218 C CG2   . THR B 1 173 ? 72.547 87.595  6.290   1.00 32.89  ? 664 THR B CG2   1 
ATOM   3219 N N     . VAL B 1 174 ? 74.336 85.997  8.843   1.00 33.94  ? 665 VAL B N     1 
ATOM   3220 C CA    . VAL B 1 174 ? 74.890 84.648  8.747   1.00 34.84  ? 665 VAL B CA    1 
ATOM   3221 C C     . VAL B 1 174 ? 74.284 83.837  9.898   1.00 34.36  ? 665 VAL B C     1 
ATOM   3222 O O     . VAL B 1 174 ? 73.852 82.692  9.730   1.00 32.31  ? 665 VAL B O     1 
ATOM   3223 C CB    . VAL B 1 174 ? 76.426 84.655  8.891   1.00 34.26  ? 665 VAL B CB    1 
ATOM   3224 C CG1   . VAL B 1 174 ? 76.960 83.234  8.882   1.00 34.96  ? 665 VAL B CG1   1 
ATOM   3225 C CG2   . VAL B 1 174 ? 77.041 85.437  7.763   1.00 36.96  ? 665 VAL B CG2   1 
ATOM   3226 N N     . ALA B 1 175 ? 74.263 84.463  11.067  1.00 35.45  ? 666 ALA B N     1 
ATOM   3227 C CA    . ALA B 1 175 ? 73.717 83.856  12.262  1.00 37.35  ? 666 ALA B CA    1 
ATOM   3228 C C     . ALA B 1 175 ? 72.300 83.402  11.951  1.00 38.70  ? 666 ALA B C     1 
ATOM   3229 O O     . ALA B 1 175 ? 71.985 82.207  12.005  1.00 40.11  ? 666 ALA B O     1 
ATOM   3230 C CB    . ALA B 1 175 ? 73.708 84.872  13.404  1.00 36.27  ? 666 ALA B CB    1 
ATOM   3231 N N     . ASP B 1 176 ? 71.447 84.363  11.610  1.00 38.54  ? 667 ASP B N     1 
ATOM   3232 C CA    . ASP B 1 176 ? 70.062 84.055  11.299  1.00 37.71  ? 667 ASP B CA    1 
ATOM   3233 C C     . ASP B 1 176 ? 69.964 82.797  10.464  1.00 36.50  ? 667 ASP B C     1 
ATOM   3234 O O     . ASP B 1 176 ? 69.215 81.884  10.793  1.00 37.46  ? 667 ASP B O     1 
ATOM   3235 C CB    . ASP B 1 176 ? 69.414 85.219  10.560  1.00 37.98  ? 667 ASP B CB    1 
ATOM   3236 C CG    . ASP B 1 176 ? 69.222 86.432  11.449  1.00 41.32  ? 667 ASP B CG    1 
ATOM   3237 O OD1   . ASP B 1 176 ? 69.540 86.352  12.655  1.00 43.26  ? 667 ASP B OD1   1 
ATOM   3238 O OD2   . ASP B 1 176 ? 68.745 87.471  10.946  1.00 43.29  ? 667 ASP B OD2   1 
ATOM   3239 N N     . ALA B 1 177 ? 70.766 82.738  9.413   1.00 35.08  ? 668 ALA B N     1 
ATOM   3240 C CA    . ALA B 1 177 ? 70.755 81.621  8.491   1.00 34.11  ? 668 ALA B CA    1 
ATOM   3241 C C     . ALA B 1 177 ? 71.392 80.340  9.000   1.00 35.72  ? 668 ALA B C     1 
ATOM   3242 O O     . ALA B 1 177 ? 71.323 79.301  8.337   1.00 35.83  ? 668 ALA B O     1 
ATOM   3243 C CB    . ALA B 1 177 ? 71.428 82.044  7.204   1.00 32.07  ? 668 ALA B CB    1 
ATOM   3244 N N     . LEU B 1 178 ? 71.999 80.387  10.177  1.00 37.25  ? 669 LEU B N     1 
ATOM   3245 C CA    . LEU B 1 178 ? 72.686 79.201  10.685  1.00 38.47  ? 669 LEU B CA    1 
ATOM   3246 C C     . LEU B 1 178 ? 71.837 78.033  11.157  1.00 39.66  ? 669 LEU B C     1 
ATOM   3247 O O     . LEU B 1 178 ? 70.950 78.193  11.993  1.00 40.91  ? 669 LEU B O     1 
ATOM   3248 C CB    . LEU B 1 178 ? 73.668 79.613  11.785  1.00 36.54  ? 669 LEU B CB    1 
ATOM   3249 C CG    . LEU B 1 178 ? 74.945 80.262  11.240  1.00 35.22  ? 669 LEU B CG    1 
ATOM   3250 C CD1   . LEU B 1 178 ? 75.760 80.801  12.377  1.00 36.84  ? 669 LEU B CD1   1 
ATOM   3251 C CD2   . LEU B 1 178 ? 75.744 79.250  10.446  1.00 33.59  ? 669 LEU B CD2   1 
ATOM   3252 N N     . GLU B 1 179 ? 72.120 76.850  10.621  1.00 41.46  ? 670 GLU B N     1 
ATOM   3253 C CA    . GLU B 1 179 ? 71.387 75.650  11.015  1.00 44.23  ? 670 GLU B CA    1 
ATOM   3254 C C     . GLU B 1 179 ? 72.238 74.739  11.913  1.00 44.77  ? 670 GLU B C     1 
ATOM   3255 O O     . GLU B 1 179 ? 73.230 74.155  11.482  1.00 44.14  ? 670 GLU B O     1 
ATOM   3256 C CB    . GLU B 1 179 ? 70.920 74.869  9.781   1.00 45.60  ? 670 GLU B CB    1 
ATOM   3257 C CG    . GLU B 1 179 ? 70.030 73.673  10.110  1.00 47.93  ? 670 GLU B CG    1 
ATOM   3258 C CD    . GLU B 1 179 ? 69.788 72.760  8.911   1.00 50.31  ? 670 GLU B CD    1 
ATOM   3259 O OE1   . GLU B 1 179 ? 69.120 71.712  9.083   1.00 48.93  ? 670 GLU B OE1   1 
ATOM   3260 O OE2   . GLU B 1 179 ? 70.268 73.092  7.802   1.00 50.97  ? 670 GLU B OE2   1 
ATOM   3261 N N     . PRO B 1 180 ? 71.859 74.624  13.189  1.00 46.05  ? 671 PRO B N     1 
ATOM   3262 C CA    . PRO B 1 180 ? 72.584 73.786  14.140  1.00 47.36  ? 671 PRO B CA    1 
ATOM   3263 C C     . PRO B 1 180 ? 72.445 72.326  13.783  1.00 49.24  ? 671 PRO B C     1 
ATOM   3264 O O     . PRO B 1 180 ? 71.335 71.839  13.659  1.00 50.22  ? 671 PRO B O     1 
ATOM   3265 C CB    . PRO B 1 180 ? 71.894 74.092  15.462  1.00 46.63  ? 671 PRO B CB    1 
ATOM   3266 C CG    . PRO B 1 180 ? 71.419 75.492  15.283  1.00 46.71  ? 671 PRO B CG    1 
ATOM   3267 C CD    . PRO B 1 180 ? 70.865 75.457  13.886  1.00 46.62  ? 671 PRO B CD    1 
ATOM   3268 N N     . VAL B 1 181 ? 73.563 71.629  13.622  1.00 52.14  ? 672 VAL B N     1 
ATOM   3269 C CA    . VAL B 1 181 ? 73.537 70.203  13.316  1.00 54.27  ? 672 VAL B CA    1 
ATOM   3270 C C     . VAL B 1 181 ? 74.664 69.456  14.029  1.00 57.10  ? 672 VAL B C     1 
ATOM   3271 O O     . VAL B 1 181 ? 75.828 69.861  13.976  1.00 57.35  ? 672 VAL B O     1 
ATOM   3272 C CB    . VAL B 1 181 ? 73.645 69.960  11.807  1.00 54.16  ? 672 VAL B CB    1 
ATOM   3273 C CG1   . VAL B 1 181 ? 72.323 70.293  11.138  1.00 55.52  ? 672 VAL B CG1   1 
ATOM   3274 C CG2   . VAL B 1 181 ? 74.744 70.816  11.223  1.00 53.96  ? 672 VAL B CG2   1 
ATOM   3275 N N     . GLN B 1 182 ? 74.315 68.373  14.718  1.00 60.41  ? 673 GLN B N     1 
ATOM   3276 C CA    . GLN B 1 182 ? 75.313 67.572  15.431  1.00 63.21  ? 673 GLN B CA    1 
ATOM   3277 C C     . GLN B 1 182 ? 75.504 66.207  14.777  1.00 64.09  ? 673 GLN B C     1 
ATOM   3278 O O     . GLN B 1 182 ? 74.642 65.735  14.033  1.00 64.28  ? 673 GLN B O     1 
ATOM   3279 C CB    . GLN B 1 182 ? 74.939 67.399  16.919  1.00 63.42  ? 673 GLN B CB    1 
ATOM   3280 C CG    . GLN B 1 182 ? 73.463 67.602  17.259  1.00 66.59  ? 673 GLN B CG    1 
ATOM   3281 C CD    . GLN B 1 182 ? 73.120 69.050  17.595  1.00 67.59  ? 673 GLN B CD    1 
ATOM   3282 O OE1   . GLN B 1 182 ? 73.626 69.600  18.574  1.00 69.43  ? 673 GLN B OE1   1 
ATOM   3283 N NE2   . GLN B 1 182 ? 72.259 69.669  16.790  1.00 66.19  ? 673 GLN B NE2   1 
ATOM   3284 N N     . PHE B 1 183 ? 76.643 65.584  15.063  1.00 65.45  ? 674 PHE B N     1 
ATOM   3285 C CA    . PHE B 1 183 ? 76.989 64.281  14.505  1.00 66.63  ? 674 PHE B CA    1 
ATOM   3286 C C     . PHE B 1 183 ? 77.501 63.307  15.566  1.00 68.31  ? 674 PHE B C     1 
ATOM   3287 O O     . PHE B 1 183 ? 77.796 63.699  16.700  1.00 68.86  ? 674 PHE B O     1 
ATOM   3288 C CB    . PHE B 1 183 ? 78.054 64.467  13.424  1.00 66.06  ? 674 PHE B CB    1 
ATOM   3289 C CG    . PHE B 1 183 ? 77.570 65.225  12.229  1.00 65.02  ? 674 PHE B CG    1 
ATOM   3290 C CD1   . PHE B 1 183 ? 76.875 64.575  11.213  1.00 64.44  ? 674 PHE B CD1   1 
ATOM   3291 C CD2   . PHE B 1 183 ? 77.776 66.597  12.134  1.00 64.56  ? 674 PHE B CD2   1 
ATOM   3292 C CE1   . PHE B 1 183 ? 76.387 65.281  10.116  1.00 64.87  ? 674 PHE B CE1   1 
ATOM   3293 C CE2   . PHE B 1 183 ? 77.294 67.318  11.043  1.00 64.69  ? 674 PHE B CE2   1 
ATOM   3294 C CZ    . PHE B 1 183 ? 76.597 66.658  10.030  1.00 64.90  ? 674 PHE B CZ    1 
ATOM   3295 N N     . GLU B 1 184 ? 77.607 62.035  15.185  1.00 69.35  ? 675 GLU B N     1 
ATOM   3296 C CA    . GLU B 1 184 ? 78.078 60.989  16.087  1.00 69.97  ? 675 GLU B CA    1 
ATOM   3297 C C     . GLU B 1 184 ? 79.556 60.711  15.872  1.00 70.57  ? 675 GLU B C     1 
ATOM   3298 O O     . GLU B 1 184 ? 80.126 61.082  14.843  1.00 70.07  ? 675 GLU B O     1 
ATOM   3299 C CB    . GLU B 1 184 ? 77.272 59.706  15.882  1.00 69.60  ? 675 GLU B CB    1 
ATOM   3300 N N     . ASP B 1 185 ? 80.162 60.048  16.853  1.00 71.63  ? 676 ASP B N     1 
ATOM   3301 C CA    . ASP B 1 185 ? 81.580 59.705  16.820  1.00 72.61  ? 676 ASP B CA    1 
ATOM   3302 C C     . ASP B 1 185 ? 81.945 58.772  15.669  1.00 73.18  ? 676 ASP B C     1 
ATOM   3303 O O     . ASP B 1 185 ? 82.621 57.766  15.874  1.00 73.65  ? 676 ASP B O     1 
ATOM   3304 C CB    . ASP B 1 185 ? 81.991 59.072  18.152  1.00 71.49  ? 676 ASP B CB    1 
ATOM   3305 N N     . GLY B 1 186 ? 81.505 59.107  14.461  1.00 73.77  ? 677 GLY B N     1 
ATOM   3306 C CA    . GLY B 1 186 ? 81.823 58.266  13.324  1.00 74.75  ? 677 GLY B CA    1 
ATOM   3307 C C     . GLY B 1 186 ? 81.076 58.598  12.046  1.00 74.83  ? 677 GLY B C     1 
ATOM   3308 O O     . GLY B 1 186 ? 81.462 58.148  10.961  1.00 74.76  ? 677 GLY B O     1 
ATOM   3309 N N     . GLN B 1 187 ? 80.008 59.379  12.163  1.00 74.07  ? 678 GLN B N     1 
ATOM   3310 C CA    . GLN B 1 187 ? 79.222 59.748  10.993  1.00 73.72  ? 678 GLN B CA    1 
ATOM   3311 C C     . GLN B 1 187 ? 80.085 60.513  9.998   1.00 72.85  ? 678 GLN B C     1 
ATOM   3312 O O     . GLN B 1 187 ? 80.939 61.308  10.391  1.00 73.05  ? 678 GLN B O     1 
ATOM   3313 C CB    . GLN B 1 187 ? 78.021 60.593  11.420  1.00 74.28  ? 678 GLN B CB    1 
ATOM   3314 C CG    . GLN B 1 187 ? 77.075 59.860  12.358  1.00 76.34  ? 678 GLN B CG    1 
ATOM   3315 C CD    . GLN B 1 187 ? 76.026 60.768  12.967  1.00 77.71  ? 678 GLN B CD    1 
ATOM   3316 O OE1   . GLN B 1 187 ? 75.178 60.325  13.747  1.00 78.27  ? 678 GLN B OE1   1 
ATOM   3317 N NE2   . GLN B 1 187 ? 76.079 62.048  12.619  1.00 78.10  ? 678 GLN B NE2   1 
ATOM   3318 N N     . LYS B 1 188 ? 79.872 60.261  8.710   1.00 71.42  ? 679 LYS B N     1 
ATOM   3319 C CA    . LYS B 1 188 ? 80.639 60.938  7.668   1.00 70.45  ? 679 LYS B CA    1 
ATOM   3320 C C     . LYS B 1 188 ? 79.851 62.117  7.089   1.00 69.46  ? 679 LYS B C     1 
ATOM   3321 O O     . LYS B 1 188 ? 79.080 61.947  6.147   1.00 69.67  ? 679 LYS B O     1 
ATOM   3322 C CB    . LYS B 1 188 ? 80.992 59.947  6.564   1.00 70.07  ? 679 LYS B CB    1 
ATOM   3323 N N     . ILE B 1 189 ? 80.051 63.307  7.651   1.00 67.80  ? 680 ILE B N     1 
ATOM   3324 C CA    . ILE B 1 189 ? 79.344 64.501  7.190   1.00 66.73  ? 680 ILE B CA    1 
ATOM   3325 C C     . ILE B 1 189 ? 79.178 64.510  5.681   1.00 67.91  ? 680 ILE B C     1 
ATOM   3326 O O     . ILE B 1 189 ? 78.064 64.400  5.173   1.00 67.50  ? 680 ILE B O     1 
ATOM   3327 C CB    . ILE B 1 189 ? 80.072 65.786  7.608   1.00 64.72  ? 680 ILE B CB    1 
ATOM   3328 C CG1   . ILE B 1 189 ? 79.895 66.022  9.107   1.00 62.31  ? 680 ILE B CG1   1 
ATOM   3329 C CG2   . ILE B 1 189 ? 79.535 66.963  6.822   1.00 63.93  ? 680 ILE B CG2   1 
ATOM   3330 C CD1   . ILE B 1 189 ? 80.482 64.939  9.974   1.00 61.01  ? 680 ILE B CD1   1 
ATOM   3331 N N     . VAL B 1 190 ? 80.288 64.652  4.970   1.00 69.65  ? 681 VAL B N     1 
ATOM   3332 C CA    . VAL B 1 190 ? 80.260 64.649  3.513   1.00 71.87  ? 681 VAL B CA    1 
ATOM   3333 C C     . VAL B 1 190 ? 80.996 63.403  3.017   1.00 73.32  ? 681 VAL B C     1 
ATOM   3334 O O     . VAL B 1 190 ? 81.660 62.719  3.803   1.00 73.95  ? 681 VAL B O     1 
ATOM   3335 C CB    . VAL B 1 190 ? 80.931 65.917  2.933   1.00 71.84  ? 681 VAL B CB    1 
ATOM   3336 C CG1   . VAL B 1 190 ? 80.206 67.157  3.432   1.00 71.18  ? 681 VAL B CG1   1 
ATOM   3337 C CG2   . VAL B 1 190 ? 82.399 65.959  3.320   1.00 71.71  ? 681 VAL B CG2   1 
ATOM   3338 N N     . VAL B 1 191 ? 80.869 63.099  1.727   1.00 74.06  ? 682 VAL B N     1 
ATOM   3339 C CA    . VAL B 1 191 ? 81.531 61.928  1.158   1.00 74.95  ? 682 VAL B CA    1 
ATOM   3340 C C     . VAL B 1 191 ? 82.130 62.242  -0.204  1.00 75.81  ? 682 VAL B C     1 
ATOM   3341 O O     . VAL B 1 191 ? 81.417 62.589  -1.145  1.00 76.24  ? 682 VAL B O     1 
ATOM   3342 C CB    . VAL B 1 191 ? 80.549 60.769  1.043   1.00 73.99  ? 682 VAL B CB    1 
ATOM   3343 N N     . GLN B 1 192 ? 83.450 62.105  -0.297  1.00 77.06  ? 683 GLN B N     1 
ATOM   3344 C CA    . GLN B 1 192 ? 84.190 62.376  -1.526  1.00 77.09  ? 683 GLN B CA    1 
ATOM   3345 C C     . GLN B 1 192 ? 83.480 61.756  -2.712  1.00 76.96  ? 683 GLN B C     1 
ATOM   3346 O O     . GLN B 1 192 ? 83.110 60.583  -2.677  1.00 76.12  ? 683 GLN B O     1 
ATOM   3347 C CB    . GLN B 1 192 ? 85.623 61.878  -1.389  1.00 77.32  ? 683 GLN B CB    1 
ATOM   3348 N N     . GLY B 1 193 ? 83.297 62.551  -3.762  1.00 77.67  ? 684 GLY B N     1 
ATOM   3349 C CA    . GLY B 1 193 ? 82.648 62.048  -4.961  1.00 79.20  ? 684 GLY B CA    1 
ATOM   3350 C C     . GLY B 1 193 ? 81.163 62.309  -5.102  1.00 79.56  ? 684 GLY B C     1 
ATOM   3351 O O     . GLY B 1 193 ? 80.633 62.337  -6.215  1.00 79.72  ? 684 GLY B O     1 
ATOM   3352 N N     . GLU B 1 194 ? 80.484 62.485  -3.973  1.00 79.42  ? 685 GLU B N     1 
ATOM   3353 C CA    . GLU B 1 194 ? 79.054 62.745  -3.982  1.00 79.06  ? 685 GLU B CA    1 
ATOM   3354 C C     . GLU B 1 194 ? 78.768 64.198  -4.334  1.00 79.99  ? 685 GLU B C     1 
ATOM   3355 O O     . GLU B 1 194 ? 79.424 65.114  -3.839  1.00 79.56  ? 685 GLU B O     1 
ATOM   3356 C CB    . GLU B 1 194 ? 78.458 62.409  -2.623  1.00 77.79  ? 685 GLU B CB    1 
ATOM   3357 C CG    . GLU B 1 194 ? 78.196 60.936  -2.432  1.00 77.48  ? 685 GLU B CG    1 
ATOM   3358 C CD    . GLU B 1 194 ? 78.035 60.573  -0.978  1.00 77.42  ? 685 GLU B CD    1 
ATOM   3359 O OE1   . GLU B 1 194 ? 77.567 61.431  -0.204  1.00 76.92  ? 685 GLU B OE1   1 
ATOM   3360 O OE2   . GLU B 1 194 ? 78.366 59.427  -0.610  1.00 78.48  ? 685 GLU B OE2   1 
ATOM   3361 N N     . PRO B 1 195 ? 77.793 64.425  -5.224  1.00 80.51  ? 686 PRO B N     1 
ATOM   3362 C CA    . PRO B 1 195 ? 77.439 65.789  -5.629  1.00 80.11  ? 686 PRO B CA    1 
ATOM   3363 C C     . PRO B 1 195 ? 76.688 66.476  -4.492  1.00 79.44  ? 686 PRO B C     1 
ATOM   3364 O O     . PRO B 1 195 ? 75.514 66.179  -4.254  1.00 79.68  ? 686 PRO B O     1 
ATOM   3365 C CB    . PRO B 1 195 ? 76.548 65.565  -6.856  1.00 81.09  ? 686 PRO B CB    1 
ATOM   3366 C CG    . PRO B 1 195 ? 76.978 64.197  -7.370  1.00 80.84  ? 686 PRO B CG    1 
ATOM   3367 C CD    . PRO B 1 195 ? 77.134 63.430  -6.087  1.00 80.64  ? 686 PRO B CD    1 
ATOM   3368 N N     . GLY B 1 196 ? 77.362 67.389  -3.792  1.00 78.21  ? 687 GLY B N     1 
ATOM   3369 C CA    . GLY B 1 196 ? 76.726 68.077  -2.679  1.00 76.03  ? 687 GLY B CA    1 
ATOM   3370 C C     . GLY B 1 196 ? 76.793 69.597  -2.696  1.00 74.27  ? 687 GLY B C     1 
ATOM   3371 O O     . GLY B 1 196 ? 77.421 70.200  -3.571  1.00 73.75  ? 687 GLY B O     1 
ATOM   3372 N N     . ASP B 1 197 ? 76.136 70.220  -1.718  1.00 72.01  ? 688 ASP B N     1 
ATOM   3373 C CA    . ASP B 1 197 ? 76.131 71.670  -1.627  1.00 69.70  ? 688 ASP B CA    1 
ATOM   3374 C C     . ASP B 1 197 ? 75.706 72.260  -0.274  1.00 67.55  ? 688 ASP B C     1 
ATOM   3375 O O     . ASP B 1 197 ? 74.671 72.920  -0.165  1.00 66.38  ? 688 ASP B O     1 
ATOM   3376 C CB    . ASP B 1 197 ? 75.279 72.258  -2.765  1.00 71.29  ? 688 ASP B CB    1 
ATOM   3377 C CG    . ASP B 1 197 ? 73.866 71.687  -2.819  1.00 72.45  ? 688 ASP B CG    1 
ATOM   3378 O OD1   . ASP B 1 197 ? 73.055 72.011  -1.923  1.00 74.10  ? 688 ASP B OD1   1 
ATOM   3379 O OD2   . ASP B 1 197 ? 73.564 70.921  -3.765  1.00 71.08  ? 688 ASP B OD2   1 
ATOM   3380 N N     . GLU B 1 198 ? 76.532 72.027  0.746   1.00 65.36  ? 689 GLU B N     1 
ATOM   3381 C CA    . GLU B 1 198 ? 76.304 72.538  2.098   1.00 62.73  ? 689 GLU B CA    1 
ATOM   3382 C C     . GLU B 1 198 ? 77.635 73.002  2.676   1.00 61.79  ? 689 GLU B C     1 
ATOM   3383 O O     . GLU B 1 198 ? 78.634 72.302  2.563   1.00 62.35  ? 689 GLU B O     1 
ATOM   3384 C CB    . GLU B 1 198 ? 75.724 71.454  3.002   1.00 61.50  ? 689 GLU B CB    1 
ATOM   3385 C CG    . GLU B 1 198 ? 74.445 70.856  2.494   1.00 61.56  ? 689 GLU B CG    1 
ATOM   3386 C CD    . GLU B 1 198 ? 73.769 69.992  3.523   1.00 60.99  ? 689 GLU B CD    1 
ATOM   3387 O OE1   . GLU B 1 198 ? 74.448 69.106  4.080   1.00 60.89  ? 689 GLU B OE1   1 
ATOM   3388 O OE2   . GLU B 1 198 ? 72.560 70.196  3.769   1.00 60.10  ? 689 GLU B OE2   1 
ATOM   3389 N N     . PHE B 1 199 ? 77.646 74.176  3.301   1.00 60.64  ? 690 PHE B N     1 
ATOM   3390 C CA    . PHE B 1 199 ? 78.865 74.724  3.888   1.00 58.97  ? 690 PHE B CA    1 
ATOM   3391 C C     . PHE B 1 199 ? 78.866 74.590  5.405   1.00 57.41  ? 690 PHE B C     1 
ATOM   3392 O O     . PHE B 1 199 ? 77.951 75.059  6.074   1.00 57.25  ? 690 PHE B O     1 
ATOM   3393 C CB    . PHE B 1 199 ? 79.027 76.193  3.492   1.00 59.23  ? 690 PHE B CB    1 
ATOM   3394 C CG    . PHE B 1 199 ? 80.100 76.903  4.249   1.00 59.56  ? 690 PHE B CG    1 
ATOM   3395 C CD1   . PHE B 1 199 ? 81.382 76.375  4.315   1.00 59.84  ? 690 PHE B CD1   1 
ATOM   3396 C CD2   . PHE B 1 199 ? 79.826 78.095  4.912   1.00 60.22  ? 690 PHE B CD2   1 
ATOM   3397 C CE1   . PHE B 1 199 ? 82.382 77.027  5.037   1.00 62.35  ? 690 PHE B CE1   1 
ATOM   3398 C CE2   . PHE B 1 199 ? 80.817 78.759  5.638   1.00 60.85  ? 690 PHE B CE2   1 
ATOM   3399 C CZ    . PHE B 1 199 ? 82.096 78.227  5.703   1.00 61.78  ? 690 PHE B CZ    1 
ATOM   3400 N N     . PHE B 1 200 ? 79.919 73.972  5.936   1.00 55.23  ? 691 PHE B N     1 
ATOM   3401 C CA    . PHE B 1 200 ? 80.037 73.731  7.367   1.00 52.41  ? 691 PHE B CA    1 
ATOM   3402 C C     . PHE B 1 200 ? 81.025 74.595  8.142   1.00 51.47  ? 691 PHE B C     1 
ATOM   3403 O O     . PHE B 1 200 ? 81.913 75.232  7.582   1.00 50.09  ? 691 PHE B O     1 
ATOM   3404 C CB    . PHE B 1 200 ? 80.373 72.256  7.603   1.00 51.20  ? 691 PHE B CB    1 
ATOM   3405 C CG    . PHE B 1 200 ? 79.418 71.310  6.942   1.00 49.52  ? 691 PHE B CG    1 
ATOM   3406 C CD1   . PHE B 1 200 ? 79.297 71.278  5.562   1.00 47.60  ? 691 PHE B CD1   1 
ATOM   3407 C CD2   . PHE B 1 200 ? 78.595 70.489  7.703   1.00 50.94  ? 691 PHE B CD2   1 
ATOM   3408 C CE1   . PHE B 1 200 ? 78.371 70.449  4.952   1.00 48.40  ? 691 PHE B CE1   1 
ATOM   3409 C CE2   . PHE B 1 200 ? 77.657 69.648  7.096   1.00 49.94  ? 691 PHE B CE2   1 
ATOM   3410 C CZ    . PHE B 1 200 ? 77.546 69.632  5.720   1.00 48.95  ? 691 PHE B CZ    1 
ATOM   3411 N N     . ILE B 1 201 ? 80.831 74.590  9.456   1.00 51.44  ? 692 ILE B N     1 
ATOM   3412 C CA    . ILE B 1 201 ? 81.646 75.314  10.426  1.00 50.86  ? 692 ILE B CA    1 
ATOM   3413 C C     . ILE B 1 201 ? 81.499 74.504  11.719  1.00 51.87  ? 692 ILE B C     1 
ATOM   3414 O O     . ILE B 1 201 ? 80.389 74.092  12.081  1.00 51.47  ? 692 ILE B O     1 
ATOM   3415 C CB    . ILE B 1 201 ? 81.123 76.763  10.676  1.00 49.37  ? 692 ILE B CB    1 
ATOM   3416 C CG1   . ILE B 1 201 ? 81.264 77.608  9.411   1.00 49.92  ? 692 ILE B CG1   1 
ATOM   3417 C CG2   . ILE B 1 201 ? 81.917 77.422  11.785  1.00 47.60  ? 692 ILE B CG2   1 
ATOM   3418 C CD1   . ILE B 1 201 ? 80.792 79.051  9.570   1.00 46.67  ? 692 ILE B CD1   1 
ATOM   3419 N N     . ILE B 1 202 ? 82.611 74.268  12.412  1.00 52.04  ? 693 ILE B N     1 
ATOM   3420 C CA    . ILE B 1 202 ? 82.573 73.495  13.647  1.00 51.17  ? 693 ILE B CA    1 
ATOM   3421 C C     . ILE B 1 202 ? 82.394 74.366  14.878  1.00 51.53  ? 693 ILE B C     1 
ATOM   3422 O O     . ILE B 1 202 ? 82.815 75.517  14.907  1.00 50.14  ? 693 ILE B O     1 
ATOM   3423 C CB    . ILE B 1 202 ? 83.843 72.655  13.802  1.00 51.32  ? 693 ILE B CB    1 
ATOM   3424 C CG1   . ILE B 1 202 ? 84.096 71.883  12.498  1.00 51.73  ? 693 ILE B CG1   1 
ATOM   3425 C CG2   . ILE B 1 202 ? 83.696 71.708  14.992  1.00 50.01  ? 693 ILE B CG2   1 
ATOM   3426 C CD1   . ILE B 1 202 ? 85.354 71.046  12.487  1.00 50.97  ? 693 ILE B CD1   1 
ATOM   3427 N N     . LEU B 1 203 ? 81.754 73.799  15.893  1.00 53.33  ? 694 LEU B N     1 
ATOM   3428 C CA    . LEU B 1 203 ? 81.489 74.497  17.142  1.00 54.73  ? 694 LEU B CA    1 
ATOM   3429 C C     . LEU B 1 203 ? 82.180 73.791  18.308  1.00 57.14  ? 694 LEU B C     1 
ATOM   3430 O O     . LEU B 1 203 ? 82.878 74.422  19.106  1.00 58.08  ? 694 LEU B O     1 
ATOM   3431 C CB    . LEU B 1 203 ? 79.989 74.535  17.386  1.00 52.63  ? 694 LEU B CB    1 
ATOM   3432 C CG    . LEU B 1 203 ? 79.168 75.129  16.247  1.00 51.04  ? 694 LEU B CG    1 
ATOM   3433 C CD1   . LEU B 1 203 ? 77.764 74.593  16.337  1.00 49.68  ? 694 LEU B CD1   1 
ATOM   3434 C CD2   . LEU B 1 203 ? 79.189 76.652  16.309  1.00 49.24  ? 694 LEU B CD2   1 
ATOM   3435 N N     . GLU B 1 204 ? 81.973 72.483  18.403  1.00 59.33  ? 695 GLU B N     1 
ATOM   3436 C CA    . GLU B 1 204 ? 82.574 71.672  19.457  1.00 61.99  ? 695 GLU B CA    1 
ATOM   3437 C C     . GLU B 1 204 ? 82.938 70.301  18.914  1.00 64.04  ? 695 GLU B C     1 
ATOM   3438 O O     . GLU B 1 204 ? 82.112 69.618  18.301  1.00 64.76  ? 695 GLU B O     1 
ATOM   3439 C CB    . GLU B 1 204 ? 81.613 71.511  20.628  1.00 62.57  ? 695 GLU B CB    1 
ATOM   3440 C CG    . GLU B 1 204 ? 81.546 72.710  21.534  1.00 65.14  ? 695 GLU B CG    1 
ATOM   3441 C CD    . GLU B 1 204 ? 80.483 72.561  22.602  1.00 66.85  ? 695 GLU B CD    1 
ATOM   3442 O OE1   . GLU B 1 204 ? 80.125 71.402  22.916  1.00 66.63  ? 695 GLU B OE1   1 
ATOM   3443 O OE2   . GLU B 1 204 ? 80.016 73.598  23.133  1.00 67.09  ? 695 GLU B OE2   1 
ATOM   3444 N N     . GLY B 1 205 ? 84.182 69.897  19.144  1.00 65.59  ? 696 GLY B N     1 
ATOM   3445 C CA    . GLY B 1 205 ? 84.634 68.609  18.658  1.00 66.04  ? 696 GLY B CA    1 
ATOM   3446 C C     . GLY B 1 205 ? 85.570 68.808  17.492  1.00 66.20  ? 696 GLY B C     1 
ATOM   3447 O O     . GLY B 1 205 ? 85.635 69.896  16.928  1.00 66.57  ? 696 GLY B O     1 
ATOM   3448 N N     . SER B 1 206 ? 86.305 67.764  17.135  1.00 66.55  ? 697 SER B N     1 
ATOM   3449 C CA    . SER B 1 206 ? 87.236 67.848  16.021  1.00 66.27  ? 697 SER B CA    1 
ATOM   3450 C C     . SER B 1 206 ? 86.897 66.765  15.019  1.00 65.99  ? 697 SER B C     1 
ATOM   3451 O O     . SER B 1 206 ? 86.229 65.787  15.356  1.00 65.95  ? 697 SER B O     1 
ATOM   3452 C CB    . SER B 1 206 ? 88.665 67.674  16.513  1.00 66.72  ? 697 SER B CB    1 
ATOM   3453 N N     . ALA B 1 207 ? 87.358 66.945  13.787  1.00 65.59  ? 698 ALA B N     1 
ATOM   3454 C CA    . ALA B 1 207 ? 87.101 65.972  12.742  1.00 65.17  ? 698 ALA B CA    1 
ATOM   3455 C C     . ALA B 1 207 ? 88.249 65.892  11.741  1.00 65.40  ? 698 ALA B C     1 
ATOM   3456 O O     . ALA B 1 207 ? 88.958 66.875  11.499  1.00 64.16  ? 698 ALA B O     1 
ATOM   3457 C CB    . ALA B 1 207 ? 85.799 66.308  12.029  1.00 65.17  ? 698 ALA B CB    1 
ATOM   3458 N N     . ALA B 1 208 ? 88.410 64.702  11.164  1.00 65.90  ? 699 ALA B N     1 
ATOM   3459 C CA    . ALA B 1 208 ? 89.446 64.413  10.180  1.00 66.09  ? 699 ALA B CA    1 
ATOM   3460 C C     . ALA B 1 208 ? 88.980 64.708  8.756   1.00 66.27  ? 699 ALA B C     1 
ATOM   3461 O O     . ALA B 1 208 ? 87.835 65.099  8.533   1.00 65.86  ? 699 ALA B O     1 
ATOM   3462 C CB    . ALA B 1 208 ? 89.835 62.953  10.279  1.00 66.07  ? 699 ALA B CB    1 
ATOM   3463 N N     . VAL B 1 209 ? 89.880 64.513  7.796   1.00 67.13  ? 700 VAL B N     1 
ATOM   3464 C CA    . VAL B 1 209 ? 89.581 64.745  6.383   1.00 67.51  ? 700 VAL B CA    1 
ATOM   3465 C C     . VAL B 1 209 ? 90.126 63.578  5.553   1.00 68.40  ? 700 VAL B C     1 
ATOM   3466 O O     . VAL B 1 209 ? 91.019 63.758  4.727   1.00 68.44  ? 700 VAL B O     1 
ATOM   3467 C CB    . VAL B 1 209 ? 90.257 66.044  5.878   1.00 66.44  ? 700 VAL B CB    1 
ATOM   3468 C CG1   . VAL B 1 209 ? 89.801 66.347  4.456   1.00 65.46  ? 700 VAL B CG1   1 
ATOM   3469 C CG2   . VAL B 1 209 ? 89.914 67.196  6.798   1.00 65.84  ? 700 VAL B CG2   1 
ATOM   3470 N N     . LEU B 1 210 ? 89.583 62.387  5.782   1.00 69.80  ? 701 LEU B N     1 
ATOM   3471 C CA    . LEU B 1 210 ? 90.011 61.197  5.053   1.00 70.67  ? 701 LEU B CA    1 
ATOM   3472 C C     . LEU B 1 210 ? 89.941 61.398  3.533   1.00 70.91  ? 701 LEU B C     1 
ATOM   3473 O O     . LEU B 1 210 ? 88.994 61.989  3.013   1.00 69.61  ? 701 LEU B O     1 
ATOM   3474 C CB    . LEU B 1 210 ? 89.166 59.995  5.473   1.00 70.14  ? 701 LEU B CB    1 
ATOM   3475 N N     . GLN B 1 211 ? 90.959 60.893  2.838   1.00 72.76  ? 702 GLN B N     1 
ATOM   3476 C CA    . GLN B 1 211 ? 91.074 61.005  1.384   1.00 73.57  ? 702 GLN B CA    1 
ATOM   3477 C C     . GLN B 1 211 ? 91.476 59.672  0.739   1.00 75.25  ? 702 GLN B C     1 
ATOM   3478 O O     . GLN B 1 211 ? 92.035 58.787  1.402   1.00 74.68  ? 702 GLN B O     1 
ATOM   3479 C CB    . GLN B 1 211 ? 92.120 62.068  1.038   1.00 72.28  ? 702 GLN B CB    1 
ATOM   3480 C CG    . GLN B 1 211 ? 92.402 62.221  -0.436  1.00 70.69  ? 702 GLN B CG    1 
ATOM   3481 C CD    . GLN B 1 211 ? 91.449 63.176  -1.108  1.00 70.39  ? 702 GLN B CD    1 
ATOM   3482 O OE1   . GLN B 1 211 ? 91.522 64.386  -0.904  1.00 69.67  ? 702 GLN B OE1   1 
ATOM   3483 N NE2   . GLN B 1 211 ? 90.544 62.639  -1.915  1.00 70.89  ? 702 GLN B NE2   1 
ATOM   3484 N N     . ARG B 1 212 ? 91.190 59.544  -0.558  1.00 77.17  ? 703 ARG B N     1 
ATOM   3485 C CA    . ARG B 1 212 ? 91.515 58.340  -1.324  1.00 78.70  ? 703 ARG B CA    1 
ATOM   3486 C C     . ARG B 1 212 ? 91.798 58.658  -2.790  1.00 79.96  ? 703 ARG B C     1 
ATOM   3487 O O     . ARG B 1 212 ? 91.583 59.783  -3.246  1.00 78.83  ? 703 ARG B O     1 
ATOM   3488 C CB    . ARG B 1 212 ? 90.379 57.335  -1.230  1.00 78.87  ? 703 ARG B CB    1 
ATOM   3489 N N     . ARG B 1 213 ? 92.269 57.647  -3.520  1.00 82.32  ? 704 ARG B N     1 
ATOM   3490 C CA    . ARG B 1 213 ? 92.607 57.778  -4.939  1.00 84.78  ? 704 ARG B CA    1 
ATOM   3491 C C     . ARG B 1 213 ? 91.527 57.192  -5.863  1.00 86.44  ? 704 ARG B C     1 
ATOM   3492 O O     . ARG B 1 213 ? 90.331 57.321  -5.591  1.00 87.16  ? 704 ARG B O     1 
ATOM   3493 C CB    . ARG B 1 213 ? 93.958 57.104  -5.208  1.00 83.70  ? 704 ARG B CB    1 
ATOM   3494 N N     . SER B 1 214 ? 91.957 56.559  -6.956  1.00 88.08  ? 705 SER B N     1 
ATOM   3495 C CA    . SER B 1 214 ? 91.038 55.952  -7.921  1.00 89.42  ? 705 SER B CA    1 
ATOM   3496 C C     . SER B 1 214 ? 90.535 54.598  -7.431  1.00 90.76  ? 705 SER B C     1 
ATOM   3497 O O     . SER B 1 214 ? 91.066 54.043  -6.464  1.00 91.69  ? 705 SER B O     1 
ATOM   3498 C CB    . SER B 1 214 ? 91.726 55.787  -9.272  1.00 88.77  ? 705 SER B CB    1 
ATOM   3499 N N     . GLU B 1 215 ? 89.515 54.074  -8.109  1.00 91.69  ? 706 GLU B N     1 
ATOM   3500 C CA    . GLU B 1 215 ? 88.910 52.786  -7.766  1.00 92.23  ? 706 GLU B CA    1 
ATOM   3501 C C     . GLU B 1 215 ? 88.751 52.636  -6.253  1.00 92.89  ? 706 GLU B C     1 
ATOM   3502 O O     . GLU B 1 215 ? 88.324 53.572  -5.573  1.00 92.64  ? 706 GLU B O     1 
ATOM   3503 C CB    . GLU B 1 215 ? 89.753 51.640  -8.329  1.00 91.67  ? 706 GLU B CB    1 
ATOM   3504 N N     . ASN B 1 216 ? 89.102 51.462  -5.732  1.00 93.75  ? 707 ASN B N     1 
ATOM   3505 C CA    . ASN B 1 216 ? 88.994 51.181  -4.300  1.00 94.33  ? 707 ASN B CA    1 
ATOM   3506 C C     . ASN B 1 216 ? 90.361 50.999  -3.628  1.00 94.77  ? 707 ASN B C     1 
ATOM   3507 O O     . ASN B 1 216 ? 90.745 49.881  -3.277  1.00 94.77  ? 707 ASN B O     1 
ATOM   3508 C CB    . ASN B 1 216 ? 88.130 49.931  -4.083  1.00 93.62  ? 707 ASN B CB    1 
ATOM   3509 N N     . GLU B 1 217 ? 91.090 52.097  -3.443  1.00 95.19  ? 708 GLU B N     1 
ATOM   3510 C CA    . GLU B 1 217 ? 92.409 52.042  -2.812  1.00 95.66  ? 708 GLU B CA    1 
ATOM   3511 C C     . GLU B 1 217 ? 92.301 51.925  -1.284  1.00 95.62  ? 708 GLU B C     1 
ATOM   3512 O O     . GLU B 1 217 ? 91.964 50.865  -0.753  1.00 95.34  ? 708 GLU B O     1 
ATOM   3513 C CB    . GLU B 1 217 ? 93.223 53.285  -3.196  1.00 95.52  ? 708 GLU B CB    1 
ATOM   3514 N N     . GLU B 1 218 ? 92.593 53.015  -0.585  1.00 95.30  ? 709 GLU B N     1 
ATOM   3515 C CA    . GLU B 1 218 ? 92.517 53.036  0.868   1.00 95.28  ? 709 GLU B CA    1 
ATOM   3516 C C     . GLU B 1 218 ? 92.324 54.471  1.362   1.00 95.54  ? 709 GLU B C     1 
ATOM   3517 O O     . GLU B 1 218 ? 93.030 55.389  0.937   1.00 96.09  ? 709 GLU B O     1 
ATOM   3518 C CB    . GLU B 1 218 ? 93.780 52.436  1.461   1.00 95.07  ? 709 GLU B CB    1 
ATOM   3519 N N     . PHE B 1 219 ? 91.364 54.664  2.259   1.00 95.22  ? 710 PHE B N     1 
ATOM   3520 C CA    . PHE B 1 219 ? 91.084 55.989  2.801   1.00 94.32  ? 710 PHE B CA    1 
ATOM   3521 C C     . PHE B 1 219 ? 91.816 56.247  4.125   1.00 93.24  ? 710 PHE B C     1 
ATOM   3522 O O     . PHE B 1 219 ? 91.548 55.599  5.143   1.00 93.03  ? 710 PHE B O     1 
ATOM   3523 C CB    . PHE B 1 219 ? 89.570 56.159  3.020   1.00 94.95  ? 710 PHE B CB    1 
ATOM   3524 C CG    . PHE B 1 219 ? 88.764 56.175  1.742   1.00 94.97  ? 710 PHE B CG    1 
ATOM   3525 C CD1   . PHE B 1 219 ? 88.656 55.033  0.952   1.00 95.20  ? 710 PHE B CD1   1 
ATOM   3526 C CD2   . PHE B 1 219 ? 88.112 57.336  1.333   1.00 94.76  ? 710 PHE B CD2   1 
ATOM   3527 C CE1   . PHE B 1 219 ? 87.911 55.046  -0.227  1.00 95.08  ? 710 PHE B CE1   1 
ATOM   3528 C CE2   . PHE B 1 219 ? 87.367 57.362  0.160   1.00 94.95  ? 710 PHE B CE2   1 
ATOM   3529 C CZ    . PHE B 1 219 ? 87.265 56.213  -0.624  1.00 95.36  ? 710 PHE B CZ    1 
ATOM   3530 N N     . VAL B 1 220 ? 92.747 57.196  4.097   1.00 91.54  ? 711 VAL B N     1 
ATOM   3531 C CA    . VAL B 1 220 ? 93.509 57.556  5.290   1.00 89.64  ? 711 VAL B CA    1 
ATOM   3532 C C     . VAL B 1 220 ? 93.514 59.078  5.475   1.00 87.75  ? 711 VAL B C     1 
ATOM   3533 O O     . VAL B 1 220 ? 93.541 59.836  4.498   1.00 87.61  ? 711 VAL B O     1 
ATOM   3534 C CB    . VAL B 1 220 ? 94.973 57.042  5.211   1.00 90.03  ? 711 VAL B CB    1 
ATOM   3535 C CG1   . VAL B 1 220 ? 95.694 57.675  4.027   1.00 89.97  ? 711 VAL B CG1   1 
ATOM   3536 C CG2   . VAL B 1 220 ? 95.701 57.354  6.515   1.00 90.05  ? 711 VAL B CG2   1 
ATOM   3537 N N     . GLU B 1 221 ? 93.488 59.515  6.731   1.00 84.58  ? 712 GLU B N     1 
ATOM   3538 C CA    . GLU B 1 221 ? 93.470 60.938  7.048   1.00 81.67  ? 712 GLU B CA    1 
ATOM   3539 C C     . GLU B 1 221 ? 94.516 61.799  6.346   1.00 79.85  ? 712 GLU B C     1 
ATOM   3540 O O     . GLU B 1 221 ? 95.669 61.394  6.190   1.00 79.31  ? 712 GLU B O     1 
ATOM   3541 C CB    . GLU B 1 221 ? 93.670 61.138  8.551   1.00 81.08  ? 712 GLU B CB    1 
ATOM   3542 C CG    . GLU B 1 221 ? 92.430 60.837  9.375   1.00 79.99  ? 712 GLU B CG    1 
ATOM   3543 C CD    . GLU B 1 221 ? 92.650 61.054  10.859  1.00 79.79  ? 712 GLU B CD    1 
ATOM   3544 O OE1   . GLU B 1 221 ? 93.281 62.069  11.223  1.00 79.07  ? 712 GLU B OE1   1 
ATOM   3545 O OE2   . GLU B 1 221 ? 92.184 60.216  11.661  1.00 79.64  ? 712 GLU B OE2   1 
ATOM   3546 N N     . VAL B 1 222 ? 94.090 62.988  5.916   1.00 77.85  ? 713 VAL B N     1 
ATOM   3547 C CA    . VAL B 1 222 ? 94.956 63.945  5.225   1.00 75.18  ? 713 VAL B CA    1 
ATOM   3548 C C     . VAL B 1 222 ? 94.662 65.374  5.648   1.00 73.52  ? 713 VAL B C     1 
ATOM   3549 O O     . VAL B 1 222 ? 95.228 66.326  5.106   1.00 72.52  ? 713 VAL B O     1 
ATOM   3550 C CB    . VAL B 1 222 ? 94.684 63.841  3.658   1.00 75.19  ? 713 VAL B CB    1 
ATOM   3551 C CG1   . VAL B 1 222 ? 94.687 62.385  3.226   1.00 75.45  ? 713 VAL B CG1   1 
ATOM   3552 C CG2   . VAL B 1 222 ? 93.366 64.503  3.283   1.00 73.47  ? 713 VAL B CG2   1 
ATOM   3553 N N     . GLY B 1 223 ? 93.788 65.517  6.644   1.00 72.05  ? 714 GLY B N     1 
ATOM   3554 C CA    . GLY B 1 223 ? 93.442 66.832  7.164   1.00 68.80  ? 714 GLY B CA    1 
ATOM   3555 C C     . GLY B 1 223 ? 92.631 66.797  8.452   1.00 66.43  ? 714 GLY B C     1 
ATOM   3556 O O     . GLY B 1 223 ? 91.838 65.881  8.683   1.00 65.11  ? 714 GLY B O     1 
ATOM   3557 N N     . ARG B 1 224 ? 92.828 67.805  9.296   1.00 64.56  ? 715 ARG B N     1 
ATOM   3558 C CA    . ARG B 1 224 ? 92.113 67.889  10.567  1.00 62.77  ? 715 ARG B CA    1 
ATOM   3559 C C     . ARG B 1 224 ? 91.420 69.235  10.711  1.00 61.08  ? 715 ARG B C     1 
ATOM   3560 O O     . ARG B 1 224 ? 91.926 70.257  10.245  1.00 60.50  ? 715 ARG B O     1 
ATOM   3561 C CB    . ARG B 1 224 ? 93.076 67.669  11.736  1.00 61.82  ? 715 ARG B CB    1 
ATOM   3562 N N     . LEU B 1 225 ? 90.261 69.226  11.365  1.00 59.47  ? 716 LEU B N     1 
ATOM   3563 C CA    . LEU B 1 225 ? 89.482 70.439  11.578  1.00 56.35  ? 716 LEU B CA    1 
ATOM   3564 C C     . LEU B 1 225 ? 88.805 70.408  12.949  1.00 54.49  ? 716 LEU B C     1 
ATOM   3565 O O     . LEU B 1 225 ? 88.082 69.467  13.272  1.00 54.83  ? 716 LEU B O     1 
ATOM   3566 C CB    . LEU B 1 225 ? 88.433 70.556  10.477  1.00 56.57  ? 716 LEU B CB    1 
ATOM   3567 C CG    . LEU B 1 225 ? 88.996 70.332  9.072   1.00 56.50  ? 716 LEU B CG    1 
ATOM   3568 C CD1   . LEU B 1 225 ? 87.900 69.826  8.145   1.00 57.92  ? 716 LEU B CD1   1 
ATOM   3569 C CD2   . LEU B 1 225 ? 89.617 71.625  8.558   1.00 55.99  ? 716 LEU B CD2   1 
ATOM   3570 N N     . GLY B 1 226 ? 89.052 71.434  13.754  1.00 52.26  ? 717 GLY B N     1 
ATOM   3571 C CA    . GLY B 1 226 ? 88.448 71.506  15.072  1.00 50.56  ? 717 GLY B CA    1 
ATOM   3572 C C     . GLY B 1 226 ? 87.487 72.680  15.148  1.00 50.29  ? 717 GLY B C     1 
ATOM   3573 O O     . GLY B 1 226 ? 87.082 73.213  14.107  1.00 49.71  ? 717 GLY B O     1 
ATOM   3574 N N     . PRO B 1 227 ? 87.089 73.112  16.358  1.00 49.30  ? 718 PRO B N     1 
ATOM   3575 C CA    . PRO B 1 227 ? 86.164 74.242  16.495  1.00 49.56  ? 718 PRO B CA    1 
ATOM   3576 C C     . PRO B 1 227 ? 86.607 75.498  15.728  1.00 50.57  ? 718 PRO B C     1 
ATOM   3577 O O     . PRO B 1 227 ? 87.787 75.843  15.705  1.00 51.16  ? 718 PRO B O     1 
ATOM   3578 C CB    . PRO B 1 227 ? 86.122 74.460  18.002  1.00 48.17  ? 718 PRO B CB    1 
ATOM   3579 C CG    . PRO B 1 227 ? 86.275 73.083  18.531  1.00 46.21  ? 718 PRO B CG    1 
ATOM   3580 C CD    . PRO B 1 227 ? 87.366 72.506  17.672  1.00 47.38  ? 718 PRO B CD    1 
ATOM   3581 N N     . SER B 1 228 ? 85.641 76.164  15.101  1.00 52.02  ? 719 SER B N     1 
ATOM   3582 C CA    . SER B 1 228 ? 85.864 77.382  14.325  1.00 52.05  ? 719 SER B CA    1 
ATOM   3583 C C     . SER B 1 228 ? 86.368 77.107  12.908  1.00 53.38  ? 719 SER B C     1 
ATOM   3584 O O     . SER B 1 228 ? 86.597 78.034  12.125  1.00 53.45  ? 719 SER B O     1 
ATOM   3585 C CB    . SER B 1 228 ? 86.834 78.304  15.054  1.00 52.00  ? 719 SER B CB    1 
ATOM   3586 O OG    . SER B 1 228 ? 87.064 79.477  14.304  1.00 52.36  ? 719 SER B OG    1 
ATOM   3587 N N     . ASP B 1 229 ? 86.534 75.830  12.581  1.00 53.51  ? 720 ASP B N     1 
ATOM   3588 C CA    . ASP B 1 229 ? 86.995 75.429  11.258  1.00 54.15  ? 720 ASP B CA    1 
ATOM   3589 C C     . ASP B 1 229 ? 85.790 75.329  10.333  1.00 54.44  ? 720 ASP B C     1 
ATOM   3590 O O     . ASP B 1 229 ? 84.660 75.180  10.806  1.00 54.59  ? 720 ASP B O     1 
ATOM   3591 C CB    . ASP B 1 229 ? 87.690 74.067  11.340  1.00 56.08  ? 720 ASP B CB    1 
ATOM   3592 C CG    . ASP B 1 229 ? 89.060 74.146  11.989  1.00 56.25  ? 720 ASP B CG    1 
ATOM   3593 O OD1   . ASP B 1 229 ? 89.251 74.974  12.902  1.00 57.63  ? 720 ASP B OD1   1 
ATOM   3594 O OD2   . ASP B 1 229 ? 89.945 73.365  11.591  1.00 56.81  ? 720 ASP B OD2   1 
ATOM   3595 N N     . TYR B 1 230 ? 86.026 75.400  9.023   1.00 53.80  ? 721 TYR B N     1 
ATOM   3596 C CA    . TYR B 1 230 ? 84.935 75.306  8.055   1.00 54.28  ? 721 TYR B CA    1 
ATOM   3597 C C     . TYR B 1 230 ? 85.276 74.475  6.818   1.00 54.67  ? 721 TYR B C     1 
ATOM   3598 O O     . TYR B 1 230 ? 86.410 74.483  6.342   1.00 54.51  ? 721 TYR B O     1 
ATOM   3599 C CB    . TYR B 1 230 ? 84.476 76.707  7.633   1.00 53.19  ? 721 TYR B CB    1 
ATOM   3600 C CG    . TYR B 1 230 ? 85.434 77.467  6.744   1.00 52.65  ? 721 TYR B CG    1 
ATOM   3601 C CD1   . TYR B 1 230 ? 85.688 77.049  5.435   1.00 51.64  ? 721 TYR B CD1   1 
ATOM   3602 C CD2   . TYR B 1 230 ? 86.055 78.635  7.200   1.00 52.80  ? 721 TYR B CD2   1 
ATOM   3603 C CE1   . TYR B 1 230 ? 86.530 77.773  4.603   1.00 53.62  ? 721 TYR B CE1   1 
ATOM   3604 C CE2   . TYR B 1 230 ? 86.900 79.376  6.373   1.00 53.46  ? 721 TYR B CE2   1 
ATOM   3605 C CZ    . TYR B 1 230 ? 87.134 78.940  5.074   1.00 53.83  ? 721 TYR B CZ    1 
ATOM   3606 O OH    . TYR B 1 230 ? 87.959 79.670  4.244   1.00 53.06  ? 721 TYR B OH    1 
ATOM   3607 N N     . PHE B 1 231 ? 84.282 73.766  6.292   1.00 56.00  ? 722 PHE B N     1 
ATOM   3608 C CA    . PHE B 1 231 ? 84.494 72.927  5.115   1.00 56.81  ? 722 PHE B CA    1 
ATOM   3609 C C     . PHE B 1 231 ? 83.249 72.721  4.260   1.00 58.68  ? 722 PHE B C     1 
ATOM   3610 O O     . PHE B 1 231 ? 82.126 72.966  4.695   1.00 59.30  ? 722 PHE B O     1 
ATOM   3611 C CB    . PHE B 1 231 ? 85.043 71.559  5.532   1.00 53.14  ? 722 PHE B CB    1 
ATOM   3612 C CG    . PHE B 1 231 ? 84.114 70.770  6.406   1.00 48.35  ? 722 PHE B CG    1 
ATOM   3613 C CD1   . PHE B 1 231 ? 83.879 71.152  7.717   1.00 47.81  ? 722 PHE B CD1   1 
ATOM   3614 C CD2   . PHE B 1 231 ? 83.499 69.626  5.925   1.00 46.95  ? 722 PHE B CD2   1 
ATOM   3615 C CE1   . PHE B 1 231 ? 83.052 70.405  8.533   1.00 46.11  ? 722 PHE B CE1   1 
ATOM   3616 C CE2   . PHE B 1 231 ? 82.671 68.873  6.734   1.00 45.46  ? 722 PHE B CE2   1 
ATOM   3617 C CZ    . PHE B 1 231 ? 82.448 69.260  8.038   1.00 45.30  ? 722 PHE B CZ    1 
ATOM   3618 N N     . GLY B 1 232 ? 83.474 72.252  3.037   1.00 60.95  ? 723 GLY B N     1 
ATOM   3619 C CA    . GLY B 1 232 ? 82.387 72.006  2.110   1.00 63.09  ? 723 GLY B CA    1 
ATOM   3620 C C     . GLY B 1 232 ? 82.343 73.028  0.989   1.00 65.13  ? 723 GLY B C     1 
ATOM   3621 O O     . GLY B 1 232 ? 81.917 72.722  -0.126  1.00 65.30  ? 723 GLY B O     1 
ATOM   3622 N N     . GLU B 1 233 ? 82.811 74.239  1.285   1.00 66.76  ? 724 GLU B N     1 
ATOM   3623 C CA    . GLU B 1 233 ? 82.803 75.341  0.326   1.00 67.91  ? 724 GLU B CA    1 
ATOM   3624 C C     . GLU B 1 233 ? 83.196 74.979  -1.111  1.00 68.18  ? 724 GLU B C     1 
ATOM   3625 O O     . GLU B 1 233 ? 82.559 75.427  -2.069  1.00 67.02  ? 724 GLU B O     1 
ATOM   3626 C CB    . GLU B 1 233 ? 83.684 76.493  0.845   1.00 68.18  ? 724 GLU B CB    1 
ATOM   3627 C CG    . GLU B 1 233 ? 85.163 76.471  0.435   1.00 70.42  ? 724 GLU B CG    1 
ATOM   3628 C CD    . GLU B 1 233 ? 86.033 75.526  1.252   1.00 71.05  ? 724 GLU B CD    1 
ATOM   3629 O OE1   . GLU B 1 233 ? 87.273 75.619  1.125   1.00 70.17  ? 724 GLU B OE1   1 
ATOM   3630 O OE2   . GLU B 1 233 ? 85.489 74.698  2.012   1.00 72.60  ? 724 GLU B OE2   1 
ATOM   3631 N N     . ILE B 1 234 ? 84.234 74.163  -1.264  1.00 69.25  ? 725 ILE B N     1 
ATOM   3632 C CA    . ILE B 1 234 ? 84.694 73.778  -2.592  1.00 69.96  ? 725 ILE B CA    1 
ATOM   3633 C C     . ILE B 1 234 ? 83.534 73.444  -3.515  1.00 70.12  ? 725 ILE B C     1 
ATOM   3634 O O     . ILE B 1 234 ? 83.264 74.174  -4.466  1.00 70.16  ? 725 ILE B O     1 
ATOM   3635 C CB    . ILE B 1 234 ? 85.626 72.563  -2.504  1.00 69.72  ? 725 ILE B CB    1 
ATOM   3636 N N     . ALA B 1 235 ? 82.841 72.349  -3.216  1.00 70.48  ? 726 ALA B N     1 
ATOM   3637 C CA    . ALA B 1 235 ? 81.703 71.901  -4.016  1.00 69.91  ? 726 ALA B CA    1 
ATOM   3638 C C     . ALA B 1 235 ? 80.751 73.043  -4.335  1.00 69.14  ? 726 ALA B C     1 
ATOM   3639 O O     . ALA B 1 235 ? 80.319 73.212  -5.473  1.00 69.41  ? 726 ALA B O     1 
ATOM   3640 C CB    . ALA B 1 235 ? 80.975 70.783  -3.291  1.00 69.95  ? 726 ALA B CB    1 
ATOM   3641 N N     . LEU B 1 236 ? 80.424 73.823  -3.310  1.00 68.01  ? 727 LEU B N     1 
ATOM   3642 C CA    . LEU B 1 236 ? 79.509 74.948  -3.446  1.00 67.55  ? 727 LEU B CA    1 
ATOM   3643 C C     . LEU B 1 236 ? 80.055 76.019  -4.376  1.00 68.73  ? 727 LEU B C     1 
ATOM   3644 O O     . LEU B 1 236 ? 79.507 77.122  -4.463  1.00 68.48  ? 727 LEU B O     1 
ATOM   3645 C CB    . LEU B 1 236 ? 79.219 75.548  -2.069  1.00 65.87  ? 727 LEU B CB    1 
ATOM   3646 C CG    . LEU B 1 236 ? 78.287 74.759  -1.151  1.00 64.59  ? 727 LEU B CG    1 
ATOM   3647 C CD1   . LEU B 1 236 ? 78.327 75.309  0.261   1.00 64.56  ? 727 LEU B CD1   1 
ATOM   3648 C CD2   . LEU B 1 236 ? 76.895 74.835  -1.702  1.00 63.89  ? 727 LEU B CD2   1 
ATOM   3649 N N     . LEU B 1 237 ? 81.134 75.696  -5.079  1.00 69.56  ? 728 LEU B N     1 
ATOM   3650 C CA    . LEU B 1 237 ? 81.751 76.648  -5.994  1.00 70.43  ? 728 LEU B CA    1 
ATOM   3651 C C     . LEU B 1 237 ? 82.281 76.202  -7.343  1.00 72.39  ? 728 LEU B C     1 
ATOM   3652 O O     . LEU B 1 237 ? 81.737 76.555  -8.397  1.00 72.37  ? 728 LEU B O     1 
ATOM   3653 C CB    . LEU B 1 237 ? 82.914 77.363  -5.280  1.00 68.51  ? 728 LEU B CB    1 
ATOM   3654 C CG    . LEU B 1 237 ? 82.547 78.205  -4.054  1.00 66.84  ? 728 LEU B CG    1 
ATOM   3655 C CD1   . LEU B 1 237 ? 83.797 78.565  -3.247  1.00 64.18  ? 728 LEU B CD1   1 
ATOM   3656 C CD2   . LEU B 1 237 ? 81.799 79.454  -4.523  1.00 66.18  ? 728 LEU B CD2   1 
ATOM   3657 N N     . MET B 1 238 ? 83.341 75.394  -7.309  1.00 74.13  ? 729 MET B N     1 
ATOM   3658 C CA    . MET B 1 238 ? 83.984 74.876  -8.520  1.00 75.84  ? 729 MET B CA    1 
ATOM   3659 C C     . MET B 1 238 ? 83.067 73.994  -9.344  1.00 77.26  ? 729 MET B C     1 
ATOM   3660 O O     . MET B 1 238 ? 83.342 73.690  -10.513 1.00 77.52  ? 729 MET B O     1 
ATOM   3661 C CB    . MET B 1 238 ? 85.274 74.201  -8.181  1.00 75.96  ? 729 MET B CB    1 
ATOM   3662 N N     . ASN B 1 239 ? 81.982 73.544  -8.711  1.00 77.93  ? 730 ASN B N     1 
ATOM   3663 C CA    . ASN B 1 239 ? 80.987 72.666  -9.340  1.00 77.99  ? 730 ASN B CA    1 
ATOM   3664 C C     . ASN B 1 239 ? 81.415 71.204  -9.475  1.00 77.79  ? 730 ASN B C     1 
ATOM   3665 O O     . ASN B 1 239 ? 81.036 70.526  -10.432 1.00 78.15  ? 730 ASN B O     1 
ATOM   3666 C CB    . ASN B 1 239 ? 80.583 73.223  -10.718 1.00 78.06  ? 730 ASN B CB    1 
ATOM   3667 N N     . ARG B 1 240 ? 82.185 70.716  -8.509  1.00 76.97  ? 731 ARG B N     1 
ATOM   3668 C CA    . ARG B 1 240 ? 82.651 69.335  -8.535  1.00 75.97  ? 731 ARG B CA    1 
ATOM   3669 C C     . ARG B 1 240 ? 82.160 68.577  -7.296  1.00 75.49  ? 731 ARG B C     1 
ATOM   3670 O O     . ARG B 1 240 ? 81.809 69.186  -6.285  1.00 74.70  ? 731 ARG B O     1 
ATOM   3671 C CB    . ARG B 1 240 ? 84.183 69.308  -8.608  1.00 75.63  ? 731 ARG B CB    1 
ATOM   3672 N N     . PRO B 1 241 ? 82.118 67.234  -7.368  1.00 75.40  ? 732 PRO B N     1 
ATOM   3673 C CA    . PRO B 1 241 ? 81.675 66.380  -6.259  1.00 75.63  ? 732 PRO B CA    1 
ATOM   3674 C C     . PRO B 1 241 ? 82.495 66.631  -5.000  1.00 75.66  ? 732 PRO B C     1 
ATOM   3675 O O     . PRO B 1 241 ? 83.464 67.387  -5.027  1.00 75.95  ? 732 PRO B O     1 
ATOM   3676 C CB    . PRO B 1 241 ? 81.890 64.973  -6.803  1.00 75.40  ? 732 PRO B CB    1 
ATOM   3677 C CG    . PRO B 1 241 ? 81.632 65.146  -8.264  1.00 75.80  ? 732 PRO B CG    1 
ATOM   3678 C CD    . PRO B 1 241 ? 82.381 66.424  -8.570  1.00 75.71  ? 732 PRO B CD    1 
ATOM   3679 N N     . ARG B 1 242 ? 82.119 65.994  -3.899  1.00 75.70  ? 733 ARG B N     1 
ATOM   3680 C CA    . ARG B 1 242 ? 82.851 66.189  -2.657  1.00 75.75  ? 733 ARG B CA    1 
ATOM   3681 C C     . ARG B 1 242 ? 84.290 65.739  -2.856  1.00 75.99  ? 733 ARG B C     1 
ATOM   3682 O O     . ARG B 1 242 ? 84.532 64.600  -3.276  1.00 75.84  ? 733 ARG B O     1 
ATOM   3683 C CB    . ARG B 1 242 ? 82.204 65.400  -1.533  1.00 75.54  ? 733 ARG B CB    1 
ATOM   3684 N N     . ALA B 1 243 ? 85.236 66.640  -2.573  1.00 75.61  ? 734 ALA B N     1 
ATOM   3685 C CA    . ALA B 1 243 ? 86.670 66.348  -2.709  1.00 74.08  ? 734 ALA B CA    1 
ATOM   3686 C C     . ALA B 1 243 ? 87.074 65.124  -1.900  1.00 72.76  ? 734 ALA B C     1 
ATOM   3687 O O     . ALA B 1 243 ? 87.402 64.073  -2.457  1.00 72.88  ? 734 ALA B O     1 
ATOM   3688 C CB    . ALA B 1 243 ? 87.500 67.528  -2.222  1.00 73.63  ? 734 ALA B CB    1 
ATOM   3689 N N     . ALA B 1 244 ? 87.049 65.267  -0.580  1.00 71.09  ? 735 ALA B N     1 
ATOM   3690 C CA    . ALA B 1 244 ? 87.388 64.164  0.306   1.00 69.45  ? 735 ALA B CA    1 
ATOM   3691 C C     . ALA B 1 244 ? 86.167 63.915  1.180   1.00 68.63  ? 735 ALA B C     1 
ATOM   3692 O O     . ALA B 1 244 ? 85.147 64.608  1.053   1.00 68.60  ? 735 ALA B O     1 
ATOM   3693 C CB    . ALA B 1 244 ? 88.560 64.510  1.217   1.00 69.29  ? 735 ALA B CB    1 
ATOM   3694 N N     . THR B 1 245 ? 86.278 62.931  2.067   1.00 66.62  ? 736 THR B N     1 
ATOM   3695 C CA    . THR B 1 245 ? 85.202 62.598  2.989   1.00 64.76  ? 736 THR B CA    1 
ATOM   3696 C C     . THR B 1 245 ? 85.530 63.055  4.402   1.00 64.98  ? 736 THR B C     1 
ATOM   3697 O O     . THR B 1 245 ? 86.524 62.628  4.991   1.00 65.79  ? 736 THR B O     1 
ATOM   3698 C CB    . THR B 1 245 ? 85.001 61.062  2.987   1.00 63.29  ? 736 THR B CB    1 
ATOM   3699 O OG1   . THR B 1 245 ? 84.705 60.625  1.656   1.00 62.84  ? 736 THR B OG1   1 
ATOM   3700 C CG2   . THR B 1 245 ? 83.863 60.671  3.915   1.00 61.09  ? 736 THR B CG2   1 
ATOM   3701 N N     . VAL B 1 246 ? 84.700 63.943  4.942   1.00 63.49  ? 737 VAL B N     1 
ATOM   3702 C CA    . VAL B 1 246 ? 84.913 64.457  6.288   1.00 62.01  ? 737 VAL B CA    1 
ATOM   3703 C C     . VAL B 1 246 ? 84.211 63.581  7.323   1.00 61.40  ? 737 VAL B C     1 
ATOM   3704 O O     . VAL B 1 246 ? 82.985 63.475  7.319   1.00 62.72  ? 737 VAL B O     1 
ATOM   3705 C CB    . VAL B 1 246 ? 84.403 65.891  6.380   1.00 61.03  ? 737 VAL B CB    1 
ATOM   3706 N N     . VAL B 1 247 ? 84.985 62.942  8.198   1.00 59.63  ? 738 VAL B N     1 
ATOM   3707 C CA    . VAL B 1 247 ? 84.411 62.093  9.242   1.00 58.14  ? 738 VAL B CA    1 
ATOM   3708 C C     . VAL B 1 247 ? 84.533 62.839  10.555  1.00 57.65  ? 738 VAL B C     1 
ATOM   3709 O O     . VAL B 1 247 ? 85.315 63.775  10.666  1.00 57.40  ? 738 VAL B O     1 
ATOM   3710 C CB    . VAL B 1 247 ? 85.144 60.766  9.326   1.00 56.20  ? 738 VAL B CB    1 
ATOM   3711 N N     . ALA B 1 248 ? 83.765 62.428  11.552  1.00 57.30  ? 739 ALA B N     1 
ATOM   3712 C CA    . ALA B 1 248 ? 83.806 63.110  12.832  1.00 57.15  ? 739 ALA B CA    1 
ATOM   3713 C C     . ALA B 1 248 ? 84.339 62.251  13.961  1.00 57.30  ? 739 ALA B C     1 
ATOM   3714 O O     . ALA B 1 248 ? 83.658 61.345  14.449  1.00 57.39  ? 739 ALA B O     1 
ATOM   3715 C CB    . ALA B 1 248 ? 82.419 63.630  13.194  1.00 57.39  ? 739 ALA B CB    1 
ATOM   3716 N N     . ARG B 1 249 ? 85.566 62.546  14.371  1.00 56.50  ? 740 ARG B N     1 
ATOM   3717 C CA    . ARG B 1 249 ? 86.185 61.835  15.471  1.00 55.60  ? 740 ARG B CA    1 
ATOM   3718 C C     . ARG B 1 249 ? 85.597 62.424  16.755  1.00 55.05  ? 740 ARG B C     1 
ATOM   3719 O O     . ARG B 1 249 ? 85.884 63.578  17.116  1.00 54.27  ? 740 ARG B O     1 
ATOM   3720 C CB    . ARG B 1 249 ? 87.695 62.032  15.435  1.00 57.17  ? 740 ARG B CB    1 
ATOM   3721 N N     . GLY B 1 250 ? 84.767 61.633  17.435  1.00 53.78  ? 741 GLY B N     1 
ATOM   3722 C CA    . GLY B 1 250 ? 84.138 62.096  18.661  1.00 51.89  ? 741 GLY B CA    1 
ATOM   3723 C C     . GLY B 1 250 ? 82.947 62.971  18.321  1.00 51.00  ? 741 GLY B C     1 
ATOM   3724 O O     . GLY B 1 250 ? 82.866 63.482  17.205  1.00 51.37  ? 741 GLY B O     1 
ATOM   3725 N N     . PRO B 1 251 ? 82.000 63.164  19.250  1.00 50.10  ? 742 PRO B N     1 
ATOM   3726 C CA    . PRO B 1 251 ? 80.827 64.003  18.965  1.00 49.27  ? 742 PRO B CA    1 
ATOM   3727 C C     . PRO B 1 251 ? 81.162 65.319  18.248  1.00 47.87  ? 742 PRO B C     1 
ATOM   3728 O O     . PRO B 1 251 ? 82.059 66.056  18.669  1.00 47.19  ? 742 PRO B O     1 
ATOM   3729 C CB    . PRO B 1 251 ? 80.200 64.216  20.357  1.00 49.54  ? 742 PRO B CB    1 
ATOM   3730 C CG    . PRO B 1 251 ? 81.320 63.900  21.326  1.00 49.05  ? 742 PRO B CG    1 
ATOM   3731 C CD    . PRO B 1 251 ? 82.021 62.749  20.661  1.00 49.38  ? 742 PRO B CD    1 
ATOM   3732 N N     . LEU B 1 252 ? 80.448 65.609  17.161  1.00 45.83  ? 743 LEU B N     1 
ATOM   3733 C CA    . LEU B 1 252 ? 80.707 66.836  16.413  1.00 44.11  ? 743 LEU B CA    1 
ATOM   3734 C C     . LEU B 1 252 ? 79.485 67.732  16.261  1.00 44.27  ? 743 LEU B C     1 
ATOM   3735 O O     . LEU B 1 252 ? 78.455 67.332  15.730  1.00 44.46  ? 743 LEU B O     1 
ATOM   3736 C CB    . LEU B 1 252 ? 81.288 66.514  15.025  1.00 40.56  ? 743 LEU B CB    1 
ATOM   3737 C CG    . LEU B 1 252 ? 81.941 67.669  14.250  1.00 37.52  ? 743 LEU B CG    1 
ATOM   3738 C CD1   . LEU B 1 252 ? 82.925 68.436  15.125  1.00 34.37  ? 743 LEU B CD1   1 
ATOM   3739 C CD2   . LEU B 1 252 ? 82.655 67.110  13.048  1.00 35.82  ? 743 LEU B CD2   1 
ATOM   3740 N N     . LYS B 1 253 ? 79.620 68.960  16.742  1.00 44.90  ? 744 LYS B N     1 
ATOM   3741 C CA    . LYS B 1 253 ? 78.559 69.943  16.665  1.00 43.74  ? 744 LYS B CA    1 
ATOM   3742 C C     . LYS B 1 253 ? 78.935 70.943  15.588  1.00 44.25  ? 744 LYS B C     1 
ATOM   3743 O O     . LYS B 1 253 ? 80.058 71.437  15.557  1.00 44.44  ? 744 LYS B O     1 
ATOM   3744 C CB    . LYS B 1 253 ? 78.407 70.651  18.013  1.00 42.83  ? 744 LYS B CB    1 
ATOM   3745 C CG    . LYS B 1 253 ? 77.899 69.751  19.135  1.00 41.96  ? 744 LYS B CG    1 
ATOM   3746 C CD    . LYS B 1 253 ? 77.694 70.540  20.412  1.00 41.55  ? 744 LYS B CD    1 
ATOM   3747 C CE    . LYS B 1 253 ? 76.827 69.787  21.405  1.00 40.21  ? 744 LYS B CE    1 
ATOM   3748 N NZ    . LYS B 1 253 ? 75.466 69.514  20.875  1.00 38.36  ? 744 LYS B NZ    1 
ATOM   3749 N N     . CYS B 1 254 ? 77.998 71.234  14.693  1.00 44.76  ? 745 CYS B N     1 
ATOM   3750 C CA    . CYS B 1 254 ? 78.260 72.187  13.617  1.00 43.49  ? 745 CYS B CA    1 
ATOM   3751 C C     . CYS B 1 254 ? 77.052 73.059  13.312  1.00 42.91  ? 745 CYS B C     1 
ATOM   3752 O O     . CYS B 1 254 ? 75.959 72.872  13.862  1.00 42.68  ? 745 CYS B O     1 
ATOM   3753 C CB    . CYS B 1 254 ? 78.632 71.452  12.333  1.00 44.46  ? 745 CYS B CB    1 
ATOM   3754 S SG    . CYS B 1 254 ? 79.903 70.193  12.488  1.00 43.81  ? 745 CYS B SG    1 
ATOM   3755 N N     . VAL B 1 255 ? 77.275 74.030  12.435  1.00 41.15  ? 746 VAL B N     1 
ATOM   3756 C CA    . VAL B 1 255 ? 76.222 74.920  11.965  1.00 39.38  ? 746 VAL B CA    1 
ATOM   3757 C C     . VAL B 1 255 ? 76.489 74.989  10.484  1.00 38.58  ? 746 VAL B C     1 
ATOM   3758 O O     . VAL B 1 255 ? 77.554 75.444  10.062  1.00 38.09  ? 746 VAL B O     1 
ATOM   3759 C CB    . VAL B 1 255 ? 76.311 76.328  12.563  1.00 37.64  ? 746 VAL B CB    1 
ATOM   3760 C CG1   . VAL B 1 255 ? 75.789 76.311  13.982  1.00 36.57  ? 746 VAL B CG1   1 
ATOM   3761 C CG2   . VAL B 1 255 ? 77.740 76.828  12.504  1.00 39.41  ? 746 VAL B CG2   1 
ATOM   3762 N N     . LYS B 1 256 ? 75.538 74.512  9.691   1.00 37.75  ? 747 LYS B N     1 
ATOM   3763 C CA    . LYS B 1 256 ? 75.725 74.510  8.252   1.00 38.52  ? 747 LYS B CA    1 
ATOM   3764 C C     . LYS B 1 256 ? 74.930 75.564  7.521   1.00 39.10  ? 747 LYS B C     1 
ATOM   3765 O O     . LYS B 1 256 ? 74.189 76.347  8.120   1.00 39.31  ? 747 LYS B O     1 
ATOM   3766 C CB    . LYS B 1 256 ? 75.403 73.129  7.657   1.00 37.54  ? 747 LYS B CB    1 
ATOM   3767 C CG    . LYS B 1 256 ? 73.992 72.641  7.936   1.00 37.40  ? 747 LYS B CG    1 
ATOM   3768 C CD    . LYS B 1 256 ? 73.666 71.410  7.148   1.00 35.46  ? 747 LYS B CD    1 
ATOM   3769 C CE    . LYS B 1 256 ? 72.235 71.001  7.396   1.00 37.42  ? 747 LYS B CE    1 
ATOM   3770 N NZ    . LYS B 1 256 ? 71.798 69.894  6.475   1.00 40.44  ? 747 LYS B NZ    1 
ATOM   3771 N N     . LEU B 1 257 ? 75.121 75.552  6.206   1.00 40.90  ? 748 LEU B N     1 
ATOM   3772 C CA    . LEU B 1 257 ? 74.481 76.456  5.265   1.00 42.22  ? 748 LEU B CA    1 
ATOM   3773 C C     . LEU B 1 257 ? 74.138 75.645  4.020   1.00 44.22  ? 748 LEU B C     1 
ATOM   3774 O O     . LEU B 1 257 ? 74.703 74.576  3.794   1.00 44.95  ? 748 LEU B O     1 
ATOM   3775 C CB    . LEU B 1 257 ? 75.452 77.579  4.894   1.00 39.68  ? 748 LEU B CB    1 
ATOM   3776 C CG    . LEU B 1 257 ? 75.198 78.951  5.516   1.00 39.49  ? 748 LEU B CG    1 
ATOM   3777 C CD1   . LEU B 1 257 ? 74.951 78.818  6.999   1.00 42.30  ? 748 LEU B CD1   1 
ATOM   3778 C CD2   . LEU B 1 257 ? 76.380 79.849  5.264   1.00 38.76  ? 748 LEU B CD2   1 
ATOM   3779 N N     . ASP B 1 258 ? 73.190 76.127  3.229   1.00 46.40  ? 749 ASP B N     1 
ATOM   3780 C CA    . ASP B 1 258 ? 72.852 75.437  1.994   1.00 47.51  ? 749 ASP B CA    1 
ATOM   3781 C C     . ASP B 1 258 ? 73.174 76.402  0.855   1.00 48.20  ? 749 ASP B C     1 
ATOM   3782 O O     . ASP B 1 258 ? 73.350 77.612  1.082   1.00 48.24  ? 749 ASP B O     1 
ATOM   3783 C CB    . ASP B 1 258 ? 71.379 74.992  1.972   1.00 48.66  ? 749 ASP B CB    1 
ATOM   3784 C CG    . ASP B 1 258 ? 70.398 76.137  1.766   1.00 50.51  ? 749 ASP B CG    1 
ATOM   3785 O OD1   . ASP B 1 258 ? 69.207 75.834  1.525   1.00 52.16  ? 749 ASP B OD1   1 
ATOM   3786 O OD2   . ASP B 1 258 ? 70.789 77.321  1.842   1.00 51.15  ? 749 ASP B OD2   1 
ATOM   3787 N N     . ARG B 1 259 ? 73.280 75.876  -0.359  1.00 47.73  ? 750 ARG B N     1 
ATOM   3788 C CA    . ARG B 1 259 ? 73.614 76.714  -1.498  1.00 47.66  ? 750 ARG B CA    1 
ATOM   3789 C C     . ARG B 1 259 ? 72.961 78.113  -1.416  1.00 46.79  ? 750 ARG B C     1 
ATOM   3790 O O     . ARG B 1 259 ? 73.650 79.120  -1.487  1.00 47.72  ? 750 ARG B O     1 
ATOM   3791 C CB    . ARG B 1 259 ? 73.230 75.998  -2.803  1.00 49.24  ? 750 ARG B CB    1 
ATOM   3792 C CG    . ARG B 1 259 ? 73.933 76.532  -4.048  1.00 51.35  ? 750 ARG B CG    1 
ATOM   3793 C CD    . ARG B 1 259 ? 75.000 75.571  -4.549  1.00 53.31  ? 750 ARG B CD    1 
ATOM   3794 N NE    . ARG B 1 259 ? 74.435 74.442  -5.288  1.00 54.66  ? 750 ARG B NE    1 
ATOM   3795 C CZ    . ARG B 1 259 ? 75.102 73.332  -5.593  1.00 55.38  ? 750 ARG B CZ    1 
ATOM   3796 N NH1   . ARG B 1 259 ? 76.369 73.189  -5.216  1.00 56.78  ? 750 ARG B NH1   1 
ATOM   3797 N NH2   . ARG B 1 259 ? 74.507 72.364  -6.279  1.00 55.93  ? 750 ARG B NH2   1 
ATOM   3798 N N     . PRO B 1 260 ? 71.630 78.193  -1.247  1.00 45.87  ? 751 PRO B N     1 
ATOM   3799 C CA    . PRO B 1 260 ? 70.957 79.493  -1.166  1.00 45.62  ? 751 PRO B CA    1 
ATOM   3800 C C     . PRO B 1 260 ? 71.506 80.506  -0.158  1.00 46.13  ? 751 PRO B C     1 
ATOM   3801 O O     . PRO B 1 260 ? 71.985 81.577  -0.543  1.00 45.53  ? 751 PRO B O     1 
ATOM   3802 C CB    . PRO B 1 260 ? 69.519 79.102  -0.867  1.00 44.75  ? 751 PRO B CB    1 
ATOM   3803 C CG    . PRO B 1 260 ? 69.367 77.870  -1.660  1.00 44.36  ? 751 PRO B CG    1 
ATOM   3804 C CD    . PRO B 1 260 ? 70.629 77.113  -1.314  1.00 45.79  ? 751 PRO B CD    1 
ATOM   3805 N N     . ARG B 1 261 ? 71.417 80.175  1.129   1.00 46.70  ? 752 ARG B N     1 
ATOM   3806 C CA    . ARG B 1 261 ? 71.898 81.058  2.191   1.00 45.89  ? 752 ARG B CA    1 
ATOM   3807 C C     . ARG B 1 261 ? 73.407 81.254  2.100   1.00 47.18  ? 752 ARG B C     1 
ATOM   3808 O O     . ARG B 1 261 ? 73.928 82.346  2.364   1.00 45.64  ? 752 ARG B O     1 
ATOM   3809 C CB    . ARG B 1 261 ? 71.542 80.477  3.559   1.00 43.94  ? 752 ARG B CB    1 
ATOM   3810 C CG    . ARG B 1 261 ? 70.063 80.314  3.795   1.00 39.89  ? 752 ARG B CG    1 
ATOM   3811 C CD    . ARG B 1 261 ? 69.746 78.886  4.162   1.00 38.44  ? 752 ARG B CD    1 
ATOM   3812 N NE    . ARG B 1 261 ? 70.393 78.478  5.405   1.00 36.22  ? 752 ARG B NE    1 
ATOM   3813 C CZ    . ARG B 1 261 ? 70.455 77.223  5.829   1.00 36.16  ? 752 ARG B CZ    1 
ATOM   3814 N NH1   . ARG B 1 261 ? 69.904 76.257  5.111   1.00 35.84  ? 752 ARG B NH1   1 
ATOM   3815 N NH2   . ARG B 1 261 ? 71.097 76.927  6.949   1.00 37.50  ? 752 ARG B NH2   1 
ATOM   3816 N N     . PHE B 1 262 ? 74.105 80.182  1.740   1.00 48.21  ? 753 PHE B N     1 
ATOM   3817 C CA    . PHE B 1 262 ? 75.553 80.235  1.599   1.00 50.07  ? 753 PHE B CA    1 
ATOM   3818 C C     . PHE B 1 262 ? 75.899 81.344  0.625   1.00 50.20  ? 753 PHE B C     1 
ATOM   3819 O O     . PHE B 1 262 ? 76.547 82.328  0.972   1.00 50.53  ? 753 PHE B O     1 
ATOM   3820 C CB    . PHE B 1 262 ? 76.073 78.906  1.057   1.00 51.96  ? 753 PHE B CB    1 
ATOM   3821 C CG    . PHE B 1 262 ? 77.520 78.937  0.648   1.00 53.62  ? 753 PHE B CG    1 
ATOM   3822 C CD1   . PHE B 1 262 ? 78.509 79.293  1.562   1.00 54.03  ? 753 PHE B CD1   1 
ATOM   3823 C CD2   . PHE B 1 262 ? 77.898 78.567  -0.638  1.00 53.13  ? 753 PHE B CD2   1 
ATOM   3824 C CE1   . PHE B 1 262 ? 79.854 79.273  1.202   1.00 54.98  ? 753 PHE B CE1   1 
ATOM   3825 C CE2   . PHE B 1 262 ? 79.236 78.543  -1.005  1.00 53.74  ? 753 PHE B CE2   1 
ATOM   3826 C CZ    . PHE B 1 262 ? 80.217 78.896  -0.082  1.00 54.29  ? 753 PHE B CZ    1 
ATOM   3827 N N     . GLU B 1 263 ? 75.444 81.166  -0.605  1.00 50.64  ? 754 GLU B N     1 
ATOM   3828 C CA    . GLU B 1 263 ? 75.679 82.127  -1.660  1.00 51.50  ? 754 GLU B CA    1 
ATOM   3829 C C     . GLU B 1 263 ? 75.161 83.507  -1.285  1.00 52.00  ? 754 GLU B C     1 
ATOM   3830 O O     . GLU B 1 263 ? 75.476 84.488  -1.959  1.00 52.07  ? 754 GLU B O     1 
ATOM   3831 C CB    . GLU B 1 263 ? 75.036 81.635  -2.948  1.00 51.85  ? 754 GLU B CB    1 
ATOM   3832 C CG    . GLU B 1 263 ? 75.477 80.248  -3.374  1.00 52.35  ? 754 GLU B CG    1 
ATOM   3833 C CD    . GLU B 1 263 ? 74.840 79.827  -4.679  1.00 53.42  ? 754 GLU B CD    1 
ATOM   3834 O OE1   . GLU B 1 263 ? 73.593 79.846  -4.770  1.00 53.03  ? 754 GLU B OE1   1 
ATOM   3835 O OE2   . GLU B 1 263 ? 75.586 79.478  -5.615  1.00 55.25  ? 754 GLU B OE2   1 
ATOM   3836 N N     . ARG B 1 264 ? 74.382 83.582  -0.207  1.00 52.77  ? 755 ARG B N     1 
ATOM   3837 C CA    . ARG B 1 264 ? 73.807 84.855  0.239   1.00 53.39  ? 755 ARG B CA    1 
ATOM   3838 C C     . ARG B 1 264 ? 74.448 85.489  1.479   1.00 54.79  ? 755 ARG B C     1 
ATOM   3839 O O     . ARG B 1 264 ? 75.054 86.563  1.388   1.00 55.55  ? 755 ARG B O     1 
ATOM   3840 C CB    . ARG B 1 264 ? 72.291 84.665  0.489   1.00 51.25  ? 755 ARG B CB    1 
ATOM   3841 C CG    . ARG B 1 264 ? 71.528 85.978  0.619   1.00 48.56  ? 755 ARG B CG    1 
ATOM   3842 C CD    . ARG B 1 264 ? 70.091 85.770  1.053   1.00 46.42  ? 755 ARG B CD    1 
ATOM   3843 N NE    . ARG B 1 264 ? 70.027 85.302  2.429   1.00 44.16  ? 755 ARG B NE    1 
ATOM   3844 C CZ    . ARG B 1 264 ? 69.469 84.162  2.809   1.00 41.90  ? 755 ARG B CZ    1 
ATOM   3845 N NH1   . ARG B 1 264 ? 68.902 83.352  1.914   1.00 39.11  ? 755 ARG B NH1   1 
ATOM   3846 N NH2   . ARG B 1 264 ? 69.515 83.820  4.087   1.00 41.16  ? 755 ARG B NH2   1 
ATOM   3847 N N     . VAL B 1 265 ? 74.318 84.840  2.637   1.00 54.74  ? 756 VAL B N     1 
ATOM   3848 C CA    . VAL B 1 265 ? 74.891 85.387  3.863   1.00 54.06  ? 756 VAL B CA    1 
ATOM   3849 C C     . VAL B 1 265 ? 76.403 85.507  3.758   1.00 52.86  ? 756 VAL B C     1 
ATOM   3850 O O     . VAL B 1 265 ? 77.013 86.343  4.415   1.00 52.46  ? 756 VAL B O     1 
ATOM   3851 C CB    . VAL B 1 265 ? 74.547 84.516  5.102   1.00 54.44  ? 756 VAL B CB    1 
ATOM   3852 C CG1   . VAL B 1 265 ? 73.042 84.421  5.260   1.00 55.37  ? 756 VAL B CG1   1 
ATOM   3853 C CG2   . VAL B 1 265 ? 75.158 83.134  4.970   1.00 54.72  ? 756 VAL B CG2   1 
ATOM   3854 N N     . LEU B 1 266 ? 76.994 84.663  2.922   1.00 52.59  ? 757 LEU B N     1 
ATOM   3855 C CA    . LEU B 1 266 ? 78.436 84.644  2.722   1.00 52.56  ? 757 LEU B CA    1 
ATOM   3856 C C     . LEU B 1 266 ? 78.852 85.148  1.356   1.00 53.66  ? 757 LEU B C     1 
ATOM   3857 O O     . LEU B 1 266 ? 79.951 84.857  0.896   1.00 53.04  ? 757 LEU B O     1 
ATOM   3858 C CB    . LEU B 1 266 ? 78.990 83.241  3.006   1.00 50.69  ? 757 LEU B CB    1 
ATOM   3859 C CG    . LEU B 1 266 ? 79.365 82.835  4.439   1.00 48.78  ? 757 LEU B CG    1 
ATOM   3860 C CD1   . LEU B 1 266 ? 78.468 83.475  5.474   1.00 49.37  ? 757 LEU B CD1   1 
ATOM   3861 C CD2   . LEU B 1 266 ? 79.292 81.338  4.535   1.00 48.43  ? 757 LEU B CD2   1 
ATOM   3862 N N     . GLY B 1 267 ? 77.964 85.895  0.711   1.00 56.04  ? 758 GLY B N     1 
ATOM   3863 C CA    . GLY B 1 267 ? 78.272 86.444  -0.595  1.00 59.00  ? 758 GLY B CA    1 
ATOM   3864 C C     . GLY B 1 267 ? 79.607 87.171  -0.597  1.00 61.66  ? 758 GLY B C     1 
ATOM   3865 O O     . GLY B 1 267 ? 80.492 86.851  -1.397  1.00 61.35  ? 758 GLY B O     1 
ATOM   3866 N N     . PRO B 1 268 ? 79.777 88.164  0.293   1.00 63.63  ? 759 PRO B N     1 
ATOM   3867 C CA    . PRO B 1 268 ? 81.020 88.934  0.401   1.00 64.71  ? 759 PRO B CA    1 
ATOM   3868 C C     . PRO B 1 268 ? 82.171 88.094  0.957   1.00 65.32  ? 759 PRO B C     1 
ATOM   3869 O O     . PRO B 1 268 ? 83.097 88.622  1.566   1.00 65.12  ? 759 PRO B O     1 
ATOM   3870 C CB    . PRO B 1 268 ? 80.634 90.082  1.334   1.00 65.13  ? 759 PRO B CB    1 
ATOM   3871 C CG    . PRO B 1 268 ? 79.176 90.278  1.039   1.00 65.14  ? 759 PRO B CG    1 
ATOM   3872 C CD    . PRO B 1 268 ? 78.684 88.848  1.008   1.00 64.51  ? 759 PRO B CD    1 
ATOM   3873 N N     . CYS B 1 269 ? 82.101 86.785  0.748   1.00 66.42  ? 760 CYS B N     1 
ATOM   3874 C CA    . CYS B 1 269 ? 83.139 85.879  1.215   1.00 68.15  ? 760 CYS B CA    1 
ATOM   3875 C C     . CYS B 1 269 ? 83.635 85.031  0.054   1.00 69.73  ? 760 CYS B C     1 
ATOM   3876 O O     . CYS B 1 269 ? 84.657 84.348  0.157   1.00 69.79  ? 760 CYS B O     1 
ATOM   3877 C CB    . CYS B 1 269 ? 82.594 84.963  2.307   1.00 67.81  ? 760 CYS B CB    1 
ATOM   3878 S SG    . CYS B 1 269 ? 82.070 85.815  3.795   1.00 70.05  ? 760 CYS B SG    1 
ATOM   3879 N N     . SER B 1 270 ? 82.899 85.079  -1.052  1.00 70.97  ? 761 SER B N     1 
ATOM   3880 C CA    . SER B 1 270 ? 83.243 84.308  -2.240  1.00 72.39  ? 761 SER B CA    1 
ATOM   3881 C C     . SER B 1 270 ? 84.743 84.327  -2.550  1.00 73.62  ? 761 SER B C     1 
ATOM   3882 O O     . SER B 1 270 ? 85.372 83.272  -2.684  1.00 74.94  ? 761 SER B O     1 
ATOM   3883 C CB    . SER B 1 270 ? 82.461 84.830  -3.449  1.00 71.89  ? 761 SER B CB    1 
ATOM   3884 O OG    . SER B 1 270 ? 82.609 83.967  -4.563  1.00 70.34  ? 761 SER B OG    1 
ATOM   3885 N N     . ASP B 1 271 ? 85.315 85.523  -2.660  1.00 73.52  ? 762 ASP B N     1 
ATOM   3886 C CA    . ASP B 1 271 ? 86.735 85.657  -2.969  1.00 73.33  ? 762 ASP B CA    1 
ATOM   3887 C C     . ASP B 1 271 ? 87.673 84.854  -2.085  1.00 72.04  ? 762 ASP B C     1 
ATOM   3888 O O     . ASP B 1 271 ? 88.287 83.888  -2.534  1.00 70.63  ? 762 ASP B O     1 
ATOM   3889 C CB    . ASP B 1 271 ? 87.147 87.123  -2.886  1.00 74.60  ? 762 ASP B CB    1 
ATOM   3890 C CG    . ASP B 1 271 ? 86.498 87.960  -3.962  1.00 75.81  ? 762 ASP B CG    1 
ATOM   3891 O OD1   . ASP B 1 271 ? 86.728 89.185  -3.969  1.00 77.14  ? 762 ASP B OD1   1 
ATOM   3892 O OD2   . ASP B 1 271 ? 85.762 87.391  -4.803  1.00 75.95  ? 762 ASP B OD2   1 
ATOM   3893 N N     . ILE B 1 272 ? 87.781 85.270  -0.829  1.00 71.63  ? 763 ILE B N     1 
ATOM   3894 C CA    . ILE B 1 272 ? 88.645 84.596  0.127   1.00 72.02  ? 763 ILE B CA    1 
ATOM   3895 C C     . ILE B 1 272 ? 88.401 83.092  0.111   1.00 71.30  ? 763 ILE B C     1 
ATOM   3896 O O     . ILE B 1 272 ? 89.335 82.292  0.156   1.00 72.31  ? 763 ILE B O     1 
ATOM   3897 C CB    . ILE B 1 272 ? 88.417 85.184  1.526   1.00 71.79  ? 763 ILE B CB    1 
ATOM   3898 N N     . LEU B 1 273 ? 87.135 82.701  0.047   1.00 69.37  ? 764 LEU B N     1 
ATOM   3899 C CA    . LEU B 1 273 ? 86.792 81.290  0.025   1.00 67.76  ? 764 LEU B CA    1 
ATOM   3900 C C     . LEU B 1 273 ? 87.430 80.601  -1.167  1.00 67.35  ? 764 LEU B C     1 
ATOM   3901 O O     . LEU B 1 273 ? 88.072 79.555  -1.026  1.00 67.63  ? 764 LEU B O     1 
ATOM   3902 C CB    . LEU B 1 273 ? 85.274 81.125  -0.018  1.00 67.13  ? 764 LEU B CB    1 
ATOM   3903 C CG    . LEU B 1 273 ? 84.660 81.190  1.379   1.00 67.18  ? 764 LEU B CG    1 
ATOM   3904 C CD1   . LEU B 1 273 ? 83.157 81.436  1.315   1.00 67.00  ? 764 LEU B CD1   1 
ATOM   3905 C CD2   . LEU B 1 273 ? 84.984 79.887  2.090   1.00 66.02  ? 764 LEU B CD2   1 
ATOM   3906 N N     . LYS B 1 274 ? 87.246 81.195  -2.342  1.00 66.63  ? 765 LYS B N     1 
ATOM   3907 C CA    . LYS B 1 274 ? 87.802 80.652  -3.573  1.00 64.84  ? 765 LYS B CA    1 
ATOM   3908 C C     . LYS B 1 274 ? 89.315 80.568  -3.440  1.00 63.83  ? 765 LYS B C     1 
ATOM   3909 O O     . LYS B 1 274 ? 89.902 79.507  -3.635  1.00 63.59  ? 765 LYS B O     1 
ATOM   3910 C CB    . LYS B 1 274 ? 87.460 81.550  -4.762  1.00 64.99  ? 765 LYS B CB    1 
ATOM   3911 C CG    . LYS B 1 274 ? 85.982 81.712  -5.074  1.00 64.83  ? 765 LYS B CG    1 
ATOM   3912 C CD    . LYS B 1 274 ? 85.827 82.667  -6.249  1.00 64.67  ? 765 LYS B CD    1 
ATOM   3913 C CE    . LYS B 1 274 ? 84.394 82.796  -6.729  1.00 64.66  ? 765 LYS B CE    1 
ATOM   3914 N NZ    . LYS B 1 274 ? 84.309 83.662  -7.951  1.00 64.60  ? 765 LYS B NZ    1 
ATOM   3915 N N     . ARG B 1 275 ? 89.933 81.699  -3.109  1.00 62.63  ? 766 ARG B N     1 
ATOM   3916 C CA    . ARG B 1 275 ? 91.380 81.779  -2.952  1.00 61.83  ? 766 ARG B CA    1 
ATOM   3917 C C     . ARG B 1 275 ? 91.841 80.834  -1.859  1.00 61.87  ? 766 ARG B C     1 
ATOM   3918 O O     . ARG B 1 275 ? 92.363 81.272  -0.834  1.00 61.44  ? 766 ARG B O     1 
ATOM   3919 C CB    . ARG B 1 275 ? 91.793 83.201  -2.620  1.00 61.03  ? 766 ARG B CB    1 
ATOM   3920 N N     . ASN B 1 276 ? 91.630 79.540  -2.099  1.00 62.28  ? 767 ASN B N     1 
ATOM   3921 C CA    . ASN B 1 276 ? 91.994 78.448  -1.192  1.00 62.59  ? 767 ASN B CA    1 
ATOM   3922 C C     . ASN B 1 276 ? 91.759 77.122  -1.927  1.00 61.77  ? 767 ASN B C     1 
ATOM   3923 O O     . ASN B 1 276 ? 91.069 77.149  -2.968  1.00 60.16  ? 767 ASN B O     1 
ATOM   3924 C CB    . ASN B 1 276 ? 91.131 78.481  0.078   1.00 62.27  ? 767 ASN B CB    1 
ATOM   3925 C CG    . ASN B 1 276 ? 91.481 79.634  1.000   1.00 62.92  ? 767 ASN B CG    1 
ATOM   3926 O OD1   . ASN B 1 276 ? 90.602 80.250  1.614   1.00 63.84  ? 767 ASN B OD1   1 
ATOM   3927 N ND2   . ASN B 1 276 ? 92.769 79.924  1.113   1.00 63.37  ? 767 ASN B ND2   1 
HETATM 3928 P PA    . PCG C 2 .   ? 21.350 63.858  -3.442  1.00 39.85  ? 401 PCG A PA    1 
HETATM 3929 O O1A   . PCG C 2 .   ? 22.304 64.874  -2.850  1.00 44.09  ? 401 PCG A O1A   1 
HETATM 3930 O O2A   . PCG C 2 .   ? 20.915 64.507  -4.750  1.00 42.53  ? 401 PCG A O2A   1 
HETATM 3931 O "O5'" . PCG C 2 .   ? 20.252 63.736  -2.431  1.00 34.60  ? 401 PCG A "O5'" 1 
HETATM 3932 C "C5'" . PCG C 2 .   ? 20.433 63.276  -1.064  1.00 31.19  ? 401 PCG A "C5'" 1 
HETATM 3933 C "C4'" . PCG C 2 .   ? 21.567 62.290  -1.016  1.00 33.43  ? 401 PCG A "C4'" 1 
HETATM 3934 O "O4'" . PCG C 2 .   ? 21.636 61.304  0.064   1.00 34.98  ? 401 PCG A "O4'" 1 
HETATM 3935 C "C3'" . PCG C 2 .   ? 21.615 61.517  -2.294  1.00 34.87  ? 401 PCG A "C3'" 1 
HETATM 3936 O "O3'" . PCG C 2 .   ? 21.537 62.373  -3.524  1.00 37.86  ? 401 PCG A "O3'" 1 
HETATM 3937 C "C2'" . PCG C 2 .   ? 22.845 60.664  -1.856  1.00 34.70  ? 401 PCG A "C2'" 1 
HETATM 3938 O "O2'" . PCG C 2 .   ? 24.160 61.169  -1.993  1.00 32.59  ? 401 PCG A "O2'" 1 
HETATM 3939 C "C1'" . PCG C 2 .   ? 22.630 60.384  -0.362  1.00 34.08  ? 401 PCG A "C1'" 1 
HETATM 3940 N N9    . PCG C 2 .   ? 22.171 58.998  -0.032  1.00 35.96  ? 401 PCG A N9    1 
HETATM 3941 C C8    . PCG C 2 .   ? 22.509 58.067  0.949   1.00 37.64  ? 401 PCG A C8    1 
HETATM 3942 N N7    . PCG C 2 .   ? 21.814 56.942  0.843   1.00 35.50  ? 401 PCG A N7    1 
HETATM 3943 C C5    . PCG C 2 .   ? 20.939 57.083  -0.268  1.00 33.55  ? 401 PCG A C5    1 
HETATM 3944 C C6    . PCG C 2 .   ? 19.947 56.198  -0.870  1.00 33.66  ? 401 PCG A C6    1 
HETATM 3945 O O6    . PCG C 2 .   ? 19.608 55.034  -0.520  1.00 33.59  ? 401 PCG A O6    1 
HETATM 3946 N N1    . PCG C 2 .   ? 19.306 56.780  -2.000  1.00 33.95  ? 401 PCG A N1    1 
HETATM 3947 C C2    . PCG C 2 .   ? 19.550 58.068  -2.532  1.00 35.70  ? 401 PCG A C2    1 
HETATM 3948 N N2    . PCG C 2 .   ? 18.832 58.430  -3.619  1.00 35.34  ? 401 PCG A N2    1 
HETATM 3949 N N3    . PCG C 2 .   ? 20.462 58.931  -1.996  1.00 33.74  ? 401 PCG A N3    1 
HETATM 3950 C C4    . PCG C 2 .   ? 21.139 58.391  -0.859  1.00 34.68  ? 401 PCG A C4    1 
HETATM 3951 C C1    . GOL D 3 .   ? 40.188 35.180  4.675   1.00 56.96  ? 402 GOL A C1    1 
HETATM 3952 O O1    . GOL D 3 .   ? 39.912 33.987  3.613   1.00 58.88  ? 402 GOL A O1    1 
HETATM 3953 C C2    . GOL D 3 .   ? 41.358 35.943  4.760   1.00 55.24  ? 402 GOL A C2    1 
HETATM 3954 O O2    . GOL D 3 .   ? 42.080 35.863  3.645   1.00 55.77  ? 402 GOL A O2    1 
HETATM 3955 C C3    . GOL D 3 .   ? 41.411 36.490  5.818   1.00 54.53  ? 402 GOL A C3    1 
HETATM 3956 O O3    . GOL D 3 .   ? 41.028 36.948  7.242   1.00 53.11  ? 402 GOL A O3    1 
HETATM 3957 P PA    . PCG E 2 .   ? 64.926 98.509  10.112  1.00 30.11  ? 801 PCG B PA    1 
HETATM 3958 O O1A   . PCG E 2 .   ? 63.632 97.765  10.417  1.00 33.81  ? 801 PCG B O1A   1 
HETATM 3959 O O2A   . PCG E 2 .   ? 64.815 99.750  10.973  1.00 33.80  ? 801 PCG B O2A   1 
HETATM 3960 O "O5'" . PCG E 2 .   ? 64.873 98.855  8.662   1.00 28.39  ? 801 PCG B "O5'" 1 
HETATM 3961 C "C5'" . PCG E 2 .   ? 65.994 99.199  7.842   1.00 29.63  ? 801 PCG B "C5'" 1 
HETATM 3962 C "C4'" . PCG E 2 .   ? 66.656 97.904  7.707   1.00 29.36  ? 801 PCG B "C4'" 1 
HETATM 3963 O "O4'" . PCG E 2 .   ? 67.667 97.657  6.696   1.00 30.86  ? 801 PCG B "O4'" 1 
HETATM 3964 C "C3'" . PCG E 2 .   ? 67.251 97.595  9.020   1.00 30.80  ? 801 PCG B "C3'" 1 
HETATM 3965 O "O3'" . PCG E 2 .   ? 66.319 97.870  10.189  1.00 32.63  ? 801 PCG B "O3'" 1 
HETATM 3966 C "C2'" . PCG E 2 .   ? 67.795 96.222  8.554   1.00 29.65  ? 801 PCG B "C2'" 1 
HETATM 3967 O "O2'" . PCG E 2 .   ? 66.936 95.113  8.569   1.00 28.74  ? 801 PCG B "O2'" 1 
HETATM 3968 C "C1'" . PCG E 2 .   ? 68.216 96.416  7.083   1.00 31.86  ? 801 PCG B "C1'" 1 
HETATM 3969 N N9    . PCG E 2 .   ? 69.709 96.414  6.807   1.00 32.33  ? 801 PCG B N9    1 
HETATM 3970 C C8    . PCG E 2 .   ? 70.510 95.822  5.835   1.00 32.31  ? 801 PCG B C8    1 
HETATM 3971 N N7    . PCG E 2 .   ? 71.796 96.099  5.993   1.00 32.28  ? 801 PCG B N7    1 
HETATM 3972 C C5    . PCG E 2 .   ? 71.914 96.940  7.141   1.00 32.63  ? 801 PCG B C5    1 
HETATM 3973 C C6    . PCG E 2 .   ? 73.063 97.578  7.815   1.00 34.02  ? 801 PCG B C6    1 
HETATM 3974 O O6    . PCG E 2 .   ? 74.296 97.536  7.512   1.00 36.28  ? 801 PCG B O6    1 
HETATM 3975 N N1    . PCG E 2 .   ? 72.680 98.350  8.959   1.00 32.93  ? 801 PCG B N1    1 
HETATM 3976 C C2    . PCG E 2 .   ? 71.374 98.531  9.452   1.00 32.07  ? 801 PCG B C2    1 
HETATM 3977 N N2    . PCG E 2 .   ? 71.247 99.314  10.550  1.00 28.53  ? 801 PCG B N2    1 
HETATM 3978 N N3    . PCG E 2 .   ? 70.270 97.962  8.860   1.00 33.18  ? 801 PCG B N3    1 
HETATM 3979 C C4    . PCG E 2 .   ? 70.591 97.166  7.695   1.00 32.85  ? 801 PCG B C4    1 
HETATM 3980 C C1    . GOL F 3 .   ? 84.397 68.653  0.194   1.00 39.46  ? 802 GOL B C1    1 
HETATM 3981 O O1    . GOL F 3 .   ? 85.017 67.614  1.264   1.00 38.01  ? 802 GOL B O1    1 
HETATM 3982 C C2    . GOL F 3 .   ? 84.711 70.018  0.051   1.00 39.09  ? 802 GOL B C2    1 
HETATM 3983 O O2    . GOL F 3 .   ? 84.098 70.536  -1.035  1.00 41.14  ? 802 GOL B O2    1 
HETATM 3984 C C3    . GOL F 3 .   ? 85.447 70.375  0.945   1.00 37.47  ? 802 GOL B C3    1 
HETATM 3985 O O3    . GOL F 3 .   ? 86.326 70.311  2.235   1.00 38.39  ? 802 GOL B O3    1 
HETATM 3986 C C1    . GOL G 3 .   ? 57.555 104.636 -4.232  1.00 65.09  ? 901 GOL B C1    1 
HETATM 3987 O O1    . GOL G 3 .   ? 56.870 104.315 -2.812  1.00 61.36  ? 901 GOL B O1    1 
HETATM 3988 C C2    . GOL G 3 .   ? 58.414 105.709 -4.515  1.00 66.94  ? 901 GOL B C2    1 
HETATM 3989 O O2    . GOL G 3 .   ? 57.762 106.717 -5.137  1.00 67.27  ? 901 GOL B O2    1 
HETATM 3990 C C3    . GOL G 3 .   ? 59.538 105.444 -4.136  1.00 67.79  ? 901 GOL B C3    1 
HETATM 3991 O O3    . GOL G 3 .   ? 60.738 104.661 -3.508  1.00 67.07  ? 901 GOL B O3    1 
HETATM 3992 O O     . HOH H 4 .   ? 39.712 74.057  -12.822 1.00 51.89  ? 902 HOH A O     1 
HETATM 3993 O O     . HOH H 4 .   ? 38.232 76.252  -17.574 1.00 43.43  ? 903 HOH A O     1 
HETATM 3994 O O     . HOH H 4 .   ? 41.305 78.495  -6.922  1.00 33.15  ? 904 HOH A O     1 
HETATM 3995 O O     . HOH H 4 .   ? 42.792 81.762  -8.975  1.00 26.90  ? 905 HOH A O     1 
HETATM 3996 O O     . HOH H 4 .   ? 16.216 69.781  10.611  1.00 22.80  ? 906 HOH A O     1 
HETATM 3997 O O     . HOH H 4 .   ? 19.083 75.817  12.151  1.00 38.04  ? 907 HOH A O     1 
HETATM 3998 O O     . HOH H 4 .   ? 19.423 73.310  8.342   1.00 39.80  ? 908 HOH A O     1 
HETATM 3999 O O     . HOH H 4 .   ? 19.187 57.289  13.572  1.00 24.76  ? 909 HOH A O     1 
HETATM 4000 O O     . HOH H 4 .   ? 33.842 61.096  14.071  1.00 31.73  ? 910 HOH A O     1 
HETATM 4001 O O     . HOH H 4 .   ? 26.361 67.630  21.940  1.00 35.31  ? 911 HOH A O     1 
HETATM 4002 O O     . HOH H 4 .   ? 22.183 41.364  -8.971  1.00 36.05  ? 912 HOH A O     1 
HETATM 4003 O O     . HOH H 4 .   ? 18.065 49.771  -4.484  1.00 38.81  ? 913 HOH A O     1 
HETATM 4004 O O     . HOH I 4 .   ? 65.455 85.328  5.727   1.00 45.07  ? 914 HOH B O     1 
HETATM 4005 O O     . HOH I 4 .   ? 53.151 72.306  19.877  1.00 30.82  ? 915 HOH B O     1 
HETATM 4006 O O     . HOH I 4 .   ? 55.086 70.218  18.979  1.00 53.69  ? 916 HOH B O     1 
HETATM 4007 O O     . HOH I 4 .   ? 69.857 68.544  16.892  1.00 34.88  ? 918 HOH B O     1 
HETATM 4008 O O     . HOH I 4 .   ? 76.979 70.064  -6.257  1.00 46.45  ? 919 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   92  ?   ?   ?   A . n 
A 1 2   ARG 2   93  ?   ?   ?   A . n 
A 1 3   ARG 3   94  ?   ?   ?   A . n 
A 1 4   ARG 4   95  ?   ?   ?   A . n 
A 1 5   GLY 5   96  ?   ?   ?   A . n 
A 1 6   ALA 6   97  ?   ?   ?   A . n 
A 1 7   ILE 7   98  ?   ?   ?   A . n 
A 1 8   SER 8   99  ?   ?   ?   A . n 
A 1 9   ALA 9   100 ?   ?   ?   A . n 
A 1 10  GLU 10  101 ?   ?   ?   A . n 
A 1 11  VAL 11  102 ?   ?   ?   A . n 
A 1 12  TYR 12  103 ?   ?   ?   A . n 
A 1 13  THR 13  104 ?   ?   ?   A . n 
A 1 14  GLU 14  105 ?   ?   ?   A . n 
A 1 15  GLU 15  106 ?   ?   ?   A . n 
A 1 16  ASP 16  107 ?   ?   ?   A . n 
A 1 17  ALA 17  108 ?   ?   ?   A . n 
A 1 18  ALA 18  109 109 ALA ALA A . n 
A 1 19  SER 19  110 110 SER SER A . n 
A 1 20  TYR 20  111 111 TYR TYR A . n 
A 1 21  VAL 21  112 112 VAL VAL A . n 
A 1 22  ARG 22  113 113 ARG ALA A . n 
A 1 23  LYS 23  114 114 LYS LYS A . n 
A 1 24  VAL 24  115 115 VAL ALA A . n 
A 1 25  ILE 25  116 116 ILE ILE A . n 
A 1 26  PRO 26  117 117 PRO PRO A . n 
A 1 27  LYS 27  118 118 LYS LYS A . n 
A 1 28  ASP 28  119 119 ASP ASP A . n 
A 1 29  TYR 29  120 120 TYR TYR A . n 
A 1 30  LYS 30  121 121 LYS LYS A . n 
A 1 31  THR 31  122 122 THR THR A . n 
A 1 32  MET 32  123 123 MET MET A . n 
A 1 33  ALA 33  124 124 ALA ALA A . n 
A 1 34  ALA 34  125 125 ALA ALA A . n 
A 1 35  LEU 35  126 126 LEU LEU A . n 
A 1 36  ALA 36  127 127 ALA ALA A . n 
A 1 37  LYS 37  128 128 LYS LYS A . n 
A 1 38  ALA 38  129 129 ALA ALA A . n 
A 1 39  ILE 39  130 130 ILE ILE A . n 
A 1 40  GLU 40  131 131 GLU GLU A . n 
A 1 41  LYS 41  132 132 LYS LYS A . n 
A 1 42  ASN 42  133 133 ASN ASN A . n 
A 1 43  VAL 43  134 134 VAL VAL A . n 
A 1 44  LEU 44  135 135 LEU LEU A . n 
A 1 45  PHE 45  136 136 PHE PHE A . n 
A 1 46  SER 46  137 137 SER SER A . n 
A 1 47  HIS 47  138 138 HIS HIS A . n 
A 1 48  LEU 48  139 139 LEU LEU A . n 
A 1 49  ASP 49  140 140 ASP ASP A . n 
A 1 50  ASP 50  141 141 ASP ASP A . n 
A 1 51  ASN 51  142 142 ASN ASN A . n 
A 1 52  GLU 52  143 143 GLU GLU A . n 
A 1 53  ARG 53  144 144 ARG ARG A . n 
A 1 54  SER 54  145 145 SER SER A . n 
A 1 55  ASP 55  146 146 ASP ASP A . n 
A 1 56  ILE 56  147 147 ILE ILE A . n 
A 1 57  PHE 57  148 148 PHE PHE A . n 
A 1 58  ASP 58  149 149 ASP ASP A . n 
A 1 59  ALA 59  150 150 ALA ALA A . n 
A 1 60  MET 60  151 151 MET MET A . n 
A 1 61  PHE 61  152 152 PHE PHE A . n 
A 1 62  PRO 62  153 153 PRO PRO A . n 
A 1 63  VAL 63  154 154 VAL VAL A . n 
A 1 64  SER 64  155 155 SER SER A . n 
A 1 65  PHE 65  156 156 PHE PHE A . n 
A 1 66  ILE 66  157 157 ILE ILE A . n 
A 1 67  ALA 67  158 158 ALA ALA A . n 
A 1 68  GLY 68  159 159 GLY GLY A . n 
A 1 69  GLU 69  160 160 GLU GLU A . n 
A 1 70  THR 70  161 161 THR THR A . n 
A 1 71  VAL 71  162 162 VAL VAL A . n 
A 1 72  ILE 72  163 163 ILE ILE A . n 
A 1 73  GLN 73  164 164 GLN GLN A . n 
A 1 74  GLN 74  165 165 GLN GLN A . n 
A 1 75  GLY 75  166 166 GLY GLY A . n 
A 1 76  ASP 76  167 167 ASP ASP A . n 
A 1 77  GLU 77  168 168 GLU GLU A . n 
A 1 78  GLY 78  169 169 GLY GLY A . n 
A 1 79  ASP 79  170 170 ASP ASP A . n 
A 1 80  ASN 80  171 171 ASN ASN A . n 
A 1 81  PHE 81  172 172 PHE PHE A . n 
A 1 82  TYR 82  173 173 TYR TYR A . n 
A 1 83  VAL 83  174 174 VAL VAL A . n 
A 1 84  ILE 84  175 175 ILE ILE A . n 
A 1 85  ASP 85  176 176 ASP ASP A . n 
A 1 86  GLN 86  177 177 GLN GLN A . n 
A 1 87  GLY 87  178 178 GLY GLY A . n 
A 1 88  GLU 88  179 179 GLU GLU A . n 
A 1 89  MET 89  180 180 MET MET A . n 
A 1 90  ASP 90  181 181 ASP ASP A . n 
A 1 91  VAL 91  182 182 VAL VAL A . n 
A 1 92  TYR 92  183 183 TYR TYR A . n 
A 1 93  VAL 93  184 184 VAL VAL A . n 
A 1 94  ASN 94  185 185 ASN ASN A . n 
A 1 95  ASN 95  186 186 ASN ASN A . n 
A 1 96  GLU 96  187 187 GLU ALA A . n 
A 1 97  TRP 97  188 188 TRP TRP A . n 
A 1 98  ALA 98  189 189 ALA ALA A . n 
A 1 99  THR 99  190 190 THR THR A . n 
A 1 100 SER 100 191 191 SER SER A . n 
A 1 101 VAL 101 192 192 VAL VAL A . n 
A 1 102 GLY 102 193 193 GLY GLY A . n 
A 1 103 GLU 103 194 194 GLU GLU A . n 
A 1 104 GLY 104 195 195 GLY GLY A . n 
A 1 105 GLY 105 196 196 GLY GLY A . n 
A 1 106 SER 106 197 197 SER SER A . n 
A 1 107 PHE 107 198 198 PHE PHE A . n 
A 1 108 GLY 108 199 199 GLY GLY A . n 
A 1 109 GLU 109 200 200 GLU GLU A . n 
A 1 110 LEU 110 201 201 LEU LEU A . n 
A 1 111 ALA 111 202 202 ALA ALA A . n 
A 1 112 LEU 112 203 203 LEU LEU A . n 
A 1 113 ILE 113 204 204 ILE ILE A . n 
A 1 114 TYR 114 205 205 TYR TYR A . n 
A 1 115 GLY 115 206 206 GLY GLY A . n 
A 1 116 THR 116 207 207 THR THR A . n 
A 1 117 PRO 117 208 208 PRO PRO A . n 
A 1 118 ARG 118 209 209 ARG ARG A . n 
A 1 119 ALA 119 210 210 ALA ALA A . n 
A 1 120 ALA 120 211 211 ALA ALA A . n 
A 1 121 THR 121 212 212 THR THR A . n 
A 1 122 VAL 122 213 213 VAL VAL A . n 
A 1 123 LYS 123 214 214 LYS LYS A . n 
A 1 124 ALA 124 215 215 ALA ALA A . n 
A 1 125 LYS 125 216 216 LYS LYS A . n 
A 1 126 THR 126 217 217 THR THR A . n 
A 1 127 ASN 127 218 218 ASN ASN A . n 
A 1 128 VAL 128 219 219 VAL VAL A . n 
A 1 129 LYS 129 220 220 LYS LYS A . n 
A 1 130 LEU 130 221 221 LEU LEU A . n 
A 1 131 TRP 131 222 222 TRP TRP A . n 
A 1 132 GLY 132 223 223 GLY GLY A . n 
A 1 133 ILE 133 224 224 ILE ILE A . n 
A 1 134 ASP 134 225 225 ASP ASP A . n 
A 1 135 ARG 135 226 226 ARG ARG A . n 
A 1 136 ASP 136 227 227 ASP ASP A . n 
A 1 137 SER 137 228 228 SER SER A . n 
A 1 138 TYR 138 229 229 TYR TYR A . n 
A 1 139 ARG 139 230 230 ARG ARG A . n 
A 1 140 ARG 140 231 231 ARG ARG A . n 
A 1 141 ILE 141 232 232 ILE ILE A . n 
A 1 142 LEU 142 233 233 LEU LEU A . n 
A 1 143 MET 143 234 234 MET MET A . n 
A 1 144 GLY 144 235 235 GLY GLY A . n 
A 1 145 SER 145 236 236 SER SER A . n 
A 1 146 THR 146 237 237 THR THR A . n 
A 1 147 LEU 147 238 238 LEU LEU A . n 
A 1 148 ARG 148 239 239 ARG ARG A . n 
A 1 149 LYS 149 240 240 LYS LYS A . n 
A 1 150 ARG 150 241 241 ARG ARG A . n 
A 1 151 LYS 151 242 242 LYS LYS A . n 
A 1 152 MET 152 243 243 MET MET A . n 
A 1 153 TYR 153 244 244 TYR TYR A . n 
A 1 154 GLU 154 245 245 GLU GLU A . n 
A 1 155 GLU 155 246 246 GLU GLU A . n 
A 1 156 PHE 156 247 247 PHE PHE A . n 
A 1 157 LEU 157 248 248 LEU LEU A . n 
A 1 158 SER 158 249 249 SER SER A . n 
A 1 159 LYS 159 250 250 LYS LYS A . n 
A 1 160 VAL 160 251 251 VAL VAL A . n 
A 1 161 SER 161 252 252 SER SER A . n 
A 1 162 ILE 162 253 253 ILE ILE A . n 
A 1 163 LEU 163 254 254 LEU LEU A . n 
A 1 164 GLU 164 255 255 GLU ALA A . n 
A 1 165 SER 165 256 256 SER SER A . n 
A 1 166 LEU 166 257 257 LEU LEU A . n 
A 1 167 ASP 167 258 258 ASP ASP A . n 
A 1 168 LYS 168 259 259 LYS LYS A . n 
A 1 169 TRP 169 260 260 TRP TRP A . n 
A 1 170 GLU 170 261 261 GLU GLU A . n 
A 1 171 ARG 171 262 262 ARG ARG A . n 
A 1 172 LEU 172 263 263 LEU LEU A . n 
A 1 173 THR 173 264 264 THR THR A . n 
A 1 174 VAL 174 265 265 VAL VAL A . n 
A 1 175 ALA 175 266 266 ALA ALA A . n 
A 1 176 ASP 176 267 267 ASP ASP A . n 
A 1 177 ALA 177 268 268 ALA ALA A . n 
A 1 178 LEU 178 269 269 LEU LEU A . n 
A 1 179 GLU 179 270 270 GLU GLU A . n 
A 1 180 PRO 180 271 271 PRO PRO A . n 
A 1 181 VAL 181 272 272 VAL VAL A . n 
A 1 182 GLN 182 273 273 GLN GLN A . n 
A 1 183 PHE 183 274 274 PHE PHE A . n 
A 1 184 GLU 184 275 275 GLU ALA A . n 
A 1 185 ASP 185 276 276 ASP ASP A . n 
A 1 186 GLY 186 277 277 GLY GLY A . n 
A 1 187 GLN 187 278 278 GLN GLN A . n 
A 1 188 LYS 188 279 279 LYS ALA A . n 
A 1 189 ILE 189 280 280 ILE ALA A . n 
A 1 190 VAL 190 281 281 VAL ALA A . n 
A 1 191 VAL 191 282 282 VAL ALA A . n 
A 1 192 GLN 192 283 283 GLN ALA A . n 
A 1 193 GLY 193 284 284 GLY GLY A . n 
A 1 194 GLU 194 285 285 GLU GLU A . n 
A 1 195 PRO 195 286 286 PRO PRO A . n 
A 1 196 GLY 196 287 287 GLY GLY A . n 
A 1 197 ASP 197 288 288 ASP ASP A . n 
A 1 198 GLU 198 289 289 GLU GLU A . n 
A 1 199 PHE 199 290 290 PHE PHE A . n 
A 1 200 PHE 200 291 291 PHE PHE A . n 
A 1 201 ILE 201 292 292 ILE ILE A . n 
A 1 202 ILE 202 293 293 ILE ALA A . n 
A 1 203 LEU 203 294 294 LEU ALA A . n 
A 1 204 GLU 204 295 295 GLU GLU A . n 
A 1 205 GLY 205 296 296 GLY GLY A . n 
A 1 206 SER 206 297 297 SER SER A . n 
A 1 207 ALA 207 298 298 ALA ALA A . n 
A 1 208 ALA 208 299 299 ALA ALA A . n 
A 1 209 VAL 209 300 300 VAL VAL A . n 
A 1 210 LEU 210 301 301 LEU ALA A . n 
A 1 211 GLN 211 302 302 GLN ALA A . n 
A 1 212 ARG 212 303 303 ARG ALA A . n 
A 1 213 ARG 213 304 304 ARG ALA A . n 
A 1 214 SER 214 305 305 SER ALA A . n 
A 1 215 GLU 215 306 306 GLU ALA A . n 
A 1 216 ASN 216 307 307 ASN ALA A . n 
A 1 217 GLU 217 308 308 GLU ALA A . n 
A 1 218 GLU 218 309 309 GLU ALA A . n 
A 1 219 PHE 219 310 310 PHE ALA A . n 
A 1 220 VAL 220 311 311 VAL VAL A . n 
A 1 221 GLU 221 312 312 GLU GLU A . n 
A 1 222 VAL 222 313 313 VAL ALA A . n 
A 1 223 GLY 223 314 314 GLY GLY A . n 
A 1 224 ARG 224 315 315 ARG ARG A . n 
A 1 225 LEU 225 316 316 LEU LEU A . n 
A 1 226 GLY 226 317 317 GLY GLY A . n 
A 1 227 PRO 227 318 318 PRO PRO A . n 
A 1 228 SER 228 319 319 SER SER A . n 
A 1 229 ASP 229 320 320 ASP ASP A . n 
A 1 230 TYR 230 321 321 TYR TYR A . n 
A 1 231 PHE 231 322 322 PHE PHE A . n 
A 1 232 GLY 232 323 323 GLY GLY A . n 
A 1 233 GLU 233 324 324 GLU GLU A . n 
A 1 234 ILE 234 325 325 ILE ALA A . n 
A 1 235 ALA 235 326 326 ALA ALA A . n 
A 1 236 LEU 236 327 327 LEU ALA A . n 
A 1 237 LEU 237 328 328 LEU LEU A . n 
A 1 238 MET 238 329 329 MET ALA A . n 
A 1 239 ASN 239 330 330 ASN ALA A . n 
A 1 240 ARG 240 331 331 ARG ALA A . n 
A 1 241 PRO 241 332 332 PRO PRO A . n 
A 1 242 ARG 242 333 333 ARG ALA A . n 
A 1 243 ALA 243 334 334 ALA ALA A . n 
A 1 244 ALA 244 335 335 ALA ALA A . n 
A 1 245 THR 245 336 336 THR ALA A . n 
A 1 246 VAL 246 337 337 VAL ALA A . n 
A 1 247 VAL 247 338 338 VAL ALA A . n 
A 1 248 ALA 248 339 339 ALA ALA A . n 
A 1 249 ARG 249 340 340 ARG ALA A . n 
A 1 250 GLY 250 341 341 GLY GLY A . n 
A 1 251 PRO 251 342 342 PRO PRO A . n 
A 1 252 LEU 252 343 343 LEU ALA A . n 
A 1 253 LYS 253 344 344 LYS ALA A . n 
A 1 254 CYS 254 345 345 CYS CYS A . n 
A 1 255 VAL 255 346 346 VAL VAL A . n 
A 1 256 LYS 256 347 347 LYS ALA A . n 
A 1 257 LEU 257 348 348 LEU LEU A . n 
A 1 258 ASP 258 349 349 ASP ASP A . n 
A 1 259 ARG 259 350 350 ARG ARG A . n 
A 1 260 PRO 260 351 351 PRO PRO A . n 
A 1 261 ARG 261 352 352 ARG ARG A . n 
A 1 262 PHE 262 353 353 PHE PHE A . n 
A 1 263 GLU 263 354 354 GLU GLU A . n 
A 1 264 ARG 264 355 355 ARG ARG A . n 
A 1 265 VAL 265 356 356 VAL VAL A . n 
A 1 266 LEU 266 357 357 LEU LEU A . n 
A 1 267 GLY 267 358 358 GLY GLY A . n 
A 1 268 PRO 268 359 359 PRO PRO A . n 
A 1 269 CYS 269 360 360 CYS CYS A . n 
A 1 270 SER 270 361 361 SER SER A . n 
A 1 271 ASP 271 362 362 ASP ASP A . n 
A 1 272 ILE 272 363 363 ILE ILE A . n 
A 1 273 LEU 273 364 364 LEU LEU A . n 
A 1 274 LYS 274 365 365 LYS ALA A . n 
A 1 275 ARG 275 366 366 ARG ARG A . n 
A 1 276 ASN 276 367 367 ASN ASN A . n 
A 1 277 ILE 277 368 368 ILE ILE A . n 
A 1 278 GLN 278 369 369 GLN GLN A . n 
A 1 279 GLN 279 370 370 GLN GLN A . n 
A 1 280 TYR 280 371 371 TYR TYR A . n 
A 1 281 ASN 281 372 372 ASN ASN A . n 
A 1 282 SER 282 373 373 SER SER A . n 
A 1 283 PHE 283 374 374 PHE PHE A . n 
A 1 284 VAL 284 375 375 VAL VAL A . n 
A 1 285 SER 285 376 376 SER SER A . n 
A 1 286 LEU 286 377 ?   ?   ?   A . n 
A 1 287 SER 287 378 ?   ?   ?   A . n 
A 1 288 VAL 288 379 ?   ?   ?   A . n 
B 1 1   ARG 1   492 ?   ?   ?   B . n 
B 1 2   ARG 2   493 ?   ?   ?   B . n 
B 1 3   ARG 3   494 ?   ?   ?   B . n 
B 1 4   ARG 4   495 ?   ?   ?   B . n 
B 1 5   GLY 5   496 ?   ?   ?   B . n 
B 1 6   ALA 6   497 ?   ?   ?   B . n 
B 1 7   ILE 7   498 ?   ?   ?   B . n 
B 1 8   SER 8   499 ?   ?   ?   B . n 
B 1 9   ALA 9   500 ?   ?   ?   B . n 
B 1 10  GLU 10  501 ?   ?   ?   B . n 
B 1 11  VAL 11  502 ?   ?   ?   B . n 
B 1 12  TYR 12  503 ?   ?   ?   B . n 
B 1 13  THR 13  504 ?   ?   ?   B . n 
B 1 14  GLU 14  505 ?   ?   ?   B . n 
B 1 15  GLU 15  506 ?   ?   ?   B . n 
B 1 16  ASP 16  507 ?   ?   ?   B . n 
B 1 17  ALA 17  508 ?   ?   ?   B . n 
B 1 18  ALA 18  509 509 ALA ALA B . n 
B 1 19  SER 19  510 510 SER SER B . n 
B 1 20  TYR 20  511 511 TYR TYR B . n 
B 1 21  VAL 21  512 512 VAL ALA B . n 
B 1 22  ARG 22  513 513 ARG ALA B . n 
B 1 23  LYS 23  514 514 LYS LYS B . n 
B 1 24  VAL 24  515 515 VAL ALA B . n 
B 1 25  ILE 25  516 516 ILE ILE B . n 
B 1 26  PRO 26  517 517 PRO PRO B . n 
B 1 27  LYS 27  518 518 LYS LYS B . n 
B 1 28  ASP 28  519 519 ASP ASP B . n 
B 1 29  TYR 29  520 520 TYR TYR B . n 
B 1 30  LYS 30  521 521 LYS LYS B . n 
B 1 31  THR 31  522 522 THR THR B . n 
B 1 32  MET 32  523 523 MET MET B . n 
B 1 33  ALA 33  524 524 ALA ALA B . n 
B 1 34  ALA 34  525 525 ALA ALA B . n 
B 1 35  LEU 35  526 526 LEU LEU B . n 
B 1 36  ALA 36  527 527 ALA ALA B . n 
B 1 37  LYS 37  528 528 LYS LYS B . n 
B 1 38  ALA 38  529 529 ALA ALA B . n 
B 1 39  ILE 39  530 530 ILE ILE B . n 
B 1 40  GLU 40  531 531 GLU GLU B . n 
B 1 41  LYS 41  532 532 LYS LYS B . n 
B 1 42  ASN 42  533 533 ASN ASN B . n 
B 1 43  VAL 43  534 534 VAL VAL B . n 
B 1 44  LEU 44  535 535 LEU LEU B . n 
B 1 45  PHE 45  536 536 PHE PHE B . n 
B 1 46  SER 46  537 537 SER SER B . n 
B 1 47  HIS 47  538 538 HIS HIS B . n 
B 1 48  LEU 48  539 539 LEU LEU B . n 
B 1 49  ASP 49  540 540 ASP ASP B . n 
B 1 50  ASP 50  541 541 ASP ASP B . n 
B 1 51  ASN 51  542 542 ASN ASN B . n 
B 1 52  GLU 52  543 543 GLU GLU B . n 
B 1 53  ARG 53  544 544 ARG ARG B . n 
B 1 54  SER 54  545 545 SER SER B . n 
B 1 55  ASP 55  546 546 ASP ASP B . n 
B 1 56  ILE 56  547 547 ILE ILE B . n 
B 1 57  PHE 57  548 548 PHE PHE B . n 
B 1 58  ASP 58  549 549 ASP ASP B . n 
B 1 59  ALA 59  550 550 ALA ALA B . n 
B 1 60  MET 60  551 551 MET MET B . n 
B 1 61  PHE 61  552 552 PHE PHE B . n 
B 1 62  PRO 62  553 553 PRO PRO B . n 
B 1 63  VAL 63  554 554 VAL VAL B . n 
B 1 64  SER 64  555 555 SER SER B . n 
B 1 65  PHE 65  556 556 PHE PHE B . n 
B 1 66  ILE 66  557 557 ILE ILE B . n 
B 1 67  ALA 67  558 558 ALA ALA B . n 
B 1 68  GLY 68  559 559 GLY GLY B . n 
B 1 69  GLU 69  560 560 GLU GLU B . n 
B 1 70  THR 70  561 561 THR THR B . n 
B 1 71  VAL 71  562 562 VAL VAL B . n 
B 1 72  ILE 72  563 563 ILE ILE B . n 
B 1 73  GLN 73  564 564 GLN GLN B . n 
B 1 74  GLN 74  565 565 GLN GLN B . n 
B 1 75  GLY 75  566 566 GLY GLY B . n 
B 1 76  ASP 76  567 567 ASP ASP B . n 
B 1 77  GLU 77  568 568 GLU GLU B . n 
B 1 78  GLY 78  569 569 GLY GLY B . n 
B 1 79  ASP 79  570 570 ASP ASP B . n 
B 1 80  ASN 80  571 571 ASN ASN B . n 
B 1 81  PHE 81  572 572 PHE PHE B . n 
B 1 82  TYR 82  573 573 TYR TYR B . n 
B 1 83  VAL 83  574 574 VAL VAL B . n 
B 1 84  ILE 84  575 575 ILE ILE B . n 
B 1 85  ASP 85  576 576 ASP ASP B . n 
B 1 86  GLN 86  577 577 GLN GLN B . n 
B 1 87  GLY 87  578 578 GLY GLY B . n 
B 1 88  GLU 88  579 579 GLU GLU B . n 
B 1 89  MET 89  580 580 MET MET B . n 
B 1 90  ASP 90  581 581 ASP ASP B . n 
B 1 91  VAL 91  582 582 VAL VAL B . n 
B 1 92  TYR 92  583 583 TYR TYR B . n 
B 1 93  VAL 93  584 584 VAL VAL B . n 
B 1 94  ASN 94  585 585 ASN ASN B . n 
B 1 95  ASN 95  586 586 ASN ASN B . n 
B 1 96  GLU 96  587 587 GLU ALA B . n 
B 1 97  TRP 97  588 588 TRP TRP B . n 
B 1 98  ALA 98  589 589 ALA ALA B . n 
B 1 99  THR 99  590 590 THR THR B . n 
B 1 100 SER 100 591 591 SER SER B . n 
B 1 101 VAL 101 592 592 VAL VAL B . n 
B 1 102 GLY 102 593 593 GLY GLY B . n 
B 1 103 GLU 103 594 594 GLU GLU B . n 
B 1 104 GLY 104 595 595 GLY GLY B . n 
B 1 105 GLY 105 596 596 GLY GLY B . n 
B 1 106 SER 106 597 597 SER SER B . n 
B 1 107 PHE 107 598 598 PHE PHE B . n 
B 1 108 GLY 108 599 599 GLY GLY B . n 
B 1 109 GLU 109 600 600 GLU GLU B . n 
B 1 110 LEU 110 601 601 LEU LEU B . n 
B 1 111 ALA 111 602 602 ALA ALA B . n 
B 1 112 LEU 112 603 603 LEU LEU B . n 
B 1 113 ILE 113 604 604 ILE ILE B . n 
B 1 114 TYR 114 605 605 TYR TYR B . n 
B 1 115 GLY 115 606 606 GLY GLY B . n 
B 1 116 THR 116 607 607 THR THR B . n 
B 1 117 PRO 117 608 608 PRO PRO B . n 
B 1 118 ARG 118 609 609 ARG ARG B . n 
B 1 119 ALA 119 610 610 ALA ALA B . n 
B 1 120 ALA 120 611 611 ALA ALA B . n 
B 1 121 THR 121 612 612 THR THR B . n 
B 1 122 VAL 122 613 613 VAL VAL B . n 
B 1 123 LYS 123 614 614 LYS LYS B . n 
B 1 124 ALA 124 615 615 ALA ALA B . n 
B 1 125 LYS 125 616 616 LYS LYS B . n 
B 1 126 THR 126 617 617 THR THR B . n 
B 1 127 ASN 127 618 618 ASN ASN B . n 
B 1 128 VAL 128 619 619 VAL VAL B . n 
B 1 129 LYS 129 620 620 LYS LYS B . n 
B 1 130 LEU 130 621 621 LEU LEU B . n 
B 1 131 TRP 131 622 622 TRP TRP B . n 
B 1 132 GLY 132 623 623 GLY GLY B . n 
B 1 133 ILE 133 624 624 ILE ILE B . n 
B 1 134 ASP 134 625 625 ASP ASP B . n 
B 1 135 ARG 135 626 626 ARG ARG B . n 
B 1 136 ASP 136 627 627 ASP ASP B . n 
B 1 137 SER 137 628 628 SER SER B . n 
B 1 138 TYR 138 629 629 TYR TYR B . n 
B 1 139 ARG 139 630 630 ARG ARG B . n 
B 1 140 ARG 140 631 631 ARG ARG B . n 
B 1 141 ILE 141 632 632 ILE ILE B . n 
B 1 142 LEU 142 633 633 LEU LEU B . n 
B 1 143 MET 143 634 634 MET MET B . n 
B 1 144 GLY 144 635 635 GLY GLY B . n 
B 1 145 SER 145 636 636 SER SER B . n 
B 1 146 THR 146 637 637 THR THR B . n 
B 1 147 LEU 147 638 638 LEU LEU B . n 
B 1 148 ARG 148 639 639 ARG ARG B . n 
B 1 149 LYS 149 640 640 LYS LYS B . n 
B 1 150 ARG 150 641 641 ARG ARG B . n 
B 1 151 LYS 151 642 642 LYS LYS B . n 
B 1 152 MET 152 643 643 MET MET B . n 
B 1 153 TYR 153 644 644 TYR TYR B . n 
B 1 154 GLU 154 645 645 GLU GLU B . n 
B 1 155 GLU 155 646 646 GLU GLU B . n 
B 1 156 PHE 156 647 647 PHE PHE B . n 
B 1 157 LEU 157 648 648 LEU LEU B . n 
B 1 158 SER 158 649 649 SER SER B . n 
B 1 159 LYS 159 650 650 LYS LYS B . n 
B 1 160 VAL 160 651 651 VAL ALA B . n 
B 1 161 SER 161 652 652 SER SER B . n 
B 1 162 ILE 162 653 653 ILE ALA B . n 
B 1 163 LEU 163 654 654 LEU LEU B . n 
B 1 164 GLU 164 655 655 GLU GLU B . n 
B 1 165 SER 165 656 656 SER SER B . n 
B 1 166 LEU 166 657 657 LEU LEU B . n 
B 1 167 ASP 167 658 658 ASP ASP B . n 
B 1 168 LYS 168 659 659 LYS LYS B . n 
B 1 169 TRP 169 660 660 TRP TRP B . n 
B 1 170 GLU 170 661 661 GLU GLU B . n 
B 1 171 ARG 171 662 662 ARG ARG B . n 
B 1 172 LEU 172 663 663 LEU LEU B . n 
B 1 173 THR 173 664 664 THR THR B . n 
B 1 174 VAL 174 665 665 VAL VAL B . n 
B 1 175 ALA 175 666 666 ALA ALA B . n 
B 1 176 ASP 176 667 667 ASP ASP B . n 
B 1 177 ALA 177 668 668 ALA ALA B . n 
B 1 178 LEU 178 669 669 LEU LEU B . n 
B 1 179 GLU 179 670 670 GLU GLU B . n 
B 1 180 PRO 180 671 671 PRO PRO B . n 
B 1 181 VAL 181 672 672 VAL VAL B . n 
B 1 182 GLN 182 673 673 GLN GLN B . n 
B 1 183 PHE 183 674 674 PHE PHE B . n 
B 1 184 GLU 184 675 675 GLU ALA B . n 
B 1 185 ASP 185 676 676 ASP ALA B . n 
B 1 186 GLY 186 677 677 GLY GLY B . n 
B 1 187 GLN 187 678 678 GLN GLN B . n 
B 1 188 LYS 188 679 679 LYS ALA B . n 
B 1 189 ILE 189 680 680 ILE ILE B . n 
B 1 190 VAL 190 681 681 VAL VAL B . n 
B 1 191 VAL 191 682 682 VAL ALA B . n 
B 1 192 GLN 192 683 683 GLN ALA B . n 
B 1 193 GLY 193 684 684 GLY GLY B . n 
B 1 194 GLU 194 685 685 GLU GLU B . n 
B 1 195 PRO 195 686 686 PRO PRO B . n 
B 1 196 GLY 196 687 687 GLY GLY B . n 
B 1 197 ASP 197 688 688 ASP ASP B . n 
B 1 198 GLU 198 689 689 GLU GLU B . n 
B 1 199 PHE 199 690 690 PHE PHE B . n 
B 1 200 PHE 200 691 691 PHE PHE B . n 
B 1 201 ILE 201 692 692 ILE ILE B . n 
B 1 202 ILE 202 693 693 ILE ILE B . n 
B 1 203 LEU 203 694 694 LEU LEU B . n 
B 1 204 GLU 204 695 695 GLU GLU B . n 
B 1 205 GLY 205 696 696 GLY GLY B . n 
B 1 206 SER 206 697 697 SER ALA B . n 
B 1 207 ALA 207 698 698 ALA ALA B . n 
B 1 208 ALA 208 699 699 ALA ALA B . n 
B 1 209 VAL 209 700 700 VAL VAL B . n 
B 1 210 LEU 210 701 701 LEU ALA B . n 
B 1 211 GLN 211 702 702 GLN GLN B . n 
B 1 212 ARG 212 703 703 ARG ALA B . n 
B 1 213 ARG 213 704 704 ARG ALA B . n 
B 1 214 SER 214 705 705 SER ALA B . n 
B 1 215 GLU 215 706 706 GLU ALA B . n 
B 1 216 ASN 216 707 707 ASN ALA B . n 
B 1 217 GLU 217 708 708 GLU ALA B . n 
B 1 218 GLU 218 709 709 GLU ALA B . n 
B 1 219 PHE 219 710 710 PHE PHE B . n 
B 1 220 VAL 220 711 711 VAL VAL B . n 
B 1 221 GLU 221 712 712 GLU GLU B . n 
B 1 222 VAL 222 713 713 VAL VAL B . n 
B 1 223 GLY 223 714 714 GLY GLY B . n 
B 1 224 ARG 224 715 715 ARG ALA B . n 
B 1 225 LEU 225 716 716 LEU LEU B . n 
B 1 226 GLY 226 717 717 GLY GLY B . n 
B 1 227 PRO 227 718 718 PRO PRO B . n 
B 1 228 SER 228 719 719 SER SER B . n 
B 1 229 ASP 229 720 720 ASP ASP B . n 
B 1 230 TYR 230 721 721 TYR TYR B . n 
B 1 231 PHE 231 722 722 PHE PHE B . n 
B 1 232 GLY 232 723 723 GLY GLY B . n 
B 1 233 GLU 233 724 724 GLU GLU B . n 
B 1 234 ILE 234 725 725 ILE ALA B . n 
B 1 235 ALA 235 726 726 ALA ALA B . n 
B 1 236 LEU 236 727 727 LEU LEU B . n 
B 1 237 LEU 237 728 728 LEU LEU B . n 
B 1 238 MET 238 729 729 MET ALA B . n 
B 1 239 ASN 239 730 730 ASN ALA B . n 
B 1 240 ARG 240 731 731 ARG ALA B . n 
B 1 241 PRO 241 732 732 PRO PRO B . n 
B 1 242 ARG 242 733 733 ARG ALA B . n 
B 1 243 ALA 243 734 734 ALA ALA B . n 
B 1 244 ALA 244 735 735 ALA ALA B . n 
B 1 245 THR 245 736 736 THR THR B . n 
B 1 246 VAL 246 737 737 VAL ALA B . n 
B 1 247 VAL 247 738 738 VAL ALA B . n 
B 1 248 ALA 248 739 739 ALA ALA B . n 
B 1 249 ARG 249 740 740 ARG ALA B . n 
B 1 250 GLY 250 741 741 GLY GLY B . n 
B 1 251 PRO 251 742 742 PRO PRO B . n 
B 1 252 LEU 252 743 743 LEU LEU B . n 
B 1 253 LYS 253 744 744 LYS LYS B . n 
B 1 254 CYS 254 745 745 CYS CYS B . n 
B 1 255 VAL 255 746 746 VAL VAL B . n 
B 1 256 LYS 256 747 747 LYS LYS B . n 
B 1 257 LEU 257 748 748 LEU LEU B . n 
B 1 258 ASP 258 749 749 ASP ASP B . n 
B 1 259 ARG 259 750 750 ARG ARG B . n 
B 1 260 PRO 260 751 751 PRO PRO B . n 
B 1 261 ARG 261 752 752 ARG ARG B . n 
B 1 262 PHE 262 753 753 PHE PHE B . n 
B 1 263 GLU 263 754 754 GLU GLU B . n 
B 1 264 ARG 264 755 755 ARG ARG B . n 
B 1 265 VAL 265 756 756 VAL VAL B . n 
B 1 266 LEU 266 757 757 LEU LEU B . n 
B 1 267 GLY 267 758 758 GLY GLY B . n 
B 1 268 PRO 268 759 759 PRO PRO B . n 
B 1 269 CYS 269 760 760 CYS CYS B . n 
B 1 270 SER 270 761 761 SER SER B . n 
B 1 271 ASP 271 762 762 ASP ASP B . n 
B 1 272 ILE 272 763 763 ILE ALA B . n 
B 1 273 LEU 273 764 764 LEU LEU B . n 
B 1 274 LYS 274 765 765 LYS LYS B . n 
B 1 275 ARG 275 766 766 ARG ALA B . n 
B 1 276 ASN 276 767 767 ASN ASN B . n 
B 1 277 ILE 277 768 ?   ?   ?   B . n 
B 1 278 GLN 278 769 ?   ?   ?   B . n 
B 1 279 GLN 279 770 ?   ?   ?   B . n 
B 1 280 TYR 280 771 ?   ?   ?   B . n 
B 1 281 ASN 281 772 ?   ?   ?   B . n 
B 1 282 SER 282 773 ?   ?   ?   B . n 
B 1 283 PHE 283 774 ?   ?   ?   B . n 
B 1 284 VAL 284 775 ?   ?   ?   B . n 
B 1 285 SER 285 776 ?   ?   ?   B . n 
B 1 286 LEU 286 777 ?   ?   ?   B . n 
B 1 287 SER 287 778 ?   ?   ?   B . n 
B 1 288 VAL 288 779 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,H   
2 1 B,E,F,G,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-07-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ALA 
_pdbx_validate_close_contact.auth_seq_id_1    268 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    352 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ILE 116 ? ? N  A PRO 117 ? ? CA A PRO 117 ? ? 130.87 119.30 11.57  1.50 Y 
2 1 CB A SER 361 ? ? CA A SER 361 ? ? C  A SER 361 ? ? 96.57  110.10 -13.53 1.90 N 
3 1 C  B ILE 516 ? ? N  B PRO 517 ? ? CA B PRO 517 ? ? 133.13 119.30 13.83  1.50 Y 
4 1 CB B ASN 586 ? ? CA B ASN 586 ? ? C  B ASN 586 ? ? 96.27  110.40 -14.13 2.00 N 
5 1 N  B GLU 587 ? ? CA B GLU 587 ? ? CB B GLU 587 ? ? 125.11 110.60 14.51  1.80 N 
6 1 CA B GLU 587 ? ? C  B GLU 587 ? ? O  B GLU 587 ? ? 105.54 120.10 -14.56 2.10 N 
7 1 CA B GLU 587 ? ? C  B GLU 587 ? ? N  B TRP 588 ? ? 131.31 117.20 14.11  2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 112 ? ? -77.11  37.89   
2  1 LYS A 114 ? ? 160.18  3.10    
3  1 VAL A 115 ? ? -28.32  112.07  
4  1 PRO A 117 ? ? -5.17   -76.12  
5  1 LYS A 118 ? ? 62.84   118.38  
6  1 ASP A 119 ? ? -68.98  -162.06 
7  1 HIS A 138 ? ? -93.23  45.52   
8  1 ALA A 158 ? ? -34.79  116.05  
9  1 ASP A 167 ? ? -157.79 -143.67 
10 1 ASN A 186 ? ? 29.45   37.78   
11 1 ALA A 189 ? ? -130.40 -76.26  
12 1 PRO A 208 ? ? -18.42  146.98  
13 1 ARG A 209 ? ? -60.55  87.98   
14 1 ALA A 210 ? ? -51.54  17.05   
15 1 TYR A 244 ? ? -140.90 -13.14  
16 1 SER A 252 ? ? 21.00   -99.05  
17 1 LEU A 254 ? ? -69.15  18.78   
18 1 SER A 256 ? ? -78.66  38.50   
19 1 PHE A 274 ? ? -121.45 -163.31 
20 1 ILE A 280 ? ? -178.48 94.94   
21 1 VAL A 281 ? ? -78.50  38.31   
22 1 VAL A 282 ? ? -93.06  -131.50 
23 1 GLN A 283 ? ? 80.72   -166.98 
24 1 PRO A 286 ? ? -73.20  22.69   
25 1 GLU A 295 ? ? -179.31 95.40   
26 1 LEU A 301 ? ? -73.37  -167.67 
27 1 SER A 305 ? ? 174.82  -71.93  
28 1 GLU A 306 ? ? -161.58 -67.81  
29 1 GLU A 308 ? ? -177.60 136.93  
30 1 GLU A 309 ? ? -65.13  -110.19 
31 1 GLU A 312 ? ? 42.24   177.59  
32 1 VAL A 313 ? ? 155.85  -16.37  
33 1 SER A 319 ? ? 91.56   23.15   
34 1 ASN A 330 ? ? 74.23   84.43   
35 1 ARG A 331 ? ? 178.15  162.70  
36 1 PRO A 332 ? ? -64.39  -175.36 
37 1 ALA A 335 ? ? -108.48 -169.72 
38 1 ARG A 340 ? ? 172.29  80.75   
39 1 CYS A 360 ? ? -81.84  -127.36 
40 1 SER A 361 ? ? 61.45   -13.61  
41 1 PHE A 374 ? ? -56.87  0.84    
42 1 SER B 510 ? ? 55.29   -170.95 
43 1 TYR B 511 ? ? 145.30  145.31  
44 1 VAL B 512 ? ? 176.50  112.39  
45 1 ARG B 513 ? ? 162.61  90.59   
46 1 VAL B 515 ? ? -19.78  100.05  
47 1 PRO B 517 ? ? -9.03   -85.36  
48 1 LYS B 518 ? ? 62.71   105.32  
49 1 ASP B 519 ? ? -42.03  -128.19 
50 1 ASP B 570 ? ? -100.08 -70.47  
51 1 ASN B 585 ? ? 66.86   -5.68   
52 1 ASN B 586 ? ? 107.36  44.72   
53 1 THR B 590 ? ? -138.29 -153.43 
54 1 SER B 591 ? ? -175.80 99.45   
55 1 SER B 652 ? ? 25.58   -57.37  
56 1 ASP B 676 ? ? -62.53  48.96   
57 1 ASP B 688 ? ? -162.90 66.69   
58 1 ARG B 704 ? ? -101.92 -142.32 
59 1 GLU B 706 ? ? 42.00   -135.71 
60 1 ASN B 707 ? ? -113.03 73.29   
61 1 GLU B 708 ? ? -78.67  -106.07 
62 1 SER B 719 ? ? 81.63   -0.12   
63 1 LEU B 727 ? ? -63.58  10.58   
64 1 LEU B 728 ? ? -139.79 -67.30  
65 1 ASN B 730 ? ? 76.45   33.88   
66 1 PRO B 732 ? ? -56.72  174.80  
67 1 ARG B 755 ? ? -105.33 -66.07  
68 1 PRO B 759 ? ? -69.32  26.68   
69 1 ARG B 766 ? ? -60.25  63.61   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 113 ? CG  ? A ARG 22  CG  
2   1 Y 1 A ARG 113 ? CD  ? A ARG 22  CD  
3   1 Y 1 A ARG 113 ? NE  ? A ARG 22  NE  
4   1 Y 1 A ARG 113 ? CZ  ? A ARG 22  CZ  
5   1 Y 1 A ARG 113 ? NH1 ? A ARG 22  NH1 
6   1 Y 1 A ARG 113 ? NH2 ? A ARG 22  NH2 
7   1 Y 1 A VAL 115 ? CG1 ? A VAL 24  CG1 
8   1 Y 1 A VAL 115 ? CG2 ? A VAL 24  CG2 
9   1 Y 1 A GLU 187 ? CG  ? A GLU 96  CG  
10  1 Y 1 A GLU 187 ? CD  ? A GLU 96  CD  
11  1 Y 1 A GLU 187 ? OE1 ? A GLU 96  OE1 
12  1 Y 1 A GLU 187 ? OE2 ? A GLU 96  OE2 
13  1 Y 1 A GLU 255 ? CG  ? A GLU 164 CG  
14  1 Y 1 A GLU 255 ? CD  ? A GLU 164 CD  
15  1 Y 1 A GLU 255 ? OE1 ? A GLU 164 OE1 
16  1 Y 1 A GLU 255 ? OE2 ? A GLU 164 OE2 
17  1 Y 1 A GLU 275 ? CG  ? A GLU 184 CG  
18  1 Y 1 A GLU 275 ? CD  ? A GLU 184 CD  
19  1 Y 1 A GLU 275 ? OE1 ? A GLU 184 OE1 
20  1 Y 1 A GLU 275 ? OE2 ? A GLU 184 OE2 
21  1 Y 1 A LYS 279 ? CG  ? A LYS 188 CG  
22  1 Y 1 A LYS 279 ? CD  ? A LYS 188 CD  
23  1 Y 1 A LYS 279 ? CE  ? A LYS 188 CE  
24  1 Y 1 A LYS 279 ? NZ  ? A LYS 188 NZ  
25  1 Y 1 A ILE 280 ? CG1 ? A ILE 189 CG1 
26  1 Y 1 A ILE 280 ? CG2 ? A ILE 189 CG2 
27  1 Y 1 A ILE 280 ? CD1 ? A ILE 189 CD1 
28  1 Y 1 A VAL 281 ? CG1 ? A VAL 190 CG1 
29  1 Y 1 A VAL 281 ? CG2 ? A VAL 190 CG2 
30  1 Y 1 A VAL 282 ? CG1 ? A VAL 191 CG1 
31  1 Y 1 A VAL 282 ? CG2 ? A VAL 191 CG2 
32  1 Y 1 A GLN 283 ? CG  ? A GLN 192 CG  
33  1 Y 1 A GLN 283 ? CD  ? A GLN 192 CD  
34  1 Y 1 A GLN 283 ? OE1 ? A GLN 192 OE1 
35  1 Y 1 A GLN 283 ? NE2 ? A GLN 192 NE2 
36  1 Y 1 A ILE 293 ? CG1 ? A ILE 202 CG1 
37  1 Y 1 A ILE 293 ? CG2 ? A ILE 202 CG2 
38  1 Y 1 A ILE 293 ? CD1 ? A ILE 202 CD1 
39  1 Y 1 A LEU 294 ? CG  ? A LEU 203 CG  
40  1 Y 1 A LEU 294 ? CD1 ? A LEU 203 CD1 
41  1 Y 1 A LEU 294 ? CD2 ? A LEU 203 CD2 
42  1 Y 1 A LEU 301 ? CG  ? A LEU 210 CG  
43  1 Y 1 A LEU 301 ? CD1 ? A LEU 210 CD1 
44  1 Y 1 A LEU 301 ? CD2 ? A LEU 210 CD2 
45  1 Y 1 A GLN 302 ? CG  ? A GLN 211 CG  
46  1 Y 1 A GLN 302 ? CD  ? A GLN 211 CD  
47  1 Y 1 A GLN 302 ? OE1 ? A GLN 211 OE1 
48  1 Y 1 A GLN 302 ? NE2 ? A GLN 211 NE2 
49  1 Y 1 A ARG 303 ? CG  ? A ARG 212 CG  
50  1 Y 1 A ARG 303 ? CD  ? A ARG 212 CD  
51  1 Y 1 A ARG 303 ? NE  ? A ARG 212 NE  
52  1 Y 1 A ARG 303 ? CZ  ? A ARG 212 CZ  
53  1 Y 1 A ARG 303 ? NH1 ? A ARG 212 NH1 
54  1 Y 1 A ARG 303 ? NH2 ? A ARG 212 NH2 
55  1 Y 1 A ARG 304 ? CG  ? A ARG 213 CG  
56  1 Y 1 A ARG 304 ? CD  ? A ARG 213 CD  
57  1 Y 1 A ARG 304 ? NE  ? A ARG 213 NE  
58  1 Y 1 A ARG 304 ? CZ  ? A ARG 213 CZ  
59  1 Y 1 A ARG 304 ? NH1 ? A ARG 213 NH1 
60  1 Y 1 A ARG 304 ? NH2 ? A ARG 213 NH2 
61  1 Y 1 A SER 305 ? OG  ? A SER 214 OG  
62  1 Y 1 A GLU 306 ? CG  ? A GLU 215 CG  
63  1 Y 1 A GLU 306 ? CD  ? A GLU 215 CD  
64  1 Y 1 A GLU 306 ? OE1 ? A GLU 215 OE1 
65  1 Y 1 A GLU 306 ? OE2 ? A GLU 215 OE2 
66  1 Y 1 A ASN 307 ? CG  ? A ASN 216 CG  
67  1 Y 1 A ASN 307 ? OD1 ? A ASN 216 OD1 
68  1 Y 1 A ASN 307 ? ND2 ? A ASN 216 ND2 
69  1 Y 1 A GLU 308 ? CG  ? A GLU 217 CG  
70  1 Y 1 A GLU 308 ? CD  ? A GLU 217 CD  
71  1 Y 1 A GLU 308 ? OE1 ? A GLU 217 OE1 
72  1 Y 1 A GLU 308 ? OE2 ? A GLU 217 OE2 
73  1 Y 1 A GLU 309 ? CG  ? A GLU 218 CG  
74  1 Y 1 A GLU 309 ? CD  ? A GLU 218 CD  
75  1 Y 1 A GLU 309 ? OE1 ? A GLU 218 OE1 
76  1 Y 1 A GLU 309 ? OE2 ? A GLU 218 OE2 
77  1 Y 1 A PHE 310 ? CG  ? A PHE 219 CG  
78  1 Y 1 A PHE 310 ? CD1 ? A PHE 219 CD1 
79  1 Y 1 A PHE 310 ? CD2 ? A PHE 219 CD2 
80  1 Y 1 A PHE 310 ? CE1 ? A PHE 219 CE1 
81  1 Y 1 A PHE 310 ? CE2 ? A PHE 219 CE2 
82  1 Y 1 A PHE 310 ? CZ  ? A PHE 219 CZ  
83  1 Y 1 A VAL 313 ? CG1 ? A VAL 222 CG1 
84  1 Y 1 A VAL 313 ? CG2 ? A VAL 222 CG2 
85  1 Y 1 A ILE 325 ? CG1 ? A ILE 234 CG1 
86  1 Y 1 A ILE 325 ? CG2 ? A ILE 234 CG2 
87  1 Y 1 A ILE 325 ? CD1 ? A ILE 234 CD1 
88  1 Y 1 A LEU 327 ? CG  ? A LEU 236 CG  
89  1 Y 1 A LEU 327 ? CD1 ? A LEU 236 CD1 
90  1 Y 1 A LEU 327 ? CD2 ? A LEU 236 CD2 
91  1 Y 1 A MET 329 ? CG  ? A MET 238 CG  
92  1 Y 1 A MET 329 ? SD  ? A MET 238 SD  
93  1 Y 1 A MET 329 ? CE  ? A MET 238 CE  
94  1 Y 1 A ASN 330 ? CG  ? A ASN 239 CG  
95  1 Y 1 A ASN 330 ? OD1 ? A ASN 239 OD1 
96  1 Y 1 A ASN 330 ? ND2 ? A ASN 239 ND2 
97  1 Y 1 A ARG 331 ? CG  ? A ARG 240 CG  
98  1 Y 1 A ARG 331 ? CD  ? A ARG 240 CD  
99  1 Y 1 A ARG 331 ? NE  ? A ARG 240 NE  
100 1 Y 1 A ARG 331 ? CZ  ? A ARG 240 CZ  
101 1 Y 1 A ARG 331 ? NH1 ? A ARG 240 NH1 
102 1 Y 1 A ARG 331 ? NH2 ? A ARG 240 NH2 
103 1 Y 1 A ARG 333 ? CG  ? A ARG 242 CG  
104 1 Y 1 A ARG 333 ? CD  ? A ARG 242 CD  
105 1 Y 1 A ARG 333 ? NE  ? A ARG 242 NE  
106 1 Y 1 A ARG 333 ? CZ  ? A ARG 242 CZ  
107 1 Y 1 A ARG 333 ? NH1 ? A ARG 242 NH1 
108 1 Y 1 A ARG 333 ? NH2 ? A ARG 242 NH2 
109 1 Y 1 A THR 336 ? OG1 ? A THR 245 OG1 
110 1 Y 1 A THR 336 ? CG2 ? A THR 245 CG2 
111 1 Y 1 A VAL 337 ? CG1 ? A VAL 246 CG1 
112 1 Y 1 A VAL 337 ? CG2 ? A VAL 246 CG2 
113 1 Y 1 A VAL 338 ? CG1 ? A VAL 247 CG1 
114 1 Y 1 A VAL 338 ? CG2 ? A VAL 247 CG2 
115 1 Y 1 A ARG 340 ? CG  ? A ARG 249 CG  
116 1 Y 1 A ARG 340 ? CD  ? A ARG 249 CD  
117 1 Y 1 A ARG 340 ? NE  ? A ARG 249 NE  
118 1 Y 1 A ARG 340 ? CZ  ? A ARG 249 CZ  
119 1 Y 1 A ARG 340 ? NH1 ? A ARG 249 NH1 
120 1 Y 1 A ARG 340 ? NH2 ? A ARG 249 NH2 
121 1 Y 1 A LEU 343 ? CG  ? A LEU 252 CG  
122 1 Y 1 A LEU 343 ? CD1 ? A LEU 252 CD1 
123 1 Y 1 A LEU 343 ? CD2 ? A LEU 252 CD2 
124 1 Y 1 A LYS 344 ? CG  ? A LYS 253 CG  
125 1 Y 1 A LYS 344 ? CD  ? A LYS 253 CD  
126 1 Y 1 A LYS 344 ? CE  ? A LYS 253 CE  
127 1 Y 1 A LYS 344 ? NZ  ? A LYS 253 NZ  
128 1 Y 1 A LYS 347 ? CG  ? A LYS 256 CG  
129 1 Y 1 A LYS 347 ? CD  ? A LYS 256 CD  
130 1 Y 1 A LYS 347 ? CE  ? A LYS 256 CE  
131 1 Y 1 A LYS 347 ? NZ  ? A LYS 256 NZ  
132 1 Y 1 A LYS 365 ? CG  ? A LYS 274 CG  
133 1 Y 1 A LYS 365 ? CD  ? A LYS 274 CD  
134 1 Y 1 A LYS 365 ? CE  ? A LYS 274 CE  
135 1 Y 1 A LYS 365 ? NZ  ? A LYS 274 NZ  
136 1 Y 1 B VAL 512 ? CG1 ? B VAL 21  CG1 
137 1 Y 1 B VAL 512 ? CG2 ? B VAL 21  CG2 
138 1 Y 1 B ARG 513 ? CG  ? B ARG 22  CG  
139 1 Y 1 B ARG 513 ? CD  ? B ARG 22  CD  
140 1 Y 1 B ARG 513 ? NE  ? B ARG 22  NE  
141 1 Y 1 B ARG 513 ? CZ  ? B ARG 22  CZ  
142 1 Y 1 B ARG 513 ? NH1 ? B ARG 22  NH1 
143 1 Y 1 B ARG 513 ? NH2 ? B ARG 22  NH2 
144 1 Y 1 B VAL 515 ? CG1 ? B VAL 24  CG1 
145 1 Y 1 B VAL 515 ? CG2 ? B VAL 24  CG2 
146 1 Y 1 B GLU 587 ? CG  ? B GLU 96  CG  
147 1 Y 1 B GLU 587 ? CD  ? B GLU 96  CD  
148 1 Y 1 B GLU 587 ? OE1 ? B GLU 96  OE1 
149 1 Y 1 B GLU 587 ? OE2 ? B GLU 96  OE2 
150 1 Y 1 B VAL 651 ? CG1 ? B VAL 160 CG1 
151 1 Y 1 B VAL 651 ? CG2 ? B VAL 160 CG2 
152 1 Y 1 B ILE 653 ? CG1 ? B ILE 162 CG1 
153 1 Y 1 B ILE 653 ? CG2 ? B ILE 162 CG2 
154 1 Y 1 B ILE 653 ? CD1 ? B ILE 162 CD1 
155 1 Y 1 B GLU 675 ? CG  ? B GLU 184 CG  
156 1 Y 1 B GLU 675 ? CD  ? B GLU 184 CD  
157 1 Y 1 B GLU 675 ? OE1 ? B GLU 184 OE1 
158 1 Y 1 B GLU 675 ? OE2 ? B GLU 184 OE2 
159 1 Y 1 B ASP 676 ? CG  ? B ASP 185 CG  
160 1 Y 1 B ASP 676 ? OD1 ? B ASP 185 OD1 
161 1 Y 1 B ASP 676 ? OD2 ? B ASP 185 OD2 
162 1 Y 1 B LYS 679 ? CG  ? B LYS 188 CG  
163 1 Y 1 B LYS 679 ? CD  ? B LYS 188 CD  
164 1 Y 1 B LYS 679 ? CE  ? B LYS 188 CE  
165 1 Y 1 B LYS 679 ? NZ  ? B LYS 188 NZ  
166 1 Y 1 B VAL 682 ? CG1 ? B VAL 191 CG1 
167 1 Y 1 B VAL 682 ? CG2 ? B VAL 191 CG2 
168 1 Y 1 B GLN 683 ? CG  ? B GLN 192 CG  
169 1 Y 1 B GLN 683 ? CD  ? B GLN 192 CD  
170 1 Y 1 B GLN 683 ? OE1 ? B GLN 192 OE1 
171 1 Y 1 B GLN 683 ? NE2 ? B GLN 192 NE2 
172 1 Y 1 B SER 697 ? OG  ? B SER 206 OG  
173 1 Y 1 B LEU 701 ? CG  ? B LEU 210 CG  
174 1 Y 1 B LEU 701 ? CD1 ? B LEU 210 CD1 
175 1 Y 1 B LEU 701 ? CD2 ? B LEU 210 CD2 
176 1 Y 1 B ARG 703 ? CG  ? B ARG 212 CG  
177 1 Y 1 B ARG 703 ? CD  ? B ARG 212 CD  
178 1 Y 1 B ARG 703 ? NE  ? B ARG 212 NE  
179 1 Y 1 B ARG 703 ? CZ  ? B ARG 212 CZ  
180 1 Y 1 B ARG 703 ? NH1 ? B ARG 212 NH1 
181 1 Y 1 B ARG 703 ? NH2 ? B ARG 212 NH2 
182 1 Y 1 B ARG 704 ? CG  ? B ARG 213 CG  
183 1 Y 1 B ARG 704 ? CD  ? B ARG 213 CD  
184 1 Y 1 B ARG 704 ? NE  ? B ARG 213 NE  
185 1 Y 1 B ARG 704 ? CZ  ? B ARG 213 CZ  
186 1 Y 1 B ARG 704 ? NH1 ? B ARG 213 NH1 
187 1 Y 1 B ARG 704 ? NH2 ? B ARG 213 NH2 
188 1 Y 1 B SER 705 ? OG  ? B SER 214 OG  
189 1 Y 1 B GLU 706 ? CG  ? B GLU 215 CG  
190 1 Y 1 B GLU 706 ? CD  ? B GLU 215 CD  
191 1 Y 1 B GLU 706 ? OE1 ? B GLU 215 OE1 
192 1 Y 1 B GLU 706 ? OE2 ? B GLU 215 OE2 
193 1 Y 1 B ASN 707 ? CG  ? B ASN 216 CG  
194 1 Y 1 B ASN 707 ? OD1 ? B ASN 216 OD1 
195 1 Y 1 B ASN 707 ? ND2 ? B ASN 216 ND2 
196 1 Y 1 B GLU 708 ? CG  ? B GLU 217 CG  
197 1 Y 1 B GLU 708 ? CD  ? B GLU 217 CD  
198 1 Y 1 B GLU 708 ? OE1 ? B GLU 217 OE1 
199 1 Y 1 B GLU 708 ? OE2 ? B GLU 217 OE2 
200 1 Y 1 B GLU 709 ? CG  ? B GLU 218 CG  
201 1 Y 1 B GLU 709 ? CD  ? B GLU 218 CD  
202 1 Y 1 B GLU 709 ? OE1 ? B GLU 218 OE1 
203 1 Y 1 B GLU 709 ? OE2 ? B GLU 218 OE2 
204 1 Y 1 B ARG 715 ? CG  ? B ARG 224 CG  
205 1 Y 1 B ARG 715 ? CD  ? B ARG 224 CD  
206 1 Y 1 B ARG 715 ? NE  ? B ARG 224 NE  
207 1 Y 1 B ARG 715 ? CZ  ? B ARG 224 CZ  
208 1 Y 1 B ARG 715 ? NH1 ? B ARG 224 NH1 
209 1 Y 1 B ARG 715 ? NH2 ? B ARG 224 NH2 
210 1 Y 1 B ILE 725 ? CG1 ? B ILE 234 CG1 
211 1 Y 1 B ILE 725 ? CG2 ? B ILE 234 CG2 
212 1 Y 1 B ILE 725 ? CD1 ? B ILE 234 CD1 
213 1 Y 1 B MET 729 ? CG  ? B MET 238 CG  
214 1 Y 1 B MET 729 ? SD  ? B MET 238 SD  
215 1 Y 1 B MET 729 ? CE  ? B MET 238 CE  
216 1 Y 1 B ASN 730 ? CG  ? B ASN 239 CG  
217 1 Y 1 B ASN 730 ? OD1 ? B ASN 239 OD1 
218 1 Y 1 B ASN 730 ? ND2 ? B ASN 239 ND2 
219 1 Y 1 B ARG 731 ? CG  ? B ARG 240 CG  
220 1 Y 1 B ARG 731 ? CD  ? B ARG 240 CD  
221 1 Y 1 B ARG 731 ? NE  ? B ARG 240 NE  
222 1 Y 1 B ARG 731 ? CZ  ? B ARG 240 CZ  
223 1 Y 1 B ARG 731 ? NH1 ? B ARG 240 NH1 
224 1 Y 1 B ARG 731 ? NH2 ? B ARG 240 NH2 
225 1 Y 1 B ARG 733 ? CG  ? B ARG 242 CG  
226 1 Y 1 B ARG 733 ? CD  ? B ARG 242 CD  
227 1 Y 1 B ARG 733 ? NE  ? B ARG 242 NE  
228 1 Y 1 B ARG 733 ? CZ  ? B ARG 242 CZ  
229 1 Y 1 B ARG 733 ? NH1 ? B ARG 242 NH1 
230 1 Y 1 B ARG 733 ? NH2 ? B ARG 242 NH2 
231 1 Y 1 B VAL 737 ? CG1 ? B VAL 246 CG1 
232 1 Y 1 B VAL 737 ? CG2 ? B VAL 246 CG2 
233 1 Y 1 B VAL 738 ? CG1 ? B VAL 247 CG1 
234 1 Y 1 B VAL 738 ? CG2 ? B VAL 247 CG2 
235 1 Y 1 B ARG 740 ? CG  ? B ARG 249 CG  
236 1 Y 1 B ARG 740 ? CD  ? B ARG 249 CD  
237 1 Y 1 B ARG 740 ? NE  ? B ARG 249 NE  
238 1 Y 1 B ARG 740 ? CZ  ? B ARG 249 CZ  
239 1 Y 1 B ARG 740 ? NH1 ? B ARG 249 NH1 
240 1 Y 1 B ARG 740 ? NH2 ? B ARG 249 NH2 
241 1 Y 1 B ILE 763 ? CG1 ? B ILE 272 CG1 
242 1 Y 1 B ILE 763 ? CG2 ? B ILE 272 CG2 
243 1 Y 1 B ILE 763 ? CD1 ? B ILE 272 CD1 
244 1 Y 1 B ARG 766 ? CG  ? B ARG 275 CG  
245 1 Y 1 B ARG 766 ? CD  ? B ARG 275 CD  
246 1 Y 1 B ARG 766 ? NE  ? B ARG 275 NE  
247 1 Y 1 B ARG 766 ? CZ  ? B ARG 275 CZ  
248 1 Y 1 B ARG 766 ? NH1 ? B ARG 275 NH1 
249 1 Y 1 B ARG 766 ? NH2 ? B ARG 275 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 92  ? A ARG 1   
2  1 Y 1 A ARG 93  ? A ARG 2   
3  1 Y 1 A ARG 94  ? A ARG 3   
4  1 Y 1 A ARG 95  ? A ARG 4   
5  1 Y 1 A GLY 96  ? A GLY 5   
6  1 Y 1 A ALA 97  ? A ALA 6   
7  1 Y 1 A ILE 98  ? A ILE 7   
8  1 Y 1 A SER 99  ? A SER 8   
9  1 Y 1 A ALA 100 ? A ALA 9   
10 1 Y 1 A GLU 101 ? A GLU 10  
11 1 Y 1 A VAL 102 ? A VAL 11  
12 1 Y 1 A TYR 103 ? A TYR 12  
13 1 Y 1 A THR 104 ? A THR 13  
14 1 Y 1 A GLU 105 ? A GLU 14  
15 1 Y 1 A GLU 106 ? A GLU 15  
16 1 Y 1 A ASP 107 ? A ASP 16  
17 1 Y 1 A ALA 108 ? A ALA 17  
18 1 Y 1 A LEU 377 ? A LEU 286 
19 1 Y 1 A SER 378 ? A SER 287 
20 1 Y 1 A VAL 379 ? A VAL 288 
21 1 Y 1 B ARG 492 ? B ARG 1   
22 1 Y 1 B ARG 493 ? B ARG 2   
23 1 Y 1 B ARG 494 ? B ARG 3   
24 1 Y 1 B ARG 495 ? B ARG 4   
25 1 Y 1 B GLY 496 ? B GLY 5   
26 1 Y 1 B ALA 497 ? B ALA 6   
27 1 Y 1 B ILE 498 ? B ILE 7   
28 1 Y 1 B SER 499 ? B SER 8   
29 1 Y 1 B ALA 500 ? B ALA 9   
30 1 Y 1 B GLU 501 ? B GLU 10  
31 1 Y 1 B VAL 502 ? B VAL 11  
32 1 Y 1 B TYR 503 ? B TYR 12  
33 1 Y 1 B THR 504 ? B THR 13  
34 1 Y 1 B GLU 505 ? B GLU 14  
35 1 Y 1 B GLU 506 ? B GLU 15  
36 1 Y 1 B ASP 507 ? B ASP 16  
37 1 Y 1 B ALA 508 ? B ALA 17  
38 1 Y 1 B ILE 768 ? B ILE 277 
39 1 Y 1 B GLN 769 ? B GLN 278 
40 1 Y 1 B GLN 770 ? B GLN 279 
41 1 Y 1 B TYR 771 ? B TYR 280 
42 1 Y 1 B ASN 772 ? B ASN 281 
43 1 Y 1 B SER 773 ? B SER 282 
44 1 Y 1 B PHE 774 ? B PHE 283 
45 1 Y 1 B VAL 775 ? B VAL 284 
46 1 Y 1 B SER 776 ? B SER 285 
47 1 Y 1 B LEU 777 ? B LEU 286 
48 1 Y 1 B SER 778 ? B SER 287 
49 1 Y 1 B VAL 779 ? B VAL 288 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CYCLIC GUANOSINE MONOPHOSPHATE' PCG 
3 GLYCEROL                         GOL 
4 water                            HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PCG 1  401 401 PCG PCG A . 
D 3 GOL 1  402 402 GOL GOL A . 
E 2 PCG 1  801 801 PCG PCG B . 
F 3 GOL 1  802 802 GOL GOL B . 
G 3 GOL 1  901 901 GOL GOL B . 
H 4 HOH 1  902 902 HOH WAT A . 
H 4 HOH 2  903 903 HOH WAT A . 
H 4 HOH 3  904 904 HOH WAT A . 
H 4 HOH 4  905 905 HOH WAT A . 
H 4 HOH 5  906 906 HOH WAT A . 
H 4 HOH 6  907 907 HOH WAT A . 
H 4 HOH 7  908 908 HOH WAT A . 
H 4 HOH 8  909 909 HOH WAT A . 
H 4 HOH 9  910 910 HOH WAT A . 
H 4 HOH 10 911 911 HOH WAT A . 
H 4 HOH 11 912 912 HOH WAT A . 
H 4 HOH 12 913 913 HOH WAT A . 
I 4 HOH 1  914 914 HOH WAT B . 
I 4 HOH 2  915 915 HOH WAT B . 
I 4 HOH 3  916 916 HOH WAT B . 
I 4 HOH 4  918 918 HOH WAT B . 
I 4 HOH 5  919 919 HOH WAT B . 
#