data_1RM1
# 
_entry.id   1RM1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RM1         
NDB   PD0559       
RCSB  RCSB020875   
WWPDB D_1000020875 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RM1 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jin, X.'       1 
'Gewirth, D.T.' 2 
'Geiger, J.H.'  3 
# 
_citation.id                        primary 
_citation.title                     'High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jin, X.'       1 
primary 'Gewirth, D.T.' 2 
primary 'Geiger, J.H.'  3 
# 
_cell.entry_id           1RM1 
_cell.length_a           173.250 
_cell.length_b           173.250 
_cell.length_c           164.070 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RM1 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-3'"  5532.631  1   ? ? ? ? 
2 polymer syn "5'-D(P*CP*GP*TP*TP*TP*TP*AP*TP*AP*TP*CP*GP*AP*TP*CP*GP*AP*T)-3'" 5496.575  1   ? ? ? ? 
3 polymer man 'TATA-box binding protein'                                        27042.275 1   ? ? ? ? 
4 polymer man 'Transcription initiation factor IIA small chain'                 13473.070 1   ? ? ? ? 
5 polymer man 'Transcription initiation factor IIA large chain'                 32230.805 1   ? ? ? ? 
6 water   nat water                                                             18.015    301 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 
;TATA-box factor, TATA binding factor, TATA sequence-binding protein, TBP, Transcription factor D, Transcription initiation factor TFIID TBP subunit
;
4 'TFIIA 13.5 kDa subunit' 
5 'TFIIA 32 kDa subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DG)(DA)(DT)(DC)(DG)(DA)(DT)(DA)(DT)(DA)(DA)(DA)(DA)(DC)(DG)' ATCGATCGATATAAAACG D ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DT)(DA)(DT)(DC)(DG)(DA)(DT)(DC)(DG)(DA)(DT)' CGTTTTATATCGATCGAT E ? 
3 'polypeptide(L)'        no no 
;MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRL
DLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
;
;MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRL
DLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
;
A ? 
4 'polypeptide(L)'        no no 
;MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIV
KNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE
;
;MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIV
KNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE
;
B ? 
5 'polypeptide(L)'        no no 
;MSNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNEGNINGVQNDLNFNLATPG
VNSSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTNTVEATNNSGATLNTNTSGNTNADVTSQPKIEVKPEIELTI
NNANITTVENIDDESEKKDDEEKEEDVEKTRKEKEQIEQVKLQAKKEKRSALLDTDEVGSELDDSDDDYLISEGEEDGPD
ENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
;
;MSNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNEGNINGVQNDLNFNLATPG
VNSSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTNTVEATNNSGATLNTNTSGNTNADVTSQPKIEVKPEIELTI
NNANITTVENIDDESEKKDDEEKEEDVEKTRKEKEQIEQVKLQAKKEKRSALLDTDEVGSELDDSDDDYLISEGEEDGPD
ENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
1 7   DC  n 
1 8   DG  n 
1 9   DA  n 
1 10  DT  n 
1 11  DA  n 
1 12  DT  n 
1 13  DA  n 
1 14  DA  n 
1 15  DA  n 
1 16  DA  n 
1 17  DC  n 
1 18  DG  n 
2 1   DC  n 
2 2   DG  n 
2 3   DT  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DC  n 
2 12  DG  n 
2 13  DA  n 
2 14  DT  n 
2 15  DC  n 
2 16  DG  n 
2 17  DA  n 
2 18  DT  n 
3 1   MET n 
3 2   ALA n 
3 3   ASP n 
3 4   GLU n 
3 5   GLU n 
3 6   ARG n 
3 7   LEU n 
3 8   LYS n 
3 9   GLU n 
3 10  PHE n 
3 11  LYS n 
3 12  GLU n 
3 13  ALA n 
3 14  ASN n 
3 15  LYS n 
3 16  ILE n 
3 17  VAL n 
3 18  PHE n 
3 19  ASP n 
3 20  PRO n 
3 21  ASN n 
3 22  THR n 
3 23  ARG n 
3 24  GLN n 
3 25  VAL n 
3 26  TRP n 
3 27  GLU n 
3 28  ASN n 
3 29  GLN n 
3 30  ASN n 
3 31  ARG n 
3 32  ASP n 
3 33  GLY n 
3 34  THR n 
3 35  LYS n 
3 36  PRO n 
3 37  ALA n 
3 38  THR n 
3 39  THR n 
3 40  PHE n 
3 41  GLN n 
3 42  SER n 
3 43  GLU n 
3 44  GLU n 
3 45  ASP n 
3 46  ILE n 
3 47  LYS n 
3 48  ARG n 
3 49  ALA n 
3 50  ALA n 
3 51  PRO n 
3 52  GLU n 
3 53  SER n 
3 54  GLU n 
3 55  LYS n 
3 56  ASP n 
3 57  THR n 
3 58  SER n 
3 59  ALA n 
3 60  THR n 
3 61  SER n 
3 62  GLY n 
3 63  ILE n 
3 64  VAL n 
3 65  PRO n 
3 66  THR n 
3 67  LEU n 
3 68  GLN n 
3 69  ASN n 
3 70  ILE n 
3 71  VAL n 
3 72  ALA n 
3 73  THR n 
3 74  VAL n 
3 75  THR n 
3 76  LEU n 
3 77  GLY n 
3 78  CYS n 
3 79  ARG n 
3 80  LEU n 
3 81  ASP n 
3 82  LEU n 
3 83  LYS n 
3 84  THR n 
3 85  VAL n 
3 86  ALA n 
3 87  LEU n 
3 88  HIS n 
3 89  ALA n 
3 90  ARG n 
3 91  ASN n 
3 92  ALA n 
3 93  GLU n 
3 94  TYR n 
3 95  ASN n 
3 96  PRO n 
3 97  LYS n 
3 98  ARG n 
3 99  PHE n 
3 100 ALA n 
3 101 ALA n 
3 102 VAL n 
3 103 ILE n 
3 104 MET n 
3 105 ARG n 
3 106 ILE n 
3 107 ARG n 
3 108 GLU n 
3 109 PRO n 
3 110 LYS n 
3 111 THR n 
3 112 THR n 
3 113 ALA n 
3 114 LEU n 
3 115 ILE n 
3 116 PHE n 
3 117 ALA n 
3 118 SER n 
3 119 GLY n 
3 120 LYS n 
3 121 MET n 
3 122 VAL n 
3 123 VAL n 
3 124 THR n 
3 125 GLY n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 GLU n 
3 130 ASP n 
3 131 ASP n 
3 132 SER n 
3 133 LYS n 
3 134 LEU n 
3 135 ALA n 
3 136 SER n 
3 137 ARG n 
3 138 LYS n 
3 139 TYR n 
3 140 ALA n 
3 141 ARG n 
3 142 ILE n 
3 143 ILE n 
3 144 GLN n 
3 145 LYS n 
3 146 ILE n 
3 147 GLY n 
3 148 PHE n 
3 149 ALA n 
3 150 ALA n 
3 151 LYS n 
3 152 PHE n 
3 153 THR n 
3 154 ASP n 
3 155 PHE n 
3 156 LYS n 
3 157 ILE n 
3 158 GLN n 
3 159 ASN n 
3 160 ILE n 
3 161 VAL n 
3 162 GLY n 
3 163 SER n 
3 164 CYS n 
3 165 ASP n 
3 166 VAL n 
3 167 LYS n 
3 168 PHE n 
3 169 PRO n 
3 170 ILE n 
3 171 ARG n 
3 172 LEU n 
3 173 GLU n 
3 174 GLY n 
3 175 LEU n 
3 176 ALA n 
3 177 PHE n 
3 178 SER n 
3 179 HIS n 
3 180 GLY n 
3 181 THR n 
3 182 PHE n 
3 183 SER n 
3 184 SER n 
3 185 TYR n 
3 186 GLU n 
3 187 PRO n 
3 188 GLU n 
3 189 LEU n 
3 190 PHE n 
3 191 PRO n 
3 192 GLY n 
3 193 LEU n 
3 194 ILE n 
3 195 TYR n 
3 196 ARG n 
3 197 MET n 
3 198 VAL n 
3 199 LYS n 
3 200 PRO n 
3 201 LYS n 
3 202 ILE n 
3 203 VAL n 
3 204 LEU n 
3 205 LEU n 
3 206 ILE n 
3 207 PHE n 
3 208 VAL n 
3 209 SER n 
3 210 GLY n 
3 211 LYS n 
3 212 ILE n 
3 213 VAL n 
3 214 LEU n 
3 215 THR n 
3 216 GLY n 
3 217 ALA n 
3 218 LYS n 
3 219 GLN n 
3 220 ARG n 
3 221 GLU n 
3 222 GLU n 
3 223 ILE n 
3 224 TYR n 
3 225 GLN n 
3 226 ALA n 
3 227 PHE n 
3 228 GLU n 
3 229 ALA n 
3 230 ILE n 
3 231 TYR n 
3 232 PRO n 
3 233 VAL n 
3 234 LEU n 
3 235 SER n 
3 236 GLU n 
3 237 PHE n 
3 238 ARG n 
3 239 LYS n 
3 240 MET n 
4 1   MET n 
4 2   ALA n 
4 3   VAL n 
4 4   PRO n 
4 5   GLY n 
4 6   TYR n 
4 7   TYR n 
4 8   GLU n 
4 9   LEU n 
4 10  TYR n 
4 11  ARG n 
4 12  ARG n 
4 13  SER n 
4 14  THR n 
4 15  ILE n 
4 16  GLY n 
4 17  ASN n 
4 18  SER n 
4 19  LEU n 
4 20  VAL n 
4 21  ASP n 
4 22  ALA n 
4 23  LEU n 
4 24  ASP n 
4 25  THR n 
4 26  LEU n 
4 27  ILE n 
4 28  SER n 
4 29  ASP n 
4 30  GLY n 
4 31  ARG n 
4 32  ILE n 
4 33  GLU n 
4 34  ALA n 
4 35  SER n 
4 36  LEU n 
4 37  ALA n 
4 38  MET n 
4 39  ARG n 
4 40  VAL n 
4 41  LEU n 
4 42  GLU n 
4 43  THR n 
4 44  PHE n 
4 45  ASP n 
4 46  LYS n 
4 47  VAL n 
4 48  VAL n 
4 49  ALA n 
4 50  GLU n 
4 51  THR n 
4 52  LEU n 
4 53  LYS n 
4 54  ASP n 
4 55  ASN n 
4 56  THR n 
4 57  GLN n 
4 58  SER n 
4 59  LYS n 
4 60  LEU n 
4 61  THR n 
4 62  VAL n 
4 63  LYS n 
4 64  GLY n 
4 65  ASN n 
4 66  LEU n 
4 67  ASP n 
4 68  THR n 
4 69  TYR n 
4 70  GLY n 
4 71  PHE n 
4 72  CYS n 
4 73  ASP n 
4 74  ASP n 
4 75  VAL n 
4 76  TRP n 
4 77  THR n 
4 78  PHE n 
4 79  ILE n 
4 80  VAL n 
4 81  LYS n 
4 82  ASN n 
4 83  CYS n 
4 84  GLN n 
4 85  VAL n 
4 86  THR n 
4 87  VAL n 
4 88  GLU n 
4 89  ASP n 
4 90  SER n 
4 91  HIS n 
4 92  ARG n 
4 93  ASP n 
4 94  ALA n 
4 95  SER n 
4 96  GLN n 
4 97  ASN n 
4 98  GLY n 
4 99  SER n 
4 100 GLY n 
4 101 ASP n 
4 102 SER n 
4 103 GLN n 
4 104 SER n 
4 105 VAL n 
4 106 ILE n 
4 107 SER n 
4 108 VAL n 
4 109 ASP n 
4 110 LYS n 
4 111 LEU n 
4 112 ARG n 
4 113 ILE n 
4 114 VAL n 
4 115 ALA n 
4 116 CYS n 
4 117 ASN n 
4 118 SER n 
4 119 LYS n 
4 120 LYS n 
4 121 SER n 
4 122 GLU n 
5 1   MET n 
5 2   SER n 
5 3   ASN n 
5 4   ALA n 
5 5   GLU n 
5 6   ALA n 
5 7   SER n 
5 8   ARG n 
5 9   VAL n 
5 10  TYR n 
5 11  GLU n 
5 12  ILE n 
5 13  ILE n 
5 14  VAL n 
5 15  GLU n 
5 16  SER n 
5 17  VAL n 
5 18  VAL n 
5 19  ASN n 
5 20  GLU n 
5 21  VAL n 
5 22  ARG n 
5 23  GLU n 
5 24  ASP n 
5 25  PHE n 
5 26  GLU n 
5 27  ASN n 
5 28  ALA n 
5 29  GLY n 
5 30  ILE n 
5 31  ASP n 
5 32  GLU n 
5 33  GLN n 
5 34  THR n 
5 35  LEU n 
5 36  GLN n 
5 37  ASP n 
5 38  LEU n 
5 39  LYS n 
5 40  ASN n 
5 41  ILE n 
5 42  TRP n 
5 43  GLN n 
5 44  LYS n 
5 45  LYS n 
5 46  LEU n 
5 47  THR n 
5 48  GLU n 
5 49  THR n 
5 50  LYS n 
5 51  VAL n 
5 52  THR n 
5 53  THR n 
5 54  PHE n 
5 55  SER n 
5 56  TRP n 
5 57  ASP n 
5 58  ASN n 
5 59  GLN n 
5 60  PHE n 
5 61  ASN n 
5 62  GLU n 
5 63  GLY n 
5 64  ASN n 
5 65  ILE n 
5 66  ASN n 
5 67  GLY n 
5 68  VAL n 
5 69  GLN n 
5 70  ASN n 
5 71  ASP n 
5 72  LEU n 
5 73  ASN n 
5 74  PHE n 
5 75  ASN n 
5 76  LEU n 
5 77  ALA n 
5 78  THR n 
5 79  PRO n 
5 80  GLY n 
5 81  VAL n 
5 82  ASN n 
5 83  SER n 
5 84  SER n 
5 85  GLU n 
5 86  PHE n 
5 87  ASN n 
5 88  ILE n 
5 89  LYS n 
5 90  GLU n 
5 91  GLU n 
5 92  ASN n 
5 93  THR n 
5 94  GLY n 
5 95  ASN n 
5 96  GLU n 
5 97  GLY n 
5 98  LEU n 
5 99  ILE n 
5 100 LEU n 
5 101 PRO n 
5 102 ASN n 
5 103 ILE n 
5 104 ASN n 
5 105 SER n 
5 106 ASN n 
5 107 ASN n 
5 108 ASN n 
5 109 ILE n 
5 110 PRO n 
5 111 HIS n 
5 112 SER n 
5 113 GLY n 
5 114 GLU n 
5 115 THR n 
5 116 ASN n 
5 117 ILE n 
5 118 ASN n 
5 119 THR n 
5 120 ASN n 
5 121 THR n 
5 122 VAL n 
5 123 GLU n 
5 124 ALA n 
5 125 THR n 
5 126 ASN n 
5 127 ASN n 
5 128 SER n 
5 129 GLY n 
5 130 ALA n 
5 131 THR n 
5 132 LEU n 
5 133 ASN n 
5 134 THR n 
5 135 ASN n 
5 136 THR n 
5 137 SER n 
5 138 GLY n 
5 139 ASN n 
5 140 THR n 
5 141 ASN n 
5 142 ALA n 
5 143 ASP n 
5 144 VAL n 
5 145 THR n 
5 146 SER n 
5 147 GLN n 
5 148 PRO n 
5 149 LYS n 
5 150 ILE n 
5 151 GLU n 
5 152 VAL n 
5 153 LYS n 
5 154 PRO n 
5 155 GLU n 
5 156 ILE n 
5 157 GLU n 
5 158 LEU n 
5 159 THR n 
5 160 ILE n 
5 161 ASN n 
5 162 ASN n 
5 163 ALA n 
5 164 ASN n 
5 165 ILE n 
5 166 THR n 
5 167 THR n 
5 168 VAL n 
5 169 GLU n 
5 170 ASN n 
5 171 ILE n 
5 172 ASP n 
5 173 ASP n 
5 174 GLU n 
5 175 SER n 
5 176 GLU n 
5 177 LYS n 
5 178 LYS n 
5 179 ASP n 
5 180 ASP n 
5 181 GLU n 
5 182 GLU n 
5 183 LYS n 
5 184 GLU n 
5 185 GLU n 
5 186 ASP n 
5 187 VAL n 
5 188 GLU n 
5 189 LYS n 
5 190 THR n 
5 191 ARG n 
5 192 LYS n 
5 193 GLU n 
5 194 LYS n 
5 195 GLU n 
5 196 GLN n 
5 197 ILE n 
5 198 GLU n 
5 199 GLN n 
5 200 VAL n 
5 201 LYS n 
5 202 LEU n 
5 203 GLN n 
5 204 ALA n 
5 205 LYS n 
5 206 LYS n 
5 207 GLU n 
5 208 LYS n 
5 209 ARG n 
5 210 SER n 
5 211 ALA n 
5 212 LEU n 
5 213 LEU n 
5 214 ASP n 
5 215 THR n 
5 216 ASP n 
5 217 GLU n 
5 218 VAL n 
5 219 GLY n 
5 220 SER n 
5 221 GLU n 
5 222 LEU n 
5 223 ASP n 
5 224 ASP n 
5 225 SER n 
5 226 ASP n 
5 227 ASP n 
5 228 ASP n 
5 229 TYR n 
5 230 LEU n 
5 231 ILE n 
5 232 SER n 
5 233 GLU n 
5 234 GLY n 
5 235 GLU n 
5 236 GLU n 
5 237 ASP n 
5 238 GLY n 
5 239 PRO n 
5 240 ASP n 
5 241 GLU n 
5 242 ASN n 
5 243 LEU n 
5 244 MET n 
5 245 LEU n 
5 246 CYS n 
5 247 LEU n 
5 248 TYR n 
5 249 ASP n 
5 250 LYS n 
5 251 VAL n 
5 252 THR n 
5 253 ARG n 
5 254 THR n 
5 255 LYS n 
5 256 ALA n 
5 257 ARG n 
5 258 TRP n 
5 259 LYS n 
5 260 CYS n 
5 261 SER n 
5 262 LEU n 
5 263 LYS n 
5 264 ASP n 
5 265 GLY n 
5 266 VAL n 
5 267 VAL n 
5 268 THR n 
5 269 ILE n 
5 270 ASN n 
5 271 ARG n 
5 272 ASN n 
5 273 ASP n 
5 274 TYR n 
5 275 THR n 
5 276 PHE n 
5 277 GLN n 
5 278 LYS n 
5 279 ALA n 
5 280 GLN n 
5 281 VAL n 
5 282 GLU n 
5 283 ALA n 
5 284 GLU n 
5 285 TRP n 
5 286 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'SPT15, BTF1, YER148W' ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? T7 ? ? ? ? ? ? 
4 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'TOA2, YKL058W'        ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? T7 ? ? ? ? ? ? 
5 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'TOA1, YOR194C'        ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? T7 ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TBP_YEAST  P13393 3 
;ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLD
LKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIV
GSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
;
1 ? 
2 UNP TOA2_YEAST P32774 4 
;MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIV
KNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE
;
1 ? 
3 UNP TOA1_YEAST P32773 5 
;MSNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNEGNINGVQNDLNFNLATPG
VNSSEFNIKEENTGNEGLILPNINSNNNIPHSGETNINTNTVEATNNSGATLNTNTSGNTNADVTSQPKIEVKPEIELTI
NNANITTVENIDDESEKKDDEEKEEDVEKTRKEKEQIEQVKLQAKKEKRSALLDTDEVGSELDDSDDDYLISEGEEDGPD
ENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
;
1 ? 
4 PDB 1RM1       1RM1   1 ? ? ? 
5 PDB 1RM1       1RM1   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RM1 A 2 ? 240 ? P13393 1  ? 239 ? 2  240 
2 2 1RM1 B 1 ? 122 ? P32774 1  ? 122 ? 1  122 
3 3 1RM1 C 1 ? 286 ? P32773 1  ? 286 ? 1  286 
4 4 1RM1 D 1 ? 18  ? 1RM1   1  ? 18  ? 1  18  
5 5 1RM1 E 1 ? 18  ? 1RM1   19 ? 36  ? 19 36  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1RM1 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P13393 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'INITIATING METHIONINE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RM1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    'PEG 4000, ammonium citrate, MES, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000'         ? ? ? 
1 2 1 'ammonium citrate' ? ? ? 
1 3 1 MES                ? ? ? 
1 4 1 H2O                ? ? ? 
1 5 2 'PEG 4000'         ? ? ? 
1 6 2 'ammonium citrate' ? ? ? 
1 7 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'PRINCETON 2K' 
_diffrn_detector.pdbx_collection_date   2000-09-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.908 
# 
_reflns.entry_id                     1RM1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   29228 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1RM1 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     32744 
_refine.ls_number_reflns_obs                     29188 
_refine.ls_number_reflns_R_free                  2992 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.201 
_refine.ls_R_factor_obs                          0.189 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1YTB' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3164 
_refine_hist.pdbx_number_atoms_nucleic_acid   735 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             301 
_refine_hist.number_atoms_total               4200 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RM1 
_struct.title                     'Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex' 
_struct.pdbx_descriptor           
;TATA-box binding PROTEIN/Transcription initiation factor IIA small chain/Transcription initiation factor IIA large chain/DNA Complex
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RM1 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'Yeast TFIIA, TBP protein, ATA-box DNA, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 81  ? ALA C 89  ? ASP A 81  ALA A 89  1 ? 9  
HELX_P HELX_P2  2  SER C 128 ? GLY C 147 ? SER A 128 GLY A 147 1 ? 20 
HELX_P HELX_P3  3  ARG C 171 ? HIS C 179 ? ARG A 171 HIS A 179 1 ? 9  
HELX_P HELX_P4  4  GLN C 219 ? PHE C 237 ? GLN A 219 PHE A 237 1 ? 19 
HELX_P HELX_P5  5  GLU D 8   ? ARG D 12  ? GLU B 8   ARG B 12  5 ? 5  
HELX_P HELX_P6  6  SER D 13  ? ASP D 29  ? SER B 13  ASP B 29  1 ? 17 
HELX_P HELX_P7  7  GLU D 33  ? ASN D 55  ? GLU B 33  ASN B 55  1 ? 23 
HELX_P HELX_P8  8  ASN E 3   ? ALA E 28  ? ASN C 3   ALA C 28  1 ? 26 
HELX_P HELX_P9  9  ASP E 31  ? LYS E 50  ? ASP C 31  LYS C 50  1 ? 20 
HELX_P HELX_P10 10 TRP E 56  ? ASN E 61  ? TRP C 56  ASN C 61  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 18 N3 ? ? D DA 1  E DT 36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 18 O4 ? ? D DA 1  E DT 36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA 17 N1 ? ? D DT 2  E DA 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA 17 N6 ? ? D DT 2  E DA 35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B DG 16 N1 ? ? D DC 3  E DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B DG 16 O6 ? ? D DC 3  E DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B DG 16 N2 ? ? D DC 3  E DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 15 N3 ? ? D DG 4  E DC 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 15 O2 ? ? D DG 4  E DC 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 15 N4 ? ? D DG 4  E DC 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 14 N3 ? ? D DA 5  E DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 14 O4 ? ? D DA 5  E DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 13 N1 ? ? D DT 6  E DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 13 N6 ? ? D DT 6  E DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 7  N3 ? ? ? 1_555 B DG 12 N1 ? ? D DC 7  E DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 7  N4 ? ? ? 1_555 B DG 12 O6 ? ? D DC 7  E DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 7  O2 ? ? ? 1_555 B DG 12 N2 ? ? D DC 7  E DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 11 N3 ? ? D DG 8  E DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 11 O2 ? ? D DG 8  E DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 11 N4 ? ? D DG 8  E DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 10 N3 ? ? D DA 9  E DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 10 O4 ? ? D DA 9  E DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 9  N1 ? ? D DT 10 E DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 9  N6 ? ? D DT 10 E DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 8  N3 ? ? D DA 11 E DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 8  O4 ? ? D DA 11 E DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 7  N1 ? ? D DT 12 E DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 7  N6 ? ? D DT 12 E DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 6  N3 ? ? D DA 13 E DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 6  O4 ? ? D DA 13 E DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 5  N3 ? ? D DA 14 E DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 5  O4 ? ? D DA 14 E DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 4  N3 ? ? D DA 15 E DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 4  O4 ? ? D DA 15 E DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 3  N3 ? ? D DA 16 E DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 3  O4 ? ? D DA 16 E DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG 2  N1 ? ? D DC 17 E DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG 2  O6 ? ? D DC 17 E DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG 2  N2 ? ? D DC 17 E DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DG 18 O6 ? ? ? 1_555 B DC 1  N4 ? ? D DG 18 E DC 19 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 108 C . ? GLU 108 A PRO 109 C ? PRO 109 A 1 -0.53 
2 LYS 199 C . ? LYS 199 A PRO 200 C ? PRO 200 A 1 -0.10 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   17 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? parallel      
A 11 12 ? parallel      
A 12 13 ? anti-parallel 
A 13 14 ? anti-parallel 
A 14 15 ? parallel      
A 15 16 ? anti-parallel 
A 16 17 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  SER C 183 ? GLU C 186 ? SER A 183 GLU A 186 
A 2  PHE C 190 ? MET C 197 ? PHE A 190 MET A 197 
A 3  ILE C 202 ? ILE C 206 ? ILE A 202 ILE A 206 
A 4  LYS C 211 ? ALA C 217 ? LYS A 211 ALA A 217 
A 5  THR C 153 ? ASP C 165 ? THR A 153 ASP A 165 
A 6  THR C 66  ? THR C 75  ? THR A 66  THR A 75  
A 7  LYS C 120 ? ALA C 126 ? LYS A 120 ALA A 126 
A 8  THR C 111 ? PHE C 116 ? THR A 111 PHE A 116 
A 9  ALA C 101 ? ILE C 106 ? ALA A 101 ILE A 106 
A 10 ALA C 92  ? TYR C 94  ? ALA A 92  TYR A 94  
A 11 LYS D 59  ? CYS D 72  ? LYS B 59  CYS B 72  
A 12 ASP E 273 ? GLU E 284 ? ASP C 273 GLU C 284 
A 13 ARG E 257 ? THR E 268 ? ARG C 257 THR C 268 
A 14 LEU E 243 ? THR E 254 ? LEU C 243 THR C 254 
A 15 ILE D 106 ? ASN D 117 ? ILE B 106 ASN B 117 
A 16 VAL D 75  ? THR D 86  ? VAL B 75  THR B 86  
A 17 LYS D 59  ? CYS D 72  ? LYS B 59  CYS B 72  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N SER C 184 ? N SER A 184 O ILE C 194 ? O ILE A 194 
A 2  3  N LEU C 193 ? N LEU A 193 O ILE C 206 ? O ILE A 206 
A 3  4  N VAL C 203 ? N VAL A 203 O THR C 215 ? O THR A 215 
A 4  5  O LEU C 214 ? O LEU A 214 N GLY C 162 ? N GLY A 162 
A 5  6  O GLN C 158 ? O GLN A 158 N VAL C 71  ? N VAL A 71  
A 6  7  N ALA C 72  ? N ALA A 72  O VAL C 123 ? O VAL A 123 
A 7  8  O VAL C 122 ? O VAL A 122 N LEU C 114 ? N LEU A 114 
A 8  9  O ALA C 113 ? O ALA A 113 N MET C 104 ? N MET A 104 
A 9  10 O ILE C 103 ? O ILE A 103 N GLU C 93  ? N GLU A 93  
A 10 11 N TYR C 94  ? N TYR A 94  O PHE D 71  ? O PHE B 71  
A 11 12 N VAL D 62  ? N VAL B 62  O GLN E 280 ? O GLN C 280 
A 12 13 O TYR E 274 ? O TYR C 274 N VAL E 267 ? N VAL C 267 
A 13 14 O SER E 261 ? O SER C 261 N ASP E 249 ? N ASP C 249 
A 14 15 O MET E 244 ? O MET C 244 N ARG D 112 ? N ARG B 112 
A 15 16 O ILE D 106 ? O ILE B 106 N VAL D 85  ? N VAL B 85  
A 16 17 O GLN D 84  ? O GLN B 84  N LYS D 63  ? N LYS B 63  
# 
_database_PDB_matrix.entry_id          1RM1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RM1 
_atom_sites.fract_transf_matrix[1][1]   0.005772 
_atom_sites.fract_transf_matrix[1][2]   0.003332 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006665 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006095 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? -35.574 51.447 74.251  1.00 90.00  ? 1   DA  D "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? -34.986 52.732 74.027  1.00 90.00  ? 1   DA  D "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? -35.499 53.749 75.020  1.00 90.00  ? 1   DA  D "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? -34.881 53.525 76.314  1.00 90.00  ? 1   DA  D "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? -35.209 55.212 74.665  1.00 90.00  ? 1   DA  D "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? -36.337 56.029 75.009  1.00 90.00  ? 1   DA  D "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? -34.027 55.563 75.552  1.00 90.00  ? 1   DA  D "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? -34.325 54.744 76.792  1.00 90.00  ? 1   DA  D "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? -33.165 54.424 77.630  1.00 88.07  ? 1   DA  D N9    1 
ATOM   10   C C8    . DA  A 1 1   ? -32.344 53.321 77.557  1.00 88.07  ? 1   DA  D C8    1 
ATOM   11   N N7    . DA  A 1 1   ? -31.393 53.308 78.464  1.00 87.75  ? 1   DA  D N7    1 
ATOM   12   C C5    . DA  A 1 1   ? -31.596 54.482 79.179  1.00 85.76  ? 1   DA  D C5    1 
ATOM   13   C C6    . DA  A 1 1   ? -30.916 55.054 80.271  1.00 83.88  ? 1   DA  D C6    1 
ATOM   14   N N6    . DA  A 1 1   ? -29.851 54.494 80.856  1.00 82.28  ? 1   DA  D N6    1 
ATOM   15   N N1    . DA  A 1 1   ? -31.373 56.234 80.747  1.00 82.45  ? 1   DA  D N1    1 
ATOM   16   C C2    . DA  A 1 1   ? -32.439 56.795 80.157  1.00 82.74  ? 1   DA  D C2    1 
ATOM   17   N N3    . DA  A 1 1   ? -33.161 56.358 79.125  1.00 84.52  ? 1   DA  D N3    1 
ATOM   18   C C4    . DA  A 1 1   ? -32.682 55.182 78.675  1.00 86.72  ? 1   DA  D C4    1 
ATOM   19   P P     . DT  A 1 2   ? -36.495 57.491 74.354  1.00 90.00  ? 2   DT  D P     1 
ATOM   20   O OP1   . DT  A 1 2   ? -37.822 58.045 74.742  1.00 89.42  ? 2   DT  D OP1   1 
ATOM   21   O OP2   . DT  A 1 2   ? -36.135 57.375 72.912  1.00 89.42  ? 2   DT  D OP2   1 
ATOM   22   O "O5'" . DT  A 1 2   ? -35.377 58.363 75.080  1.00 90.00  ? 2   DT  D "O5'" 1 
ATOM   23   C "C5'" . DT  A 1 2   ? -34.813 59.503 74.443  1.00 90.00  ? 2   DT  D "C5'" 1 
ATOM   24   C "C4'" . DT  A 1 2   ? -34.416 60.526 75.479  1.00 90.00  ? 2   DT  D "C4'" 1 
ATOM   25   O "O4'" . DT  A 1 2   ? -33.714 59.859 76.553  1.00 90.00  ? 2   DT  D "O4'" 1 
ATOM   26   C "C3'" . DT  A 1 2   ? -33.461 61.589 74.945  1.00 90.00  ? 2   DT  D "C3'" 1 
ATOM   27   O "O3'" . DT  A 1 2   ? -33.670 62.840 75.610  1.00 90.00  ? 2   DT  D "O3'" 1 
ATOM   28   C "C2'" . DT  A 1 2   ? -32.096 61.021 75.282  1.00 90.00  ? 2   DT  D "C2'" 1 
ATOM   29   C "C1'" . DT  A 1 2   ? -32.350 60.265 76.581  1.00 90.00  ? 2   DT  D "C1'" 1 
ATOM   30   N N1    . DT  A 1 2   ? -31.527 59.048 76.714  1.00 89.42  ? 2   DT  D N1    1 
ATOM   31   C C2    . DT  A 1 2   ? -30.686 58.930 77.806  1.00 89.42  ? 2   DT  D C2    1 
ATOM   32   O O2    . DT  A 1 2   ? -30.583 59.791 78.674  1.00 89.42  ? 2   DT  D O2    1 
ATOM   33   N N3    . DT  A 1 2   ? -29.963 57.757 77.842  1.00 89.42  ? 2   DT  D N3    1 
ATOM   34   C C4    . DT  A 1 2   ? -29.993 56.721 76.919  1.00 89.42  ? 2   DT  D C4    1 
ATOM   35   O O4    . DT  A 1 2   ? -29.286 55.725 77.092  1.00 89.42  ? 2   DT  D O4    1 
ATOM   36   C C5    . DT  A 1 2   ? -30.893 56.919 75.796  1.00 89.42  ? 2   DT  D C5    1 
ATOM   37   C C7    . DT  A 1 2   ? -30.984 55.863 74.739  1.00 89.42  ? 2   DT  D C7    1 
ATOM   38   C C6    . DT  A 1 2   ? -31.605 58.054 75.755  1.00 89.42  ? 2   DT  D C6    1 
ATOM   39   P P     . DC  A 1 3   ? -33.056 64.190 74.974  1.00 90.00  ? 3   DC  D P     1 
ATOM   40   O OP1   . DC  A 1 3   ? -34.186 65.054 74.511  1.00 90.00  ? 3   DC  D OP1   1 
ATOM   41   O OP2   . DC  A 1 3   ? -31.989 63.789 74.005  1.00 90.00  ? 3   DC  D OP2   1 
ATOM   42   O "O5'" . DC  A 1 3   ? -32.347 64.912 76.208  1.00 90.00  ? 3   DC  D "O5'" 1 
ATOM   43   C "C5'" . DC  A 1 3   ? -31.231 65.777 76.001  1.00 90.00  ? 3   DC  D "C5'" 1 
ATOM   44   C "C4'" . DC  A 1 3   ? -30.354 65.795 77.230  1.00 90.00  ? 3   DC  D "C4'" 1 
ATOM   45   O "O4'" . DC  A 1 3   ? -30.068 64.427 77.622  1.00 90.00  ? 3   DC  D "O4'" 1 
ATOM   46   C "C3'" . DC  A 1 3   ? -29.003 66.478 77.011  1.00 90.00  ? 3   DC  D "C3'" 1 
ATOM   47   O "O3'" . DC  A 1 3   ? -28.628 67.291 78.139  1.00 90.00  ? 3   DC  D "O3'" 1 
ATOM   48   C "C2'" . DC  A 1 3   ? -28.044 65.316 76.820  1.00 90.00  ? 3   DC  D "C2'" 1 
ATOM   49   C "C1'" . DC  A 1 3   ? -28.665 64.200 77.647  1.00 90.00  ? 3   DC  D "C1'" 1 
ATOM   50   N N1    . DC  A 1 3   ? -28.414 62.854 77.097  1.00 90.00  ? 3   DC  D N1    1 
ATOM   51   C C2    . DC  A 1 3   ? -27.541 61.988 77.783  1.00 90.00  ? 3   DC  D C2    1 
ATOM   52   O O2    . DC  A 1 3   ? -27.013 62.374 78.846  1.00 90.00  ? 3   DC  D O2    1 
ATOM   53   N N3    . DC  A 1 3   ? -27.297 60.755 77.267  1.00 90.00  ? 3   DC  D N3    1 
ATOM   54   C C4    . DC  A 1 3   ? -27.882 60.379 76.123  1.00 90.00  ? 3   DC  D C4    1 
ATOM   55   N N4    . DC  A 1 3   ? -27.605 59.160 75.646  1.00 90.00  ? 3   DC  D N4    1 
ATOM   56   C C5    . DC  A 1 3   ? -28.776 61.238 75.414  1.00 90.00  ? 3   DC  D C5    1 
ATOM   57   C C6    . DC  A 1 3   ? -29.012 62.452 75.933  1.00 90.00  ? 3   DC  D C6    1 
ATOM   58   P P     . DG  A 1 4   ? -28.380 68.879 77.936  1.00 90.00  ? 4   DG  D P     1 
ATOM   59   O OP1   . DG  A 1 4   ? -29.470 69.626 78.633  1.00 90.00  ? 4   DG  D OP1   1 
ATOM   60   O OP2   . DG  A 1 4   ? -28.133 69.119 76.481  1.00 90.00  ? 4   DG  D OP2   1 
ATOM   61   O "O5'" . DG  A 1 4   ? -27.012 69.179 78.699  1.00 90.00  ? 4   DG  D "O5'" 1 
ATOM   62   C "C5'" . DG  A 1 4   ? -26.007 69.977 78.080  1.00 90.00  ? 4   DG  D "C5'" 1 
ATOM   63   C "C4'" . DG  A 1 4   ? -24.653 69.333 78.254  1.00 90.00  ? 4   DG  D "C4'" 1 
ATOM   64   O "O4'" . DG  A 1 4   ? -24.761 67.899 78.061  1.00 90.00  ? 4   DG  D "O4'" 1 
ATOM   65   C "C3'" . DG  A 1 4   ? -23.613 69.814 77.245  1.00 90.00  ? 4   DG  D "C3'" 1 
ATOM   66   O "O3'" . DG  A 1 4   ? -22.331 69.882 77.886  1.00 90.00  ? 4   DG  D "O3'" 1 
ATOM   67   C "C2'" . DG  A 1 4   ? -23.662 68.742 76.170  1.00 90.00  ? 4   DG  D "C2'" 1 
ATOM   68   C "C1'" . DG  A 1 4   ? -23.910 67.494 76.999  1.00 90.00  ? 4   DG  D "C1'" 1 
ATOM   69   N N9    . DG  A 1 4   ? -24.558 66.403 76.278  1.00 90.00  ? 4   DG  D N9    1 
ATOM   70   C C8    . DG  A 1 4   ? -25.525 66.507 75.306  1.00 90.00  ? 4   DG  D C8    1 
ATOM   71   N N7    . DG  A 1 4   ? -25.895 65.350 74.824  1.00 89.66  ? 4   DG  D N7    1 
ATOM   72   C C5    . DG  A 1 4   ? -25.128 64.425 75.522  1.00 89.12  ? 4   DG  D C5    1 
ATOM   73   C C6    . DG  A 1 4   ? -25.079 63.003 75.426  1.00 87.97  ? 4   DG  D C6    1 
ATOM   74   O O6    . DG  A 1 4   ? -25.728 62.253 74.676  1.00 86.33  ? 4   DG  D O6    1 
ATOM   75   N N1    . DG  A 1 4   ? -24.156 62.464 76.318  1.00 86.99  ? 4   DG  D N1    1 
ATOM   76   C C2    . DG  A 1 4   ? -23.376 63.192 77.187  1.00 87.81  ? 4   DG  D C2    1 
ATOM   77   N N2    . DG  A 1 4   ? -22.538 62.487 77.964  1.00 87.93  ? 4   DG  D N2    1 
ATOM   78   N N3    . DG  A 1 4   ? -23.412 64.513 77.285  1.00 88.44  ? 4   DG  D N3    1 
ATOM   79   C C4    . DG  A 1 4   ? -24.302 65.059 76.429  1.00 89.44  ? 4   DG  D C4    1 
ATOM   80   P P     . DA  A 1 5   ? -21.017 69.346 77.121  1.00 90.00  ? 5   DA  D P     1 
ATOM   81   O OP1   . DA  A 1 5   ? -19.849 69.678 77.990  1.00 90.00  ? 5   DA  D OP1   1 
ATOM   82   O OP2   . DA  A 1 5   ? -21.040 69.824 75.706  1.00 90.00  ? 5   DA  D OP2   1 
ATOM   83   O "O5'" . DA  A 1 5   ? -21.210 67.759 77.113  1.00 90.00  ? 5   DA  D "O5'" 1 
ATOM   84   C "C5'" . DA  A 1 5   ? -20.866 66.964 78.251  1.00 90.00  ? 5   DA  D "C5'" 1 
ATOM   85   C "C4'" . DA  A 1 5   ? -19.827 65.945 77.853  1.00 90.00  ? 5   DA  D "C4'" 1 
ATOM   86   O "O4'" . DA  A 1 5   ? -20.437 64.893 77.068  1.00 90.00  ? 5   DA  D "O4'" 1 
ATOM   87   C "C3'" . DA  A 1 5   ? -18.753 66.559 76.960  1.00 90.00  ? 5   DA  D "C3'" 1 
ATOM   88   O "O3'" . DA  A 1 5   ? -17.485 65.965 77.217  1.00 90.00  ? 5   DA  D "O3'" 1 
ATOM   89   C "C2'" . DA  A 1 5   ? -19.226 66.221 75.560  1.00 90.00  ? 5   DA  D "C2'" 1 
ATOM   90   C "C1'" . DA  A 1 5   ? -19.873 64.865 75.762  1.00 90.00  ? 5   DA  D "C1'" 1 
ATOM   91   N N9    . DA  A 1 5   ? -20.951 64.568 74.818  1.00 77.69  ? 5   DA  D N9    1 
ATOM   92   C C8    . DA  A 1 5   ? -21.921 65.423 74.344  1.00 75.06  ? 5   DA  D C8    1 
ATOM   93   N N7    . DA  A 1 5   ? -22.773 64.853 73.522  1.00 72.82  ? 5   DA  D N7    1 
ATOM   94   C C5    . DA  A 1 5   ? -22.331 63.537 73.441  1.00 72.60  ? 5   DA  D C5    1 
ATOM   95   C C6    . DA  A 1 5   ? -22.808 62.417 72.725  1.00 71.15  ? 5   DA  D C6    1 
ATOM   96   N N6    . DA  A 1 5   ? -23.884 62.446 71.934  1.00 69.41  ? 5   DA  D N6    1 
ATOM   97   N N1    . DA  A 1 5   ? -22.129 61.250 72.856  1.00 70.86  ? 5   DA  D N1    1 
ATOM   98   C C2    . DA  A 1 5   ? -21.046 61.221 73.655  1.00 71.83  ? 5   DA  D C2    1 
ATOM   99   N N3    . DA  A 1 5   ? -20.504 62.204 74.381  1.00 73.14  ? 5   DA  D N3    1 
ATOM   100  C C4    . DA  A 1 5   ? -21.203 63.349 74.229  1.00 74.69  ? 5   DA  D C4    1 
ATOM   101  P P     . DT  A 1 6   ? -16.144 66.773 76.846  1.00 90.00  ? 6   DT  D P     1 
ATOM   102  O OP1   . DT  A 1 6   ? -15.551 67.312 78.108  1.00 90.00  ? 6   DT  D OP1   1 
ATOM   103  O OP2   . DT  A 1 6   ? -16.480 67.709 75.729  1.00 90.00  ? 6   DT  D OP2   1 
ATOM   104  O "O5'" . DT  A 1 6   ? -15.177 65.636 76.282  1.00 90.00  ? 6   DT  D "O5'" 1 
ATOM   105  C "C5'" . DT  A 1 6   ? -15.203 64.315 76.824  1.00 90.00  ? 6   DT  D "C5'" 1 
ATOM   106  C "C4'" . DT  A 1 6   ? -15.149 63.296 75.710  1.00 90.00  ? 6   DT  D "C4'" 1 
ATOM   107  O "O4'" . DT  A 1 6   ? -16.437 63.206 75.035  1.00 90.00  ? 6   DT  D "O4'" 1 
ATOM   108  C "C3'" . DT  A 1 6   ? -14.118 63.619 74.620  1.00 90.00  ? 6   DT  D "C3'" 1 
ATOM   109  O "O3'" . DT  A 1 6   ? -13.404 62.433 74.231  1.00 90.00  ? 6   DT  D "O3'" 1 
ATOM   110  C "C2'" . DT  A 1 6   ? -14.977 64.129 73.476  1.00 90.00  ? 6   DT  D "C2'" 1 
ATOM   111  C "C1'" . DT  A 1 6   ? -16.206 63.257 73.633  1.00 90.00  ? 6   DT  D "C1'" 1 
ATOM   112  N N1    . DT  A 1 6   ? -17.412 63.769 72.949  1.00 78.95  ? 6   DT  D N1    1 
ATOM   113  C C2    . DT  A 1 6   ? -18.168 62.873 72.216  1.00 76.60  ? 6   DT  D C2    1 
ATOM   114  O O2    . DT  A 1 6   ? -17.934 61.674 72.174  1.00 74.61  ? 6   DT  D O2    1 
ATOM   115  N N3    . DT  A 1 6   ? -19.219 63.436 71.533  1.00 75.09  ? 6   DT  D N3    1 
ATOM   116  C C4    . DT  A 1 6   ? -19.592 64.769 71.521  1.00 74.50  ? 6   DT  D C4    1 
ATOM   117  O O4    . DT  A 1 6   ? -20.549 65.132 70.832  1.00 72.38  ? 6   DT  D O4    1 
ATOM   118  C C5    . DT  A 1 6   ? -18.782 65.643 72.349  1.00 75.37  ? 6   DT  D C5    1 
ATOM   119  C C7    . DT  A 1 6   ? -19.134 67.095 72.431  1.00 74.67  ? 6   DT  D C7    1 
ATOM   120  C C6    . DT  A 1 6   ? -17.747 65.105 73.011  1.00 76.43  ? 6   DT  D C6    1 
ATOM   121  P P     . DC  A 1 7   ? -13.075 62.162 72.674  1.00 90.00  ? 7   DC  D P     1 
ATOM   122  O OP1   . DC  A 1 7   ? -11.987 61.147 72.616  1.00 81.08  ? 7   DC  D OP1   1 
ATOM   123  O OP2   . DC  A 1 7   ? -12.903 63.457 71.955  1.00 81.08  ? 7   DC  D OP2   1 
ATOM   124  O "O5'" . DC  A 1 7   ? -14.407 61.467 72.140  1.00 90.00  ? 7   DC  D "O5'" 1 
ATOM   125  C "C5'" . DC  A 1 7   ? -14.660 60.083 72.389  1.00 90.00  ? 7   DC  D "C5'" 1 
ATOM   126  C "C4'" . DC  A 1 7   ? -14.520 59.309 71.101  1.00 90.00  ? 7   DC  D "C4'" 1 
ATOM   127  O "O4'" . DC  A 1 7   ? -15.574 59.723 70.203  1.00 90.00  ? 7   DC  D "O4'" 1 
ATOM   128  C "C3'" . DC  A 1 7   ? -13.217 59.630 70.380  1.00 90.00  ? 7   DC  D "C3'" 1 
ATOM   129  O "O3'" . DC  A 1 7   ? -12.763 58.511 69.629  1.00 90.00  ? 7   DC  D "O3'" 1 
ATOM   130  C "C2'" . DC  A 1 7   ? -13.596 60.772 69.460  1.00 90.00  ? 7   DC  D "C2'" 1 
ATOM   131  C "C1'" . DC  A 1 7   ? -15.045 60.476 69.121  1.00 88.97  ? 7   DC  D "C1'" 1 
ATOM   132  N N1    . DC  A 1 7   ? -15.866 61.688 68.984  1.00 58.57  ? 7   DC  D N1    1 
ATOM   133  C C2    . DC  A 1 7   ? -17.017 61.626 68.206  1.00 55.96  ? 7   DC  D C2    1 
ATOM   134  O O2    . DC  A 1 7   ? -17.313 60.545 67.670  1.00 53.58  ? 7   DC  D O2    1 
ATOM   135  N N3    . DC  A 1 7   ? -17.776 62.741 68.055  1.00 55.18  ? 7   DC  D N3    1 
ATOM   136  C C4    . DC  A 1 7   ? -17.414 63.884 68.653  1.00 55.42  ? 7   DC  D C4    1 
ATOM   137  N N4    . DC  A 1 7   ? -18.183 64.969 68.464  1.00 55.78  ? 7   DC  D N4    1 
ATOM   138  C C5    . DC  A 1 7   ? -16.246 63.969 69.467  1.00 55.05  ? 7   DC  D C5    1 
ATOM   139  C C6    . DC  A 1 7   ? -15.509 62.858 69.604  1.00 56.08  ? 7   DC  D C6    1 
ATOM   140  P P     . DG  A 1 8   ? -11.417 58.636 68.762  1.00 90.00  ? 8   DG  D P     1 
ATOM   141  O OP1   . DG  A 1 8   ? -10.485 57.578 69.244  1.00 83.71  ? 8   DG  D OP1   1 
ATOM   142  O OP2   . DG  A 1 8   ? -10.973 60.062 68.757  1.00 83.71  ? 8   DG  D OP2   1 
ATOM   143  O "O5'" . DG  A 1 8   ? -11.907 58.250 67.300  1.00 90.00  ? 8   DG  D "O5'" 1 
ATOM   144  C "C5'" . DG  A 1 8   ? -12.800 57.166 67.117  1.00 90.00  ? 8   DG  D "C5'" 1 
ATOM   145  C "C4'" . DG  A 1 8   ? -13.523 57.310 65.803  1.00 90.00  ? 8   DG  D "C4'" 1 
ATOM   146  O "O4'" . DG  A 1 8   ? -14.461 58.414 65.869  1.00 90.00  ? 8   DG  D "O4'" 1 
ATOM   147  C "C3'" . DG  A 1 8   ? -12.622 57.586 64.597  1.00 90.00  ? 8   DG  D "C3'" 1 
ATOM   148  O "O3'" . DG  A 1 8   ? -13.008 56.705 63.522  1.00 90.00  ? 8   DG  D "O3'" 1 
ATOM   149  C "C2'" . DG  A 1 8   ? -12.852 59.061 64.312  1.00 90.00  ? 8   DG  D "C2'" 1 
ATOM   150  C "C1'" . DG  A 1 8   ? -14.301 59.225 64.714  1.00 89.17  ? 8   DG  D "C1'" 1 
ATOM   151  N N9    . DG  A 1 8   ? -14.725 60.584 65.041  1.00 60.80  ? 8   DG  D N9    1 
ATOM   152  C C8    . DG  A 1 8   ? -14.169 61.439 65.968  1.00 58.78  ? 8   DG  D C8    1 
ATOM   153  N N7    . DG  A 1 8   ? -14.805 62.578 66.062  1.00 55.77  ? 8   DG  D N7    1 
ATOM   154  C C5    . DG  A 1 8   ? -15.840 62.474 65.137  1.00 54.44  ? 8   DG  D C5    1 
ATOM   155  C C6    . DG  A 1 8   ? -16.881 63.392 64.803  1.00 52.07  ? 8   DG  D C6    1 
ATOM   156  O O6    . DG  A 1 8   ? -17.111 64.513 65.290  1.00 49.34  ? 8   DG  D O6    1 
ATOM   157  N N1    . DG  A 1 8   ? -17.706 62.885 63.800  1.00 50.38  ? 8   DG  D N1    1 
ATOM   158  C C2    . DG  A 1 8   ? -17.559 61.655 63.198  1.00 51.96  ? 8   DG  D C2    1 
ATOM   159  N N2    . DG  A 1 8   ? -18.445 61.353 62.234  1.00 51.51  ? 8   DG  D N2    1 
ATOM   160  N N3    . DG  A 1 8   ? -16.611 60.786 63.514  1.00 53.53  ? 8   DG  D N3    1 
ATOM   161  C C4    . DG  A 1 8   ? -15.792 61.258 64.484  1.00 56.30  ? 8   DG  D C4    1 
ATOM   162  P P     . DA  A 1 9   ? -13.234 57.268 62.025  1.00 90.00  ? 9   DA  D P     1 
ATOM   163  O OP1   . DA  A 1 9   ? -14.576 57.925 62.019  1.00 73.21  ? 9   DA  D OP1   1 
ATOM   164  O OP2   . DA  A 1 9   ? -12.948 56.175 61.045  1.00 72.44  ? 9   DA  D OP2   1 
ATOM   165  O "O5'" . DA  A 1 9   ? -12.123 58.395 61.830  1.00 90.00  ? 9   DA  D "O5'" 1 
ATOM   166  C "C5'" . DA  A 1 9   ? -11.928 58.990 60.550  1.00 90.00  ? 9   DA  D "C5'" 1 
ATOM   167  C "C4'" . DA  A 1 9   ? -13.242 59.049 59.805  1.00 90.00  ? 9   DA  D "C4'" 1 
ATOM   168  O "O4'" . DA  A 1 9   ? -14.235 59.746 60.597  1.00 90.00  ? 9   DA  D "O4'" 1 
ATOM   169  C "C3'" . DA  A 1 9   ? -13.170 59.787 58.477  1.00 90.00  ? 9   DA  D "C3'" 1 
ATOM   170  O "O3'" . DA  A 1 9   ? -14.025 59.174 57.521  1.00 90.00  ? 9   DA  D "O3'" 1 
ATOM   171  C "C2'" . DA  A 1 9   ? -13.674 61.173 58.816  1.00 90.00  ? 9   DA  D "C2'" 1 
ATOM   172  C "C1'" . DA  A 1 9   ? -14.666 60.923 59.939  1.00 90.00  ? 9   DA  D "C1'" 1 
ATOM   173  N N9    . DA  A 1 9   ? -14.629 62.011 60.910  1.00 43.51  ? 9   DA  D N9    1 
ATOM   174  C C8    . DA  A 1 9   ? -13.684 62.241 61.886  1.00 40.67  ? 9   DA  D C8    1 
ATOM   175  N N7    . DA  A 1 9   ? -13.873 63.354 62.552  1.00 37.85  ? 9   DA  D N7    1 
ATOM   176  C C5    . DA  A 1 9   ? -15.031 63.885 61.990  1.00 37.65  ? 9   DA  D C5    1 
ATOM   177  C C6    . DA  A 1 9   ? -15.752 65.074 62.240  1.00 35.85  ? 9   DA  D C6    1 
ATOM   178  N N6    . DA  A 1 9   ? -15.380 65.991 63.141  1.00 33.00  ? 9   DA  D N6    1 
ATOM   179  N N1    . DA  A 1 9   ? -16.873 65.294 61.511  1.00 35.09  ? 9   DA  D N1    1 
ATOM   180  C C2    . DA  A 1 9   ? -17.226 64.386 60.586  1.00 36.03  ? 9   DA  D C2    1 
ATOM   181  N N3    . DA  A 1 9   ? -16.622 63.244 60.248  1.00 37.57  ? 9   DA  D N3    1 
ATOM   182  C C4    . DA  A 1 9   ? -15.519 63.052 60.995  1.00 39.48  ? 9   DA  D C4    1 
ATOM   183  P P     . DT  A 1 10  ? -13.978 59.676 56.002  1.00 84.40  ? 10  DT  D P     1 
ATOM   184  O OP1   . DT  A 1 10  ? -13.848 58.490 55.110  1.00 70.47  ? 10  DT  D OP1   1 
ATOM   185  O OP2   . DT  A 1 10  ? -12.945 60.750 55.957  1.00 69.63  ? 10  DT  D OP2   1 
ATOM   186  O "O5'" . DT  A 1 10  ? -15.416 60.327 55.772  1.00 81.19  ? 10  DT  D "O5'" 1 
ATOM   187  C "C5'" . DT  A 1 10  ? -15.862 61.416 56.577  1.00 74.41  ? 10  DT  D "C5'" 1 
ATOM   188  C "C4'" . DT  A 1 10  ? -16.077 62.635 55.716  1.00 68.59  ? 10  DT  D "C4'" 1 
ATOM   189  O "O4'" . DT  A 1 10  ? -16.154 63.777 56.598  1.00 64.47  ? 10  DT  D "O4'" 1 
ATOM   190  C "C3'" . DT  A 1 10  ? -14.889 62.895 54.795  1.00 66.43  ? 10  DT  D "C3'" 1 
ATOM   191  O "O3'" . DT  A 1 10  ? -15.279 63.482 53.555  1.00 66.68  ? 10  DT  D "O3'" 1 
ATOM   192  C "C2'" . DT  A 1 10  ? -14.034 63.860 55.577  1.00 64.53  ? 10  DT  D "C2'" 1 
ATOM   193  C "C1'" . DT  A 1 10  ? -15.051 64.635 56.387  1.00 61.08  ? 10  DT  D "C1'" 1 
ATOM   194  N N1    . DT  A 1 10  ? -14.500 65.004 57.691  1.00 42.76  ? 10  DT  D N1    1 
ATOM   195  C C2    . DT  A 1 10  ? -15.051 66.065 58.361  1.00 41.27  ? 10  DT  D C2    1 
ATOM   196  O O2    . DT  A 1 10  ? -16.061 66.641 57.984  1.00 40.57  ? 10  DT  D O2    1 
ATOM   197  N N3    . DT  A 1 10  ? -14.373 66.426 59.501  1.00 40.24  ? 10  DT  D N3    1 
ATOM   198  C C4    . DT  A 1 10  ? -13.234 65.830 60.026  1.00 39.58  ? 10  DT  D C4    1 
ATOM   199  O O4    . DT  A 1 10  ? -12.691 66.307 61.025  1.00 40.25  ? 10  DT  D O4    1 
ATOM   200  C C5    . DT  A 1 10  ? -12.762 64.673 59.311  1.00 39.67  ? 10  DT  D C5    1 
ATOM   201  C C7    . DT  A 1 10  ? -11.579 63.925 59.840  1.00 39.69  ? 10  DT  D C7    1 
ATOM   202  C C6    . DT  A 1 10  ? -13.411 64.320 58.196  1.00 41.08  ? 10  DT  D C6    1 
ATOM   203  P P     . DA  A 1 11  ? -14.145 63.890 52.490  1.00 67.95  ? 11  DA  D P     1 
ATOM   204  O OP1   . DA  A 1 11  ? -14.731 63.906 51.126  1.00 56.14  ? 11  DA  D OP1   1 
ATOM   205  O OP2   . DA  A 1 11  ? -12.948 63.053 52.766  1.00 55.42  ? 11  DA  D OP2   1 
ATOM   206  O "O5'" . DA  A 1 11  ? -13.777 65.386 52.893  1.00 64.97  ? 11  DA  D "O5'" 1 
ATOM   207  C "C5'" . DA  A 1 11  ? -14.588 66.479 52.470  1.00 57.69  ? 11  DA  D "C5'" 1 
ATOM   208  C "C4'" . DA  A 1 11  ? -13.761 67.741 52.394  1.00 52.18  ? 11  DA  D "C4'" 1 
ATOM   209  O "O4'" . DA  A 1 11  ? -13.483 68.250 53.721  1.00 50.64  ? 11  DA  D "O4'" 1 
ATOM   210  C "C3'" . DA  A 1 11  ? -12.405 67.570 51.713  1.00 49.58  ? 11  DA  D "C3'" 1 
ATOM   211  O "O3'" . DA  A 1 11  ? -12.141 68.698 50.890  1.00 47.68  ? 11  DA  D "O3'" 1 
ATOM   212  C "C2'" . DA  A 1 11  ? -11.424 67.546 52.869  1.00 49.43  ? 11  DA  D "C2'" 1 
ATOM   213  C "C1'" . DA  A 1 11  ? -12.088 68.469 53.872  1.00 47.86  ? 11  DA  D "C1'" 1 
ATOM   214  N N9    . DA  A 1 11  ? -11.742 68.193 55.267  1.00 32.61  ? 11  DA  D N9    1 
ATOM   215  C C8    . DA  A 1 11  ? -11.805 66.985 55.915  1.00 31.58  ? 11  DA  D C8    1 
ATOM   216  N N7    . DA  A 1 11  ? -11.439 67.038 57.173  1.00 30.43  ? 11  DA  D N7    1 
ATOM   217  C C5    . DA  A 1 11  ? -11.113 68.370 57.368  1.00 29.91  ? 11  DA  D C5    1 
ATOM   218  C C6    . DA  A 1 11  ? -10.649 69.066 58.491  1.00 30.16  ? 11  DA  D C6    1 
ATOM   219  N N6    . DA  A 1 11  ? -10.431 68.491 59.680  1.00 26.40  ? 11  DA  D N6    1 
ATOM   220  N N1    . DA  A 1 11  ? -10.411 70.391 58.351  1.00 30.76  ? 11  DA  D N1    1 
ATOM   221  C C2    . DA  A 1 11  ? -10.627 70.960 57.154  1.00 29.55  ? 11  DA  D C2    1 
ATOM   222  N N3    . DA  A 1 11  ? -11.061 70.408 56.027  1.00 29.13  ? 11  DA  D N3    1 
ATOM   223  C C4    . DA  A 1 11  ? -11.289 69.095 56.202  1.00 30.83  ? 11  DA  D C4    1 
ATOM   224  P P     . DT  A 1 12  ? -11.001 68.608 49.766  1.00 33.82  ? 12  DT  D P     1 
ATOM   225  O OP1   . DT  A 1 12  ? -11.633 68.574 48.421  1.00 37.87  ? 12  DT  D OP1   1 
ATOM   226  O OP2   . DT  A 1 12  ? -10.079 67.522 50.174  1.00 34.27  ? 12  DT  D OP2   1 
ATOM   227  O "O5'" . DT  A 1 12  ? -10.268 70.011 49.902  1.00 33.16  ? 12  DT  D "O5'" 1 
ATOM   228  C "C5'" . DT  A 1 12  ? -10.068 70.589 51.179  1.00 29.76  ? 12  DT  D "C5'" 1 
ATOM   229  C "C4'" . DT  A 1 12  ? -8.777  71.359 51.172  1.00 28.73  ? 12  DT  D "C4'" 1 
ATOM   230  O "O4'" . DT  A 1 12  ? -8.471  71.671 52.549  1.00 26.53  ? 12  DT  D "O4'" 1 
ATOM   231  C "C3'" . DT  A 1 12  ? -7.618  70.516 50.644  1.00 27.95  ? 12  DT  D "C3'" 1 
ATOM   232  O "O3'" . DT  A 1 12  ? -6.848  71.214 49.673  1.00 27.92  ? 12  DT  D "O3'" 1 
ATOM   233  C "C2'" . DT  A 1 12  ? -6.793  70.179 51.871  1.00 27.62  ? 12  DT  D "C2'" 1 
ATOM   234  C "C1'" . DT  A 1 12  ? -7.179  71.230 52.892  1.00 23.44  ? 12  DT  D "C1'" 1 
ATOM   235  N N1    . DT  A 1 12  ? -7.260  70.670 54.239  1.00 24.90  ? 12  DT  D N1    1 
ATOM   236  C C2    . DT  A 1 12  ? -6.969  71.481 55.316  1.00 24.89  ? 12  DT  D C2    1 
ATOM   237  O O2    . DT  A 1 12  ? -6.716  72.671 55.212  1.00 24.87  ? 12  DT  D O2    1 
ATOM   238  N N3    . DT  A 1 12  ? -6.999  70.841 56.533  1.00 24.53  ? 12  DT  D N3    1 
ATOM   239  C C4    . DT  A 1 12  ? -7.302  69.516 56.773  1.00 23.11  ? 12  DT  D C4    1 
ATOM   240  O O4    . DT  A 1 12  ? -7.259  69.084 57.915  1.00 25.23  ? 12  DT  D O4    1 
ATOM   241  C C5    . DT  A 1 12  ? -7.644  68.737 55.600  1.00 21.54  ? 12  DT  D C5    1 
ATOM   242  C C7    . DT  A 1 12  ? -8.029  67.302 55.762  1.00 20.30  ? 12  DT  D C7    1 
ATOM   243  C C6    . DT  A 1 12  ? -7.602  69.345 54.410  1.00 22.78  ? 12  DT  D C6    1 
ATOM   244  P P     . DA  A 1 13  ? -5.871  70.390 48.691  1.00 28.89  ? 13  DA  D P     1 
ATOM   245  O OP1   . DA  A 1 13  ? -6.191  70.720 47.284  1.00 29.20  ? 13  DA  D OP1   1 
ATOM   246  O OP2   . DA  A 1 13  ? -5.845  68.975 49.119  1.00 30.49  ? 13  DA  D OP2   1 
ATOM   247  O "O5'" . DA  A 1 13  ? -4.447  71.001 49.033  1.00 27.21  ? 13  DA  D "O5'" 1 
ATOM   248  C "C5'" . DA  A 1 13  ? -4.275  72.411 49.159  1.00 24.73  ? 13  DA  D "C5'" 1 
ATOM   249  C "C4'" . DA  A 1 13  ? -2.906  72.695 49.715  1.00 23.22  ? 13  DA  D "C4'" 1 
ATOM   250  O "O4'" . DA  A 1 13  ? -2.967  72.594 51.155  1.00 21.76  ? 13  DA  D "O4'" 1 
ATOM   251  C "C3'" . DA  A 1 13  ? -1.949  71.613 49.244  1.00 24.40  ? 13  DA  D "C3'" 1 
ATOM   252  O "O3'" . DA  A 1 13  ? -0.852  72.078 48.499  1.00 29.15  ? 13  DA  D "O3'" 1 
ATOM   253  C "C2'" . DA  A 1 13  ? -1.493  70.890 50.492  1.00 24.28  ? 13  DA  D "C2'" 1 
ATOM   254  C "C1'" . DA  A 1 13  ? -1.991  71.704 51.660  1.00 21.27  ? 13  DA  D "C1'" 1 
ATOM   255  N N9    . DA  A 1 13  ? -2.640  70.819 52.630  1.00 21.56  ? 13  DA  D N9    1 
ATOM   256  C C8    . DA  A 1 13  ? -3.071  69.543 52.368  1.00 21.22  ? 13  DA  D C8    1 
ATOM   257  N N7    . DA  A 1 13  ? -3.549  68.916 53.412  1.00 21.25  ? 13  DA  D N7    1 
ATOM   258  C C5    . DA  A 1 13  ? -3.446  69.846 54.433  1.00 21.07  ? 13  DA  D C5    1 
ATOM   259  C C6    . DA  A 1 13  ? -3.776  69.783 55.802  1.00 22.22  ? 13  DA  D C6    1 
ATOM   260  N N6    . DA  A 1 13  ? -4.273  68.692 56.391  1.00 18.83  ? 13  DA  D N6    1 
ATOM   261  N N1    . DA  A 1 13  ? -3.563  70.887 56.553  1.00 21.93  ? 13  DA  D N1    1 
ATOM   262  C C2    . DA  A 1 13  ? -3.043  71.972 55.959  1.00 22.98  ? 13  DA  D C2    1 
ATOM   263  N N3    . DA  A 1 13  ? -2.678  72.149 54.682  1.00 23.43  ? 13  DA  D N3    1 
ATOM   264  C C4    . DA  A 1 13  ? -2.907  71.033 53.963  1.00 22.13  ? 13  DA  D C4    1 
ATOM   265  P P     . DA  A 1 14  ? 0.003   71.012 47.663  1.00 33.93  ? 14  DA  D P     1 
ATOM   266  O OP1   . DA  A 1 14  ? 0.669   71.701 46.531  1.00 34.30  ? 14  DA  D OP1   1 
ATOM   267  O OP2   . DA  A 1 14  ? -0.849  69.825 47.404  1.00 30.07  ? 14  DA  D OP2   1 
ATOM   268  O "O5'" . DA  A 1 14  ? 1.106   70.599 48.720  1.00 30.86  ? 14  DA  D "O5'" 1 
ATOM   269  C "C5'" . DA  A 1 14  ? 1.816   71.598 49.442  1.00 30.21  ? 14  DA  D "C5'" 1 
ATOM   270  C "C4'" . DA  A 1 14  ? 2.934   70.937 50.193  1.00 29.31  ? 14  DA  D "C4'" 1 
ATOM   271  O "O4'" . DA  A 1 14  ? 2.462   70.538 51.505  1.00 29.36  ? 14  DA  D "O4'" 1 
ATOM   272  C "C3'" . DA  A 1 14  ? 3.263   69.660 49.435  1.00 30.19  ? 14  DA  D "C3'" 1 
ATOM   273  O "O3'" . DA  A 1 14  ? 4.636   69.461 49.233  1.00 30.95  ? 14  DA  D "O3'" 1 
ATOM   274  C "C2'" . DA  A 1 14  ? 2.696   68.551 50.288  1.00 31.68  ? 14  DA  D "C2'" 1 
ATOM   275  C "C1'" . DA  A 1 14  ? 2.603   69.143 51.676  1.00 28.61  ? 14  DA  D "C1'" 1 
ATOM   276  N N9    . DA  A 1 14  ? 1.406   68.631 52.340  1.00 26.88  ? 14  DA  D N9    1 
ATOM   277  C C8    . DA  A 1 14  ? 0.440   67.848 51.750  1.00 25.67  ? 14  DA  D C8    1 
ATOM   278  N N7    . DA  A 1 14  ? -0.484  67.433 52.576  1.00 27.68  ? 14  DA  D N7    1 
ATOM   279  C C5    . DA  A 1 14  ? -0.123  67.999 53.791  1.00 28.31  ? 14  DA  D C5    1 
ATOM   280  C C6    . DA  A 1 14  ? -0.703  67.933 55.071  1.00 28.90  ? 14  DA  D C6    1 
ATOM   281  N N6    . DA  A 1 14  ? -1.810  67.233 55.343  1.00 28.84  ? 14  DA  D N6    1 
ATOM   282  N N1    . DA  A 1 14  ? -0.099  68.619 56.072  1.00 28.17  ? 14  DA  D N1    1 
ATOM   283  C C2    . DA  A 1 14  ? 1.010   69.318 55.790  1.00 27.36  ? 14  DA  D C2    1 
ATOM   284  N N3    . DA  A 1 14  ? 1.653   69.455 54.626  1.00 27.88  ? 14  DA  D N3    1 
ATOM   285  C C4    . DA  A 1 14  ? 1.029   68.761 53.655  1.00 27.63  ? 14  DA  D C4    1 
ATOM   286  P P     . DA  A 1 15  ? 5.115   68.346 48.190  1.00 27.99  ? 15  DA  D P     1 
ATOM   287  O OP1   . DA  A 1 15  ? 5.675   69.042 47.004  1.00 28.64  ? 15  DA  D OP1   1 
ATOM   288  O OP2   . DA  A 1 15  ? 4.033   67.344 48.003  1.00 20.21  ? 15  DA  D OP2   1 
ATOM   289  O "O5'" . DA  A 1 15  ? 6.314   67.707 49.003  1.00 27.66  ? 15  DA  D "O5'" 1 
ATOM   290  C "C5'" . DA  A 1 15  ? 7.171   68.557 49.756  1.00 29.46  ? 15  DA  D "C5'" 1 
ATOM   291  C "C4'" . DA  A 1 15  ? 7.847   67.776 50.852  1.00 30.57  ? 15  DA  D "C4'" 1 
ATOM   292  O "O4'" . DA  A 1 15  ? 6.949   67.653 51.981  1.00 31.44  ? 15  DA  D "O4'" 1 
ATOM   293  C "C3'" . DA  A 1 15  ? 8.207   66.364 50.405  1.00 30.13  ? 15  DA  D "C3'" 1 
ATOM   294  O "O3'" . DA  A 1 15  ? 9.573   66.056 50.609  1.00 33.42  ? 15  DA  D "O3'" 1 
ATOM   295  C "C2'" . DA  A 1 15  ? 7.322   65.453 51.228  1.00 29.89  ? 15  DA  D "C2'" 1 
ATOM   296  C "C1'" . DA  A 1 15  ? 6.802   66.304 52.371  1.00 27.38  ? 15  DA  D "C1'" 1 
ATOM   297  N N9    . DA  A 1 15  ? 5.377   66.037 52.523  1.00 22.84  ? 15  DA  D N9    1 
ATOM   298  C C8    . DA  A 1 15  ? 4.547   65.579 51.526  1.00 20.53  ? 15  DA  D C8    1 
ATOM   299  N N7    . DA  A 1 15  ? 3.348   65.263 51.941  1.00 21.32  ? 15  DA  D N7    1 
ATOM   300  C C5    . DA  A 1 15  ? 3.377   65.560 53.298  1.00 21.48  ? 15  DA  D C5    1 
ATOM   301  C C6    . DA  A 1 15  ? 2.427   65.402 54.314  1.00 22.13  ? 15  DA  D C6    1 
ATOM   302  N N6    . DA  A 1 15  ? 1.229   64.845 54.117  1.00 19.75  ? 15  DA  D N6    1 
ATOM   303  N N1    . DA  A 1 15  ? 2.760   65.821 55.560  1.00 23.96  ? 15  DA  D N1    1 
ATOM   304  C C2    . DA  A 1 15  ? 3.979   66.340 55.756  1.00 22.32  ? 15  DA  D C2    1 
ATOM   305  N N3    . DA  A 1 15  ? 4.972   66.513 54.882  1.00 22.47  ? 15  DA  D N3    1 
ATOM   306  C C4    . DA  A 1 15  ? 4.605   66.092 53.658  1.00 21.35  ? 15  DA  D C4    1 
ATOM   307  P P     . DA  A 1 16  ? 10.216  64.811 49.827  1.00 39.15  ? 16  DA  D P     1 
ATOM   308  O OP1   . DA  A 1 16  ? 11.533  65.233 49.289  1.00 33.40  ? 16  DA  D OP1   1 
ATOM   309  O OP2   . DA  A 1 16  ? 9.194   64.239 48.908  1.00 29.28  ? 16  DA  D OP2   1 
ATOM   310  O "O5'" . DA  A 1 16  ? 10.446  63.770 51.000  1.00 36.23  ? 16  DA  D "O5'" 1 
ATOM   311  C "C5'" . DA  A 1 16  ? 10.864  64.202 52.290  1.00 37.06  ? 16  DA  D "C5'" 1 
ATOM   312  C "C4'" . DA  A 1 16  ? 10.785  63.039 53.243  1.00 38.26  ? 16  DA  D "C4'" 1 
ATOM   313  O "O4'" . DA  A 1 16  ? 9.439   62.983 53.788  1.00 36.16  ? 16  DA  D "O4'" 1 
ATOM   314  C "C3'" . DA  A 1 16  ? 10.993  61.747 52.457  1.00 39.76  ? 16  DA  D "C3'" 1 
ATOM   315  O "O3'" . DA  A 1 16  ? 12.072  60.923 52.884  1.00 42.25  ? 16  DA  D "O3'" 1 
ATOM   316  C "C2'" . DA  A 1 16  ? 9.657   61.029 52.498  1.00 37.84  ? 16  DA  D "C2'" 1 
ATOM   317  C "C1'" . DA  A 1 16  ? 8.875   61.694 53.614  1.00 33.16  ? 16  DA  D "C1'" 1 
ATOM   318  N N9    . DA  A 1 16  ? 7.471   61.845 53.225  1.00 23.99  ? 16  DA  D N9    1 
ATOM   319  C C8    . DA  A 1 16  ? 6.983   61.666 51.957  1.00 23.07  ? 16  DA  D C8    1 
ATOM   320  N N7    . DA  A 1 16  ? 5.677   61.739 51.874  1.00 24.23  ? 16  DA  D N7    1 
ATOM   321  C C5    . DA  A 1 16  ? 5.277   62.008 53.170  1.00 21.69  ? 16  DA  D C5    1 
ATOM   322  C C6    . DA  A 1 16  ? 4.014   62.167 53.740  1.00 20.86  ? 16  DA  D C6    1 
ATOM   323  N N6    . DA  A 1 16  ? 2.881   62.048 53.052  1.00 21.51  ? 16  DA  D N6    1 
ATOM   324  N N1    . DA  A 1 16  ? 3.947   62.440 55.060  1.00 21.09  ? 16  DA  D N1    1 
ATOM   325  C C2    . DA  A 1 16  ? 5.089   62.529 55.750  1.00 20.72  ? 16  DA  D C2    1 
ATOM   326  N N3    . DA  A 1 16  ? 6.345   62.378 55.326  1.00 22.70  ? 16  DA  D N3    1 
ATOM   327  C C4    . DA  A 1 16  ? 6.372   62.113 54.010  1.00 22.13  ? 16  DA  D C4    1 
ATOM   328  P P     . DC  A 1 17  ? 12.740  59.928 51.807  1.00 35.54  ? 17  DC  D P     1 
ATOM   329  O OP1   . DC  A 1 17  ? 14.104  59.533 52.238  1.00 32.17  ? 17  DC  D OP1   1 
ATOM   330  O OP2   . DC  A 1 17  ? 12.543  60.535 50.467  1.00 29.49  ? 17  DC  D OP2   1 
ATOM   331  O "O5'" . DC  A 1 17  ? 11.793  58.652 51.841  1.00 36.99  ? 17  DC  D "O5'" 1 
ATOM   332  C "C5'" . DC  A 1 17  ? 11.850  57.726 52.911  1.00 41.41  ? 17  DC  D "C5'" 1 
ATOM   333  C "C4'" . DC  A 1 17  ? 11.004  56.522 52.578  1.00 45.69  ? 17  DC  D "C4'" 1 
ATOM   334  O "O4'" . DC  A 1 17  ? 9.596   56.858 52.707  1.00 44.27  ? 17  DC  D "O4'" 1 
ATOM   335  C "C3'" . DC  A 1 17  ? 11.203  56.022 51.143  1.00 49.36  ? 17  DC  D "C3'" 1 
ATOM   336  O "O3'" . DC  A 1 17  ? 11.349  54.600 51.128  1.00 58.22  ? 17  DC  D "O3'" 1 
ATOM   337  C "C2'" . DC  A 1 17  ? 9.927   56.449 50.434  1.00 47.03  ? 17  DC  D "C2'" 1 
ATOM   338  C "C1'" . DC  A 1 17  ? 8.905   56.407 51.560  1.00 42.74  ? 17  DC  D "C1'" 1 
ATOM   339  N N1    . DC  A 1 17  ? 7.700   57.241 51.370  1.00 33.96  ? 17  DC  D N1    1 
ATOM   340  C C2    . DC  A 1 17  ? 6.604   57.100 52.274  1.00 33.18  ? 17  DC  D C2    1 
ATOM   341  O O2    . DC  A 1 17  ? 6.718   56.346 53.267  1.00 33.46  ? 17  DC  D O2    1 
ATOM   342  N N3    . DC  A 1 17  ? 5.459   57.792 52.036  1.00 29.66  ? 17  DC  D N3    1 
ATOM   343  C C4    . DC  A 1 17  ? 5.378   58.604 50.973  1.00 32.36  ? 17  DC  D C4    1 
ATOM   344  N N4    . DC  A 1 17  ? 4.217   59.238 50.750  1.00 30.50  ? 17  DC  D N4    1 
ATOM   345  C C5    . DC  A 1 17  ? 6.485   58.800 50.078  1.00 32.89  ? 17  DC  D C5    1 
ATOM   346  C C6    . DC  A 1 17  ? 7.613   58.109 50.316  1.00 32.65  ? 17  DC  D C6    1 
ATOM   347  P P     . DG  A 1 18  ? 12.790  53.949 51.445  1.00 90.00  ? 18  DG  D P     1 
ATOM   348  O OP1   . DG  A 1 18  ? 13.748  55.043 51.764  1.00 62.10  ? 18  DG  D OP1   1 
ATOM   349  O OP2   . DG  A 1 18  ? 13.124  52.978 50.373  1.00 60.12  ? 18  DG  D OP2   1 
ATOM   350  O "O5'" . DG  A 1 18  ? 12.535  53.148 52.796  1.00 90.00  ? 18  DG  D "O5'" 1 
ATOM   351  C "C5'" . DG  A 1 18  ? 11.215  53.010 53.317  1.00 90.00  ? 18  DG  D "C5'" 1 
ATOM   352  C "C4'" . DG  A 1 18  ? 10.747  51.586 53.147  1.00 90.00  ? 18  DG  D "C4'" 1 
ATOM   353  O "O4'" . DG  A 1 18  ? 9.350   51.503 53.518  1.00 90.00  ? 18  DG  D "O4'" 1 
ATOM   354  C "C3'" . DG  A 1 18  ? 10.822  51.112 51.696  1.00 90.00  ? 18  DG  D "C3'" 1 
ATOM   355  O "O3'" . DG  A 1 18  ? 11.107  49.709 51.649  1.00 90.00  ? 18  DG  D "O3'" 1 
ATOM   356  C "C2'" . DG  A 1 18  ? 9.431   51.401 51.171  1.00 90.00  ? 18  DG  D "C2'" 1 
ATOM   357  C "C1'" . DG  A 1 18  ? 8.589   51.094 52.393  1.00 90.00  ? 18  DG  D "C1'" 1 
ATOM   358  N N9    . DG  A 1 18  ? 7.287   51.749 52.458  1.00 56.88  ? 18  DG  D N9    1 
ATOM   359  C C8    . DG  A 1 18  ? 6.283   51.442 53.343  1.00 56.55  ? 18  DG  D C8    1 
ATOM   360  N N7    . DG  A 1 18  ? 5.196   52.140 53.150  1.00 55.55  ? 18  DG  D N7    1 
ATOM   361  C C5    . DG  A 1 18  ? 5.501   52.972 52.080  1.00 52.69  ? 18  DG  D C5    1 
ATOM   362  C C6    . DG  A 1 18  ? 4.700   53.941 51.420  1.00 50.78  ? 18  DG  D C6    1 
ATOM   363  O O6    . DG  A 1 18  ? 3.520   54.259 51.659  1.00 47.85  ? 18  DG  D O6    1 
ATOM   364  N N1    . DG  A 1 18  ? 5.397   54.557 50.382  1.00 47.99  ? 18  DG  D N1    1 
ATOM   365  C C2    . DG  A 1 18  ? 6.693   54.269 50.024  1.00 48.12  ? 18  DG  D C2    1 
ATOM   366  N N2    . DG  A 1 18  ? 7.179   54.958 48.980  1.00 48.72  ? 18  DG  D N2    1 
ATOM   367  N N3    . DG  A 1 18  ? 7.454   53.371 50.636  1.00 48.95  ? 18  DG  D N3    1 
ATOM   368  C C4    . DG  A 1 18  ? 6.796   52.759 51.646  1.00 52.93  ? 18  DG  D C4    1 
ATOM   369  P P     . DC  B 2 1   ? -4.500  54.355 46.334  1.00 90.00  ? 19  DC  E P     1 
ATOM   370  O OP1   . DC  B 2 1   ? -4.214  53.242 45.379  1.00 84.22  ? 19  DC  E OP1   1 
ATOM   371  O OP2   . DC  B 2 1   ? -3.664  55.594 46.298  1.00 84.22  ? 19  DC  E OP2   1 
ATOM   372  O "O5'" . DC  B 2 1   ? -4.487  53.768 47.819  1.00 90.00  ? 19  DC  E "O5'" 1 
ATOM   373  C "C5'" . DC  B 2 1   ? -4.743  54.611 48.945  1.00 90.00  ? 19  DC  E "C5'" 1 
ATOM   374  C "C4'" . DC  B 2 1   ? -4.183  53.992 50.205  1.00 90.00  ? 19  DC  E "C4'" 1 
ATOM   375  O "O4'" . DC  B 2 1   ? -2.757  53.764 50.051  1.00 90.00  ? 19  DC  E "O4'" 1 
ATOM   376  C "C3'" . DC  B 2 1   ? -4.337  54.863 51.451  1.00 90.00  ? 19  DC  E "C3'" 1 
ATOM   377  O "O3'" . DC  B 2 1   ? -4.681  54.056 52.580  1.00 90.00  ? 19  DC  E "O3'" 1 
ATOM   378  C "C2'" . DC  B 2 1   ? -2.963  55.484 51.631  1.00 90.00  ? 19  DC  E "C2'" 1 
ATOM   379  C "C1'" . DC  B 2 1   ? -2.035  54.409 51.093  1.00 90.00  ? 19  DC  E "C1'" 1 
ATOM   380  N N1    . DC  B 2 1   ? -0.783  54.939 50.520  1.00 90.00  ? 19  DC  E N1    1 
ATOM   381  C C2    . DC  B 2 1   ? 0.441   54.490 51.034  1.00 90.00  ? 19  DC  E C2    1 
ATOM   382  O O2    . DC  B 2 1   ? 0.440   53.633 51.936  1.00 90.00  ? 19  DC  E O2    1 
ATOM   383  N N3    . DC  B 2 1   ? 1.591   55.001 50.533  1.00 90.00  ? 19  DC  E N3    1 
ATOM   384  C C4    . DC  B 2 1   ? 1.551   55.914 49.556  1.00 90.00  ? 19  DC  E C4    1 
ATOM   385  N N4    . DC  B 2 1   ? 2.712   56.400 49.103  1.00 90.00  ? 19  DC  E N4    1 
ATOM   386  C C5    . DC  B 2 1   ? 0.320   56.372 49.005  1.00 90.00  ? 19  DC  E C5    1 
ATOM   387  C C6    . DC  B 2 1   ? -0.811  55.863 49.511  1.00 90.00  ? 19  DC  E C6    1 
ATOM   388  P P     . DG  B 2 2   ? -5.021  54.759 53.984  1.00 90.00  ? 20  DG  E P     1 
ATOM   389  O OP1   . DG  B 2 2   ? -5.979  53.886 54.710  1.00 86.39  ? 20  DG  E OP1   1 
ATOM   390  O OP2   . DG  B 2 2   ? -5.376  56.185 53.723  1.00 85.84  ? 20  DG  E OP2   1 
ATOM   391  O "O5'" . DG  B 2 2   ? -3.628  54.734 54.755  1.00 90.00  ? 20  DG  E "O5'" 1 
ATOM   392  C "C5'" . DG  B 2 2   ? -3.105  53.519 55.294  1.00 90.00  ? 20  DG  E "C5'" 1 
ATOM   393  C "C4'" . DG  B 2 2   ? -2.035  53.836 56.313  1.00 90.00  ? 20  DG  E "C4'" 1 
ATOM   394  O "O4'" . DG  B 2 2   ? -0.868  54.363 55.637  1.00 90.00  ? 20  DG  E "O4'" 1 
ATOM   395  C "C3'" . DG  B 2 2   ? -2.463  54.912 57.308  1.00 90.00  ? 20  DG  E "C3'" 1 
ATOM   396  O "O3'" . DG  B 2 2   ? -1.919  54.660 58.600  1.00 90.00  ? 20  DG  E "O3'" 1 
ATOM   397  C "C2'" . DG  B 2 2   ? -1.879  56.186 56.732  1.00 90.00  ? 20  DG  E "C2'" 1 
ATOM   398  C "C1'" . DG  B 2 2   ? -0.614  55.701 56.041  1.00 90.00  ? 20  DG  E "C1'" 1 
ATOM   399  N N9    . DG  B 2 2   ? -0.302  56.472 54.843  1.00 70.52  ? 20  DG  E N9    1 
ATOM   400  C C8    . DG  B 2 2   ? -1.204  57.064 53.992  1.00 70.04  ? 20  DG  E C8    1 
ATOM   401  N N7    . DG  B 2 2   ? -0.637  57.720 53.020  1.00 69.79  ? 20  DG  E N7    1 
ATOM   402  C C5    . DG  B 2 2   ? 0.720   57.544 53.235  1.00 70.50  ? 20  DG  E C5    1 
ATOM   403  C C6    . DG  B 2 2   ? 1.829   58.031 52.505  1.00 72.04  ? 20  DG  E C6    1 
ATOM   404  O O6    . DG  B 2 2   ? 1.829   58.752 51.495  1.00 72.63  ? 20  DG  E O6    1 
ATOM   405  N N1    . DG  B 2 2   ? 3.034   57.605 53.062  1.00 72.71  ? 20  DG  E N1    1 
ATOM   406  C C2    . DG  B 2 2   ? 3.152   56.815 54.185  1.00 72.25  ? 20  DG  E C2    1 
ATOM   407  N N2    . DG  B 2 2   ? 4.409   56.499 54.561  1.00 71.79  ? 20  DG  E N2    1 
ATOM   408  N N3    . DG  B 2 2   ? 2.118   56.365 54.884  1.00 70.20  ? 20  DG  E N3    1 
ATOM   409  C C4    . DG  B 2 2   ? 0.943   56.765 54.353  1.00 69.72  ? 20  DG  E C4    1 
ATOM   410  P P     . DT  B 2 3   ? -2.146  55.734 59.765  1.00 72.77  ? 21  DT  E P     1 
ATOM   411  O OP1   . DT  B 2 3   ? -2.031  55.026 61.066  1.00 59.28  ? 21  DT  E OP1   1 
ATOM   412  O OP2   . DT  B 2 3   ? -3.377  56.506 59.438  1.00 57.42  ? 21  DT  E OP2   1 
ATOM   413  O "O5'" . DT  B 2 3   ? -0.899  56.710 59.620  1.00 68.43  ? 21  DT  E "O5'" 1 
ATOM   414  C "C5'" . DT  B 2 3   ? 0.380   56.322 60.110  1.00 59.65  ? 21  DT  E "C5'" 1 
ATOM   415  C "C4'" . DT  B 2 3   ? 1.130   57.535 60.604  1.00 52.44  ? 21  DT  E "C4'" 1 
ATOM   416  O "O4'" . DT  B 2 3   ? 1.658   58.288 59.484  1.00 49.40  ? 21  DT  E "O4'" 1 
ATOM   417  C "C3'" . DT  B 2 3   ? 0.255   58.498 61.400  1.00 48.99  ? 21  DT  E "C3'" 1 
ATOM   418  O "O3'" . DT  B 2 3   ? 0.928   58.906 62.589  1.00 47.15  ? 21  DT  E "O3'" 1 
ATOM   419  C "C2'" . DT  B 2 3   ? 0.019   59.659 60.444  1.00 46.05  ? 21  DT  E "C2'" 1 
ATOM   420  C "C1'" . DT  B 2 3   ? 1.242   59.641 59.540  1.00 42.50  ? 21  DT  E "C1'" 1 
ATOM   421  N N1    . DT  B 2 3   ? 0.974   60.083 58.154  1.00 23.83  ? 21  DT  E N1    1 
ATOM   422  C C2    . DT  B 2 3   ? 1.938   60.812 57.477  1.00 22.67  ? 21  DT  E C2    1 
ATOM   423  O O2    . DT  B 2 3   ? 2.996   61.139 57.972  1.00 25.18  ? 21  DT  E O2    1 
ATOM   424  N N3    . DT  B 2 3   ? 1.609   61.156 56.192  1.00 19.27  ? 21  DT  E N3    1 
ATOM   425  C C4    . DT  B 2 3   ? 0.430   60.874 55.529  1.00 19.41  ? 21  DT  E C4    1 
ATOM   426  O O4    . DT  B 2 3   ? 0.279   61.246 54.359  1.00 16.26  ? 21  DT  E O4    1 
ATOM   427  C C5    . DT  B 2 3   ? -0.554  60.132 56.312  1.00 19.61  ? 21  DT  E C5    1 
ATOM   428  C C7    . DT  B 2 3   ? -1.886  59.819 55.706  1.00 18.87  ? 21  DT  E C7    1 
ATOM   429  C C6    . DT  B 2 3   ? -0.224  59.769 57.558  1.00 20.88  ? 21  DT  E C6    1 
ATOM   430  P P     . DT  B 2 4   ? 0.216   59.940 63.588  1.00 46.42  ? 22  DT  E P     1 
ATOM   431  O OP1   . DT  B 2 4   ? 0.730   59.707 64.964  1.00 34.39  ? 22  DT  E OP1   1 
ATOM   432  O OP2   . DT  B 2 4   ? -1.243  59.908 63.323  1.00 35.94  ? 22  DT  E OP2   1 
ATOM   433  O "O5'" . DT  B 2 4   ? 0.779   61.340 63.095  1.00 44.66  ? 22  DT  E "O5'" 1 
ATOM   434  C "C5'" . DT  B 2 4   ? 2.170   61.601 63.163  1.00 39.69  ? 22  DT  E "C5'" 1 
ATOM   435  C "C4'" . DT  B 2 4   ? 2.419   63.075 63.009  1.00 35.45  ? 22  DT  E "C4'" 1 
ATOM   436  O "O4'" . DT  B 2 4   ? 2.518   63.395 61.603  1.00 35.60  ? 22  DT  E "O4'" 1 
ATOM   437  C "C3'" . DT  B 2 4   ? 1.280   63.912 63.581  1.00 33.44  ? 22  DT  E "C3'" 1 
ATOM   438  O "O3'" . DT  B 2 4   ? 1.768   64.836 64.542  1.00 32.29  ? 22  DT  E "O3'" 1 
ATOM   439  C "C2'" . DT  B 2 4   ? 0.667   64.599 62.370  1.00 33.80  ? 22  DT  E "C2'" 1 
ATOM   440  C "C1'" . DT  B 2 4   ? 1.741   64.530 61.293  1.00 31.05  ? 22  DT  E "C1'" 1 
ATOM   441  N N1    . DT  B 2 4   ? 1.199   64.349 59.917  1.00 19.30  ? 22  DT  E N1    1 
ATOM   442  C C2    . DT  B 2 4   ? 1.897   64.861 58.838  1.00 16.91  ? 22  DT  E C2    1 
ATOM   443  O O2    . DT  B 2 4   ? 2.979   65.410 58.936  1.00 18.54  ? 22  DT  E O2    1 
ATOM   444  N N3    . DT  B 2 4   ? 1.272   64.708 57.629  1.00 14.22  ? 22  DT  E N3    1 
ATOM   445  C C4    . DT  B 2 4   ? 0.049   64.108 57.387  1.00 15.34  ? 22  DT  E C4    1 
ATOM   446  O O4    . DT  B 2 4   ? -0.410  64.077 56.245  1.00 17.14  ? 22  DT  E O4    1 
ATOM   447  C C5    . DT  B 2 4   ? -0.606  63.562 58.545  1.00 15.33  ? 22  DT  E C5    1 
ATOM   448  C C7    . DT  B 2 4   ? -1.921  62.873 58.371  1.00 13.38  ? 22  DT  E C7    1 
ATOM   449  C C6    . DT  B 2 4   ? -0.005  63.700 59.734  1.00 18.35  ? 22  DT  E C6    1 
ATOM   450  P P     . DT  B 2 5   ? 0.744   65.556 65.549  1.00 20.60  ? 23  DT  E P     1 
ATOM   451  O OP1   . DT  B 2 5   ? 1.392   65.647 66.883  1.00 20.75  ? 23  DT  E OP1   1 
ATOM   452  O OP2   . DT  B 2 5   ? -0.600  64.932 65.422  1.00 23.28  ? 23  DT  E OP2   1 
ATOM   453  O "O5'" . DT  B 2 5   ? 0.691   67.014 64.936  1.00 22.23  ? 23  DT  E "O5'" 1 
ATOM   454  C "C5'" . DT  B 2 5   ? 1.899   67.649 64.545  1.00 22.49  ? 23  DT  E "C5'" 1 
ATOM   455  C "C4'" . DT  B 2 5   ? 1.594   68.971 63.892  1.00 21.84  ? 23  DT  E "C4'" 1 
ATOM   456  O "O4'" . DT  B 2 5   ? 1.356   68.759 62.483  1.00 19.58  ? 23  DT  E "O4'" 1 
ATOM   457  C "C3'" . DT  B 2 5   ? 0.339   69.625 64.463  1.00 22.10  ? 23  DT  E "C3'" 1 
ATOM   458  O "O3'" . DT  B 2 5   ? 0.600   70.917 64.992  1.00 22.50  ? 23  DT  E "O3'" 1 
ATOM   459  C "C2'" . DT  B 2 5   ? -0.648  69.648 63.308  1.00 22.01  ? 23  DT  E "C2'" 1 
ATOM   460  C "C1'" . DT  B 2 5   ? 0.206   69.461 62.064  1.00 19.99  ? 23  DT  E "C1'" 1 
ATOM   461  N N1    . DT  B 2 5   ? -0.447  68.643 61.021  1.00 23.01  ? 23  DT  E N1    1 
ATOM   462  C C2    . DT  B 2 5   ? -0.172  68.906 59.691  1.00 21.83  ? 23  DT  E C2    1 
ATOM   463  O O2    . DT  B 2 5   ? 0.599   69.773 59.321  1.00 19.76  ? 23  DT  E O2    1 
ATOM   464  N N3    . DT  B 2 5   ? -0.846  68.106 58.803  1.00 21.93  ? 23  DT  E N3    1 
ATOM   465  C C4    . DT  B 2 5   ? -1.744  67.101 59.097  1.00 21.01  ? 23  DT  E C4    1 
ATOM   466  O O4    . DT  B 2 5   ? -2.285  66.487 58.190  1.00 20.95  ? 23  DT  E O4    1 
ATOM   467  C C5    . DT  B 2 5   ? -1.972  66.869 60.502  1.00 21.35  ? 23  DT  E C5    1 
ATOM   468  C C7    . DT  B 2 5   ? -2.915  65.785 60.915  1.00 18.02  ? 23  DT  E C7    1 
ATOM   469  C C6    . DT  B 2 5   ? -1.321  67.639 61.382  1.00 21.50  ? 23  DT  E C6    1 
ATOM   470  P P     . DT  B 2 6   ? -0.261  71.435 66.246  1.00 25.99  ? 24  DT  E P     1 
ATOM   471  O OP1   . DT  B 2 6   ? 0.571   72.311 67.106  1.00 28.98  ? 24  DT  E OP1   1 
ATOM   472  O OP2   . DT  B 2 6   ? -0.971  70.284 66.852  1.00 27.09  ? 24  DT  E OP2   1 
ATOM   473  O "O5'" . DT  B 2 6   ? -1.340  72.337 65.527  1.00 25.02  ? 24  DT  E "O5'" 1 
ATOM   474  C "C5'" . DT  B 2 6   ? -0.921  73.315 64.596  1.00 25.33  ? 24  DT  E "C5'" 1 
ATOM   475  C "C4'" . DT  B 2 6   ? -2.128  73.906 63.921  1.00 25.60  ? 24  DT  E "C4'" 1 
ATOM   476  O "O4'" . DT  B 2 6   ? -2.331  73.287 62.626  1.00 26.90  ? 24  DT  E "O4'" 1 
ATOM   477  C "C3'" . DT  B 2 6   ? -3.395  73.663 64.738  1.00 24.65  ? 24  DT  E "C3'" 1 
ATOM   478  O "O3'" . DT  B 2 6   ? -4.124  74.861 64.908  1.00 22.83  ? 24  DT  E "O3'" 1 
ATOM   479  C "C2'" . DT  B 2 6   ? -4.188  72.690 63.889  1.00 29.18  ? 24  DT  E "C2'" 1 
ATOM   480  C "C1'" . DT  B 2 6   ? -3.692  72.967 62.478  1.00 27.67  ? 24  DT  E "C1'" 1 
ATOM   481  N N1    . DT  B 2 6   ? -3.811  71.793 61.582  1.00 31.44  ? 24  DT  E N1    1 
ATOM   482  C C2    . DT  B 2 6   ? -3.441  71.896 60.257  1.00 32.29  ? 24  DT  E C2    1 
ATOM   483  O O2    . DT  B 2 6   ? -2.932  72.889 59.773  1.00 34.62  ? 24  DT  E O2    1 
ATOM   484  N N3    . DT  B 2 6   ? -3.696  70.774 59.511  1.00 33.44  ? 24  DT  E N3    1 
ATOM   485  C C4    . DT  B 2 6   ? -4.264  69.590 59.945  1.00 33.87  ? 24  DT  E C4    1 
ATOM   486  O O4    . DT  B 2 6   ? -4.468  68.680 59.151  1.00 36.95  ? 24  DT  E O4    1 
ATOM   487  C C5    . DT  B 2 6   ? -4.585  69.540 61.346  1.00 33.46  ? 24  DT  E C5    1 
ATOM   488  C C7    . DT  B 2 6   ? -5.181  68.290 61.911  1.00 32.59  ? 24  DT  E C7    1 
ATOM   489  C C6    . DT  B 2 6   ? -4.338  70.622 62.083  1.00 31.55  ? 24  DT  E C6    1 
ATOM   490  P P     . DA  B 2 7   ? -5.299  74.939 66.000  1.00 22.73  ? 25  DA  E P     1 
ATOM   491  O OP1   . DA  B 2 7   ? -4.746  75.419 67.284  1.00 20.58  ? 25  DA  E OP1   1 
ATOM   492  O OP2   . DA  B 2 7   ? -6.105  73.701 65.971  1.00 18.63  ? 25  DA  E OP2   1 
ATOM   493  O "O5'" . DA  B 2 7   ? -6.182  76.105 65.393  1.00 23.00  ? 25  DA  E "O5'" 1 
ATOM   494  C "C5'" . DA  B 2 7   ? -5.558  77.153 64.656  1.00 26.38  ? 25  DA  E "C5'" 1 
ATOM   495  C "C4'" . DA  B 2 7   ? -6.486  77.631 63.570  1.00 28.82  ? 25  DA  E "C4'" 1 
ATOM   496  O "O4'" . DA  B 2 7   ? -6.336  76.767 62.417  1.00 27.07  ? 25  DA  E "O4'" 1 
ATOM   497  C "C3'" . DA  B 2 7   ? -7.923  77.489 64.050  1.00 30.85  ? 25  DA  E "C3'" 1 
ATOM   498  O "O3'" . DA  B 2 7   ? -8.704  78.660 64.024  1.00 34.02  ? 25  DA  E "O3'" 1 
ATOM   499  C "C2'" . DA  B 2 7   ? -8.550  76.448 63.153  1.00 31.55  ? 25  DA  E "C2'" 1 
ATOM   500  C "C1'" . DA  B 2 7   ? -7.589  76.249 62.001  1.00 27.66  ? 25  DA  E "C1'" 1 
ATOM   501  N N9    . DA  B 2 7   ? -7.453  74.807 61.801  1.00 24.20  ? 25  DA  E N9    1 
ATOM   502  C C8    . DA  B 2 7   ? -7.788  73.859 62.739  1.00 23.68  ? 25  DA  E C8    1 
ATOM   503  N N7    . DA  B 2 7   ? -7.698  72.632 62.309  1.00 24.12  ? 25  DA  E N7    1 
ATOM   504  C C5    . DA  B 2 7   ? -7.251  72.772 61.004  1.00 22.76  ? 25  DA  E C5    1 
ATOM   505  C C6    . DA  B 2 7   ? -6.981  71.834 60.002  1.00 22.48  ? 25  DA  E C6    1 
ATOM   506  N N6    . DA  B 2 7   ? -7.144  70.516 60.167  1.00 19.84  ? 25  DA  E N6    1 
ATOM   507  N N1    . DA  B 2 7   ? -6.541  72.297 58.811  1.00 23.05  ? 25  DA  E N1    1 
ATOM   508  C C2    . DA  B 2 7   ? -6.391  73.619 58.652  1.00 23.01  ? 25  DA  E C2    1 
ATOM   509  N N3    . DA  B 2 7   ? -6.622  74.603 59.519  1.00 23.91  ? 25  DA  E N3    1 
ATOM   510  C C4    . DA  B 2 7   ? -7.060  74.108 60.688  1.00 22.72  ? 25  DA  E C4    1 
ATOM   511  P P     . DT  B 2 8   ? -10.119 78.628 64.767  1.00 36.15  ? 26  DT  E P     1 
ATOM   512  O OP1   . DT  B 2 8   ? -10.614 80.020 64.968  1.00 35.39  ? 26  DT  E OP1   1 
ATOM   513  O OP2   . DT  B 2 8   ? -9.948  77.733 65.931  1.00 29.52  ? 26  DT  E OP2   1 
ATOM   514  O "O5'" . DT  B 2 8   ? -11.042 77.851 63.734  1.00 35.51  ? 26  DT  E "O5'" 1 
ATOM   515  C "C5'" . DT  B 2 8   ? -11.131 78.275 62.379  1.00 38.40  ? 26  DT  E "C5'" 1 
ATOM   516  C "C4'" . DT  B 2 8   ? -12.269 77.559 61.696  1.00 39.35  ? 26  DT  E "C4'" 1 
ATOM   517  O "O4'" . DT  B 2 8   ? -11.785 76.333 61.084  1.00 39.65  ? 26  DT  E "O4'" 1 
ATOM   518  C "C3'" . DT  B 2 8   ? -13.378 77.157 62.671  1.00 39.60  ? 26  DT  E "C3'" 1 
ATOM   519  O "O3'" . DT  B 2 8   ? -14.676 77.586 62.261  1.00 39.92  ? 26  DT  E "O3'" 1 
ATOM   520  C "C2'" . DT  B 2 8   ? -13.311 75.642 62.704  1.00 40.47  ? 26  DT  E "C2'" 1 
ATOM   521  C "C1'" . DT  B 2 8   ? -12.668 75.271 61.380  1.00 38.08  ? 26  DT  E "C1'" 1 
ATOM   522  N N1    . DT  B 2 8   ? -11.884 74.020 61.452  1.00 31.72  ? 26  DT  E N1    1 
ATOM   523  C C2    . DT  B 2 8   ? -11.451 73.432 60.287  1.00 31.56  ? 26  DT  E C2    1 
ATOM   524  O O2    . DT  B 2 8   ? -11.603 73.932 59.190  1.00 29.90  ? 26  DT  E O2    1 
ATOM   525  N N3    . DT  B 2 8   ? -10.813 72.228 60.461  1.00 33.10  ? 26  DT  E N3    1 
ATOM   526  C C4    . DT  B 2 8   ? -10.548 71.582 61.659  1.00 33.20  ? 26  DT  E C4    1 
ATOM   527  O O4    . DT  B 2 8   ? -9.993  70.489 61.659  1.00 35.79  ? 26  DT  E O4    1 
ATOM   528  C C5    . DT  B 2 8   ? -10.974 72.284 62.841  1.00 32.45  ? 26  DT  E C5    1 
ATOM   529  C C7    . DT  B 2 8   ? -10.670 71.698 64.183  1.00 30.35  ? 26  DT  E C7    1 
ATOM   530  C C6    . DT  B 2 8   ? -11.620 73.445 62.681  1.00 32.07  ? 26  DT  E C6    1 
ATOM   531  P P     . DA  B 2 9   ? -15.904 77.485 63.301  1.00 31.47  ? 27  DA  E P     1 
ATOM   532  O OP1   . DA  B 2 9   ? -16.753 78.699 63.189  1.00 36.91  ? 27  DA  E OP1   1 
ATOM   533  O OP2   . DA  B 2 9   ? -15.352 77.098 64.622  1.00 35.61  ? 27  DA  E OP2   1 
ATOM   534  O "O5'" . DA  B 2 9   ? -16.737 76.256 62.753  1.00 29.80  ? 27  DA  E "O5'" 1 
ATOM   535  C "C5'" . DA  B 2 9   ? -17.194 76.248 61.416  1.00 33.90  ? 27  DA  E "C5'" 1 
ATOM   536  C "C4'" . DA  B 2 9   ? -17.970 74.984 61.167  1.00 36.90  ? 27  DA  E "C4'" 1 
ATOM   537  O "O4'" . DA  B 2 9   ? -17.072 73.855 61.035  1.00 35.66  ? 27  DA  E "O4'" 1 
ATOM   538  C "C3'" . DA  B 2 9   ? -18.896 74.650 62.332  1.00 39.85  ? 27  DA  E "C3'" 1 
ATOM   539  O "O3'" . DA  B 2 9   ? -20.088 74.085 61.806  1.00 48.05  ? 27  DA  E "O3'" 1 
ATOM   540  C "C2'" . DA  B 2 9   ? -18.117 73.601 63.105  1.00 36.91  ? 27  DA  E "C2'" 1 
ATOM   541  C "C1'" . DA  B 2 9   ? -17.446 72.856 61.970  1.00 33.23  ? 27  DA  E "C1'" 1 
ATOM   542  N N9    . DA  B 2 9   ? -16.257 72.074 62.314  1.00 33.21  ? 27  DA  E N9    1 
ATOM   543  C C8    . DA  B 2 9   ? -15.319 72.279 63.303  1.00 31.61  ? 27  DA  E C8    1 
ATOM   544  N N7    . DA  B 2 9   ? -14.380 71.359 63.340  1.00 31.18  ? 27  DA  E N7    1 
ATOM   545  C C5    . DA  B 2 9   ? -14.720 70.495 62.302  1.00 30.63  ? 27  DA  E C5    1 
ATOM   546  C C6    . DA  B 2 9   ? -14.127 69.307 61.811  1.00 30.12  ? 27  DA  E C6    1 
ATOM   547  N N6    . DA  B 2 9   ? -13.009 68.763 62.311  1.00 29.80  ? 27  DA  E N6    1 
ATOM   548  N N1    . DA  B 2 9   ? -14.733 68.691 60.770  1.00 28.62  ? 27  DA  E N1    1 
ATOM   549  C C2    . DA  B 2 9   ? -15.849 69.236 60.257  1.00 28.24  ? 27  DA  E C2    1 
ATOM   550  N N3    . DA  B 2 9   ? -16.494 70.342 60.624  1.00 28.38  ? 27  DA  E N3    1 
ATOM   551  C C4    . DA  B 2 9   ? -15.873 70.928 61.663  1.00 30.93  ? 27  DA  E C4    1 
ATOM   552  P P     . DT  B 2 10  ? -21.434 74.103 62.673  1.00 77.27  ? 28  DT  E P     1 
ATOM   553  O OP1   . DT  B 2 10  ? -22.113 75.402 62.417  1.00 52.78  ? 28  DT  E OP1   1 
ATOM   554  O OP2   . DT  B 2 10  ? -21.118 73.690 64.073  1.00 53.01  ? 28  DT  E OP2   1 
ATOM   555  O "O5'" . DT  B 2 10  ? -22.276 72.946 61.986  1.00 75.78  ? 28  DT  E "O5'" 1 
ATOM   556  C "C5'" . DT  B 2 10  ? -22.102 72.661 60.602  1.00 74.02  ? 28  DT  E "C5'" 1 
ATOM   557  C "C4'" . DT  B 2 10  ? -22.266 71.182 60.368  1.00 72.41  ? 28  DT  E "C4'" 1 
ATOM   558  O "O4'" . DT  B 2 10  ? -21.016 70.469 60.544  1.00 68.12  ? 28  DT  E "O4'" 1 
ATOM   559  C "C3'" . DT  B 2 10  ? -23.253 70.563 61.350  1.00 73.47  ? 28  DT  E "C3'" 1 
ATOM   560  O "O3'" . DT  B 2 10  ? -24.117 69.685 60.651  1.00 81.30  ? 28  DT  E "O3'" 1 
ATOM   561  C "C2'" . DT  B 2 10  ? -22.363 69.792 62.307  1.00 69.77  ? 28  DT  E "C2'" 1 
ATOM   562  C "C1'" . DT  B 2 10  ? -21.230 69.361 61.398  1.00 64.51  ? 28  DT  E "C1'" 1 
ATOM   563  N N1    . DT  B 2 10  ? -19.962 69.052 62.095  1.00 34.71  ? 28  DT  E N1    1 
ATOM   564  C C2    . DT  B 2 10  ? -19.156 68.039 61.605  1.00 32.51  ? 28  DT  E C2    1 
ATOM   565  O O2    . DT  B 2 10  ? -19.421 67.390 60.600  1.00 31.79  ? 28  DT  E O2    1 
ATOM   566  N N3    . DT  B 2 10  ? -18.014 67.811 62.343  1.00 31.73  ? 28  DT  E N3    1 
ATOM   567  C C4    . DT  B 2 10  ? -17.606 68.478 63.488  1.00 32.75  ? 28  DT  E C4    1 
ATOM   568  O O4    . DT  B 2 10  ? -16.553 68.163 64.049  1.00 31.95  ? 28  DT  E O4    1 
ATOM   569  C C5    . DT  B 2 10  ? -18.492 69.526 63.934  1.00 34.41  ? 28  DT  E C5    1 
ATOM   570  C C7    . DT  B 2 10  ? -18.133 70.300 65.164  1.00 35.06  ? 28  DT  E C7    1 
ATOM   571  C C6    . DT  B 2 10  ? -19.607 69.760 63.223  1.00 35.74  ? 28  DT  E C6    1 
ATOM   572  P P     . DC  B 2 11  ? -25.375 69.043 61.405  1.00 90.00  ? 29  DC  E P     1 
ATOM   573  O OP1   . DC  B 2 11  ? -26.581 69.474 60.645  1.00 61.75  ? 29  DC  E OP1   1 
ATOM   574  O OP2   . DC  B 2 11  ? -25.282 69.323 62.871  1.00 59.24  ? 29  DC  E OP2   1 
ATOM   575  O "O5'" . DC  B 2 11  ? -25.146 67.490 61.150  1.00 90.00  ? 29  DC  E "O5'" 1 
ATOM   576  C "C5'" . DC  B 2 11  ? -24.692 67.029 59.875  1.00 90.00  ? 29  DC  E "C5'" 1 
ATOM   577  C "C4'" . DC  B 2 11  ? -24.271 65.584 59.969  1.00 90.00  ? 29  DC  E "C4'" 1 
ATOM   578  O "O4'" . DC  B 2 11  ? -22.959 65.485 60.577  1.00 90.00  ? 29  DC  E "O4'" 1 
ATOM   579  C "C3'" . DC  B 2 11  ? -25.216 64.763 60.844  1.00 90.00  ? 29  DC  E "C3'" 1 
ATOM   580  O "O3'" . DC  B 2 11  ? -25.460 63.472 60.276  1.00 90.00  ? 29  DC  E "O3'" 1 
ATOM   581  C "C2'" . DC  B 2 11  ? -24.483 64.664 62.170  1.00 90.00  ? 29  DC  E "C2'" 1 
ATOM   582  C "C1'" . DC  B 2 11  ? -23.022 64.678 61.745  1.00 90.00  ? 29  DC  E "C1'" 1 
ATOM   583  N N1    . DC  B 2 11  ? -22.108 65.253 62.752  1.00 50.83  ? 29  DC  E N1    1 
ATOM   584  C C2    . DC  B 2 11  ? -20.825 64.708 62.886  1.00 48.52  ? 29  DC  E C2    1 
ATOM   585  O O2    . DC  B 2 11  ? -20.488 63.776 62.131  1.00 46.03  ? 29  DC  E O2    1 
ATOM   586  N N3    . DC  B 2 11  ? -19.988 65.210 63.834  1.00 47.08  ? 29  DC  E N3    1 
ATOM   587  C C4    . DC  B 2 11  ? -20.393 66.217 64.620  1.00 46.20  ? 29  DC  E C4    1 
ATOM   588  N N4    . DC  B 2 11  ? -19.542 66.678 65.547  1.00 45.15  ? 29  DC  E N4    1 
ATOM   589  C C5    . DC  B 2 11  ? -21.688 66.796 64.492  1.00 46.75  ? 29  DC  E C5    1 
ATOM   590  C C6    . DC  B 2 11  ? -22.504 66.290 63.554  1.00 48.92  ? 29  DC  E C6    1 
ATOM   591  P P     . DG  B 2 12  ? -26.739 62.622 60.764  1.00 90.00  ? 30  DG  E P     1 
ATOM   592  O OP1   . DG  B 2 12  ? -26.663 61.286 60.101  1.00 84.40  ? 30  DG  E OP1   1 
ATOM   593  O OP2   . DG  B 2 12  ? -27.962 63.460 60.597  1.00 83.37  ? 30  DG  E OP2   1 
ATOM   594  O "O5'" . DG  B 2 12  ? -26.469 62.438 62.326  1.00 90.00  ? 30  DG  E "O5'" 1 
ATOM   595  C "C5'" . DG  B 2 12  ? -26.643 61.173 62.957  1.00 90.00  ? 30  DG  E "C5'" 1 
ATOM   596  C "C4'" . DG  B 2 12  ? -25.523 60.236 62.565  1.00 90.00  ? 30  DG  E "C4'" 1 
ATOM   597  O "O4'" . DG  B 2 12  ? -24.256 60.919 62.697  1.00 90.00  ? 30  DG  E "O4'" 1 
ATOM   598  C "C3'" . DG  B 2 12  ? -25.431 59.005 63.461  1.00 90.00  ? 30  DG  E "C3'" 1 
ATOM   599  O "O3'" . DG  B 2 12  ? -24.975 57.856 62.739  1.00 90.00  ? 30  DG  E "O3'" 1 
ATOM   600  C "C2'" . DG  B 2 12  ? -24.401 59.411 64.493  1.00 90.00  ? 30  DG  E "C2'" 1 
ATOM   601  C "C1'" . DG  B 2 12  ? -23.465 60.291 63.689  1.00 90.00  ? 30  DG  E "C1'" 1 
ATOM   602  N N9    . DG  B 2 12  ? -22.879 61.336 64.512  1.00 71.37  ? 30  DG  E N9    1 
ATOM   603  C C8    . DG  B 2 12  ? -23.457 62.528 64.887  1.00 69.11  ? 30  DG  E C8    1 
ATOM   604  N N7    . DG  B 2 12  ? -22.694 63.240 65.672  1.00 67.87  ? 30  DG  E N7    1 
ATOM   605  C C5    . DG  B 2 12  ? -21.541 62.474 65.813  1.00 67.26  ? 30  DG  E C5    1 
ATOM   606  C C6    . DG  B 2 12  ? -20.358 62.720 66.557  1.00 65.72  ? 30  DG  E C6    1 
ATOM   607  O O6    . DG  B 2 12  ? -20.078 63.700 67.259  1.00 64.92  ? 30  DG  E O6    1 
ATOM   608  N N1    . DG  B 2 12  ? -19.448 61.673 66.426  1.00 65.25  ? 30  DG  E N1    1 
ATOM   609  C C2    . DG  B 2 12  ? -19.647 60.536 65.677  1.00 66.32  ? 30  DG  E C2    1 
ATOM   610  N N2    . DG  B 2 12  ? -18.655 59.632 65.685  1.00 66.41  ? 30  DG  E N2    1 
ATOM   611  N N3    . DG  B 2 12  ? -20.741 60.300 64.974  1.00 66.26  ? 30  DG  E N3    1 
ATOM   612  C C4    . DG  B 2 12  ? -21.640 61.301 65.092  1.00 68.57  ? 30  DG  E C4    1 
ATOM   613  P P     . DA  B 2 13  ? -24.936 56.428 63.480  1.00 90.00  ? 31  DA  E P     1 
ATOM   614  O OP1   . DA  B 2 13  ? -23.541 55.907 63.373  1.00 89.58  ? 31  DA  E OP1   1 
ATOM   615  O OP2   . DA  B 2 13  ? -26.069 55.614 62.961  1.00 89.58  ? 31  DA  E OP2   1 
ATOM   616  O "O5'" . DA  B 2 13  ? -25.237 56.806 65.003  1.00 90.00  ? 31  DA  E "O5'" 1 
ATOM   617  C "C5'" . DA  B 2 13  ? -24.843 55.953 66.076  1.00 90.00  ? 31  DA  E "C5'" 1 
ATOM   618  C "C4'" . DA  B 2 13  ? -23.343 55.999 66.255  1.00 90.00  ? 31  DA  E "C4'" 1 
ATOM   619  O "O4'" . DA  B 2 13  ? -22.884 57.374 66.283  1.00 90.00  ? 31  DA  E "O4'" 1 
ATOM   620  C "C3'" . DA  B 2 13  ? -22.837 55.345 67.541  1.00 90.00  ? 31  DA  E "C3'" 1 
ATOM   621  O "O3'" . DA  B 2 13  ? -21.660 54.571 67.279  1.00 90.00  ? 31  DA  E "O3'" 1 
ATOM   622  C "C2'" . DA  B 2 13  ? -22.510 56.527 68.434  1.00 90.00  ? 31  DA  E "C2'" 1 
ATOM   623  C "C1'" . DA  B 2 13  ? -22.105 57.603 67.444  1.00 90.00  ? 31  DA  E "C1'" 1 
ATOM   624  N N9    . DA  B 2 13  ? -22.380 58.963 67.907  1.00 86.19  ? 31  DA  E N9    1 
ATOM   625  C C8    . DA  B 2 13  ? -23.492 59.729 67.661  1.00 84.42  ? 31  DA  E C8    1 
ATOM   626  N N7    . DA  B 2 13  ? -23.447 60.918 68.212  1.00 83.76  ? 31  DA  E N7    1 
ATOM   627  C C5    . DA  B 2 13  ? -22.221 60.937 68.866  1.00 83.87  ? 31  DA  E C5    1 
ATOM   628  C C6    . DA  B 2 13  ? -21.569 61.923 69.639  1.00 83.11  ? 31  DA  E C6    1 
ATOM   629  N N6    . DA  B 2 13  ? -22.081 63.133 69.884  1.00 82.64  ? 31  DA  E N6    1 
ATOM   630  N N1    . DA  B 2 13  ? -20.356 61.618 70.155  1.00 82.23  ? 31  DA  E N1    1 
ATOM   631  C C2    . DA  B 2 13  ? -19.838 60.412 69.902  1.00 83.78  ? 31  DA  E C2    1 
ATOM   632  N N3    . DA  B 2 13  ? -20.347 59.407 69.185  1.00 85.63  ? 31  DA  E N3    1 
ATOM   633  C C4    . DA  B 2 13  ? -21.554 59.738 68.689  1.00 85.21  ? 31  DA  E C4    1 
ATOM   634  P P     . DT  B 2 14  ? -21.725 52.962 67.375  1.00 90.00  ? 32  DT  E P     1 
ATOM   635  O OP1   . DT  B 2 14  ? -21.187 52.422 66.092  1.00 90.00  ? 32  DT  E OP1   1 
ATOM   636  O OP2   . DT  B 2 14  ? -23.094 52.569 67.820  1.00 90.00  ? 32  DT  E OP2   1 
ATOM   637  O "O5'" . DT  B 2 14  ? -20.703 52.606 68.546  1.00 90.00  ? 32  DT  E "O5'" 1 
ATOM   638  C "C5'" . DT  B 2 14  ? -21.158 52.380 69.880  1.00 90.00  ? 32  DT  E "C5'" 1 
ATOM   639  C "C4'" . DT  B 2 14  ? -20.354 53.221 70.843  1.00 90.00  ? 32  DT  E "C4'" 1 
ATOM   640  O "O4'" . DT  B 2 14  ? -20.688 54.623 70.659  1.00 90.00  ? 32  DT  E "O4'" 1 
ATOM   641  C "C3'" . DT  B 2 14  ? -20.589 52.926 72.326  1.00 90.00  ? 32  DT  E "C3'" 1 
ATOM   642  O "O3'" . DT  B 2 14  ? -19.323 52.985 73.009  1.00 90.00  ? 32  DT  E "O3'" 1 
ATOM   643  C "C2'" . DT  B 2 14  ? -21.530 54.037 72.762  1.00 90.00  ? 32  DT  E "C2'" 1 
ATOM   644  C "C1'" . DT  B 2 14  ? -21.044 55.196 71.913  1.00 90.00  ? 32  DT  E "C1'" 1 
ATOM   645  N N1    . DT  B 2 14  ? -22.043 56.262 71.677  1.00 90.00  ? 32  DT  E N1    1 
ATOM   646  C C2    . DT  B 2 14  ? -21.648 57.573 71.865  1.00 90.00  ? 32  DT  E C2    1 
ATOM   647  O O2    . DT  B 2 14  ? -20.524 57.886 72.232  1.00 90.00  ? 32  DT  E O2    1 
ATOM   648  N N3    . DT  B 2 14  ? -22.625 58.508 71.609  1.00 90.00  ? 32  DT  E N3    1 
ATOM   649  C C4    . DT  B 2 14  ? -23.924 58.270 71.193  1.00 90.00  ? 32  DT  E C4    1 
ATOM   650  O O4    . DT  B 2 14  ? -24.687 59.215 70.993  1.00 90.00  ? 32  DT  E O4    1 
ATOM   651  C C5    . DT  B 2 14  ? -24.272 56.873 71.025  1.00 90.00  ? 32  DT  E C5    1 
ATOM   652  C C7    . DT  B 2 14  ? -25.655 56.518 70.577  1.00 90.00  ? 32  DT  E C7    1 
ATOM   653  C C6    . DT  B 2 14  ? -23.329 55.952 71.277  1.00 90.00  ? 32  DT  E C6    1 
ATOM   654  P P     . DC  B 2 15  ? -19.251 53.458 74.551  1.00 90.00  ? 33  DC  E P     1 
ATOM   655  O OP1   . DC  B 2 15  ? -17.851 53.235 75.013  1.00 90.00  ? 33  DC  E OP1   1 
ATOM   656  O OP2   . DC  B 2 15  ? -20.380 52.841 75.308  1.00 90.00  ? 33  DC  E OP2   1 
ATOM   657  O "O5'" . DC  B 2 15  ? -19.496 55.034 74.469  1.00 90.00  ? 33  DC  E "O5'" 1 
ATOM   658  C "C5'" . DC  B 2 15  ? -18.476 55.956 74.855  1.00 90.00  ? 33  DC  E "C5'" 1 
ATOM   659  C "C4'" . DC  B 2 15  ? -18.838 56.595 76.175  1.00 90.00  ? 33  DC  E "C4'" 1 
ATOM   660  O "O4'" . DC  B 2 15  ? -19.790 57.670 75.979  1.00 90.00  ? 33  DC  E "O4'" 1 
ATOM   661  C "C3'" . DC  B 2 15  ? -19.499 55.603 77.129  1.00 90.00  ? 33  DC  E "C3'" 1 
ATOM   662  O "O3'" . DC  B 2 15  ? -19.015 55.767 78.463  1.00 90.00  ? 33  DC  E "O3'" 1 
ATOM   663  C "C2'" . DC  B 2 15  ? -20.978 55.925 77.007  1.00 90.00  ? 33  DC  E "C2'" 1 
ATOM   664  C "C1'" . DC  B 2 15  ? -20.976 57.418 76.717  1.00 90.00  ? 33  DC  E "C1'" 1 
ATOM   665  N N1    . DC  B 2 15  ? -22.117 57.894 75.913  1.00 90.00  ? 33  DC  E N1    1 
ATOM   666  C C2    . DC  B 2 15  ? -22.486 59.241 76.010  1.00 90.00  ? 33  DC  E C2    1 
ATOM   667  O O2    . DC  B 2 15  ? -21.838 59.990 76.767  1.00 90.00  ? 33  DC  E O2    1 
ATOM   668  N N3    . DC  B 2 15  ? -23.537 59.692 75.279  1.00 90.00  ? 33  DC  E N3    1 
ATOM   669  C C4    . DC  B 2 15  ? -24.207 58.854 74.482  1.00 90.00  ? 33  DC  E C4    1 
ATOM   670  N N4    . DC  B 2 15  ? -25.237 59.343 73.783  1.00 90.00  ? 33  DC  E N4    1 
ATOM   671  C C5    . DC  B 2 15  ? -23.851 57.477 74.367  1.00 90.00  ? 33  DC  E C5    1 
ATOM   672  C C6    . DC  B 2 15  ? -22.808 57.045 75.090  1.00 90.00  ? 33  DC  E C6    1 
ATOM   673  P P     . DG  B 2 16  ? -18.464 54.482 79.263  1.00 89.80  ? 34  DG  E P     1 
ATOM   674  O OP1   . DG  B 2 16  ? -17.390 53.850 78.442  1.00 90.00  ? 34  DG  E OP1   1 
ATOM   675  O OP2   . DG  B 2 16  ? -19.649 53.672 79.682  1.00 90.00  ? 34  DG  E OP2   1 
ATOM   676  O "O5'" . DG  B 2 16  ? -17.804 55.091 80.578  1.00 89.80  ? 34  DG  E "O5'" 1 
ATOM   677  C "C5'" . DG  B 2 16  ? -18.548 55.175 81.786  1.00 89.80  ? 34  DG  E "C5'" 1 
ATOM   678  C "C4'" . DG  B 2 16  ? -18.972 56.602 82.027  1.00 89.80  ? 34  DG  E "C4'" 1 
ATOM   679  O "O4'" . DG  B 2 16  ? -19.773 57.078 80.913  1.00 89.80  ? 34  DG  E "O4'" 1 
ATOM   680  C "C3'" . DG  B 2 16  ? -19.837 56.776 83.268  1.00 89.80  ? 34  DG  E "C3'" 1 
ATOM   681  O "O3'" . DG  B 2 16  ? -19.499 58.010 83.905  1.00 89.80  ? 34  DG  E "O3'" 1 
ATOM   682  C "C2'" . DG  B 2 16  ? -21.248 56.814 82.709  1.00 89.80  ? 34  DG  E "C2'" 1 
ATOM   683  C "C1'" . DG  B 2 16  ? -21.045 57.514 81.379  1.00 89.80  ? 34  DG  E "C1'" 1 
ATOM   684  N N9    . DG  B 2 16  ? -22.047 57.162 80.376  1.00 90.00  ? 34  DG  E N9    1 
ATOM   685  C C8    . DG  B 2 16  ? -22.244 55.926 79.806  1.00 90.00  ? 34  DG  E C8    1 
ATOM   686  N N7    . DG  B 2 16  ? -23.233 55.904 78.952  1.00 90.00  ? 34  DG  E N7    1 
ATOM   687  C C5    . DG  B 2 16  ? -23.721 57.205 78.955  1.00 90.00  ? 34  DG  E C5    1 
ATOM   688  C C6    . DG  B 2 16  ? -24.807 57.788 78.230  1.00 90.00  ? 34  DG  E C6    1 
ATOM   689  O O6    . DG  B 2 16  ? -25.567 57.251 77.404  1.00 90.00  ? 34  DG  E O6    1 
ATOM   690  N N1    . DG  B 2 16  ? -24.967 59.138 78.547  1.00 90.00  ? 34  DG  E N1    1 
ATOM   691  C C2    . DG  B 2 16  ? -24.185 59.842 79.438  1.00 90.00  ? 34  DG  E C2    1 
ATOM   692  N N2    . DG  B 2 16  ? -24.507 61.140 79.618  1.00 90.00  ? 34  DG  E N2    1 
ATOM   693  N N3    . DG  B 2 16  ? -23.164 59.312 80.109  1.00 90.00  ? 34  DG  E N3    1 
ATOM   694  C C4    . DG  B 2 16  ? -22.996 57.999 79.825  1.00 90.00  ? 34  DG  E C4    1 
ATOM   695  P P     . DA  B 2 17  ? -20.407 58.556 85.115  1.00 89.74  ? 35  DA  E P     1 
ATOM   696  O OP1   . DA  B 2 17  ? -19.746 59.763 85.699  1.00 89.93  ? 35  DA  E OP1   1 
ATOM   697  O OP2   . DA  B 2 17  ? -20.703 57.387 85.990  1.00 89.93  ? 35  DA  E OP2   1 
ATOM   698  O "O5'" . DA  B 2 17  ? -21.759 59.009 84.393  1.00 89.74  ? 35  DA  E "O5'" 1 
ATOM   699  C "C5'" . DA  B 2 17  ? -21.798 60.182 83.574  1.00 89.74  ? 35  DA  E "C5'" 1 
ATOM   700  C "C4'" . DA  B 2 17  ? -23.225 60.640 83.386  1.00 89.74  ? 35  DA  E "C4'" 1 
ATOM   701  O "O4'" . DA  B 2 17  ? -23.895 59.817 82.402  1.00 89.74  ? 35  DA  E "O4'" 1 
ATOM   702  C "C3'" . DA  B 2 17  ? -24.083 60.564 84.649  1.00 89.74  ? 35  DA  E "C3'" 1 
ATOM   703  O "O3'" . DA  B 2 17  ? -24.944 61.700 84.724  1.00 89.74  ? 35  DA  E "O3'" 1 
ATOM   704  C "C2'" . DA  B 2 17  ? -24.902 59.301 84.444  1.00 89.74  ? 35  DA  E "C2'" 1 
ATOM   705  C "C1'" . DA  B 2 17  ? -25.111 59.324 82.943  1.00 89.74  ? 35  DA  E "C1'" 1 
ATOM   706  N N9    . DA  B 2 17  ? -25.392 58.029 82.320  1.00 89.93  ? 35  DA  E N9    1 
ATOM   707  C C8    . DA  B 2 17  ? -24.827 56.803 82.588  1.00 89.93  ? 35  DA  E C8    1 
ATOM   708  N N7    . DA  B 2 17  ? -25.294 55.830 81.838  1.00 89.93  ? 35  DA  E N7    1 
ATOM   709  C C5    . DA  B 2 17  ? -26.231 56.456 81.023  1.00 89.93  ? 35  DA  E C5    1 
ATOM   710  C C6    . DA  B 2 17  ? -27.077 55.974 80.002  1.00 89.93  ? 35  DA  E C6    1 
ATOM   711  N N6    . DA  B 2 17  ? -27.116 54.695 79.608  1.00 89.93  ? 35  DA  E N6    1 
ATOM   712  N N1    . DA  B 2 17  ? -27.891 56.865 79.390  1.00 89.93  ? 35  DA  E N1    1 
ATOM   713  C C2    . DA  B 2 17  ? -27.850 58.148 79.781  1.00 89.93  ? 35  DA  E C2    1 
ATOM   714  N N3    . DA  B 2 17  ? -27.101 58.720 80.720  1.00 89.93  ? 35  DA  E N3    1 
ATOM   715  C C4    . DA  B 2 17  ? -26.303 57.810 81.311  1.00 89.93  ? 35  DA  E C4    1 
ATOM   716  P P     . DT  B 2 18  ? -25.665 62.054 86.117  1.00 90.00  ? 36  DT  E P     1 
ATOM   717  O OP1   . DT  B 2 18  ? -26.219 63.437 86.032  1.00 90.00  ? 36  DT  E OP1   1 
ATOM   718  O OP2   . DT  B 2 18  ? -24.697 61.712 87.201  1.00 90.00  ? 36  DT  E OP2   1 
ATOM   719  O "O5'" . DT  B 2 18  ? -26.883 61.024 86.176  1.00 90.00  ? 36  DT  E "O5'" 1 
ATOM   720  C "C5'" . DT  B 2 18  ? -28.172 61.427 86.647  1.00 90.00  ? 36  DT  E "C5'" 1 
ATOM   721  C "C4'" . DT  B 2 18  ? -28.969 62.042 85.519  1.00 90.00  ? 36  DT  E "C4'" 1 
ATOM   722  O "O4'" . DT  B 2 18  ? -28.757 61.273 84.315  1.00 90.00  ? 36  DT  E "O4'" 1 
ATOM   723  C "C3'" . DT  B 2 18  ? -30.479 62.051 85.737  1.00 90.00  ? 36  DT  E "C3'" 1 
ATOM   724  O "O3'" . DT  B 2 18  ? -31.070 63.074 84.926  1.00 90.00  ? 36  DT  E "O3'" 1 
ATOM   725  C "C2'" . DT  B 2 18  ? -30.892 60.701 85.175  1.00 90.00  ? 36  DT  E "C2'" 1 
ATOM   726  C "C1'" . DT  B 2 18  ? -29.913 60.498 84.015  1.00 90.00  ? 36  DT  E "C1'" 1 
ATOM   727  N N1    . DT  B 2 18  ? -29.464 59.102 83.841  1.00 90.00  ? 36  DT  E N1    1 
ATOM   728  C C2    . DT  B 2 18  ? -30.054 58.326 82.862  1.00 90.00  ? 36  DT  E C2    1 
ATOM   729  O O2    . DT  B 2 18  ? -30.932 58.742 82.112  1.00 90.00  ? 36  DT  E O2    1 
ATOM   730  N N3    . DT  B 2 18  ? -29.571 57.035 82.791  1.00 90.00  ? 36  DT  E N3    1 
ATOM   731  C C4    . DT  B 2 18  ? -28.577 56.465 83.576  1.00 90.00  ? 36  DT  E C4    1 
ATOM   732  O O4    . DT  B 2 18  ? -28.248 55.291 83.396  1.00 90.00  ? 36  DT  E O4    1 
ATOM   733  C C5    . DT  B 2 18  ? -27.998 57.345 84.572  1.00 90.00  ? 36  DT  E C5    1 
ATOM   734  C C7    . DT  B 2 18  ? -26.907 56.826 85.456  1.00 90.00  ? 36  DT  E C7    1 
ATOM   735  C C6    . DT  B 2 18  ? -28.467 58.596 84.655  1.00 90.00  ? 36  DT  E C6    1 
ATOM   736  N N     . SER C 3 61  ? -8.524  95.721 54.324  1.00 68.32  ? 61  SER A N     1 
ATOM   737  C CA    . SER C 3 61  ? -9.388  94.827 55.151  1.00 67.02  ? 61  SER A CA    1 
ATOM   738  C C     . SER C 3 61  ? -9.232  95.157 56.628  1.00 65.87  ? 61  SER A C     1 
ATOM   739  O O     . SER C 3 61  ? -10.207 95.138 57.383  1.00 66.34  ? 61  SER A O     1 
ATOM   740  C CB    . SER C 3 61  ? -9.007  93.366 54.927  1.00 70.59  ? 61  SER A CB    1 
ATOM   741  O OG    . SER C 3 61  ? -7.732  93.090 55.480  1.00 72.20  ? 61  SER A OG    1 
ATOM   742  N N     . GLY C 3 62  ? -7.995  95.446 57.028  1.00 89.62  ? 62  GLY A N     1 
ATOM   743  C CA    . GLY C 3 62  ? -7.702  95.786 58.411  1.00 89.62  ? 62  GLY A CA    1 
ATOM   744  C C     . GLY C 3 62  ? -7.359  94.598 59.296  1.00 89.61  ? 62  GLY A C     1 
ATOM   745  O O     . GLY C 3 62  ? -7.093  94.762 60.488  1.00 89.62  ? 62  GLY A O     1 
ATOM   746  N N     . ILE C 3 63  ? -7.360  93.403 58.712  1.00 59.11  ? 63  ILE A N     1 
ATOM   747  C CA    . ILE C 3 63  ? -7.067  92.174 59.446  1.00 53.32  ? 63  ILE A CA    1 
ATOM   748  C C     . ILE C 3 63  ? -5.846  91.473 58.867  1.00 51.89  ? 63  ILE A C     1 
ATOM   749  O O     . ILE C 3 63  ? -5.586  91.545 57.667  1.00 51.48  ? 63  ILE A O     1 
ATOM   750  C CB    . ILE C 3 63  ? -8.261  91.191 59.379  1.00 31.33  ? 63  ILE A CB    1 
ATOM   751  C CG1   . ILE C 3 63  ? -9.507  91.850 59.972  1.00 30.03  ? 63  ILE A CG1   1 
ATOM   752  C CG2   . ILE C 3 63  ? -7.926  89.892 60.113  1.00 30.33  ? 63  ILE A CG2   1 
ATOM   753  C CD1   . ILE C 3 63  ? -10.750 91.000 59.883  1.00 30.95  ? 63  ILE A CD1   1 
ATOM   754  N N     . VAL C 3 64  ? -5.098  90.793 59.724  1.00 40.77  ? 64  VAL A N     1 
ATOM   755  C CA    . VAL C 3 64  ? -3.923  90.075 59.268  1.00 37.47  ? 64  VAL A CA    1 
ATOM   756  C C     . VAL C 3 64  ? -4.002  88.630 59.699  1.00 35.29  ? 64  VAL A C     1 
ATOM   757  O O     . VAL C 3 64  ? -3.962  88.324 60.889  1.00 34.69  ? 64  VAL A O     1 
ATOM   758  C CB    . VAL C 3 64  ? -2.624  90.656 59.841  1.00 43.36  ? 64  VAL A CB    1 
ATOM   759  C CG1   . VAL C 3 64  ? -1.415  89.992 59.174  1.00 42.73  ? 64  VAL A CG1   1 
ATOM   760  C CG2   . VAL C 3 64  ? -2.599  92.149 59.634  1.00 44.53  ? 64  VAL A CG2   1 
ATOM   761  N N     . PRO C 3 65  ? -4.129  87.719 58.731  1.00 31.67  ? 65  PRO A N     1 
ATOM   762  C CA    . PRO C 3 65  ? -4.203  86.303 59.069  1.00 29.35  ? 65  PRO A CA    1 
ATOM   763  C C     . PRO C 3 65  ? -3.049  85.840 59.971  1.00 28.98  ? 65  PRO A C     1 
ATOM   764  O O     . PRO C 3 65  ? -1.903  86.302 59.870  1.00 28.29  ? 65  PRO A O     1 
ATOM   765  C CB    . PRO C 3 65  ? -4.219  85.616 57.695  1.00 39.33  ? 65  PRO A CB    1 
ATOM   766  C CG    . PRO C 3 65  ? -3.660  86.653 56.752  1.00 39.59  ? 65  PRO A CG    1 
ATOM   767  C CD    . PRO C 3 65  ? -4.245  87.920 57.278  1.00 38.82  ? 65  PRO A CD    1 
ATOM   768  N N     . THR C 3 66  ? -3.382  84.923 60.868  1.00 31.62  ? 66  THR A N     1 
ATOM   769  C CA    . THR C 3 66  ? -2.430  84.372 61.813  1.00 28.35  ? 66  THR A CA    1 
ATOM   770  C C     . THR C 3 66  ? -1.856  83.033 61.348  1.00 25.81  ? 66  THR A C     1 
ATOM   771  O O     . THR C 3 66  ? -2.595  82.093 61.064  1.00 24.77  ? 66  THR A O     1 
ATOM   772  C CB    . THR C 3 66  ? -3.115  84.181 63.167  1.00 26.76  ? 66  THR A CB    1 
ATOM   773  O OG1   . THR C 3 66  ? -3.453  85.464 63.706  1.00 27.73  ? 66  THR A OG1   1 
ATOM   774  C CG2   . THR C 3 66  ? -2.216  83.427 64.124  1.00 26.97  ? 66  THR A CG2   1 
ATOM   775  N N     . LEU C 3 67  ? -0.535  82.951 61.265  1.00 26.22  ? 67  LEU A N     1 
ATOM   776  C CA    . LEU C 3 67  ? 0.109   81.715 60.861  1.00 25.37  ? 67  LEU A CA    1 
ATOM   777  C C     . LEU C 3 67  ? -0.097  80.694 61.966  1.00 24.85  ? 67  LEU A C     1 
ATOM   778  O O     . LEU C 3 67  ? 0.260   80.945 63.117  1.00 25.98  ? 67  LEU A O     1 
ATOM   779  C CB    . LEU C 3 67  ? 1.589   81.960 60.627  1.00 23.47  ? 67  LEU A CB    1 
ATOM   780  C CG    . LEU C 3 67  ? 1.969   82.272 59.175  1.00 26.03  ? 67  LEU A CG    1 
ATOM   781  C CD1   . LEU C 3 67  ? 0.945   83.159 58.490  1.00 21.65  ? 67  LEU A CD1   1 
ATOM   782  C CD2   . LEU C 3 67  ? 3.347   82.905 59.183  1.00 25.38  ? 67  LEU A CD2   1 
ATOM   783  N N     . GLN C 3 68  ? -0.671  79.545 61.611  1.00 25.28  ? 68  GLN A N     1 
ATOM   784  C CA    . GLN C 3 68  ? -0.972  78.490 62.579  1.00 24.28  ? 68  GLN A CA    1 
ATOM   785  C C     . GLN C 3 68  ? -0.128  77.237 62.460  1.00 24.42  ? 68  GLN A C     1 
ATOM   786  O O     . GLN C 3 68  ? -0.005  76.474 63.413  1.00 25.04  ? 68  GLN A O     1 
ATOM   787  C CB    . GLN C 3 68  ? -2.432  78.061 62.449  1.00 23.59  ? 68  GLN A CB    1 
ATOM   788  C CG    . GLN C 3 68  ? -3.428  79.187 62.515  1.00 21.33  ? 68  GLN A CG    1 
ATOM   789  C CD    . GLN C 3 68  ? -3.681  79.652 63.919  1.00 20.88  ? 68  GLN A CD    1 
ATOM   790  O OE1   . GLN C 3 68  ? -4.578  80.463 64.158  1.00 23.91  ? 68  GLN A OE1   1 
ATOM   791  N NE2   . GLN C 3 68  ? -2.899  79.138 64.867  1.00 20.18  ? 68  GLN A NE2   1 
ATOM   792  N N     . ASN C 3 69  ? 0.456   77.008 61.299  1.00 23.66  ? 69  ASN A N     1 
ATOM   793  C CA    . ASN C 3 69  ? 1.221   75.786 61.136  1.00 23.57  ? 69  ASN A CA    1 
ATOM   794  C C     . ASN C 3 69  ? 2.177   75.885 59.965  1.00 23.09  ? 69  ASN A C     1 
ATOM   795  O O     . ASN C 3 69  ? 1.819   76.386 58.904  1.00 23.13  ? 69  ASN A O     1 
ATOM   796  C CB    . ASN C 3 69  ? 0.224   74.630 60.947  1.00 24.86  ? 69  ASN A CB    1 
ATOM   797  C CG    . ASN C 3 69  ? 0.891   73.305 60.656  1.00 25.13  ? 69  ASN A CG    1 
ATOM   798  O OD1   . ASN C 3 69  ? 1.849   72.915 61.328  1.00 24.63  ? 69  ASN A OD1   1 
ATOM   799  N ND2   . ASN C 3 69  ? 0.370   72.589 59.657  1.00 25.58  ? 69  ASN A ND2   1 
ATOM   800  N N     . ILE C 3 70  ? 3.402   75.416 60.163  1.00 27.29  ? 70  ILE A N     1 
ATOM   801  C CA    . ILE C 3 70  ? 4.391   75.445 59.097  1.00 27.49  ? 70  ILE A CA    1 
ATOM   802  C C     . ILE C 3 70  ? 5.074   74.091 59.003  1.00 27.04  ? 70  ILE A C     1 
ATOM   803  O O     . ILE C 3 70  ? 5.567   73.564 59.997  1.00 27.86  ? 70  ILE A O     1 
ATOM   804  C CB    . ILE C 3 70  ? 5.430   76.572 59.336  1.00 24.42  ? 70  ILE A CB    1 
ATOM   805  C CG1   . ILE C 3 70  ? 4.724   77.928 59.248  1.00 25.05  ? 70  ILE A CG1   1 
ATOM   806  C CG2   . ILE C 3 70  ? 6.550   76.503 58.307  1.00 22.90  ? 70  ILE A CG2   1 
ATOM   807  C CD1   . ILE C 3 70  ? 5.630   79.105 59.414  1.00 26.00  ? 70  ILE A CD1   1 
ATOM   808  N N     . VAL C 3 71  ? 5.068   73.523 57.803  1.00 25.74  ? 71  VAL A N     1 
ATOM   809  C CA    . VAL C 3 71  ? 5.680   72.226 57.546  1.00 25.68  ? 71  VAL A CA    1 
ATOM   810  C C     . VAL C 3 71  ? 6.976   72.418 56.771  1.00 26.38  ? 71  VAL A C     1 
ATOM   811  O O     . VAL C 3 71  ? 6.994   73.063 55.727  1.00 28.25  ? 71  VAL A O     1 
ATOM   812  C CB    . VAL C 3 71  ? 4.744   71.323 56.728  1.00 15.76  ? 71  VAL A CB    1 
ATOM   813  C CG1   . VAL C 3 71  ? 5.433   70.028 56.401  1.00 14.44  ? 71  VAL A CG1   1 
ATOM   814  C CG2   . VAL C 3 71  ? 3.477   71.051 57.508  1.00 15.60  ? 71  VAL A CG2   1 
ATOM   815  N N     . ALA C 3 72  ? 8.060   71.852 57.287  1.00 23.33  ? 72  ALA A N     1 
ATOM   816  C CA    . ALA C 3 72  ? 9.362   71.972 56.652  1.00 24.97  ? 72  ALA A CA    1 
ATOM   817  C C     . ALA C 3 72  ? 10.062  70.623 56.551  1.00 26.16  ? 72  ALA A C     1 
ATOM   818  O O     . ALA C 3 72  ? 9.803   69.722 57.342  1.00 25.93  ? 72  ALA A O     1 
ATOM   819  C CB    . ALA C 3 72  ? 10.230  72.947 57.449  1.00 16.66  ? 72  ALA A CB    1 
ATOM   820  N N     . THR C 3 73  ? 10.939  70.487 55.563  1.00 30.31  ? 73  THR A N     1 
ATOM   821  C CA    . THR C 3 73  ? 11.707  69.263 55.383  1.00 33.26  ? 73  THR A CA    1 
ATOM   822  C C     . THR C 3 73  ? 13.178  69.578 55.626  1.00 35.00  ? 73  THR A C     1 
ATOM   823  O O     . THR C 3 73  ? 13.627  70.707 55.404  1.00 35.98  ? 73  THR A O     1 
ATOM   824  C CB    . THR C 3 73  ? 11.559  68.681 53.960  1.00 31.96  ? 73  THR A CB    1 
ATOM   825  O OG1   . THR C 3 73  ? 11.850  69.695 52.991  1.00 34.66  ? 73  THR A OG1   1 
ATOM   826  C CG2   . THR C 3 73  ? 10.158  68.133 53.747  1.00 31.14  ? 73  THR A CG2   1 
ATOM   827  N N     . VAL C 3 74  ? 13.917  68.580 56.097  1.00 48.13  ? 74  VAL A N     1 
ATOM   828  C CA    . VAL C 3 74  ? 15.337  68.739 56.369  1.00 49.36  ? 74  VAL A CA    1 
ATOM   829  C C     . VAL C 3 74  ? 16.066  67.435 56.079  1.00 50.85  ? 74  VAL A C     1 
ATOM   830  O O     . VAL C 3 74  ? 15.654  66.375 56.552  1.00 53.52  ? 74  VAL A O     1 
ATOM   831  C CB    . VAL C 3 74  ? 15.590  69.115 57.849  1.00 29.73  ? 74  VAL A CB    1 
ATOM   832  C CG1   . VAL C 3 74  ? 17.081  69.287 58.100  1.00 29.12  ? 74  VAL A CG1   1 
ATOM   833  C CG2   . VAL C 3 74  ? 14.856  70.394 58.191  1.00 30.52  ? 74  VAL A CG2   1 
ATOM   834  N N     . THR C 3 75  ? 17.134  67.513 55.287  1.00 37.07  ? 75  THR A N     1 
ATOM   835  C CA    . THR C 3 75  ? 17.944  66.340 54.971  1.00 36.88  ? 75  THR A CA    1 
ATOM   836  C C     . THR C 3 75  ? 19.086  66.345 55.977  1.00 35.13  ? 75  THR A C     1 
ATOM   837  O O     . THR C 3 75  ? 19.859  67.293 56.011  1.00 34.48  ? 75  THR A O     1 
ATOM   838  C CB    . THR C 3 75  ? 18.557  66.420 53.561  1.00 38.90  ? 75  THR A CB    1 
ATOM   839  O OG1   . THR C 3 75  ? 17.521  66.430 52.571  1.00 40.21  ? 75  THR A OG1   1 
ATOM   840  C CG2   . THR C 3 75  ? 19.453  65.229 53.317  1.00 38.51  ? 75  THR A CG2   1 
ATOM   841  N N     . LEU C 3 76  ? 19.186  65.310 56.809  1.00 47.43  ? 76  LEU A N     1 
ATOM   842  C CA    . LEU C 3 76  ? 20.258  65.246 57.802  1.00 47.27  ? 76  LEU A CA    1 
ATOM   843  C C     . LEU C 3 76  ? 21.521  64.641 57.190  1.00 48.65  ? 76  LEU A C     1 
ATOM   844  O O     . LEU C 3 76  ? 22.572  64.577 57.826  1.00 47.81  ? 76  LEU A O     1 
ATOM   845  C CB    . LEU C 3 76  ? 19.808  64.441 59.032  1.00 27.17  ? 76  LEU A CB    1 
ATOM   846  C CG    . LEU C 3 76  ? 18.719  65.088 59.906  1.00 25.90  ? 76  LEU A CG    1 
ATOM   847  C CD1   . LEU C 3 76  ? 18.244  64.104 60.967  1.00 26.25  ? 76  LEU A CD1   1 
ATOM   848  C CD2   . LEU C 3 76  ? 19.253  66.357 60.553  1.00 25.47  ? 76  LEU A CD2   1 
ATOM   849  N N     . GLY C 3 77  ? 21.403  64.202 55.943  1.00 45.21  ? 77  GLY A N     1 
ATOM   850  C CA    . GLY C 3 77  ? 22.534  63.629 55.238  1.00 48.07  ? 77  GLY A CA    1 
ATOM   851  C C     . GLY C 3 77  ? 23.293  62.512 55.930  1.00 50.04  ? 77  GLY A C     1 
ATOM   852  O O     . GLY C 3 77  ? 24.468  62.678 56.257  1.00 51.52  ? 77  GLY A O     1 
ATOM   853  N N     . CYS C 3 78  ? 22.622  61.381 56.147  1.00 52.94  ? 78  CYS A N     1 
ATOM   854  C CA    . CYS C 3 78  ? 23.213  60.198 56.776  1.00 52.52  ? 78  CYS A CA    1 
ATOM   855  C C     . CYS C 3 78  ? 22.116  59.217 57.191  1.00 53.23  ? 78  CYS A C     1 
ATOM   856  O O     . CYS C 3 78  ? 21.131  59.602 57.820  1.00 54.20  ? 78  CYS A O     1 
ATOM   857  C CB    . CYS C 3 78  ? 24.066  60.581 57.995  1.00 43.75  ? 78  CYS A CB    1 
ATOM   858  S SG    . CYS C 3 78  ? 23.250  60.479 59.587  1.00 43.28  ? 78  CYS A SG    1 
ATOM   859  N N     . ARG C 3 79  ? 22.289  57.951 56.818  1.00 44.15  ? 79  ARG A N     1 
ATOM   860  C CA    . ARG C 3 79  ? 21.329  56.895 57.135  1.00 42.96  ? 79  ARG A CA    1 
ATOM   861  C C     . ARG C 3 79  ? 21.053  56.793 58.631  1.00 41.07  ? 79  ARG A C     1 
ATOM   862  O O     . ARG C 3 79  ? 21.919  57.089 59.449  1.00 40.82  ? 79  ARG A O     1 
ATOM   863  C CB    . ARG C 3 79  ? 21.851  55.557 56.613  1.00 54.39  ? 79  ARG A CB    1 
ATOM   864  C CG    . ARG C 3 79  ? 21.486  55.280 55.181  1.00 54.64  ? 79  ARG A CG    1 
ATOM   865  C CD    . ARG C 3 79  ? 20.091  54.728 55.129  1.00 57.57  ? 79  ARG A CD    1 
ATOM   866  N NE    . ARG C 3 79  ? 19.508  54.824 53.799  1.00 62.09  ? 79  ARG A NE    1 
ATOM   867  C CZ    . ARG C 3 79  ? 18.309  54.349 53.481  1.00 65.32  ? 79  ARG A CZ    1 
ATOM   868  N NH1   . ARG C 3 79  ? 17.570  53.738 54.401  1.00 65.49  ? 79  ARG A NH1   1 
ATOM   869  N NH2   . ARG C 3 79  ? 17.839  54.498 52.247  1.00 68.82  ? 79  ARG A NH2   1 
ATOM   870  N N     . LEU C 3 80  ? 19.850  56.360 58.991  1.00 37.81  ? 80  LEU A N     1 
ATOM   871  C CA    . LEU C 3 80  ? 19.493  56.242 60.404  1.00 36.02  ? 80  LEU A CA    1 
ATOM   872  C C     . LEU C 3 80  ? 18.903  54.893 60.804  1.00 35.75  ? 80  LEU A C     1 
ATOM   873  O O     . LEU C 3 80  ? 18.244  54.226 60.006  1.00 35.32  ? 80  LEU A O     1 
ATOM   874  C CB    . LEU C 3 80  ? 18.491  57.338 60.785  1.00 27.89  ? 80  LEU A CB    1 
ATOM   875  C CG    . LEU C 3 80  ? 18.931  58.796 60.711  1.00 25.28  ? 80  LEU A CG    1 
ATOM   876  C CD1   . LEU C 3 80  ? 17.764  59.674 61.101  1.00 24.86  ? 80  LEU A CD1   1 
ATOM   877  C CD2   . LEU C 3 80  ? 20.117  59.030 61.631  1.00 23.00  ? 80  LEU A CD2   1 
ATOM   878  N N     . ASP C 3 81  ? 19.164  54.491 62.045  1.00 43.09  ? 81  ASP A N     1 
ATOM   879  C CA    . ASP C 3 81  ? 18.605  53.251 62.576  1.00 43.52  ? 81  ASP A CA    1 
ATOM   880  C C     . ASP C 3 81  ? 17.453  53.778 63.400  1.00 42.82  ? 81  ASP A C     1 
ATOM   881  O O     . ASP C 3 81  ? 17.652  54.254 64.517  1.00 41.90  ? 81  ASP A O     1 
ATOM   882  C CB    . ASP C 3 81  ? 19.583  52.521 63.504  1.00 53.89  ? 81  ASP A CB    1 
ATOM   883  C CG    . ASP C 3 81  ? 19.041  51.174 63.980  1.00 54.89  ? 81  ASP A CG    1 
ATOM   884  O OD1   . ASP C 3 81  ? 19.405  50.738 65.091  1.00 55.77  ? 81  ASP A OD1   1 
ATOM   885  O OD2   . ASP C 3 81  ? 18.258  50.543 63.238  1.00 55.07  ? 81  ASP A OD2   1 
ATOM   886  N N     . LEU C 3 82  ? 16.252  53.713 62.839  1.00 39.19  ? 82  LEU A N     1 
ATOM   887  C CA    . LEU C 3 82  ? 15.087  54.227 63.528  1.00 37.77  ? 82  LEU A CA    1 
ATOM   888  C C     . LEU C 3 82  ? 14.889  53.532 64.867  1.00 38.86  ? 82  LEU A C     1 
ATOM   889  O O     . LEU C 3 82  ? 14.531  54.166 65.861  1.00 38.78  ? 82  LEU A O     1 
ATOM   890  C CB    . LEU C 3 82  ? 13.854  54.087 62.627  1.00 20.45  ? 82  LEU A CB    1 
ATOM   891  C CG    . LEU C 3 82  ? 13.965  54.805 61.266  1.00 16.88  ? 82  LEU A CG    1 
ATOM   892  C CD1   . LEU C 3 82  ? 12.580  54.918 60.633  1.00 15.53  ? 82  LEU A CD1   1 
ATOM   893  C CD2   . LEU C 3 82  ? 14.569  56.201 61.440  1.00 15.72  ? 82  LEU A CD2   1 
ATOM   894  N N     . LYS C 3 83  ? 15.161  52.235 64.899  1.00 41.62  ? 83  LYS A N     1 
ATOM   895  C CA    . LYS C 3 83  ? 15.010  51.459 66.121  1.00 43.56  ? 83  LYS A CA    1 
ATOM   896  C C     . LYS C 3 83  ? 15.891  52.019 67.223  1.00 43.73  ? 83  LYS A C     1 
ATOM   897  O O     . LYS C 3 83  ? 15.509  52.008 68.384  1.00 46.31  ? 83  LYS A O     1 
ATOM   898  C CB    . LYS C 3 83  ? 15.376  49.999 65.870  1.00 56.03  ? 83  LYS A CB    1 
ATOM   899  C CG    . LYS C 3 83  ? 14.470  49.007 66.573  1.00 59.90  ? 83  LYS A CG    1 
ATOM   900  C CD    . LYS C 3 83  ? 14.469  49.201 68.071  1.00 63.59  ? 83  LYS A CD    1 
ATOM   901  C CE    . LYS C 3 83  ? 13.652  48.115 68.744  1.00 67.53  ? 83  LYS A CE    1 
ATOM   902  N NZ    . LYS C 3 83  ? 14.165  46.745 68.427  1.00 70.93  ? 83  LYS A NZ    1 
ATOM   903  N N     . THR C 3 84  ? 17.067  52.514 66.861  1.00 37.54  ? 84  THR A N     1 
ATOM   904  C CA    . THR C 3 84  ? 17.989  53.074 67.848  1.00 36.47  ? 84  THR A CA    1 
ATOM   905  C C     . THR C 3 84  ? 17.554  54.457 68.302  1.00 36.84  ? 84  THR A C     1 
ATOM   906  O O     . THR C 3 84  ? 17.686  54.803 69.478  1.00 36.76  ? 84  THR A O     1 
ATOM   907  C CB    . THR C 3 84  ? 19.433  53.181 67.290  1.00 50.25  ? 84  THR A CB    1 
ATOM   908  O OG1   . THR C 3 84  ? 19.968  51.868 67.082  1.00 50.05  ? 84  THR A OG1   1 
ATOM   909  C CG2   . THR C 3 84  ? 20.330  53.934 68.262  1.00 48.32  ? 84  THR A CG2   1 
ATOM   910  N N     . VAL C 3 85  ? 17.053  55.253 67.364  1.00 34.26  ? 85  VAL A N     1 
ATOM   911  C CA    . VAL C 3 85  ? 16.598  56.604 67.675  1.00 32.89  ? 85  VAL A CA    1 
ATOM   912  C C     . VAL C 3 85  ? 15.468  56.506 68.687  1.00 31.71  ? 85  VAL A C     1 
ATOM   913  O O     . VAL C 3 85  ? 15.483  57.170 69.722  1.00 29.82  ? 85  VAL A O     1 
ATOM   914  C CB    . VAL C 3 85  ? 16.081  57.329 66.404  1.00 63.44  ? 85  VAL A CB    1 
ATOM   915  C CG1   . VAL C 3 85  ? 15.441  58.657 66.780  1.00 62.73  ? 85  VAL A CG1   1 
ATOM   916  C CG2   . VAL C 3 85  ? 17.232  57.558 65.429  1.00 63.39  ? 85  VAL A CG2   1 
ATOM   917  N N     . ALA C 3 86  ? 14.498  55.654 68.375  1.00 36.65  ? 86  ALA A N     1 
ATOM   918  C CA    . ALA C 3 86  ? 13.347  55.447 69.231  1.00 37.39  ? 86  ALA A CA    1 
ATOM   919  C C     . ALA C 3 86  ? 13.762  55.010 70.630  1.00 38.87  ? 86  ALA A C     1 
ATOM   920  O O     . ALA C 3 86  ? 13.073  55.303 71.610  1.00 40.87  ? 86  ALA A O     1 
ATOM   921  C CB    . ALA C 3 86  ? 12.428  54.404 68.609  1.00 15.87  ? 86  ALA A CB    1 
ATOM   922  N N     . LEU C 3 87  ? 14.892  54.317 70.728  1.00 39.54  ? 87  LEU A N     1 
ATOM   923  C CA    . LEU C 3 87  ? 15.375  53.824 72.017  1.00 38.55  ? 87  LEU A CA    1 
ATOM   924  C C     . LEU C 3 87  ? 16.126  54.835 72.871  1.00 38.87  ? 87  LEU A C     1 
ATOM   925  O O     . LEU C 3 87  ? 16.057  54.790 74.102  1.00 37.49  ? 87  LEU A O     1 
ATOM   926  C CB    . LEU C 3 87  ? 16.267  52.605 71.800  1.00 45.17  ? 87  LEU A CB    1 
ATOM   927  C CG    . LEU C 3 87  ? 15.684  51.219 72.070  1.00 42.80  ? 87  LEU A CG    1 
ATOM   928  C CD1   . LEU C 3 87  ? 14.223  51.118 71.655  1.00 43.71  ? 87  LEU A CD1   1 
ATOM   929  C CD2   . LEU C 3 87  ? 16.528  50.217 71.314  1.00 42.88  ? 87  LEU A CD2   1 
ATOM   930  N N     . HIS C 3 88  ? 16.834  55.752 72.224  1.00 45.91  ? 88  HIS A N     1 
ATOM   931  C CA    . HIS C 3 88  ? 17.610  56.738 72.959  1.00 49.19  ? 88  HIS A CA    1 
ATOM   932  C C     . HIS C 3 88  ? 17.005  58.142 73.071  1.00 50.11  ? 88  HIS A C     1 
ATOM   933  O O     . HIS C 3 88  ? 17.433  58.942 73.904  1.00 51.60  ? 88  HIS A O     1 
ATOM   934  C CB    . HIS C 3 88  ? 19.014  56.794 72.363  1.00 55.58  ? 88  HIS A CB    1 
ATOM   935  C CG    . HIS C 3 88  ? 19.702  55.464 72.349  1.00 58.99  ? 88  HIS A CG    1 
ATOM   936  N ND1   . HIS C 3 88  ? 19.907  54.723 73.493  1.00 59.43  ? 88  HIS A ND1   1 
ATOM   937  C CD2   . HIS C 3 88  ? 20.186  54.720 71.328  1.00 60.05  ? 88  HIS A CD2   1 
ATOM   938  C CE1   . HIS C 3 88  ? 20.484  53.577 73.176  1.00 59.95  ? 88  HIS A CE1   1 
ATOM   939  N NE2   . HIS C 3 88  ? 20.664  53.551 71.869  1.00 60.85  ? 88  HIS A NE2   1 
ATOM   940  N N     . ALA C 3 89  ? 16.007  58.445 72.249  1.00 38.19  ? 89  ALA A N     1 
ATOM   941  C CA    . ALA C 3 89  ? 15.370  59.752 72.305  1.00 36.57  ? 89  ALA A CA    1 
ATOM   942  C C     . ALA C 3 89  ? 14.122  59.669 73.179  1.00 35.91  ? 89  ALA A C     1 
ATOM   943  O O     . ALA C 3 89  ? 13.436  58.651 73.183  1.00 35.41  ? 89  ALA A O     1 
ATOM   944  C CB    . ALA C 3 89  ? 14.999  60.201 70.908  1.00 24.27  ? 89  ALA A CB    1 
ATOM   945  N N     . ARG C 3 90  ? 13.833  60.729 73.930  1.00 43.18  ? 90  ARG A N     1 
ATOM   946  C CA    . ARG C 3 90  ? 12.644  60.735 74.775  1.00 42.90  ? 90  ARG A CA    1 
ATOM   947  C C     . ARG C 3 90  ? 11.489  61.250 73.925  1.00 40.15  ? 90  ARG A C     1 
ATOM   948  O O     . ARG C 3 90  ? 11.709  61.898 72.901  1.00 39.65  ? 90  ARG A O     1 
ATOM   949  C CB    . ARG C 3 90  ? 12.831  61.648 75.987  1.00 62.00  ? 90  ARG A CB    1 
ATOM   950  C CG    . ARG C 3 90  ? 14.253  61.744 76.482  1.00 69.02  ? 90  ARG A CG    1 
ATOM   951  C CD    . ARG C 3 90  ? 14.308  62.017 77.974  1.00 76.87  ? 90  ARG A CD    1 
ATOM   952  N NE    . ARG C 3 90  ? 14.008  60.812 78.744  1.00 84.64  ? 90  ARG A NE    1 
ATOM   953  C CZ    . ARG C 3 90  ? 14.062  60.728 80.073  1.00 88.73  ? 90  ARG A CZ    1 
ATOM   954  N NH1   . ARG C 3 90  ? 13.772  59.580 80.677  1.00 89.82  ? 90  ARG A NH1   1 
ATOM   955  N NH2   . ARG C 3 90  ? 14.403  61.788 80.799  1.00 89.82  ? 90  ARG A NH2   1 
ATOM   956  N N     . ASN C 3 91  ? 10.262  60.946 74.337  1.00 35.92  ? 91  ASN A N     1 
ATOM   957  C CA    . ASN C 3 91  ? 9.075   61.397 73.615  1.00 32.87  ? 91  ASN A CA    1 
ATOM   958  C C     . ASN C 3 91  ? 9.051   60.949 72.156  1.00 31.25  ? 91  ASN A C     1 
ATOM   959  O O     . ASN C 3 91  ? 8.572   61.667 71.279  1.00 30.14  ? 91  ASN A O     1 
ATOM   960  C CB    . ASN C 3 91  ? 8.993   62.917 73.695  1.00 30.07  ? 91  ASN A CB    1 
ATOM   961  C CG    . ASN C 3 91  ? 9.165   63.416 75.102  1.00 28.84  ? 91  ASN A CG    1 
ATOM   962  O OD1   . ASN C 3 91  ? 8.433   63.014 75.999  1.00 30.01  ? 91  ASN A OD1   1 
ATOM   963  N ND2   . ASN C 3 91  ? 10.137  64.290 75.311  1.00 28.26  ? 91  ASN A ND2   1 
ATOM   964  N N     . ALA C 3 92  ? 9.561   59.750 71.912  1.00 28.00  ? 92  ALA A N     1 
ATOM   965  C CA    . ALA C 3 92  ? 9.611   59.195 70.575  1.00 25.18  ? 92  ALA A CA    1 
ATOM   966  C C     . ALA C 3 92  ? 8.759   57.950 70.492  1.00 24.45  ? 92  ALA A C     1 
ATOM   967  O O     . ALA C 3 92  ? 8.715   57.157 71.426  1.00 25.81  ? 92  ALA A O     1 
ATOM   968  C CB    . ALA C 3 92  ? 11.043  58.852 70.218  1.00 11.31  ? 92  ALA A CB    1 
ATOM   969  N N     . GLU C 3 93  ? 8.060   57.786 69.380  1.00 22.73  ? 93  GLU A N     1 
ATOM   970  C CA    . GLU C 3 93  ? 7.261   56.593 69.177  1.00 22.72  ? 93  GLU A CA    1 
ATOM   971  C C     . GLU C 3 93  ? 7.600   56.020 67.815  1.00 22.64  ? 93  GLU A C     1 
ATOM   972  O O     . GLU C 3 93  ? 7.702   56.745 66.831  1.00 23.74  ? 93  GLU A O     1 
ATOM   973  C CB    . GLU C 3 93  ? 5.755   56.876 69.325  1.00 29.91  ? 93  GLU A CB    1 
ATOM   974  C CG    . GLU C 3 93  ? 5.233   58.196 68.808  1.00 32.33  ? 93  GLU A CG    1 
ATOM   975  C CD    . GLU C 3 93  ? 3.748   58.378 69.114  1.00 34.36  ? 93  GLU A CD    1 
ATOM   976  O OE1   . GLU C 3 93  ? 2.953   57.462 68.808  1.00 37.01  ? 93  GLU A OE1   1 
ATOM   977  O OE2   . GLU C 3 93  ? 3.369   59.433 69.656  1.00 34.52  ? 93  GLU A OE2   1 
ATOM   978  N N     . TYR C 3 94  ? 7.834   54.714 67.775  1.00 24.34  ? 94  TYR A N     1 
ATOM   979  C CA    . TYR C 3 94  ? 8.184   54.041 66.534  1.00 24.01  ? 94  TYR A CA    1 
ATOM   980  C C     . TYR C 3 94  ? 7.365   52.766 66.378  1.00 23.64  ? 94  TYR A C     1 
ATOM   981  O O     . TYR C 3 94  ? 7.471   51.847 67.179  1.00 24.80  ? 94  TYR A O     1 
ATOM   982  C CB    . TYR C 3 94  ? 9.678   53.729 66.523  1.00 35.85  ? 94  TYR A CB    1 
ATOM   983  C CG    . TYR C 3 94  ? 10.128  53.006 65.289  1.00 40.56  ? 94  TYR A CG    1 
ATOM   984  C CD1   . TYR C 3 94  ? 9.782   53.471 64.027  1.00 43.20  ? 94  TYR A CD1   1 
ATOM   985  C CD2   . TYR C 3 94  ? 10.890  51.843 65.378  1.00 43.76  ? 94  TYR A CD2   1 
ATOM   986  C CE1   . TYR C 3 94  ? 10.179  52.790 62.872  1.00 45.08  ? 94  TYR A CE1   1 
ATOM   987  C CE2   . TYR C 3 94  ? 11.295  51.155 64.235  1.00 45.19  ? 94  TYR A CE2   1 
ATOM   988  C CZ    . TYR C 3 94  ? 10.935  51.633 62.982  1.00 45.52  ? 94  TYR A CZ    1 
ATOM   989  O OH    . TYR C 3 94  ? 11.316  50.955 61.842  1.00 47.55  ? 94  TYR A OH    1 
ATOM   990  N N     . ASN C 3 95  ? 6.527   52.733 65.350  1.00 22.26  ? 95  ASN A N     1 
ATOM   991  C CA    . ASN C 3 95  ? 5.672   51.586 65.078  1.00 23.81  ? 95  ASN A CA    1 
ATOM   992  C C     . ASN C 3 95  ? 5.735   51.301 63.576  1.00 26.04  ? 95  ASN A C     1 
ATOM   993  O O     . ASN C 3 95  ? 4.771   51.527 62.846  1.00 25.15  ? 95  ASN A O     1 
ATOM   994  C CB    . ASN C 3 95  ? 4.238   51.908 65.512  1.00 33.66  ? 95  ASN A CB    1 
ATOM   995  C CG    . ASN C 3 95  ? 3.276   50.764 65.266  1.00 34.40  ? 95  ASN A CG    1 
ATOM   996  O OD1   . ASN C 3 95  ? 3.673   49.679 64.845  1.00 37.44  ? 95  ASN A OD1   1 
ATOM   997  N ND2   . ASN C 3 95  ? 2.001   51.000 65.534  1.00 33.53  ? 95  ASN A ND2   1 
ATOM   998  N N     . PRO C 3 96  ? 6.879   50.787 63.101  1.00 44.20  ? 96  PRO A N     1 
ATOM   999  C CA    . PRO C 3 96  ? 7.079   50.476 61.682  1.00 44.60  ? 96  PRO A CA    1 
ATOM   1000 C C     . PRO C 3 96  ? 5.917   49.764 61.004  1.00 47.69  ? 96  PRO A C     1 
ATOM   1001 O O     . PRO C 3 96  ? 5.686   49.951 59.812  1.00 47.89  ? 96  PRO A O     1 
ATOM   1002 C CB    . PRO C 3 96  ? 8.361   49.644 61.685  1.00 32.81  ? 96  PRO A CB    1 
ATOM   1003 C CG    . PRO C 3 96  ? 8.349   49.009 63.040  1.00 31.73  ? 96  PRO A CG    1 
ATOM   1004 C CD    . PRO C 3 96  ? 7.933   50.162 63.915  1.00 31.53  ? 96  PRO A CD    1 
ATOM   1005 N N     . LYS C 3 97  ? 5.182   48.958 61.761  1.00 36.48  ? 97  LYS A N     1 
ATOM   1006 C CA    . LYS C 3 97  ? 4.048   48.227 61.214  1.00 39.76  ? 97  LYS A CA    1 
ATOM   1007 C C     . LYS C 3 97  ? 3.004   49.170 60.610  1.00 38.93  ? 97  LYS A C     1 
ATOM   1008 O O     . LYS C 3 97  ? 2.189   48.747 59.796  1.00 39.01  ? 97  LYS A O     1 
ATOM   1009 C CB    . LYS C 3 97  ? 3.395   47.374 62.308  1.00 75.29  ? 97  LYS A CB    1 
ATOM   1010 C CG    . LYS C 3 97  ? 4.363   46.453 63.042  1.00 82.44  ? 97  LYS A CG    1 
ATOM   1011 C CD    . LYS C 3 97  ? 3.690   45.716 64.206  1.00 87.33  ? 97  LYS A CD    1 
ATOM   1012 C CE    . LYS C 3 97  ? 2.623   44.728 63.734  1.00 87.33  ? 97  LYS A CE    1 
ATOM   1013 N NZ    . LYS C 3 97  ? 2.018   43.963 64.865  1.00 87.33  ? 97  LYS A NZ    1 
ATOM   1014 N N     . ARG C 3 98  ? 3.025   50.444 60.995  1.00 48.52  ? 98  ARG A N     1 
ATOM   1015 C CA    . ARG C 3 98  ? 2.043   51.394 60.478  1.00 49.11  ? 98  ARG A CA    1 
ATOM   1016 C C     . ARG C 3 98  ? 2.640   52.598 59.762  1.00 46.01  ? 98  ARG A C     1 
ATOM   1017 O O     . ARG C 3 98  ? 1.985   53.215 58.912  1.00 46.92  ? 98  ARG A O     1 
ATOM   1018 C CB    . ARG C 3 98  ? 1.146   51.883 61.611  1.00 65.90  ? 98  ARG A CB    1 
ATOM   1019 C CG    . ARG C 3 98  ? 0.586   50.764 62.460  1.00 73.89  ? 98  ARG A CG    1 
ATOM   1020 C CD    . ARG C 3 98  ? -0.706  51.195 63.108  1.00 80.62  ? 98  ARG A CD    1 
ATOM   1021 N NE    . ARG C 3 98  ? -1.676  51.580 62.090  1.00 87.60  ? 98  ARG A NE    1 
ATOM   1022 C CZ    . ARG C 3 98  ? -2.183  50.743 61.194  1.00 87.77  ? 98  ARG A CZ    1 
ATOM   1023 N NH1   . ARG C 3 98  ? -1.816  49.466 61.193  1.00 87.77  ? 98  ARG A NH1   1 
ATOM   1024 N NH2   . ARG C 3 98  ? -3.048  51.186 60.291  1.00 87.77  ? 98  ARG A NH2   1 
ATOM   1025 N N     . PHE C 3 99  ? 3.875   52.936 60.113  1.00 32.45  ? 99  PHE A N     1 
ATOM   1026 C CA    . PHE C 3 99  ? 4.561   54.067 59.509  1.00 29.15  ? 99  PHE A CA    1 
ATOM   1027 C C     . PHE C 3 99  ? 6.061   53.841 59.686  1.00 27.07  ? 99  PHE A C     1 
ATOM   1028 O O     . PHE C 3 99  ? 6.536   53.661 60.803  1.00 26.39  ? 99  PHE A O     1 
ATOM   1029 C CB    . PHE C 3 99  ? 4.127   55.365 60.200  1.00 35.16  ? 99  PHE A CB    1 
ATOM   1030 C CG    . PHE C 3 99  ? 4.473   56.613 59.427  1.00 32.90  ? 99  PHE A CG    1 
ATOM   1031 C CD1   . PHE C 3 99  ? 5.102   57.681 60.054  1.00 30.81  ? 99  PHE A CD1   1 
ATOM   1032 C CD2   . PHE C 3 99  ? 4.162   56.721 58.071  1.00 32.07  ? 99  PHE A CD2   1 
ATOM   1033 C CE1   . PHE C 3 99  ? 5.416   58.831 59.346  1.00 31.27  ? 99  PHE A CE1   1 
ATOM   1034 C CE2   . PHE C 3 99  ? 4.472   57.873 57.354  1.00 30.51  ? 99  PHE A CE2   1 
ATOM   1035 C CZ    . PHE C 3 99  ? 5.101   58.928 57.993  1.00 30.77  ? 99  PHE A CZ    1 
ATOM   1036 N N     . ALA C 3 100 ? 6.804   53.851 58.585  1.00 34.89  ? 100 ALA A N     1 
ATOM   1037 C CA    . ALA C 3 100 ? 8.238   53.612 58.643  1.00 33.72  ? 100 ALA A CA    1 
ATOM   1038 C C     . ALA C 3 100 ? 9.040   54.842 59.024  1.00 31.75  ? 100 ALA A C     1 
ATOM   1039 O O     . ALA C 3 100 ? 9.941   55.247 58.293  1.00 31.79  ? 100 ALA A O     1 
ATOM   1040 C CB    . ALA C 3 100 ? 8.731   53.061 57.303  1.00 57.65  ? 100 ALA A CB    1 
ATOM   1041 N N     . ALA C 3 101 ? 8.720   55.429 60.173  1.00 23.54  ? 101 ALA A N     1 
ATOM   1042 C CA    . ALA C 3 101 ? 9.427   56.613 60.648  1.00 23.46  ? 101 ALA A CA    1 
ATOM   1043 C C     . ALA C 3 101 ? 9.226   56.797 62.139  1.00 23.04  ? 101 ALA A C     1 
ATOM   1044 O O     . ALA C 3 101 ? 8.253   56.293 62.713  1.00 23.58  ? 101 ALA A O     1 
ATOM   1045 C CB    . ALA C 3 101 ? 8.939   57.857 59.909  1.00 42.83  ? 101 ALA A CB    1 
ATOM   1046 N N     . VAL C 3 102 ? 10.159  57.512 62.764  1.00 28.18  ? 102 VAL A N     1 
ATOM   1047 C CA    . VAL C 3 102 ? 10.081  57.791 64.186  1.00 29.42  ? 102 VAL A CA    1 
ATOM   1048 C C     . VAL C 3 102 ? 9.434   59.155 64.355  1.00 28.01  ? 102 VAL A C     1 
ATOM   1049 O O     . VAL C 3 102 ? 9.831   60.140 63.721  1.00 27.63  ? 102 VAL A O     1 
ATOM   1050 C CB    . VAL C 3 102 ? 11.484  57.789 64.854  1.00 22.23  ? 102 VAL A CB    1 
ATOM   1051 C CG1   . VAL C 3 102 ? 11.402  58.340 66.275  1.00 20.25  ? 102 VAL A CG1   1 
ATOM   1052 C CG2   . VAL C 3 102 ? 12.024  56.372 64.890  1.00 21.86  ? 102 VAL A CG2   1 
ATOM   1053 N N     . ILE C 3 103 ? 8.411   59.192 65.198  1.00 31.83  ? 103 ILE A N     1 
ATOM   1054 C CA    . ILE C 3 103 ? 7.687   60.417 65.477  1.00 32.65  ? 103 ILE A CA    1 
ATOM   1055 C C     . ILE C 3 103 ? 8.253   60.968 66.773  1.00 30.56  ? 103 ILE A C     1 
ATOM   1056 O O     . ILE C 3 103 ? 8.242   60.298 67.795  1.00 33.86  ? 103 ILE A O     1 
ATOM   1057 C CB    . ILE C 3 103 ? 6.186   60.134 65.650  1.00 20.50  ? 103 ILE A CB    1 
ATOM   1058 C CG1   . ILE C 3 103 ? 5.644   59.430 64.405  1.00 17.85  ? 103 ILE A CG1   1 
ATOM   1059 C CG2   . ILE C 3 103 ? 5.438   61.432 65.896  1.00 18.27  ? 103 ILE A CG2   1 
ATOM   1060 C CD1   . ILE C 3 103 ? 4.256   58.875 64.590  1.00 18.86  ? 103 ILE A CD1   1 
ATOM   1061 N N     . MET C 3 104 ? 8.759   62.188 66.732  1.00 18.93  ? 104 MET A N     1 
ATOM   1062 C CA    . MET C 3 104 ? 9.336   62.780 67.919  1.00 20.60  ? 104 MET A CA    1 
ATOM   1063 C C     . MET C 3 104 ? 8.827   64.202 68.110  1.00 19.82  ? 104 MET A C     1 
ATOM   1064 O O     . MET C 3 104 ? 8.659   64.940 67.143  1.00 18.20  ? 104 MET A O     1 
ATOM   1065 C CB    . MET C 3 104 ? 10.853  62.781 67.794  1.00 28.19  ? 104 MET A CB    1 
ATOM   1066 C CG    . MET C 3 104 ? 11.561  63.002 69.098  1.00 31.13  ? 104 MET A CG    1 
ATOM   1067 S SD    . MET C 3 104 ? 13.291  63.338 68.843  1.00 35.84  ? 104 MET A SD    1 
ATOM   1068 C CE    . MET C 3 104 ? 13.820  61.853 67.944  1.00 34.19  ? 104 MET A CE    1 
ATOM   1069 N N     . ARG C 3 105 ? 8.583   64.581 69.360  1.00 27.09  ? 105 ARG A N     1 
ATOM   1070 C CA    . ARG C 3 105 ? 8.104   65.921 69.671  1.00 28.30  ? 105 ARG A CA    1 
ATOM   1071 C C     . ARG C 3 105 ? 9.009   66.636 70.656  1.00 30.86  ? 105 ARG A C     1 
ATOM   1072 O O     . ARG C 3 105 ? 9.676   66.011 71.479  1.00 32.09  ? 105 ARG A O     1 
ATOM   1073 C CB    . ARG C 3 105 ? 6.704   65.873 70.292  1.00 22.65  ? 105 ARG A CB    1 
ATOM   1074 C CG    . ARG C 3 105 ? 5.698   65.082 69.512  1.00 22.08  ? 105 ARG A CG    1 
ATOM   1075 C CD    . ARG C 3 105 ? 4.298   65.448 69.920  1.00 19.96  ? 105 ARG A CD    1 
ATOM   1076 N NE    . ARG C 3 105 ? 3.357   64.868 68.975  1.00 20.68  ? 105 ARG A NE    1 
ATOM   1077 C CZ    . ARG C 3 105 ? 3.084   63.573 68.920  1.00 20.29  ? 105 ARG A CZ    1 
ATOM   1078 N NH1   . ARG C 3 105 ? 2.225   63.105 68.027  1.00 19.15  ? 105 ARG A NH1   1 
ATOM   1079 N NH2   . ARG C 3 105 ? 3.657   62.747 69.782  1.00 20.67  ? 105 ARG A NH2   1 
ATOM   1080 N N     . ILE C 3 106 ? 9.033   67.957 70.570  1.00 25.86  ? 106 ILE A N     1 
ATOM   1081 C CA    . ILE C 3 106 ? 9.799   68.747 71.518  1.00 26.46  ? 106 ILE A CA    1 
ATOM   1082 C C     . ILE C 3 106 ? 8.869   69.857 71.975  1.00 27.73  ? 106 ILE A C     1 
ATOM   1083 O O     . ILE C 3 106 ? 7.858   70.125 71.328  1.00 25.40  ? 106 ILE A O     1 
ATOM   1084 C CB    . ILE C 3 106 ? 11.079  69.353 70.902  1.00 35.13  ? 106 ILE A CB    1 
ATOM   1085 C CG1   . ILE C 3 106 ? 10.730  70.326 69.770  1.00 34.87  ? 106 ILE A CG1   1 
ATOM   1086 C CG2   . ILE C 3 106 ? 11.989  68.229 70.440  1.00 35.52  ? 106 ILE A CG2   1 
ATOM   1087 C CD1   . ILE C 3 106 ? 11.912  71.138 69.287  1.00 30.58  ? 106 ILE A CD1   1 
ATOM   1088 N N     . ARG C 3 107 ? 9.207   70.493 73.089  1.00 32.82  ? 107 ARG A N     1 
ATOM   1089 C CA    . ARG C 3 107 ? 8.386   71.562 73.640  1.00 34.84  ? 107 ARG A CA    1 
ATOM   1090 C C     . ARG C 3 107 ? 8.751   72.978 73.206  1.00 35.38  ? 107 ARG A C     1 
ATOM   1091 O O     . ARG C 3 107 ? 7.897   73.859 73.209  1.00 35.36  ? 107 ARG A O     1 
ATOM   1092 C CB    . ARG C 3 107 ? 8.402   71.477 75.164  1.00 47.59  ? 107 ARG A CB    1 
ATOM   1093 C CG    . ARG C 3 107 ? 7.488   70.411 75.719  1.00 52.09  ? 107 ARG A CG    1 
ATOM   1094 C CD    . ARG C 3 107 ? 8.104   69.762 76.933  1.00 55.74  ? 107 ARG A CD    1 
ATOM   1095 N NE    . ARG C 3 107 ? 7.117   68.991 77.677  1.00 59.37  ? 107 ARG A NE    1 
ATOM   1096 C CZ    . ARG C 3 107 ? 7.420   68.049 78.564  1.00 62.51  ? 107 ARG A CZ    1 
ATOM   1097 N NH1   . ARG C 3 107 ? 8.689   67.757 78.815  1.00 63.05  ? 107 ARG A NH1   1 
ATOM   1098 N NH2   . ARG C 3 107 ? 6.453   67.400 79.202  1.00 64.05  ? 107 ARG A NH2   1 
ATOM   1099 N N     . GLU C 3 108 ? 10.006  73.203 72.829  1.00 38.50  ? 108 GLU A N     1 
ATOM   1100 C CA    . GLU C 3 108 ? 10.429  74.535 72.425  1.00 40.02  ? 108 GLU A CA    1 
ATOM   1101 C C     . GLU C 3 108 ? 11.322  74.582 71.199  1.00 38.43  ? 108 GLU A C     1 
ATOM   1102 O O     . GLU C 3 108 ? 12.497  74.250 71.277  1.00 40.78  ? 108 GLU A O     1 
ATOM   1103 C CB    . GLU C 3 108 ? 11.146  75.230 73.585  1.00 57.54  ? 108 GLU A CB    1 
ATOM   1104 C CG    . GLU C 3 108 ? 10.226  75.972 74.528  1.00 64.76  ? 108 GLU A CG    1 
ATOM   1105 C CD    . GLU C 3 108 ? 9.450   77.062 73.819  1.00 69.73  ? 108 GLU A CD    1 
ATOM   1106 O OE1   . GLU C 3 108 ? 10.091  77.900 73.148  1.00 72.40  ? 108 GLU A OE1   1 
ATOM   1107 O OE2   . GLU C 3 108 ? 8.202   77.083 73.930  1.00 71.87  ? 108 GLU A OE2   1 
ATOM   1108 N N     . PRO C 3 109 ? 10.769  74.972 70.040  1.00 32.56  ? 109 PRO A N     1 
ATOM   1109 C CA    . PRO C 3 109 ? 9.360   75.343 69.883  1.00 31.07  ? 109 PRO A CA    1 
ATOM   1110 C C     . PRO C 3 109 ? 8.459   74.121 69.736  1.00 30.99  ? 109 PRO A C     1 
ATOM   1111 O O     . PRO C 3 109 ? 8.840   73.123 69.127  1.00 31.75  ? 109 PRO A O     1 
ATOM   1112 C CB    . PRO C 3 109 ? 9.372   76.229 68.642  1.00 19.54  ? 109 PRO A CB    1 
ATOM   1113 C CG    . PRO C 3 109 ? 10.586  75.776 67.888  1.00 20.00  ? 109 PRO A CG    1 
ATOM   1114 C CD    . PRO C 3 109 ? 11.586  75.574 68.970  1.00 21.24  ? 109 PRO A CD    1 
ATOM   1115 N N     . LYS C 3 110 ? 7.266   74.209 70.311  1.00 34.64  ? 110 LYS A N     1 
ATOM   1116 C CA    . LYS C 3 110 ? 6.294   73.125 70.279  1.00 34.10  ? 110 LYS A CA    1 
ATOM   1117 C C     . LYS C 3 110 ? 6.065   72.624 68.857  1.00 32.93  ? 110 LYS A C     1 
ATOM   1118 O O     . LYS C 3 110 ? 5.318   73.224 68.087  1.00 33.83  ? 110 LYS A O     1 
ATOM   1119 C CB    . LYS C 3 110 ? 4.982   73.612 70.901  1.00 32.52  ? 110 LYS A CB    1 
ATOM   1120 C CG    . LYS C 3 110 ? 3.905   72.565 71.035  1.00 35.10  ? 110 LYS A CG    1 
ATOM   1121 C CD    . LYS C 3 110 ? 2.746   73.078 71.887  1.00 38.17  ? 110 LYS A CD    1 
ATOM   1122 C CE    . LYS C 3 110 ? 1.884   74.111 71.167  1.00 40.30  ? 110 LYS A CE    1 
ATOM   1123 N NZ    . LYS C 3 110 ? 1.016   73.495 70.119  1.00 43.83  ? 110 LYS A NZ    1 
ATOM   1124 N N     . THR C 3 111 ? 6.712   71.513 68.518  1.00 30.25  ? 111 THR A N     1 
ATOM   1125 C CA    . THR C 3 111 ? 6.604   70.926 67.183  1.00 30.98  ? 111 THR A CA    1 
ATOM   1126 C C     . THR C 3 111 ? 6.662   69.393 67.218  1.00 29.09  ? 111 THR A C     1 
ATOM   1127 O O     . THR C 3 111 ? 6.844   68.786 68.270  1.00 30.04  ? 111 THR A O     1 
ATOM   1128 C CB    . THR C 3 111 ? 7.755   71.432 66.274  1.00 29.56  ? 111 THR A CB    1 
ATOM   1129 O OG1   . THR C 3 111 ? 9.015   71.080 66.867  1.00 30.00  ? 111 THR A OG1   1 
ATOM   1130 C CG2   . THR C 3 111 ? 7.690   72.956 66.103  1.00 28.76  ? 111 THR A CG2   1 
ATOM   1131 N N     . THR C 3 112 ? 6.506   68.771 66.056  1.00 35.81  ? 112 THR A N     1 
ATOM   1132 C CA    . THR C 3 112 ? 6.566   67.315 65.940  1.00 34.44  ? 112 THR A CA    1 
ATOM   1133 C C     . THR C 3 112 ? 7.373   66.970 64.692  1.00 32.78  ? 112 THR A C     1 
ATOM   1134 O O     . THR C 3 112 ? 7.089   67.475 63.613  1.00 33.48  ? 112 THR A O     1 
ATOM   1135 C CB    . THR C 3 112 ? 5.157   66.693 65.791  1.00 27.76  ? 112 THR A CB    1 
ATOM   1136 O OG1   . THR C 3 112 ? 4.348   67.053 66.916  1.00 25.62  ? 112 THR A OG1   1 
ATOM   1137 C CG2   . THR C 3 112 ? 5.250   65.179 65.726  1.00 26.72  ? 112 THR A CG2   1 
ATOM   1138 N N     . ALA C 3 113 ? 8.382   66.118 64.832  1.00 19.87  ? 113 ALA A N     1 
ATOM   1139 C CA    . ALA C 3 113 ? 9.188   65.730 63.680  1.00 18.81  ? 113 ALA A CA    1 
ATOM   1140 C C     . ALA C 3 113 ? 8.960   64.284 63.249  1.00 18.14  ? 113 ALA A C     1 
ATOM   1141 O O     . ALA C 3 113 ? 8.723   63.402 64.072  1.00 17.29  ? 113 ALA A O     1 
ATOM   1142 C CB    . ALA C 3 113 ? 10.657  65.940 63.981  1.00 37.68  ? 113 ALA A CB    1 
ATOM   1143 N N     . LEU C 3 114 ? 9.006   64.055 61.945  1.00 22.75  ? 114 LEU A N     1 
ATOM   1144 C CA    . LEU C 3 114 ? 8.866   62.715 61.394  1.00 23.81  ? 114 LEU A CA    1 
ATOM   1145 C C     . LEU C 3 114 ? 10.278  62.421 60.890  1.00 24.87  ? 114 LEU A C     1 
ATOM   1146 O O     . LEU C 3 114 ? 10.744  63.055 59.944  1.00 23.63  ? 114 LEU A O     1 
ATOM   1147 C CB    . LEU C 3 114 ? 7.878   62.689 60.214  1.00 19.52  ? 114 LEU A CB    1 
ATOM   1148 C CG    . LEU C 3 114 ? 6.413   63.091 60.433  1.00 18.64  ? 114 LEU A CG    1 
ATOM   1149 C CD1   . LEU C 3 114 ? 5.639   62.920 59.139  1.00 16.57  ? 114 LEU A CD1   1 
ATOM   1150 C CD2   . LEU C 3 114 ? 5.797   62.240 61.526  1.00 18.09  ? 114 LEU A CD2   1 
ATOM   1151 N N     . ILE C 3 115 ? 10.963  61.482 61.534  1.00 27.19  ? 115 ILE A N     1 
ATOM   1152 C CA    . ILE C 3 115 ? 12.323  61.129 61.143  1.00 29.14  ? 115 ILE A CA    1 
ATOM   1153 C C     . ILE C 3 115 ? 12.374  59.799 60.388  1.00 29.25  ? 115 ILE A C     1 
ATOM   1154 O O     . ILE C 3 115 ? 11.831  58.795 60.847  1.00 29.33  ? 115 ILE A O     1 
ATOM   1155 C CB    . ILE C 3 115 ? 13.214  61.060 62.384  1.00 30.02  ? 115 ILE A CB    1 
ATOM   1156 C CG1   . ILE C 3 115 ? 13.130  62.404 63.116  1.00 30.04  ? 115 ILE A CG1   1 
ATOM   1157 C CG2   . ILE C 3 115 ? 14.656  60.723 61.989  1.00 30.86  ? 115 ILE A CG2   1 
ATOM   1158 C CD1   . ILE C 3 115 ? 13.671  62.396 64.514  1.00 28.51  ? 115 ILE A CD1   1 
ATOM   1159 N N     . PHE C 3 116 ? 13.026  59.795 59.228  1.00 25.56  ? 116 PHE A N     1 
ATOM   1160 C CA    . PHE C 3 116 ? 13.114  58.581 58.424  1.00 26.80  ? 116 PHE A CA    1 
ATOM   1161 C C     . PHE C 3 116 ? 14.464  57.873 58.452  1.00 28.29  ? 116 PHE A C     1 
ATOM   1162 O O     . PHE C 3 116 ? 15.474  58.439 58.880  1.00 28.35  ? 116 PHE A O     1 
ATOM   1163 C CB    . PHE C 3 116 ? 12.704  58.885 56.983  1.00 25.24  ? 116 PHE A CB    1 
ATOM   1164 C CG    . PHE C 3 116 ? 11.246  59.225 56.839  1.00 23.77  ? 116 PHE A CG    1 
ATOM   1165 C CD1   . PHE C 3 116 ? 10.770  60.486 57.200  1.00 23.22  ? 116 PHE A CD1   1 
ATOM   1166 C CD2   . PHE C 3 116 ? 10.335  58.262 56.410  1.00 22.96  ? 116 PHE A CD2   1 
ATOM   1167 C CE1   . PHE C 3 116 ? 9.405   60.789 57.144  1.00 23.47  ? 116 PHE A CE1   1 
ATOM   1168 C CE2   . PHE C 3 116 ? 8.973   58.547 56.351  1.00 24.31  ? 116 PHE A CE2   1 
ATOM   1169 C CZ    . PHE C 3 116 ? 8.503   59.820 56.720  1.00 23.88  ? 116 PHE A CZ    1 
ATOM   1170 N N     . ALA C 3 117 ? 14.469  56.621 58.005  1.00 40.43  ? 117 ALA A N     1 
ATOM   1171 C CA    . ALA C 3 117 ? 15.690  55.822 57.987  1.00 43.06  ? 117 ALA A CA    1 
ATOM   1172 C C     . ALA C 3 117 ? 16.698  56.429 57.028  1.00 45.38  ? 117 ALA A C     1 
ATOM   1173 O O     . ALA C 3 117 ? 17.911  56.272 57.201  1.00 46.90  ? 117 ALA A O     1 
ATOM   1174 C CB    . ALA C 3 117 ? 15.377  54.388 57.572  1.00 26.70  ? 117 ALA A CB    1 
ATOM   1175 N N     . SER C 3 118 ? 16.184  57.127 56.020  1.00 37.94  ? 118 SER A N     1 
ATOM   1176 C CA    . SER C 3 118 ? 17.015  57.772 55.012  1.00 36.57  ? 118 SER A CA    1 
ATOM   1177 C C     . SER C 3 118 ? 17.770  58.981 55.553  1.00 37.26  ? 118 SER A C     1 
ATOM   1178 O O     . SER C 3 118 ? 18.646  59.518 54.877  1.00 39.12  ? 118 SER A O     1 
ATOM   1179 C CB    . SER C 3 118 ? 16.148  58.226 53.854  1.00 27.22  ? 118 SER A CB    1 
ATOM   1180 O OG    . SER C 3 118 ? 15.316  59.289 54.274  1.00 27.15  ? 118 SER A OG    1 
ATOM   1181 N N     . GLY C 3 119 ? 17.422  59.415 56.761  1.00 35.20  ? 119 GLY A N     1 
ATOM   1182 C CA    . GLY C 3 119 ? 18.087  60.562 57.352  1.00 35.53  ? 119 GLY A CA    1 
ATOM   1183 C C     . GLY C 3 119 ? 17.352  61.869 57.094  1.00 35.55  ? 119 GLY A C     1 
ATOM   1184 O O     . GLY C 3 119 ? 17.784  62.938 57.538  1.00 36.28  ? 119 GLY A O     1 
ATOM   1185 N N     . LYS C 3 120 ? 16.242  61.786 56.368  1.00 38.73  ? 120 LYS A N     1 
ATOM   1186 C CA    . LYS C 3 120 ? 15.434  62.957 56.059  1.00 36.53  ? 120 LYS A CA    1 
ATOM   1187 C C     . LYS C 3 120 ? 14.274  63.070 57.036  1.00 36.18  ? 120 LYS A C     1 
ATOM   1188 O O     . LYS C 3 120 ? 13.764  62.057 57.523  1.00 36.55  ? 120 LYS A O     1 
ATOM   1189 C CB    . LYS C 3 120 ? 14.887  62.859 54.638  1.00 34.26  ? 120 LYS A CB    1 
ATOM   1190 C CG    . LYS C 3 120 ? 15.962  62.957 53.587  1.00 33.36  ? 120 LYS A CG    1 
ATOM   1191 C CD    . LYS C 3 120 ? 15.370  63.127 52.212  1.00 31.74  ? 120 LYS A CD    1 
ATOM   1192 C CE    . LYS C 3 120 ? 16.453  63.514 51.221  1.00 32.09  ? 120 LYS A CE    1 
ATOM   1193 N NZ    . LYS C 3 120 ? 15.908  63.794 49.865  1.00 32.27  ? 120 LYS A NZ    1 
ATOM   1194 N N     . MET C 3 121 ? 13.867  64.298 57.341  1.00 32.35  ? 121 MET A N     1 
ATOM   1195 C CA    . MET C 3 121 ? 12.745  64.485 58.243  1.00 32.28  ? 121 MET A CA    1 
ATOM   1196 C C     . MET C 3 121 ? 11.808  65.631 57.881  1.00 30.16  ? 121 MET A C     1 
ATOM   1197 O O     . MET C 3 121 ? 12.127  66.485 57.060  1.00 31.36  ? 121 MET A O     1 
ATOM   1198 C CB    . MET C 3 121 ? 13.226  64.638 59.688  1.00 32.39  ? 121 MET A CB    1 
ATOM   1199 C CG    . MET C 3 121 ? 14.251  65.699 59.916  1.00 35.12  ? 121 MET A CG    1 
ATOM   1200 S SD    . MET C 3 121 ? 14.533  65.891 61.678  1.00 37.02  ? 121 MET A SD    1 
ATOM   1201 C CE    . MET C 3 121 ? 14.889  67.617 61.743  1.00 36.66  ? 121 MET A CE    1 
ATOM   1202 N N     . VAL C 3 122 ? 10.631  65.606 58.496  1.00 27.75  ? 122 VAL A N     1 
ATOM   1203 C CA    . VAL C 3 122 ? 9.604   66.608 58.293  1.00 25.18  ? 122 VAL A CA    1 
ATOM   1204 C C     . VAL C 3 122 ? 9.295   67.202 59.657  1.00 23.63  ? 122 VAL A C     1 
ATOM   1205 O O     . VAL C 3 122 ? 9.060   66.470 60.609  1.00 23.60  ? 122 VAL A O     1 
ATOM   1206 C CB    . VAL C 3 122 ? 8.320   65.972 57.737  1.00 18.60  ? 122 VAL A CB    1 
ATOM   1207 C CG1   . VAL C 3 122 ? 7.226   67.008 57.636  1.00 15.22  ? 122 VAL A CG1   1 
ATOM   1208 C CG2   . VAL C 3 122 ? 8.597   65.341 56.386  1.00 14.37  ? 122 VAL A CG2   1 
ATOM   1209 N N     . VAL C 3 123 ? 9.316   68.523 59.758  1.00 33.80  ? 123 VAL A N     1 
ATOM   1210 C CA    . VAL C 3 123 ? 9.011   69.181 61.020  1.00 34.59  ? 123 VAL A CA    1 
ATOM   1211 C C     . VAL C 3 123 ? 7.696   69.927 60.841  1.00 33.82  ? 123 VAL A C     1 
ATOM   1212 O O     . VAL C 3 123 ? 7.541   70.716 59.915  1.00 35.37  ? 123 VAL A O     1 
ATOM   1213 C CB    . VAL C 3 123 ? 10.128  70.155 61.436  1.00 19.67  ? 123 VAL A CB    1 
ATOM   1214 C CG1   . VAL C 3 123 ? 9.818   70.738 62.806  1.00 18.69  ? 123 VAL A CG1   1 
ATOM   1215 C CG2   . VAL C 3 123 ? 11.471  69.423 61.457  1.00 18.84  ? 123 VAL A CG2   1 
ATOM   1216 N N     . THR C 3 124 ? 6.753   69.667 61.741  1.00 21.96  ? 124 THR A N     1 
ATOM   1217 C CA    . THR C 3 124 ? 5.421   70.255 61.681  1.00 20.81  ? 124 THR A CA    1 
ATOM   1218 C C     . THR C 3 124 ? 5.021   70.944 62.975  1.00 19.66  ? 124 THR A C     1 
ATOM   1219 O O     . THR C 3 124 ? 5.615   70.711 64.029  1.00 18.91  ? 124 THR A O     1 
ATOM   1220 C CB    . THR C 3 124 ? 4.375   69.165 61.419  1.00 23.00  ? 124 THR A CB    1 
ATOM   1221 O OG1   . THR C 3 124 ? 4.285   68.316 62.572  1.00 24.38  ? 124 THR A OG1   1 
ATOM   1222 C CG2   . THR C 3 124 ? 4.769   68.313 60.223  1.00 21.73  ? 124 THR A CG2   1 
ATOM   1223 N N     . GLY C 3 125 ? 4.005   71.793 62.882  1.00 26.35  ? 125 GLY A N     1 
ATOM   1224 C CA    . GLY C 3 125 ? 3.501   72.479 64.054  1.00 27.36  ? 125 GLY A CA    1 
ATOM   1225 C C     . GLY C 3 125 ? 4.090   73.840 64.347  1.00 29.17  ? 125 GLY A C     1 
ATOM   1226 O O     . GLY C 3 125 ? 3.563   74.574 65.186  1.00 30.14  ? 125 GLY A O     1 
ATOM   1227 N N     . ALA C 3 126 ? 5.181   74.187 63.677  1.00 22.45  ? 126 ALA A N     1 
ATOM   1228 C CA    . ALA C 3 126 ? 5.816   75.477 63.909  1.00 22.42  ? 126 ALA A CA    1 
ATOM   1229 C C     . ALA C 3 126 ? 4.895   76.609 63.457  1.00 24.85  ? 126 ALA A C     1 
ATOM   1230 O O     . ALA C 3 126 ? 4.171   76.480 62.460  1.00 26.12  ? 126 ALA A O     1 
ATOM   1231 C CB    . ALA C 3 126 ? 7.132   75.541 63.177  1.00 15.98  ? 126 ALA A CB    1 
ATOM   1232 N N     . LYS C 3 127 ? 4.930   77.717 64.195  1.00 26.90  ? 127 LYS A N     1 
ATOM   1233 C CA    . LYS C 3 127 ? 4.077   78.866 63.904  1.00 25.86  ? 127 LYS A CA    1 
ATOM   1234 C C     . LYS C 3 127 ? 4.785   80.061 63.270  1.00 26.85  ? 127 LYS A C     1 
ATOM   1235 O O     . LYS C 3 127 ? 4.167   81.088 63.020  1.00 28.59  ? 127 LYS A O     1 
ATOM   1236 C CB    . LYS C 3 127 ? 3.341   79.297 65.180  1.00 23.55  ? 127 LYS A CB    1 
ATOM   1237 C CG    . LYS C 3 127 ? 2.136   78.422 65.496  1.00 21.79  ? 127 LYS A CG    1 
ATOM   1238 C CD    . LYS C 3 127 ? 1.367   78.924 66.694  1.00 20.25  ? 127 LYS A CD    1 
ATOM   1239 C CE    . LYS C 3 127 ? -0.111  78.551 66.602  1.00 21.93  ? 127 LYS A CE    1 
ATOM   1240 N NZ    . LYS C 3 127 ? -0.357  77.101 66.384  1.00 20.11  ? 127 LYS A NZ    1 
ATOM   1241 N N     . SER C 3 128 ? 6.079   79.923 63.007  1.00 18.67  ? 128 SER A N     1 
ATOM   1242 C CA    . SER C 3 128 ? 6.848   80.984 62.367  1.00 19.83  ? 128 SER A CA    1 
ATOM   1243 C C     . SER C 3 128 ? 8.000   80.327 61.620  1.00 21.03  ? 128 SER A C     1 
ATOM   1244 O O     . SER C 3 128 ? 8.353   79.190 61.911  1.00 20.17  ? 128 SER A O     1 
ATOM   1245 C CB    . SER C 3 128 ? 7.384   81.980 63.402  1.00 28.24  ? 128 SER A CB    1 
ATOM   1246 O OG    . SER C 3 128 ? 8.375   81.404 64.233  1.00 33.58  ? 128 SER A OG    1 
ATOM   1247 N N     . GLU C 3 129 ? 8.569   81.030 60.646  1.00 30.71  ? 129 GLU A N     1 
ATOM   1248 C CA    . GLU C 3 129 ? 9.679   80.498 59.864  1.00 33.84  ? 129 GLU A CA    1 
ATOM   1249 C C     . GLU C 3 129 ? 10.874  80.231 60.766  1.00 35.61  ? 129 GLU A C     1 
ATOM   1250 O O     . GLU C 3 129 ? 11.570  79.232 60.604  1.00 34.65  ? 129 GLU A O     1 
ATOM   1251 C CB    . GLU C 3 129 ? 10.095  81.486 58.770  1.00 43.78  ? 129 GLU A CB    1 
ATOM   1252 C CG    . GLU C 3 129 ? 9.018   81.816 57.734  1.00 44.03  ? 129 GLU A CG    1 
ATOM   1253 C CD    . GLU C 3 129 ? 7.980   82.828 58.216  1.00 44.59  ? 129 GLU A CD    1 
ATOM   1254 O OE1   . GLU C 3 129 ? 7.185   83.290 57.373  1.00 44.70  ? 129 GLU A OE1   1 
ATOM   1255 O OE2   . GLU C 3 129 ? 7.950   83.164 59.420  1.00 42.03  ? 129 GLU A OE2   1 
ATOM   1256 N N     . ASP C 3 130 ? 11.106  81.134 61.713  1.00 41.09  ? 130 ASP A N     1 
ATOM   1257 C CA    . ASP C 3 130 ? 12.220  81.011 62.650  1.00 43.39  ? 130 ASP A CA    1 
ATOM   1258 C C     . ASP C 3 130 ? 12.082  79.801 63.584  1.00 42.10  ? 130 ASP A C     1 
ATOM   1259 O O     . ASP C 3 130 ? 13.051  79.068 63.806  1.00 41.84  ? 130 ASP A O     1 
ATOM   1260 C CB    . ASP C 3 130 ? 12.349  82.298 63.471  1.00 66.92  ? 130 ASP A CB    1 
ATOM   1261 C CG    . ASP C 3 130 ? 12.660  83.512 62.608  1.00 73.12  ? 130 ASP A CG    1 
ATOM   1262 O OD1   . ASP C 3 130 ? 13.709  83.509 61.930  1.00 73.63  ? 130 ASP A OD1   1 
ATOM   1263 O OD2   . ASP C 3 130 ? 11.857  84.469 62.605  1.00 75.44  ? 130 ASP A OD2   1 
ATOM   1264 N N     . ASP C 3 131 ? 10.885  79.602 64.134  1.00 32.44  ? 131 ASP A N     1 
ATOM   1265 C CA    . ASP C 3 131 ? 10.630  78.474 65.022  1.00 29.06  ? 131 ASP A CA    1 
ATOM   1266 C C     . ASP C 3 131 ? 10.806  77.161 64.271  1.00 26.83  ? 131 ASP A C     1 
ATOM   1267 O O     . ASP C 3 131 ? 11.246  76.164 64.840  1.00 26.35  ? 131 ASP A O     1 
ATOM   1268 C CB    . ASP C 3 131 ? 9.214   78.543 65.592  1.00 42.45  ? 131 ASP A CB    1 
ATOM   1269 C CG    . ASP C 3 131 ? 9.146   79.310 66.901  1.00 45.55  ? 131 ASP A CG    1 
ATOM   1270 O OD1   . ASP C 3 131 ? 8.076   79.287 67.551  1.00 45.11  ? 131 ASP A OD1   1 
ATOM   1271 O OD2   . ASP C 3 131 ? 10.160  79.932 67.287  1.00 46.97  ? 131 ASP A OD2   1 
ATOM   1272 N N     . SER C 3 132 ? 10.466  77.169 62.988  1.00 26.55  ? 132 SER A N     1 
ATOM   1273 C CA    . SER C 3 132 ? 10.580  75.980 62.153  1.00 27.41  ? 132 SER A CA    1 
ATOM   1274 C C     . SER C 3 132 ? 12.037  75.594 61.950  1.00 28.50  ? 132 SER A C     1 
ATOM   1275 O O     . SER C 3 132 ? 12.405  74.431 62.113  1.00 26.85  ? 132 SER A O     1 
ATOM   1276 C CB    . SER C 3 132 ? 9.913   76.218 60.795  1.00 36.27  ? 132 SER A CB    1 
ATOM   1277 O OG    . SER C 3 132 ? 9.832   75.014 60.049  1.00 36.92  ? 132 SER A OG    1 
ATOM   1278 N N     . LYS C 3 133 ? 12.866  76.572 61.596  1.00 37.86  ? 133 LYS A N     1 
ATOM   1279 C CA    . LYS C 3 133 ? 14.287  76.324 61.380  1.00 38.94  ? 133 LYS A CA    1 
ATOM   1280 C C     . LYS C 3 133 ? 14.917  75.934 62.723  1.00 38.95  ? 133 LYS A C     1 
ATOM   1281 O O     . LYS C 3 133 ? 15.690  74.973 62.809  1.00 38.84  ? 133 LYS A O     1 
ATOM   1282 C CB    . LYS C 3 133 ? 14.952  77.584 60.811  1.00 50.27  ? 133 LYS A CB    1 
ATOM   1283 C CG    . LYS C 3 133 ? 16.253  77.331 60.052  1.00 56.53  ? 133 LYS A CG    1 
ATOM   1284 C CD    . LYS C 3 133 ? 16.770  78.615 59.386  1.00 62.30  ? 133 LYS A CD    1 
ATOM   1285 C CE    . LYS C 3 133 ? 18.088  78.405 58.616  1.00 65.49  ? 133 LYS A CE    1 
ATOM   1286 N NZ    . LYS C 3 133 ? 17.950  77.620 57.348  1.00 68.60  ? 133 LYS A NZ    1 
ATOM   1287 N N     . LEU C 3 134 ? 14.559  76.676 63.770  1.00 32.36  ? 134 LEU A N     1 
ATOM   1288 C CA    . LEU C 3 134 ? 15.075  76.428 65.110  1.00 31.54  ? 134 LEU A CA    1 
ATOM   1289 C C     . LEU C 3 134 ? 14.732  75.033 65.615  1.00 32.33  ? 134 LEU A C     1 
ATOM   1290 O O     . LEU C 3 134 ? 15.596  74.325 66.133  1.00 33.27  ? 134 LEU A O     1 
ATOM   1291 C CB    . LEU C 3 134 ? 14.534  77.474 66.088  1.00 33.46  ? 134 LEU A CB    1 
ATOM   1292 C CG    . LEU C 3 134 ? 14.790  77.209 67.576  1.00 31.67  ? 134 LEU A CG    1 
ATOM   1293 C CD1   . LEU C 3 134 ? 16.272  77.046 67.816  1.00 31.75  ? 134 LEU A CD1   1 
ATOM   1294 C CD2   . LEU C 3 134 ? 14.238  78.347 68.412  1.00 32.02  ? 134 LEU A CD2   1 
ATOM   1295 N N     . ALA C 3 135 ? 13.470  74.643 65.478  1.00 34.30  ? 135 ALA A N     1 
ATOM   1296 C CA    . ALA C 3 135 ? 13.040  73.322 65.911  1.00 34.13  ? 135 ALA A CA    1 
ATOM   1297 C C     . ALA C 3 135 ? 13.792  72.261 65.101  1.00 34.35  ? 135 ALA A C     1 
ATOM   1298 O O     . ALA C 3 135 ? 14.280  71.273 65.649  1.00 34.04  ? 135 ALA A O     1 
ATOM   1299 C CB    . ALA C 3 135 ? 11.551  73.177 65.703  1.00 39.97  ? 135 ALA A CB    1 
ATOM   1300 N N     . SER C 3 136 ? 13.883  72.473 63.791  1.00 34.44  ? 136 SER A N     1 
ATOM   1301 C CA    . SER C 3 136 ? 14.583  71.536 62.918  1.00 34.14  ? 136 SER A CA    1 
ATOM   1302 C C     . SER C 3 136 ? 16.004  71.311 63.399  1.00 34.76  ? 136 SER A C     1 
ATOM   1303 O O     . SER C 3 136 ? 16.512  70.189 63.365  1.00 33.44  ? 136 SER A O     1 
ATOM   1304 C CB    . SER C 3 136 ? 14.619  72.060 61.478  1.00 32.53  ? 136 SER A CB    1 
ATOM   1305 O OG    . SER C 3 136 ? 13.356  71.931 60.846  1.00 31.07  ? 136 SER A OG    1 
ATOM   1306 N N     . ARG C 3 137 ? 16.648  72.383 63.847  1.00 33.52  ? 137 ARG A N     1 
ATOM   1307 C CA    . ARG C 3 137 ? 18.018  72.286 64.324  1.00 35.83  ? 137 ARG A CA    1 
ATOM   1308 C C     . ARG C 3 137 ? 18.125  71.463 65.594  1.00 34.37  ? 137 ARG A C     1 
ATOM   1309 O O     . ARG C 3 137 ? 19.104  70.753 65.783  1.00 34.90  ? 137 ARG A O     1 
ATOM   1310 C CB    . ARG C 3 137 ? 18.600  73.674 64.555  1.00 62.27  ? 137 ARG A CB    1 
ATOM   1311 C CG    . ARG C 3 137 ? 18.758  74.475 63.295  1.00 66.98  ? 137 ARG A CG    1 
ATOM   1312 C CD    . ARG C 3 137 ? 19.482  75.758 63.588  1.00 72.66  ? 137 ARG A CD    1 
ATOM   1313 N NE    . ARG C 3 137 ? 19.886  76.428 62.362  1.00 81.18  ? 137 ARG A NE    1 
ATOM   1314 C CZ    . ARG C 3 137 ? 20.649  77.516 62.322  1.00 85.86  ? 137 ARG A CZ    1 
ATOM   1315 N NH1   . ARG C 3 137 ? 20.969  78.061 61.154  1.00 87.79  ? 137 ARG A NH1   1 
ATOM   1316 N NH2   . ARG C 3 137 ? 21.092  78.058 63.451  1.00 88.85  ? 137 ARG A NH2   1 
ATOM   1317 N N     . LYS C 3 138 ? 17.115  71.550 66.457  1.00 38.40  ? 138 LYS A N     1 
ATOM   1318 C CA    . LYS C 3 138 ? 17.111  70.794 67.708  1.00 37.30  ? 138 LYS A CA    1 
ATOM   1319 C C     . LYS C 3 138 ? 16.968  69.301 67.469  1.00 37.39  ? 138 LYS A C     1 
ATOM   1320 O O     . LYS C 3 138 ? 17.618  68.492 68.130  1.00 39.00  ? 138 LYS A O     1 
ATOM   1321 C CB    . LYS C 3 138 ? 15.984  71.265 68.621  1.00 39.33  ? 138 LYS A CB    1 
ATOM   1322 C CG    . LYS C 3 138 ? 16.123  72.708 69.045  1.00 38.85  ? 138 LYS A CG    1 
ATOM   1323 C CD    . LYS C 3 138 ? 15.324  73.009 70.301  1.00 39.22  ? 138 LYS A CD    1 
ATOM   1324 C CE    . LYS C 3 138 ? 15.512  74.459 70.720  1.00 39.79  ? 138 LYS A CE    1 
ATOM   1325 N NZ    . LYS C 3 138 ? 14.937  74.752 72.064  1.00 42.14  ? 138 LYS A NZ    1 
ATOM   1326 N N     . TYR C 3 139 ? 16.108  68.936 66.528  1.00 36.58  ? 139 TYR A N     1 
ATOM   1327 C CA    . TYR C 3 139 ? 15.903  67.537 66.204  1.00 36.26  ? 139 TYR A CA    1 
ATOM   1328 C C     . TYR C 3 139 ? 17.194  66.956 65.663  1.00 37.44  ? 139 TYR A C     1 
ATOM   1329 O O     . TYR C 3 139 ? 17.616  65.871 66.070  1.00 38.65  ? 139 TYR A O     1 
ATOM   1330 C CB    . TYR C 3 139 ? 14.778  67.390 65.178  1.00 32.03  ? 139 TYR A CB    1 
ATOM   1331 C CG    . TYR C 3 139 ? 13.413  67.644 65.776  1.00 30.79  ? 139 TYR A CG    1 
ATOM   1332 C CD1   . TYR C 3 139 ? 12.595  68.675 65.299  1.00 29.48  ? 139 TYR A CD1   1 
ATOM   1333 C CD2   . TYR C 3 139 ? 12.944  66.859 66.838  1.00 28.62  ? 139 TYR A CD2   1 
ATOM   1334 C CE1   . TYR C 3 139 ? 11.339  68.919 65.871  1.00 28.72  ? 139 TYR A CE1   1 
ATOM   1335 C CE2   . TYR C 3 139 ? 11.696  67.088 67.410  1.00 28.26  ? 139 TYR A CE2   1 
ATOM   1336 C CZ    . TYR C 3 139 ? 10.896  68.119 66.929  1.00 28.33  ? 139 TYR A CZ    1 
ATOM   1337 O OH    . TYR C 3 139 ? 9.665   68.345 67.512  1.00 26.23  ? 139 TYR A OH    1 
ATOM   1338 N N     . ALA C 3 140 ? 17.829  67.685 64.750  1.00 41.99  ? 140 ALA A N     1 
ATOM   1339 C CA    . ALA C 3 140 ? 19.087  67.234 64.163  1.00 42.07  ? 140 ALA A CA    1 
ATOM   1340 C C     . ALA C 3 140 ? 20.117  67.077 65.267  1.00 43.16  ? 140 ALA A C     1 
ATOM   1341 O O     . ALA C 3 140 ? 20.888  66.122 65.277  1.00 43.47  ? 140 ALA A O     1 
ATOM   1342 C CB    . ALA C 3 140 ? 19.577  68.238 63.143  1.00 23.14  ? 140 ALA A CB    1 
ATOM   1343 N N     . ARG C 3 141 ? 20.111  68.018 66.205  1.00 39.74  ? 141 ARG A N     1 
ATOM   1344 C CA    . ARG C 3 141 ? 21.050  67.996 67.310  1.00 40.94  ? 141 ARG A CA    1 
ATOM   1345 C C     . ARG C 3 141 ? 20.824  66.778 68.189  1.00 40.46  ? 141 ARG A C     1 
ATOM   1346 O O     . ARG C 3 141 ? 21.768  66.259 68.771  1.00 41.65  ? 141 ARG A O     1 
ATOM   1347 C CB    . ARG C 3 141 ? 20.922  69.274 68.138  1.00 66.27  ? 141 ARG A CB    1 
ATOM   1348 C CG    . ARG C 3 141 ? 22.226  69.723 68.780  1.00 73.12  ? 141 ARG A CG    1 
ATOM   1349 C CD    . ARG C 3 141 ? 22.721  68.736 69.829  1.00 81.47  ? 141 ARG A CD    1 
ATOM   1350 N NE    . ARG C 3 141 ? 24.121  68.961 70.194  1.00 89.04  ? 141 ARG A NE    1 
ATOM   1351 C CZ    . ARG C 3 141 ? 25.149  68.803 69.362  1.00 90.00  ? 141 ARG A CZ    1 
ATOM   1352 N NH1   . ARG C 3 141 ? 24.941  68.419 68.108  1.00 90.00  ? 141 ARG A NH1   1 
ATOM   1353 N NH2   . ARG C 3 141 ? 26.390  69.023 69.782  1.00 90.00  ? 141 ARG A NH2   1 
ATOM   1354 N N     . ILE C 3 142 ? 19.582  66.314 68.292  1.00 33.99  ? 142 ILE A N     1 
ATOM   1355 C CA    . ILE C 3 142 ? 19.301  65.140 69.113  1.00 33.22  ? 142 ILE A CA    1 
ATOM   1356 C C     . ILE C 3 142 ? 19.815  63.887 68.417  1.00 35.19  ? 142 ILE A C     1 
ATOM   1357 O O     . ILE C 3 142 ? 20.427  63.020 69.045  1.00 35.35  ? 142 ILE A O     1 
ATOM   1358 C CB    . ILE C 3 142 ? 17.799  64.961 69.366  1.00 34.03  ? 142 ILE A CB    1 
ATOM   1359 C CG1   . ILE C 3 142 ? 17.276  66.084 70.254  1.00 32.54  ? 142 ILE A CG1   1 
ATOM   1360 C CG2   . ILE C 3 142 ? 17.546  63.627 70.039  1.00 33.13  ? 142 ILE A CG2   1 
ATOM   1361 C CD1   . ILE C 3 142 ? 15.809  65.950 70.587  1.00 31.31  ? 142 ILE A CD1   1 
ATOM   1362 N N     . ILE C 3 143 ? 19.551  63.797 67.118  1.00 36.43  ? 143 ILE A N     1 
ATOM   1363 C CA    . ILE C 3 143 ? 19.992  62.664 66.322  1.00 37.86  ? 143 ILE A CA    1 
ATOM   1364 C C     . ILE C 3 143 ? 21.499  62.544 66.466  1.00 39.54  ? 143 ILE A C     1 
ATOM   1365 O O     . ILE C 3 143 ? 22.028  61.444 66.605  1.00 39.93  ? 143 ILE A O     1 
ATOM   1366 C CB    . ILE C 3 143 ? 19.651  62.857 64.826  1.00 37.24  ? 143 ILE A CB    1 
ATOM   1367 C CG1   . ILE C 3 143 ? 18.144  63.036 64.654  1.00 36.55  ? 143 ILE A CG1   1 
ATOM   1368 C CG2   . ILE C 3 143 ? 20.126  61.660 64.021  1.00 37.02  ? 143 ILE A CG2   1 
ATOM   1369 C CD1   . ILE C 3 143 ? 17.342  61.858 65.148  1.00 36.19  ? 143 ILE A CD1   1 
ATOM   1370 N N     . GLN C 3 144 ? 22.192  63.677 66.426  1.00 44.83  ? 144 GLN A N     1 
ATOM   1371 C CA    . GLN C 3 144 ? 23.642  63.672 66.571  1.00 47.47  ? 144 GLN A CA    1 
ATOM   1372 C C     . GLN C 3 144 ? 24.004  63.183 67.968  1.00 49.10  ? 144 GLN A C     1 
ATOM   1373 O O     . GLN C 3 144 ? 24.763  62.226 68.127  1.00 50.01  ? 144 GLN A O     1 
ATOM   1374 C CB    . GLN C 3 144 ? 24.217  65.077 66.384  1.00 54.59  ? 144 GLN A CB    1 
ATOM   1375 C CG    . GLN C 3 144 ? 24.012  65.678 65.008  1.00 57.82  ? 144 GLN A CG    1 
ATOM   1376 C CD    . GLN C 3 144 ? 24.721  67.012 64.846  1.00 59.01  ? 144 GLN A CD    1 
ATOM   1377 O OE1   . GLN C 3 144 ? 24.425  67.778 63.928  1.00 60.71  ? 144 GLN A OE1   1 
ATOM   1378 N NE2   . GLN C 3 144 ? 25.667  67.291 65.734  1.00 58.95  ? 144 GLN A NE2   1 
ATOM   1379 N N     . LYS C 3 145 ? 23.447  63.854 68.974  1.00 59.72  ? 145 LYS A N     1 
ATOM   1380 C CA    . LYS C 3 145 ? 23.691  63.532 70.374  1.00 58.91  ? 145 LYS A CA    1 
ATOM   1381 C C     . LYS C 3 145 ? 23.447  62.056 70.673  1.00 58.03  ? 145 LYS A C     1 
ATOM   1382 O O     . LYS C 3 145 ? 23.938  61.533 71.672  1.00 58.37  ? 145 LYS A O     1 
ATOM   1383 C CB    . LYS C 3 145 ? 22.802  64.399 71.267  1.00 80.26  ? 145 LYS A CB    1 
ATOM   1384 C CG    . LYS C 3 145 ? 23.326  64.609 72.680  1.00 83.20  ? 145 LYS A CG    1 
ATOM   1385 C CD    . LYS C 3 145 ? 24.560  65.522 72.717  1.00 87.96  ? 145 LYS A CD    1 
ATOM   1386 C CE    . LYS C 3 145 ? 25.838  64.807 72.259  1.00 90.00  ? 145 LYS A CE    1 
ATOM   1387 N NZ    . LYS C 3 145 ? 27.057  65.674 72.311  1.00 90.00  ? 145 LYS A NZ    1 
ATOM   1388 N N     . ILE C 3 146 ? 22.683  61.389 69.813  1.00 45.79  ? 146 ILE A N     1 
ATOM   1389 C CA    . ILE C 3 146 ? 22.406  59.970 69.990  1.00 43.73  ? 146 ILE A CA    1 
ATOM   1390 C C     . ILE C 3 146 ? 23.547  59.161 69.404  1.00 44.22  ? 146 ILE A C     1 
ATOM   1391 O O     . ILE C 3 146 ? 23.839  58.065 69.870  1.00 44.79  ? 146 ILE A O     1 
ATOM   1392 C CB    . ILE C 3 146 ? 21.094  59.543 69.299  1.00 38.13  ? 146 ILE A CB    1 
ATOM   1393 C CG1   . ILE C 3 146 ? 19.899  59.933 70.171  1.00 36.72  ? 146 ILE A CG1   1 
ATOM   1394 C CG2   . ILE C 3 146 ? 21.101  58.038 69.035  1.00 36.69  ? 146 ILE A CG2   1 
ATOM   1395 C CD1   . ILE C 3 146 ? 18.554  59.489 69.612  1.00 36.52  ? 146 ILE A CD1   1 
ATOM   1396 N N     . GLY C 3 147 ? 24.185  59.692 68.370  1.00 56.52  ? 147 GLY A N     1 
ATOM   1397 C CA    . GLY C 3 147 ? 25.299  58.975 67.784  1.00 55.77  ? 147 GLY A CA    1 
ATOM   1398 C C     . GLY C 3 147 ? 25.329  58.854 66.279  1.00 56.46  ? 147 GLY A C     1 
ATOM   1399 O O     . GLY C 3 147 ? 25.920  57.913 65.753  1.00 57.62  ? 147 GLY A O     1 
ATOM   1400 N N     . PHE C 3 148 ? 24.703  59.787 65.572  1.00 59.07  ? 148 PHE A N     1 
ATOM   1401 C CA    . PHE C 3 148 ? 24.713  59.728 64.117  1.00 58.70  ? 148 PHE A CA    1 
ATOM   1402 C C     . PHE C 3 148 ? 25.423  60.936 63.520  1.00 59.36  ? 148 PHE A C     1 
ATOM   1403 O O     . PHE C 3 148 ? 25.505  61.990 64.148  1.00 59.73  ? 148 PHE A O     1 
ATOM   1404 C CB    . PHE C 3 148 ? 23.284  59.632 63.567  1.00 45.22  ? 148 PHE A CB    1 
ATOM   1405 C CG    . PHE C 3 148 ? 22.592  58.340 63.897  1.00 43.78  ? 148 PHE A CG    1 
ATOM   1406 C CD1   . PHE C 3 148 ? 22.031  58.134 65.150  1.00 43.71  ? 148 PHE A CD1   1 
ATOM   1407 C CD2   . PHE C 3 148 ? 22.514  57.322 62.957  1.00 43.11  ? 148 PHE A CD2   1 
ATOM   1408 C CE1   . PHE C 3 148 ? 21.402  56.929 65.457  1.00 43.63  ? 148 PHE A CE1   1 
ATOM   1409 C CE2   . PHE C 3 148 ? 21.889  56.117 63.255  1.00 41.94  ? 148 PHE A CE2   1 
ATOM   1410 C CZ    . PHE C 3 148 ? 21.333  55.920 64.505  1.00 42.62  ? 148 PHE A CZ    1 
ATOM   1411 N N     . ALA C 3 149 ? 25.945  60.769 62.309  1.00 61.65  ? 149 ALA A N     1 
ATOM   1412 C CA    . ALA C 3 149 ? 26.650  61.840 61.613  1.00 63.29  ? 149 ALA A CA    1 
ATOM   1413 C C     . ALA C 3 149 ? 25.639  62.763 60.943  1.00 64.31  ? 149 ALA A C     1 
ATOM   1414 O O     . ALA C 3 149 ? 25.814  63.165 59.792  1.00 63.72  ? 149 ALA A O     1 
ATOM   1415 C CB    . ALA C 3 149 ? 27.585  61.249 60.569  1.00 84.28  ? 149 ALA A CB    1 
ATOM   1416 N N     . ALA C 3 150 ? 24.579  63.092 61.674  1.00 54.99  ? 150 ALA A N     1 
ATOM   1417 C CA    . ALA C 3 150 ? 23.527  63.954 61.159  1.00 55.77  ? 150 ALA A CA    1 
ATOM   1418 C C     . ALA C 3 150 ? 24.001  65.393 61.011  1.00 56.12  ? 150 ALA A C     1 
ATOM   1419 O O     . ALA C 3 150 ? 24.795  65.879 61.812  1.00 55.90  ? 150 ALA A O     1 
ATOM   1420 C CB    . ALA C 3 150 ? 22.314  63.894 62.080  1.00 58.32  ? 150 ALA A CB    1 
ATOM   1421 N N     . LYS C 3 151 ? 23.508  66.064 59.974  1.00 70.68  ? 151 LYS A N     1 
ATOM   1422 C CA    . LYS C 3 151 ? 23.853  67.456 59.705  1.00 70.96  ? 151 LYS A CA    1 
ATOM   1423 C C     . LYS C 3 151 ? 22.583  68.204 59.298  1.00 68.68  ? 151 LYS A C     1 
ATOM   1424 O O     . LYS C 3 151 ? 21.664  67.613 58.730  1.00 68.02  ? 151 LYS A O     1 
ATOM   1425 C CB    . LYS C 3 151 ? 24.877  67.553 58.566  1.00 75.24  ? 151 LYS A CB    1 
ATOM   1426 C CG    . LYS C 3 151 ? 25.993  66.518 58.602  1.00 79.61  ? 151 LYS A CG    1 
ATOM   1427 C CD    . LYS C 3 151 ? 25.594  65.238 57.875  1.00 83.48  ? 151 LYS A CD    1 
ATOM   1428 C CE    . LYS C 3 151 ? 25.437  65.456 56.369  1.00 85.53  ? 151 LYS A CE    1 
ATOM   1429 N NZ    . LYS C 3 151 ? 26.724  65.765 55.676  1.00 86.83  ? 151 LYS A NZ    1 
ATOM   1430 N N     . PHE C 3 152 ? 22.528  69.500 59.591  1.00 52.78  ? 152 PHE A N     1 
ATOM   1431 C CA    . PHE C 3 152 ? 21.366  70.306 59.228  1.00 50.61  ? 152 PHE A CA    1 
ATOM   1432 C C     . PHE C 3 152 ? 21.545  70.762 57.779  1.00 49.55  ? 152 PHE A C     1 
ATOM   1433 O O     . PHE C 3 152 ? 22.312  71.679 57.499  1.00 49.98  ? 152 PHE A O     1 
ATOM   1434 C CB    . PHE C 3 152 ? 21.240  71.513 60.163  1.00 41.43  ? 152 PHE A CB    1 
ATOM   1435 C CG    . PHE C 3 152 ? 19.957  72.274 59.995  1.00 41.11  ? 152 PHE A CG    1 
ATOM   1436 C CD1   . PHE C 3 152 ? 18.734  71.621 60.078  1.00 41.62  ? 152 PHE A CD1   1 
ATOM   1437 C CD2   . PHE C 3 152 ? 19.967  73.640 59.739  1.00 40.45  ? 152 PHE A CD2   1 
ATOM   1438 C CE1   . PHE C 3 152 ? 17.540  72.317 59.907  1.00 41.49  ? 152 PHE A CE1   1 
ATOM   1439 C CE2   . PHE C 3 152 ? 18.776  74.342 59.568  1.00 40.23  ? 152 PHE A CE2   1 
ATOM   1440 C CZ    . PHE C 3 152 ? 17.562  73.678 59.651  1.00 40.55  ? 152 PHE A CZ    1 
ATOM   1441 N N     . THR C 3 153 ? 20.829  70.112 56.866  1.00 49.32  ? 153 THR A N     1 
ATOM   1442 C CA    . THR C 3 153 ? 20.923  70.403 55.438  1.00 47.83  ? 153 THR A CA    1 
ATOM   1443 C C     . THR C 3 153 ? 19.564  70.702 54.814  1.00 47.51  ? 153 THR A C     1 
ATOM   1444 O O     . THR C 3 153 ? 18.520  70.541 55.446  1.00 48.77  ? 153 THR A O     1 
ATOM   1445 C CB    . THR C 3 153 ? 21.540  69.195 54.681  1.00 53.69  ? 153 THR A CB    1 
ATOM   1446 O OG1   . THR C 3 153 ? 22.816  68.874 55.245  1.00 54.53  ? 153 THR A OG1   1 
ATOM   1447 C CG2   . THR C 3 153 ? 21.715  69.497 53.212  1.00 53.71  ? 153 THR A CG2   1 
ATOM   1448 N N     . ASP C 3 154 ? 19.609  71.141 53.562  1.00 49.14  ? 154 ASP A N     1 
ATOM   1449 C CA    . ASP C 3 154 ? 18.440  71.460 52.755  1.00 47.62  ? 154 ASP A CA    1 
ATOM   1450 C C     . ASP C 3 154 ? 17.158  71.931 53.444  1.00 46.59  ? 154 ASP A C     1 
ATOM   1451 O O     . ASP C 3 154 ? 16.064  71.556 53.004  1.00 48.26  ? 154 ASP A O     1 
ATOM   1452 C CB    . ASP C 3 154 ? 18.083  70.263 51.868  1.00 42.09  ? 154 ASP A CB    1 
ATOM   1453 C CG    . ASP C 3 154 ? 19.235  69.811 50.991  1.00 43.77  ? 154 ASP A CG    1 
ATOM   1454 O OD1   . ASP C 3 154 ? 20.014  70.673 50.525  1.00 44.00  ? 154 ASP A OD1   1 
ATOM   1455 O OD2   . ASP C 3 154 ? 19.346  68.587 50.753  1.00 45.53  ? 154 ASP A OD2   1 
ATOM   1456 N N     . PHE C 3 155 ? 17.259  72.745 54.495  1.00 37.48  ? 155 PHE A N     1 
ATOM   1457 C CA    . PHE C 3 155 ? 16.042  73.225 55.159  1.00 34.77  ? 155 PHE A CA    1 
ATOM   1458 C C     . PHE C 3 155 ? 15.120  73.929 54.149  1.00 33.33  ? 155 PHE A C     1 
ATOM   1459 O O     . PHE C 3 155 ? 15.560  74.796 53.402  1.00 32.41  ? 155 PHE A O     1 
ATOM   1460 C CB    . PHE C 3 155 ? 16.367  74.200 56.286  1.00 29.47  ? 155 PHE A CB    1 
ATOM   1461 C CG    . PHE C 3 155 ? 15.143  74.790 56.920  1.00 29.39  ? 155 PHE A CG    1 
ATOM   1462 C CD1   . PHE C 3 155 ? 14.457  74.100 57.913  1.00 28.11  ? 155 PHE A CD1   1 
ATOM   1463 C CD2   . PHE C 3 155 ? 14.627  76.004 56.470  1.00 28.26  ? 155 PHE A CD2   1 
ATOM   1464 C CE1   . PHE C 3 155 ? 13.273  74.609 58.444  1.00 26.23  ? 155 PHE A CE1   1 
ATOM   1465 C CE2   . PHE C 3 155 ? 13.445  76.517 56.997  1.00 26.19  ? 155 PHE A CE2   1 
ATOM   1466 C CZ    . PHE C 3 155 ? 12.769  75.815 57.985  1.00 25.90  ? 155 PHE A CZ    1 
ATOM   1467 N N     . LYS C 3 156 ? 13.839  73.572 54.144  1.00 38.40  ? 156 LYS A N     1 
ATOM   1468 C CA    . LYS C 3 156 ? 12.892  74.162 53.199  1.00 37.60  ? 156 LYS A CA    1 
ATOM   1469 C C     . LYS C 3 156 ? 11.445  74.090 53.701  1.00 37.03  ? 156 LYS A C     1 
ATOM   1470 O O     . LYS C 3 156 ? 10.954  73.014 54.029  1.00 37.39  ? 156 LYS A O     1 
ATOM   1471 C CB    . LYS C 3 156 ? 13.019  73.427 51.857  1.00 35.08  ? 156 LYS A CB    1 
ATOM   1472 C CG    . LYS C 3 156 ? 11.942  73.720 50.811  1.00 35.81  ? 156 LYS A CG    1 
ATOM   1473 C CD    . LYS C 3 156 ? 12.287  74.909 49.935  1.00 36.47  ? 156 LYS A CD    1 
ATOM   1474 C CE    . LYS C 3 156 ? 11.226  75.122 48.865  1.00 34.79  ? 156 LYS A CE    1 
ATOM   1475 N NZ    . LYS C 3 156 ? 10.991  73.864 48.107  1.00 33.93  ? 156 LYS A NZ    1 
ATOM   1476 N N     . ILE C 3 157 ? 10.765  75.233 53.769  1.00 36.05  ? 157 ILE A N     1 
ATOM   1477 C CA    . ILE C 3 157 ? 9.370   75.244 54.205  1.00 34.71  ? 157 ILE A CA    1 
ATOM   1478 C C     . ILE C 3 157 ? 8.525   74.758 53.024  1.00 34.21  ? 157 ILE A C     1 
ATOM   1479 O O     . ILE C 3 157 ? 8.678   75.241 51.901  1.00 35.45  ? 157 ILE A O     1 
ATOM   1480 C CB    . ILE C 3 157 ? 8.919   76.667 54.652  1.00 24.10  ? 157 ILE A CB    1 
ATOM   1481 C CG1   . ILE C 3 157 ? 9.722   77.087 55.887  1.00 23.29  ? 157 ILE A CG1   1 
ATOM   1482 C CG2   . ILE C 3 157 ? 7.418   76.684 54.966  1.00 23.75  ? 157 ILE A CG2   1 
ATOM   1483 C CD1   . ILE C 3 157 ? 9.236   78.351 56.556  1.00 23.42  ? 157 ILE A CD1   1 
ATOM   1484 N N     . GLN C 3 158 ? 7.643   73.796 53.278  1.00 34.51  ? 158 GLN A N     1 
ATOM   1485 C CA    . GLN C 3 158 ? 6.808   73.225 52.224  1.00 33.55  ? 158 GLN A CA    1 
ATOM   1486 C C     . GLN C 3 158 ? 5.349   73.642 52.274  1.00 33.42  ? 158 GLN A C     1 
ATOM   1487 O O     . GLN C 3 158 ? 4.638   73.527 51.275  1.00 35.16  ? 158 GLN A O     1 
ATOM   1488 C CB    . GLN C 3 158 ? 6.894   71.703 52.269  1.00 27.96  ? 158 GLN A CB    1 
ATOM   1489 C CG    . GLN C 3 158 ? 8.309   71.187 52.124  1.00 26.79  ? 158 GLN A CG    1 
ATOM   1490 C CD    . GLN C 3 158 ? 8.793   71.209 50.694  1.00 25.93  ? 158 GLN A CD    1 
ATOM   1491 O OE1   . GLN C 3 158 ? 9.952   70.909 50.421  1.00 27.19  ? 158 GLN A OE1   1 
ATOM   1492 N NE2   . GLN C 3 158 ? 7.901   71.546 49.768  1.00 23.95  ? 158 GLN A NE2   1 
ATOM   1493 N N     . ASN C 3 159 ? 4.896   74.127 53.427  1.00 27.58  ? 159 ASN A N     1 
ATOM   1494 C CA    . ASN C 3 159 ? 3.508   74.550 53.549  1.00 25.85  ? 159 ASN A CA    1 
ATOM   1495 C C     . ASN C 3 159 ? 3.263   75.433 54.762  1.00 23.74  ? 159 ASN A C     1 
ATOM   1496 O O     . ASN C 3 159 ? 3.794   75.184 55.843  1.00 23.18  ? 159 ASN A O     1 
ATOM   1497 C CB    . ASN C 3 159 ? 2.592   73.320 53.609  1.00 21.70  ? 159 ASN A CB    1 
ATOM   1498 C CG    . ASN C 3 159 ? 1.116   73.682 53.544  1.00 20.96  ? 159 ASN A CG    1 
ATOM   1499 O OD1   . ASN C 3 159 ? 0.659   74.324 52.597  1.00 21.36  ? 159 ASN A OD1   1 
ATOM   1500 N ND2   . ASN C 3 159 ? 0.363   73.261 54.551  1.00 21.82  ? 159 ASN A ND2   1 
ATOM   1501 N N     . ILE C 3 160 ? 2.461   76.477 54.563  1.00 29.65  ? 160 ILE A N     1 
ATOM   1502 C CA    . ILE C 3 160 ? 2.102   77.395 55.637  1.00 28.86  ? 160 ILE A CA    1 
ATOM   1503 C C     . ILE C 3 160 ? 0.590   77.526 55.657  1.00 26.11  ? 160 ILE A C     1 
ATOM   1504 O O     . ILE C 3 160 ? -0.036  77.725 54.617  1.00 26.44  ? 160 ILE A O     1 
ATOM   1505 C CB    . ILE C 3 160 ? 2.694   78.790 55.430  1.00 20.23  ? 160 ILE A CB    1 
ATOM   1506 C CG1   . ILE C 3 160 ? 4.182   78.674 55.116  1.00 19.18  ? 160 ILE A CG1   1 
ATOM   1507 C CG2   . ILE C 3 160 ? 2.473   79.631 56.690  1.00 19.28  ? 160 ILE A CG2   1 
ATOM   1508 C CD1   . ILE C 3 160 ? 4.893   80.000 55.021  1.00 21.65  ? 160 ILE A CD1   1 
ATOM   1509 N N     . VAL C 3 161 ? 0.016   77.399 56.850  1.00 16.66  ? 161 VAL A N     1 
ATOM   1510 C CA    . VAL C 3 161 ? -1.419  77.490 57.055  1.00 15.84  ? 161 VAL A CA    1 
ATOM   1511 C C     . VAL C 3 161 ? -1.697  78.679 57.956  1.00 17.04  ? 161 VAL A C     1 
ATOM   1512 O O     . VAL C 3 161 ? -0.962  78.917 58.905  1.00 18.36  ? 161 VAL A O     1 
ATOM   1513 C CB    . VAL C 3 161 ? -1.954  76.213 57.739  1.00 12.10  ? 161 VAL A CB    1 
ATOM   1514 C CG1   . VAL C 3 161 ? -3.476  76.277 57.885  1.00 10.00  ? 161 VAL A CG1   1 
ATOM   1515 C CG2   . VAL C 3 161 ? -1.557  74.998 56.928  1.00 11.63  ? 161 VAL A CG2   1 
ATOM   1516 N N     . GLY C 3 162 ? -2.754  79.426 57.651  1.00 24.52  ? 162 GLY A N     1 
ATOM   1517 C CA    . GLY C 3 162 ? -3.116  80.575 58.462  1.00 25.67  ? 162 GLY A CA    1 
ATOM   1518 C C     . GLY C 3 162 ? -4.623  80.662 58.614  1.00 26.81  ? 162 GLY A C     1 
ATOM   1519 O O     . GLY C 3 162 ? -5.353  80.122 57.789  1.00 28.49  ? 162 GLY A O     1 
ATOM   1520 N N     . SER C 3 163 ? -5.097  81.330 59.665  1.00 18.05  ? 163 SER A N     1 
ATOM   1521 C CA    . SER C 3 163 ? -6.533  81.475 59.889  1.00 18.94  ? 163 SER A CA    1 
ATOM   1522 C C     . SER C 3 163 ? -6.916  82.921 60.177  1.00 20.40  ? 163 SER A C     1 
ATOM   1523 O O     . SER C 3 163 ? -6.087  83.735 60.579  1.00 18.98  ? 163 SER A O     1 
ATOM   1524 C CB    . SER C 3 163 ? -7.007  80.565 61.033  1.00 26.87  ? 163 SER A CB    1 
ATOM   1525 O OG    . SER C 3 163 ? -6.453  80.933 62.282  1.00 27.88  ? 163 SER A OG    1 
ATOM   1526 N N     . CYS C 3 164 ? -8.187  83.232 59.963  1.00 27.72  ? 164 CYS A N     1 
ATOM   1527 C CA    . CYS C 3 164 ? -8.712  84.576 60.159  1.00 31.28  ? 164 CYS A CA    1 
ATOM   1528 C C     . CYS C 3 164 ? -10.082 84.521 60.758  1.00 32.19  ? 164 CYS A C     1 
ATOM   1529 O O     . CYS C 3 164 ? -10.674 83.464 60.931  1.00 32.87  ? 164 CYS A O     1 
ATOM   1530 C CB    . CYS C 3 164 ? -8.873  85.301 58.829  1.00 45.95  ? 164 CYS A CB    1 
ATOM   1531 S SG    . CYS C 3 164 ? -7.537  86.325 58.335  1.00 56.82  ? 164 CYS A SG    1 
ATOM   1532 N N     . ASP C 3 165 ? -10.588 85.709 61.026  1.00 37.32  ? 165 ASP A N     1 
ATOM   1533 C CA    . ASP C 3 165 ? -11.914 85.892 61.557  1.00 37.15  ? 165 ASP A CA    1 
ATOM   1534 C C     . ASP C 3 165 ? -12.312 87.270 61.058  1.00 37.80  ? 165 ASP A C     1 
ATOM   1535 O O     . ASP C 3 165 ? -11.807 88.280 61.540  1.00 39.21  ? 165 ASP A O     1 
ATOM   1536 C CB    . ASP C 3 165 ? -11.904 85.866 63.079  1.00 30.37  ? 165 ASP A CB    1 
ATOM   1537 C CG    . ASP C 3 165 ? -13.296 85.857 63.659  1.00 32.32  ? 165 ASP A CG    1 
ATOM   1538 O OD1   . ASP C 3 165 ? -14.258 86.138 62.912  1.00 32.73  ? 165 ASP A OD1   1 
ATOM   1539 O OD2   . ASP C 3 165 ? -13.435 85.576 64.861  1.00 33.08  ? 165 ASP A OD2   1 
ATOM   1540 N N     . VAL C 3 166 ? -13.185 87.308 60.063  1.00 29.70  ? 166 VAL A N     1 
ATOM   1541 C CA    . VAL C 3 166 ? -13.633 88.578 59.524  1.00 30.09  ? 166 VAL A CA    1 
ATOM   1542 C C     . VAL C 3 166 ? -14.725 89.174 60.425  1.00 31.32  ? 166 VAL A C     1 
ATOM   1543 O O     . VAL C 3 166 ? -15.211 90.275 60.183  1.00 30.38  ? 166 VAL A O     1 
ATOM   1544 C CB    . VAL C 3 166 ? -14.143 88.410 58.070  1.00 22.34  ? 166 VAL A CB    1 
ATOM   1545 C CG1   . VAL C 3 166 ? -12.979 87.973 57.161  1.00 22.42  ? 166 VAL A CG1   1 
ATOM   1546 C CG2   . VAL C 3 166 ? -15.266 87.387 58.016  1.00 20.75  ? 166 VAL A CG2   1 
ATOM   1547 N N     . LYS C 3 167 ? -15.095 88.432 61.467  1.00 48.53  ? 167 LYS A N     1 
ATOM   1548 C CA    . LYS C 3 167 ? -16.098 88.855 62.447  1.00 50.69  ? 167 LYS A CA    1 
ATOM   1549 C C     . LYS C 3 167 ? -17.579 88.794 62.051  1.00 49.53  ? 167 LYS A C     1 
ATOM   1550 O O     . LYS C 3 167 ? -18.453 88.806 62.919  1.00 50.87  ? 167 LYS A O     1 
ATOM   1551 C CB    . LYS C 3 167 ? -15.771 90.260 62.949  1.00 73.61  ? 167 LYS A CB    1 
ATOM   1552 C CG    . LYS C 3 167 ? -15.399 90.316 64.420  1.00 78.48  ? 167 LYS A CG    1 
ATOM   1553 C CD    . LYS C 3 167 ? -14.088 89.614 64.711  1.00 83.51  ? 167 LYS A CD    1 
ATOM   1554 C CE    . LYS C 3 167 ? -13.739 89.735 66.188  1.00 86.67  ? 167 LYS A CE    1 
ATOM   1555 N NZ    . LYS C 3 167 ? -12.413 89.140 66.510  1.00 89.58  ? 167 LYS A NZ    1 
ATOM   1556 N N     . PHE C 3 168 ? -17.876 88.730 60.759  1.00 38.85  ? 168 PHE A N     1 
ATOM   1557 C CA    . PHE C 3 168 ? -19.271 88.653 60.331  1.00 36.27  ? 168 PHE A CA    1 
ATOM   1558 C C     . PHE C 3 168 ? -19.613 87.319 59.666  1.00 36.43  ? 168 PHE A C     1 
ATOM   1559 O O     . PHE C 3 168 ? -18.727 86.593 59.209  1.00 34.67  ? 168 PHE A O     1 
ATOM   1560 C CB    . PHE C 3 168 ? -19.614 89.829 59.398  1.00 23.98  ? 168 PHE A CB    1 
ATOM   1561 C CG    . PHE C 3 168 ? -18.687 89.979 58.214  1.00 20.11  ? 168 PHE A CG    1 
ATOM   1562 C CD1   . PHE C 3 168 ? -18.893 89.244 57.045  1.00 18.60  ? 168 PHE A CD1   1 
ATOM   1563 C CD2   . PHE C 3 168 ? -17.616 90.873 58.261  1.00 18.47  ? 168 PHE A CD2   1 
ATOM   1564 C CE1   . PHE C 3 168 ? -18.045 89.394 55.934  1.00 17.16  ? 168 PHE A CE1   1 
ATOM   1565 C CE2   . PHE C 3 168 ? -16.759 91.034 57.157  1.00 18.09  ? 168 PHE A CE2   1 
ATOM   1566 C CZ    . PHE C 3 168 ? -16.976 90.293 55.992  1.00 17.63  ? 168 PHE A CZ    1 
ATOM   1567 N N     . PRO C 3 169 ? -20.909 86.966 59.635  1.00 33.83  ? 169 PRO A N     1 
ATOM   1568 C CA    . PRO C 3 169 ? -21.393 85.718 59.028  1.00 34.35  ? 169 PRO A CA    1 
ATOM   1569 C C     . PRO C 3 169 ? -21.284 85.767 57.498  1.00 34.42  ? 169 PRO A C     1 
ATOM   1570 O O     . PRO C 3 169 ? -21.166 86.840 56.906  1.00 33.74  ? 169 PRO A O     1 
ATOM   1571 C CB    . PRO C 3 169 ? -22.847 85.641 59.498  1.00 40.13  ? 169 PRO A CB    1 
ATOM   1572 C CG    . PRO C 3 169 ? -22.860 86.459 60.752  1.00 39.94  ? 169 PRO A CG    1 
ATOM   1573 C CD    . PRO C 3 169 ? -21.992 87.629 60.374  1.00 39.82  ? 169 PRO A CD    1 
ATOM   1574 N N     . ILE C 3 170 ? -21.341 84.607 56.856  1.00 22.85  ? 170 ILE A N     1 
ATOM   1575 C CA    . ILE C 3 170 ? -21.212 84.560 55.409  1.00 21.86  ? 170 ILE A CA    1 
ATOM   1576 C C     . ILE C 3 170 ? -22.225 83.621 54.776  1.00 24.09  ? 170 ILE A C     1 
ATOM   1577 O O     . ILE C 3 170 ? -22.372 82.469 55.189  1.00 23.21  ? 170 ILE A O     1 
ATOM   1578 C CB    . ILE C 3 170 ? -19.777 84.106 54.999  1.00 24.10  ? 170 ILE A CB    1 
ATOM   1579 C CG1   . ILE C 3 170 ? -18.737 84.997 55.676  1.00 22.58  ? 170 ILE A CG1   1 
ATOM   1580 C CG2   . ILE C 3 170 ? -19.590 84.202 53.489  1.00 22.41  ? 170 ILE A CG2   1 
ATOM   1581 C CD1   . ILE C 3 170 ? -17.322 84.621 55.360  1.00 21.18  ? 170 ILE A CD1   1 
ATOM   1582 N N     . ARG C 3 171 ? -22.932 84.126 53.774  1.00 30.91  ? 171 ARG A N     1 
ATOM   1583 C CA    . ARG C 3 171 ? -23.902 83.318 53.058  1.00 32.70  ? 171 ARG A CA    1 
ATOM   1584 C C     . ARG C 3 171 ? -23.065 82.533 52.045  1.00 32.93  ? 171 ARG A C     1 
ATOM   1585 O O     . ARG C 3 171 ? -22.808 82.999 50.936  1.00 32.98  ? 171 ARG A O     1 
ATOM   1586 C CB    . ARG C 3 171 ? -24.912 84.218 52.344  1.00 45.09  ? 171 ARG A CB    1 
ATOM   1587 C CG    . ARG C 3 171 ? -26.075 83.470 51.734  1.00 48.57  ? 171 ARG A CG    1 
ATOM   1588 C CD    . ARG C 3 171 ? -26.904 84.387 50.867  1.00 50.44  ? 171 ARG A CD    1 
ATOM   1589 N NE    . ARG C 3 171 ? -27.246 83.720 49.620  1.00 52.86  ? 171 ARG A NE    1 
ATOM   1590 C CZ    . ARG C 3 171 ? -26.987 84.216 48.415  1.00 55.57  ? 171 ARG A CZ    1 
ATOM   1591 N NH1   . ARG C 3 171 ? -26.384 85.396 48.292  1.00 54.26  ? 171 ARG A NH1   1 
ATOM   1592 N NH2   . ARG C 3 171 ? -27.318 83.517 47.333  1.00 56.21  ? 171 ARG A NH2   1 
ATOM   1593 N N     . LEU C 3 172 ? -22.628 81.345 52.446  1.00 32.27  ? 172 LEU A N     1 
ATOM   1594 C CA    . LEU C 3 172 ? -21.787 80.503 51.600  1.00 31.75  ? 172 LEU A CA    1 
ATOM   1595 C C     . LEU C 3 172 ? -22.359 80.058 50.246  1.00 32.68  ? 172 LEU A C     1 
ATOM   1596 O O     . LEU C 3 172 ? -21.655 80.120 49.231  1.00 33.31  ? 172 LEU A O     1 
ATOM   1597 C CB    . LEU C 3 172 ? -21.333 79.269 52.395  1.00 25.62  ? 172 LEU A CB    1 
ATOM   1598 C CG    . LEU C 3 172 ? -20.584 79.529 53.708  1.00 22.70  ? 172 LEU A CG    1 
ATOM   1599 C CD1   . LEU C 3 172 ? -20.273 78.209 54.376  1.00 21.45  ? 172 LEU A CD1   1 
ATOM   1600 C CD2   . LEU C 3 172 ? -19.312 80.316 53.438  1.00 21.90  ? 172 LEU A CD2   1 
ATOM   1601 N N     . GLU C 3 173 ? -23.614 79.611 50.213  1.00 38.36  ? 173 GLU A N     1 
ATOM   1602 C CA    . GLU C 3 173 ? -24.198 79.150 48.953  1.00 40.40  ? 173 GLU A CA    1 
ATOM   1603 C C     . GLU C 3 173 ? -24.316 80.244 47.918  1.00 38.69  ? 173 GLU A C     1 
ATOM   1604 O O     . GLU C 3 173 ? -24.368 79.973 46.731  1.00 41.15  ? 173 GLU A O     1 
ATOM   1605 C CB    . GLU C 3 173 ? -25.562 78.496 49.173  1.00 46.82  ? 173 GLU A CB    1 
ATOM   1606 C CG    . GLU C 3 173 ? -26.463 79.220 50.129  1.00 51.33  ? 173 GLU A CG    1 
ATOM   1607 C CD    . GLU C 3 173 ? -26.093 79.001 51.585  1.00 53.79  ? 173 GLU A CD    1 
ATOM   1608 O OE1   . GLU C 3 173 ? -25.474 79.906 52.188  1.00 55.44  ? 173 GLU A OE1   1 
ATOM   1609 O OE2   . GLU C 3 173 ? -26.422 77.921 52.125  1.00 53.45  ? 173 GLU A OE2   1 
ATOM   1610 N N     . GLY C 3 174 ? -24.367 81.486 48.365  1.00 27.13  ? 174 GLY A N     1 
ATOM   1611 C CA    . GLY C 3 174 ? -24.433 82.574 47.418  1.00 25.77  ? 174 GLY A CA    1 
ATOM   1612 C C     . GLY C 3 174 ? -23.043 82.782 46.850  1.00 25.35  ? 174 GLY A C     1 
ATOM   1613 O O     . GLY C 3 174 ? -22.877 83.087 45.670  1.00 26.20  ? 174 GLY A O     1 
ATOM   1614 N N     . LEU C 3 175 ? -22.030 82.605 47.692  1.00 34.49  ? 175 LEU A N     1 
ATOM   1615 C CA    . LEU C 3 175 ? -20.640 82.781 47.278  1.00 33.41  ? 175 LEU A CA    1 
ATOM   1616 C C     . LEU C 3 175 ? -20.234 81.666 46.325  1.00 33.51  ? 175 LEU A C     1 
ATOM   1617 O O     . LEU C 3 175 ? -19.487 81.894 45.376  1.00 33.02  ? 175 LEU A O     1 
ATOM   1618 C CB    . LEU C 3 175 ? -19.724 82.779 48.510  1.00 28.99  ? 175 LEU A CB    1 
ATOM   1619 C CG    . LEU C 3 175 ? -18.304 83.355 48.396  1.00 28.53  ? 175 LEU A CG    1 
ATOM   1620 C CD1   . LEU C 3 175 ? -17.690 83.428 49.776  1.00 27.37  ? 175 LEU A CD1   1 
ATOM   1621 C CD2   . LEU C 3 175 ? -17.445 82.511 47.477  1.00 29.32  ? 175 LEU A CD2   1 
ATOM   1622 N N     . ALA C 3 176 ? -20.733 80.460 46.587  1.00 40.49  ? 176 ALA A N     1 
ATOM   1623 C CA    . ALA C 3 176 ? -20.424 79.306 45.754  1.00 39.31  ? 176 ALA A CA    1 
ATOM   1624 C C     . ALA C 3 176 ? -21.065 79.452 44.383  1.00 40.66  ? 176 ALA A C     1 
ATOM   1625 O O     . ALA C 3 176 ? -20.410 79.221 43.368  1.00 42.42  ? 176 ALA A O     1 
ATOM   1626 C CB    . ALA C 3 176 ? -20.907 78.032 46.423  1.00 28.18  ? 176 ALA A CB    1 
ATOM   1627 N N     . PHE C 3 177 ? -22.342 79.829 44.348  1.00 33.64  ? 177 PHE A N     1 
ATOM   1628 C CA    . PHE C 3 177 ? -23.042 80.005 43.076  1.00 32.91  ? 177 PHE A CA    1 
ATOM   1629 C C     . PHE C 3 177 ? -22.414 81.115 42.236  1.00 35.12  ? 177 PHE A C     1 
ATOM   1630 O O     . PHE C 3 177 ? -22.413 81.052 41.002  1.00 36.49  ? 177 PHE A O     1 
ATOM   1631 C CB    . PHE C 3 177 ? -24.515 80.340 43.303  1.00 22.51  ? 177 PHE A CB    1 
ATOM   1632 C CG    . PHE C 3 177 ? -25.320 79.205 43.840  1.00 22.66  ? 177 PHE A CG    1 
ATOM   1633 C CD1   . PHE C 3 177 ? -25.155 77.918 43.340  1.00 23.38  ? 177 PHE A CD1   1 
ATOM   1634 C CD2   . PHE C 3 177 ? -26.279 79.425 44.825  1.00 22.24  ? 177 PHE A CD2   1 
ATOM   1635 C CE1   . PHE C 3 177 ? -25.936 76.856 43.813  1.00 24.32  ? 177 PHE A CE1   1 
ATOM   1636 C CE2   . PHE C 3 177 ? -27.066 78.377 45.307  1.00 22.87  ? 177 PHE A CE2   1 
ATOM   1637 C CZ    . PHE C 3 177 ? -26.895 77.087 44.799  1.00 23.93  ? 177 PHE A CZ    1 
ATOM   1638 N N     . SER C 3 178 ? -21.890 82.134 42.911  1.00 38.65  ? 178 SER A N     1 
ATOM   1639 C CA    . SER C 3 178 ? -21.268 83.271 42.243  1.00 40.35  ? 178 SER A CA    1 
ATOM   1640 C C     . SER C 3 178 ? -19.896 82.922 41.651  1.00 40.39  ? 178 SER A C     1 
ATOM   1641 O O     . SER C 3 178 ? -19.595 83.284 40.513  1.00 40.89  ? 178 SER A O     1 
ATOM   1642 C CB    . SER C 3 178 ? -21.136 84.431 43.230  1.00 52.79  ? 178 SER A CB    1 
ATOM   1643 O OG    . SER C 3 178 ? -20.608 85.576 42.594  1.00 53.26  ? 178 SER A OG    1 
ATOM   1644 N N     . HIS C 3 179 ? -19.073 82.228 42.436  1.00 35.84  ? 179 HIS A N     1 
ATOM   1645 C CA    . HIS C 3 179 ? -17.737 81.807 42.018  1.00 34.86  ? 179 HIS A CA    1 
ATOM   1646 C C     . HIS C 3 179 ? -17.693 80.300 41.852  1.00 36.03  ? 179 HIS A C     1 
ATOM   1647 O O     . HIS C 3 179 ? -16.879 79.637 42.486  1.00 37.29  ? 179 HIS A O     1 
ATOM   1648 C CB    . HIS C 3 179 ? -16.697 82.199 43.066  1.00 36.61  ? 179 HIS A CB    1 
ATOM   1649 C CG    . HIS C 3 179 ? -16.544 83.674 43.245  1.00 35.37  ? 179 HIS A CG    1 
ATOM   1650 N ND1   . HIS C 3 179 ? -17.453 84.437 43.944  1.00 34.78  ? 179 HIS A ND1   1 
ATOM   1651 C CD2   . HIS C 3 179 ? -15.607 84.534 42.781  1.00 35.03  ? 179 HIS A CD2   1 
ATOM   1652 C CE1   . HIS C 3 179 ? -17.085 85.704 43.902  1.00 34.26  ? 179 HIS A CE1   1 
ATOM   1653 N NE2   . HIS C 3 179 ? -15.969 85.790 43.202  1.00 34.61  ? 179 HIS A NE2   1 
ATOM   1654 N N     . GLY C 3 180 ? -18.560 79.761 41.000  1.00 37.15  ? 180 GLY A N     1 
ATOM   1655 C CA    . GLY C 3 180 ? -18.616 78.323 40.794  1.00 37.91  ? 180 GLY A CA    1 
ATOM   1656 C C     . GLY C 3 180 ? -17.345 77.632 40.332  1.00 39.59  ? 180 GLY A C     1 
ATOM   1657 O O     . GLY C 3 180 ? -17.096 76.478 40.686  1.00 41.07  ? 180 GLY A O     1 
ATOM   1658 N N     . THR C 3 181 ? -16.532 78.324 39.546  1.00 44.16  ? 181 THR A N     1 
ATOM   1659 C CA    . THR C 3 181 ? -15.302 77.729 39.047  1.00 46.62  ? 181 THR A CA    1 
ATOM   1660 C C     . THR C 3 181 ? -14.180 77.604 40.080  1.00 47.19  ? 181 THR A C     1 
ATOM   1661 O O     . THR C 3 181 ? -13.213 76.876 39.856  1.00 48.19  ? 181 THR A O     1 
ATOM   1662 C CB    . THR C 3 181 ? -14.758 78.517 37.834  1.00 61.81  ? 181 THR A CB    1 
ATOM   1663 O OG1   . THR C 3 181 ? -14.585 79.896 38.190  1.00 63.86  ? 181 THR A OG1   1 
ATOM   1664 C CG2   . THR C 3 181 ? -15.718 78.412 36.659  1.00 62.20  ? 181 THR A CG2   1 
ATOM   1665 N N     . PHE C 3 182 ? -14.309 78.295 41.211  1.00 30.16  ? 182 PHE A N     1 
ATOM   1666 C CA    . PHE C 3 182 ? -13.276 78.266 42.248  1.00 29.19  ? 182 PHE A CA    1 
ATOM   1667 C C     . PHE C 3 182 ? -13.722 77.637 43.555  1.00 28.51  ? 182 PHE A C     1 
ATOM   1668 O O     . PHE C 3 182 ? -12.898 77.152 44.333  1.00 27.60  ? 182 PHE A O     1 
ATOM   1669 C CB    . PHE C 3 182 ? -12.800 79.682 42.549  1.00 45.53  ? 182 PHE A CB    1 
ATOM   1670 C CG    . PHE C 3 182 ? -12.339 80.428 41.346  1.00 48.29  ? 182 PHE A CG    1 
ATOM   1671 C CD1   . PHE C 3 182 ? -11.229 79.995 40.630  1.00 49.30  ? 182 PHE A CD1   1 
ATOM   1672 C CD2   . PHE C 3 182 ? -13.007 81.575 40.931  1.00 49.68  ? 182 PHE A CD2   1 
ATOM   1673 C CE1   . PHE C 3 182 ? -10.785 80.691 39.515  1.00 49.09  ? 182 PHE A CE1   1 
ATOM   1674 C CE2   . PHE C 3 182 ? -12.574 82.282 39.818  1.00 50.81  ? 182 PHE A CE2   1 
ATOM   1675 C CZ    . PHE C 3 182 ? -11.456 81.838 39.106  1.00 50.43  ? 182 PHE A CZ    1 
ATOM   1676 N N     . SER C 3 183 ? -15.023 77.641 43.805  1.00 39.15  ? 183 SER A N     1 
ATOM   1677 C CA    . SER C 3 183 ? -15.514 77.094 45.053  1.00 39.90  ? 183 SER A CA    1 
ATOM   1678 C C     . SER C 3 183 ? -16.360 75.836 44.939  1.00 39.79  ? 183 SER A C     1 
ATOM   1679 O O     . SER C 3 183 ? -17.150 75.679 44.010  1.00 40.24  ? 183 SER A O     1 
ATOM   1680 C CB    . SER C 3 183 ? -16.291 78.174 45.815  1.00 40.82  ? 183 SER A CB    1 
ATOM   1681 O OG    . SER C 3 183 ? -17.395 78.634 45.066  1.00 39.95  ? 183 SER A OG    1 
ATOM   1682 N N     . SER C 3 184 ? -16.165 74.936 45.898  1.00 27.83  ? 184 SER A N     1 
ATOM   1683 C CA    . SER C 3 184 ? -16.915 73.695 45.985  1.00 27.20  ? 184 SER A CA    1 
ATOM   1684 C C     . SER C 3 184 ? -17.559 73.702 47.371  1.00 26.28  ? 184 SER A C     1 
ATOM   1685 O O     . SER C 3 184 ? -16.876 73.688 48.398  1.00 23.56  ? 184 SER A O     1 
ATOM   1686 C CB    . SER C 3 184 ? -15.992 72.482 45.817  1.00 75.13  ? 184 SER A CB    1 
ATOM   1687 O OG    . SER C 3 184 ? -15.016 72.418 46.838  1.00 80.35  ? 184 SER A OG    1 
ATOM   1688 N N     . TYR C 3 185 ? -18.885 73.757 47.398  1.00 55.29  ? 185 TYR A N     1 
ATOM   1689 C CA    . TYR C 3 185 ? -19.610 73.785 48.658  1.00 55.27  ? 185 TYR A CA    1 
ATOM   1690 C C     . TYR C 3 185 ? -20.722 72.756 48.678  1.00 57.97  ? 185 TYR A C     1 
ATOM   1691 O O     . TYR C 3 185 ? -21.620 72.770 47.835  1.00 59.27  ? 185 TYR A O     1 
ATOM   1692 C CB    . TYR C 3 185 ? -20.197 75.173 48.892  1.00 31.30  ? 185 TYR A CB    1 
ATOM   1693 C CG    . TYR C 3 185 ? -20.981 75.299 50.174  1.00 28.56  ? 185 TYR A CG    1 
ATOM   1694 C CD1   . TYR C 3 185 ? -20.415 74.938 51.391  1.00 26.29  ? 185 TYR A CD1   1 
ATOM   1695 C CD2   . TYR C 3 185 ? -22.273 75.829 50.176  1.00 27.21  ? 185 TYR A CD2   1 
ATOM   1696 C CE1   . TYR C 3 185 ? -21.108 75.106 52.585  1.00 27.42  ? 185 TYR A CE1   1 
ATOM   1697 C CE2   . TYR C 3 185 ? -22.981 76.000 51.369  1.00 26.23  ? 185 TYR A CE2   1 
ATOM   1698 C CZ    . TYR C 3 185 ? -22.390 75.638 52.571  1.00 27.52  ? 185 TYR A CZ    1 
ATOM   1699 O OH    . TYR C 3 185 ? -23.068 75.809 53.760  1.00 29.15  ? 185 TYR A OH    1 
ATOM   1700 N N     . GLU C 3 186 ? -20.646 71.861 49.651  1.00 43.62  ? 186 GLU A N     1 
ATOM   1701 C CA    . GLU C 3 186 ? -21.632 70.808 49.825  1.00 45.97  ? 186 GLU A CA    1 
ATOM   1702 C C     . GLU C 3 186 ? -21.566 70.430 51.275  1.00 44.81  ? 186 GLU A C     1 
ATOM   1703 O O     . GLU C 3 186 ? -20.888 69.481 51.652  1.00 43.93  ? 186 GLU A O     1 
ATOM   1704 C CB    . GLU C 3 186 ? -21.300 69.612 48.943  1.00 75.89  ? 186 GLU A CB    1 
ATOM   1705 C CG    . GLU C 3 186 ? -19.826 69.355 48.802  1.00 82.64  ? 186 GLU A CG    1 
ATOM   1706 C CD    . GLU C 3 186 ? -19.534 68.408 47.667  1.00 87.58  ? 186 GLU A CD    1 
ATOM   1707 O OE1   . GLU C 3 186 ? -19.846 67.206 47.804  1.00 89.67  ? 186 GLU A OE1   1 
ATOM   1708 O OE2   . GLU C 3 186 ? -19.005 68.871 46.632  1.00 89.67  ? 186 GLU A OE2   1 
ATOM   1709 N N     . PRO C 3 187 ? -22.275 71.188 52.115  1.00 42.17  ? 187 PRO A N     1 
ATOM   1710 C CA    . PRO C 3 187 ? -22.364 71.024 53.569  1.00 42.57  ? 187 PRO A CA    1 
ATOM   1711 C C     . PRO C 3 187 ? -22.521 69.578 54.007  1.00 45.33  ? 187 PRO A C     1 
ATOM   1712 O O     . PRO C 3 187 ? -22.112 69.208 55.111  1.00 44.96  ? 187 PRO A O     1 
ATOM   1713 C CB    . PRO C 3 187 ? -23.567 71.886 53.942  1.00 30.18  ? 187 PRO A CB    1 
ATOM   1714 C CG    . PRO C 3 187 ? -24.382 71.900 52.676  1.00 29.26  ? 187 PRO A CG    1 
ATOM   1715 C CD    . PRO C 3 187 ? -23.337 72.080 51.627  1.00 28.17  ? 187 PRO A CD    1 
ATOM   1716 N N     . GLU C 3 188 ? -23.122 68.770 53.138  1.00 55.28  ? 188 GLU A N     1 
ATOM   1717 C CA    . GLU C 3 188 ? -23.316 67.356 53.414  1.00 56.49  ? 188 GLU A CA    1 
ATOM   1718 C C     . GLU C 3 188 ? -21.966 66.727 53.732  1.00 54.44  ? 188 GLU A C     1 
ATOM   1719 O O     . GLU C 3 188 ? -21.826 66.032 54.736  1.00 54.85  ? 188 GLU A O     1 
ATOM   1720 C CB    . GLU C 3 188 ? -23.939 66.668 52.202  1.00 89.54  ? 188 GLU A CB    1 
ATOM   1721 C CG    . GLU C 3 188 ? -23.446 67.214 50.874  1.00 90.00  ? 188 GLU A CG    1 
ATOM   1722 C CD    . GLU C 3 188 ? -23.623 66.226 49.742  1.00 90.00  ? 188 GLU A CD    1 
ATOM   1723 O OE1   . GLU C 3 188 ? -24.725 65.648 49.622  1.00 90.00  ? 188 GLU A OE1   1 
ATOM   1724 O OE2   . GLU C 3 188 ? -22.658 66.031 48.970  1.00 90.00  ? 188 GLU A OE2   1 
ATOM   1725 N N     . LEU C 3 189 ? -20.980 66.990 52.872  1.00 52.56  ? 189 LEU A N     1 
ATOM   1726 C CA    . LEU C 3 189 ? -19.615 66.481 53.026  1.00 50.50  ? 189 LEU A CA    1 
ATOM   1727 C C     . LEU C 3 189 ? -18.850 67.231 54.099  1.00 46.74  ? 189 LEU A C     1 
ATOM   1728 O O     . LEU C 3 189 ? -18.382 66.652 55.083  1.00 47.65  ? 189 LEU A O     1 
ATOM   1729 C CB    . LEU C 3 189 ? -18.840 66.630 51.720  1.00 68.06  ? 189 LEU A CB    1 
ATOM   1730 C CG    . LEU C 3 189 ? -18.789 65.428 50.792  1.00 71.42  ? 189 LEU A CG    1 
ATOM   1731 C CD1   . LEU C 3 189 ? -18.062 64.298 51.497  1.00 73.20  ? 189 LEU A CD1   1 
ATOM   1732 C CD2   . LEU C 3 189 ? -20.197 65.014 50.398  1.00 72.65  ? 189 LEU A CD2   1 
ATOM   1733 N N     . PHE C 3 190 ? -18.716 68.534 53.883  1.00 41.48  ? 190 PHE A N     1 
ATOM   1734 C CA    . PHE C 3 190 ? -17.992 69.394 54.799  1.00 36.56  ? 190 PHE A CA    1 
ATOM   1735 C C     . PHE C 3 190 ? -18.705 70.740 54.913  1.00 35.11  ? 190 PHE A C     1 
ATOM   1736 O O     . PHE C 3 190 ? -19.082 71.344 53.911  1.00 32.20  ? 190 PHE A O     1 
ATOM   1737 C CB    . PHE C 3 190 ? -16.553 69.568 54.286  1.00 25.91  ? 190 PHE A CB    1 
ATOM   1738 C CG    . PHE C 3 190 ? -15.646 70.275 55.244  1.00 23.51  ? 190 PHE A CG    1 
ATOM   1739 C CD1   . PHE C 3 190 ? -15.296 71.606 55.039  1.00 22.69  ? 190 PHE A CD1   1 
ATOM   1740 C CD2   . PHE C 3 190 ? -15.175 69.625 56.378  1.00 21.49  ? 190 PHE A CD2   1 
ATOM   1741 C CE1   . PHE C 3 190 ? -14.492 72.282 55.958  1.00 21.63  ? 190 PHE A CE1   1 
ATOM   1742 C CE2   . PHE C 3 190 ? -14.372 70.292 57.297  1.00 20.37  ? 190 PHE A CE2   1 
ATOM   1743 C CZ    . PHE C 3 190 ? -14.031 71.624 57.088  1.00 21.21  ? 190 PHE A CZ    1 
ATOM   1744 N N     . PRO C 3 191 ? -18.907 71.219 56.146  1.00 39.06  ? 191 PRO A N     1 
ATOM   1745 C CA    . PRO C 3 191 ? -19.576 72.491 56.435  1.00 37.12  ? 191 PRO A CA    1 
ATOM   1746 C C     . PRO C 3 191 ? -18.966 73.749 55.813  1.00 37.34  ? 191 PRO A C     1 
ATOM   1747 O O     . PRO C 3 191 ? -19.678 74.719 55.561  1.00 38.93  ? 191 PRO A O     1 
ATOM   1748 C CB    . PRO C 3 191 ? -19.571 72.544 57.965  1.00 18.73  ? 191 PRO A CB    1 
ATOM   1749 C CG    . PRO C 3 191 ? -18.367 71.743 58.329  1.00 18.44  ? 191 PRO A CG    1 
ATOM   1750 C CD    . PRO C 3 191 ? -18.483 70.565 57.394  1.00 19.25  ? 191 PRO A CD    1 
ATOM   1751 N N     . GLY C 3 192 ? -17.659 73.740 55.567  1.00 33.21  ? 192 GLY A N     1 
ATOM   1752 C CA    . GLY C 3 192 ? -17.019 74.912 54.993  1.00 29.63  ? 192 GLY A CA    1 
ATOM   1753 C C     . GLY C 3 192 ? -16.945 74.907 53.478  1.00 27.74  ? 192 GLY A C     1 
ATOM   1754 O O     . GLY C 3 192 ? -17.024 73.855 52.847  1.00 29.22  ? 192 GLY A O     1 
ATOM   1755 N N     . LEU C 3 193 ? -16.801 76.086 52.887  1.00 19.32  ? 193 LEU A N     1 
ATOM   1756 C CA    . LEU C 3 193 ? -16.708 76.199 51.442  1.00 19.53  ? 193 LEU A CA    1 
ATOM   1757 C C     . LEU C 3 193 ? -15.231 76.186 51.048  1.00 19.84  ? 193 LEU A C     1 
ATOM   1758 O O     . LEU C 3 193 ? -14.416 76.877 51.656  1.00 18.59  ? 193 LEU A O     1 
ATOM   1759 C CB    . LEU C 3 193 ? -17.397 77.487 50.972  1.00 17.16  ? 193 LEU A CB    1 
ATOM   1760 C CG    . LEU C 3 193 ? -17.372 77.827 49.477  1.00 17.79  ? 193 LEU A CG    1 
ATOM   1761 C CD1   . LEU C 3 193 ? -18.562 78.699 49.141  1.00 18.42  ? 193 LEU A CD1   1 
ATOM   1762 C CD2   . LEU C 3 193 ? -16.068 78.540 49.111  1.00 17.76  ? 193 LEU A CD2   1 
ATOM   1763 N N     . ILE C 3 194 ? -14.891 75.386 50.040  1.00 28.42  ? 194 ILE A N     1 
ATOM   1764 C CA    . ILE C 3 194 ? -13.510 75.268 49.582  1.00 28.47  ? 194 ILE A CA    1 
ATOM   1765 C C     . ILE C 3 194 ? -13.254 76.159 48.385  1.00 28.44  ? 194 ILE A C     1 
ATOM   1766 O O     . ILE C 3 194 ? -13.724 75.890 47.289  1.00 29.42  ? 194 ILE A O     1 
ATOM   1767 C CB    . ILE C 3 194 ? -13.176 73.807 49.194  1.00 18.90  ? 194 ILE A CB    1 
ATOM   1768 C CG1   . ILE C 3 194 ? -13.446 72.897 50.392  1.00 20.38  ? 194 ILE A CG1   1 
ATOM   1769 C CG2   . ILE C 3 194 ? -11.727 73.695 48.736  1.00 15.09  ? 194 ILE A CG2   1 
ATOM   1770 C CD1   . ILE C 3 194 ? -13.585 71.457 50.026  1.00 24.94  ? 194 ILE A CD1   1 
ATOM   1771 N N     . TYR C 3 195 ? -12.497 77.220 48.600  1.00 26.49  ? 195 TYR A N     1 
ATOM   1772 C CA    . TYR C 3 195 ? -12.195 78.139 47.525  1.00 26.40  ? 195 TYR A CA    1 
ATOM   1773 C C     . TYR C 3 195 ? -10.764 77.928 47.048  1.00 26.20  ? 195 TYR A C     1 
ATOM   1774 O O     . TYR C 3 195 ? -9.813  78.120 47.810  1.00 26.82  ? 195 TYR A O     1 
ATOM   1775 C CB    . TYR C 3 195 ? -12.372 79.576 48.003  1.00 19.31  ? 195 TYR A CB    1 
ATOM   1776 C CG    . TYR C 3 195 ? -12.328 80.575 46.887  1.00 19.50  ? 195 TYR A CG    1 
ATOM   1777 C CD1   . TYR C 3 195 ? -13.502 81.039 46.296  1.00 21.75  ? 195 TYR A CD1   1 
ATOM   1778 C CD2   . TYR C 3 195 ? -11.111 81.053 46.408  1.00 20.89  ? 195 TYR A CD2   1 
ATOM   1779 C CE1   . TYR C 3 195 ? -13.468 81.966 45.253  1.00 23.94  ? 195 TYR A CE1   1 
ATOM   1780 C CE2   . TYR C 3 195 ? -11.054 81.973 45.363  1.00 24.40  ? 195 TYR A CE2   1 
ATOM   1781 C CZ    . TYR C 3 195 ? -12.236 82.434 44.789  1.00 26.05  ? 195 TYR A CZ    1 
ATOM   1782 O OH    . TYR C 3 195 ? -12.181 83.382 43.783  1.00 26.73  ? 195 TYR A OH    1 
ATOM   1783 N N     . ARG C 3 196 ? -10.615 77.524 45.790  1.00 25.55  ? 196 ARG A N     1 
ATOM   1784 C CA    . ARG C 3 196 ? -9.294  77.308 45.212  1.00 28.06  ? 196 ARG A CA    1 
ATOM   1785 C C     . ARG C 3 196 ? -8.836  78.512 44.401  1.00 28.85  ? 196 ARG A C     1 
ATOM   1786 O O     . ARG C 3 196 ? -9.109  78.611 43.204  1.00 27.84  ? 196 ARG A O     1 
ATOM   1787 C CB    . ARG C 3 196 ? -9.300  76.057 44.345  1.00 28.43  ? 196 ARG A CB    1 
ATOM   1788 C CG    . ARG C 3 196 ? -9.357  74.812 45.173  1.00 30.77  ? 196 ARG A CG    1 
ATOM   1789 C CD    . ARG C 3 196 ? -9.724  73.605 44.359  1.00 33.70  ? 196 ARG A CD    1 
ATOM   1790 N NE    . ARG C 3 196 ? -9.928  72.461 45.239  1.00 36.04  ? 196 ARG A NE    1 
ATOM   1791 C CZ    . ARG C 3 196 ? -8.959  71.886 45.943  1.00 37.78  ? 196 ARG A CZ    1 
ATOM   1792 N NH1   . ARG C 3 196 ? -7.708  72.342 45.865  1.00 37.82  ? 196 ARG A NH1   1 
ATOM   1793 N NH2   . ARG C 3 196 ? -9.247  70.869 46.744  1.00 37.50  ? 196 ARG A NH2   1 
ATOM   1794 N N     . MET C 3 197 ? -8.131  79.419 45.072  1.00 30.89  ? 197 MET A N     1 
ATOM   1795 C CA    . MET C 3 197 ? -7.634  80.642 44.456  1.00 33.25  ? 197 MET A CA    1 
ATOM   1796 C C     . MET C 3 197 ? -6.502  80.369 43.482  1.00 36.02  ? 197 MET A C     1 
ATOM   1797 O O     . MET C 3 197 ? -5.641  79.526 43.726  1.00 37.30  ? 197 MET A O     1 
ATOM   1798 C CB    . MET C 3 197 ? -7.164  81.614 45.538  1.00 31.50  ? 197 MET A CB    1 
ATOM   1799 C CG    . MET C 3 197 ? -6.867  83.018 45.041  1.00 29.95  ? 197 MET A CG    1 
ATOM   1800 S SD    . MET C 3 197 ? -6.628  84.159 46.412  1.00 27.61  ? 197 MET A SD    1 
ATOM   1801 C CE    . MET C 3 197 ? -8.206  84.030 47.207  1.00 24.71  ? 197 MET A CE    1 
ATOM   1802 N N     . VAL C 3 198 ? -6.516  81.105 42.379  1.00 37.51  ? 198 VAL A N     1 
ATOM   1803 C CA    . VAL C 3 198 ? -5.521  80.963 41.333  1.00 37.22  ? 198 VAL A CA    1 
ATOM   1804 C C     . VAL C 3 198 ? -4.247  81.761 41.581  1.00 38.35  ? 198 VAL A C     1 
ATOM   1805 O O     . VAL C 3 198 ? -3.139  81.235 41.458  1.00 36.65  ? 198 VAL A O     1 
ATOM   1806 C CB    . VAL C 3 198 ? -6.111  81.393 40.000  1.00 32.43  ? 198 VAL A CB    1 
ATOM   1807 C CG1   . VAL C 3 198 ? -5.084  81.221 38.898  1.00 32.71  ? 198 VAL A CG1   1 
ATOM   1808 C CG2   . VAL C 3 198 ? -7.367  80.583 39.724  1.00 32.60  ? 198 VAL A CG2   1 
ATOM   1809 N N     . LYS C 3 199 ? -4.398  83.034 41.920  1.00 36.21  ? 199 LYS A N     1 
ATOM   1810 C CA    . LYS C 3 199 ? -3.233  83.863 42.166  1.00 39.01  ? 199 LYS A CA    1 
ATOM   1811 C C     . LYS C 3 199 ? -3.427  84.718 43.412  1.00 37.74  ? 199 LYS A C     1 
ATOM   1812 O O     . LYS C 3 199 ? -4.216  85.671 43.407  1.00 37.81  ? 199 LYS A O     1 
ATOM   1813 C CB    . LYS C 3 199 ? -2.959  84.763 40.956  1.00 72.49  ? 199 LYS A CB    1 
ATOM   1814 C CG    . LYS C 3 199 ? -1.532  85.297 40.893  1.00 79.13  ? 199 LYS A CG    1 
ATOM   1815 C CD    . LYS C 3 199 ? -1.331  86.224 39.704  1.00 83.41  ? 199 LYS A CD    1 
ATOM   1816 C CE    . LYS C 3 199 ? 0.141   86.534 39.486  1.00 85.19  ? 199 LYS A CE    1 
ATOM   1817 N NZ    . LYS C 3 199 ? 0.912   85.312 39.113  1.00 86.94  ? 199 LYS A NZ    1 
ATOM   1818 N N     . PRO C 3 200 ? -2.707  84.387 44.503  1.00 34.24  ? 200 PRO A N     1 
ATOM   1819 C CA    . PRO C 3 200 ? -1.759  83.268 44.573  1.00 32.42  ? 200 PRO A CA    1 
ATOM   1820 C C     . PRO C 3 200 ? -2.493  81.943 44.622  1.00 31.45  ? 200 PRO A C     1 
ATOM   1821 O O     . PRO C 3 200 ? -3.715  81.919 44.759  1.00 32.09  ? 200 PRO A O     1 
ATOM   1822 C CB    . PRO C 3 200 ? -0.989  83.552 45.856  1.00 22.05  ? 200 PRO A CB    1 
ATOM   1823 C CG    . PRO C 3 200 ? -2.031  84.186 46.723  1.00 22.41  ? 200 PRO A CG    1 
ATOM   1824 C CD    . PRO C 3 200 ? -2.713  85.143 45.770  1.00 22.61  ? 200 PRO A CD    1 
ATOM   1825 N N     . LYS C 3 201 ? -1.752  80.845 44.501  1.00 30.58  ? 201 LYS A N     1 
ATOM   1826 C CA    . LYS C 3 201 ? -2.365  79.523 44.540  1.00 29.77  ? 201 LYS A CA    1 
ATOM   1827 C C     . LYS C 3 201 ? -2.490  79.120 45.998  1.00 28.06  ? 201 LYS A C     1 
ATOM   1828 O O     . LYS C 3 201 ? -1.584  78.529 46.586  1.00 27.82  ? 201 LYS A O     1 
ATOM   1829 C CB    . LYS C 3 201 ? -1.517  78.506 43.775  1.00 44.04  ? 201 LYS A CB    1 
ATOM   1830 C CG    . LYS C 3 201 ? -2.233  77.188 43.523  1.00 45.71  ? 201 LYS A CG    1 
ATOM   1831 C CD    . LYS C 3 201 ? -1.358  76.200 42.777  1.00 47.47  ? 201 LYS A CD    1 
ATOM   1832 C CE    . LYS C 3 201 ? -2.111  74.909 42.497  1.00 48.58  ? 201 LYS A CE    1 
ATOM   1833 N NZ    . LYS C 3 201 ? -3.339  75.148 41.672  1.00 50.70  ? 201 LYS A NZ    1 
ATOM   1834 N N     . ILE C 3 202 ? -3.633  79.463 46.573  1.00 28.09  ? 202 ILE A N     1 
ATOM   1835 C CA    . ILE C 3 202 ? -3.913  79.197 47.967  1.00 27.08  ? 202 ILE A CA    1 
ATOM   1836 C C     . ILE C 3 202 ? -5.312  78.636 48.084  1.00 26.43  ? 202 ILE A C     1 
ATOM   1837 O O     . ILE C 3 202 ? -6.232  79.100 47.410  1.00 26.51  ? 202 ILE A O     1 
ATOM   1838 C CB    . ILE C 3 202 ? -3.836  80.506 48.784  1.00 31.19  ? 202 ILE A CB    1 
ATOM   1839 C CG1   . ILE C 3 202 ? -2.399  81.014 48.800  1.00 30.75  ? 202 ILE A CG1   1 
ATOM   1840 C CG2   . ILE C 3 202 ? -4.339  80.289 50.201  1.00 30.58  ? 202 ILE A CG2   1 
ATOM   1841 C CD1   . ILE C 3 202 ? -1.426  80.068 49.460  1.00 31.74  ? 202 ILE A CD1   1 
ATOM   1842 N N     . VAL C 3 203 ? -5.477  77.632 48.933  1.00 26.64  ? 203 VAL A N     1 
ATOM   1843 C CA    . VAL C 3 203 ? -6.793  77.067 49.124  1.00 26.01  ? 203 VAL A CA    1 
ATOM   1844 C C     . VAL C 3 203 ? -7.360  77.666 50.398  1.00 25.99  ? 203 VAL A C     1 
ATOM   1845 O O     . VAL C 3 203 ? -6.675  77.742 51.420  1.00 27.96  ? 203 VAL A O     1 
ATOM   1846 C CB    . VAL C 3 203 ? -6.740  75.539 49.246  1.00 20.22  ? 203 VAL A CB    1 
ATOM   1847 C CG1   . VAL C 3 203 ? -8.109  74.999 49.658  1.00 20.12  ? 203 VAL A CG1   1 
ATOM   1848 C CG2   . VAL C 3 203 ? -6.316  74.942 47.922  1.00 18.59  ? 203 VAL A CG2   1 
ATOM   1849 N N     . LEU C 3 204 ? -8.604  78.123 50.326  1.00 28.98  ? 204 LEU A N     1 
ATOM   1850 C CA    . LEU C 3 204 ? -9.258  78.711 51.486  1.00 27.22  ? 204 LEU A CA    1 
ATOM   1851 C C     . LEU C 3 204 ? -10.439 77.856 51.898  1.00 27.11  ? 204 LEU A C     1 
ATOM   1852 O O     . LEU C 3 204 ? -11.068 77.202 51.071  1.00 28.83  ? 204 LEU A O     1 
ATOM   1853 C CB    . LEU C 3 204 ? -9.760  80.131 51.183  1.00 19.32  ? 204 LEU A CB    1 
ATOM   1854 C CG    . LEU C 3 204 ? -8.743  81.254 50.949  1.00 18.74  ? 204 LEU A CG    1 
ATOM   1855 C CD1   . LEU C 3 204 ? -8.218  81.206 49.543  1.00 15.56  ? 204 LEU A CD1   1 
ATOM   1856 C CD2   . LEU C 3 204 ? -9.417  82.577 51.183  1.00 18.00  ? 204 LEU A CD2   1 
ATOM   1857 N N     . LEU C 3 205 ? -10.719 77.846 53.192  1.00 20.65  ? 205 LEU A N     1 
ATOM   1858 C CA    . LEU C 3 205 ? -11.849 77.111 53.729  1.00 19.34  ? 205 LEU A CA    1 
ATOM   1859 C C     . LEU C 3 205 ? -12.659 78.222 54.373  1.00 19.71  ? 205 LEU A C     1 
ATOM   1860 O O     . LEU C 3 205 ? -12.255 78.762 55.391  1.00 18.98  ? 205 LEU A O     1 
ATOM   1861 C CB    . LEU C 3 205 ? -11.394 76.100 54.782  1.00 19.55  ? 205 LEU A CB    1 
ATOM   1862 C CG    . LEU C 3 205 ? -10.395 75.015 54.358  1.00 18.74  ? 205 LEU A CG    1 
ATOM   1863 C CD1   . LEU C 3 205 ? -9.967  74.220 55.574  1.00 17.51  ? 205 LEU A CD1   1 
ATOM   1864 C CD2   . LEU C 3 205 ? -11.026 74.102 53.327  1.00 18.35  ? 205 LEU A CD2   1 
ATOM   1865 N N     . ILE C 3 206 ? -13.781 78.578 53.752  1.00 25.19  ? 206 ILE A N     1 
ATOM   1866 C CA    . ILE C 3 206 ? -14.645 79.647 54.239  1.00 25.79  ? 206 ILE A CA    1 
ATOM   1867 C C     . ILE C 3 206 ? -15.849 79.090 54.989  1.00 27.16  ? 206 ILE A C     1 
ATOM   1868 O O     . ILE C 3 206 ? -16.580 78.250 54.472  1.00 27.22  ? 206 ILE A O     1 
ATOM   1869 C CB    . ILE C 3 206 ? -15.117 80.521 53.061  1.00 17.27  ? 206 ILE A CB    1 
ATOM   1870 C CG1   . ILE C 3 206 ? -13.899 81.163 52.381  1.00 15.62  ? 206 ILE A CG1   1 
ATOM   1871 C CG2   . ILE C 3 206 ? -16.073 81.575 53.549  1.00 18.95  ? 206 ILE A CG2   1 
ATOM   1872 C CD1   . ILE C 3 206 ? -14.055 81.387 50.888  1.00 11.30  ? 206 ILE A CD1   1 
ATOM   1873 N N     . PHE C 3 207 ? -16.051 79.572 56.210  1.00 28.03  ? 207 PHE A N     1 
ATOM   1874 C CA    . PHE C 3 207 ? -17.144 79.108 57.050  1.00 29.52  ? 207 PHE A CA    1 
ATOM   1875 C C     . PHE C 3 207 ? -18.205 80.160 57.284  1.00 31.66  ? 207 PHE A C     1 
ATOM   1876 O O     . PHE C 3 207 ? -17.955 81.359 57.156  1.00 33.30  ? 207 PHE A O     1 
ATOM   1877 C CB    . PHE C 3 207 ? -16.579 78.625 58.380  1.00 24.35  ? 207 PHE A CB    1 
ATOM   1878 C CG    . PHE C 3 207 ? -15.597 77.504 58.230  1.00 24.49  ? 207 PHE A CG    1 
ATOM   1879 C CD1   . PHE C 3 207 ? -16.023 76.185 58.238  1.00 24.18  ? 207 PHE A CD1   1 
ATOM   1880 C CD2   . PHE C 3 207 ? -14.248 77.772 58.005  1.00 24.82  ? 207 PHE A CD2   1 
ATOM   1881 C CE1   . PHE C 3 207 ? -15.113 75.148 58.018  1.00 25.09  ? 207 PHE A CE1   1 
ATOM   1882 C CE2   . PHE C 3 207 ? -13.331 76.744 57.784  1.00 22.22  ? 207 PHE A CE2   1 
ATOM   1883 C CZ    . PHE C 3 207 ? -13.760 75.436 57.790  1.00 23.96  ? 207 PHE A CZ    1 
ATOM   1884 N N     . VAL C 3 208 ? -19.398 79.698 57.635  1.00 28.72  ? 208 VAL A N     1 
ATOM   1885 C CA    . VAL C 3 208 ? -20.526 80.587 57.875  1.00 29.01  ? 208 VAL A CA    1 
ATOM   1886 C C     . VAL C 3 208 ? -20.230 81.605 58.973  1.00 27.96  ? 208 VAL A C     1 
ATOM   1887 O O     . VAL C 3 208 ? -20.741 82.722 58.964  1.00 27.84  ? 208 VAL A O     1 
ATOM   1888 C CB    . VAL C 3 208 ? -21.777 79.774 58.260  1.00 34.29  ? 208 VAL A CB    1 
ATOM   1889 C CG1   . VAL C 3 208 ? -22.956 80.692 58.473  1.00 37.37  ? 208 VAL A CG1   1 
ATOM   1890 C CG2   . VAL C 3 208 ? -22.094 78.778 57.168  1.00 35.84  ? 208 VAL A CG2   1 
ATOM   1891 N N     . SER C 3 209 ? -19.380 81.211 59.907  1.00 26.89  ? 209 SER A N     1 
ATOM   1892 C CA    . SER C 3 209 ? -19.022 82.050 61.032  1.00 25.64  ? 209 SER A CA    1 
ATOM   1893 C C     . SER C 3 209 ? -18.138 83.255 60.711  1.00 27.10  ? 209 SER A C     1 
ATOM   1894 O O     . SER C 3 209 ? -18.052 84.197 61.502  1.00 28.51  ? 209 SER A O     1 
ATOM   1895 C CB    . SER C 3 209 ? -18.328 81.183 62.063  1.00 23.41  ? 209 SER A CB    1 
ATOM   1896 O OG    . SER C 3 209 ? -17.284 80.458 61.440  1.00 21.20  ? 209 SER A OG    1 
ATOM   1897 N N     . GLY C 3 210 ? -17.478 83.233 59.561  1.00 28.76  ? 210 GLY A N     1 
ATOM   1898 C CA    . GLY C 3 210 ? -16.597 84.335 59.223  1.00 28.33  ? 210 GLY A CA    1 
ATOM   1899 C C     . GLY C 3 210 ? -15.163 83.886 59.426  1.00 28.83  ? 210 GLY A C     1 
ATOM   1900 O O     . GLY C 3 210 ? -14.212 84.616 59.140  1.00 29.46  ? 210 GLY A O     1 
ATOM   1901 N N     . LYS C 3 211 ? -15.014 82.666 59.933  1.00 26.74  ? 211 LYS A N     1 
ATOM   1902 C CA    . LYS C 3 211 ? -13.706 82.075 60.166  1.00 25.65  ? 211 LYS A CA    1 
ATOM   1903 C C     . LYS C 3 211 ? -13.114 81.668 58.822  1.00 25.85  ? 211 LYS A C     1 
ATOM   1904 O O     . LYS C 3 211 ? -13.796 81.057 57.997  1.00 26.21  ? 211 LYS A O     1 
ATOM   1905 C CB    . LYS C 3 211 ? -13.851 80.848 61.057  1.00 32.52  ? 211 LYS A CB    1 
ATOM   1906 C CG    . LYS C 3 211 ? -13.279 81.019 62.438  1.00 34.46  ? 211 LYS A CG    1 
ATOM   1907 C CD    . LYS C 3 211 ? -13.812 82.252 63.114  1.00 36.37  ? 211 LYS A CD    1 
ATOM   1908 C CE    . LYS C 3 211 ? -13.480 82.222 64.581  1.00 37.18  ? 211 LYS A CE    1 
ATOM   1909 N NZ    . LYS C 3 211 ? -14.107 81.028 65.199  1.00 40.43  ? 211 LYS A NZ    1 
ATOM   1910 N N     . ILE C 3 212 ? -11.845 81.995 58.610  1.00 28.21  ? 212 ILE A N     1 
ATOM   1911 C CA    . ILE C 3 212 ? -11.188 81.677 57.352  1.00 26.86  ? 212 ILE A CA    1 
ATOM   1912 C C     . ILE C 3 212 ? -9.899  80.879 57.532  1.00 26.44  ? 212 ILE A C     1 
ATOM   1913 O O     . ILE C 3 212 ? -9.076  81.211 58.375  1.00 26.63  ? 212 ILE A O     1 
ATOM   1914 C CB    . ILE C 3 212 ? -10.838 82.971 56.577  1.00 25.29  ? 212 ILE A CB    1 
ATOM   1915 C CG1   . ILE C 3 212 ? -12.088 83.842 56.406  1.00 24.17  ? 212 ILE A CG1   1 
ATOM   1916 C CG2   . ILE C 3 212 ? -10.255 82.623 55.219  1.00 23.29  ? 212 ILE A CG2   1 
ATOM   1917 C CD1   . ILE C 3 212 ? -13.184 83.204 55.566  1.00 24.59  ? 212 ILE A CD1   1 
ATOM   1918 N N     . VAL C 3 213 ? -9.734  79.822 56.740  1.00 24.06  ? 213 VAL A N     1 
ATOM   1919 C CA    . VAL C 3 213 ? -8.521  79.009 56.773  1.00 23.49  ? 213 VAL A CA    1 
ATOM   1920 C C     . VAL C 3 213 ? -7.837  79.151 55.425  1.00 23.62  ? 213 VAL A C     1 
ATOM   1921 O O     . VAL C 3 213 ? -8.464  78.995 54.382  1.00 23.17  ? 213 VAL A O     1 
ATOM   1922 C CB    . VAL C 3 213 ? -8.826  77.520 57.022  1.00 19.87  ? 213 VAL A CB    1 
ATOM   1923 C CG1   . VAL C 3 213 ? -7.602  76.680 56.758  1.00 17.37  ? 213 VAL A CG1   1 
ATOM   1924 C CG2   . VAL C 3 213 ? -9.280  77.330 58.457  1.00 22.13  ? 213 VAL A CG2   1 
ATOM   1925 N N     . LEU C 3 214 ? -6.551  79.469 55.449  1.00 23.74  ? 214 LEU A N     1 
ATOM   1926 C CA    . LEU C 3 214 ? -5.788  79.633 54.220  1.00 24.16  ? 214 LEU A CA    1 
ATOM   1927 C C     . LEU C 3 214 ? -4.589  78.692 54.267  1.00 24.03  ? 214 LEU A C     1 
ATOM   1928 O O     . LEU C 3 214 ? -3.831  78.692 55.231  1.00 23.46  ? 214 LEU A O     1 
ATOM   1929 C CB    . LEU C 3 214 ? -5.324  81.091 54.083  1.00 26.98  ? 214 LEU A CB    1 
ATOM   1930 C CG    . LEU C 3 214 ? -6.407  82.167 54.268  1.00 26.94  ? 214 LEU A CG    1 
ATOM   1931 C CD1   . LEU C 3 214 ? -6.400  82.671 55.701  1.00 24.11  ? 214 LEU A CD1   1 
ATOM   1932 C CD2   . LEU C 3 214 ? -6.155  83.325 53.321  1.00 25.85  ? 214 LEU A CD2   1 
ATOM   1933 N N     . THR C 3 215 ? -4.420  77.882 53.232  1.00 20.68  ? 215 THR A N     1 
ATOM   1934 C CA    . THR C 3 215 ? -3.308  76.942 53.199  1.00 21.20  ? 215 THR A CA    1 
ATOM   1935 C C     . THR C 3 215 ? -2.758  76.734 51.785  1.00 21.55  ? 215 THR A C     1 
ATOM   1936 O O     . THR C 3 215 ? -3.387  77.123 50.793  1.00 21.25  ? 215 THR A O     1 
ATOM   1937 C CB    . THR C 3 215 ? -3.743  75.570 53.786  1.00 30.44  ? 215 THR A CB    1 
ATOM   1938 O OG1   . THR C 3 215 ? -2.604  74.713 53.901  1.00 31.62  ? 215 THR A OG1   1 
ATOM   1939 C CG2   . THR C 3 215 ? -4.779  74.898 52.894  1.00 28.82  ? 215 THR A CG2   1 
ATOM   1940 N N     . GLY C 3 216 ? -1.580  76.125 51.702  1.00 24.46  ? 216 GLY A N     1 
ATOM   1941 C CA    . GLY C 3 216 ? -0.966  75.860 50.416  1.00 25.19  ? 216 GLY A CA    1 
ATOM   1942 C C     . GLY C 3 216 ? 0.144   76.829 50.069  1.00 25.88  ? 216 GLY A C     1 
ATOM   1943 O O     . GLY C 3 216 ? 0.761   76.726 49.002  1.00 26.83  ? 216 GLY A O     1 
ATOM   1944 N N     . ALA C 3 217 ? 0.410   77.759 50.981  1.00 25.26  ? 217 ALA A N     1 
ATOM   1945 C CA    . ALA C 3 217 ? 1.431   78.779 50.779  1.00 26.93  ? 217 ALA A CA    1 
ATOM   1946 C C     . ALA C 3 217 ? 2.827   78.308 51.139  1.00 28.28  ? 217 ALA A C     1 
ATOM   1947 O O     . ALA C 3 217 ? 2.994   77.476 52.025  1.00 29.39  ? 217 ALA A O     1 
ATOM   1948 C CB    . ALA C 3 217 ? 1.087   80.024 51.598  1.00 16.06  ? 217 ALA A CB    1 
ATOM   1949 N N     . LYS C 3 218 ? 3.827   78.859 50.455  1.00 35.90  ? 218 LYS A N     1 
ATOM   1950 C CA    . LYS C 3 218 ? 5.221   78.513 50.710  1.00 36.95  ? 218 LYS A CA    1 
ATOM   1951 C C     . LYS C 3 218 ? 5.919   79.719 51.314  1.00 37.91  ? 218 LYS A C     1 
ATOM   1952 O O     . LYS C 3 218 ? 6.989   79.588 51.909  1.00 38.82  ? 218 LYS A O     1 
ATOM   1953 C CB    . LYS C 3 218 ? 5.933   78.134 49.421  1.00 34.45  ? 218 LYS A CB    1 
ATOM   1954 C CG    . LYS C 3 218 ? 6.585   76.770 49.443  1.00 36.12  ? 218 LYS A CG    1 
ATOM   1955 C CD    . LYS C 3 218 ? 5.637   75.701 48.929  1.00 36.98  ? 218 LYS A CD    1 
ATOM   1956 C CE    . LYS C 3 218 ? 6.396   74.447 48.523  1.00 35.27  ? 218 LYS A CE    1 
ATOM   1957 N NZ    . LYS C 3 218 ? 5.482   73.395 48.004  1.00 33.87  ? 218 LYS A NZ    1 
ATOM   1958 N N     . GLN C 3 219 ? 5.311   80.890 51.125  1.00 28.21  ? 219 GLN A N     1 
ATOM   1959 C CA    . GLN C 3 219 ? 5.812   82.164 51.654  1.00 29.14  ? 219 GLN A CA    1 
ATOM   1960 C C     . GLN C 3 219 ? 4.645   82.697 52.477  1.00 29.10  ? 219 GLN A C     1 
ATOM   1961 O O     . GLN C 3 219 ? 3.498   82.559 52.057  1.00 29.33  ? 219 GLN A O     1 
ATOM   1962 C CB    . GLN C 3 219 ? 6.119   83.142 50.517  1.00 51.03  ? 219 GLN A CB    1 
ATOM   1963 C CG    . GLN C 3 219 ? 6.994   82.570 49.405  1.00 56.23  ? 219 GLN A CG    1 
ATOM   1964 C CD    . GLN C 3 219 ? 8.446   82.356 49.823  1.00 58.92  ? 219 GLN A CD    1 
ATOM   1965 O OE1   . GLN C 3 219 ? 9.145   81.503 49.268  1.00 60.33  ? 219 GLN A OE1   1 
ATOM   1966 N NE2   . GLN C 3 219 ? 8.908   83.140 50.792  1.00 59.88  ? 219 GLN A NE2   1 
ATOM   1967 N N     . ARG C 3 220 ? 4.906   83.285 53.643  1.00 32.63  ? 220 ARG A N     1 
ATOM   1968 C CA    . ARG C 3 220 ? 3.806   83.793 54.457  1.00 31.86  ? 220 ARG A CA    1 
ATOM   1969 C C     . ARG C 3 220 ? 3.080   84.915 53.737  1.00 32.60  ? 220 ARG A C     1 
ATOM   1970 O O     . ARG C 3 220 ? 1.929   85.223 54.044  1.00 31.39  ? 220 ARG A O     1 
ATOM   1971 C CB    . ARG C 3 220 ? 4.296   84.294 55.816  1.00 35.72  ? 220 ARG A CB    1 
ATOM   1972 C CG    . ARG C 3 220 ? 5.214   85.482 55.759  1.00 36.64  ? 220 ARG A CG    1 
ATOM   1973 C CD    . ARG C 3 220 ? 4.825   86.530 56.782  1.00 38.03  ? 220 ARG A CD    1 
ATOM   1974 N NE    . ARG C 3 220 ? 4.654   86.003 58.140  1.00 41.12  ? 220 ARG A NE    1 
ATOM   1975 C CZ    . ARG C 3 220 ? 5.644   85.609 58.941  1.00 42.89  ? 220 ARG A CZ    1 
ATOM   1976 N NH1   . ARG C 3 220 ? 6.905   85.674 58.528  1.00 44.19  ? 220 ARG A NH1   1 
ATOM   1977 N NH2   . ARG C 3 220 ? 5.374   85.154 60.162  1.00 42.39  ? 220 ARG A NH2   1 
ATOM   1978 N N     . GLU C 3 221 ? 3.749   85.517 52.762  1.00 36.93  ? 221 GLU A N     1 
ATOM   1979 C CA    . GLU C 3 221 ? 3.144   86.606 52.010  1.00 39.19  ? 221 GLU A CA    1 
ATOM   1980 C C     . GLU C 3 221 ? 1.933   86.154 51.192  1.00 36.70  ? 221 GLU A C     1 
ATOM   1981 O O     . GLU C 3 221 ? 0.979   86.909 51.017  1.00 35.92  ? 221 GLU A O     1 
ATOM   1982 C CB    . GLU C 3 221 ? 4.176   87.257 51.088  1.00 60.21  ? 221 GLU A CB    1 
ATOM   1983 C CG    . GLU C 3 221 ? 3.674   88.544 50.448  1.00 68.34  ? 221 GLU A CG    1 
ATOM   1984 C CD    . GLU C 3 221 ? 3.326   89.623 51.473  1.00 72.08  ? 221 GLU A CD    1 
ATOM   1985 O OE1   . GLU C 3 221 ? 2.626   90.594 51.105  1.00 72.56  ? 221 GLU A OE1   1 
ATOM   1986 O OE2   . GLU C 3 221 ? 3.759   89.505 52.642  1.00 72.33  ? 221 GLU A OE2   1 
ATOM   1987 N N     . GLU C 3 222 ? 1.969   84.921 50.696  1.00 33.49  ? 222 GLU A N     1 
ATOM   1988 C CA    . GLU C 3 222 ? 0.874   84.374 49.902  1.00 31.50  ? 222 GLU A CA    1 
ATOM   1989 C C     . GLU C 3 222 ? -0.418  84.275 50.721  1.00 30.39  ? 222 GLU A C     1 
ATOM   1990 O O     . GLU C 3 222 ? -1.509  84.479 50.186  1.00 29.53  ? 222 GLU A O     1 
ATOM   1991 C CB    . GLU C 3 222 ? 1.272   83.000 49.353  1.00 40.89  ? 222 GLU A CB    1 
ATOM   1992 C CG    . GLU C 3 222 ? 2.513   83.038 48.472  1.00 42.88  ? 222 GLU A CG    1 
ATOM   1993 C CD    . GLU C 3 222 ? 3.063   81.664 48.131  1.00 45.86  ? 222 GLU A CD    1 
ATOM   1994 O OE1   . GLU C 3 222 ? 4.059   81.596 47.381  1.00 48.59  ? 222 GLU A OE1   1 
ATOM   1995 O OE2   . GLU C 3 222 ? 2.515   80.650 48.608  1.00 47.42  ? 222 GLU A OE2   1 
ATOM   1996 N N     . ILE C 3 223 ? -0.297  83.968 52.015  1.00 39.31  ? 223 ILE A N     1 
ATOM   1997 C CA    . ILE C 3 223 ? -1.467  83.865 52.894  1.00 37.85  ? 223 ILE A CA    1 
ATOM   1998 C C     . ILE C 3 223 ? -2.094  85.249 52.965  1.00 38.29  ? 223 ILE A C     1 
ATOM   1999 O O     . ILE C 3 223 ? -3.304  85.410 52.826  1.00 40.66  ? 223 ILE A O     1 
ATOM   2000 C CB    . ILE C 3 223 ? -1.082  83.427 54.345  1.00 19.52  ? 223 ILE A CB    1 
ATOM   2001 C CG1   . ILE C 3 223 ? -0.425  82.041 54.338  1.00 15.77  ? 223 ILE A CG1   1 
ATOM   2002 C CG2   . ILE C 3 223 ? -2.326  83.427 55.235  1.00 18.67  ? 223 ILE A CG2   1 
ATOM   2003 C CD1   . ILE C 3 223 ? -1.321  80.912 53.884  1.00 10.00  ? 223 ILE A CD1   1 
ATOM   2004 N N     . TYR C 3 224 ? -1.240  86.245 53.176  1.00 31.28  ? 224 TYR A N     1 
ATOM   2005 C CA    . TYR C 3 224 ? -1.656  87.638 53.271  1.00 30.82  ? 224 TYR A CA    1 
ATOM   2006 C C     . TYR C 3 224 ? -2.315  88.114 51.972  1.00 29.62  ? 224 TYR A C     1 
ATOM   2007 O O     . TYR C 3 224 ? -3.393  88.696 51.998  1.00 29.01  ? 224 TYR A O     1 
ATOM   2008 C CB    . TYR C 3 224 ? -0.439  88.511 53.623  1.00 32.83  ? 224 TYR A CB    1 
ATOM   2009 C CG    . TYR C 3 224 ? 0.190   88.187 54.971  1.00 33.33  ? 224 TYR A CG    1 
ATOM   2010 C CD1   . TYR C 3 224 ? 1.501   88.560 55.261  1.00 34.61  ? 224 TYR A CD1   1 
ATOM   2011 C CD2   . TYR C 3 224 ? -0.528  87.512 55.956  1.00 34.94  ? 224 TYR A CD2   1 
ATOM   2012 C CE1   . TYR C 3 224 ? 2.086   88.266 56.507  1.00 35.24  ? 224 TYR A CE1   1 
ATOM   2013 C CE2   . TYR C 3 224 ? 0.041   87.214 57.200  1.00 35.09  ? 224 TYR A CE2   1 
ATOM   2014 C CZ    . TYR C 3 224 ? 1.348   87.594 57.472  1.00 35.83  ? 224 TYR A CZ    1 
ATOM   2015 O OH    . TYR C 3 224 ? 1.901   87.306 58.709  1.00 36.20  ? 224 TYR A OH    1 
ATOM   2016 N N     . GLN C 3 225 ? -1.680  87.852 50.838  1.00 26.21  ? 225 GLN A N     1 
ATOM   2017 C CA    . GLN C 3 225 ? -2.231  88.255 49.554  1.00 29.36  ? 225 GLN A CA    1 
ATOM   2018 C C     . GLN C 3 225 ? -3.515  87.492 49.243  1.00 29.50  ? 225 GLN A C     1 
ATOM   2019 O O     . GLN C 3 225 ? -4.424  88.026 48.596  1.00 30.02  ? 225 GLN A O     1 
ATOM   2020 C CB    . GLN C 3 225 ? -1.212  88.014 48.445  1.00 47.76  ? 225 GLN A CB    1 
ATOM   2021 C CG    . GLN C 3 225 ? 0.163   88.552 48.773  1.00 54.95  ? 225 GLN A CG    1 
ATOM   2022 C CD    . GLN C 3 225 ? 1.187   88.262 47.696  1.00 58.83  ? 225 GLN A CD    1 
ATOM   2023 O OE1   . GLN C 3 225 ? 1.235   87.161 47.141  1.00 59.46  ? 225 GLN A OE1   1 
ATOM   2024 N NE2   . GLN C 3 225 ? 2.029   89.248 47.407  1.00 60.78  ? 225 GLN A NE2   1 
ATOM   2025 N N     . ALA C 3 226 ? -3.595  86.244 49.695  1.00 32.41  ? 226 ALA A N     1 
ATOM   2026 C CA    . ALA C 3 226 ? -4.787  85.436 49.450  1.00 30.82  ? 226 ALA A CA    1 
ATOM   2027 C C     . ALA C 3 226 ? -5.956  86.025 50.231  1.00 30.29  ? 226 ALA A C     1 
ATOM   2028 O O     . ALA C 3 226 ? -7.070  86.140 49.717  1.00 28.33  ? 226 ALA A O     1 
ATOM   2029 C CB    . ALA C 3 226 ? -4.543  83.983 49.867  1.00 26.81  ? 226 ALA A CB    1 
ATOM   2030 N N     . PHE C 3 227 ? -5.697  86.415 51.472  1.00 26.39  ? 227 PHE A N     1 
ATOM   2031 C CA    . PHE C 3 227 ? -6.747  86.992 52.294  1.00 27.16  ? 227 PHE A CA    1 
ATOM   2032 C C     . PHE C 3 227 ? -7.241  88.339 51.759  1.00 27.82  ? 227 PHE A C     1 
ATOM   2033 O O     . PHE C 3 227 ? -8.438  88.618 51.766  1.00 29.27  ? 227 PHE A O     1 
ATOM   2034 C CB    . PHE C 3 227 ? -6.276  87.166 53.736  1.00 22.89  ? 227 PHE A CB    1 
ATOM   2035 C CG    . PHE C 3 227 ? -7.317  87.781 54.626  1.00 23.74  ? 227 PHE A CG    1 
ATOM   2036 C CD1   . PHE C 3 227 ? -8.501  87.107 54.898  1.00 24.15  ? 227 PHE A CD1   1 
ATOM   2037 C CD2   . PHE C 3 227 ? -7.141  89.055 55.154  1.00 23.27  ? 227 PHE A CD2   1 
ATOM   2038 C CE1   . PHE C 3 227 ? -9.497  87.695 55.684  1.00 22.91  ? 227 PHE A CE1   1 
ATOM   2039 C CE2   . PHE C 3 227 ? -8.130  89.653 55.940  1.00 21.68  ? 227 PHE A CE2   1 
ATOM   2040 C CZ    . PHE C 3 227 ? -9.306  88.972 56.203  1.00 21.92  ? 227 PHE A CZ    1 
ATOM   2041 N N     . GLU C 3 228 ? -6.325  89.180 51.301  1.00 26.29  ? 228 GLU A N     1 
ATOM   2042 C CA    . GLU C 3 228 ? -6.719  90.480 50.776  1.00 28.43  ? 228 GLU A CA    1 
ATOM   2043 C C     . GLU C 3 228 ? -7.616  90.314 49.560  1.00 25.65  ? 228 GLU A C     1 
ATOM   2044 O O     . GLU C 3 228 ? -8.607  91.028 49.414  1.00 25.31  ? 228 GLU A O     1 
ATOM   2045 C CB    . GLU C 3 228 ? -5.488  91.312 50.409  1.00 69.41  ? 228 GLU A CB    1 
ATOM   2046 C CG    . GLU C 3 228 ? -4.537  91.515 51.574  1.00 81.42  ? 228 GLU A CG    1 
ATOM   2047 C CD    . GLU C 3 228 ? -5.227  92.066 52.816  1.00 88.13  ? 228 GLU A CD    1 
ATOM   2048 O OE1   . GLU C 3 228 ? -4.646  91.959 53.921  1.00 90.00  ? 228 GLU A OE1   1 
ATOM   2049 O OE2   . GLU C 3 228 ? -6.345  92.613 52.689  1.00 90.00  ? 228 GLU A OE2   1 
ATOM   2050 N N     . ALA C 3 229 ? -7.271  89.359 48.700  1.00 29.24  ? 229 ALA A N     1 
ATOM   2051 C CA    . ALA C 3 229 ? -8.037  89.090 47.490  1.00 26.58  ? 229 ALA A CA    1 
ATOM   2052 C C     . ALA C 3 229 ? -9.453  88.605 47.782  1.00 26.55  ? 229 ALA A C     1 
ATOM   2053 O O     . ALA C 3 229 ? -10.408 89.015 47.116  1.00 26.93  ? 229 ALA A O     1 
ATOM   2054 C CB    . ALA C 3 229 ? -7.311  88.063 46.639  1.00 10.00  ? 229 ALA A CB    1 
ATOM   2055 N N     . ILE C 3 230 ? -9.591  87.750 48.790  1.00 22.51  ? 230 ILE A N     1 
ATOM   2056 C CA    . ILE C 3 230 ? -10.893 87.194 49.142  1.00 20.79  ? 230 ILE A CA    1 
ATOM   2057 C C     . ILE C 3 230 ? -11.781 88.099 50.001  1.00 22.94  ? 230 ILE A C     1 
ATOM   2058 O O     . ILE C 3 230 ? -13.000 87.937 50.019  1.00 22.33  ? 230 ILE A O     1 
ATOM   2059 C CB    . ILE C 3 230 ? -10.724 85.841 49.888  1.00 22.78  ? 230 ILE A CB    1 
ATOM   2060 C CG1   . ILE C 3 230 ? -11.934 84.934 49.633  1.00 20.57  ? 230 ILE A CG1   1 
ATOM   2061 C CG2   . ILE C 3 230 ? -10.575 86.085 51.390  1.00 21.52  ? 230 ILE A CG2   1 
ATOM   2062 C CD1   . ILE C 3 230 ? -11.993 84.350 48.236  1.00 16.32  ? 230 ILE A CD1   1 
ATOM   2063 N N     . TYR C 3 231 ? -11.188 89.048 50.714  1.00 23.06  ? 231 TYR A N     1 
ATOM   2064 C CA    . TYR C 3 231 ? -11.985 89.908 51.580  1.00 24.88  ? 231 TYR A CA    1 
ATOM   2065 C C     . TYR C 3 231 ? -13.179 90.614 50.909  1.00 25.40  ? 231 TYR A C     1 
ATOM   2066 O O     . TYR C 3 231 ? -14.272 90.678 51.476  1.00 25.71  ? 231 TYR A O     1 
ATOM   2067 C CB    . TYR C 3 231 ? -11.101 90.945 52.269  1.00 31.57  ? 231 TYR A CB    1 
ATOM   2068 C CG    . TYR C 3 231 ? -11.825 91.612 53.405  1.00 33.11  ? 231 TYR A CG    1 
ATOM   2069 C CD1   . TYR C 3 231 ? -12.066 90.929 54.595  1.00 34.67  ? 231 TYR A CD1   1 
ATOM   2070 C CD2   . TYR C 3 231 ? -12.356 92.888 53.260  1.00 33.56  ? 231 TYR A CD2   1 
ATOM   2071 C CE1   . TYR C 3 231 ? -12.822 91.497 55.607  1.00 35.88  ? 231 TYR A CE1   1 
ATOM   2072 C CE2   . TYR C 3 231 ? -13.114 93.465 54.261  1.00 36.58  ? 231 TYR A CE2   1 
ATOM   2073 C CZ    . TYR C 3 231 ? -13.346 92.766 55.432  1.00 37.50  ? 231 TYR A CZ    1 
ATOM   2074 O OH    . TYR C 3 231 ? -14.112 93.342 56.418  1.00 40.68  ? 231 TYR A OH    1 
ATOM   2075 N N     . PRO C 3 232 ? -12.983 91.172 49.705  1.00 30.08  ? 232 PRO A N     1 
ATOM   2076 C CA    . PRO C 3 232 ? -14.087 91.853 49.021  1.00 29.37  ? 232 PRO A CA    1 
ATOM   2077 C C     . PRO C 3 232 ? -15.284 90.930 48.777  1.00 31.50  ? 232 PRO A C     1 
ATOM   2078 O O     . PRO C 3 232 ? -16.437 91.318 48.995  1.00 33.19  ? 232 PRO A O     1 
ATOM   2079 C CB    . PRO C 3 232 ? -13.452 92.310 47.713  1.00 27.36  ? 232 PRO A CB    1 
ATOM   2080 C CG    . PRO C 3 232 ? -12.025 92.550 48.099  1.00 27.40  ? 232 PRO A CG    1 
ATOM   2081 C CD    . PRO C 3 232 ? -11.712 91.370 48.983  1.00 27.30  ? 232 PRO A CD    1 
ATOM   2082 N N     . VAL C 3 233 ? -15.010 89.712 48.312  1.00 33.88  ? 233 VAL A N     1 
ATOM   2083 C CA    . VAL C 3 233 ? -16.073 88.756 48.035  1.00 34.98  ? 233 VAL A CA    1 
ATOM   2084 C C     . VAL C 3 233 ? -16.685 88.228 49.332  1.00 35.49  ? 233 VAL A C     1 
ATOM   2085 O O     . VAL C 3 233 ? -17.875 87.908 49.383  1.00 37.17  ? 233 VAL A O     1 
ATOM   2086 C CB    . VAL C 3 233 ? -15.558 87.600 47.111  1.00 28.63  ? 233 VAL A CB    1 
ATOM   2087 C CG1   . VAL C 3 233 ? -14.078 87.411 47.287  1.00 27.73  ? 233 VAL A CG1   1 
ATOM   2088 C CG2   . VAL C 3 233 ? -16.303 86.306 47.394  1.00 27.20  ? 233 VAL A CG2   1 
ATOM   2089 N N     . LEU C 3 234 ? -15.876 88.147 50.385  1.00 40.05  ? 234 LEU A N     1 
ATOM   2090 C CA    . LEU C 3 234 ? -16.374 87.703 51.683  1.00 39.34  ? 234 LEU A CA    1 
ATOM   2091 C C     . LEU C 3 234 ? -17.365 88.772 52.143  1.00 40.36  ? 234 LEU A C     1 
ATOM   2092 O O     . LEU C 3 234 ? -18.482 88.472 52.567  1.00 40.85  ? 234 LEU A O     1 
ATOM   2093 C CB    . LEU C 3 234 ? -15.222 87.605 52.682  1.00 25.39  ? 234 LEU A CB    1 
ATOM   2094 C CG    . LEU C 3 234 ? -14.684 86.232 53.085  1.00 22.75  ? 234 LEU A CG    1 
ATOM   2095 C CD1   . LEU C 3 234 ? -14.562 85.315 51.888  1.00 22.81  ? 234 LEU A CD1   1 
ATOM   2096 C CD2   . LEU C 3 234 ? -13.330 86.422 53.757  1.00 22.83  ? 234 LEU A CD2   1 
ATOM   2097 N N     . SER C 3 235 ? -16.941 90.027 52.038  1.00 40.80  ? 235 SER A N     1 
ATOM   2098 C CA    . SER C 3 235 ? -17.763 91.165 52.429  1.00 41.33  ? 235 SER A CA    1 
ATOM   2099 C C     . SER C 3 235 ? -19.051 91.212 51.610  1.00 39.05  ? 235 SER A C     1 
ATOM   2100 O O     . SER C 3 235 ? -20.129 91.451 52.147  1.00 39.47  ? 235 SER A O     1 
ATOM   2101 C CB    . SER C 3 235 ? -16.976 92.463 52.239  1.00 59.26  ? 235 SER A CB    1 
ATOM   2102 O OG    . SER C 3 235 ? -17.704 93.578 52.720  1.00 64.10  ? 235 SER A OG    1 
ATOM   2103 N N     . GLU C 3 236 ? -18.930 90.975 50.310  1.00 30.30  ? 236 GLU A N     1 
ATOM   2104 C CA    . GLU C 3 236 ? -20.078 90.986 49.419  1.00 28.80  ? 236 GLU A CA    1 
ATOM   2105 C C     . GLU C 3 236 ? -21.135 89.977 49.820  1.00 28.81  ? 236 GLU A C     1 
ATOM   2106 O O     . GLU C 3 236 ? -22.317 90.199 49.567  1.00 28.54  ? 236 GLU A O     1 
ATOM   2107 C CB    . GLU C 3 236 ? -19.648 90.698 47.980  1.00 35.62  ? 236 GLU A CB    1 
ATOM   2108 C CG    . GLU C 3 236 ? -20.813 90.517 47.020  1.00 35.73  ? 236 GLU A CG    1 
ATOM   2109 C CD    . GLU C 3 236 ? -20.368 90.209 45.602  1.00 37.41  ? 236 GLU A CD    1 
ATOM   2110 O OE1   . GLU C 3 236 ? -21.248 90.069 44.718  1.00 35.82  ? 236 GLU A OE1   1 
ATOM   2111 O OE2   . GLU C 3 236 ? -19.141 90.106 45.370  1.00 39.31  ? 236 GLU A OE2   1 
ATOM   2112 N N     . PHE C 3 237 ? -20.730 88.861 50.422  1.00 33.95  ? 237 PHE A N     1 
ATOM   2113 C CA    . PHE C 3 237 ? -21.714 87.853 50.818  1.00 34.02  ? 237 PHE A CA    1 
ATOM   2114 C C     . PHE C 3 237 ? -21.976 87.809 52.310  1.00 35.94  ? 237 PHE A C     1 
ATOM   2115 O O     . PHE C 3 237 ? -22.482 86.817 52.842  1.00 35.73  ? 237 PHE A O     1 
ATOM   2116 C CB    . PHE C 3 237 ? -21.326 86.468 50.295  1.00 24.90  ? 237 PHE A CB    1 
ATOM   2117 C CG    . PHE C 3 237 ? -21.346 86.373 48.795  1.00 24.99  ? 237 PHE A CG    1 
ATOM   2118 C CD1   . PHE C 3 237 ? -20.192 86.614 48.050  1.00 22.55  ? 237 PHE A CD1   1 
ATOM   2119 C CD2   . PHE C 3 237 ? -22.535 86.116 48.118  1.00 24.32  ? 237 PHE A CD2   1 
ATOM   2120 C CE1   . PHE C 3 237 ? -20.218 86.601 46.663  1.00 20.32  ? 237 PHE A CE1   1 
ATOM   2121 C CE2   . PHE C 3 237 ? -22.569 86.105 46.726  1.00 22.26  ? 237 PHE A CE2   1 
ATOM   2122 C CZ    . PHE C 3 237 ? -21.403 86.349 46.000  1.00 20.53  ? 237 PHE A CZ    1 
ATOM   2123 N N     . ARG C 3 238 ? -21.641 88.908 52.976  1.00 28.72  ? 238 ARG A N     1 
ATOM   2124 C CA    . ARG C 3 238 ? -21.870 89.032 54.401  1.00 33.33  ? 238 ARG A CA    1 
ATOM   2125 C C     . ARG C 3 238 ? -23.369 88.951 54.668  1.00 35.58  ? 238 ARG A C     1 
ATOM   2126 O O     . ARG C 3 238 ? -24.158 89.540 53.934  1.00 34.48  ? 238 ARG A O     1 
ATOM   2127 C CB    . ARG C 3 238 ? -21.351 90.378 54.897  1.00 41.72  ? 238 ARG A CB    1 
ATOM   2128 C CG    . ARG C 3 238 ? -21.885 90.747 56.260  1.00 43.96  ? 238 ARG A CG    1 
ATOM   2129 C CD    . ARG C 3 238 ? -21.316 92.044 56.753  1.00 45.12  ? 238 ARG A CD    1 
ATOM   2130 N NE    . ARG C 3 238 ? -21.741 92.291 58.124  1.00 46.22  ? 238 ARG A NE    1 
ATOM   2131 C CZ    . ARG C 3 238 ? -21.219 93.228 58.907  1.00 47.12  ? 238 ARG A CZ    1 
ATOM   2132 N NH1   . ARG C 3 238 ? -21.670 93.377 60.146  1.00 48.22  ? 238 ARG A NH1   1 
ATOM   2133 N NH2   . ARG C 3 238 ? -20.246 94.012 58.452  1.00 48.80  ? 238 ARG A NH2   1 
ATOM   2134 N N     . LYS C 3 239 ? -23.760 88.220 55.708  1.00 45.30  ? 239 LYS A N     1 
ATOM   2135 C CA    . LYS C 3 239 ? -25.166 88.109 56.069  1.00 50.97  ? 239 LYS A CA    1 
ATOM   2136 C C     . LYS C 3 239 ? -25.517 89.323 56.920  1.00 56.66  ? 239 LYS A C     1 
ATOM   2137 O O     . LYS C 3 239 ? -25.100 89.414 58.079  1.00 57.08  ? 239 LYS A O     1 
ATOM   2138 C CB    . LYS C 3 239 ? -25.424 86.853 56.895  1.00 41.89  ? 239 LYS A CB    1 
ATOM   2139 C CG    . LYS C 3 239 ? -25.241 85.540 56.170  1.00 42.34  ? 239 LYS A CG    1 
ATOM   2140 C CD    . LYS C 3 239 ? -25.661 84.396 57.078  1.00 41.81  ? 239 LYS A CD    1 
ATOM   2141 C CE    . LYS C 3 239 ? -25.481 83.051 56.415  1.00 41.85  ? 239 LYS A CE    1 
ATOM   2142 N NZ    . LYS C 3 239 ? -26.141 81.984 57.222  1.00 42.52  ? 239 LYS A NZ    1 
ATOM   2143 N N     . MET C 3 240 ? -26.276 90.256 56.356  1.00 90.00  ? 240 MET A N     1 
ATOM   2144 C CA    . MET C 3 240 ? -26.659 91.452 57.096  1.00 90.00  ? 240 MET A CA    1 
ATOM   2145 C C     . MET C 3 240 ? -27.950 92.044 56.563  1.00 90.00  ? 240 MET A C     1 
ATOM   2146 O O     . MET C 3 240 ? -28.826 92.364 57.395  1.00 90.00  ? 240 MET A O     1 
ATOM   2147 C CB    . MET C 3 240 ? -25.548 92.504 57.031  1.00 90.00  ? 240 MET A CB    1 
ATOM   2148 C CG    . MET C 3 240 ? -25.253 93.023 55.636  1.00 90.00  ? 240 MET A CG    1 
ATOM   2149 S SD    . MET C 3 240 ? -24.091 94.402 55.673  1.00 90.00  ? 240 MET A SD    1 
ATOM   2150 C CE    . MET C 3 240 ? -25.234 95.827 55.791  1.00 90.00  ? 240 MET A CE    1 
ATOM   2151 O OXT   . MET C 3 240 ? -28.060 92.190 55.327  1.00 90.00  ? 240 MET A OXT   1 
ATOM   2152 N N     . PRO D 4 4   ? 5.398   31.762 72.039  1.00 90.00  ? 4   PRO B N     1 
ATOM   2153 C CA    . PRO D 4 4   ? 4.079   31.433 72.632  1.00 90.00  ? 4   PRO B CA    1 
ATOM   2154 C C     . PRO D 4 4   ? 4.016   31.677 74.142  1.00 90.00  ? 4   PRO B C     1 
ATOM   2155 O O     . PRO D 4 4   ? 3.727   30.756 74.912  1.00 90.00  ? 4   PRO B O     1 
ATOM   2156 C CB    . PRO D 4 4   ? 3.807   29.969 72.305  1.00 89.47  ? 4   PRO B CB    1 
ATOM   2157 C CG    . PRO D 4 4   ? 5.217   29.432 72.074  1.00 89.47  ? 4   PRO B CG    1 
ATOM   2158 C CD    . PRO D 4 4   ? 5.952   30.572 71.368  1.00 89.47  ? 4   PRO B CD    1 
ATOM   2159 N N     . GLY D 4 5   ? 4.263   32.920 74.557  1.00 90.00  ? 5   GLY B N     1 
ATOM   2160 C CA    . GLY D 4 5   ? 4.248   33.242 75.976  1.00 89.53  ? 5   GLY B CA    1 
ATOM   2161 C C     . GLY D 4 5   ? 3.567   34.533 76.406  1.00 85.97  ? 5   GLY B C     1 
ATOM   2162 O O     . GLY D 4 5   ? 2.898   35.204 75.617  1.00 86.18  ? 5   GLY B O     1 
ATOM   2163 N N     . TYR D 4 6   ? 3.750   34.872 77.680  1.00 52.45  ? 6   TYR B N     1 
ATOM   2164 C CA    . TYR D 4 6   ? 3.165   36.066 78.274  1.00 46.86  ? 6   TYR B CA    1 
ATOM   2165 C C     . TYR D 4 6   ? 4.235   37.128 78.475  1.00 42.77  ? 6   TYR B C     1 
ATOM   2166 O O     . TYR D 4 6   ? 5.426   36.825 78.452  1.00 43.93  ? 6   TYR B O     1 
ATOM   2167 C CB    . TYR D 4 6   ? 2.531   35.712 79.617  1.00 47.51  ? 6   TYR B CB    1 
ATOM   2168 C CG    . TYR D 4 6   ? 1.541   34.574 79.531  1.00 47.80  ? 6   TYR B CG    1 
ATOM   2169 C CD1   . TYR D 4 6   ? 1.962   33.286 79.202  1.00 48.43  ? 6   TYR B CD1   1 
ATOM   2170 C CD2   . TYR D 4 6   ? 0.178   34.793 79.735  1.00 48.39  ? 6   TYR B CD2   1 
ATOM   2171 C CE1   . TYR D 4 6   ? 1.054   32.240 79.069  1.00 49.05  ? 6   TYR B CE1   1 
ATOM   2172 C CE2   . TYR D 4 6   ? -0.745  33.755 79.608  1.00 50.35  ? 6   TYR B CE2   1 
ATOM   2173 C CZ    . TYR D 4 6   ? -0.300  32.478 79.272  1.00 50.90  ? 6   TYR B CZ    1 
ATOM   2174 O OH    . TYR D 4 6   ? -1.204  31.438 79.140  1.00 52.56  ? 6   TYR B OH    1 
ATOM   2175 N N     . TYR D 4 7   ? 3.814   38.372 78.672  1.00 34.20  ? 7   TYR B N     1 
ATOM   2176 C CA    . TYR D 4 7   ? 4.765   39.457 78.874  1.00 28.79  ? 7   TYR B CA    1 
ATOM   2177 C C     . TYR D 4 7   ? 5.575   39.212 80.123  1.00 25.92  ? 7   TYR B C     1 
ATOM   2178 O O     . TYR D 4 7   ? 5.101   38.590 81.073  1.00 24.05  ? 7   TYR B O     1 
ATOM   2179 C CB    . TYR D 4 7   ? 4.042   40.788 79.025  1.00 35.49  ? 7   TYR B CB    1 
ATOM   2180 C CG    . TYR D 4 7   ? 3.190   41.146 77.849  1.00 33.58  ? 7   TYR B CG    1 
ATOM   2181 C CD1   . TYR D 4 7   ? 3.751   41.308 76.590  1.00 31.79  ? 7   TYR B CD1   1 
ATOM   2182 C CD2   . TYR D 4 7   ? 1.818   41.316 77.992  1.00 33.70  ? 7   TYR B CD2   1 
ATOM   2183 C CE1   . TYR D 4 7   ? 2.971   41.625 75.502  1.00 31.94  ? 7   TYR B CE1   1 
ATOM   2184 C CE2   . TYR D 4 7   ? 1.023   41.637 76.909  1.00 32.92  ? 7   TYR B CE2   1 
ATOM   2185 C CZ    . TYR D 4 7   ? 1.604   41.787 75.662  1.00 32.69  ? 7   TYR B CZ    1 
ATOM   2186 O OH    . TYR D 4 7   ? 0.818   42.070 74.564  1.00 31.98  ? 7   TYR B OH    1 
ATOM   2187 N N     . GLU D 4 8   ? 6.790   39.735 80.138  1.00 28.32  ? 8   GLU B N     1 
ATOM   2188 C CA    . GLU D 4 8   ? 7.662   39.561 81.282  1.00 27.93  ? 8   GLU B CA    1 
ATOM   2189 C C     . GLU D 4 8   ? 7.808   40.815 82.139  1.00 27.82  ? 8   GLU B C     1 
ATOM   2190 O O     . GLU D 4 8   ? 8.569   40.810 83.110  1.00 28.08  ? 8   GLU B O     1 
ATOM   2191 C CB    . GLU D 4 8   ? 9.031   39.110 80.797  1.00 25.79  ? 8   GLU B CB    1 
ATOM   2192 C CG    . GLU D 4 8   ? 8.954   37.908 79.895  1.00 30.90  ? 8   GLU B CG    1 
ATOM   2193 C CD    . GLU D 4 8   ? 10.309  37.486 79.358  1.00 35.08  ? 8   GLU B CD    1 
ATOM   2194 O OE1   . GLU D 4 8   ? 10.365  36.444 78.667  1.00 37.19  ? 8   GLU B OE1   1 
ATOM   2195 O OE2   . GLU D 4 8   ? 11.314  38.187 79.622  1.00 34.98  ? 8   GLU B OE2   1 
ATOM   2196 N N     . LEU D 4 9   ? 7.079   41.881 81.810  1.00 27.06  ? 9   LEU B N     1 
ATOM   2197 C CA    . LEU D 4 9   ? 7.216   43.116 82.578  1.00 25.28  ? 9   LEU B CA    1 
ATOM   2198 C C     . LEU D 4 9   ? 6.938   42.939 84.062  1.00 25.49  ? 9   LEU B C     1 
ATOM   2199 O O     . LEU D 4 9   ? 7.557   43.598 84.893  1.00 27.98  ? 9   LEU B O     1 
ATOM   2200 C CB    . LEU D 4 9   ? 6.315   44.233 82.021  1.00 19.35  ? 9   LEU B CB    1 
ATOM   2201 C CG    . LEU D 4 9   ? 4.804   44.214 82.265  1.00 18.33  ? 9   LEU B CG    1 
ATOM   2202 C CD1   . LEU D 4 9   ? 4.257   45.613 82.069  1.00 15.99  ? 9   LEU B CD1   1 
ATOM   2203 C CD2   . LEU D 4 9   ? 4.126   43.223 81.335  1.00 17.26  ? 9   LEU B CD2   1 
ATOM   2204 N N     . TYR D 4 10  ? 6.023   42.036 84.396  1.00 24.70  ? 10  TYR B N     1 
ATOM   2205 C CA    . TYR D 4 10  ? 5.645   41.800 85.781  1.00 22.55  ? 10  TYR B CA    1 
ATOM   2206 C C     . TYR D 4 10  ? 6.747   41.257 86.671  1.00 22.42  ? 10  TYR B C     1 
ATOM   2207 O O     . TYR D 4 10  ? 6.607   41.226 87.897  1.00 22.08  ? 10  TYR B O     1 
ATOM   2208 C CB    . TYR D 4 10  ? 4.450   40.868 85.828  1.00 25.39  ? 10  TYR B CB    1 
ATOM   2209 C CG    . TYR D 4 10  ? 3.212   41.464 85.224  1.00 27.38  ? 10  TYR B CG    1 
ATOM   2210 C CD1   . TYR D 4 10  ? 2.619   40.892 84.098  1.00 28.02  ? 10  TYR B CD1   1 
ATOM   2211 C CD2   . TYR D 4 10  ? 2.614   42.592 85.791  1.00 26.65  ? 10  TYR B CD2   1 
ATOM   2212 C CE1   . TYR D 4 10  ? 1.459   41.422 83.553  1.00 28.54  ? 10  TYR B CE1   1 
ATOM   2213 C CE2   . TYR D 4 10  ? 1.452   43.130 85.253  1.00 27.63  ? 10  TYR B CE2   1 
ATOM   2214 C CZ    . TYR D 4 10  ? 0.879   42.539 84.136  1.00 27.67  ? 10  TYR B CZ    1 
ATOM   2215 O OH    . TYR D 4 10  ? -0.283  43.055 83.614  1.00 27.04  ? 10  TYR B OH    1 
ATOM   2216 N N     . ARG D 4 11  ? 7.844   40.821 86.066  1.00 21.20  ? 11  ARG B N     1 
ATOM   2217 C CA    . ARG D 4 11  ? 8.953   40.309 86.844  1.00 20.41  ? 11  ARG B CA    1 
ATOM   2218 C C     . ARG D 4 11  ? 9.665   41.482 87.528  1.00 21.00  ? 11  ARG B C     1 
ATOM   2219 O O     . ARG D 4 11  ? 10.461  41.298 88.455  1.00 21.86  ? 11  ARG B O     1 
ATOM   2220 C CB    . ARG D 4 11  ? 9.910   39.566 85.928  1.00 22.12  ? 11  ARG B CB    1 
ATOM   2221 C CG    . ARG D 4 11  ? 9.305   38.382 85.195  1.00 22.00  ? 11  ARG B CG    1 
ATOM   2222 C CD    . ARG D 4 11  ? 10.396  37.710 84.395  1.00 22.32  ? 11  ARG B CD    1 
ATOM   2223 N NE    . ARG D 4 11  ? 9.945   36.601 83.562  1.00 24.43  ? 11  ARG B NE    1 
ATOM   2224 C CZ    . ARG D 4 11  ? 10.777  35.823 82.872  1.00 26.60  ? 11  ARG B CZ    1 
ATOM   2225 N NH1   . ARG D 4 11  ? 10.311  34.823 82.128  1.00 26.32  ? 11  ARG B NH1   1 
ATOM   2226 N NH2   . ARG D 4 11  ? 12.086  36.047 82.931  1.00 26.18  ? 11  ARG B NH2   1 
ATOM   2227 N N     . ARG D 4 12  ? 9.368   42.692 87.060  1.00 19.30  ? 12  ARG B N     1 
ATOM   2228 C CA    . ARG D 4 12  ? 9.944   43.917 87.609  1.00 21.24  ? 12  ARG B CA    1 
ATOM   2229 C C     . ARG D 4 12  ? 9.107   44.462 88.772  1.00 21.06  ? 12  ARG B C     1 
ATOM   2230 O O     . ARG D 4 12  ? 9.481   45.456 89.390  1.00 20.81  ? 12  ARG B O     1 
ATOM   2231 C CB    . ARG D 4 12  ? 10.045  44.977 86.512  1.00 33.45  ? 12  ARG B CB    1 
ATOM   2232 C CG    . ARG D 4 12  ? 10.819  44.519 85.291  1.00 38.58  ? 12  ARG B CG    1 
ATOM   2233 C CD    . ARG D 4 12  ? 10.551  45.419 84.090  1.00 44.23  ? 12  ARG B CD    1 
ATOM   2234 N NE    . ARG D 4 12  ? 10.766  46.830 84.415  1.00 50.31  ? 12  ARG B NE    1 
ATOM   2235 C CZ    . ARG D 4 12  ? 10.718  47.827 83.532  1.00 52.12  ? 12  ARG B CZ    1 
ATOM   2236 N NH1   . ARG D 4 12  ? 10.462  47.575 82.251  1.00 53.30  ? 12  ARG B NH1   1 
ATOM   2237 N NH2   . ARG D 4 12  ? 10.928  49.079 83.936  1.00 51.43  ? 12  ARG B NH2   1 
ATOM   2238 N N     . SER D 4 13  ? 7.980   43.810 89.059  1.00 25.97  ? 13  SER B N     1 
ATOM   2239 C CA    . SER D 4 13  ? 7.084   44.211 90.148  1.00 25.13  ? 13  SER B CA    1 
ATOM   2240 C C     . SER D 4 13  ? 7.607   43.724 91.496  1.00 27.20  ? 13  SER B C     1 
ATOM   2241 O O     . SER D 4 13  ? 8.545   42.934 91.549  1.00 29.81  ? 13  SER B O     1 
ATOM   2242 C CB    . SER D 4 13  ? 5.709   43.611 89.936  1.00 17.17  ? 13  SER B CB    1 
ATOM   2243 O OG    . SER D 4 13  ? 5.772   42.215 90.141  1.00 15.84  ? 13  SER B OG    1 
ATOM   2244 N N     . THR D 4 14  ? 6.985   44.165 92.587  1.00 26.72  ? 14  THR B N     1 
ATOM   2245 C CA    . THR D 4 14  ? 7.434   43.748 93.914  1.00 25.83  ? 14  THR B CA    1 
ATOM   2246 C C     . THR D 4 14  ? 7.412   42.227 94.109  1.00 25.78  ? 14  THR B C     1 
ATOM   2247 O O     . THR D 4 14  ? 8.379   41.647 94.591  1.00 26.42  ? 14  THR B O     1 
ATOM   2248 C CB    . THR D 4 14  ? 6.584   44.381 95.030  1.00 22.49  ? 14  THR B CB    1 
ATOM   2249 O OG1   . THR D 4 14  ? 6.545   45.801 94.855  1.00 24.38  ? 14  THR B OG1   1 
ATOM   2250 C CG2   . THR D 4 14  ? 7.186   44.063 96.396  1.00 21.81  ? 14  THR B CG2   1 
ATOM   2251 N N     . ILE D 4 15  ? 6.316   41.579 93.729  1.00 24.52  ? 15  ILE B N     1 
ATOM   2252 C CA    . ILE D 4 15  ? 6.211   40.137 93.905  1.00 24.17  ? 15  ILE B CA    1 
ATOM   2253 C C     . ILE D 4 15  ? 7.115   39.360 92.963  1.00 25.44  ? 15  ILE B C     1 
ATOM   2254 O O     . ILE D 4 15  ? 7.638   38.302 93.318  1.00 25.12  ? 15  ILE B O     1 
ATOM   2255 C CB    . ILE D 4 15  ? 4.755   39.650 93.708  1.00 19.30  ? 15  ILE B CB    1 
ATOM   2256 C CG1   . ILE D 4 15  ? 4.680   38.142 93.965  1.00 17.57  ? 15  ILE B CG1   1 
ATOM   2257 C CG2   . ILE D 4 15  ? 4.270   39.983 92.308  1.00 17.74  ? 15  ILE B CG2   1 
ATOM   2258 C CD1   . ILE D 4 15  ? 3.274   37.591 94.011  1.00 15.49  ? 15  ILE B CD1   1 
ATOM   2259 N N     . GLY D 4 16  ? 7.287   39.890 91.757  1.00 38.51  ? 16  GLY B N     1 
ATOM   2260 C CA    . GLY D 4 16  ? 8.121   39.236 90.767  1.00 38.61  ? 16  GLY B CA    1 
ATOM   2261 C C     . GLY D 4 16  ? 9.586   39.370 91.097  1.00 39.66  ? 16  GLY B C     1 
ATOM   2262 O O     . GLY D 4 16  ? 10.379  38.465 90.853  1.00 41.95  ? 16  GLY B O     1 
ATOM   2263 N N     . ASN D 4 17  ? 9.950   40.512 91.659  1.00 23.71  ? 17  ASN B N     1 
ATOM   2264 C CA    . ASN D 4 17  ? 11.330  40.746 92.023  1.00 22.88  ? 17  ASN B CA    1 
ATOM   2265 C C     . ASN D 4 17  ? 11.701  39.874 93.224  1.00 21.04  ? 17  ASN B C     1 
ATOM   2266 O O     . ASN D 4 17  ? 12.826  39.394 93.319  1.00 20.01  ? 17  ASN B O     1 
ATOM   2267 C CB    . ASN D 4 17  ? 11.537  42.221 92.339  1.00 49.70  ? 17  ASN B CB    1 
ATOM   2268 C CG    . ASN D 4 17  ? 12.865  42.727 91.848  1.00 52.97  ? 17  ASN B CG    1 
ATOM   2269 O OD1   . ASN D 4 17  ? 13.910  42.440 92.433  1.00 54.92  ? 17  ASN B OD1   1 
ATOM   2270 N ND2   . ASN D 4 17  ? 12.839  43.472 90.751  1.00 56.10  ? 17  ASN B ND2   1 
ATOM   2271 N N     . SER D 4 18  ? 10.749  39.660 94.131  1.00 20.81  ? 18  SER B N     1 
ATOM   2272 C CA    . SER D 4 18  ? 10.977  38.828 95.312  1.00 20.15  ? 18  SER B CA    1 
ATOM   2273 C C     . SER D 4 18  ? 11.169  37.374 94.914  1.00 18.91  ? 18  SER B C     1 
ATOM   2274 O O     . SER D 4 18  ? 11.937  36.654 95.536  1.00 18.54  ? 18  SER B O     1 
ATOM   2275 C CB    . SER D 4 18  ? 9.799   38.934 96.279  1.00 25.31  ? 18  SER B CB    1 
ATOM   2276 O OG    . SER D 4 18  ? 9.803   40.180 96.940  1.00 27.57  ? 18  SER B OG    1 
ATOM   2277 N N     . LEU D 4 19  ? 10.449  36.951 93.882  1.00 19.52  ? 19  LEU B N     1 
ATOM   2278 C CA    . LEU D 4 19  ? 10.535  35.591 93.372  1.00 19.96  ? 19  LEU B CA    1 
ATOM   2279 C C     . LEU D 4 19  ? 11.934  35.406 92.785  1.00 21.79  ? 19  LEU B C     1 
ATOM   2280 O O     . LEU D 4 19  ? 12.565  34.370 92.974  1.00 22.59  ? 19  LEU B O     1 
ATOM   2281 C CB    . LEU D 4 19  ? 9.488   35.381 92.277  1.00 20.58  ? 19  LEU B CB    1 
ATOM   2282 C CG    . LEU D 4 19  ? 9.035   33.968 91.901  1.00 20.90  ? 19  LEU B CG    1 
ATOM   2283 C CD1   . LEU D 4 19  ? 8.958   33.860 90.391  1.00 17.96  ? 19  LEU B CD1   1 
ATOM   2284 C CD2   . LEU D 4 19  ? 9.974   32.929 92.467  1.00 20.58  ? 19  LEU B CD2   1 
ATOM   2285 N N     . VAL D 4 20  ? 12.417  36.422 92.073  1.00 24.33  ? 20  VAL B N     1 
ATOM   2286 C CA    . VAL D 4 20  ? 13.739  36.361 91.464  1.00 26.18  ? 20  VAL B CA    1 
ATOM   2287 C C     . VAL D 4 20  ? 14.769  36.218 92.565  1.00 28.61  ? 20  VAL B C     1 
ATOM   2288 O O     . VAL D 4 20  ? 15.721  35.460 92.419  1.00 29.47  ? 20  VAL B O     1 
ATOM   2289 C CB    . VAL D 4 20  ? 14.036  37.626 90.609  1.00 18.71  ? 20  VAL B CB    1 
ATOM   2290 C CG1   . VAL D 4 20  ? 15.476  37.646 90.173  1.00 16.06  ? 20  VAL B CG1   1 
ATOM   2291 C CG2   . VAL D 4 20  ? 13.158  37.626 89.370  1.00 18.74  ? 20  VAL B CG2   1 
ATOM   2292 N N     . ASP D 4 21  ? 14.566  36.933 93.670  1.00 35.63  ? 21  ASP B N     1 
ATOM   2293 C CA    . ASP D 4 21  ? 15.470  36.870 94.821  1.00 38.87  ? 21  ASP B CA    1 
ATOM   2294 C C     . ASP D 4 21  ? 15.511  35.465 95.406  1.00 38.43  ? 21  ASP B C     1 
ATOM   2295 O O     . ASP D 4 21  ? 16.577  34.881 95.573  1.00 40.58  ? 21  ASP B O     1 
ATOM   2296 C CB    . ASP D 4 21  ? 15.013  37.829 95.921  1.00 51.35  ? 21  ASP B CB    1 
ATOM   2297 C CG    . ASP D 4 21  ? 15.415  39.263 95.655  1.00 54.21  ? 21  ASP B CG    1 
ATOM   2298 O OD1   . ASP D 4 21  ? 14.995  40.143 96.442  1.00 55.28  ? 21  ASP B OD1   1 
ATOM   2299 O OD2   . ASP D 4 21  ? 16.153  39.512 94.675  1.00 55.39  ? 21  ASP B OD2   1 
ATOM   2300 N N     . ALA D 4 22  ? 14.336  34.942 95.734  1.00 31.32  ? 22  ALA B N     1 
ATOM   2301 C CA    . ALA D 4 22  ? 14.215  33.612 96.304  1.00 29.00  ? 22  ALA B CA    1 
ATOM   2302 C C     . ALA D 4 22  ? 14.843  32.598 95.360  1.00 28.00  ? 22  ALA B C     1 
ATOM   2303 O O     . ALA D 4 22  ? 15.575  31.709 95.781  1.00 29.17  ? 22  ALA B O     1 
ATOM   2304 C CB    . ALA D 4 22  ? 12.731  33.277 96.545  1.00 13.73  ? 22  ALA B CB    1 
ATOM   2305 N N     . LEU D 4 23  ? 14.560  32.753 94.076  1.00 21.93  ? 23  LEU B N     1 
ATOM   2306 C CA    . LEU D 4 23  ? 15.075  31.851 93.057  1.00 21.54  ? 23  LEU B CA    1 
ATOM   2307 C C     . LEU D 4 23  ? 16.599  31.883 92.973  1.00 23.36  ? 23  LEU B C     1 
ATOM   2308 O O     . LEU D 4 23  ? 17.237  30.853 92.756  1.00 23.86  ? 23  LEU B O     1 
ATOM   2309 C CB    . LEU D 4 23  ? 14.458  32.219 91.702  1.00 18.68  ? 23  LEU B CB    1 
ATOM   2310 C CG    . LEU D 4 23  ? 13.519  31.241 90.986  1.00 16.06  ? 23  LEU B CG    1 
ATOM   2311 C CD1   . LEU D 4 23  ? 12.931  30.240 91.963  1.00 14.49  ? 23  LEU B CD1   1 
ATOM   2312 C CD2   . LEU D 4 23  ? 12.429  32.028 90.269  1.00 14.21  ? 23  LEU B CD2   1 
ATOM   2313 N N     . ASP D 4 24  ? 17.187  33.062 93.154  1.00 35.89  ? 24  ASP B N     1 
ATOM   2314 C CA    . ASP D 4 24  ? 18.638  33.195 93.080  1.00 37.80  ? 24  ASP B CA    1 
ATOM   2315 C C     . ASP D 4 24  ? 19.365  32.580 94.262  1.00 37.81  ? 24  ASP B C     1 
ATOM   2316 O O     . ASP D 4 24  ? 20.473  32.065 94.107  1.00 37.44  ? 24  ASP B O     1 
ATOM   2317 C CB    . ASP D 4 24  ? 19.047  34.662 92.937  1.00 73.61  ? 24  ASP B CB    1 
ATOM   2318 C CG    . ASP D 4 24  ? 18.810  35.199 91.538  1.00 79.05  ? 24  ASP B CG    1 
ATOM   2319 O OD1   . ASP D 4 24  ? 19.177  34.514 90.558  1.00 79.72  ? 24  ASP B OD1   1 
ATOM   2320 O OD2   . ASP D 4 24  ? 18.266  36.314 91.416  1.00 82.72  ? 24  ASP B OD2   1 
ATOM   2321 N N     . THR D 4 25  ? 18.754  32.631 95.441  1.00 31.57  ? 25  THR B N     1 
ATOM   2322 C CA    . THR D 4 25  ? 19.384  32.052 96.618  1.00 30.18  ? 25  THR B CA    1 
ATOM   2323 C C     . THR D 4 25  ? 19.421  30.524 96.482  1.00 29.33  ? 25  THR B C     1 
ATOM   2324 O O     . THR D 4 25  ? 20.381  29.880 96.893  1.00 30.01  ? 25  THR B O     1 
ATOM   2325 C CB    . THR D 4 25  ? 18.640  32.451 97.908  1.00 31.83  ? 25  THR B CB    1 
ATOM   2326 O OG1   . THR D 4 25  ? 17.531  31.577 98.114  1.00 36.21  ? 25  THR B OG1   1 
ATOM   2327 C CG2   . THR D 4 25  ? 18.122  33.878 97.798  1.00 31.06  ? 25  THR B CG2   1 
ATOM   2328 N N     . LEU D 4 26  ? 18.387  29.939 95.892  1.00 30.51  ? 26  LEU B N     1 
ATOM   2329 C CA    . LEU D 4 26  ? 18.377  28.497 95.715  1.00 29.64  ? 26  LEU B CA    1 
ATOM   2330 C C     . LEU D 4 26  ? 19.399  28.091 94.654  1.00 30.23  ? 26  LEU B C     1 
ATOM   2331 O O     . LEU D 4 26  ? 19.963  26.994 94.721  1.00 29.97  ? 26  LEU B O     1 
ATOM   2332 C CB    . LEU D 4 26  ? 16.989  28.009 95.302  1.00 29.97  ? 26  LEU B CB    1 
ATOM   2333 C CG    . LEU D 4 26  ? 15.842  28.216 96.285  1.00 29.28  ? 26  LEU B CG    1 
ATOM   2334 C CD1   . LEU D 4 26  ? 14.661  27.384 95.845  1.00 30.98  ? 26  LEU B CD1   1 
ATOM   2335 C CD2   . LEU D 4 26  ? 16.267  27.789 97.664  1.00 30.64  ? 26  LEU B CD2   1 
ATOM   2336 N N     . ILE D 4 27  ? 19.624  28.969 93.672  1.00 24.61  ? 27  ILE B N     1 
ATOM   2337 C CA    . ILE D 4 27  ? 20.596  28.690 92.614  1.00 24.77  ? 27  ILE B CA    1 
ATOM   2338 C C     . ILE D 4 27  ? 22.003  28.741 93.188  1.00 26.61  ? 27  ILE B C     1 
ATOM   2339 O O     . ILE D 4 27  ? 22.824  27.872 92.904  1.00 25.39  ? 27  ILE B O     1 
ATOM   2340 C CB    . ILE D 4 27  ? 20.545  29.720 91.461  1.00 19.25  ? 27  ILE B CB    1 
ATOM   2341 C CG1   . ILE D 4 27  ? 19.230  29.613 90.701  1.00 19.53  ? 27  ILE B CG1   1 
ATOM   2342 C CG2   . ILE D 4 27  ? 21.676  29.462 90.484  1.00 16.28  ? 27  ILE B CG2   1 
ATOM   2343 C CD1   . ILE D 4 27  ? 19.085  30.649 89.599  1.00 18.14  ? 27  ILE B CD1   1 
ATOM   2344 N N     . SER D 4 28  ? 22.274  29.768 93.993  1.00 43.48  ? 28  SER B N     1 
ATOM   2345 C CA    . SER D 4 28  ? 23.586  29.938 94.611  1.00 47.27  ? 28  SER B CA    1 
ATOM   2346 C C     . SER D 4 28  ? 23.865  28.838 95.631  1.00 47.50  ? 28  SER B C     1 
ATOM   2347 O O     . SER D 4 28  ? 25.016  28.513 95.894  1.00 47.65  ? 28  SER B O     1 
ATOM   2348 C CB    . SER D 4 28  ? 23.689  31.306 95.292  1.00 60.85  ? 28  SER B CB    1 
ATOM   2349 O OG    . SER D 4 28  ? 23.029  31.309 96.546  1.00 64.79  ? 28  SER B OG    1 
ATOM   2350 N N     . ASP D 4 29  ? 22.810  28.277 96.212  1.00 31.52  ? 29  ASP B N     1 
ATOM   2351 C CA    . ASP D 4 29  ? 22.953  27.199 97.185  1.00 33.42  ? 29  ASP B CA    1 
ATOM   2352 C C     . ASP D 4 29  ? 23.110  25.887 96.436  1.00 31.11  ? 29  ASP B C     1 
ATOM   2353 O O     . ASP D 4 29  ? 23.415  24.851 97.028  1.00 31.51  ? 29  ASP B O     1 
ATOM   2354 C CB    . ASP D 4 29  ? 21.718  27.128 98.082  1.00 78.16  ? 29  ASP B CB    1 
ATOM   2355 C CG    . ASP D 4 29  ? 21.799  28.076 99.255  1.00 83.61  ? 29  ASP B CG    1 
ATOM   2356 O OD1   . ASP D 4 29  ? 22.141  29.261 99.051  1.00 84.14  ? 29  ASP B OD1   1 
ATOM   2357 O OD2   . ASP D 4 29  ? 21.516  27.632 100.385 1.00 85.68  ? 29  ASP B OD2   1 
ATOM   2358 N N     . GLY D 4 30  ? 22.895  25.949 95.125  1.00 33.13  ? 30  GLY B N     1 
ATOM   2359 C CA    . GLY D 4 30  ? 22.997  24.774 94.283  1.00 30.42  ? 30  GLY B CA    1 
ATOM   2360 C C     . GLY D 4 30  ? 21.829  23.831 94.494  1.00 28.70  ? 30  GLY B C     1 
ATOM   2361 O O     . GLY D 4 30  ? 21.950  22.625 94.273  1.00 27.76  ? 30  GLY B O     1 
ATOM   2362 N N     . ARG D 4 31  ? 20.695  24.377 94.922  1.00 25.19  ? 31  ARG B N     1 
ATOM   2363 C CA    . ARG D 4 31  ? 19.520  23.561 95.173  1.00 22.75  ? 31  ARG B CA    1 
ATOM   2364 C C     . ARG D 4 31  ? 18.676  23.340 93.939  1.00 21.59  ? 31  ARG B C     1 
ATOM   2365 O O     . ARG D 4 31  ? 17.845  22.434 93.900  1.00 21.32  ? 31  ARG B O     1 
ATOM   2366 C CB    . ARG D 4 31  ? 18.682  24.177 96.281  1.00 30.43  ? 31  ARG B CB    1 
ATOM   2367 C CG    . ARG D 4 31  ? 19.178  23.784 97.645  1.00 32.29  ? 31  ARG B CG    1 
ATOM   2368 C CD    . ARG D 4 31  ? 18.173  24.122 98.716  1.00 33.29  ? 31  ARG B CD    1 
ATOM   2369 N NE    . ARG D 4 31  ? 18.402  25.458 99.248  1.00 37.65  ? 31  ARG B NE    1 
ATOM   2370 C CZ    . ARG D 4 31  ? 17.624  26.029 100.159 1.00 38.91  ? 31  ARG B CZ    1 
ATOM   2371 N NH1   . ARG D 4 31  ? 16.564  25.368 100.621 1.00 38.29  ? 31  ARG B NH1   1 
ATOM   2372 N NH2   . ARG D 4 31  ? 17.916  27.242 100.619 1.00 38.36  ? 31  ARG B NH2   1 
ATOM   2373 N N     . ILE D 4 32  ? 18.893  24.175 92.931  1.00 20.66  ? 32  ILE B N     1 
ATOM   2374 C CA    . ILE D 4 32  ? 18.174  24.061 91.668  1.00 18.60  ? 32  ILE B CA    1 
ATOM   2375 C C     . ILE D 4 32  ? 19.077  24.580 90.564  1.00 18.65  ? 32  ILE B C     1 
ATOM   2376 O O     . ILE D 4 32  ? 20.076  25.255 90.822  1.00 18.56  ? 32  ILE B O     1 
ATOM   2377 C CB    . ILE D 4 32  ? 16.886  24.903 91.650  1.00 25.99  ? 32  ILE B CB    1 
ATOM   2378 C CG1   . ILE D 4 32  ? 17.237  26.367 91.913  1.00 24.94  ? 32  ILE B CG1   1 
ATOM   2379 C CG2   . ILE D 4 32  ? 15.887  24.370 92.669  1.00 27.08  ? 32  ILE B CG2   1 
ATOM   2380 C CD1   . ILE D 4 32  ? 16.067  27.301 91.835  1.00 22.93  ? 32  ILE B CD1   1 
ATOM   2381 N N     . GLU D 4 33  ? 18.730  24.251 89.330  1.00 21.49  ? 33  GLU B N     1 
ATOM   2382 C CA    . GLU D 4 33  ? 19.503  24.713 88.197  1.00 22.48  ? 33  GLU B CA    1 
ATOM   2383 C C     . GLU D 4 33  ? 18.879  26.019 87.736  1.00 22.37  ? 33  GLU B C     1 
ATOM   2384 O O     . GLU D 4 33  ? 17.688  26.258 87.961  1.00 21.78  ? 33  GLU B O     1 
ATOM   2385 C CB    . GLU D 4 33  ? 19.437  23.694 87.067  1.00 34.37  ? 33  GLU B CB    1 
ATOM   2386 C CG    . GLU D 4 33  ? 20.112  22.382 87.373  1.00 38.96  ? 33  GLU B CG    1 
ATOM   2387 C CD    . GLU D 4 33  ? 21.588  22.551 87.594  1.00 42.54  ? 33  GLU B CD    1 
ATOM   2388 O OE1   . GLU D 4 33  ? 22.260  23.124 86.711  1.00 43.08  ? 33  GLU B OE1   1 
ATOM   2389 O OE2   . GLU D 4 33  ? 22.081  22.109 88.651  1.00 45.80  ? 33  GLU B OE2   1 
ATOM   2390 N N     . ALA D 4 34  ? 19.682  26.862 87.100  1.00 24.39  ? 34  ALA B N     1 
ATOM   2391 C CA    . ALA D 4 34  ? 19.196  28.133 86.589  1.00 24.69  ? 34  ALA B CA    1 
ATOM   2392 C C     . ALA D 4 34  ? 18.041  27.904 85.614  1.00 25.58  ? 34  ALA B C     1 
ATOM   2393 O O     . ALA D 4 34  ? 17.106  28.695 85.566  1.00 26.52  ? 34  ALA B O     1 
ATOM   2394 C CB    . ALA D 4 34  ? 20.318  28.878 85.895  1.00 26.42  ? 34  ALA B CB    1 
ATOM   2395 N N     . SER D 4 35  ? 18.109  26.829 84.833  1.00 24.25  ? 35  SER B N     1 
ATOM   2396 C CA    . SER D 4 35  ? 17.047  26.510 83.883  1.00 22.16  ? 35  SER B CA    1 
ATOM   2397 C C     . SER D 4 35  ? 15.715  26.331 84.606  1.00 22.13  ? 35  SER B C     1 
ATOM   2398 O O     . SER D 4 35  ? 14.674  26.782 84.120  1.00 23.84  ? 35  SER B O     1 
ATOM   2399 C CB    . SER D 4 35  ? 17.387  25.235 83.110  1.00 24.99  ? 35  SER B CB    1 
ATOM   2400 O OG    . SER D 4 35  ? 17.656  24.153 83.985  1.00 24.80  ? 35  SER B OG    1 
ATOM   2401 N N     . LEU D 4 36  ? 15.742  25.676 85.768  1.00 22.12  ? 36  LEU B N     1 
ATOM   2402 C CA    . LEU D 4 36  ? 14.516  25.477 86.528  1.00 21.81  ? 36  LEU B CA    1 
ATOM   2403 C C     . LEU D 4 36  ? 14.009  26.822 87.026  1.00 21.66  ? 36  LEU B C     1 
ATOM   2404 O O     . LEU D 4 36  ? 12.806  27.062 87.066  1.00 21.38  ? 36  LEU B O     1 
ATOM   2405 C CB    . LEU D 4 36  ? 14.744  24.527 87.712  1.00 18.58  ? 36  LEU B CB    1 
ATOM   2406 C CG    . LEU D 4 36  ? 13.494  24.231 88.571  1.00 18.14  ? 36  LEU B CG    1 
ATOM   2407 C CD1   . LEU D 4 36  ? 12.307  23.861 87.680  1.00 14.06  ? 36  LEU B CD1   1 
ATOM   2408 C CD2   . LEU D 4 36  ? 13.792  23.116 89.566  1.00 14.73  ? 36  LEU B CD2   1 
ATOM   2409 N N     . ALA D 4 37  ? 14.935  27.697 87.403  1.00 24.45  ? 37  ALA B N     1 
ATOM   2410 C CA    . ALA D 4 37  ? 14.589  29.036 87.873  1.00 26.28  ? 37  ALA B CA    1 
ATOM   2411 C C     . ALA D 4 37  ? 13.890  29.823 86.756  1.00 27.56  ? 37  ALA B C     1 
ATOM   2412 O O     . ALA D 4 37  ? 12.876  30.484 86.981  1.00 29.88  ? 37  ALA B O     1 
ATOM   2413 C CB    . ALA D 4 37  ? 15.854  29.779 88.327  1.00 10.00  ? 37  ALA B CB    1 
ATOM   2414 N N     . MET D 4 38  ? 14.444  29.749 85.552  1.00 23.78  ? 38  MET B N     1 
ATOM   2415 C CA    . MET D 4 38  ? 13.883  30.438 84.396  1.00 25.17  ? 38  MET B CA    1 
ATOM   2416 C C     . MET D 4 38  ? 12.481  29.913 84.082  1.00 24.58  ? 38  MET B C     1 
ATOM   2417 O O     . MET D 4 38  ? 11.587  30.679 83.727  1.00 23.06  ? 38  MET B O     1 
ATOM   2418 C CB    . MET D 4 38  ? 14.803  30.253 83.188  1.00 38.27  ? 38  MET B CB    1 
ATOM   2419 C CG    . MET D 4 38  ? 15.654  31.471 82.848  1.00 43.75  ? 38  MET B CG    1 
ATOM   2420 S SD    . MET D 4 38  ? 14.623  32.925 82.428  1.00 51.39  ? 38  MET B SD    1 
ATOM   2421 C CE    . MET D 4 38  ? 15.282  34.179 83.583  1.00 47.01  ? 38  MET B CE    1 
ATOM   2422 N N     . ARG D 4 39  ? 12.292  28.605 84.227  1.00 23.15  ? 39  ARG B N     1 
ATOM   2423 C CA    . ARG D 4 39  ? 11.001  27.990 83.968  1.00 22.92  ? 39  ARG B CA    1 
ATOM   2424 C C     . ARG D 4 39  ? 9.980   28.471 85.001  1.00 21.73  ? 39  ARG B C     1 
ATOM   2425 O O     . ARG D 4 39  ? 8.802   28.626 84.683  1.00 22.66  ? 39  ARG B O     1 
ATOM   2426 C CB    . ARG D 4 39  ? 11.133  26.465 83.997  1.00 41.41  ? 39  ARG B CB    1 
ATOM   2427 C CG    . ARG D 4 39  ? 10.159  25.728 83.090  1.00 47.05  ? 39  ARG B CG    1 
ATOM   2428 C CD    . ARG D 4 39  ? 8.775   25.690 83.700  1.00 54.49  ? 39  ARG B CD    1 
ATOM   2429 N NE    . ARG D 4 39  ? 7.759   25.168 82.788  1.00 59.68  ? 39  ARG B NE    1 
ATOM   2430 C CZ    . ARG D 4 39  ? 7.134   25.889 81.861  1.00 63.47  ? 39  ARG B CZ    1 
ATOM   2431 N NH1   . ARG D 4 39  ? 6.225   25.316 81.078  1.00 66.18  ? 39  ARG B NH1   1 
ATOM   2432 N NH2   . ARG D 4 39  ? 7.410   27.180 81.719  1.00 65.20  ? 39  ARG B NH2   1 
ATOM   2433 N N     . VAL D 4 40  ? 10.424  28.726 86.231  1.00 22.92  ? 40  VAL B N     1 
ATOM   2434 C CA    . VAL D 4 40  ? 9.519   29.212 87.275  1.00 20.56  ? 40  VAL B CA    1 
ATOM   2435 C C     . VAL D 4 40  ? 9.091   30.636 86.935  1.00 20.51  ? 40  VAL B C     1 
ATOM   2436 O O     . VAL D 4 40  ? 7.931   31.009 87.101  1.00 21.35  ? 40  VAL B O     1 
ATOM   2437 C CB    . VAL D 4 40  ? 10.196  29.194 88.679  1.00 22.46  ? 40  VAL B CB    1 
ATOM   2438 C CG1   . VAL D 4 40  ? 9.335   29.925 89.694  1.00 21.36  ? 40  VAL B CG1   1 
ATOM   2439 C CG2   . VAL D 4 40  ? 10.396  27.757 89.149  1.00 21.13  ? 40  VAL B CG2   1 
ATOM   2440 N N     . LEU D 4 41  ? 10.040  31.427 86.449  1.00 22.36  ? 41  LEU B N     1 
ATOM   2441 C CA    . LEU D 4 41  ? 9.794   32.809 86.058  1.00 20.45  ? 41  LEU B CA    1 
ATOM   2442 C C     . LEU D 4 41  ? 8.778   32.899 84.907  1.00 19.85  ? 41  LEU B C     1 
ATOM   2443 O O     . LEU D 4 41  ? 7.947   33.801 84.871  1.00 19.60  ? 41  LEU B O     1 
ATOM   2444 C CB    . LEU D 4 41  ? 11.115  33.439 85.638  1.00 20.79  ? 41  LEU B CB    1 
ATOM   2445 C CG    . LEU D 4 41  ? 11.815  34.469 86.528  1.00 23.38  ? 41  LEU B CG    1 
ATOM   2446 C CD1   . LEU D 4 41  ? 11.417  34.341 87.984  1.00 23.80  ? 41  LEU B CD1   1 
ATOM   2447 C CD2   . LEU D 4 41  ? 13.312  34.298 86.341  1.00 23.26  ? 41  LEU B CD2   1 
ATOM   2448 N N     . GLU D 4 42  ? 8.854   31.957 83.970  1.00 20.23  ? 42  GLU B N     1 
ATOM   2449 C CA    . GLU D 4 42  ? 7.954   31.917 82.824  1.00 19.45  ? 42  GLU B CA    1 
ATOM   2450 C C     . GLU D 4 42  ? 6.550   31.472 83.220  1.00 20.17  ? 42  GLU B C     1 
ATOM   2451 O O     . GLU D 4 42  ? 5.568   31.840 82.576  1.00 20.78  ? 42  GLU B O     1 
ATOM   2452 C CB    . GLU D 4 42  ? 8.537   30.991 81.772  1.00 18.39  ? 42  GLU B CB    1 
ATOM   2453 C CG    . GLU D 4 42  ? 9.976   31.354 81.485  1.00 19.80  ? 42  GLU B CG    1 
ATOM   2454 C CD    . GLU D 4 42  ? 10.660  30.404 80.549  1.00 20.41  ? 42  GLU B CD    1 
ATOM   2455 O OE1   . GLU D 4 42  ? 10.322  29.207 80.557  1.00 20.18  ? 42  GLU B OE1   1 
ATOM   2456 O OE2   . GLU D 4 42  ? 11.557  30.854 79.818  1.00 23.97  ? 42  GLU B OE2   1 
ATOM   2457 N N     . THR D 4 43  ? 6.454   30.670 84.271  1.00 20.62  ? 43  THR B N     1 
ATOM   2458 C CA    . THR D 4 43  ? 5.156   30.238 84.763  1.00 21.05  ? 43  THR B CA    1 
ATOM   2459 C C     . THR D 4 43  ? 4.582   31.440 85.512  1.00 21.55  ? 43  THR B C     1 
ATOM   2460 O O     . THR D 4 43  ? 3.385   31.728 85.450  1.00 24.14  ? 43  THR B O     1 
ATOM   2461 C CB    . THR D 4 43  ? 5.292   29.041 85.728  1.00 19.29  ? 43  THR B CB    1 
ATOM   2462 O OG1   . THR D 4 43  ? 5.729   27.888 84.995  1.00 20.74  ? 43  THR B OG1   1 
ATOM   2463 C CG2   . THR D 4 43  ? 3.965   28.738 86.391  1.00 14.86  ? 43  THR B CG2   1 
ATOM   2464 N N     . PHE D 4 44  ? 5.461   32.138 86.223  1.00 16.00  ? 44  PHE B N     1 
ATOM   2465 C CA    . PHE D 4 44  ? 5.084   33.319 86.971  1.00 16.12  ? 44  PHE B CA    1 
ATOM   2466 C C     . PHE D 4 44  ? 4.413   34.319 86.025  1.00 18.25  ? 44  PHE B C     1 
ATOM   2467 O O     . PHE D 4 44  ? 3.358   34.863 86.337  1.00 18.71  ? 44  PHE B O     1 
ATOM   2468 C CB    . PHE D 4 44  ? 6.335   33.945 87.603  1.00 22.49  ? 44  PHE B CB    1 
ATOM   2469 C CG    . PHE D 4 44  ? 6.121   35.340 88.137  1.00 21.61  ? 44  PHE B CG    1 
ATOM   2470 C CD1   . PHE D 4 44  ? 5.539   35.544 89.382  1.00 19.58  ? 44  PHE B CD1   1 
ATOM   2471 C CD2   . PHE D 4 44  ? 6.456   36.450 87.366  1.00 21.95  ? 44  PHE B CD2   1 
ATOM   2472 C CE1   . PHE D 4 44  ? 5.292   36.831 89.852  1.00 20.35  ? 44  PHE B CE1   1 
ATOM   2473 C CE2   . PHE D 4 44  ? 6.212   37.734 87.827  1.00 21.83  ? 44  PHE B CE2   1 
ATOM   2474 C CZ    . PHE D 4 44  ? 5.627   37.926 89.075  1.00 21.22  ? 44  PHE B CZ    1 
ATOM   2475 N N     . ASP D 4 45  ? 5.023   34.553 84.866  1.00 25.04  ? 45  ASP B N     1 
ATOM   2476 C CA    . ASP D 4 45  ? 4.476   35.499 83.902  1.00 27.54  ? 45  ASP B CA    1 
ATOM   2477 C C     . ASP D 4 45  ? 3.028   35.191 83.576  1.00 27.90  ? 45  ASP B C     1 
ATOM   2478 O O     . ASP D 4 45  ? 2.185   36.085 83.501  1.00 28.21  ? 45  ASP B O     1 
ATOM   2479 C CB    . ASP D 4 45  ? 5.290   35.487 82.612  1.00 30.66  ? 45  ASP B CB    1 
ATOM   2480 C CG    . ASP D 4 45  ? 6.726   35.917 82.827  1.00 34.90  ? 45  ASP B CG    1 
ATOM   2481 O OD1   . ASP D 4 45  ? 6.988   36.685 83.776  1.00 36.88  ? 45  ASP B OD1   1 
ATOM   2482 O OD2   . ASP D 4 45  ? 7.595   35.500 82.034  1.00 35.21  ? 45  ASP B OD2   1 
ATOM   2483 N N     . LYS D 4 46  ? 2.747   33.912 83.380  1.00 24.88  ? 46  LYS B N     1 
ATOM   2484 C CA    . LYS D 4 46  ? 1.407   33.467 83.053  1.00 23.05  ? 46  LYS B CA    1 
ATOM   2485 C C     . LYS D 4 46  ? 0.474   33.686 84.228  1.00 22.88  ? 46  LYS B C     1 
ATOM   2486 O O     . LYS D 4 46  ? -0.563  34.322 84.107  1.00 24.52  ? 46  LYS B O     1 
ATOM   2487 C CB    . LYS D 4 46  ? 1.450   31.990 82.680  1.00 24.65  ? 46  LYS B CB    1 
ATOM   2488 C CG    . LYS D 4 46  ? 0.105   31.348 82.440  1.00 26.07  ? 46  LYS B CG    1 
ATOM   2489 C CD    . LYS D 4 46  ? 0.296   29.932 81.929  1.00 28.02  ? 46  LYS B CD    1 
ATOM   2490 C CE    . LYS D 4 46  ? -1.026  29.203 81.871  1.00 32.30  ? 46  LYS B CE    1 
ATOM   2491 N NZ    . LYS D 4 46  ? -1.648  29.168 83.229  1.00 33.22  ? 46  LYS B NZ    1 
ATOM   2492 N N     . VAL D 4 47  ? 0.866   33.161 85.376  1.00 21.99  ? 47  VAL B N     1 
ATOM   2493 C CA    . VAL D 4 47  ? 0.064   33.268 86.575  1.00 21.30  ? 47  VAL B CA    1 
ATOM   2494 C C     . VAL D 4 47  ? -0.282  34.696 86.982  1.00 22.76  ? 47  VAL B C     1 
ATOM   2495 O O     . VAL D 4 47  ? -1.393  34.957 87.449  1.00 21.71  ? 47  VAL B O     1 
ATOM   2496 C CB    . VAL D 4 47  ? 0.763   32.551 87.728  1.00 14.58  ? 47  VAL B CB    1 
ATOM   2497 C CG1   . VAL D 4 47  ? -0.041  32.699 89.022  1.00 13.44  ? 47  VAL B CG1   1 
ATOM   2498 C CG2   . VAL D 4 47  ? 0.935   31.089 87.355  1.00 12.91  ? 47  VAL B CG2   1 
ATOM   2499 N N     . VAL D 4 48  ? 0.656   35.622 86.818  1.00 26.55  ? 48  VAL B N     1 
ATOM   2500 C CA    . VAL D 4 48  ? 0.380   37.006 87.177  1.00 29.45  ? 48  VAL B CA    1 
ATOM   2501 C C     . VAL D 4 48  ? -0.665  37.585 86.248  1.00 31.07  ? 48  VAL B C     1 
ATOM   2502 O O     . VAL D 4 48  ? -1.574  38.281 86.680  1.00 32.76  ? 48  VAL B O     1 
ATOM   2503 C CB    . VAL D 4 48  ? 1.601   37.890 87.052  1.00 33.22  ? 48  VAL B CB    1 
ATOM   2504 C CG1   . VAL D 4 48  ? 1.272   39.270 87.582  1.00 31.30  ? 48  VAL B CG1   1 
ATOM   2505 C CG2   . VAL D 4 48  ? 2.750   37.283 87.791  1.00 35.22  ? 48  VAL B CG2   1 
ATOM   2506 N N     . ALA D 4 49  ? -0.518  37.300 84.963  1.00 27.58  ? 49  ALA B N     1 
ATOM   2507 C CA    . ALA D 4 49  ? -1.445  37.794 83.964  1.00 28.64  ? 49  ALA B CA    1 
ATOM   2508 C C     . ALA D 4 49  ? -2.854  37.280 84.215  1.00 31.09  ? 49  ALA B C     1 
ATOM   2509 O O     . ALA D 4 49  ? -3.824  38.002 84.024  1.00 33.46  ? 49  ALA B O     1 
ATOM   2510 C CB    . ALA D 4 49  ? -0.986  37.375 82.591  1.00 11.73  ? 49  ALA B CB    1 
ATOM   2511 N N     . GLU D 4 50  ? -2.966  36.033 84.649  1.00 34.66  ? 50  GLU B N     1 
ATOM   2512 C CA    . GLU D 4 50  ? -4.272  35.443 84.902  1.00 36.56  ? 50  GLU B CA    1 
ATOM   2513 C C     . GLU D 4 50  ? -4.836  35.897 86.241  1.00 34.20  ? 50  GLU B C     1 
ATOM   2514 O O     . GLU D 4 50  ? -6.028  36.129 86.367  1.00 34.96  ? 50  GLU B O     1 
ATOM   2515 C CB    . GLU D 4 50  ? -4.181  33.913 84.858  1.00 53.61  ? 50  GLU B CB    1 
ATOM   2516 C CG    . GLU D 4 50  ? -3.380  33.389 83.672  1.00 60.76  ? 50  GLU B CG    1 
ATOM   2517 C CD    . GLU D 4 50  ? -3.524  31.891 83.460  1.00 65.78  ? 50  GLU B CD    1 
ATOM   2518 O OE1   . GLU D 4 50  ? -3.377  31.126 84.438  1.00 66.61  ? 50  GLU B OE1   1 
ATOM   2519 O OE2   . GLU D 4 50  ? -3.775  31.478 82.304  1.00 67.57  ? 50  GLU B OE2   1 
ATOM   2520 N N     . THR D 4 51  ? -3.980  36.040 87.241  1.00 37.12  ? 51  THR B N     1 
ATOM   2521 C CA    . THR D 4 51  ? -4.449  36.459 88.551  1.00 36.90  ? 51  THR B CA    1 
ATOM   2522 C C     . THR D 4 51  ? -4.925  37.912 88.516  1.00 37.19  ? 51  THR B C     1 
ATOM   2523 O O     . THR D 4 51  ? -5.929  38.252 89.133  1.00 38.48  ? 51  THR B O     1 
ATOM   2524 C CB    . THR D 4 51  ? -3.341  36.298 89.619  1.00 29.70  ? 51  THR B CB    1 
ATOM   2525 O OG1   . THR D 4 51  ? -2.817  34.964 89.561  1.00 29.91  ? 51  THR B OG1   1 
ATOM   2526 C CG2   . THR D 4 51  ? -3.894  36.553 91.010  1.00 28.56  ? 51  THR B CG2   1 
ATOM   2527 N N     . LEU D 4 52  ? -4.212  38.771 87.795  1.00 49.69  ? 52  LEU B N     1 
ATOM   2528 C CA    . LEU D 4 52  ? -4.603  40.175 87.706  1.00 47.83  ? 52  LEU B CA    1 
ATOM   2529 C C     . LEU D 4 52  ? -5.870  40.324 86.884  1.00 50.43  ? 52  LEU B C     1 
ATOM   2530 O O     . LEU D 4 52  ? -6.626  41.270 87.063  1.00 52.12  ? 52  LEU B O     1 
ATOM   2531 C CB    . LEU D 4 52  ? -3.498  41.011 87.062  1.00 22.30  ? 52  LEU B CB    1 
ATOM   2532 C CG    . LEU D 4 52  ? -2.236  41.276 87.884  1.00 19.39  ? 52  LEU B CG    1 
ATOM   2533 C CD1   . LEU D 4 52  ? -1.167  41.848 86.959  1.00 19.70  ? 52  LEU B CD1   1 
ATOM   2534 C CD2   . LEU D 4 52  ? -2.539  42.227 89.043  1.00 16.85  ? 52  LEU B CD2   1 
ATOM   2535 N N     . LYS D 4 53  ? -6.099  39.387 85.975  1.00 42.37  ? 53  LYS B N     1 
ATOM   2536 C CA    . LYS D 4 53  ? -7.275  39.440 85.129  1.00 43.11  ? 53  LYS B CA    1 
ATOM   2537 C C     . LYS D 4 53  ? -8.530  38.912 85.815  1.00 43.94  ? 53  LYS B C     1 
ATOM   2538 O O     . LYS D 4 53  ? -9.620  39.434 85.598  1.00 44.21  ? 53  LYS B O     1 
ATOM   2539 C CB    . LYS D 4 53  ? -7.026  38.649 83.846  1.00 37.47  ? 53  LYS B CB    1 
ATOM   2540 C CG    . LYS D 4 53  ? -8.229  38.583 82.927  1.00 41.27  ? 53  LYS B CG    1 
ATOM   2541 C CD    . LYS D 4 53  ? -7.916  37.847 81.628  1.00 46.23  ? 53  LYS B CD    1 
ATOM   2542 C CE    . LYS D 4 53  ? -6.928  38.629 80.759  1.00 50.31  ? 53  LYS B CE    1 
ATOM   2543 N NZ    . LYS D 4 53  ? -6.593  37.917 79.484  1.00 53.88  ? 53  LYS B NZ    1 
ATOM   2544 N N     . ASP D 4 54  ? -8.379  37.892 86.654  1.00 39.93  ? 54  ASP B N     1 
ATOM   2545 C CA    . ASP D 4 54  ? -9.528  37.293 87.319  1.00 40.77  ? 54  ASP B CA    1 
ATOM   2546 C C     . ASP D 4 54  ? -9.752  37.605 88.796  1.00 41.63  ? 54  ASP B C     1 
ATOM   2547 O O     . ASP D 4 54  ? -10.822 37.306 89.319  1.00 42.99  ? 54  ASP B O     1 
ATOM   2548 C CB    . ASP D 4 54  ? -9.493  35.775 87.143  1.00 59.63  ? 54  ASP B CB    1 
ATOM   2549 C CG    . ASP D 4 54  ? -9.469  35.354 85.685  1.00 62.73  ? 54  ASP B CG    1 
ATOM   2550 O OD1   . ASP D 4 54  ? -10.191 35.976 84.877  1.00 63.82  ? 54  ASP B OD1   1 
ATOM   2551 O OD2   . ASP D 4 54  ? -8.740  34.394 85.347  1.00 63.94  ? 54  ASP B OD2   1 
ATOM   2552 N N     . ASN D 4 55  ? -8.772  38.189 89.479  1.00 35.44  ? 55  ASN B N     1 
ATOM   2553 C CA    . ASN D 4 55  ? -8.939  38.496 90.905  1.00 35.88  ? 55  ASN B CA    1 
ATOM   2554 C C     . ASN D 4 55  ? -8.641  39.954 91.242  1.00 37.85  ? 55  ASN B C     1 
ATOM   2555 O O     . ASN D 4 55  ? -8.219  40.274 92.355  1.00 37.71  ? 55  ASN B O     1 
ATOM   2556 C CB    . ASN D 4 55  ? -8.043  37.592 91.759  1.00 34.22  ? 55  ASN B CB    1 
ATOM   2557 C CG    . ASN D 4 55  ? -8.244  36.128 91.459  1.00 33.19  ? 55  ASN B CG    1 
ATOM   2558 O OD1   . ASN D 4 55  ? -7.750  35.612 90.457  1.00 33.66  ? 55  ASN B OD1   1 
ATOM   2559 N ND2   . ASN D 4 55  ? -8.988  35.447 92.320  1.00 35.18  ? 55  ASN B ND2   1 
ATOM   2560 N N     . THR D 4 56  ? -8.861  40.829 90.273  1.00 42.65  ? 56  THR B N     1 
ATOM   2561 C CA    . THR D 4 56  ? -8.621  42.247 90.454  1.00 44.81  ? 56  THR B CA    1 
ATOM   2562 C C     . THR D 4 56  ? -9.976  42.943 90.286  1.00 46.97  ? 56  THR B C     1 
ATOM   2563 O O     . THR D 4 56  ? -10.745 42.606 89.383  1.00 46.51  ? 56  THR B O     1 
ATOM   2564 C CB    . THR D 4 56  ? -7.603  42.746 89.406  1.00 51.27  ? 56  THR B CB    1 
ATOM   2565 O OG1   . THR D 4 56  ? -6.931  43.903 89.906  1.00 55.13  ? 56  THR B OG1   1 
ATOM   2566 C CG2   . THR D 4 56  ? -8.295  43.091 88.103  1.00 51.18  ? 56  THR B CG2   1 
ATOM   2567 N N     . GLN D 4 57  ? -10.277 43.896 91.162  1.00 43.88  ? 57  GLN B N     1 
ATOM   2568 C CA    . GLN D 4 57  ? -11.556 44.599 91.102  1.00 46.87  ? 57  GLN B CA    1 
ATOM   2569 C C     . GLN D 4 57  ? -11.353 46.113 91.120  1.00 45.91  ? 57  GLN B C     1 
ATOM   2570 O O     . GLN D 4 57  ? -12.090 46.856 90.466  1.00 44.65  ? 57  GLN B O     1 
ATOM   2571 C CB    . GLN D 4 57  ? -12.424 44.180 92.292  1.00 79.14  ? 57  GLN B CB    1 
ATOM   2572 C CG    . GLN D 4 57  ? -13.914 44.366 92.090  1.00 84.95  ? 57  GLN B CG    1 
ATOM   2573 C CD    . GLN D 4 57  ? -14.486 43.402 91.066  1.00 88.09  ? 57  GLN B CD    1 
ATOM   2574 O OE1   . GLN D 4 57  ? -15.690 43.392 90.810  1.00 88.09  ? 57  GLN B OE1   1 
ATOM   2575 N NE2   . GLN D 4 57  ? -13.623 42.583 90.477  1.00 88.09  ? 57  GLN B NE2   1 
ATOM   2576 N N     . SER D 4 58  ? -10.347 46.556 91.872  1.00 37.59  ? 58  SER B N     1 
ATOM   2577 C CA    . SER D 4 58  ? -10.025 47.972 92.001  1.00 37.13  ? 58  SER B CA    1 
ATOM   2578 C C     . SER D 4 58  ? -9.876  48.653 90.649  1.00 37.40  ? 58  SER B C     1 
ATOM   2579 O O     . SER D 4 58  ? -9.620  48.007 89.633  1.00 35.94  ? 58  SER B O     1 
ATOM   2580 C CB    . SER D 4 58  ? -8.727  48.153 92.789  1.00 46.00  ? 58  SER B CB    1 
ATOM   2581 O OG    . SER D 4 58  ? -8.818  47.572 94.076  1.00 47.81  ? 58  SER B OG    1 
ATOM   2582 N N     . LYS D 4 59  ? -10.053 49.967 90.648  1.00 58.11  ? 59  LYS B N     1 
ATOM   2583 C CA    . LYS D 4 59  ? -9.925  50.766 89.441  1.00 59.30  ? 59  LYS B CA    1 
ATOM   2584 C C     . LYS D 4 59  ? -9.382  52.109 89.887  1.00 57.45  ? 59  LYS B C     1 
ATOM   2585 O O     . LYS D 4 59  ? -10.097 52.904 90.487  1.00 58.12  ? 59  LYS B O     1 
ATOM   2586 C CB    . LYS D 4 59  ? -11.285 50.948 88.756  1.00 76.80  ? 59  LYS B CB    1 
ATOM   2587 C CG    . LYS D 4 59  ? -11.873 49.668 88.159  1.00 82.33  ? 59  LYS B CG    1 
ATOM   2588 C CD    . LYS D 4 59  ? -13.258 49.922 87.572  1.00 85.72  ? 59  LYS B CD    1 
ATOM   2589 C CE    . LYS D 4 59  ? -13.927 48.633 87.118  1.00 88.35  ? 59  LYS B CE    1 
ATOM   2590 N NZ    . LYS D 4 59  ? -15.345 48.867 86.714  1.00 88.35  ? 59  LYS B NZ    1 
ATOM   2591 N N     . LEU D 4 60  ? -8.106  52.357 89.623  1.00 48.88  ? 60  LEU B N     1 
ATOM   2592 C CA    . LEU D 4 60  ? -7.527  53.618 90.031  1.00 47.94  ? 60  LEU B CA    1 
ATOM   2593 C C     . LEU D 4 60  ? -7.383  54.552 88.845  1.00 46.29  ? 60  LEU B C     1 
ATOM   2594 O O     . LEU D 4 60  ? -7.586  54.156 87.693  1.00 46.21  ? 60  LEU B O     1 
ATOM   2595 C CB    . LEU D 4 60  ? -6.178  53.385 90.717  1.00 51.96  ? 60  LEU B CB    1 
ATOM   2596 C CG    . LEU D 4 60  ? -4.994  52.804 89.954  1.00 52.30  ? 60  LEU B CG    1 
ATOM   2597 C CD1   . LEU D 4 60  ? -4.399  53.860 89.037  1.00 52.91  ? 60  LEU B CD1   1 
ATOM   2598 C CD2   . LEU D 4 60  ? -3.946  52.358 90.947  1.00 53.20  ? 60  LEU B CD2   1 
ATOM   2599 N N     . THR D 4 61  ? -7.056  55.805 89.129  1.00 45.52  ? 61  THR B N     1 
ATOM   2600 C CA    . THR D 4 61  ? -6.888  56.785 88.072  1.00 43.59  ? 61  THR B CA    1 
ATOM   2601 C C     . THR D 4 61  ? -5.716  57.691 88.416  1.00 42.08  ? 61  THR B C     1 
ATOM   2602 O O     . THR D 4 61  ? -5.480  58.004 89.585  1.00 41.86  ? 61  THR B O     1 
ATOM   2603 C CB    . THR D 4 61  ? -8.141  57.653 87.907  1.00 46.21  ? 61  THR B CB    1 
ATOM   2604 O OG1   . THR D 4 61  ? -8.207  58.585 88.990  1.00 46.41  ? 61  THR B OG1   1 
ATOM   2605 C CG2   . THR D 4 61  ? -9.404  56.787 87.895  1.00 45.03  ? 61  THR B CG2   1 
ATOM   2606 N N     . VAL D 4 62  ? -4.990  58.105 87.382  1.00 34.48  ? 62  VAL B N     1 
ATOM   2607 C CA    . VAL D 4 62  ? -3.836  58.971 87.540  1.00 32.25  ? 62  VAL B CA    1 
ATOM   2608 C C     . VAL D 4 62  ? -4.020  60.284 86.769  1.00 32.52  ? 62  VAL B C     1 
ATOM   2609 O O     . VAL D 4 62  ? -4.394  60.281 85.593  1.00 32.41  ? 62  VAL B O     1 
ATOM   2610 C CB    . VAL D 4 62  ? -2.560  58.260 87.031  1.00 32.24  ? 62  VAL B CB    1 
ATOM   2611 C CG1   . VAL D 4 62  ? -1.329  59.085 87.363  1.00 31.68  ? 62  VAL B CG1   1 
ATOM   2612 C CG2   . VAL D 4 62  ? -2.466  56.872 87.643  1.00 30.64  ? 62  VAL B CG2   1 
ATOM   2613 N N     . LYS D 4 63  ? -3.775  61.402 87.445  1.00 31.53  ? 63  LYS B N     1 
ATOM   2614 C CA    . LYS D 4 63  ? -3.878  62.720 86.825  1.00 32.02  ? 63  LYS B CA    1 
ATOM   2615 C C     . LYS D 4 63  ? -2.625  63.495 87.170  1.00 31.53  ? 63  LYS B C     1 
ATOM   2616 O O     . LYS D 4 63  ? -2.268  63.606 88.333  1.00 32.12  ? 63  LYS B O     1 
ATOM   2617 C CB    . LYS D 4 63  ? -5.106  63.473 87.333  1.00 44.85  ? 63  LYS B CB    1 
ATOM   2618 C CG    . LYS D 4 63  ? -6.407  62.832 86.907  1.00 48.79  ? 63  LYS B CG    1 
ATOM   2619 C CD    . LYS D 4 63  ? -7.575  63.779 87.059  1.00 50.12  ? 63  LYS B CD    1 
ATOM   2620 C CE    . LYS D 4 63  ? -8.865  63.140 86.571  1.00 51.39  ? 63  LYS B CE    1 
ATOM   2621 N NZ    . LYS D 4 63  ? -10.005 64.102 86.615  1.00 54.92  ? 63  LYS B NZ    1 
ATOM   2622 N N     . GLY D 4 64  ? -1.951  64.026 86.159  1.00 21.72  ? 64  GLY B N     1 
ATOM   2623 C CA    . GLY D 4 64  ? -0.730  64.768 86.414  1.00 24.17  ? 64  GLY B CA    1 
ATOM   2624 C C     . GLY D 4 64  ? -0.102  65.280 85.138  1.00 25.38  ? 64  GLY B C     1 
ATOM   2625 O O     . GLY D 4 64  ? -0.761  65.349 84.107  1.00 26.15  ? 64  GLY B O     1 
ATOM   2626 N N     . ASN D 4 65  ? 1.172   65.642 85.201  1.00 45.35  ? 65  ASN B N     1 
ATOM   2627 C CA    . ASN D 4 65  ? 1.857   66.152 84.029  1.00 47.79  ? 65  ASN B CA    1 
ATOM   2628 C C     . ASN D 4 65  ? 2.728   65.076 83.423  1.00 46.88  ? 65  ASN B C     1 
ATOM   2629 O O     . ASN D 4 65  ? 3.599   64.530 84.099  1.00 48.67  ? 65  ASN B O     1 
ATOM   2630 C CB    . ASN D 4 65  ? 2.721   67.356 84.400  1.00 77.72  ? 65  ASN B CB    1 
ATOM   2631 C CG    . ASN D 4 65  ? 1.910   68.502 84.962  1.00 83.73  ? 65  ASN B CG    1 
ATOM   2632 O OD1   . ASN D 4 65  ? 1.433   68.446 86.100  1.00 84.76  ? 65  ASN B OD1   1 
ATOM   2633 N ND2   . ASN D 4 65  ? 1.737   69.550 84.163  1.00 84.76  ? 65  ASN B ND2   1 
ATOM   2634 N N     . LEU D 4 66  ? 2.486   64.765 82.152  1.00 31.78  ? 66  LEU B N     1 
ATOM   2635 C CA    . LEU D 4 66  ? 3.273   63.760 81.443  1.00 28.05  ? 66  LEU B CA    1 
ATOM   2636 C C     . LEU D 4 66  ? 4.654   64.360 81.161  1.00 27.72  ? 66  LEU B C     1 
ATOM   2637 O O     . LEU D 4 66  ? 4.787   65.247 80.324  1.00 26.98  ? 66  LEU B O     1 
ATOM   2638 C CB    . LEU D 4 66  ? 2.609   63.398 80.115  1.00 26.75  ? 66  LEU B CB    1 
ATOM   2639 C CG    . LEU D 4 66  ? 2.759   61.985 79.534  1.00 23.60  ? 66  LEU B CG    1 
ATOM   2640 C CD1   . LEU D 4 66  ? 2.716   62.088 78.021  1.00 22.94  ? 66  LEU B CD1   1 
ATOM   2641 C CD2   . LEU D 4 66  ? 4.055   61.339 79.972  1.00 23.69  ? 66  LEU B CD2   1 
ATOM   2642 N N     . ASP D 4 67  ? 5.677   63.877 81.860  1.00 41.64  ? 67  ASP B N     1 
ATOM   2643 C CA    . ASP D 4 67  ? 7.029   64.387 81.686  1.00 42.10  ? 67  ASP B CA    1 
ATOM   2644 C C     . ASP D 4 67  ? 7.708   63.777 80.466  1.00 41.73  ? 67  ASP B C     1 
ATOM   2645 O O     . ASP D 4 67  ? 8.413   64.464 79.725  1.00 43.04  ? 67  ASP B O     1 
ATOM   2646 C CB    . ASP D 4 67  ? 7.863   64.096 82.933  1.00 41.57  ? 67  ASP B CB    1 
ATOM   2647 C CG    . ASP D 4 67  ? 9.239   64.727 82.874  1.00 43.82  ? 67  ASP B CG    1 
ATOM   2648 O OD1   . ASP D 4 67  ? 9.326   65.973 82.910  1.00 46.19  ? 67  ASP B OD1   1 
ATOM   2649 O OD2   . ASP D 4 67  ? 10.235  63.980 82.790  1.00 43.98  ? 67  ASP B OD2   1 
ATOM   2650 N N     . THR D 4 68  ? 7.500   62.482 80.266  1.00 34.71  ? 68  THR B N     1 
ATOM   2651 C CA    . THR D 4 68  ? 8.087   61.773 79.137  1.00 33.13  ? 68  THR B CA    1 
ATOM   2652 C C     . THR D 4 68  ? 7.174   60.640 78.718  1.00 32.07  ? 68  THR B C     1 
ATOM   2653 O O     . THR D 4 68  ? 6.476   60.058 79.541  1.00 32.69  ? 68  THR B O     1 
ATOM   2654 C CB    . THR D 4 68  ? 9.466   61.155 79.493  1.00 36.94  ? 68  THR B CB    1 
ATOM   2655 O OG1   . THR D 4 68  ? 10.406  62.199 79.765  1.00 37.49  ? 68  THR B OG1   1 
ATOM   2656 C CG2   . THR D 4 68  ? 9.994   60.301 78.337  1.00 36.96  ? 68  THR B CG2   1 
ATOM   2657 N N     . TYR D 4 69  ? 7.172   60.340 77.430  1.00 33.42  ? 69  TYR B N     1 
ATOM   2658 C CA    . TYR D 4 69  ? 6.383   59.241 76.923  1.00 32.45  ? 69  TYR B CA    1 
ATOM   2659 C C     . TYR D 4 69  ? 7.292   58.536 75.928  1.00 32.91  ? 69  TYR B C     1 
ATOM   2660 O O     . TYR D 4 69  ? 8.327   59.077 75.524  1.00 32.56  ? 69  TYR B O     1 
ATOM   2661 C CB    . TYR D 4 69  ? 5.104   59.744 76.252  1.00 29.31  ? 69  TYR B CB    1 
ATOM   2662 C CG    . TYR D 4 69  ? 5.320   60.515 74.972  1.00 29.84  ? 69  TYR B CG    1 
ATOM   2663 C CD1   . TYR D 4 69  ? 5.615   59.854 73.779  1.00 28.84  ? 69  TYR B CD1   1 
ATOM   2664 C CD2   . TYR D 4 69  ? 5.237   61.911 74.957  1.00 29.13  ? 69  TYR B CD2   1 
ATOM   2665 C CE1   . TYR D 4 69  ? 5.823   60.564 72.601  1.00 31.86  ? 69  TYR B CE1   1 
ATOM   2666 C CE2   . TYR D 4 69  ? 5.444   62.636 73.786  1.00 29.65  ? 69  TYR B CE2   1 
ATOM   2667 C CZ    . TYR D 4 69  ? 5.737   61.960 72.609  1.00 32.36  ? 69  TYR B CZ    1 
ATOM   2668 O OH    . TYR D 4 69  ? 5.949   62.673 71.441  1.00 33.44  ? 69  TYR B OH    1 
ATOM   2669 N N     . GLY D 4 70  ? 6.921   57.319 75.555  1.00 25.59  ? 70  GLY B N     1 
ATOM   2670 C CA    . GLY D 4 70  ? 7.722   56.567 74.615  1.00 23.22  ? 70  GLY B CA    1 
ATOM   2671 C C     . GLY D 4 70  ? 6.950   55.362 74.150  1.00 22.84  ? 70  GLY B C     1 
ATOM   2672 O O     . GLY D 4 70  ? 6.193   54.759 74.908  1.00 22.73  ? 70  GLY B O     1 
ATOM   2673 N N     . PHE D 4 71  ? 7.120   55.018 72.888  1.00 23.14  ? 71  PHE B N     1 
ATOM   2674 C CA    . PHE D 4 71  ? 6.437   53.865 72.358  1.00 24.44  ? 71  PHE B CA    1 
ATOM   2675 C C     . PHE D 4 71  ? 7.345   53.133 71.401  1.00 27.20  ? 71  PHE B C     1 
ATOM   2676 O O     . PHE D 4 71  ? 7.674   53.627 70.322  1.00 26.95  ? 71  PHE B O     1 
ATOM   2677 C CB    . PHE D 4 71  ? 5.153   54.264 71.641  1.00 25.02  ? 71  PHE B CB    1 
ATOM   2678 C CG    . PHE D 4 71  ? 4.468   53.122 70.984  1.00 24.11  ? 71  PHE B CG    1 
ATOM   2679 C CD1   . PHE D 4 71  ? 4.640   52.882 69.632  1.00 25.49  ? 71  PHE B CD1   1 
ATOM   2680 C CD2   . PHE D 4 71  ? 3.704   52.237 71.736  1.00 24.01  ? 71  PHE B CD2   1 
ATOM   2681 C CE1   . PHE D 4 71  ? 4.062   51.765 69.026  1.00 28.51  ? 71  PHE B CE1   1 
ATOM   2682 C CE2   . PHE D 4 71  ? 3.120   51.124 71.156  1.00 23.92  ? 71  PHE B CE2   1 
ATOM   2683 C CZ    . PHE D 4 71  ? 3.299   50.881 69.791  1.00 27.23  ? 71  PHE B CZ    1 
ATOM   2684 N N     . CYS D 4 72  ? 7.766   51.948 71.807  1.00 30.57  ? 72  CYS B N     1 
ATOM   2685 C CA    . CYS D 4 72  ? 8.624   51.161 70.960  1.00 31.72  ? 72  CYS B CA    1 
ATOM   2686 C C     . CYS D 4 72  ? 8.303   49.710 71.240  1.00 33.32  ? 72  CYS B C     1 
ATOM   2687 O O     . CYS D 4 72  ? 7.982   49.350 72.367  1.00 34.82  ? 72  CYS B O     1 
ATOM   2688 C CB    . CYS D 4 72  ? 10.086  51.470 71.269  1.00 34.58  ? 72  CYS B CB    1 
ATOM   2689 S SG    . CYS D 4 72  ? 11.181  51.179 69.881  1.00 36.34  ? 72  CYS B SG    1 
ATOM   2690 N N     . ASP D 4 73  ? 8.351   48.886 70.202  1.00 30.54  ? 73  ASP B N     1 
ATOM   2691 C CA    . ASP D 4 73  ? 8.092   47.460 70.342  1.00 32.32  ? 73  ASP B CA    1 
ATOM   2692 C C     . ASP D 4 73  ? 6.762   47.136 70.988  1.00 32.00  ? 73  ASP B C     1 
ATOM   2693 O O     . ASP D 4 73  ? 6.676   46.200 71.778  1.00 31.69  ? 73  ASP B O     1 
ATOM   2694 C CB    . ASP D 4 73  ? 9.200   46.788 71.159  1.00 70.24  ? 73  ASP B CB    1 
ATOM   2695 C CG    . ASP D 4 73  ? 10.565  46.928 70.521  1.00 73.90  ? 73  ASP B CG    1 
ATOM   2696 O OD1   . ASP D 4 73  ? 10.680  46.649 69.305  1.00 75.29  ? 73  ASP B OD1   1 
ATOM   2697 O OD2   . ASP D 4 73  ? 11.520  47.308 71.239  1.00 74.41  ? 73  ASP B OD2   1 
ATOM   2698 N N     . ASP D 4 74  ? 5.733   47.913 70.672  1.00 36.66  ? 74  ASP B N     1 
ATOM   2699 C CA    . ASP D 4 74  ? 4.399   47.654 71.211  1.00 37.17  ? 74  ASP B CA    1 
ATOM   2700 C C     . ASP D 4 74  ? 4.328   47.853 72.727  1.00 33.43  ? 74  ASP B C     1 
ATOM   2701 O O     . ASP D 4 74  ? 3.510   47.241 73.410  1.00 32.97  ? 74  ASP B O     1 
ATOM   2702 C CB    . ASP D 4 74  ? 3.988   46.227 70.843  1.00 79.97  ? 74  ASP B CB    1 
ATOM   2703 C CG    . ASP D 4 74  ? 2.495   46.036 70.815  1.00 86.40  ? 74  ASP B CG    1 
ATOM   2704 O OD1   . ASP D 4 74  ? 1.817   46.776 70.069  1.00 87.58  ? 74  ASP B OD1   1 
ATOM   2705 O OD2   . ASP D 4 74  ? 2.004   45.139 71.533  1.00 89.84  ? 74  ASP B OD2   1 
ATOM   2706 N N     . VAL D 4 75  ? 5.190   48.721 73.242  1.00 30.37  ? 75  VAL B N     1 
ATOM   2707 C CA    . VAL D 4 75  ? 5.243   49.019 74.670  1.00 27.01  ? 75  VAL B CA    1 
ATOM   2708 C C     . VAL D 4 75  ? 5.153   50.536 74.910  1.00 25.90  ? 75  VAL B C     1 
ATOM   2709 O O     . VAL D 4 75  ? 5.826   51.328 74.243  1.00 25.43  ? 75  VAL B O     1 
ATOM   2710 C CB    . VAL D 4 75  ? 6.576   48.482 75.304  1.00 20.91  ? 75  VAL B CB    1 
ATOM   2711 C CG1   . VAL D 4 75  ? 6.789   49.058 76.702  1.00 19.57  ? 75  VAL B CG1   1 
ATOM   2712 C CG2   . VAL D 4 75  ? 6.540   46.989 75.387  1.00 18.88  ? 75  VAL B CG2   1 
ATOM   2713 N N     . TRP D 4 76  ? 4.311   50.932 75.855  1.00 21.00  ? 76  TRP B N     1 
ATOM   2714 C CA    . TRP D 4 76  ? 4.172   52.338 76.192  1.00 20.80  ? 76  TRP B CA    1 
ATOM   2715 C C     . TRP D 4 76  ? 4.870   52.613 77.513  1.00 21.12  ? 76  TRP B C     1 
ATOM   2716 O O     . TRP D 4 76  ? 4.735   51.849 78.472  1.00 19.65  ? 76  TRP B O     1 
ATOM   2717 C CB    . TRP D 4 76  ? 2.698   52.736 76.320  1.00 27.40  ? 76  TRP B CB    1 
ATOM   2718 C CG    . TRP D 4 76  ? 2.044   53.076 75.022  1.00 29.19  ? 76  TRP B CG    1 
ATOM   2719 C CD1   . TRP D 4 76  ? 1.176   52.296 74.310  1.00 28.83  ? 76  TRP B CD1   1 
ATOM   2720 C CD2   . TRP D 4 76  ? 2.228   54.277 74.255  1.00 29.96  ? 76  TRP B CD2   1 
ATOM   2721 N NE1   . TRP D 4 76  ? 0.810   52.934 73.147  1.00 29.93  ? 76  TRP B NE1   1 
ATOM   2722 C CE2   . TRP D 4 76  ? 1.440   54.152 73.087  1.00 29.74  ? 76  TRP B CE2   1 
ATOM   2723 C CE3   . TRP D 4 76  ? 2.984   55.444 74.438  1.00 30.58  ? 76  TRP B CE3   1 
ATOM   2724 C CZ2   . TRP D 4 76  ? 1.387   55.155 72.102  1.00 28.88  ? 76  TRP B CZ2   1 
ATOM   2725 C CZ3   . TRP D 4 76  ? 2.931   56.443 73.456  1.00 29.88  ? 76  TRP B CZ3   1 
ATOM   2726 C CH2   . TRP D 4 76  ? 2.137   56.287 72.306  1.00 28.75  ? 76  TRP B CH2   1 
ATOM   2727 N N     . THR D 4 77  ? 5.630   53.698 77.563  1.00 26.73  ? 77  THR B N     1 
ATOM   2728 C CA    . THR D 4 77  ? 6.306   54.067 78.792  1.00 28.28  ? 77  THR B CA    1 
ATOM   2729 C C     . THR D 4 77  ? 5.956   55.516 79.064  1.00 29.37  ? 77  THR B C     1 
ATOM   2730 O O     . THR D 4 77  ? 6.054   56.364 78.187  1.00 30.16  ? 77  THR B O     1 
ATOM   2731 C CB    . THR D 4 77  ? 7.826   53.920 78.678  1.00 29.11  ? 77  THR B CB    1 
ATOM   2732 O OG1   . THR D 4 77  ? 8.139   52.607 78.203  1.00 30.81  ? 77  THR B OG1   1 
ATOM   2733 C CG2   . THR D 4 77  ? 8.481   54.109 80.045  1.00 27.86  ? 77  THR B CG2   1 
ATOM   2734 N N     . PHE D 4 78  ? 5.536   55.789 80.287  1.00 28.66  ? 78  PHE B N     1 
ATOM   2735 C CA    . PHE D 4 78  ? 5.155   57.130 80.670  1.00 28.63  ? 78  PHE B CA    1 
ATOM   2736 C C     . PHE D 4 78  ? 5.746   57.518 82.011  1.00 29.62  ? 78  PHE B C     1 
ATOM   2737 O O     . PHE D 4 78  ? 5.769   56.715 82.936  1.00 30.08  ? 78  PHE B O     1 
ATOM   2738 C CB    . PHE D 4 78  ? 3.639   57.214 80.781  1.00 30.46  ? 78  PHE B CB    1 
ATOM   2739 C CG    . PHE D 4 78  ? 2.905   56.836 79.527  1.00 30.19  ? 78  PHE B CG    1 
ATOM   2740 C CD1   . PHE D 4 78  ? 3.016   57.610 78.375  1.00 29.21  ? 78  PHE B CD1   1 
ATOM   2741 C CD2   . PHE D 4 78  ? 2.048   55.739 79.519  1.00 29.00  ? 78  PHE B CD2   1 
ATOM   2742 C CE1   . PHE D 4 78  ? 2.277   57.301 77.236  1.00 29.81  ? 78  PHE B CE1   1 
ATOM   2743 C CE2   . PHE D 4 78  ? 1.306   55.424 78.380  1.00 30.08  ? 78  PHE B CE2   1 
ATOM   2744 C CZ    . PHE D 4 78  ? 1.419   56.206 77.240  1.00 29.09  ? 78  PHE B CZ    1 
ATOM   2745 N N     . ILE D 4 79  ? 6.233   58.746 82.117  1.00 32.33  ? 79  ILE B N     1 
ATOM   2746 C CA    . ILE D 4 79  ? 6.754   59.231 83.386  1.00 34.12  ? 79  ILE B CA    1 
ATOM   2747 C C     . ILE D 4 79  ? 5.841   60.384 83.767  1.00 34.28  ? 79  ILE B C     1 
ATOM   2748 O O     . ILE D 4 79  ? 5.884   61.438 83.145  1.00 34.45  ? 79  ILE B O     1 
ATOM   2749 C CB    . ILE D 4 79  ? 8.197   59.750 83.277  1.00 27.72  ? 79  ILE B CB    1 
ATOM   2750 C CG1   . ILE D 4 79  ? 9.147   58.594 82.965  1.00 27.61  ? 79  ILE B CG1   1 
ATOM   2751 C CG2   . ILE D 4 79  ? 8.610   60.406 84.591  1.00 27.67  ? 79  ILE B CG2   1 
ATOM   2752 C CD1   . ILE D 4 79  ? 10.600  58.998 82.958  1.00 28.90  ? 79  ILE B CD1   1 
ATOM   2753 N N     . VAL D 4 80  ? 4.992   60.169 84.766  1.00 42.30  ? 80  VAL B N     1 
ATOM   2754 C CA    . VAL D 4 80  ? 4.064   61.202 85.210  1.00 44.05  ? 80  VAL B CA    1 
ATOM   2755 C C     . VAL D 4 80  ? 4.604   61.868 86.469  1.00 45.36  ? 80  VAL B C     1 
ATOM   2756 O O     . VAL D 4 80  ? 4.893   61.198 87.461  1.00 46.00  ? 80  VAL B O     1 
ATOM   2757 C CB    . VAL D 4 80  ? 2.653   60.621 85.514  1.00 37.66  ? 80  VAL B CB    1 
ATOM   2758 C CG1   . VAL D 4 80  ? 1.719   61.727 85.959  1.00 37.61  ? 80  VAL B CG1   1 
ATOM   2759 C CG2   . VAL D 4 80  ? 2.083   59.948 84.285  1.00 37.30  ? 80  VAL B CG2   1 
ATOM   2760 N N     . LYS D 4 81  ? 4.746   63.189 86.418  1.00 35.56  ? 81  LYS B N     1 
ATOM   2761 C CA    . LYS D 4 81  ? 5.247   63.936 87.554  1.00 36.47  ? 81  LYS B CA    1 
ATOM   2762 C C     . LYS D 4 81  ? 4.148   64.783 88.171  1.00 39.38  ? 81  LYS B C     1 
ATOM   2763 O O     . LYS D 4 81  ? 3.206   65.189 87.491  1.00 39.87  ? 81  LYS B O     1 
ATOM   2764 C CB    . LYS D 4 81  ? 6.415   64.821 87.133  1.00 40.67  ? 81  LYS B CB    1 
ATOM   2765 C CG    . LYS D 4 81  ? 7.689   64.052 86.811  1.00 38.52  ? 81  LYS B CG    1 
ATOM   2766 C CD    . LYS D 4 81  ? 8.905   64.975 86.763  1.00 37.90  ? 81  LYS B CD    1 
ATOM   2767 C CE    . LYS D 4 81  ? 10.193  64.188 86.565  1.00 39.04  ? 81  LYS B CE    1 
ATOM   2768 N NZ    . LYS D 4 81  ? 11.422  65.026 86.678  1.00 39.51  ? 81  LYS B NZ    1 
ATOM   2769 N N     . ASN D 4 82  ? 4.278   65.023 89.474  1.00 46.25  ? 82  ASN B N     1 
ATOM   2770 C CA    . ASN D 4 82  ? 3.328   65.818 90.254  1.00 47.61  ? 82  ASN B CA    1 
ATOM   2771 C C     . ASN D 4 82  ? 1.894   65.454 89.935  1.00 47.68  ? 82  ASN B C     1 
ATOM   2772 O O     . ASN D 4 82  ? 1.125   66.273 89.429  1.00 46.79  ? 82  ASN B O     1 
ATOM   2773 C CB    . ASN D 4 82  ? 3.587   67.304 90.010  1.00 68.65  ? 82  ASN B CB    1 
ATOM   2774 C CG    . ASN D 4 82  ? 5.010   67.703 90.375  1.00 71.37  ? 82  ASN B CG    1 
ATOM   2775 O OD1   . ASN D 4 82  ? 5.390   67.707 91.552  1.00 70.79  ? 82  ASN B OD1   1 
ATOM   2776 N ND2   . ASN D 4 82  ? 5.811   68.020 89.363  1.00 72.68  ? 82  ASN B ND2   1 
ATOM   2777 N N     . CYS D 4 83  ? 1.543   64.214 90.261  1.00 49.98  ? 83  CYS B N     1 
ATOM   2778 C CA    . CYS D 4 83  ? 0.213   63.692 89.987  1.00 52.06  ? 83  CYS B CA    1 
ATOM   2779 C C     . CYS D 4 83  ? -0.581  63.220 91.201  1.00 51.34  ? 83  CYS B C     1 
ATOM   2780 O O     . CYS D 4 83  ? -0.042  63.033 92.290  1.00 49.73  ? 83  CYS B O     1 
ATOM   2781 C CB    . CYS D 4 83  ? 0.310   62.545 88.972  1.00 59.49  ? 83  CYS B CB    1 
ATOM   2782 S SG    . CYS D 4 83  ? 1.428   61.204 89.439  1.00 61.74  ? 83  CYS B SG    1 
ATOM   2783 N N     . GLN D 4 84  ? -1.876  63.028 90.971  1.00 37.67  ? 84  GLN B N     1 
ATOM   2784 C CA    . GLN D 4 84  ? -2.820  62.581 91.977  1.00 39.60  ? 84  GLN B CA    1 
ATOM   2785 C C     . GLN D 4 84  ? -3.301  61.191 91.605  1.00 38.13  ? 84  GLN B C     1 
ATOM   2786 O O     . GLN D 4 84  ? -3.996  61.011 90.598  1.00 38.29  ? 84  GLN B O     1 
ATOM   2787 C CB    . GLN D 4 84  ? -4.033  63.513 92.022  1.00 81.47  ? 84  GLN B CB    1 
ATOM   2788 C CG    . GLN D 4 84  ? -3.727  64.948 92.377  1.00 87.46  ? 84  GLN B CG    1 
ATOM   2789 C CD    . GLN D 4 84  ? -3.328  65.118 93.829  1.00 89.99  ? 84  GLN B CD    1 
ATOM   2790 O OE1   . GLN D 4 84  ? -3.095  66.235 94.292  1.00 89.99  ? 84  GLN B OE1   1 
ATOM   2791 N NE2   . GLN D 4 84  ? -3.249  64.009 94.557  1.00 89.99  ? 84  GLN B NE2   1 
ATOM   2792 N N     . VAL D 4 85  ? -2.938  60.207 92.415  1.00 44.19  ? 85  VAL B N     1 
ATOM   2793 C CA    . VAL D 4 85  ? -3.364  58.844 92.160  1.00 43.36  ? 85  VAL B CA    1 
ATOM   2794 C C     . VAL D 4 85  ? -4.495  58.544 93.120  1.00 43.99  ? 85  VAL B C     1 
ATOM   2795 O O     . VAL D 4 85  ? -4.330  58.634 94.329  1.00 44.52  ? 85  VAL B O     1 
ATOM   2796 C CB    . VAL D 4 85  ? -2.228  57.834 92.413  1.00 33.22  ? 85  VAL B CB    1 
ATOM   2797 C CG1   . VAL D 4 85  ? -2.634  56.460 91.890  1.00 31.89  ? 85  VAL B CG1   1 
ATOM   2798 C CG2   . VAL D 4 85  ? -0.938  58.321 91.761  1.00 32.10  ? 85  VAL B CG2   1 
ATOM   2799 N N     . THR D 4 86  ? -5.655  58.207 92.586  1.00 46.54  ? 86  THR B N     1 
ATOM   2800 C CA    . THR D 4 86  ? -6.783  57.891 93.440  1.00 50.03  ? 86  THR B CA    1 
ATOM   2801 C C     . THR D 4 86  ? -7.046  56.405 93.311  1.00 50.70  ? 86  THR B C     1 
ATOM   2802 O O     . THR D 4 86  ? -7.141  55.886 92.200  1.00 51.70  ? 86  THR B O     1 
ATOM   2803 C CB    . THR D 4 86  ? -8.033  58.665 93.015  1.00 67.84  ? 86  THR B CB    1 
ATOM   2804 O OG1   . THR D 4 86  ? -8.268  58.444 91.622  1.00 69.05  ? 86  THR B OG1   1 
ATOM   2805 C CG2   . THR D 4 86  ? -7.853  60.153 93.269  1.00 66.30  ? 86  THR B CG2   1 
ATOM   2806 N N     . VAL D 4 87  ? -7.160  55.721 94.444  1.00 68.97  ? 87  VAL B N     1 
ATOM   2807 C CA    . VAL D 4 87  ? -7.394  54.280 94.447  1.00 71.24  ? 87  VAL B CA    1 
ATOM   2808 C C     . VAL D 4 87  ? -8.858  53.972 94.785  1.00 74.19  ? 87  VAL B C     1 
ATOM   2809 O O     . VAL D 4 87  ? -9.692  54.874 94.818  1.00 74.97  ? 87  VAL B O     1 
ATOM   2810 C CB    . VAL D 4 87  ? -6.433  53.591 95.466  1.00 45.62  ? 87  VAL B CB    1 
ATOM   2811 C CG1   . VAL D 4 87  ? -6.540  52.073 95.384  1.00 45.60  ? 87  VAL B CG1   1 
ATOM   2812 C CG2   . VAL D 4 87  ? -4.999  54.018 95.182  1.00 45.48  ? 87  VAL B CG2   1 
ATOM   2813 N N     . GLU D 4 88  ? -9.161  52.694 95.006  1.00 61.58  ? 88  GLU B N     1 
ATOM   2814 C CA    . GLU D 4 88  ? -10.504 52.226 95.363  1.00 64.35  ? 88  GLU B CA    1 
ATOM   2815 C C     . GLU D 4 88  ? -11.443 52.113 94.171  1.00 64.74  ? 88  GLU B C     1 
ATOM   2816 O O     . GLU D 4 88  ? -11.951 51.027 93.887  1.00 63.61  ? 88  GLU B O     1 
ATOM   2817 C CB    . GLU D 4 88  ? -11.122 53.138 96.439  1.00 90.00  ? 88  GLU B CB    1 
ATOM   2818 C CG    . GLU D 4 88  ? -10.426 53.067 97.813  1.00 90.00  ? 88  GLU B CG    1 
ATOM   2819 C CD    . GLU D 4 88  ? -10.637 54.319 98.661  1.00 90.00  ? 88  GLU B CD    1 
ATOM   2820 O OE1   . GLU D 4 88  ? -11.800 54.636 98.995  1.00 90.00  ? 88  GLU B OE1   1 
ATOM   2821 O OE2   . GLU D 4 88  ? -9.629  54.986 98.992  1.00 90.00  ? 88  GLU B OE2   1 
ATOM   2822 N N     . VAL D 4 105 ? -6.978  58.797 97.556  1.00 47.55  ? 105 VAL B N     1 
ATOM   2823 C CA    . VAL D 4 105 ? -6.201  59.817 96.855  1.00 47.39  ? 105 VAL B CA    1 
ATOM   2824 C C     . VAL D 4 105 ? -4.764  59.883 97.360  1.00 47.37  ? 105 VAL B C     1 
ATOM   2825 O O     . VAL D 4 105 ? -4.523  60.093 98.546  1.00 47.89  ? 105 VAL B O     1 
ATOM   2826 C CB    . VAL D 4 105 ? -6.824  61.208 97.020  1.00 46.50  ? 105 VAL B CB    1 
ATOM   2827 C CG1   . VAL D 4 105 ? -5.964  62.244 96.323  1.00 47.52  ? 105 VAL B CG1   1 
ATOM   2828 C CG2   . VAL D 4 105 ? -8.222  61.215 96.446  1.00 47.05  ? 105 VAL B CG2   1 
ATOM   2829 N N     . ILE D 4 106 ? -3.816  59.731 96.441  1.00 60.28  ? 106 ILE B N     1 
ATOM   2830 C CA    . ILE D 4 106 ? -2.393  59.734 96.768  1.00 59.03  ? 106 ILE B CA    1 
ATOM   2831 C C     . ILE D 4 106 ? -1.622  60.770 95.969  1.00 59.95  ? 106 ILE B C     1 
ATOM   2832 O O     . ILE D 4 106 ? -1.785  60.865 94.756  1.00 60.62  ? 106 ILE B O     1 
ATOM   2833 C CB    . ILE D 4 106 ? -1.764  58.377 96.447  1.00 36.56  ? 106 ILE B CB    1 
ATOM   2834 C CG1   . ILE D 4 106 ? -2.529  57.267 97.156  1.00 35.95  ? 106 ILE B CG1   1 
ATOM   2835 C CG2   . ILE D 4 106 ? -0.303  58.377 96.847  1.00 34.92  ? 106 ILE B CG2   1 
ATOM   2836 C CD1   . ILE D 4 106 ? -2.340  55.924 96.509  1.00 38.32  ? 106 ILE B CD1   1 
ATOM   2837 N N     . SER D 4 107 ? -0.768  61.527 96.649  1.00 45.86  ? 107 SER B N     1 
ATOM   2838 C CA    . SER D 4 107 ? 0.045   62.541 95.993  1.00 46.69  ? 107 SER B CA    1 
ATOM   2839 C C     . SER D 4 107 ? 1.381   61.901 95.655  1.00 47.11  ? 107 SER B C     1 
ATOM   2840 O O     . SER D 4 107 ? 2.046   61.363 96.540  1.00 48.72  ? 107 SER B O     1 
ATOM   2841 C CB    . SER D 4 107 ? 0.265   63.734 96.921  1.00 72.35  ? 107 SER B CB    1 
ATOM   2842 O OG    . SER D 4 107 ? -0.949  64.417 97.174  1.00 74.07  ? 107 SER B OG    1 
ATOM   2843 N N     . VAL D 4 108 ? 1.776   61.953 94.383  1.00 46.49  ? 108 VAL B N     1 
ATOM   2844 C CA    . VAL D 4 108 ? 3.031   61.342 93.957  1.00 46.03  ? 108 VAL B CA    1 
ATOM   2845 C C     . VAL D 4 108 ? 3.893   62.244 93.090  1.00 46.17  ? 108 VAL B C     1 
ATOM   2846 O O     . VAL D 4 108 ? 3.477   62.701 92.023  1.00 46.21  ? 108 VAL B O     1 
ATOM   2847 C CB    . VAL D 4 108 ? 2.780   60.040 93.178  1.00 45.55  ? 108 VAL B CB    1 
ATOM   2848 C CG1   . VAL D 4 108 ? 4.106   59.333 92.914  1.00 45.56  ? 108 VAL B CG1   1 
ATOM   2849 C CG2   . VAL D 4 108 ? 1.824   59.141 93.953  1.00 45.92  ? 108 VAL B CG2   1 
ATOM   2850 N N     . ASP D 4 109 ? 5.112   62.465 93.563  1.00 42.28  ? 109 ASP B N     1 
ATOM   2851 C CA    . ASP D 4 109 ? 6.098   63.302 92.897  1.00 42.23  ? 109 ASP B CA    1 
ATOM   2852 C C     . ASP D 4 109 ? 6.487   62.813 91.500  1.00 39.35  ? 109 ASP B C     1 
ATOM   2853 O O     . ASP D 4 109 ? 6.714   63.619 90.594  1.00 38.29  ? 109 ASP B O     1 
ATOM   2854 C CB    . ASP D 4 109 ? 7.352   63.385 93.772  1.00 86.20  ? 109 ASP B CB    1 
ATOM   2855 C CG    . ASP D 4 109 ? 7.936   62.007 94.090  1.00 90.00  ? 109 ASP B CG    1 
ATOM   2856 O OD1   . ASP D 4 109 ? 7.179   61.128 94.561  1.00 90.00  ? 109 ASP B OD1   1 
ATOM   2857 O OD2   . ASP D 4 109 ? 9.151   61.801 93.874  1.00 90.00  ? 109 ASP B OD2   1 
ATOM   2858 N N     . LYS D 4 110 ? 6.578   61.496 91.333  1.00 54.69  ? 110 LYS B N     1 
ATOM   2859 C CA    . LYS D 4 110 ? 6.970   60.905 90.053  1.00 51.89  ? 110 LYS B CA    1 
ATOM   2860 C C     . LYS D 4 110 ? 6.420   59.497 89.963  1.00 51.00  ? 110 LYS B C     1 
ATOM   2861 O O     . LYS D 4 110 ? 6.373   58.790 90.963  1.00 53.14  ? 110 LYS B O     1 
ATOM   2862 C CB    . LYS D 4 110 ? 8.494   60.867 89.949  1.00 31.35  ? 110 LYS B CB    1 
ATOM   2863 C CG    . LYS D 4 110 ? 9.053   60.284 88.672  1.00 30.14  ? 110 LYS B CG    1 
ATOM   2864 C CD    . LYS D 4 110 ? 10.561  60.439 88.691  1.00 33.33  ? 110 LYS B CD    1 
ATOM   2865 C CE    . LYS D 4 110 ? 11.213  59.945 87.418  1.00 36.53  ? 110 LYS B CE    1 
ATOM   2866 N NZ    . LYS D 4 110 ? 11.217  58.450 87.335  1.00 40.69  ? 110 LYS B NZ    1 
ATOM   2867 N N     . LEU D 4 111 ? 6.003   59.088 88.771  1.00 34.64  ? 111 LEU B N     1 
ATOM   2868 C CA    . LEU D 4 111 ? 5.450   57.751 88.600  1.00 31.94  ? 111 LEU B CA    1 
ATOM   2869 C C     . LEU D 4 111 ? 5.736   57.213 87.205  1.00 30.44  ? 111 LEU B C     1 
ATOM   2870 O O     . LEU D 4 111 ? 5.309   57.784 86.208  1.00 29.49  ? 111 LEU B O     1 
ATOM   2871 C CB    . LEU D 4 111 ? 3.931   57.766 88.873  1.00 24.72  ? 111 LEU B CB    1 
ATOM   2872 C CG    . LEU D 4 111 ? 3.140   56.452 89.025  1.00 23.06  ? 111 LEU B CG    1 
ATOM   2873 C CD1   . LEU D 4 111 ? 2.265   56.202 87.819  1.00 22.50  ? 111 LEU B CD1   1 
ATOM   2874 C CD2   . LEU D 4 111 ? 4.094   55.301 89.242  1.00 22.35  ? 111 LEU B CD2   1 
ATOM   2875 N N     . ARG D 4 112 ? 6.482   56.116 87.148  1.00 29.91  ? 112 ARG B N     1 
ATOM   2876 C CA    . ARG D 4 112 ? 6.813   55.493 85.881  1.00 30.24  ? 112 ARG B CA    1 
ATOM   2877 C C     . ARG D 4 112 ? 5.752   54.443 85.558  1.00 28.25  ? 112 ARG B C     1 
ATOM   2878 O O     . ARG D 4 112 ? 5.434   53.595 86.397  1.00 26.96  ? 112 ARG B O     1 
ATOM   2879 C CB    . ARG D 4 112 ? 8.184   54.821 85.954  1.00 39.29  ? 112 ARG B CB    1 
ATOM   2880 C CG    . ARG D 4 112 ? 8.625   54.242 84.627  1.00 43.38  ? 112 ARG B CG    1 
ATOM   2881 C CD    . ARG D 4 112 ? 9.867   53.384 84.749  1.00 48.41  ? 112 ARG B CD    1 
ATOM   2882 N NE    . ARG D 4 112 ? 10.769  53.644 83.633  1.00 54.23  ? 112 ARG B NE    1 
ATOM   2883 C CZ    . ARG D 4 112 ? 11.584  54.696 83.564  1.00 57.44  ? 112 ARG B CZ    1 
ATOM   2884 N NH1   . ARG D 4 112 ? 11.617  55.583 84.554  1.00 59.22  ? 112 ARG B NH1   1 
ATOM   2885 N NH2   . ARG D 4 112 ? 12.355  54.874 82.499  1.00 59.48  ? 112 ARG B NH2   1 
ATOM   2886 N N     . ILE D 4 113 ? 5.200   54.515 84.347  1.00 27.35  ? 113 ILE B N     1 
ATOM   2887 C CA    . ILE D 4 113 ? 4.186   53.569 83.897  1.00 27.78  ? 113 ILE B CA    1 
ATOM   2888 C C     . ILE D 4 113 ? 4.704   52.845 82.661  1.00 26.81  ? 113 ILE B C     1 
ATOM   2889 O O     . ILE D 4 113 ? 5.039   53.480 81.665  1.00 26.43  ? 113 ILE B O     1 
ATOM   2890 C CB    . ILE D 4 113 ? 2.859   54.277 83.503  1.00 21.67  ? 113 ILE B CB    1 
ATOM   2891 C CG1   . ILE D 4 113 ? 2.349   55.153 84.654  1.00 19.86  ? 113 ILE B CG1   1 
ATOM   2892 C CG2   . ILE D 4 113 ? 1.811   53.239 83.132  1.00 18.69  ? 113 ILE B CG2   1 
ATOM   2893 C CD1   . ILE D 4 113 ? 0.964   55.745 84.417  1.00 16.85  ? 113 ILE B CD1   1 
ATOM   2894 N N     . VAL D 4 114 ? 4.782   51.521 82.733  1.00 30.76  ? 114 VAL B N     1 
ATOM   2895 C CA    . VAL D 4 114 ? 5.230   50.710 81.602  1.00 29.13  ? 114 VAL B CA    1 
ATOM   2896 C C     . VAL D 4 114 ? 4.093   49.756 81.283  1.00 30.24  ? 114 VAL B C     1 
ATOM   2897 O O     . VAL D 4 114 ? 3.711   48.948 82.131  1.00 31.84  ? 114 VAL B O     1 
ATOM   2898 C CB    . VAL D 4 114 ? 6.461   49.882 81.955  1.00 14.64  ? 114 VAL B CB    1 
ATOM   2899 C CG1   . VAL D 4 114 ? 6.920   49.096 80.742  1.00 13.11  ? 114 VAL B CG1   1 
ATOM   2900 C CG2   . VAL D 4 114 ? 7.563   50.788 82.460  1.00 14.52  ? 114 VAL B CG2   1 
ATOM   2901 N N     . ALA D 4 115 ? 3.549   49.832 80.073  1.00 25.02  ? 115 ALA B N     1 
ATOM   2902 C CA    . ALA D 4 115 ? 2.427   48.968 79.729  1.00 26.49  ? 115 ALA B CA    1 
ATOM   2903 C C     . ALA D 4 115 ? 2.541   48.232 78.403  1.00 25.91  ? 115 ALA B C     1 
ATOM   2904 O O     . ALA D 4 115 ? 3.118   48.740 77.444  1.00 26.53  ? 115 ALA B O     1 
ATOM   2905 C CB    . ALA D 4 115 ? 1.138   49.773 79.665  1.00 54.22  ? 115 ALA B CB    1 
ATOM   2906 N N     . CYS D 4 116 ? 1.974   47.030 78.353  1.00 24.76  ? 116 CYS B N     1 
ATOM   2907 C CA    . CYS D 4 116 ? 1.996   46.218 77.141  1.00 26.09  ? 116 CYS B CA    1 
ATOM   2908 C C     . CYS D 4 116 ? 0.619   46.146 76.510  1.00 28.31  ? 116 CYS B C     1 
ATOM   2909 O O     . CYS D 4 116 ? -0.391  46.434 77.146  1.00 27.85  ? 116 CYS B O     1 
ATOM   2910 C CB    . CYS D 4 116 ? 2.477   44.802 77.450  1.00 28.45  ? 116 CYS B CB    1 
ATOM   2911 S SG    . CYS D 4 116 ? 4.157   44.746 78.009  1.00 29.26  ? 116 CYS B SG    1 
ATOM   2912 N N     . ASN D 4 117 ? 0.582   45.724 75.258  1.00 23.10  ? 117 ASN B N     1 
ATOM   2913 C CA    . ASN D 4 117 ? -0.671  45.647 74.541  1.00 24.57  ? 117 ASN B CA    1 
ATOM   2914 C C     . ASN D 4 117 ? -1.558  44.558 75.091  1.00 27.75  ? 117 ASN B C     1 
ATOM   2915 O O     . ASN D 4 117 ? -1.084  43.476 75.405  1.00 28.23  ? 117 ASN B O     1 
ATOM   2916 C CB    . ASN D 4 117 ? -0.399  45.403 73.061  1.00 36.91  ? 117 ASN B CB    1 
ATOM   2917 C CG    . ASN D 4 117 ? -1.498  45.934 72.173  1.00 38.13  ? 117 ASN B CG    1 
ATOM   2918 O OD1   . ASN D 4 117 ? -1.307  46.096 70.970  1.00 41.50  ? 117 ASN B OD1   1 
ATOM   2919 N ND2   . ASN D 4 117 ? -2.660  46.206 72.757  1.00 38.05  ? 117 ASN B ND2   1 
ATOM   2920 N N     . SER D 4 118 ? -2.848  44.855 75.216  1.00 36.20  ? 118 SER B N     1 
ATOM   2921 C CA    . SER D 4 118 ? -3.817  43.891 75.705  1.00 41.26  ? 118 SER B CA    1 
ATOM   2922 C C     . SER D 4 118 ? -4.115  42.910 74.583  1.00 45.51  ? 118 SER B C     1 
ATOM   2923 O O     . SER D 4 118 ? -4.696  41.854 74.818  1.00 46.02  ? 118 SER B O     1 
ATOM   2924 C CB    . SER D 4 118 ? -5.058  44.605 76.243  1.00 65.88  ? 118 SER B CB    1 
ATOM   2925 O OG    . SER D 4 118 ? -5.717  45.324 75.216  1.00 68.31  ? 118 SER B OG    1 
ATOM   2926 N N     . LYS D 4 119 ? -3.721  43.272 73.363  1.00 42.19  ? 119 LYS B N     1 
ATOM   2927 C CA    . LYS D 4 119 ? -3.942  42.432 72.189  1.00 48.80  ? 119 LYS B CA    1 
ATOM   2928 C C     . LYS D 4 119 ? -2.643  41.822 71.641  1.00 52.00  ? 119 LYS B C     1 
ATOM   2929 O O     . LYS D 4 119 ? -1.544  42.308 71.917  1.00 51.94  ? 119 LYS B O     1 
ATOM   2930 C CB    . LYS D 4 119 ? -4.617  43.234 71.076  1.00 82.17  ? 119 LYS B CB    1 
ATOM   2931 C CG    . LYS D 4 119 ? -3.723  44.284 70.439  1.00 86.20  ? 119 LYS B CG    1 
ATOM   2932 C CD    . LYS D 4 119 ? -4.456  45.042 69.344  1.00 87.94  ? 119 LYS B CD    1 
ATOM   2933 C CE    . LYS D 4 119 ? -3.562  46.092 68.707  1.00 86.31  ? 119 LYS B CE    1 
ATOM   2934 N NZ    . LYS D 4 119 ? -3.916  47.466 69.154  1.00 87.11  ? 119 LYS B NZ    1 
ATOM   2935 N N     . LYS D 4 120 ? -2.783  40.756 70.856  1.00 90.00  ? 120 LYS B N     1 
ATOM   2936 C CA    . LYS D 4 120 ? -1.643  40.062 70.261  1.00 90.00  ? 120 LYS B CA    1 
ATOM   2937 C C     . LYS D 4 120 ? -1.173  40.757 68.973  1.00 90.00  ? 120 LYS B C     1 
ATOM   2938 O O     . LYS D 4 120 ? -1.369  40.218 67.860  1.00 80.61  ? 120 LYS B O     1 
ATOM   2939 C CB    . LYS D 4 120 ? -1.994  38.601 69.978  1.00 90.00  ? 120 LYS B CB    1 
ATOM   2940 C CG    . LYS D 4 120 ? -0.862  37.801 69.356  1.00 90.00  ? 120 LYS B CG    1 
ATOM   2941 C CD    . LYS D 4 120 ? -1.279  36.362 69.103  1.00 90.00  ? 120 LYS B CD    1 
ATOM   2942 C CE    . LYS D 4 120 ? -0.147  35.562 68.481  1.00 90.00  ? 120 LYS B CE    1 
ATOM   2943 N NZ    . LYS D 4 120 ? -0.541  34.149 68.227  1.00 90.00  ? 120 LYS B NZ    1 
ATOM   2944 N N     . SER E 5 2   ? -1.721  46.983 103.783 1.00 77.66  ? 2   SER C N     1 
ATOM   2945 C CA    . SER E 5 2   ? -2.420  48.261 103.466 1.00 77.66  ? 2   SER C CA    1 
ATOM   2946 C C     . SER E 5 2   ? -3.591  48.020 102.518 1.00 77.66  ? 2   SER C C     1 
ATOM   2947 O O     . SER E 5 2   ? -4.711  48.467 102.778 1.00 77.66  ? 2   SER C O     1 
ATOM   2948 C CB    . SER E 5 2   ? -1.443  49.256 102.831 1.00 90.00  ? 2   SER C CB    1 
ATOM   2949 O OG    . SER E 5 2   ? -0.385  49.571 103.720 1.00 90.00  ? 2   SER C OG    1 
ATOM   2950 N N     . ASN E 5 3   ? -3.324  47.309 101.422 1.00 55.49  ? 3   ASN C N     1 
ATOM   2951 C CA    . ASN E 5 3   ? -4.348  47.002 100.422 1.00 51.52  ? 3   ASN C CA    1 
ATOM   2952 C C     . ASN E 5 3   ? -4.743  45.531 100.478 1.00 48.49  ? 3   ASN C C     1 
ATOM   2953 O O     . ASN E 5 3   ? -3.906  44.648 100.307 1.00 48.67  ? 3   ASN C O     1 
ATOM   2954 C CB    . ASN E 5 3   ? -3.838  47.334 99.017  1.00 62.73  ? 3   ASN C CB    1 
ATOM   2955 C CG    . ASN E 5 3   ? -4.958  47.410 97.992  1.00 62.29  ? 3   ASN C CG    1 
ATOM   2956 O OD1   . ASN E 5 3   ? -5.813  48.294 98.059  1.00 62.20  ? 3   ASN C OD1   1 
ATOM   2957 N ND2   . ASN E 5 3   ? -4.958  46.482 97.037  1.00 62.92  ? 3   ASN C ND2   1 
ATOM   2958 N N     . ALA E 5 4   ? -6.025  45.275 100.711 1.00 57.29  ? 4   ALA C N     1 
ATOM   2959 C CA    . ALA E 5 4   ? -6.529  43.911 100.793 1.00 53.75  ? 4   ALA C CA    1 
ATOM   2960 C C     . ALA E 5 4   ? -6.390  43.190 99.460  1.00 51.73  ? 4   ALA C C     1 
ATOM   2961 O O     . ALA E 5 4   ? -5.846  42.088 99.396  1.00 52.79  ? 4   ALA C O     1 
ATOM   2962 C CB    . ALA E 5 4   ? -7.993  43.914 101.234 1.00 28.35  ? 4   ALA C CB    1 
ATOM   2963 N N     . GLU E 5 5   ? -6.886  43.816 98.397  1.00 43.35  ? 5   GLU C N     1 
ATOM   2964 C CA    . GLU E 5 5   ? -6.821  43.224 97.068  1.00 39.51  ? 5   GLU C CA    1 
ATOM   2965 C C     . GLU E 5 5   ? -5.400  42.811 96.701  1.00 38.68  ? 5   GLU C C     1 
ATOM   2966 O O     . GLU E 5 5   ? -5.171  41.662 96.318  1.00 39.45  ? 5   GLU C O     1 
ATOM   2967 C CB    . GLU E 5 5   ? -7.377  44.194 96.025  1.00 35.19  ? 5   GLU C CB    1 
ATOM   2968 C CG    . GLU E 5 5   ? -7.282  43.674 94.604  1.00 34.74  ? 5   GLU C CG    1 
ATOM   2969 C CD    . GLU E 5 5   ? -8.108  44.481 93.623  1.00 35.32  ? 5   GLU C CD    1 
ATOM   2970 O OE1   . GLU E 5 5   ? -9.356  44.404 93.683  1.00 35.56  ? 5   GLU C OE1   1 
ATOM   2971 O OE2   . GLU E 5 5   ? -7.505  45.194 92.797  1.00 36.21  ? 5   GLU C OE2   1 
ATOM   2972 N N     . ALA E 5 6   ? -4.451  43.740 96.818  1.00 34.60  ? 6   ALA C N     1 
ATOM   2973 C CA    . ALA E 5 6   ? -3.055  43.445 96.511  1.00 32.47  ? 6   ALA C CA    1 
ATOM   2974 C C     . ALA E 5 6   ? -2.577  42.252 97.337  1.00 32.35  ? 6   ALA C C     1 
ATOM   2975 O O     . ALA E 5 6   ? -1.925  41.356 96.807  1.00 33.12  ? 6   ALA C O     1 
ATOM   2976 C CB    . ALA E 5 6   ? -2.184  44.651 96.796  1.00 25.95  ? 6   ALA C CB    1 
ATOM   2977 N N     . SER E 5 7   ? -2.901  42.245 98.632  1.00 31.92  ? 7   SER C N     1 
ATOM   2978 C CA    . SER E 5 7   ? -2.516  41.149 99.520  1.00 29.72  ? 7   SER C CA    1 
ATOM   2979 C C     . SER E 5 7   ? -3.026  39.853 98.933  1.00 28.83  ? 7   SER C C     1 
ATOM   2980 O O     . SER E 5 7   ? -2.276  38.900 98.745  1.00 28.56  ? 7   SER C O     1 
ATOM   2981 C CB    . SER E 5 7   ? -3.142  41.310 100.909 1.00 28.18  ? 7   SER C CB    1 
ATOM   2982 O OG    . SER E 5 7   ? -2.572  42.373 101.650 1.00 28.69  ? 7   SER C OG    1 
ATOM   2983 N N     . ARG E 5 8   ? -4.319  39.833 98.640  1.00 27.04  ? 8   ARG C N     1 
ATOM   2984 C CA    . ARG E 5 8   ? -4.966  38.653 98.095  1.00 28.13  ? 8   ARG C CA    1 
ATOM   2985 C C     . ARG E 5 8   ? -4.311  38.197 96.793  1.00 27.68  ? 8   ARG C C     1 
ATOM   2986 O O     . ARG E 5 8   ? -4.000  37.014 96.614  1.00 26.63  ? 8   ARG C O     1 
ATOM   2987 C CB    . ARG E 5 8   ? -6.450  38.957 97.880  1.00 51.32  ? 8   ARG C CB    1 
ATOM   2988 C CG    . ARG E 5 8   ? -7.293  37.745 97.577  1.00 58.71  ? 8   ARG C CG    1 
ATOM   2989 C CD    . ARG E 5 8   ? -8.755  37.997 97.914  1.00 64.17  ? 8   ARG C CD    1 
ATOM   2990 N NE    . ARG E 5 8   ? -9.558  36.779 97.802  1.00 71.67  ? 8   ARG C NE    1 
ATOM   2991 C CZ    . ARG E 5 8   ? -10.018 36.277 96.657  1.00 75.35  ? 8   ARG C CZ    1 
ATOM   2992 N NH1   . ARG E 5 8   ? -10.736 35.158 96.665  1.00 76.70  ? 8   ARG C NH1   1 
ATOM   2993 N NH2   . ARG E 5 8   ? -9.782  36.898 95.504  1.00 76.55  ? 8   ARG C NH2   1 
ATOM   2994 N N     . VAL E 5 9   ? -4.089  39.144 95.888  1.00 29.02  ? 9   VAL C N     1 
ATOM   2995 C CA    . VAL E 5 9   ? -3.486  38.829 94.601  1.00 26.75  ? 9   VAL C CA    1 
ATOM   2996 C C     . VAL E 5 9   ? -2.105  38.224 94.758  1.00 25.62  ? 9   VAL C C     1 
ATOM   2997 O O     . VAL E 5 9   ? -1.754  37.274 94.063  1.00 26.14  ? 9   VAL C O     1 
ATOM   2998 C CB    . VAL E 5 9   ? -3.390  40.088 93.698  1.00 21.95  ? 9   VAL C CB    1 
ATOM   2999 C CG1   . VAL E 5 9   ? -2.562  39.786 92.459  1.00 18.73  ? 9   VAL C CG1   1 
ATOM   3000 C CG2   . VAL E 5 9   ? -4.794  40.545 93.291  1.00 20.18  ? 9   VAL C CG2   1 
ATOM   3001 N N     . TYR E 5 10  ? -1.326  38.769 95.682  1.00 27.25  ? 10  TYR C N     1 
ATOM   3002 C CA    . TYR E 5 10  ? 0.023   38.279 95.900  1.00 26.55  ? 10  TYR C CA    1 
ATOM   3003 C C     . TYR E 5 10  ? 0.039   36.861 96.429  1.00 26.35  ? 10  TYR C C     1 
ATOM   3004 O O     . TYR E 5 10  ? 0.812   36.023 95.957  1.00 23.51  ? 10  TYR C O     1 
ATOM   3005 C CB    . TYR E 5 10  ? 0.768   39.216 96.848  1.00 25.30  ? 10  TYR C CB    1 
ATOM   3006 C CG    . TYR E 5 10  ? 1.333   40.423 96.140  1.00 26.79  ? 10  TYR C CG    1 
ATOM   3007 C CD1   . TYR E 5 10  ? 0.836   40.817 94.910  1.00 28.10  ? 10  TYR C CD1   1 
ATOM   3008 C CD2   . TYR E 5 10  ? 2.350   41.181 96.709  1.00 28.56  ? 10  TYR C CD2   1 
ATOM   3009 C CE1   . TYR E 5 10  ? 1.330   41.930 94.261  1.00 29.63  ? 10  TYR C CE1   1 
ATOM   3010 C CE2   . TYR E 5 10  ? 2.855   42.303 96.069  1.00 28.33  ? 10  TYR C CE2   1 
ATOM   3011 C CZ    . TYR E 5 10  ? 2.338   42.669 94.842  1.00 30.71  ? 10  TYR C CZ    1 
ATOM   3012 O OH    . TYR E 5 10  ? 2.833   43.766 94.171  1.00 33.06  ? 10  TYR C OH    1 
ATOM   3013 N N     . GLU E 5 11  ? -0.832  36.594 97.397  1.00 27.31  ? 11  GLU C N     1 
ATOM   3014 C CA    . GLU E 5 11  ? -0.921  35.276 98.016  1.00 27.68  ? 11  GLU C CA    1 
ATOM   3015 C C     . GLU E 5 11  ? -1.419  34.237 97.030  1.00 26.42  ? 11  GLU C C     1 
ATOM   3016 O O     . GLU E 5 11  ? -0.957  33.100 97.022  1.00 27.32  ? 11  GLU C O     1 
ATOM   3017 C CB    . GLU E 5 11  ? -1.840  35.332 99.235  1.00 29.04  ? 11  GLU C CB    1 
ATOM   3018 C CG    . GLU E 5 11  ? -1.459  36.428 100.206 1.00 32.00  ? 11  GLU C CG    1 
ATOM   3019 C CD    . GLU E 5 11  ? -1.797  36.085 101.632 1.00 32.70  ? 11  GLU C CD    1 
ATOM   3020 O OE1   . GLU E 5 11  ? -1.847  37.014 102.467 1.00 33.69  ? 11  GLU C OE1   1 
ATOM   3021 O OE2   . GLU E 5 11  ? -2.000  34.885 101.918 1.00 34.10  ? 11  GLU C OE2   1 
ATOM   3022 N N     . ILE E 5 12  ? -2.366  34.630 96.196  1.00 22.11  ? 12  ILE C N     1 
ATOM   3023 C CA    . ILE E 5 12  ? -2.881  33.718 95.207  1.00 22.15  ? 12  ILE C CA    1 
ATOM   3024 C C     . ILE E 5 12  ? -1.782  33.397 94.192  1.00 24.05  ? 12  ILE C C     1 
ATOM   3025 O O     . ILE E 5 12  ? -1.663  32.257 93.733  1.00 23.43  ? 12  ILE C O     1 
ATOM   3026 C CB    . ILE E 5 12  ? -4.052  34.335 94.473  1.00 26.12  ? 12  ILE C CB    1 
ATOM   3027 C CG1   . ILE E 5 12  ? -5.228  34.489 95.434  1.00 27.01  ? 12  ILE C CG1   1 
ATOM   3028 C CG2   . ILE E 5 12  ? -4.394  33.492 93.260  1.00 26.35  ? 12  ILE C CG2   1 
ATOM   3029 C CD1   . ILE E 5 12  ? -6.423  35.215 94.838  1.00 27.80  ? 12  ILE C CD1   1 
ATOM   3030 N N     . ILE E 5 13  ? -0.976  34.399 93.843  1.00 24.32  ? 13  ILE C N     1 
ATOM   3031 C CA    . ILE E 5 13  ? 0.092   34.191 92.875  1.00 22.97  ? 13  ILE C CA    1 
ATOM   3032 C C     . ILE E 5 13  ? 1.141   33.196 93.358  1.00 23.23  ? 13  ILE C C     1 
ATOM   3033 O O     . ILE E 5 13  ? 1.505   32.276 92.620  1.00 21.64  ? 13  ILE C O     1 
ATOM   3034 C CB    . ILE E 5 13  ? 0.784   35.531 92.489  1.00 20.12  ? 13  ILE C CB    1 
ATOM   3035 C CG1   . ILE E 5 13  ? -0.164  36.363 91.611  1.00 18.74  ? 13  ILE C CG1   1 
ATOM   3036 C CG2   . ILE E 5 13  ? 2.100   35.263 91.739  1.00 18.02  ? 13  ILE C CG2   1 
ATOM   3037 C CD1   . ILE E 5 13  ? 0.318   37.789 91.336  1.00 14.66  ? 13  ILE C CD1   1 
ATOM   3038 N N     . VAL E 5 14  ? 1.614   33.354 94.594  1.00 21.33  ? 14  VAL C N     1 
ATOM   3039 C CA    . VAL E 5 14  ? 2.635   32.440 95.097  1.00 23.02  ? 14  VAL C CA    1 
ATOM   3040 C C     . VAL E 5 14  ? 2.124   31.014 95.233  1.00 22.58  ? 14  VAL C C     1 
ATOM   3041 O O     . VAL E 5 14  ? 2.840   30.082 94.903  1.00 24.76  ? 14  VAL C O     1 
ATOM   3042 C CB    . VAL E 5 14  ? 3.236   32.911 96.449  1.00 28.39  ? 14  VAL C CB    1 
ATOM   3043 C CG1   . VAL E 5 14  ? 3.124   34.420 96.565  1.00 27.25  ? 14  VAL C CG1   1 
ATOM   3044 C CG2   . VAL E 5 14  ? 2.573   32.203 97.607  1.00 31.41  ? 14  VAL C CG2   1 
ATOM   3045 N N     . GLU E 5 15  ? 0.893   30.837 95.704  1.00 24.21  ? 15  GLU C N     1 
ATOM   3046 C CA    . GLU E 5 15  ? 0.336   29.494 95.844  1.00 24.74  ? 15  GLU C CA    1 
ATOM   3047 C C     . GLU E 5 15  ? 0.094   28.886 94.475  1.00 25.15  ? 15  GLU C C     1 
ATOM   3048 O O     . GLU E 5 15  ? 0.291   27.684 94.274  1.00 25.33  ? 15  GLU C O     1 
ATOM   3049 C CB    . GLU E 5 15  ? -0.989  29.509 96.616  1.00 27.27  ? 15  GLU C CB    1 
ATOM   3050 C CG    . GLU E 5 15  ? -0.866  29.950 98.057  1.00 29.43  ? 15  GLU C CG    1 
ATOM   3051 C CD    . GLU E 5 15  ? 0.105   29.093 98.859  1.00 31.80  ? 15  GLU C CD    1 
ATOM   3052 O OE1   . GLU E 5 15  ? 0.650   29.608 99.862  1.00 32.75  ? 15  GLU C OE1   1 
ATOM   3053 O OE2   . GLU E 5 15  ? 0.317   27.912 98.493  1.00 29.11  ? 15  GLU C OE2   1 
ATOM   3054 N N     . SER E 5 16  ? -0.341  29.716 93.534  1.00 27.78  ? 16  SER C N     1 
ATOM   3055 C CA    . SER E 5 16  ? -0.613  29.246 92.189  1.00 29.10  ? 16  SER C CA    1 
ATOM   3056 C C     . SER E 5 16  ? 0.655   28.915 91.432  1.00 27.94  ? 16  SER C C     1 
ATOM   3057 O O     . SER E 5 16  ? 0.691   27.931 90.704  1.00 27.62  ? 16  SER C O     1 
ATOM   3058 C CB    . SER E 5 16  ? -1.422  30.276 91.418  1.00 39.64  ? 16  SER C CB    1 
ATOM   3059 O OG    . SER E 5 16  ? -2.751  30.285 91.889  1.00 45.47  ? 16  SER C OG    1 
ATOM   3060 N N     . VAL E 5 17  ? 1.696   29.725 91.596  1.00 25.75  ? 17  VAL C N     1 
ATOM   3061 C CA    . VAL E 5 17  ? 2.955   29.455 90.903  1.00 25.96  ? 17  VAL C CA    1 
ATOM   3062 C C     . VAL E 5 17  ? 3.575   28.139 91.418  1.00 25.56  ? 17  VAL C C     1 
ATOM   3063 O O     . VAL E 5 17  ? 4.055   27.328 90.631  1.00 25.47  ? 17  VAL C O     1 
ATOM   3064 C CB    . VAL E 5 17  ? 3.947   30.653 91.067  1.00 19.44  ? 17  VAL C CB    1 
ATOM   3065 C CG1   . VAL E 5 17  ? 5.329   30.273 90.594  1.00 19.81  ? 17  VAL C CG1   1 
ATOM   3066 C CG2   . VAL E 5 17  ? 3.458   31.835 90.257  1.00 17.64  ? 17  VAL C CG2   1 
ATOM   3067 N N     . VAL E 5 18  ? 3.535   27.925 92.734  1.00 24.35  ? 18  VAL C N     1 
ATOM   3068 C CA    . VAL E 5 18  ? 4.075   26.714 93.351  1.00 22.75  ? 18  VAL C CA    1 
ATOM   3069 C C     . VAL E 5 18  ? 3.395   25.462 92.800  1.00 22.99  ? 18  VAL C C     1 
ATOM   3070 O O     . VAL E 5 18  ? 4.037   24.426 92.630  1.00 22.80  ? 18  VAL C O     1 
ATOM   3071 C CB    . VAL E 5 18  ? 3.895   26.747 94.890  1.00 16.67  ? 18  VAL C CB    1 
ATOM   3072 C CG1   . VAL E 5 18  ? 4.170   25.376 95.486  1.00 13.46  ? 18  VAL C CG1   1 
ATOM   3073 C CG2   . VAL E 5 18  ? 4.830   27.786 95.502  1.00 13.05  ? 18  VAL C CG2   1 
ATOM   3074 N N     . ASN E 5 19  ? 2.094   25.555 92.523  1.00 27.55  ? 19  ASN C N     1 
ATOM   3075 C CA    . ASN E 5 19  ? 1.346   24.418 91.984  1.00 29.12  ? 19  ASN C CA    1 
ATOM   3076 C C     . ASN E 5 19  ? 1.670   24.171 90.530  1.00 29.90  ? 19  ASN C C     1 
ATOM   3077 O O     . ASN E 5 19  ? 1.736   23.027 90.093  1.00 31.81  ? 19  ASN C O     1 
ATOM   3078 C CB    . ASN E 5 19  ? -0.165  24.628 92.107  1.00 25.26  ? 19  ASN C CB    1 
ATOM   3079 C CG    . ASN E 5 19  ? -0.671  24.402 93.513  1.00 27.45  ? 19  ASN C CG    1 
ATOM   3080 O OD1   . ASN E 5 19  ? -0.180  23.525 94.215  1.00 30.08  ? 19  ASN C OD1   1 
ATOM   3081 N ND2   . ASN E 5 19  ? -1.667  25.178 93.927  1.00 28.98  ? 19  ASN C ND2   1 
ATOM   3082 N N     . GLU E 5 20  ? 1.872   25.252 89.782  1.00 27.87  ? 20  GLU C N     1 
ATOM   3083 C CA    . GLU E 5 20  ? 2.175   25.172 88.354  1.00 29.02  ? 20  GLU C CA    1 
ATOM   3084 C C     . GLU E 5 20  ? 3.567   24.632 88.060  1.00 27.18  ? 20  GLU C C     1 
ATOM   3085 O O     . GLU E 5 20  ? 3.795   24.032 87.011  1.00 28.82  ? 20  GLU C O     1 
ATOM   3086 C CB    . GLU E 5 20  ? 2.051   26.552 87.713  1.00 51.84  ? 20  GLU C CB    1 
ATOM   3087 C CG    . GLU E 5 20  ? 0.791   27.311 88.070  1.00 58.64  ? 20  GLU C CG    1 
ATOM   3088 C CD    . GLU E 5 20  ? -0.422  26.812 87.339  1.00 62.58  ? 20  GLU C CD    1 
ATOM   3089 O OE1   . GLU E 5 20  ? -0.451  26.940 86.096  1.00 64.63  ? 20  GLU C OE1   1 
ATOM   3090 O OE2   . GLU E 5 20  ? -1.342  26.295 88.006  1.00 66.53  ? 20  GLU C OE2   1 
ATOM   3091 N N     . VAL E 5 21  ? 4.502   24.858 88.975  1.00 21.02  ? 21  VAL C N     1 
ATOM   3092 C CA    . VAL E 5 21  ? 5.862   24.393 88.774  1.00 19.02  ? 21  VAL C CA    1 
ATOM   3093 C C     . VAL E 5 21  ? 6.181   23.100 89.502  1.00 20.32  ? 21  VAL C C     1 
ATOM   3094 O O     . VAL E 5 21  ? 7.239   22.528 89.293  1.00 20.93  ? 21  VAL C O     1 
ATOM   3095 C CB    . VAL E 5 21  ? 6.896   25.449 89.209  1.00 18.83  ? 21  VAL C CB    1 
ATOM   3096 C CG1   . VAL E 5 21  ? 6.595   26.775 88.543  1.00 16.26  ? 21  VAL C CG1   1 
ATOM   3097 C CG2   . VAL E 5 21  ? 6.905   25.576 90.719  1.00 17.45  ? 21  VAL C CG2   1 
ATOM   3098 N N     . ARG E 5 22  ? 5.287   22.627 90.356  1.00 21.63  ? 22  ARG C N     1 
ATOM   3099 C CA    . ARG E 5 22  ? 5.572   21.388 91.061  1.00 22.26  ? 22  ARG C CA    1 
ATOM   3100 C C     . ARG E 5 22  ? 5.913   20.309 90.055  1.00 23.65  ? 22  ARG C C     1 
ATOM   3101 O O     . ARG E 5 22  ? 6.783   19.477 90.300  1.00 22.56  ? 22  ARG C O     1 
ATOM   3102 C CB    . ARG E 5 22  ? 4.376   20.941 91.902  1.00 28.39  ? 22  ARG C CB    1 
ATOM   3103 C CG    . ARG E 5 22  ? 4.574   19.580 92.563  1.00 25.89  ? 22  ARG C CG    1 
ATOM   3104 C CD    . ARG E 5 22  ? 3.487   19.264 93.582  1.00 24.94  ? 22  ARG C CD    1 
ATOM   3105 N NE    . ARG E 5 22  ? 3.562   20.104 94.778  1.00 25.35  ? 22  ARG C NE    1 
ATOM   3106 C CZ    . ARG E 5 22  ? 2.727   21.104 95.050  1.00 26.15  ? 22  ARG C CZ    1 
ATOM   3107 N NH1   . ARG E 5 22  ? 2.874   21.809 96.164  1.00 26.71  ? 22  ARG C NH1   1 
ATOM   3108 N NH2   . ARG E 5 22  ? 1.744   21.401 94.211  1.00 24.78  ? 22  ARG C NH2   1 
ATOM   3109 N N     . GLU E 5 23  ? 5.231   20.338 88.914  1.00 27.48  ? 23  GLU C N     1 
ATOM   3110 C CA    . GLU E 5 23  ? 5.446   19.359 87.850  1.00 31.76  ? 23  GLU C CA    1 
ATOM   3111 C C     . GLU E 5 23  ? 6.839   19.473 87.218  1.00 32.27  ? 23  GLU C C     1 
ATOM   3112 O O     . GLU E 5 23  ? 7.406   18.482 86.764  1.00 31.12  ? 23  GLU C O     1 
ATOM   3113 C CB    . GLU E 5 23  ? 4.374   19.539 86.777  1.00 76.67  ? 23  GLU C CB    1 
ATOM   3114 C CG    . GLU E 5 23  ? 4.365   18.478 85.699  1.00 83.90  ? 23  GLU C CG    1 
ATOM   3115 C CD    . GLU E 5 23  ? 3.227   18.678 84.724  1.00 87.47  ? 23  GLU C CD    1 
ATOM   3116 O OE1   . GLU E 5 23  ? 3.187   19.744 84.073  1.00 87.63  ? 23  GLU C OE1   1 
ATOM   3117 O OE2   . GLU E 5 23  ? 2.372   17.775 84.614  1.00 88.64  ? 23  GLU C OE2   1 
ATOM   3118 N N     . ASP E 5 24  ? 7.388   20.684 87.190  1.00 33.98  ? 24  ASP C N     1 
ATOM   3119 C CA    . ASP E 5 24  ? 8.707   20.914 86.612  1.00 32.94  ? 24  ASP C CA    1 
ATOM   3120 C C     . ASP E 5 24  ? 9.818   20.565 87.576  1.00 31.76  ? 24  ASP C C     1 
ATOM   3121 O O     . ASP E 5 24  ? 10.906  20.179 87.155  1.00 31.40  ? 24  ASP C O     1 
ATOM   3122 C CB    . ASP E 5 24  ? 8.837   22.362 86.163  1.00 47.54  ? 24  ASP C CB    1 
ATOM   3123 C CG    . ASP E 5 24  ? 7.938   22.676 84.994  1.00 49.34  ? 24  ASP C CG    1 
ATOM   3124 O OD1   . ASP E 5 24  ? 8.099   22.016 83.941  1.00 50.10  ? 24  ASP C OD1   1 
ATOM   3125 O OD2   . ASP E 5 24  ? 7.072   23.568 85.131  1.00 50.35  ? 24  ASP C OD2   1 
ATOM   3126 N N     . PHE E 5 25  ? 9.548   20.714 88.867  1.00 30.72  ? 25  PHE C N     1 
ATOM   3127 C CA    . PHE E 5 25  ? 10.528  20.362 89.876  1.00 31.06  ? 25  PHE C CA    1 
ATOM   3128 C C     . PHE E 5 25  ? 10.715  18.847 89.817  1.00 33.77  ? 25  PHE C C     1 
ATOM   3129 O O     . PHE E 5 25  ? 11.842  18.349 89.767  1.00 33.93  ? 25  PHE C O     1 
ATOM   3130 C CB    . PHE E 5 25  ? 10.037  20.764 91.263  1.00 23.14  ? 25  PHE C CB    1 
ATOM   3131 C CG    . PHE E 5 25  ? 10.439  22.146 91.674  1.00 19.54  ? 25  PHE C CG    1 
ATOM   3132 C CD1   . PHE E 5 25  ? 10.065  23.251 90.920  1.00 19.20  ? 25  PHE C CD1   1 
ATOM   3133 C CD2   . PHE E 5 25  ? 11.190  22.346 92.828  1.00 18.21  ? 25  PHE C CD2   1 
ATOM   3134 C CE1   . PHE E 5 25  ? 10.431  24.539 91.313  1.00 18.12  ? 25  PHE C CE1   1 
ATOM   3135 C CE2   . PHE E 5 25  ? 11.566  23.626 93.234  1.00 17.25  ? 25  PHE C CE2   1 
ATOM   3136 C CZ    . PHE E 5 25  ? 11.187  24.727 92.479  1.00 16.95  ? 25  PHE C CZ    1 
ATOM   3137 N N     . GLU E 5 26  ? 9.599   18.123 89.819  1.00 38.35  ? 26  GLU C N     1 
ATOM   3138 C CA    . GLU E 5 26  ? 9.621   16.668 89.759  1.00 42.09  ? 26  GLU C CA    1 
ATOM   3139 C C     . GLU E 5 26  ? 10.353  16.235 88.503  1.00 42.29  ? 26  GLU C C     1 
ATOM   3140 O O     . GLU E 5 26  ? 11.122  15.275 88.505  1.00 43.72  ? 26  GLU C O     1 
ATOM   3141 C CB    . GLU E 5 26  ? 8.200   16.114 89.713  1.00 61.15  ? 26  GLU C CB    1 
ATOM   3142 C CG    . GLU E 5 26  ? 7.377   16.410 90.949  1.00 68.74  ? 26  GLU C CG    1 
ATOM   3143 C CD    . GLU E 5 26  ? 5.919   16.012 90.789  1.00 72.01  ? 26  GLU C CD    1 
ATOM   3144 O OE1   . GLU E 5 26  ? 5.156   16.124 91.777  1.00 72.95  ? 26  GLU C OE1   1 
ATOM   3145 O OE2   . GLU E 5 26  ? 5.538   15.592 89.672  1.00 73.74  ? 26  GLU C OE2   1 
ATOM   3146 N N     . ASN E 5 27  ? 10.112  16.957 87.422  1.00 35.06  ? 27  ASN C N     1 
ATOM   3147 C CA    . ASN E 5 27  ? 10.730  16.635 86.154  1.00 35.37  ? 27  ASN C CA    1 
ATOM   3148 C C     . ASN E 5 27  ? 12.228  16.938 86.160  1.00 34.52  ? 27  ASN C C     1 
ATOM   3149 O O     . ASN E 5 27  ? 12.980  16.423 85.330  1.00 34.20  ? 27  ASN C O     1 
ATOM   3150 C CB    . ASN E 5 27  ? 10.023  17.420 85.055  1.00 63.34  ? 27  ASN C CB    1 
ATOM   3151 C CG    . ASN E 5 27  ? 10.440  16.992 83.685  1.00 67.01  ? 27  ASN C CG    1 
ATOM   3152 O OD1   . ASN E 5 27  ? 11.435  17.472 83.145  1.00 68.98  ? 27  ASN C OD1   1 
ATOM   3153 N ND2   . ASN E 5 27  ? 9.687   16.065 83.109  1.00 70.19  ? 27  ASN C ND2   1 
ATOM   3154 N N     . ALA E 5 28  ? 12.667  17.754 87.113  1.00 40.43  ? 28  ALA C N     1 
ATOM   3155 C CA    . ALA E 5 28  ? 14.074  18.131 87.189  1.00 38.81  ? 28  ALA C CA    1 
ATOM   3156 C C     . ALA E 5 28  ? 14.856  17.376 88.267  1.00 38.24  ? 28  ALA C C     1 
ATOM   3157 O O     . ALA E 5 28  ? 16.080  17.525 88.393  1.00 37.38  ? 28  ALA C O     1 
ATOM   3158 C CB    . ALA E 5 28  ? 14.186  19.642 87.403  1.00 10.00  ? 28  ALA C CB    1 
ATOM   3159 N N     . GLY E 5 29  ? 14.148  16.564 89.041  1.00 32.47  ? 29  GLY C N     1 
ATOM   3160 C CA    . GLY E 5 29  ? 14.801  15.795 90.080  1.00 30.88  ? 29  GLY C CA    1 
ATOM   3161 C C     . GLY E 5 29  ? 14.841  16.513 91.405  1.00 30.62  ? 29  GLY C C     1 
ATOM   3162 O O     . GLY E 5 29  ? 15.396  16.000 92.378  1.00 30.72  ? 29  GLY C O     1 
ATOM   3163 N N     . ILE E 5 30  ? 14.259  17.707 91.442  1.00 37.70  ? 30  ILE C N     1 
ATOM   3164 C CA    . ILE E 5 30  ? 14.221  18.508 92.660  1.00 37.34  ? 30  ILE C CA    1 
ATOM   3165 C C     . ILE E 5 30  ? 13.004  18.051 93.468  1.00 39.38  ? 30  ILE C C     1 
ATOM   3166 O O     . ILE E 5 30  ? 11.901  17.947 92.925  1.00 40.20  ? 30  ILE C O     1 
ATOM   3167 C CB    . ILE E 5 30  ? 14.096  20.002 92.312  1.00 23.74  ? 30  ILE C CB    1 
ATOM   3168 C CG1   . ILE E 5 30  ? 15.080  20.357 91.193  1.00 23.49  ? 30  ILE C CG1   1 
ATOM   3169 C CG2   . ILE E 5 30  ? 14.411  20.852 93.525  1.00 23.85  ? 30  ILE C CG2   1 
ATOM   3170 C CD1   . ILE E 5 30  ? 16.529  20.089 91.532  1.00 22.65  ? 30  ILE C CD1   1 
ATOM   3171 N N     . ASP E 5 31  ? 13.205  17.767 94.756  1.00 37.66  ? 31  ASP C N     1 
ATOM   3172 C CA    . ASP E 5 31  ? 12.122  17.291 95.614  1.00 39.03  ? 31  ASP C CA    1 
ATOM   3173 C C     . ASP E 5 31  ? 11.197  18.370 96.183  1.00 37.04  ? 31  ASP C C     1 
ATOM   3174 O O     . ASP E 5 31  ? 11.535  19.555 96.205  1.00 36.81  ? 31  ASP C O     1 
ATOM   3175 C CB    . ASP E 5 31  ? 12.696  16.446 96.750  1.00 70.74  ? 31  ASP C CB    1 
ATOM   3176 C CG    . ASP E 5 31  ? 13.787  17.158 97.499  1.00 76.47  ? 31  ASP C CG    1 
ATOM   3177 O OD1   . ASP E 5 31  ? 13.492  18.187 98.136  1.00 79.63  ? 31  ASP C OD1   1 
ATOM   3178 O OD2   . ASP E 5 31  ? 14.942  16.694 97.446  1.00 80.81  ? 31  ASP C OD2   1 
ATOM   3179 N N     . GLU E 5 32  ? 10.024  17.934 96.643  1.00 25.77  ? 32  GLU C N     1 
ATOM   3180 C CA    . GLU E 5 32  ? 9.000   18.809 97.198  1.00 23.14  ? 32  GLU C CA    1 
ATOM   3181 C C     . GLU E 5 32  ? 9.475   19.804 98.261  1.00 21.16  ? 32  GLU C C     1 
ATOM   3182 O O     . GLU E 5 32  ? 9.001   20.943 98.307  1.00 18.83  ? 32  GLU C O     1 
ATOM   3183 C CB    . GLU E 5 32  ? 7.861   17.963 97.766  1.00 37.29  ? 32  GLU C CB    1 
ATOM   3184 C CG    . GLU E 5 32  ? 6.672   18.783 98.260  1.00 39.38  ? 32  GLU C CG    1 
ATOM   3185 C CD    . GLU E 5 32  ? 5.888   19.439 97.132  1.00 38.64  ? 32  GLU C CD    1 
ATOM   3186 O OE1   . GLU E 5 32  ? 5.170   20.423 97.415  1.00 37.34  ? 32  GLU C OE1   1 
ATOM   3187 O OE2   . GLU E 5 32  ? 5.983   18.965 95.975  1.00 38.81  ? 32  GLU C OE2   1 
ATOM   3188 N N     . GLN E 5 33  ? 10.400  19.389 99.119  1.00 24.04  ? 33  GLN C N     1 
ATOM   3189 C CA    . GLN E 5 33  ? 10.891  20.284 100.157 1.00 24.01  ? 33  GLN C CA    1 
ATOM   3190 C C     . GLN E 5 33  ? 11.560  21.512 99.549  1.00 22.77  ? 33  GLN C C     1 
ATOM   3191 O O     . GLN E 5 33  ? 11.397  22.620 100.051 1.00 21.56  ? 33  GLN C O     1 
ATOM   3192 C CB    . GLN E 5 33  ? 11.852  19.552 101.095 1.00 51.20  ? 33  GLN C CB    1 
ATOM   3193 C CG    . GLN E 5 33  ? 12.316  20.391 102.284 1.00 57.96  ? 33  GLN C CG    1 
ATOM   3194 C CD    . GLN E 5 33  ? 11.169  21.084 103.024 1.00 61.70  ? 33  GLN C CD    1 
ATOM   3195 O OE1   . GLN E 5 33  ? 10.224  20.439 103.488 1.00 62.43  ? 33  GLN C OE1   1 
ATOM   3196 N NE2   . GLN E 5 33  ? 11.256  22.406 103.140 1.00 62.00  ? 33  GLN C NE2   1 
ATOM   3197 N N     . THR E 5 34  ? 12.302  21.331 98.463  1.00 23.17  ? 34  THR C N     1 
ATOM   3198 C CA    . THR E 5 34  ? 12.948  22.471 97.818  1.00 22.21  ? 34  THR C CA    1 
ATOM   3199 C C     . THR E 5 34  ? 11.883  23.422 97.251  1.00 21.50  ? 34  THR C C     1 
ATOM   3200 O O     . THR E 5 34  ? 12.049  24.642 97.293  1.00 19.77  ? 34  THR C O     1 
ATOM   3201 C CB    . THR E 5 34  ? 13.890  22.031 96.676  1.00 29.18  ? 34  THR C CB    1 
ATOM   3202 O OG1   . THR E 5 34  ? 14.819  21.060 97.167  1.00 31.39  ? 34  THR C OG1   1 
ATOM   3203 C CG2   . THR E 5 34  ? 14.677  23.219 96.156  1.00 28.29  ? 34  THR C CG2   1 
ATOM   3204 N N     . LEU E 5 35  ? 10.795  22.866 96.719  1.00 22.26  ? 35  LEU C N     1 
ATOM   3205 C CA    . LEU E 5 35  ? 9.721   23.696 96.185  1.00 22.81  ? 35  LEU C CA    1 
ATOM   3206 C C     . LEU E 5 35  ? 9.157   24.529 97.327  1.00 23.99  ? 35  LEU C C     1 
ATOM   3207 O O     . LEU E 5 35  ? 8.937   25.735 97.187  1.00 23.90  ? 35  LEU C O     1 
ATOM   3208 C CB    . LEU E 5 35  ? 8.604   22.836 95.577  1.00 17.72  ? 35  LEU C CB    1 
ATOM   3209 C CG    . LEU E 5 35  ? 7.429   23.617 94.960  1.00 15.89  ? 35  LEU C CG    1 
ATOM   3210 C CD1   . LEU E 5 35  ? 7.933   24.676 93.994  1.00 15.41  ? 35  LEU C CD1   1 
ATOM   3211 C CD2   . LEU E 5 35  ? 6.499   22.654 94.242  1.00 14.11  ? 35  LEU C CD2   1 
ATOM   3212 N N     . GLN E 5 36  ? 8.937   23.865 98.459  1.00 22.36  ? 36  GLN C N     1 
ATOM   3213 C CA    . GLN E 5 36  ? 8.410   24.513 99.648  1.00 22.97  ? 36  GLN C CA    1 
ATOM   3214 C C     . GLN E 5 36  ? 9.351   25.608 100.119 1.00 23.49  ? 36  GLN C C     1 
ATOM   3215 O O     . GLN E 5 36  ? 8.906   26.699 100.490 1.00 24.31  ? 36  GLN C O     1 
ATOM   3216 C CB    . GLN E 5 36  ? 8.200   23.483 100.755 1.00 30.22  ? 36  GLN C CB    1 
ATOM   3217 C CG    . GLN E 5 36  ? 7.061   22.518 100.474 1.00 31.46  ? 36  GLN C CG    1 
ATOM   3218 C CD    . GLN E 5 36  ? 5.795   23.241 100.044 1.00 32.86  ? 36  GLN C CD    1 
ATOM   3219 O OE1   . GLN E 5 36  ? 5.408   24.240 100.650 1.00 32.61  ? 36  GLN C OE1   1 
ATOM   3220 N NE2   . GLN E 5 36  ? 5.142   22.738 98.997  1.00 29.67  ? 36  GLN C NE2   1 
ATOM   3221 N N     . ASP E 5 37  ? 10.651  25.309 100.099 1.00 30.37  ? 37  ASP C N     1 
ATOM   3222 C CA    . ASP E 5 37  ? 11.686  26.262 100.496 1.00 31.25  ? 37  ASP C CA    1 
ATOM   3223 C C     . ASP E 5 37  ? 11.540  27.521 99.653  1.00 29.96  ? 37  ASP C C     1 
ATOM   3224 O O     . ASP E 5 37  ? 11.626  28.638 100.168 1.00 30.70  ? 37  ASP C O     1 
ATOM   3225 C CB    . ASP E 5 37  ? 13.079  25.655 100.289 1.00 46.24  ? 37  ASP C CB    1 
ATOM   3226 C CG    . ASP E 5 37  ? 13.452  24.641 101.371 1.00 51.27  ? 37  ASP C CG    1 
ATOM   3227 O OD1   . ASP E 5 37  ? 14.445  23.902 101.171 1.00 52.87  ? 37  ASP C OD1   1 
ATOM   3228 O OD2   . ASP E 5 37  ? 12.765  24.592 102.420 1.00 50.61  ? 37  ASP C OD2   1 
ATOM   3229 N N     . LEU E 5 38  ? 11.314  27.333 98.352  1.00 26.25  ? 38  LEU C N     1 
ATOM   3230 C CA    . LEU E 5 38  ? 11.125  28.456 97.444  1.00 23.07  ? 38  LEU C CA    1 
ATOM   3231 C C     . LEU E 5 38  ? 9.941   29.285 97.911  1.00 23.70  ? 38  LEU C C     1 
ATOM   3232 O O     . LEU E 5 38  ? 10.029  30.506 97.990  1.00 24.74  ? 38  LEU C O     1 
ATOM   3233 C CB    . LEU E 5 38  ? 10.870  27.969 96.020  1.00 23.21  ? 38  LEU C CB    1 
ATOM   3234 C CG    . LEU E 5 38  ? 10.384  29.057 95.049  1.00 23.74  ? 38  LEU C CG    1 
ATOM   3235 C CD1   . LEU E 5 38  ? 11.302  30.274 95.106  1.00 23.82  ? 38  LEU C CD1   1 
ATOM   3236 C CD2   . LEU E 5 38  ? 10.322  28.499 93.648  1.00 18.93  ? 38  LEU C CD2   1 
ATOM   3237 N N     . LYS E 5 39  ? 8.831   28.626 98.230  1.00 23.75  ? 39  LYS C N     1 
ATOM   3238 C CA    . LYS E 5 39  ? 7.655   29.351 98.692  1.00 24.12  ? 39  LYS C CA    1 
ATOM   3239 C C     . LYS E 5 39  ? 7.979   30.156 99.951  1.00 24.46  ? 39  LYS C C     1 
ATOM   3240 O O     . LYS E 5 39  ? 7.592   31.319 100.077 1.00 24.34  ? 39  LYS C O     1 
ATOM   3241 C CB    . LYS E 5 39  ? 6.499   28.397 98.995  1.00 24.20  ? 39  LYS C CB    1 
ATOM   3242 C CG    . LYS E 5 39  ? 5.196   29.136 99.273  1.00 23.66  ? 39  LYS C CG    1 
ATOM   3243 C CD    . LYS E 5 39  ? 4.188   28.289 100.023 1.00 25.52  ? 39  LYS C CD    1 
ATOM   3244 C CE    . LYS E 5 39  ? 3.685   27.120 99.193  1.00 26.70  ? 39  LYS C CE    1 
ATOM   3245 N NZ    . LYS E 5 39  ? 2.642   26.334 99.932  1.00 27.52  ? 39  LYS C NZ    1 
ATOM   3246 N N     . ASN E 5 40  ? 8.691   29.526 100.879 1.00 26.89  ? 40  ASN C N     1 
ATOM   3247 C CA    . ASN E 5 40  ? 9.070   30.161 102.141 1.00 28.34  ? 40  ASN C CA    1 
ATOM   3248 C C     . ASN E 5 40  ? 9.954   31.393 101.954 1.00 28.03  ? 40  ASN C C     1 
ATOM   3249 O O     . ASN E 5 40  ? 9.699   32.453 102.535 1.00 27.09  ? 40  ASN C O     1 
ATOM   3250 C CB    . ASN E 5 40  ? 9.799   29.153 103.025 1.00 42.65  ? 40  ASN C CB    1 
ATOM   3251 C CG    . ASN E 5 40  ? 8.942   27.955 103.374 1.00 46.65  ? 40  ASN C CG    1 
ATOM   3252 O OD1   . ASN E 5 40  ? 9.446   26.946 103.872 1.00 49.52  ? 40  ASN C OD1   1 
ATOM   3253 N ND2   . ASN E 5 40  ? 7.640   28.060 103.124 1.00 48.75  ? 40  ASN C ND2   1 
ATOM   3254 N N     . ILE E 5 41  ? 11.006  31.248 101.157 1.00 22.78  ? 41  ILE C N     1 
ATOM   3255 C CA    . ILE E 5 41  ? 11.905  32.357 100.910 1.00 21.47  ? 41  ILE C CA    1 
ATOM   3256 C C     . ILE E 5 41  ? 11.141  33.449 100.164 1.00 22.54  ? 41  ILE C C     1 
ATOM   3257 O O     . ILE E 5 41  ? 11.314  34.634 100.430 1.00 21.92  ? 41  ILE C O     1 
ATOM   3258 C CB    . ILE E 5 41  ? 13.115  31.898 100.077 1.00 26.23  ? 41  ILE C CB    1 
ATOM   3259 C CG1   . ILE E 5 41  ? 13.825  30.746 100.793 1.00 25.39  ? 41  ILE C CG1   1 
ATOM   3260 C CG2   . ILE E 5 41  ? 14.092  33.042 99.896  1.00 28.09  ? 41  ILE C CG2   1 
ATOM   3261 C CD1   . ILE E 5 41  ? 14.893  30.077 99.960  1.00 22.42  ? 41  ILE C CD1   1 
ATOM   3262 N N     . TRP E 5 42  ? 10.283  33.040 99.237  1.00 23.39  ? 42  TRP C N     1 
ATOM   3263 C CA    . TRP E 5 42  ? 9.492   33.981 98.457  1.00 22.07  ? 42  TRP C CA    1 
ATOM   3264 C C     . TRP E 5 42  ? 8.615   34.796 99.406  1.00 23.52  ? 42  TRP C C     1 
ATOM   3265 O O     . TRP E 5 42  ? 8.536   36.015 99.304  1.00 22.43  ? 42  TRP C O     1 
ATOM   3266 C CB    . TRP E 5 42  ? 8.625   33.204 97.458  1.00 20.81  ? 42  TRP C CB    1 
ATOM   3267 C CG    . TRP E 5 42  ? 7.968   34.026 96.373  1.00 18.59  ? 42  TRP C CG    1 
ATOM   3268 C CD1   . TRP E 5 42  ? 8.014   35.384 96.218  1.00 19.91  ? 42  TRP C CD1   1 
ATOM   3269 C CD2   . TRP E 5 42  ? 7.175   33.526 95.289  1.00 18.84  ? 42  TRP C CD2   1 
ATOM   3270 N NE1   . TRP E 5 42  ? 7.301   35.760 95.101  1.00 19.50  ? 42  TRP C NE1   1 
ATOM   3271 C CE2   . TRP E 5 42  ? 6.774   34.641 94.512  1.00 19.01  ? 42  TRP C CE2   1 
ATOM   3272 C CE3   . TRP E 5 42  ? 6.764   32.241 94.894  1.00 18.03  ? 42  TRP C CE3   1 
ATOM   3273 C CZ2   . TRP E 5 42  ? 5.978   34.511 93.360  1.00 16.92  ? 42  TRP C CZ2   1 
ATOM   3274 C CZ3   . TRP E 5 42  ? 5.973   32.113 93.743  1.00 18.21  ? 42  TRP C CZ3   1 
ATOM   3275 C CH2   . TRP E 5 42  ? 5.591   33.246 92.992  1.00 16.01  ? 42  TRP C CH2   1 
ATOM   3276 N N     . GLN E 5 43  ? 7.968   34.100 100.335 1.00 21.31  ? 43  GLN C N     1 
ATOM   3277 C CA    . GLN E 5 43  ? 7.091   34.714 101.322 1.00 23.39  ? 43  GLN C CA    1 
ATOM   3278 C C     . GLN E 5 43  ? 7.827   35.680 102.225 1.00 25.05  ? 43  GLN C C     1 
ATOM   3279 O O     . GLN E 5 43  ? 7.346   36.791 102.480 1.00 24.72  ? 43  GLN C O     1 
ATOM   3280 C CB    . GLN E 5 43  ? 6.421   33.627 102.171 1.00 29.41  ? 43  GLN C CB    1 
ATOM   3281 C CG    . GLN E 5 43  ? 5.274   32.928 101.455 1.00 30.79  ? 43  GLN C CG    1 
ATOM   3282 C CD    . GLN E 5 43  ? 4.685   31.774 102.233 1.00 31.77  ? 43  GLN C CD    1 
ATOM   3283 O OE1   . GLN E 5 43  ? 3.618   31.266 101.889 1.00 33.20  ? 43  GLN C OE1   1 
ATOM   3284 N NE2   . GLN E 5 43  ? 5.379   31.343 103.276 1.00 33.80  ? 43  GLN C NE2   1 
ATOM   3285 N N     . LYS E 5 44  ? 8.988   35.250 102.713 1.00 36.17  ? 44  LYS C N     1 
ATOM   3286 C CA    . LYS E 5 44  ? 9.811   36.072 103.596 1.00 36.45  ? 44  LYS C CA    1 
ATOM   3287 C C     . LYS E 5 44  ? 10.205  37.372 102.898 1.00 37.98  ? 44  LYS C C     1 
ATOM   3288 O O     . LYS E 5 44  ? 10.039  38.461 103.445 1.00 38.93  ? 44  LYS C O     1 
ATOM   3289 C CB    . LYS E 5 44  ? 11.071  35.314 104.008 1.00 29.72  ? 44  LYS C CB    1 
ATOM   3290 C CG    . LYS E 5 44  ? 11.930  36.078 104.996 1.00 28.50  ? 44  LYS C CG    1 
ATOM   3291 C CD    . LYS E 5 44  ? 13.270  35.408 105.196 1.00 27.20  ? 44  LYS C CD    1 
ATOM   3292 C CE    . LYS E 5 44  ? 14.093  35.428 103.915 1.00 29.23  ? 44  LYS C CE    1 
ATOM   3293 N NZ    . LYS E 5 44  ? 15.495  34.975 104.166 1.00 29.64  ? 44  LYS C NZ    1 
ATOM   3294 N N     . LYS E 5 45  ? 10.730  37.244 101.685 1.00 25.82  ? 45  LYS C N     1 
ATOM   3295 C CA    . LYS E 5 45  ? 11.128  38.398 100.903 1.00 25.25  ? 45  LYS C CA    1 
ATOM   3296 C C     . LYS E 5 45  ? 9.965   39.377 100.770 1.00 26.55  ? 45  LYS C C     1 
ATOM   3297 O O     . LYS E 5 45  ? 10.134  40.574 100.975 1.00 27.30  ? 45  LYS C O     1 
ATOM   3298 C CB    . LYS E 5 45  ? 11.575  37.951 99.522  1.00 28.62  ? 45  LYS C CB    1 
ATOM   3299 C CG    . LYS E 5 45  ? 12.725  36.970 99.531  1.00 29.21  ? 45  LYS C CG    1 
ATOM   3300 C CD    . LYS E 5 45  ? 14.003  37.599 100.015 1.00 28.05  ? 45  LYS C CD    1 
ATOM   3301 C CE    . LYS E 5 45  ? 15.188  36.842 99.457  1.00 30.31  ? 45  LYS C CE    1 
ATOM   3302 N NZ    . LYS E 5 45  ? 16.466  37.469 99.886  1.00 33.55  ? 45  LYS C NZ    1 
ATOM   3303 N N     . LEU E 5 46  ? 8.785   38.869 100.422 1.00 29.18  ? 46  LEU C N     1 
ATOM   3304 C CA    . LEU E 5 46  ? 7.613   39.724 100.273 1.00 29.55  ? 46  LEU C CA    1 
ATOM   3305 C C     . LEU E 5 46  ? 7.319   40.503 101.548 1.00 30.43  ? 46  LEU C C     1 
ATOM   3306 O O     . LEU E 5 46  ? 7.037   41.694 101.491 1.00 31.27  ? 46  LEU C O     1 
ATOM   3307 C CB    . LEU E 5 46  ? 6.386   38.894 99.886  1.00 29.02  ? 46  LEU C CB    1 
ATOM   3308 C CG    . LEU E 5 46  ? 6.224   38.545 98.406  1.00 28.76  ? 46  LEU C CG    1 
ATOM   3309 C CD1   . LEU E 5 46  ? 5.006   37.663 98.238  1.00 27.23  ? 46  LEU C CD1   1 
ATOM   3310 C CD2   . LEU E 5 46  ? 6.086   39.822 97.581  1.00 28.33  ? 46  LEU C CD2   1 
ATOM   3311 N N     . THR E 5 47  ? 7.379   39.825 102.693 1.00 28.31  ? 47  THR C N     1 
ATOM   3312 C CA    . THR E 5 47  ? 7.130   40.455 103.993 1.00 28.13  ? 47  THR C CA    1 
ATOM   3313 C C     . THR E 5 47  ? 8.163   41.542 104.289 1.00 28.73  ? 47  THR C C     1 
ATOM   3314 O O     . THR E 5 47  ? 7.844   42.591 104.855 1.00 26.87  ? 47  THR C O     1 
ATOM   3315 C CB    . THR E 5 47  ? 7.181   39.417 105.129 1.00 33.66  ? 47  THR C CB    1 
ATOM   3316 O OG1   . THR E 5 47  ? 6.143   38.443 104.943 1.00 33.14  ? 47  THR C OG1   1 
ATOM   3317 C CG2   . THR E 5 47  ? 7.007   40.097 106.475 1.00 32.50  ? 47  THR C CG2   1 
ATOM   3318 N N     . GLU E 5 48  ? 9.404   41.277 103.896 1.00 33.76  ? 48  GLU C N     1 
ATOM   3319 C CA    . GLU E 5 48  ? 10.497  42.212 104.100 1.00 37.27  ? 48  GLU C CA    1 
ATOM   3320 C C     . GLU E 5 48  ? 10.280  43.524 103.371 1.00 35.27  ? 48  GLU C C     1 
ATOM   3321 O O     . GLU E 5 48  ? 10.762  44.561 103.817 1.00 34.70  ? 48  GLU C O     1 
ATOM   3322 C CB    . GLU E 5 48  ? 11.815  41.603 103.625 1.00 54.61  ? 48  GLU C CB    1 
ATOM   3323 C CG    . GLU E 5 48  ? 12.300  40.440 104.458 1.00 62.86  ? 48  GLU C CG    1 
ATOM   3324 C CD    . GLU E 5 48  ? 13.586  39.850 103.920 1.00 67.30  ? 48  GLU C CD    1 
ATOM   3325 O OE1   . GLU E 5 48  ? 14.147  38.950 104.581 1.00 68.20  ? 48  GLU C OE1   1 
ATOM   3326 O OE2   . GLU E 5 48  ? 14.032  40.287 102.833 1.00 68.16  ? 48  GLU C OE2   1 
ATOM   3327 N N     . THR E 5 49  ? 9.567   43.481 102.248 1.00 39.27  ? 49  THR C N     1 
ATOM   3328 C CA    . THR E 5 49  ? 9.316   44.687 101.460 1.00 39.52  ? 49  THR C CA    1 
ATOM   3329 C C     . THR E 5 49  ? 8.256   45.567 102.101 1.00 40.63  ? 49  THR C C     1 
ATOM   3330 O O     . THR E 5 49  ? 8.283   46.786 101.949 1.00 40.38  ? 49  THR C O     1 
ATOM   3331 C CB    . THR E 5 49  ? 8.861   44.356 100.028 1.00 29.21  ? 49  THR C CB    1 
ATOM   3332 O OG1   . THR E 5 49  ? 7.518   43.867 100.056 1.00 29.45  ? 49  THR C OG1   1 
ATOM   3333 C CG2   . THR E 5 49  ? 9.759   43.300 99.413  1.00 28.99  ? 49  THR C CG2   1 
ATOM   3334 N N     . LYS E 5 50  ? 7.323   44.944 102.809 1.00 58.28  ? 50  LYS C N     1 
ATOM   3335 C CA    . LYS E 5 50  ? 6.259   45.671 103.488 1.00 59.61  ? 50  LYS C CA    1 
ATOM   3336 C C     . LYS E 5 50  ? 5.382   46.549 102.589 1.00 58.65  ? 50  LYS C C     1 
ATOM   3337 O O     . LYS E 5 50  ? 5.023   47.662 102.976 1.00 61.28  ? 50  LYS C O     1 
ATOM   3338 C CB    . LYS E 5 50  ? 6.859   46.520 104.617 1.00 55.46  ? 50  LYS C CB    1 
ATOM   3339 C CG    . LYS E 5 50  ? 7.272   45.710 105.842 1.00 59.07  ? 50  LYS C CG    1 
ATOM   3340 C CD    . LYS E 5 50  ? 8.035   46.544 106.860 1.00 62.10  ? 50  LYS C CD    1 
ATOM   3341 C CE    . LYS E 5 50  ? 9.436   46.872 106.361 1.00 65.06  ? 50  LYS C CE    1 
ATOM   3342 N NZ    . LYS E 5 50  ? 10.253  47.611 107.367 1.00 67.26  ? 50  LYS C NZ    1 
ATOM   3343 N N     . VAL E 5 51  ? 5.023   46.050 101.405 1.00 39.35  ? 51  VAL C N     1 
ATOM   3344 C CA    . VAL E 5 51  ? 4.180   46.812 100.478 1.00 36.34  ? 51  VAL C CA    1 
ATOM   3345 C C     . VAL E 5 51  ? 2.709   46.576 100.784 1.00 35.79  ? 51  VAL C C     1 
ATOM   3346 O O     . VAL E 5 51  ? 1.825   47.298 100.321 1.00 35.81  ? 51  VAL C O     1 
ATOM   3347 C CB    . VAL E 5 51  ? 4.472   46.436 99.012  1.00 30.00  ? 51  VAL C CB    1 
ATOM   3348 C CG1   . VAL E 5 51  ? 5.930   46.759 98.683  1.00 28.67  ? 51  VAL C CG1   1 
ATOM   3349 C CG2   . VAL E 5 51  ? 4.174   44.963 98.772  1.00 28.66  ? 51  VAL C CG2   1 
ATOM   3350 N N     . THR E 5 52  ? 2.465   45.548 101.580 1.00 32.35  ? 52  THR C N     1 
ATOM   3351 C CA    . THR E 5 52  ? 1.129   45.184 102.017 1.00 32.36  ? 52  THR C CA    1 
ATOM   3352 C C     . THR E 5 52  ? 1.312   44.068 103.034 1.00 31.64  ? 52  THR C C     1 
ATOM   3353 O O     . THR E 5 52  ? 2.397   43.514 103.155 1.00 32.38  ? 52  THR C O     1 
ATOM   3354 C CB    . THR E 5 52  ? 0.228   44.719 100.838 1.00 29.31  ? 52  THR C CB    1 
ATOM   3355 O OG1   . THR E 5 52  ? -1.078  44.407 101.341 1.00 29.22  ? 52  THR C OG1   1 
ATOM   3356 C CG2   . THR E 5 52  ? 0.808   43.504 100.144 1.00 28.36  ? 52  THR C CG2   1 
ATOM   3357 N N     . THR E 5 53  ? 0.266   43.750 103.781 1.00 41.32  ? 53  THR C N     1 
ATOM   3358 C CA    . THR E 5 53  ? 0.363   42.710 104.794 1.00 41.31  ? 53  THR C CA    1 
ATOM   3359 C C     . THR E 5 53  ? -0.099  41.349 104.279 1.00 41.15  ? 53  THR C C     1 
ATOM   3360 O O     . THR E 5 53  ? -1.037  41.263 103.486 1.00 41.66  ? 53  THR C O     1 
ATOM   3361 C CB    . THR E 5 53  ? -0.442  43.119 106.040 1.00 47.13  ? 53  THR C CB    1 
ATOM   3362 O OG1   . THR E 5 53  ? -1.700  43.679 105.633 1.00 48.65  ? 53  THR C OG1   1 
ATOM   3363 C CG2   . THR E 5 53  ? 0.329   44.160 106.847 1.00 46.75  ? 53  THR C CG2   1 
ATOM   3364 N N     . PHE E 5 54  ? 0.571   40.288 104.726 1.00 34.61  ? 54  PHE C N     1 
ATOM   3365 C CA    . PHE E 5 54  ? 0.236   38.931 104.295 1.00 33.81  ? 54  PHE C CA    1 
ATOM   3366 C C     . PHE E 5 54  ? -0.182  38.034 105.443 1.00 34.80  ? 54  PHE C C     1 
ATOM   3367 O O     . PHE E 5 54  ? 0.218   38.233 106.583 1.00 35.61  ? 54  PHE C O     1 
ATOM   3368 C CB    . PHE E 5 54  ? 1.418   38.294 103.562 1.00 29.48  ? 54  PHE C CB    1 
ATOM   3369 C CG    . PHE E 5 54  ? 1.985   39.157 102.484 1.00 27.75  ? 54  PHE C CG    1 
ATOM   3370 C CD1   . PHE E 5 54  ? 3.111   39.940 102.724 1.00 26.36  ? 54  PHE C CD1   1 
ATOM   3371 C CD2   . PHE E 5 54  ? 1.362   39.234 101.244 1.00 26.65  ? 54  PHE C CD2   1 
ATOM   3372 C CE1   . PHE E 5 54  ? 3.613   40.796 101.745 1.00 26.90  ? 54  PHE C CE1   1 
ATOM   3373 C CE2   . PHE E 5 54  ? 1.852   40.084 100.256 1.00 27.86  ? 54  PHE C CE2   1 
ATOM   3374 C CZ    . PHE E 5 54  ? 2.984   40.871 100.509 1.00 27.96  ? 54  PHE C CZ    1 
ATOM   3375 N N     . SER E 5 55  ? -0.983  37.030 105.124 1.00 48.79  ? 55  SER C N     1 
ATOM   3376 C CA    . SER E 5 55  ? -1.488  36.106 106.121 1.00 48.41  ? 55  SER C CA    1 
ATOM   3377 C C     . SER E 5 55  ? -0.414  35.226 106.725 1.00 50.44  ? 55  SER C C     1 
ATOM   3378 O O     . SER E 5 55  ? -0.678  34.480 107.661 1.00 53.52  ? 55  SER C O     1 
ATOM   3379 C CB    . SER E 5 55  ? -2.560  35.225 105.501 1.00 32.62  ? 55  SER C CB    1 
ATOM   3380 O OG    . SER E 5 55  ? -2.011  34.380 104.503 1.00 30.08  ? 55  SER C OG    1 
ATOM   3381 N N     . TRP E 5 56  ? 0.794   35.304 106.183 1.00 38.95  ? 56  TRP C N     1 
ATOM   3382 C CA    . TRP E 5 56  ? 1.906   34.496 106.681 1.00 39.66  ? 56  TRP C CA    1 
ATOM   3383 C C     . TRP E 5 56  ? 2.895   35.364 107.448 1.00 42.86  ? 56  TRP C C     1 
ATOM   3384 O O     . TRP E 5 56  ? 3.885   34.859 107.970 1.00 42.63  ? 56  TRP C O     1 
ATOM   3385 C CB    . TRP E 5 56  ? 2.632   33.815 105.512 1.00 32.40  ? 56  TRP C CB    1 
ATOM   3386 C CG    . TRP E 5 56  ? 3.211   34.789 104.511 1.00 27.89  ? 56  TRP C CG    1 
ATOM   3387 C CD1   . TRP E 5 56  ? 4.219   35.692 104.723 1.00 27.08  ? 56  TRP C CD1   1 
ATOM   3388 C CD2   . TRP E 5 56  ? 2.794   34.970 103.152 1.00 25.23  ? 56  TRP C CD2   1 
ATOM   3389 N NE1   . TRP E 5 56  ? 4.451   36.421 103.583 1.00 25.83  ? 56  TRP C NE1   1 
ATOM   3390 C CE2   . TRP E 5 56  ? 3.592   35.998 102.604 1.00 24.34  ? 56  TRP C CE2   1 
ATOM   3391 C CE3   . TRP E 5 56  ? 1.821   34.363 102.344 1.00 23.35  ? 56  TRP C CE3   1 
ATOM   3392 C CZ2   . TRP E 5 56  ? 3.450   36.431 101.285 1.00 23.36  ? 56  TRP C CZ2   1 
ATOM   3393 C CZ3   . TRP E 5 56  ? 1.678   34.795 101.034 1.00 22.80  ? 56  TRP C CZ3   1 
ATOM   3394 C CH2   . TRP E 5 56  ? 2.491   35.821 100.516 1.00 23.33  ? 56  TRP C CH2   1 
ATOM   3395 N N     . ASP E 5 57  ? 2.616   36.668 107.501 1.00 46.17  ? 57  ASP C N     1 
ATOM   3396 C CA    . ASP E 5 57  ? 3.470   37.654 108.173 1.00 50.33  ? 57  ASP C CA    1 
ATOM   3397 C C     . ASP E 5 57  ? 3.768   37.324 109.624 1.00 53.45  ? 57  ASP C C     1 
ATOM   3398 O O     . ASP E 5 57  ? 4.886   37.533 110.096 1.00 54.16  ? 57  ASP C O     1 
ATOM   3399 C CB    . ASP E 5 57  ? 2.827   39.045 108.109 1.00 64.16  ? 57  ASP C CB    1 
ATOM   3400 C CG    . ASP E 5 57  ? 3.057   39.739 106.783 1.00 64.54  ? 57  ASP C CG    1 
ATOM   3401 O OD1   . ASP E 5 57  ? 2.436   40.798 106.551 1.00 64.97  ? 57  ASP C OD1   1 
ATOM   3402 O OD2   . ASP E 5 57  ? 3.865   39.232 105.978 1.00 65.24  ? 57  ASP C OD2   1 
ATOM   3403 N N     . ASN E 5 58  ? 2.763   36.826 110.332 1.00 82.44  ? 58  ASN C N     1 
ATOM   3404 C CA    . ASN E 5 58  ? 2.918   36.477 111.738 1.00 88.02  ? 58  ASN C CA    1 
ATOM   3405 C C     . ASN E 5 58  ? 4.025   35.446 111.904 1.00 89.78  ? 58  ASN C C     1 
ATOM   3406 O O     . ASN E 5 58  ? 4.609   35.313 112.980 1.00 89.93  ? 58  ASN C O     1 
ATOM   3407 C CB    . ASN E 5 58  ? 1.600   35.926 112.271 1.00 90.00  ? 58  ASN C CB    1 
ATOM   3408 C CG    . ASN E 5 58  ? 0.428   36.817 111.929 1.00 90.00  ? 58  ASN C CG    1 
ATOM   3409 O OD1   . ASN E 5 58  ? 0.299   37.925 112.458 1.00 90.00  ? 58  ASN C OD1   1 
ATOM   3410 N ND2   . ASN E 5 58  ? -0.426  36.348 111.026 1.00 90.00  ? 58  ASN C ND2   1 
ATOM   3411 N N     . GLN E 5 59  ? 4.306   34.720 110.825 1.00 67.03  ? 59  GLN C N     1 
ATOM   3412 C CA    . GLN E 5 59  ? 5.342   33.696 110.826 1.00 68.90  ? 59  GLN C CA    1 
ATOM   3413 C C     . GLN E 5 59  ? 6.721   34.335 110.686 1.00 68.38  ? 59  GLN C C     1 
ATOM   3414 O O     . GLN E 5 59  ? 7.729   33.714 111.012 1.00 67.86  ? 59  GLN C O     1 
ATOM   3415 C CB    . GLN E 5 59  ? 5.121   32.709 109.671 1.00 90.00  ? 59  GLN C CB    1 
ATOM   3416 C CG    . GLN E 5 59  ? 3.724   32.084 109.613 1.00 90.00  ? 59  GLN C CG    1 
ATOM   3417 C CD    . GLN E 5 59  ? 3.632   30.939 108.607 1.00 90.00  ? 59  GLN C CD    1 
ATOM   3418 O OE1   . GLN E 5 59  ? 2.541   30.449 108.300 1.00 90.00  ? 59  GLN C OE1   1 
ATOM   3419 N NE2   . GLN E 5 59  ? 4.781   30.504 108.097 1.00 90.00  ? 59  GLN C NE2   1 
ATOM   3420 N N     . PHE E 5 60  ? 6.751   35.577 110.203 1.00 90.00  ? 60  PHE C N     1 
ATOM   3421 C CA    . PHE E 5 60  ? 7.999   36.319 110.001 1.00 90.00  ? 60  PHE C CA    1 
ATOM   3422 C C     . PHE E 5 60  ? 8.033   37.621 110.825 1.00 90.00  ? 60  PHE C C     1 
ATOM   3423 O O     . PHE E 5 60  ? 8.178   38.715 110.270 1.00 90.00  ? 60  PHE C O     1 
ATOM   3424 C CB    . PHE E 5 60  ? 8.177   36.649 108.508 1.00 75.18  ? 60  PHE C CB    1 
ATOM   3425 C CG    . PHE E 5 60  ? 8.171   35.439 107.604 1.00 73.89  ? 60  PHE C CG    1 
ATOM   3426 C CD1   . PHE E 5 60  ? 9.324   34.679 107.419 1.00 73.52  ? 60  PHE C CD1   1 
ATOM   3427 C CD2   . PHE E 5 60  ? 7.000   35.045 106.952 1.00 73.88  ? 60  PHE C CD2   1 
ATOM   3428 C CE1   . PHE E 5 60  ? 9.312   33.541 106.594 1.00 73.15  ? 60  PHE C CE1   1 
ATOM   3429 C CE2   . PHE E 5 60  ? 6.976   33.910 106.127 1.00 73.47  ? 60  PHE C CE2   1 
ATOM   3430 C CZ    . PHE E 5 60  ? 8.134   33.157 105.950 1.00 73.09  ? 60  PHE C CZ    1 
ATOM   3431 N N     . ASN E 5 61  ? 7.895   37.497 112.145 1.00 90.00  ? 61  ASN C N     1 
ATOM   3432 C CA    . ASN E 5 61  ? 7.921   38.655 113.044 1.00 90.00  ? 61  ASN C CA    1 
ATOM   3433 C C     . ASN E 5 61  ? 9.278   39.355 113.007 1.00 90.00  ? 61  ASN C C     1 
ATOM   3434 O O     . ASN E 5 61  ? 9.418   40.439 112.442 1.00 90.00  ? 61  ASN C O     1 
ATOM   3435 C CB    . ASN E 5 61  ? 7.615   38.224 114.484 1.00 90.00  ? 61  ASN C CB    1 
ATOM   3436 C CG    . ASN E 5 61  ? 6.136   38.293 114.814 1.00 90.00  ? 61  ASN C CG    1 
ATOM   3437 O OD1   . ASN E 5 61  ? 5.294   37.814 114.051 1.00 90.00  ? 61  ASN C OD1   1 
ATOM   3438 N ND2   . ASN E 5 61  ? 5.811   38.886 115.961 1.00 90.00  ? 61  ASN C ND2   1 
ATOM   3439 N N     . ASP E 5 228 ? 16.687  66.088 80.012  1.00 90.00  ? 228 ASP C N     1 
ATOM   3440 C CA    . ASP E 5 228 ? 17.441  66.077 78.763  1.00 90.00  ? 228 ASP C CA    1 
ATOM   3441 C C     . ASP E 5 228 ? 16.580  65.529 77.618  1.00 90.00  ? 228 ASP C C     1 
ATOM   3442 O O     . ASP E 5 228 ? 15.403  65.212 77.816  1.00 90.00  ? 228 ASP C O     1 
ATOM   3443 C CB    . ASP E 5 228 ? 18.709  65.231 78.934  1.00 90.00  ? 228 ASP C CB    1 
ATOM   3444 C CG    . ASP E 5 228 ? 19.652  65.342 77.747  1.00 90.00  ? 228 ASP C CG    1 
ATOM   3445 O OD1   . ASP E 5 228 ? 19.913  66.480 77.295  1.00 90.00  ? 228 ASP C OD1   1 
ATOM   3446 O OD2   . ASP E 5 228 ? 20.140  64.292 77.274  1.00 90.00  ? 228 ASP C OD2   1 
ATOM   3447 N N     . TYR E 5 229 ? 17.163  65.425 76.425  1.00 90.00  ? 229 TYR C N     1 
ATOM   3448 C CA    . TYR E 5 229 ? 16.443  64.919 75.259  1.00 90.00  ? 229 TYR C CA    1 
ATOM   3449 C C     . TYR E 5 229 ? 16.709  63.438 75.017  1.00 90.00  ? 229 TYR C C     1 
ATOM   3450 O O     . TYR E 5 229 ? 16.134  62.841 74.105  1.00 90.00  ? 229 TYR C O     1 
ATOM   3451 C CB    . TYR E 5 229 ? 16.840  65.697 74.005  1.00 85.37  ? 229 TYR C CB    1 
ATOM   3452 C CG    . TYR E 5 229 ? 16.643  67.183 74.118  1.00 88.70  ? 229 TYR C CG    1 
ATOM   3453 C CD1   . TYR E 5 229 ? 17.578  67.982 74.772  1.00 89.54  ? 229 TYR C CD1   1 
ATOM   3454 C CD2   . TYR E 5 229 ? 15.523  67.797 73.563  1.00 87.24  ? 229 TYR C CD2   1 
ATOM   3455 C CE1   . TYR E 5 229 ? 17.404  69.366 74.868  1.00 89.89  ? 229 TYR C CE1   1 
ATOM   3456 C CE2   . TYR E 5 229 ? 15.335  69.178 73.652  1.00 88.62  ? 229 TYR C CE2   1 
ATOM   3457 C CZ    . TYR E 5 229 ? 16.280  69.959 74.304  1.00 89.76  ? 229 TYR C CZ    1 
ATOM   3458 O OH    . TYR E 5 229 ? 16.104  71.326 74.381  1.00 89.94  ? 229 TYR C OH    1 
ATOM   3459 N N     . LEU E 5 230 ? 17.575  62.845 75.834  1.00 89.42  ? 230 LEU C N     1 
ATOM   3460 C CA    . LEU E 5 230 ? 17.915  61.436 75.679  1.00 90.00  ? 230 LEU C CA    1 
ATOM   3461 C C     . LEU E 5 230 ? 17.581  60.605 76.918  1.00 90.00  ? 230 LEU C C     1 
ATOM   3462 O O     . LEU E 5 230 ? 17.814  61.032 78.052  1.00 90.00  ? 230 LEU C O     1 
ATOM   3463 C CB    . LEU E 5 230 ? 19.399  61.307 75.325  1.00 85.49  ? 230 LEU C CB    1 
ATOM   3464 C CG    . LEU E 5 230 ? 19.858  62.221 74.178  1.00 85.85  ? 230 LEU C CG    1 
ATOM   3465 C CD1   . LEU E 5 230 ? 21.331  61.981 73.900  1.00 89.34  ? 230 LEU C CD1   1 
ATOM   3466 C CD2   . LEU E 5 230 ? 19.029  61.969 72.924  1.00 86.27  ? 230 LEU C CD2   1 
ATOM   3467 N N     . ILE E 5 231 ? 17.032  59.415 76.674  1.00 86.69  ? 231 ILE C N     1 
ATOM   3468 C CA    . ILE E 5 231 ? 16.612  58.473 77.714  1.00 89.05  ? 231 ILE C CA    1 
ATOM   3469 C C     . ILE E 5 231 ? 17.628  58.174 78.819  1.00 89.82  ? 231 ILE C C     1 
ATOM   3470 O O     . ILE E 5 231 ? 18.846  58.234 78.606  1.00 89.82  ? 231 ILE C O     1 
ATOM   3471 C CB    . ILE E 5 231 ? 16.161  57.123 77.079  1.00 90.00  ? 231 ILE C CB    1 
ATOM   3472 C CG1   . ILE E 5 231 ? 14.870  57.326 76.282  1.00 89.45  ? 231 ILE C CG1   1 
ATOM   3473 C CG2   . ILE E 5 231 ? 15.931  56.065 78.160  1.00 90.00  ? 231 ILE C CG2   1 
ATOM   3474 C CD1   . ILE E 5 231 ? 13.676  57.719 77.137  1.00 90.00  ? 231 ILE C CD1   1 
ATOM   3475 N N     . SER E 5 232 ? 17.088  57.845 79.996  1.00 90.00  ? 232 SER C N     1 
ATOM   3476 C CA    . SER E 5 232 ? 17.861  57.508 81.192  1.00 90.00  ? 232 SER C CA    1 
ATOM   3477 C C     . SER E 5 232 ? 17.644  56.039 81.588  1.00 90.00  ? 232 SER C C     1 
ATOM   3478 O O     . SER E 5 232 ? 16.523  55.611 81.890  1.00 90.00  ? 232 SER C O     1 
ATOM   3479 C CB    . SER E 5 232 ? 17.452  58.421 82.358  1.00 88.21  ? 232 SER C CB    1 
ATOM   3480 O OG    . SER E 5 232 ? 16.068  58.294 82.659  1.00 88.21  ? 232 SER C OG    1 
ATOM   3481 N N     . GLU E 5 236 ? 17.796  54.209 90.240  1.00 90.00  ? 236 GLU C N     1 
ATOM   3482 C CA    . GLU E 5 236 ? 16.547  54.392 89.505  1.00 90.00  ? 236 GLU C CA    1 
ATOM   3483 C C     . GLU E 5 236 ? 15.471  53.400 89.937  1.00 90.00  ? 236 GLU C C     1 
ATOM   3484 O O     . GLU E 5 236 ? 14.513  53.772 90.619  1.00 90.00  ? 236 GLU C O     1 
ATOM   3485 C CB    . GLU E 5 236 ? 16.791  54.259 87.996  1.00 90.00  ? 236 GLU C CB    1 
ATOM   3486 C CG    . GLU E 5 236 ? 17.591  53.030 87.598  1.00 90.00  ? 236 GLU C CG    1 
ATOM   3487 C CD    . GLU E 5 236 ? 17.761  52.908 86.098  1.00 90.00  ? 236 GLU C CD    1 
ATOM   3488 O OE1   . GLU E 5 236 ? 18.641  52.132 85.669  1.00 90.00  ? 236 GLU C OE1   1 
ATOM   3489 O OE2   . GLU E 5 236 ? 17.013  53.580 85.349  1.00 90.00  ? 236 GLU C OE2   1 
ATOM   3490 N N     . ASP E 5 237 ? 15.633  52.140 89.536  1.00 90.00  ? 237 ASP C N     1 
ATOM   3491 C CA    . ASP E 5 237 ? 14.675  51.091 89.876  1.00 90.00  ? 237 ASP C CA    1 
ATOM   3492 C C     . ASP E 5 237 ? 14.953  50.427 91.230  1.00 90.00  ? 237 ASP C C     1 
ATOM   3493 O O     . ASP E 5 237 ? 15.966  49.747 91.407  1.00 90.00  ? 237 ASP C O     1 
ATOM   3494 C CB    . ASP E 5 237 ? 14.643  50.027 88.766  1.00 90.00  ? 237 ASP C CB    1 
ATOM   3495 C CG    . ASP E 5 237 ? 16.021  49.455 88.449  1.00 90.00  ? 237 ASP C CG    1 
ATOM   3496 O OD1   . ASP E 5 237 ? 16.098  48.535 87.605  1.00 90.00  ? 237 ASP C OD1   1 
ATOM   3497 O OD2   . ASP E 5 237 ? 17.025  49.919 89.031  1.00 90.00  ? 237 ASP C OD2   1 
ATOM   3498 N N     . GLY E 5 238 ? 14.041  50.631 92.178  1.00 90.00  ? 238 GLY C N     1 
ATOM   3499 C CA    . GLY E 5 238 ? 14.187  50.052 93.504  1.00 90.00  ? 238 GLY C CA    1 
ATOM   3500 C C     . GLY E 5 238 ? 12.891  50.120 94.296  1.00 90.00  ? 238 GLY C C     1 
ATOM   3501 O O     . GLY E 5 238 ? 11.851  50.496 93.748  1.00 90.00  ? 238 GLY C O     1 
ATOM   3502 N N     . PRO E 5 239 ? 12.910  49.757 95.589  1.00 69.84  ? 239 PRO C N     1 
ATOM   3503 C CA    . PRO E 5 239 ? 11.672  49.819 96.368  1.00 67.87  ? 239 PRO C CA    1 
ATOM   3504 C C     . PRO E 5 239 ? 11.132  51.245 96.463  1.00 65.57  ? 239 PRO C C     1 
ATOM   3505 O O     . PRO E 5 239 ? 9.967   51.455 96.808  1.00 65.48  ? 239 PRO C O     1 
ATOM   3506 C CB    . PRO E 5 239 ? 12.092  49.250 97.725  1.00 79.65  ? 239 PRO C CB    1 
ATOM   3507 C CG    . PRO E 5 239 ? 13.544  49.618 97.815  1.00 79.69  ? 239 PRO C CG    1 
ATOM   3508 C CD    . PRO E 5 239 ? 14.037  49.305 96.424  1.00 81.08  ? 239 PRO C CD    1 
ATOM   3509 N N     . ASP E 5 240 ? 11.984  52.215 96.132  1.00 83.78  ? 240 ASP C N     1 
ATOM   3510 C CA    . ASP E 5 240 ? 11.612  53.628 96.183  1.00 81.41  ? 240 ASP C CA    1 
ATOM   3511 C C     . ASP E 5 240 ? 11.179  54.238 94.849  1.00 78.40  ? 240 ASP C C     1 
ATOM   3512 O O     . ASP E 5 240 ? 10.795  55.408 94.796  1.00 77.93  ? 240 ASP C O     1 
ATOM   3513 C CB    . ASP E 5 240 ? 12.756  54.453 96.782  1.00 90.00  ? 240 ASP C CB    1 
ATOM   3514 C CG    . ASP E 5 240 ? 12.904  54.239 98.279  1.00 90.00  ? 240 ASP C CG    1 
ATOM   3515 O OD1   . ASP E 5 240 ? 11.933  54.520 99.019  1.00 90.00  ? 240 ASP C OD1   1 
ATOM   3516 O OD2   . ASP E 5 240 ? 13.988  53.789 98.713  1.00 90.00  ? 240 ASP C OD2   1 
ATOM   3517 N N     . GLU E 5 241 ? 11.258  53.462 93.772  1.00 47.44  ? 241 GLU C N     1 
ATOM   3518 C CA    . GLU E 5 241 ? 10.812  53.957 92.478  1.00 44.12  ? 241 GLU C CA    1 
ATOM   3519 C C     . GLU E 5 241 ? 9.324   53.658 92.456  1.00 41.53  ? 241 GLU C C     1 
ATOM   3520 O O     . GLU E 5 241 ? 8.907   52.564 92.830  1.00 42.24  ? 241 GLU C O     1 
ATOM   3521 C CB    . GLU E 5 241 ? 11.475  53.214 91.309  1.00 71.99  ? 241 GLU C CB    1 
ATOM   3522 C CG    . GLU E 5 241 ? 11.075  53.783 89.934  1.00 73.80  ? 241 GLU C CG    1 
ATOM   3523 C CD    . GLU E 5 241 ? 11.407  52.872 88.751  1.00 73.97  ? 241 GLU C CD    1 
ATOM   3524 O OE1   . GLU E 5 241 ? 11.329  53.349 87.593  1.00 72.19  ? 241 GLU C OE1   1 
ATOM   3525 O OE2   . GLU E 5 241 ? 11.731  51.685 88.971  1.00 73.83  ? 241 GLU C OE2   1 
ATOM   3526 N N     . ASN E 5 242 ? 8.517   54.630 92.057  1.00 45.12  ? 242 ASN C N     1 
ATOM   3527 C CA    . ASN E 5 242 ? 7.086   54.404 91.972  1.00 40.82  ? 242 ASN C CA    1 
ATOM   3528 C C     . ASN E 5 242 ? 6.927   53.868 90.567  1.00 38.55  ? 242 ASN C C     1 
ATOM   3529 O O     . ASN E 5 242 ? 7.186   54.582 89.600  1.00 38.79  ? 242 ASN C O     1 
ATOM   3530 C CB    . ASN E 5 242 ? 6.327   55.717 92.149  1.00 42.43  ? 242 ASN C CB    1 
ATOM   3531 C CG    . ASN E 5 242 ? 6.516   56.304 93.528  1.00 42.15  ? 242 ASN C CG    1 
ATOM   3532 O OD1   . ASN E 5 242 ? 6.229   55.649 94.523  1.00 44.64  ? 242 ASN C OD1   1 
ATOM   3533 N ND2   . ASN E 5 242 ? 7.004   57.537 93.596  1.00 41.39  ? 242 ASN C ND2   1 
ATOM   3534 N N     . LEU E 5 243 ? 6.518   52.609 90.453  1.00 34.15  ? 243 LEU C N     1 
ATOM   3535 C CA    . LEU E 5 243 ? 6.387   51.984 89.149  1.00 31.13  ? 243 LEU C CA    1 
ATOM   3536 C C     . LEU E 5 243 ? 5.069   51.269 88.917  1.00 29.96  ? 243 LEU C C     1 
ATOM   3537 O O     . LEU E 5 243 ? 4.588   50.544 89.775  1.00 30.68  ? 243 LEU C O     1 
ATOM   3538 C CB    . LEU E 5 243 ? 7.540   51.002 88.953  1.00 25.59  ? 243 LEU C CB    1 
ATOM   3539 C CG    . LEU E 5 243 ? 7.585   50.218 87.648  1.00 25.16  ? 243 LEU C CG    1 
ATOM   3540 C CD1   . LEU E 5 243 ? 7.805   51.174 86.498  1.00 24.94  ? 243 LEU C CD1   1 
ATOM   3541 C CD2   . LEU E 5 243 ? 8.697   49.197 87.710  1.00 26.18  ? 243 LEU C CD2   1 
ATOM   3542 N N     . MET E 5 244 ? 4.492   51.479 87.742  1.00 33.04  ? 244 MET C N     1 
ATOM   3543 C CA    . MET E 5 244 ? 3.244   50.833 87.382  1.00 31.04  ? 244 MET C CA    1 
ATOM   3544 C C     . MET E 5 244 ? 3.515   49.936 86.188  1.00 30.30  ? 244 MET C C     1 
ATOM   3545 O O     . MET E 5 244 ? 4.024   50.394 85.171  1.00 32.65  ? 244 MET C O     1 
ATOM   3546 C CB    . MET E 5 244 ? 2.190   51.868 87.004  1.00 34.69  ? 244 MET C CB    1 
ATOM   3547 C CG    . MET E 5 244 ? 0.876   51.256 86.541  1.00 35.02  ? 244 MET C CG    1 
ATOM   3548 S SD    . MET E 5 244 ? -0.361  52.491 86.135  1.00 36.47  ? 244 MET C SD    1 
ATOM   3549 C CE    . MET E 5 244 ? -0.947  52.944 87.744  1.00 31.86  ? 244 MET C CE    1 
ATOM   3550 N N     . LEU E 5 245 ? 3.188   48.657 86.320  1.00 24.50  ? 245 LEU C N     1 
ATOM   3551 C CA    . LEU E 5 245 ? 3.385   47.689 85.242  1.00 22.60  ? 245 LEU C CA    1 
ATOM   3552 C C     . LEU E 5 245 ? 1.992   47.166 84.931  1.00 21.21  ? 245 LEU C C     1 
ATOM   3553 O O     . LEU E 5 245 ? 1.276   46.763 85.841  1.00 20.63  ? 245 LEU C O     1 
ATOM   3554 C CB    . LEU E 5 245 ? 4.286   46.540 85.710  1.00 19.21  ? 245 LEU C CB    1 
ATOM   3555 C CG    . LEU E 5 245 ? 5.624   46.931 86.339  1.00 18.17  ? 245 LEU C CG    1 
ATOM   3556 C CD1   . LEU E 5 245 ? 6.225   45.731 87.023  1.00 17.22  ? 245 LEU C CD1   1 
ATOM   3557 C CD2   . LEU E 5 245 ? 6.561   47.478 85.288  1.00 16.70  ? 245 LEU C CD2   1 
ATOM   3558 N N     . CYS E 5 246 ? 1.607   47.170 83.657  1.00 23.29  ? 246 CYS C N     1 
ATOM   3559 C CA    . CYS E 5 246 ? 0.271   46.722 83.276  1.00 23.36  ? 246 CYS C CA    1 
ATOM   3560 C C     . CYS E 5 246 ? 0.052   46.596 81.772  1.00 22.68  ? 246 CYS C C     1 
ATOM   3561 O O     . CYS E 5 246 ? 0.984   46.595 80.983  1.00 21.72  ? 246 CYS C O     1 
ATOM   3562 C CB    . CYS E 5 246 ? -0.753  47.707 83.826  1.00 28.54  ? 246 CYS C CB    1 
ATOM   3563 S SG    . CYS E 5 246 ? -0.452  49.378 83.220  1.00 28.14  ? 246 CYS C SG    1 
ATOM   3564 N N     . LEU E 5 247 ? -1.219  46.498 81.403  1.00 32.01  ? 247 LEU C N     1 
ATOM   3565 C CA    . LEU E 5 247 ? -1.657  46.387 80.018  1.00 32.34  ? 247 LEU C CA    1 
ATOM   3566 C C     . LEU E 5 247 ? -2.330  47.694 79.597  1.00 33.82  ? 247 LEU C C     1 
ATOM   3567 O O     . LEU E 5 247 ? -2.717  48.499 80.440  1.00 34.57  ? 247 LEU C O     1 
ATOM   3568 C CB    . LEU E 5 247 ? -2.658  45.241 79.897  1.00 18.13  ? 247 LEU C CB    1 
ATOM   3569 C CG    . LEU E 5 247 ? -2.152  43.876 79.442  1.00 17.41  ? 247 LEU C CG    1 
ATOM   3570 C CD1   . LEU E 5 247 ? -0.728  43.652 79.896  1.00 15.72  ? 247 LEU C CD1   1 
ATOM   3571 C CD2   . LEU E 5 247 ? -3.095  42.815 79.974  1.00 13.97  ? 247 LEU C CD2   1 
ATOM   3572 N N     . TYR E 5 248 ? -2.461  47.909 78.293  1.00 26.95  ? 248 TYR C N     1 
ATOM   3573 C CA    . TYR E 5 248 ? -3.120  49.111 77.790  1.00 29.72  ? 248 TYR C CA    1 
ATOM   3574 C C     . TYR E 5 248 ? -4.190  48.790 76.754  1.00 30.95  ? 248 TYR C C     1 
ATOM   3575 O O     . TYR E 5 248 ? -3.964  47.991 75.844  1.00 29.82  ? 248 TYR C O     1 
ATOM   3576 C CB    . TYR E 5 248 ? -2.094  50.104 77.215  1.00 37.78  ? 248 TYR C CB    1 
ATOM   3577 C CG    . TYR E 5 248 ? -1.413  49.716 75.916  1.00 37.44  ? 248 TYR C CG    1 
ATOM   3578 C CD1   . TYR E 5 248 ? -2.081  49.814 74.696  1.00 38.71  ? 248 TYR C CD1   1 
ATOM   3579 C CD2   . TYR E 5 248 ? -0.079  49.303 75.899  1.00 38.23  ? 248 TYR C CD2   1 
ATOM   3580 C CE1   . TYR E 5 248 ? -1.440  49.516 73.488  1.00 38.11  ? 248 TYR C CE1   1 
ATOM   3581 C CE2   . TYR E 5 248 ? 0.574   49.004 74.698  1.00 39.91  ? 248 TYR C CE2   1 
ATOM   3582 C CZ    . TYR E 5 248 ? -0.114  49.113 73.493  1.00 38.91  ? 248 TYR C CZ    1 
ATOM   3583 O OH    . TYR E 5 248 ? 0.517   48.815 72.300  1.00 37.33  ? 248 TYR C OH    1 
ATOM   3584 N N     . ASP E 5 249 ? -5.366  49.395 76.926  1.00 46.67  ? 249 ASP C N     1 
ATOM   3585 C CA    . ASP E 5 249 ? -6.496  49.216 76.010  1.00 50.64  ? 249 ASP C CA    1 
ATOM   3586 C C     . ASP E 5 249 ? -6.305  50.180 74.847  1.00 51.04  ? 249 ASP C C     1 
ATOM   3587 O O     . ASP E 5 249 ? -6.306  49.775 73.683  1.00 51.38  ? 249 ASP C O     1 
ATOM   3588 C CB    . ASP E 5 249 ? -7.820  49.533 76.712  1.00 68.82  ? 249 ASP C CB    1 
ATOM   3589 C CG    . ASP E 5 249 ? -8.374  48.355 77.475  1.00 73.68  ? 249 ASP C CG    1 
ATOM   3590 O OD1   . ASP E 5 249 ? -9.076  48.579 78.486  1.00 75.55  ? 249 ASP C OD1   1 
ATOM   3591 O OD2   . ASP E 5 249 ? -8.120  47.206 77.056  1.00 75.21  ? 249 ASP C OD2   1 
ATOM   3592 N N     . LYS E 5 250 ? -6.142  51.459 75.175  1.00 37.34  ? 250 LYS C N     1 
ATOM   3593 C CA    . LYS E 5 250 ? -5.932  52.481 74.167  1.00 38.51  ? 250 LYS C CA    1 
ATOM   3594 C C     . LYS E 5 250 ? -5.277  53.741 74.718  1.00 35.18  ? 250 LYS C C     1 
ATOM   3595 O O     . LYS E 5 250 ? -5.564  54.198 75.824  1.00 34.13  ? 250 LYS C O     1 
ATOM   3596 C CB    . LYS E 5 250 ? -7.249  52.840 73.478  1.00 76.58  ? 250 LYS C CB    1 
ATOM   3597 C CG    . LYS E 5 250 ? -8.237  53.591 74.339  1.00 84.27  ? 250 LYS C CG    1 
ATOM   3598 C CD    . LYS E 5 250 ? -9.420  54.058 73.504  1.00 89.67  ? 250 LYS C CD    1 
ATOM   3599 C CE    . LYS E 5 250 ? -8.960  54.928 72.331  1.00 89.67  ? 250 LYS C CE    1 
ATOM   3600 N NZ    . LYS E 5 250 ? -10.083 55.432 71.482  1.00 89.67  ? 250 LYS C NZ    1 
ATOM   3601 N N     . VAL E 5 251 ? -4.368  54.281 73.921  1.00 35.59  ? 251 VAL C N     1 
ATOM   3602 C CA    . VAL E 5 251 ? -3.649  55.489 74.261  1.00 32.30  ? 251 VAL C CA    1 
ATOM   3603 C C     . VAL E 5 251 ? -4.021  56.495 73.196  1.00 31.77  ? 251 VAL C C     1 
ATOM   3604 O O     . VAL E 5 251 ? -3.995  56.193 72.004  1.00 31.88  ? 251 VAL C O     1 
ATOM   3605 C CB    . VAL E 5 251 ? -2.135  55.249 74.244  1.00 18.81  ? 251 VAL C CB    1 
ATOM   3606 C CG1   . VAL E 5 251 ? -1.374  56.571 74.377  1.00 17.47  ? 251 VAL C CG1   1 
ATOM   3607 C CG2   . VAL E 5 251 ? -1.771  54.318 75.380  1.00 16.81  ? 251 VAL C CG2   1 
ATOM   3608 N N     . THR E 5 252 ? -4.386  57.691 73.635  1.00 34.45  ? 252 THR C N     1 
ATOM   3609 C CA    . THR E 5 252 ? -4.774  58.743 72.716  1.00 33.59  ? 252 THR C CA    1 
ATOM   3610 C C     . THR E 5 252 ? -4.344  60.110 73.249  1.00 32.59  ? 252 THR C C     1 
ATOM   3611 O O     . THR E 5 252 ? -4.288  60.320 74.464  1.00 32.90  ? 252 THR C O     1 
ATOM   3612 C CB    . THR E 5 252 ? -6.307  58.739 72.500  1.00 34.86  ? 252 THR C CB    1 
ATOM   3613 O OG1   . THR E 5 252 ? -6.965  59.101 73.720  1.00 34.30  ? 252 THR C OG1   1 
ATOM   3614 C CG2   . THR E 5 252 ? -6.780  57.358 72.081  1.00 32.47  ? 252 THR C CG2   1 
ATOM   3615 N N     . ARG E 5 253 ? -4.010  61.021 72.334  1.00 29.42  ? 253 ARG C N     1 
ATOM   3616 C CA    . ARG E 5 253 ? -3.624  62.373 72.713  1.00 30.21  ? 253 ARG C CA    1 
ATOM   3617 C C     . ARG E 5 253 ? -4.192  63.381 71.735  1.00 29.41  ? 253 ARG C C     1 
ATOM   3618 O O     . ARG E 5 253 ? -4.287  63.119 70.537  1.00 29.68  ? 253 ARG C O     1 
ATOM   3619 C CB    . ARG E 5 253 ? -2.106  62.545 72.759  1.00 33.26  ? 253 ARG C CB    1 
ATOM   3620 C CG    . ARG E 5 253 ? -1.419  62.327 71.441  1.00 34.53  ? 253 ARG C CG    1 
ATOM   3621 C CD    . ARG E 5 253 ? -0.193  63.206 71.308  1.00 34.33  ? 253 ARG C CD    1 
ATOM   3622 N NE    . ARG E 5 253 ? -0.521  64.442 70.620  1.00 36.89  ? 253 ARG C NE    1 
ATOM   3623 C CZ    . ARG E 5 253 ? -0.990  64.502 69.375  1.00 37.18  ? 253 ARG C CZ    1 
ATOM   3624 N NH1   . ARG E 5 253 ? -1.183  63.390 68.674  1.00 36.59  ? 253 ARG C NH1   1 
ATOM   3625 N NH2   . ARG E 5 253 ? -1.278  65.677 68.831  1.00 38.56  ? 253 ARG C NH2   1 
ATOM   3626 N N     . THR E 5 254 ? -4.589  64.528 72.268  1.00 39.39  ? 254 THR C N     1 
ATOM   3627 C CA    . THR E 5 254 ? -5.116  65.627 71.469  1.00 39.45  ? 254 THR C CA    1 
ATOM   3628 C C     . THR E 5 254 ? -4.269  66.808 71.921  1.00 38.82  ? 254 THR C C     1 
ATOM   3629 O O     . THR E 5 254 ? -4.295  67.176 73.095  1.00 39.31  ? 254 THR C O     1 
ATOM   3630 C CB    . THR E 5 254 ? -6.600  65.873 71.767  1.00 42.14  ? 254 THR C CB    1 
ATOM   3631 O OG1   . THR E 5 254 ? -7.343  64.704 71.407  1.00 44.59  ? 254 THR C OG1   1 
ATOM   3632 C CG2   . THR E 5 254 ? -7.124  67.051 70.960  1.00 42.13  ? 254 THR C CG2   1 
ATOM   3633 N N     . LYS E 5 255 ? -3.503  67.384 70.997  1.00 30.81  ? 255 LYS C N     1 
ATOM   3634 C CA    . LYS E 5 255 ? -2.607  68.469 71.356  1.00 30.91  ? 255 LYS C CA    1 
ATOM   3635 C C     . LYS E 5 255 ? -1.599  67.881 72.364  1.00 32.61  ? 255 LYS C C     1 
ATOM   3636 O O     . LYS E 5 255 ? -0.844  66.964 72.032  1.00 33.73  ? 255 LYS C O     1 
ATOM   3637 C CB    . LYS E 5 255 ? -3.398  69.619 71.977  1.00 35.32  ? 255 LYS C CB    1 
ATOM   3638 C CG    . LYS E 5 255 ? -3.741  70.747 71.017  1.00 33.54  ? 255 LYS C CG    1 
ATOM   3639 C CD    . LYS E 5 255 ? -4.503  70.281 69.795  1.00 33.59  ? 255 LYS C CD    1 
ATOM   3640 C CE    . LYS E 5 255 ? -4.977  71.480 68.975  1.00 34.42  ? 255 LYS C CE    1 
ATOM   3641 N NZ    . LYS E 5 255 ? -3.886  72.460 68.716  1.00 32.17  ? 255 LYS C NZ    1 
ATOM   3642 N N     . ALA E 5 256 ? -1.591  68.384 73.592  1.00 25.39  ? 256 ALA C N     1 
ATOM   3643 C CA    . ALA E 5 256 ? -0.672  67.873 74.596  1.00 26.24  ? 256 ALA C CA    1 
ATOM   3644 C C     . ALA E 5 256 ? -1.406  67.093 75.681  1.00 27.35  ? 256 ALA C C     1 
ATOM   3645 O O     . ALA E 5 256 ? -0.794  66.680 76.667  1.00 26.95  ? 256 ALA C O     1 
ATOM   3646 C CB    . ALA E 5 256 ? 0.106   69.012 75.220  1.00 15.89  ? 256 ALA C CB    1 
ATOM   3647 N N     . ARG E 5 257 ? -2.709  66.884 75.498  1.00 30.55  ? 257 ARG C N     1 
ATOM   3648 C CA    . ARG E 5 257 ? -3.516  66.151 76.475  1.00 33.00  ? 257 ARG C CA    1 
ATOM   3649 C C     . ARG E 5 257 ? -3.622  64.648 76.173  1.00 31.61  ? 257 ARG C C     1 
ATOM   3650 O O     . ARG E 5 257 ? -4.273  64.238 75.211  1.00 28.90  ? 257 ARG C O     1 
ATOM   3651 C CB    . ARG E 5 257 ? -4.919  66.760 76.554  1.00 61.08  ? 257 ARG C CB    1 
ATOM   3652 C CG    . ARG E 5 257 ? -4.942  68.218 77.001  1.00 67.31  ? 257 ARG C CG    1 
ATOM   3653 C CD    . ARG E 5 257 ? -6.364  68.782 77.018  1.00 72.21  ? 257 ARG C CD    1 
ATOM   3654 N NE    . ARG E 5 257 ? -7.008  68.734 75.702  1.00 76.47  ? 257 ARG C NE    1 
ATOM   3655 C CZ    . ARG E 5 257 ? -6.609  69.427 74.637  1.00 77.90  ? 257 ARG C CZ    1 
ATOM   3656 N NH1   . ARG E 5 257 ? -5.560  70.237 74.715  1.00 78.37  ? 257 ARG C NH1   1 
ATOM   3657 N NH2   . ARG E 5 257 ? -7.261  69.309 73.490  1.00 79.52  ? 257 ARG C NH2   1 
ATOM   3658 N N     . TRP E 5 258 ? -2.989  63.834 77.017  1.00 35.91  ? 258 TRP C N     1 
ATOM   3659 C CA    . TRP E 5 258 ? -2.997  62.380 76.847  1.00 33.80  ? 258 TRP C CA    1 
ATOM   3660 C C     . TRP E 5 258 ? -4.018  61.678 77.738  1.00 33.45  ? 258 TRP C C     1 
ATOM   3661 O O     . TRP E 5 258 ? -4.289  62.115 78.851  1.00 33.46  ? 258 TRP C O     1 
ATOM   3662 C CB    . TRP E 5 258 ? -1.613  61.808 77.149  1.00 33.60  ? 258 TRP C CB    1 
ATOM   3663 C CG    . TRP E 5 258 ? -0.540  62.223 76.191  1.00 32.02  ? 258 TRP C CG    1 
ATOM   3664 C CD1   . TRP E 5 258 ? -0.016  63.475 76.028  1.00 31.76  ? 258 TRP C CD1   1 
ATOM   3665 C CD2   . TRP E 5 258 ? 0.155   61.374 75.272  1.00 30.28  ? 258 TRP C CD2   1 
ATOM   3666 N NE1   . TRP E 5 258 ? 0.965   63.458 75.066  1.00 30.54  ? 258 TRP C NE1   1 
ATOM   3667 C CE2   . TRP E 5 258 ? 1.092   62.181 74.585  1.00 30.59  ? 258 TRP C CE2   1 
ATOM   3668 C CE3   . TRP E 5 258 ? 0.079   60.008 74.962  1.00 29.12  ? 258 TRP C CE3   1 
ATOM   3669 C CZ2   . TRP E 5 258 ? 1.949   61.664 73.604  1.00 30.13  ? 258 TRP C CZ2   1 
ATOM   3670 C CZ3   . TRP E 5 258 ? 0.925   59.499 73.991  1.00 30.03  ? 258 TRP C CZ3   1 
ATOM   3671 C CH2   . TRP E 5 258 ? 1.851   60.326 73.321  1.00 29.18  ? 258 TRP C CH2   1 
ATOM   3672 N N     . LYS E 5 259 ? -4.575  60.581 77.239  1.00 27.14  ? 259 LYS C N     1 
ATOM   3673 C CA    . LYS E 5 259 ? -5.560  59.803 77.982  1.00 28.39  ? 259 LYS C CA    1 
ATOM   3674 C C     . LYS E 5 259 ? -5.221  58.326 77.835  1.00 28.21  ? 259 LYS C C     1 
ATOM   3675 O O     . LYS E 5 259 ? -5.214  57.786 76.728  1.00 27.84  ? 259 LYS C O     1 
ATOM   3676 C CB    . LYS E 5 259 ? -6.967  60.067 77.444  1.00 48.83  ? 259 LYS C CB    1 
ATOM   3677 C CG    . LYS E 5 259 ? -7.540  61.434 77.808  1.00 52.15  ? 259 LYS C CG    1 
ATOM   3678 C CD    . LYS E 5 259 ? -8.925  61.624 77.201  1.00 55.05  ? 259 LYS C CD    1 
ATOM   3679 C CE    . LYS E 5 259 ? -9.612  62.887 77.711  1.00 57.99  ? 259 LYS C CE    1 
ATOM   3680 N NZ    . LYS E 5 259 ? -10.010 62.787 79.145  1.00 59.21  ? 259 LYS C NZ    1 
ATOM   3681 N N     . CYS E 5 260 ? -4.946  57.665 78.952  1.00 34.97  ? 260 CYS C N     1 
ATOM   3682 C CA    . CYS E 5 260 ? -4.593  56.257 78.897  1.00 35.82  ? 260 CYS C CA    1 
ATOM   3683 C C     . CYS E 5 260 ? -5.526  55.321 79.631  1.00 34.00  ? 260 CYS C C     1 
ATOM   3684 O O     . CYS E 5 260 ? -5.728  55.452 80.845  1.00 32.76  ? 260 CYS C O     1 
ATOM   3685 C CB    . CYS E 5 260 ? -3.184  56.058 79.438  1.00 40.13  ? 260 CYS C CB    1 
ATOM   3686 S SG    . CYS E 5 260 ? -1.984  56.985 78.527  1.00 46.76  ? 260 CYS C SG    1 
ATOM   3687 N N     . SER E 5 261 ? -6.080  54.368 78.887  1.00 24.55  ? 261 SER C N     1 
ATOM   3688 C CA    . SER E 5 261 ? -6.962  53.366 79.467  1.00 24.94  ? 261 SER C CA    1 
ATOM   3689 C C     . SER E 5 261 ? -6.111  52.115 79.697  1.00 24.33  ? 261 SER C C     1 
ATOM   3690 O O     . SER E 5 261 ? -5.632  51.486 78.756  1.00 21.09  ? 261 SER C O     1 
ATOM   3691 C CB    . SER E 5 261 ? -8.128  53.058 78.528  1.00 49.85  ? 261 SER C CB    1 
ATOM   3692 O OG    . SER E 5 261 ? -7.671  52.575 77.281  1.00 57.46  ? 261 SER C OG    1 
ATOM   3693 N N     . LEU E 5 262 ? -5.911  51.781 80.964  1.00 45.76  ? 262 LEU C N     1 
ATOM   3694 C CA    . LEU E 5 262 ? -5.102  50.635 81.336  1.00 45.74  ? 262 LEU C CA    1 
ATOM   3695 C C     . LEU E 5 262 ? -5.957  49.546 81.969  1.00 47.72  ? 262 LEU C C     1 
ATOM   3696 O O     . LEU E 5 262 ? -7.127  49.769 82.274  1.00 48.36  ? 262 LEU C O     1 
ATOM   3697 C CB    . LEU E 5 262 ? -4.012  51.082 82.318  1.00 26.06  ? 262 LEU C CB    1 
ATOM   3698 C CG    . LEU E 5 262 ? -2.808  51.907 81.824  1.00 24.92  ? 262 LEU C CG    1 
ATOM   3699 C CD1   . LEU E 5 262 ? -2.924  52.233 80.341  1.00 22.88  ? 262 LEU C CD1   1 
ATOM   3700 C CD2   . LEU E 5 262 ? -2.695  53.170 82.662  1.00 23.41  ? 262 LEU C CD2   1 
ATOM   3701 N N     . LYS E 5 263 ? -5.363  48.368 82.152  1.00 31.89  ? 263 LYS C N     1 
ATOM   3702 C CA    . LYS E 5 263 ? -6.042  47.229 82.762  1.00 32.57  ? 263 LYS C CA    1 
ATOM   3703 C C     . LYS E 5 263 ? -5.043  46.218 83.336  1.00 31.85  ? 263 LYS C C     1 
ATOM   3704 O O     . LYS E 5 263 ? -3.852  46.276 83.040  1.00 31.33  ? 263 LYS C O     1 
ATOM   3705 C CB    . LYS E 5 263 ? -6.951  46.530 81.746  1.00 58.95  ? 263 LYS C CB    1 
ATOM   3706 C CG    . LYS E 5 263 ? -6.224  45.781 80.645  1.00 63.05  ? 263 LYS C CG    1 
ATOM   3707 C CD    . LYS E 5 263 ? -7.154  44.788 79.956  1.00 66.27  ? 263 LYS C CD    1 
ATOM   3708 C CE    . LYS E 5 263 ? -8.388  45.477 79.386  1.00 69.41  ? 263 LYS C CE    1 
ATOM   3709 N NZ    . LYS E 5 263 ? -9.379  44.514 78.823  1.00 71.99  ? 263 LYS C NZ    1 
ATOM   3710 N N     . ASP E 5 264 ? -5.551  45.302 84.160  1.00 35.20  ? 264 ASP C N     1 
ATOM   3711 C CA    . ASP E 5 264 ? -4.756  44.254 84.805  1.00 35.00  ? 264 ASP C CA    1 
ATOM   3712 C C     . ASP E 5 264 ? -3.345  44.714 85.144  1.00 33.37  ? 264 ASP C C     1 
ATOM   3713 O O     . ASP E 5 264 ? -2.374  44.279 84.527  1.00 32.98  ? 264 ASP C O     1 
ATOM   3714 C CB    . ASP E 5 264 ? -4.677  43.018 83.906  1.00 41.25  ? 264 ASP C CB    1 
ATOM   3715 C CG    . ASP E 5 264 ? -6.027  42.618 83.333  1.00 44.73  ? 264 ASP C CG    1 
ATOM   3716 O OD1   . ASP E 5 264 ? -7.061  43.146 83.798  1.00 45.84  ? 264 ASP C OD1   1 
ATOM   3717 O OD2   . ASP E 5 264 ? -6.056  41.766 82.416  1.00 46.07  ? 264 ASP C OD2   1 
ATOM   3718 N N     . GLY E 5 265 ? -3.227  45.584 86.136  1.00 29.98  ? 265 GLY C N     1 
ATOM   3719 C CA    . GLY E 5 265 ? -1.913  46.071 86.497  1.00 28.86  ? 265 GLY C CA    1 
ATOM   3720 C C     . GLY E 5 265 ? -1.617  46.088 87.978  1.00 28.64  ? 265 GLY C C     1 
ATOM   3721 O O     . GLY E 5 265 ? -2.489  45.886 88.822  1.00 30.21  ? 265 GLY C O     1 
ATOM   3722 N N     . VAL E 5 266 ? -0.354  46.327 88.291  1.00 28.56  ? 266 VAL C N     1 
ATOM   3723 C CA    . VAL E 5 266 ? 0.104   46.393 89.666  1.00 26.65  ? 266 VAL C CA    1 
ATOM   3724 C C     . VAL E 5 266 ? 1.014   47.625 89.768  1.00 26.00  ? 266 VAL C C     1 
ATOM   3725 O O     . VAL E 5 266 ? 1.733   47.966 88.823  1.00 24.00  ? 266 VAL C O     1 
ATOM   3726 C CB    . VAL E 5 266 ? 0.855   45.084 90.057  1.00 25.11  ? 266 VAL C CB    1 
ATOM   3727 C CG1   . VAL E 5 266 ? 1.900   44.748 89.024  1.00 25.05  ? 266 VAL C CG1   1 
ATOM   3728 C CG2   . VAL E 5 266 ? 1.499   45.241 91.411  1.00 25.89  ? 266 VAL C CG2   1 
ATOM   3729 N N     . VAL E 5 267 ? 0.960   48.314 90.899  1.00 27.75  ? 267 VAL C N     1 
ATOM   3730 C CA    . VAL E 5 267 ? 1.770   49.505 91.065  1.00 28.39  ? 267 VAL C CA    1 
ATOM   3731 C C     . VAL E 5 267 ? 2.291   49.678 92.490  1.00 30.01  ? 267 VAL C C     1 
ATOM   3732 O O     . VAL E 5 267 ? 1.611   49.333 93.455  1.00 30.36  ? 267 VAL C O     1 
ATOM   3733 C CB    . VAL E 5 267 ? 0.963   50.774 90.643  1.00 24.80  ? 267 VAL C CB    1 
ATOM   3734 C CG1   . VAL E 5 267 ? -0.352  50.841 91.407  1.00 21.81  ? 267 VAL C CG1   1 
ATOM   3735 C CG2   . VAL E 5 267 ? 1.794   52.042 90.876  1.00 23.02  ? 267 VAL C CG2   1 
ATOM   3736 N N     . THR E 5 268 ? 3.515   50.197 92.598  1.00 35.98  ? 268 THR C N     1 
ATOM   3737 C CA    . THR E 5 268 ? 4.160   50.466 93.881  1.00 40.60  ? 268 THR C CA    1 
ATOM   3738 C C     . THR E 5 268 ? 4.232   51.987 94.007  1.00 42.15  ? 268 THR C C     1 
ATOM   3739 O O     . THR E 5 268 ? 4.882   52.655 93.203  1.00 41.67  ? 268 THR C O     1 
ATOM   3740 C CB    . THR E 5 268 ? 5.605   49.897 93.932  1.00 46.22  ? 268 THR C CB    1 
ATOM   3741 O OG1   . THR E 5 268 ? 5.573   48.468 93.834  1.00 49.00  ? 268 THR C OG1   1 
ATOM   3742 C CG2   . THR E 5 268 ? 6.286   50.291 95.229  1.00 46.57  ? 268 THR C CG2   1 
ATOM   3743 N N     . ILE E 5 269 ? 3.552   52.541 95.000  1.00 44.23  ? 269 ILE C N     1 
ATOM   3744 C CA    . ILE E 5 269 ? 3.562   53.985 95.191  1.00 45.69  ? 269 ILE C CA    1 
ATOM   3745 C C     . ILE E 5 269 ? 3.979   54.315 96.617  1.00 47.92  ? 269 ILE C C     1 
ATOM   3746 O O     . ILE E 5 269 ? 3.197   54.156 97.553  1.00 48.16  ? 269 ILE C O     1 
ATOM   3747 C CB    . ILE E 5 269 ? 2.166   54.601 94.937  1.00 45.80  ? 269 ILE C CB    1 
ATOM   3748 C CG1   . ILE E 5 269 ? 1.674   54.262 93.534  1.00 43.69  ? 269 ILE C CG1   1 
ATOM   3749 C CG2   . ILE E 5 269 ? 2.238   56.109 95.067  1.00 46.96  ? 269 ILE C CG2   1 
ATOM   3750 C CD1   . ILE E 5 269 ? 0.258   54.719 93.297  1.00 43.05  ? 269 ILE C CD1   1 
ATOM   3751 N N     . ASN E 5 270 ? 5.217   54.767 96.778  1.00 52.69  ? 270 ASN C N     1 
ATOM   3752 C CA    . ASN E 5 270 ? 5.735   55.123 98.093  1.00 54.73  ? 270 ASN C CA    1 
ATOM   3753 C C     . ASN E 5 270 ? 5.743   53.915 99.024  1.00 55.38  ? 270 ASN C C     1 
ATOM   3754 O O     . ASN E 5 270 ? 5.086   53.915 100.071 1.00 55.40  ? 270 ASN C O     1 
ATOM   3755 C CB    . ASN E 5 270 ? 4.892   56.250 98.691  1.00 69.00  ? 270 ASN C CB    1 
ATOM   3756 C CG    . ASN E 5 270 ? 4.879   57.492 97.815  1.00 70.70  ? 270 ASN C CG    1 
ATOM   3757 O OD1   . ASN E 5 270 ? 3.982   58.330 97.918  1.00 71.18  ? 270 ASN C OD1   1 
ATOM   3758 N ND2   . ASN E 5 270 ? 5.883   57.620 96.952  1.00 70.73  ? 270 ASN C ND2   1 
ATOM   3759 N N     . ARG E 5 271 ? 6.480   52.882 98.617  1.00 50.47  ? 271 ARG C N     1 
ATOM   3760 C CA    . ARG E 5 271 ? 6.622   51.656 99.394  1.00 49.07  ? 271 ARG C CA    1 
ATOM   3761 C C     . ARG E 5 271 ? 5.323   50.875 99.647  1.00 46.28  ? 271 ARG C C     1 
ATOM   3762 O O     . ARG E 5 271 ? 5.305   49.944 100.453 1.00 45.35  ? 271 ARG C O     1 
ATOM   3763 C CB    . ARG E 5 271 ? 7.297   51.986 100.722 1.00 62.14  ? 271 ARG C CB    1 
ATOM   3764 C CG    . ARG E 5 271 ? 8.672   52.613 100.580 1.00 65.05  ? 271 ARG C CG    1 
ATOM   3765 C CD    . ARG E 5 271 ? 9.733   51.555 100.386 1.00 67.84  ? 271 ARG C CD    1 
ATOM   3766 N NE    . ARG E 5 271 ? 11.072  52.084 100.625 1.00 71.98  ? 271 ARG C NE    1 
ATOM   3767 C CZ    . ARG E 5 271 ? 12.146  51.333 100.864 1.00 74.66  ? 271 ARG C CZ    1 
ATOM   3768 N NH1   . ARG E 5 271 ? 13.325  51.907 101.069 1.00 75.57  ? 271 ARG C NH1   1 
ATOM   3769 N NH2   . ARG E 5 271 ? 12.043  50.008 100.910 1.00 76.61  ? 271 ARG C NH2   1 
ATOM   3770 N N     . ASN E 5 272 ? 4.243   51.250 98.965  1.00 38.02  ? 272 ASN C N     1 
ATOM   3771 C CA    . ASN E 5 272 ? 2.955   50.560 99.106  1.00 36.19  ? 272 ASN C CA    1 
ATOM   3772 C C     . ASN E 5 272 ? 2.463   50.076 97.746  1.00 33.14  ? 272 ASN C C     1 
ATOM   3773 O O     . ASN E 5 272 ? 2.546   50.803 96.752  1.00 32.39  ? 272 ASN C O     1 
ATOM   3774 C CB    . ASN E 5 272 ? 1.911   51.483 99.728  1.00 70.76  ? 272 ASN C CB    1 
ATOM   3775 C CG    . ASN E 5 272 ? 1.986   51.509 101.233 1.00 74.26  ? 272 ASN C CG    1 
ATOM   3776 O OD1   . ASN E 5 272 ? 1.367   52.352 101.874 1.00 76.42  ? 272 ASN C OD1   1 
ATOM   3777 N ND2   . ASN E 5 272 ? 2.737   50.577 101.811 1.00 75.55  ? 272 ASN C ND2   1 
ATOM   3778 N N     . ASP E 5 273 ? 1.953   48.848 97.709  1.00 28.40  ? 273 ASP C N     1 
ATOM   3779 C CA    . ASP E 5 273 ? 1.474   48.254 96.464  1.00 28.05  ? 273 ASP C CA    1 
ATOM   3780 C C     . ASP E 5 273 ? -0.041  48.224 96.301  1.00 27.28  ? 273 ASP C C     1 
ATOM   3781 O O     . ASP E 5 273 ? -0.791  48.071 97.271  1.00 26.28  ? 273 ASP C O     1 
ATOM   3782 C CB    . ASP E 5 273 ? 2.017   46.826 96.315  1.00 33.65  ? 273 ASP C CB    1 
ATOM   3783 C CG    . ASP E 5 273 ? 3.438   46.791 95.783  1.00 35.39  ? 273 ASP C CG    1 
ATOM   3784 O OD1   . ASP E 5 273 ? 4.146   47.810 95.893  1.00 34.58  ? 273 ASP C OD1   1 
ATOM   3785 O OD2   . ASP E 5 273 ? 3.858   45.739 95.263  1.00 36.23  ? 273 ASP C OD2   1 
ATOM   3786 N N     . TYR E 5 274 ? -0.476  48.371 95.055  1.00 32.48  ? 274 TYR C N     1 
ATOM   3787 C CA    . TYR E 5 274 ? -1.889  48.334 94.701  1.00 33.00  ? 274 TYR C CA    1 
ATOM   3788 C C     . TYR E 5 274 ? -1.989  47.545 93.417  1.00 34.05  ? 274 TYR C C     1 
ATOM   3789 O O     . TYR E 5 274 ? -1.032  47.464 92.651  1.00 35.07  ? 274 TYR C O     1 
ATOM   3790 C CB    . TYR E 5 274 ? -2.449  49.736 94.446  1.00 34.96  ? 274 TYR C CB    1 
ATOM   3791 C CG    . TYR E 5 274 ? -2.177  50.715 95.552  1.00 34.12  ? 274 TYR C CG    1 
ATOM   3792 C CD1   . TYR E 5 274 ? -0.939  51.344 95.658  1.00 34.23  ? 274 TYR C CD1   1 
ATOM   3793 C CD2   . TYR E 5 274 ? -3.140  50.978 96.522  1.00 33.44  ? 274 TYR C CD2   1 
ATOM   3794 C CE1   . TYR E 5 274 ? -0.665  52.204 96.703  1.00 35.02  ? 274 TYR C CE1   1 
ATOM   3795 C CE2   . TYR E 5 274 ? -2.878  51.834 97.573  1.00 33.84  ? 274 TYR C CE2   1 
ATOM   3796 C CZ    . TYR E 5 274 ? -1.639  52.445 97.661  1.00 35.35  ? 274 TYR C CZ    1 
ATOM   3797 O OH    . TYR E 5 274 ? -1.369  53.294 98.716  1.00 37.19  ? 274 TYR C OH    1 
ATOM   3798 N N     . THR E 5 275 ? -3.147  46.955 93.185  1.00 35.79  ? 275 THR C N     1 
ATOM   3799 C CA    . THR E 5 275 ? -3.363  46.195 91.975  1.00 36.30  ? 275 THR C CA    1 
ATOM   3800 C C     . THR E 5 275 ? -4.650  46.751 91.407  1.00 36.04  ? 275 THR C C     1 
ATOM   3801 O O     . THR E 5 275 ? -5.495  47.231 92.156  1.00 37.26  ? 275 THR C O     1 
ATOM   3802 C CB    . THR E 5 275 ? -3.525  44.694 92.285  1.00 38.50  ? 275 THR C CB    1 
ATOM   3803 O OG1   . THR E 5 275 ? -4.602  44.507 93.212  1.00 38.89  ? 275 THR C OG1   1 
ATOM   3804 C CG2   . THR E 5 275 ? -2.248  44.143 92.888  1.00 36.41  ? 275 THR C CG2   1 
ATOM   3805 N N     . PHE E 5 276 ? -4.804  46.720 90.093  1.00 30.75  ? 276 PHE C N     1 
ATOM   3806 C CA    . PHE E 5 276 ? -6.030  47.235 89.519  1.00 29.48  ? 276 PHE C CA    1 
ATOM   3807 C C     . PHE E 5 276 ? -6.567  46.465 88.336  1.00 30.12  ? 276 PHE C C     1 
ATOM   3808 O O     . PHE E 5 276 ? -5.846  45.731 87.651  1.00 29.86  ? 276 PHE C O     1 
ATOM   3809 C CB    . PHE E 5 276 ? -5.865  48.701 89.123  1.00 31.35  ? 276 PHE C CB    1 
ATOM   3810 C CG    . PHE E 5 276 ? -4.750  48.955 88.156  1.00 28.99  ? 276 PHE C CG    1 
ATOM   3811 C CD1   . PHE E 5 276 ? -3.487  49.308 88.615  1.00 28.06  ? 276 PHE C CD1   1 
ATOM   3812 C CD2   . PHE E 5 276 ? -4.973  48.882 86.787  1.00 29.28  ? 276 PHE C CD2   1 
ATOM   3813 C CE1   . PHE E 5 276 ? -2.456  49.593 87.726  1.00 29.00  ? 276 PHE C CE1   1 
ATOM   3814 C CE2   . PHE E 5 276 ? -3.955  49.163 85.884  1.00 29.98  ? 276 PHE C CE2   1 
ATOM   3815 C CZ    . PHE E 5 276 ? -2.689  49.521 86.356  1.00 29.97  ? 276 PHE C CZ    1 
ATOM   3816 N N     . GLN E 5 277 ? -7.866  46.646 88.125  1.00 30.72  ? 277 GLN C N     1 
ATOM   3817 C CA    . GLN E 5 277 ? -8.604  46.031 87.031  1.00 31.38  ? 277 GLN C CA    1 
ATOM   3818 C C     . GLN E 5 277 ? -8.500  47.017 85.881  1.00 30.14  ? 277 GLN C C     1 
ATOM   3819 O O     . GLN E 5 277 ? -8.218  46.638 84.745  1.00 27.86  ? 277 GLN C O     1 
ATOM   3820 C CB    . GLN E 5 277 ? -10.069 45.845 87.442  1.00 55.18  ? 277 GLN C CB    1 
ATOM   3821 C CG    . GLN E 5 277 ? -10.984 45.305 86.366  1.00 58.95  ? 277 GLN C CG    1 
ATOM   3822 C CD    . GLN E 5 277 ? -10.592 43.922 85.910  1.00 62.83  ? 277 GLN C CD    1 
ATOM   3823 O OE1   . GLN E 5 277 ? -9.531  43.725 85.323  1.00 65.54  ? 277 GLN C OE1   1 
ATOM   3824 N NE2   . GLN E 5 277 ? -11.449 42.949 86.180  1.00 64.95  ? 277 GLN C NE2   1 
ATOM   3825 N N     . LYS E 5 278 ? -8.722  48.289 86.209  1.00 26.90  ? 278 LYS C N     1 
ATOM   3826 C CA    . LYS E 5 278 ? -8.667  49.382 85.247  1.00 27.98  ? 278 LYS C CA    1 
ATOM   3827 C C     . LYS E 5 278 ? -7.961  50.579 85.849  1.00 27.29  ? 278 LYS C C     1 
ATOM   3828 O O     . LYS E 5 278 ? -8.026  50.816 87.058  1.00 26.74  ? 278 LYS C O     1 
ATOM   3829 C CB    . LYS E 5 278 ? -10.073 49.820 84.835  1.00 52.89  ? 278 LYS C CB    1 
ATOM   3830 C CG    . LYS E 5 278 ? -10.851 48.780 84.088  1.00 57.46  ? 278 LYS C CG    1 
ATOM   3831 C CD    . LYS E 5 278 ? -12.145 49.352 83.565  1.00 62.23  ? 278 LYS C CD    1 
ATOM   3832 C CE    . LYS E 5 278 ? -12.791 48.374 82.605  1.00 66.23  ? 278 LYS C CE    1 
ATOM   3833 N NZ    . LYS E 5 278 ? -11.821 47.961 81.542  1.00 69.17  ? 278 LYS C NZ    1 
ATOM   3834 N N     . ALA E 5 279 ? -7.283  51.334 84.995  1.00 29.84  ? 279 ALA C N     1 
ATOM   3835 C CA    . ALA E 5 279 ? -6.587  52.538 85.418  1.00 30.15  ? 279 ALA C CA    1 
ATOM   3836 C C     . ALA E 5 279 ? -6.881  53.586 84.357  1.00 29.63  ? 279 ALA C C     1 
ATOM   3837 O O     . ALA E 5 279 ? -6.971  53.278 83.165  1.00 28.49  ? 279 ALA C O     1 
ATOM   3838 C CB    . ALA E 5 279 ? -5.093  52.288 85.514  1.00 61.26  ? 279 ALA C CB    1 
ATOM   3839 N N     . GLN E 5 280 ? -7.063  54.821 84.795  1.00 29.08  ? 280 GLN C N     1 
ATOM   3840 C CA    . GLN E 5 280 ? -7.336  55.898 83.870  1.00 29.76  ? 280 GLN C CA    1 
ATOM   3841 C C     . GLN E 5 280 ? -6.272  56.934 84.048  1.00 28.10  ? 280 GLN C C     1 
ATOM   3842 O O     . GLN E 5 280 ? -6.069  57.440 85.146  1.00 26.24  ? 280 GLN C O     1 
ATOM   3843 C CB    . GLN E 5 280 ? -8.702  56.515 84.144  1.00 68.38  ? 280 GLN C CB    1 
ATOM   3844 C CG    . GLN E 5 280 ? -9.837  55.721 83.560  1.00 73.57  ? 280 GLN C CG    1 
ATOM   3845 C CD    . GLN E 5 280 ? -9.603  55.407 82.094  1.00 77.66  ? 280 GLN C CD    1 
ATOM   3846 O OE1   . GLN E 5 280 ? -9.274  56.295 81.296  1.00 77.37  ? 280 GLN C OE1   1 
ATOM   3847 N NE2   . GLN E 5 280 ? -9.772  54.137 81.729  1.00 78.98  ? 280 GLN C NE2   1 
ATOM   3848 N N     . VAL E 5 281 ? -5.569  57.244 82.975  1.00 30.47  ? 281 VAL C N     1 
ATOM   3849 C CA    . VAL E 5 281 ? -4.542  58.254 83.081  1.00 31.06  ? 281 VAL C CA    1 
ATOM   3850 C C     . VAL E 5 281 ? -4.913  59.495 82.263  1.00 32.77  ? 281 VAL C C     1 
ATOM   3851 O O     . VAL E 5 281 ? -5.445  59.395 81.146  1.00 31.29  ? 281 VAL C O     1 
ATOM   3852 C CB    . VAL E 5 281 ? -3.167  57.702 82.629  1.00 29.58  ? 281 VAL C CB    1 
ATOM   3853 C CG1   . VAL E 5 281 ? -2.068  58.721 82.921  1.00 26.52  ? 281 VAL C CG1   1 
ATOM   3854 C CG2   . VAL E 5 281 ? -2.879  56.392 83.351  1.00 28.38  ? 281 VAL C CG2   1 
ATOM   3855 N N     . GLU E 5 282 ? -4.660  60.658 82.859  1.00 36.49  ? 282 GLU C N     1 
ATOM   3856 C CA    . GLU E 5 282 ? -4.911  61.948 82.225  1.00 38.49  ? 282 GLU C CA    1 
ATOM   3857 C C     . GLU E 5 282 ? -3.752  62.891 82.551  1.00 36.77  ? 282 GLU C C     1 
ATOM   3858 O O     . GLU E 5 282 ? -3.780  63.619 83.538  1.00 37.30  ? 282 GLU C O     1 
ATOM   3859 C CB    . GLU E 5 282 ? -6.238  62.535 82.703  1.00 58.12  ? 282 GLU C CB    1 
ATOM   3860 C CG    . GLU E 5 282 ? -7.442  61.773 82.187  1.00 65.77  ? 282 GLU C CG    1 
ATOM   3861 C CD    . GLU E 5 282 ? -8.755  62.408 82.590  1.00 70.72  ? 282 GLU C CD    1 
ATOM   3862 O OE1   . GLU E 5 282 ? -9.816  61.841 82.243  1.00 73.46  ? 282 GLU C OE1   1 
ATOM   3863 O OE2   . GLU E 5 282 ? -8.727  63.471 83.251  1.00 73.52  ? 282 GLU C OE2   1 
ATOM   3864 N N     . ALA E 5 283 ? -2.726  62.848 81.710  1.00 28.25  ? 283 ALA C N     1 
ATOM   3865 C CA    . ALA E 5 283 ? -1.542  63.668 81.882  1.00 30.07  ? 283 ALA C CA    1 
ATOM   3866 C C     . ALA E 5 283 ? -1.364  64.604 80.698  1.00 30.67  ? 283 ALA C C     1 
ATOM   3867 O O     . ALA E 5 283 ? -1.610  64.228 79.550  1.00 28.98  ? 283 ALA C O     1 
ATOM   3868 C CB    . ALA E 5 283 ? -0.313  62.783 82.030  1.00 42.83  ? 283 ALA C CB    1 
ATOM   3869 N N     . GLU E 5 284 ? -0.938  65.829 80.981  1.00 32.28  ? 284 GLU C N     1 
ATOM   3870 C CA    . GLU E 5 284 ? -0.718  66.804 79.930  1.00 36.59  ? 284 GLU C CA    1 
ATOM   3871 C C     . GLU E 5 284 ? 0.773   66.982 79.683  1.00 34.99  ? 284 GLU C C     1 
ATOM   3872 O O     . GLU E 5 284 ? 1.524   67.375 80.580  1.00 32.00  ? 284 GLU C O     1 
ATOM   3873 C CB    . GLU E 5 284 ? -1.345  68.146 80.297  1.00 87.17  ? 284 GLU C CB    1 
ATOM   3874 C CG    . GLU E 5 284 ? -1.170  69.192 79.214  1.00 90.00  ? 284 GLU C CG    1 
ATOM   3875 C CD    . GLU E 5 284 ? -1.633  70.560 79.648  1.00 90.00  ? 284 GLU C CD    1 
ATOM   3876 O OE1   . GLU E 5 284 ? -1.201  71.014 80.730  1.00 90.00  ? 284 GLU C OE1   1 
ATOM   3877 O OE2   . GLU E 5 284 ? -2.423  71.184 78.907  1.00 90.00  ? 284 GLU C OE2   1 
ATOM   3878 N N     . TRP E 5 285 ? 1.193   66.683 78.458  1.00 53.43  ? 285 TRP C N     1 
ATOM   3879 C CA    . TRP E 5 285 ? 2.590   66.799 78.074  1.00 54.80  ? 285 TRP C CA    1 
ATOM   3880 C C     . TRP E 5 285 ? 2.977   68.262 77.932  1.00 59.93  ? 285 TRP C C     1 
ATOM   3881 O O     . TRP E 5 285 ? 3.094   68.775 76.821  1.00 61.91  ? 285 TRP C O     1 
ATOM   3882 C CB    . TRP E 5 285 ? 2.836   66.083 76.743  1.00 37.14  ? 285 TRP C CB    1 
ATOM   3883 C CG    . TRP E 5 285 ? 4.290   65.875 76.443  1.00 31.90  ? 285 TRP C CG    1 
ATOM   3884 C CD1   . TRP E 5 285 ? 5.148   65.050 77.106  1.00 30.72  ? 285 TRP C CD1   1 
ATOM   3885 C CD2   . TRP E 5 285 ? 5.061   66.510 75.415  1.00 29.34  ? 285 TRP C CD2   1 
ATOM   3886 N NE1   . TRP E 5 285 ? 6.404   65.128 76.560  1.00 28.85  ? 285 TRP C NE1   1 
ATOM   3887 C CE2   . TRP E 5 285 ? 6.381   66.019 75.520  1.00 29.25  ? 285 TRP C CE2   1 
ATOM   3888 C CE3   . TRP E 5 285 ? 4.768   67.444 74.417  1.00 27.02  ? 285 TRP C CE3   1 
ATOM   3889 C CZ2   . TRP E 5 285 ? 7.410   66.435 74.662  1.00 27.77  ? 285 TRP C CZ2   1 
ATOM   3890 C CZ3   . TRP E 5 285 ? 5.791   67.857 73.565  1.00 26.03  ? 285 TRP C CZ3   1 
ATOM   3891 C CH2   . TRP E 5 285 ? 7.094   67.353 73.695  1.00 26.29  ? 285 TRP C CH2   1 
ATOM   3892 N N     . VAL E 5 286 ? 3.164   68.942 79.054  1.00 80.26  ? 286 VAL C N     1 
ATOM   3893 C CA    . VAL E 5 286 ? 3.550   70.341 79.006  1.00 84.01  ? 286 VAL C CA    1 
ATOM   3894 C C     . VAL E 5 286 ? 4.538   70.620 80.122  1.00 86.39  ? 286 VAL C C     1 
ATOM   3895 O O     . VAL E 5 286 ? 4.633   69.770 81.033  1.00 87.28  ? 286 VAL C O     1 
ATOM   3896 C CB    . VAL E 5 286 ? 2.326   71.267 79.163  1.00 75.69  ? 286 VAL C CB    1 
ATOM   3897 C CG1   . VAL E 5 286 ? 2.762   72.724 79.073  1.00 77.57  ? 286 VAL C CG1   1 
ATOM   3898 C CG2   . VAL E 5 286 ? 1.303   70.963 78.078  1.00 76.91  ? 286 VAL C CG2   1 
ATOM   3899 O OXT   . VAL E 5 286 ? 5.199   71.680 80.070  1.00 87.66  ? 286 VAL C OXT   1 
HETATM 3900 O O     . HOH F 6 .   ? 0.822   63.728 51.011  1.00 72.30  ? 19  HOH D O     1 
HETATM 3901 O O     . HOH F 6 .   ? -13.892 55.210 56.997  1.00 64.12  ? 20  HOH D O     1 
HETATM 3902 O O     . HOH F 6 .   ? -4.728  66.603 52.330  1.00 77.29  ? 21  HOH D O     1 
HETATM 3903 O O     . HOH F 6 .   ? -10.629 64.050 74.415  1.00 71.97  ? 22  HOH D O     1 
HETATM 3904 O O     . HOH F 6 .   ? 16.108  56.669 50.235  1.00 62.40  ? 23  HOH D O     1 
HETATM 3905 O O     . HOH F 6 .   ? -13.443 65.281 67.842  1.00 71.03  ? 24  HOH D O     1 
HETATM 3906 O O     . HOH F 6 .   ? -4.674  65.863 55.225  1.00 57.82  ? 25  HOH D O     1 
HETATM 3907 O O     . HOH F 6 .   ? 13.178  63.047 44.995  1.00 76.21  ? 26  HOH D O     1 
HETATM 3908 O O     . HOH F 6 .   ? -39.509 70.503 74.072  1.00 4.58   ? 27  HOH D O     1 
HETATM 3909 O O     . HOH F 6 .   ? -7.504  66.578 59.494  1.00 48.71  ? 28  HOH D O     1 
HETATM 3910 O O     . HOH F 6 .   ? -8.219  63.031 59.093  1.00 60.29  ? 29  HOH D O     1 
HETATM 3911 O O     . HOH F 6 .   ? 6.340   60.983 48.189  1.00 81.36  ? 30  HOH D O     1 
HETATM 3912 O O     . HOH F 6 .   ? -3.108  67.507 49.747  1.00 59.09  ? 31  HOH D O     1 
HETATM 3913 O O     . HOH F 6 .   ? -26.380 77.213 80.092  1.00 70.51  ? 32  HOH D O     1 
HETATM 3914 O O     . HOH F 6 .   ? 11.981  47.651 52.643  1.00 82.55  ? 33  HOH D O     1 
HETATM 3915 O O     . HOH F 6 .   ? -27.367 62.327 72.700  1.00 100.83 ? 34  HOH D O     1 
HETATM 3916 O O     . HOH F 6 .   ? -26.883 56.999 74.485  1.00 70.09  ? 35  HOH D O     1 
HETATM 3917 O O     . HOH F 6 .   ? -16.644 60.978 49.983  1.00 67.62  ? 36  HOH D O     1 
HETATM 3918 O O     . HOH F 6 .   ? -30.795 59.680 73.041  1.00 73.41  ? 37  HOH D O     1 
HETATM 3919 O O     . HOH F 6 .   ? -37.114 61.315 74.714  1.00 85.14  ? 38  HOH D O     1 
HETATM 3920 O O     . HOH F 6 .   ? -1.651  65.137 51.882  1.00 81.73  ? 39  HOH D O     1 
HETATM 3921 O O     . HOH F 6 .   ? -7.945  60.369 66.156  1.00 81.02  ? 40  HOH D O     1 
HETATM 3922 O O     . HOH F 6 .   ? -8.982  65.144 57.635  1.00 46.34  ? 41  HOH D O     1 
HETATM 3923 O O     . HOH F 6 .   ? 5.715   64.744 47.304  1.00 70.41  ? 42  HOH D O     1 
HETATM 3924 O O     . HOH G 6 .   ? -4.899  65.685 64.766  1.00 72.39  ? 37  HOH E O     1 
HETATM 3925 O O     . HOH G 6 .   ? -18.686 73.207 66.245  1.00 72.17  ? 38  HOH E O     1 
HETATM 3926 O O     . HOH G 6 .   ? -0.510  69.541 69.223  1.00 49.40  ? 39  HOH E O     1 
HETATM 3927 O O     . HOH G 6 .   ? 5.474   57.489 47.417  1.00 94.34  ? 40  HOH E O     1 
HETATM 3928 O O     . HOH G 6 .   ? -9.020  73.878 66.197  1.00 61.27  ? 41  HOH E O     1 
HETATM 3929 O O     . HOH G 6 .   ? -2.639  66.986 64.386  1.00 45.68  ? 42  HOH E O     1 
HETATM 3930 O O     . HOH G 6 .   ? -32.689 64.792 53.589  1.00 77.28  ? 43  HOH E O     1 
HETATM 3931 O O     . HOH G 6 .   ? -21.823 75.382 59.463  1.00 57.73  ? 44  HOH E O     1 
HETATM 3932 O O     . HOH G 6 .   ? -11.459 74.709 65.800  1.00 65.46  ? 45  HOH E O     1 
HETATM 3933 O O     . HOH G 6 .   ? -6.288  70.960 64.668  1.00 56.61  ? 46  HOH E O     1 
HETATM 3934 O O     . HOH G 6 .   ? -22.797 74.153 57.116  1.00 80.06  ? 47  HOH E O     1 
HETATM 3935 O O     . HOH G 6 .   ? -33.127 59.497 80.472  1.00 50.38  ? 48  HOH E O     1 
HETATM 3936 O O     . HOH G 6 .   ? -9.102  82.205 63.800  1.00 71.74  ? 49  HOH E O     1 
HETATM 3937 O O     . HOH G 6 .   ? 1.838   67.444 68.759  1.00 57.52  ? 50  HOH E O     1 
HETATM 3938 O O     . HOH G 6 .   ? -5.002  65.288 58.353  1.00 72.00  ? 51  HOH E O     1 
HETATM 3939 O O     . HOH G 6 .   ? -2.690  63.660 55.098  1.00 54.16  ? 52  HOH E O     1 
HETATM 3940 O O     . HOH G 6 .   ? -11.268 71.429 67.207  1.00 89.67  ? 53  HOH E O     1 
HETATM 3941 O O     . HOH G 6 .   ? -3.251  69.242 65.894  1.00 54.52  ? 54  HOH E O     1 
HETATM 3942 O O     . HOH G 6 .   ? -23.547 77.852 66.656  1.00 72.65  ? 55  HOH E O     1 
HETATM 3943 O O     . HOH G 6 .   ? -27.020 61.392 81.874  1.00 77.25  ? 56  HOH E O     1 
HETATM 3944 O O     . HOH G 6 .   ? -25.386 73.279 64.032  1.00 77.25  ? 57  HOH E O     1 
HETATM 3945 O O     . HOH G 6 .   ? -19.597 78.587 63.877  1.00 73.09  ? 58  HOH E O     1 
HETATM 3946 O O     . HOH G 6 .   ? -6.479  64.674 62.342  1.00 35.47  ? 59  HOH E O     1 
HETATM 3947 O O     . HOH G 6 .   ? -5.070  62.432 60.474  1.00 35.47  ? 60  HOH E O     1 
HETATM 3948 O O     . HOH H 6 .   ? 0.497   95.811 61.008  1.00 79.49  ? 241 HOH A O     1 
HETATM 3949 O O     . HOH H 6 .   ? 1.367   85.025 62.525  1.00 71.71  ? 242 HOH A O     1 
HETATM 3950 O O     . HOH H 6 .   ? 0.553   82.415 65.768  1.00 60.11  ? 243 HOH A O     1 
HETATM 3951 O O     . HOH H 6 .   ? 3.846   84.042 62.704  1.00 63.72  ? 244 HOH A O     1 
HETATM 3952 O O     . HOH H 6 .   ? 19.695  62.245 54.537  1.00 52.54  ? 245 HOH A O     1 
HETATM 3953 O O     . HOH H 6 .   ? 28.382  54.863 65.016  1.00 86.62  ? 246 HOH A O     1 
HETATM 3954 O O     . HOH H 6 .   ? 13.742  63.914 72.333  1.00 73.49  ? 247 HOH A O     1 
HETATM 3955 O O     . HOH H 6 .   ? 23.997  48.976 68.560  1.00 68.70  ? 248 HOH A O     1 
HETATM 3956 O O     . HOH H 6 .   ? 4.662   80.682 68.528  1.00 84.29  ? 249 HOH A O     1 
HETATM 3957 O O     . HOH H 6 .   ? 11.949  65.508 73.371  1.00 69.16  ? 250 HOH A O     1 
HETATM 3958 O O     . HOH H 6 .   ? 4.506   75.824 68.052  1.00 53.34  ? 251 HOH A O     1 
HETATM 3959 O O     . HOH H 6 .   ? 6.174   77.364 66.665  1.00 53.55  ? 252 HOH A O     1 
HETATM 3960 O O     . HOH H 6 .   ? -17.953 71.740 51.667  1.00 42.80  ? 253 HOH A O     1 
HETATM 3961 O O     . HOH H 6 .   ? -9.867  85.503 43.544  1.00 39.87  ? 254 HOH A O     1 
HETATM 3962 O O     . HOH H 6 .   ? 13.186  65.651 54.281  1.00 52.69  ? 255 HOH A O     1 
HETATM 3963 O O     . HOH H 6 .   ? 25.809  54.780 65.630  1.00 101.88 ? 256 HOH A O     1 
HETATM 3964 O O     . HOH H 6 .   ? 10.759  57.736 74.249  1.00 49.14  ? 257 HOH A O     1 
HETATM 3965 O O     . HOH H 6 .   ? 2.118   55.056 67.967  1.00 59.14  ? 258 HOH A O     1 
HETATM 3966 O O     . HOH H 6 .   ? -7.920  87.340 62.463  1.00 71.09  ? 259 HOH A O     1 
HETATM 3967 O O     . HOH H 6 .   ? 9.733   84.196 61.371  1.00 57.88  ? 260 HOH A O     1 
HETATM 3968 O O     . HOH H 6 .   ? 7.538   82.865 54.622  1.00 58.14  ? 261 HOH A O     1 
HETATM 3969 O O     . HOH H 6 .   ? 0.809   91.950 57.396  1.00 71.04  ? 262 HOH A O     1 
HETATM 3970 O O     . HOH H 6 .   ? -0.233  60.094 70.031  1.00 48.22  ? 263 HOH A O     1 
HETATM 3971 O O     . HOH H 6 .   ? 6.159   55.011 63.142  1.00 50.36  ? 264 HOH A O     1 
HETATM 3972 O O     . HOH H 6 .   ? 8.621   80.769 53.832  1.00 38.27  ? 265 HOH A O     1 
HETATM 3973 O O     . HOH H 6 .   ? 6.654   86.141 52.193  1.00 65.81  ? 266 HOH A O     1 
HETATM 3974 O O     . HOH H 6 .   ? 16.092  72.471 48.865  1.00 45.75  ? 267 HOH A O     1 
HETATM 3975 O O     . HOH H 6 .   ? -19.630 76.822 57.895  1.00 58.60  ? 268 HOH A O     1 
HETATM 3976 O O     . HOH H 6 .   ? -16.520 78.899 67.619  1.00 79.42  ? 269 HOH A O     1 
HETATM 3977 O O     . HOH H 6 .   ? -6.999  84.670 41.982  1.00 66.52  ? 270 HOH A O     1 
HETATM 3978 O O     . HOH H 6 .   ? -22.166 94.260 48.870  1.00 76.52  ? 271 HOH A O     1 
HETATM 3979 O O     . HOH H 6 .   ? -12.998 74.090 45.149  1.00 59.58  ? 272 HOH A O     1 
HETATM 3980 O O     . HOH H 6 .   ? 20.221  45.438 74.850  1.00 79.24  ? 273 HOH A O     1 
HETATM 3981 O O     . HOH H 6 .   ? -2.328  76.408 67.863  1.00 61.10  ? 274 HOH A O     1 
HETATM 3982 O O     . HOH H 6 .   ? -1.554  75.294 46.764  1.00 53.99  ? 275 HOH A O     1 
HETATM 3983 O O     . HOH H 6 .   ? -19.045 75.589 41.890  1.00 66.23  ? 276 HOH A O     1 
HETATM 3984 O O     . HOH H 6 .   ? 12.126  55.031 56.268  1.00 71.31  ? 277 HOH A O     1 
HETATM 3985 O O     . HOH H 6 .   ? 10.740  55.382 72.448  1.00 50.52  ? 278 HOH A O     1 
HETATM 3986 O O     . HOH H 6 .   ? -5.485  86.844 62.442  1.00 59.82  ? 279 HOH A O     1 
HETATM 3987 O O     . HOH H 6 .   ? 20.123  73.386 49.959  1.00 64.62  ? 280 HOH A O     1 
HETATM 3988 O O     . HOH H 6 .   ? 12.247  77.396 52.320  1.00 55.19  ? 281 HOH A O     1 
HETATM 3989 O O     . HOH H 6 .   ? -9.311  82.945 41.920  1.00 54.35  ? 282 HOH A O     1 
HETATM 3990 O O     . HOH H 6 .   ? -11.080 74.853 38.334  1.00 75.84  ? 283 HOH A O     1 
HETATM 3991 O O     . HOH H 6 .   ? 5.171   53.242 56.063  1.00 80.67  ? 284 HOH A O     1 
HETATM 3992 O O     . HOH H 6 .   ? 2.017   60.688 67.345  1.00 51.60  ? 285 HOH A O     1 
HETATM 3993 O O     . HOH H 6 .   ? 1.391   74.916 66.782  1.00 57.63  ? 286 HOH A O     1 
HETATM 3994 O O     . HOH H 6 .   ? 15.146  49.635 62.807  1.00 87.85  ? 287 HOH A O     1 
HETATM 3995 O O     . HOH H 6 .   ? -2.642  78.699 69.198  1.00 83.79  ? 288 HOH A O     1 
HETATM 3996 O O     . HOH H 6 .   ? -0.242  48.669 64.993  1.00 66.22  ? 289 HOH A O     1 
HETATM 3997 O O     . HOH H 6 .   ? 3.681   68.988 68.223  1.00 33.22  ? 290 HOH A O     1 
HETATM 3998 O O     . HOH H 6 .   ? 11.234  84.347 56.549  1.00 81.25  ? 291 HOH A O     1 
HETATM 3999 O O     . HOH H 6 .   ? 7.830   73.382 60.965  1.00 49.92  ? 292 HOH A O     1 
HETATM 4000 O O     . HOH H 6 .   ? -11.635 96.609 54.263  1.00 69.78  ? 293 HOH A O     1 
HETATM 4001 O O     . HOH H 6 .   ? 26.116  50.683 67.794  1.00 78.75  ? 294 HOH A O     1 
HETATM 4002 O O     . HOH H 6 .   ? 27.912  69.971 66.226  1.00 71.19  ? 295 HOH A O     1 
HETATM 4003 O O     . HOH H 6 .   ? -14.149 92.460 58.973  1.00 49.57  ? 296 HOH A O     1 
HETATM 4004 O O     . HOH H 6 .   ? -31.343 69.058 48.402  1.00 84.63  ? 297 HOH A O     1 
HETATM 4005 O O     . HOH H 6 .   ? 10.338  53.904 74.743  1.00 56.90  ? 298 HOH A O     1 
HETATM 4006 O O     . HOH H 6 .   ? 2.611   69.587 72.530  1.00 41.64  ? 299 HOH A O     1 
HETATM 4007 O O     . HOH H 6 .   ? 4.813   69.124 70.701  1.00 44.29  ? 300 HOH A O     1 
HETATM 4008 O O     . HOH H 6 .   ? 9.083   84.690 53.128  1.00 64.78  ? 301 HOH A O     1 
HETATM 4009 O O     . HOH H 6 .   ? 6.834   88.203 54.077  1.00 73.97  ? 302 HOH A O     1 
HETATM 4010 O O     . HOH H 6 .   ? -1.320  88.523 63.333  1.00 79.66  ? 303 HOH A O     1 
HETATM 4011 O O     . HOH H 6 .   ? 9.804   77.590 50.662  1.00 69.05  ? 304 HOH A O     1 
HETATM 4012 O O     . HOH H 6 .   ? 2.587   90.568 59.573  1.00 66.66  ? 305 HOH A O     1 
HETATM 4013 O O     . HOH H 6 .   ? 22.574  52.548 59.073  1.00 63.07  ? 306 HOH A O     1 
HETATM 4014 O O     . HOH H 6 .   ? -16.149 87.235 66.515  1.00 74.39  ? 307 HOH A O     1 
HETATM 4015 O O     . HOH H 6 .   ? -25.970 73.401 46.066  1.00 77.81  ? 308 HOH A O     1 
HETATM 4016 O O     . HOH H 6 .   ? -0.388  47.315 61.885  1.00 93.27  ? 309 HOH A O     1 
HETATM 4017 O O     . HOH H 6 .   ? -21.651 83.993 62.950  1.00 78.43  ? 310 HOH A O     1 
HETATM 4018 O O     . HOH H 6 .   ? 0.738   58.074 69.685  1.00 87.23  ? 311 HOH A O     1 
HETATM 4019 O O     . HOH H 6 .   ? -12.123 71.170 46.104  1.00 73.62  ? 312 HOH A O     1 
HETATM 4020 O O     . HOH H 6 .   ? -16.388 82.291 38.783  1.00 91.39  ? 313 HOH A O     1 
HETATM 4021 O O     . HOH H 6 .   ? 14.602  66.808 52.522  1.00 70.37  ? 314 HOH A O     1 
HETATM 4022 O O     . HOH H 6 .   ? -2.140  80.816 67.104  1.00 60.83  ? 315 HOH A O     1 
HETATM 4023 O O     . HOH H 6 .   ? -6.869  81.595 66.483  1.00 64.39  ? 316 HOH A O     1 
HETATM 4024 O O     . HOH H 6 .   ? -1.185  73.708 68.977  1.00 62.50  ? 317 HOH A O     1 
HETATM 4025 O O     . HOH H 6 .   ? 14.656  66.213 49.789  1.00 67.35  ? 318 HOH A O     1 
HETATM 4026 O O     . HOH H 6 .   ? 14.129  80.261 58.046  1.00 80.41  ? 319 HOH A O     1 
HETATM 4027 O O     . HOH H 6 .   ? -22.925 87.407 41.738  1.00 53.75  ? 320 HOH A O     1 
HETATM 4028 O O     . HOH H 6 .   ? -16.747 70.019 50.074  1.00 63.91  ? 321 HOH A O     1 
HETATM 4029 O O     . HOH H 6 .   ? -6.345  76.272 41.630  1.00 68.23  ? 322 HOH A O     1 
HETATM 4030 O O     . HOH H 6 .   ? 7.900   80.422 47.182  1.00 75.59  ? 323 HOH A O     1 
HETATM 4031 O O     . HOH H 6 .   ? -12.363 74.556 42.204  1.00 57.49  ? 324 HOH A O     1 
HETATM 4032 O O     . HOH H 6 .   ? 0.210   70.970 71.743  1.00 53.53  ? 325 HOH A O     1 
HETATM 4033 O O     . HOH H 6 .   ? 23.952  74.397 71.012  1.00 93.08  ? 326 HOH A O     1 
HETATM 4034 O O     . HOH H 6 .   ? 12.469  81.309 67.436  1.00 65.10  ? 327 HOH A O     1 
HETATM 4035 O O     . HOH H 6 .   ? 27.837  66.344 62.193  1.00 84.71  ? 328 HOH A O     1 
HETATM 4036 O O     . HOH H 6 .   ? -24.913 82.785 60.706  1.00 63.83  ? 329 HOH A O     1 
HETATM 4037 O O     . HOH H 6 .   ? -16.381 84.888 63.659  1.00 67.68  ? 330 HOH A O     1 
HETATM 4038 O O     . HOH H 6 .   ? -4.875  74.222 45.214  1.00 76.70  ? 331 HOH A O     1 
HETATM 4039 O O     . HOH H 6 .   ? 18.351  76.012 48.894  1.00 63.98  ? 332 HOH A O     1 
HETATM 4040 O O     . HOH H 6 .   ? 21.569  50.527 70.676  1.00 67.37  ? 333 HOH A O     1 
HETATM 4041 O O     . HOH H 6 .   ? -18.675 87.763 65.258  1.00 81.09  ? 334 HOH A O     1 
HETATM 4042 O O     . HOH H 6 .   ? -4.933  89.106 66.279  1.00 74.94  ? 335 HOH A O     1 
HETATM 4043 O O     . HOH H 6 .   ? 25.853  52.470 59.471  1.00 87.05  ? 336 HOH A O     1 
HETATM 4044 O O     . HOH H 6 .   ? 25.069  55.174 68.078  1.00 84.40  ? 337 HOH A O     1 
HETATM 4045 O O     . HOH H 6 .   ? -24.570 80.230 54.585  1.00 67.51  ? 338 HOH A O     1 
HETATM 4046 O O     . HOH H 6 .   ? -24.798 76.562 47.103  1.00 80.16  ? 339 HOH A O     1 
HETATM 4047 O O     . HOH H 6 .   ? -10.251 75.419 40.928  1.00 60.43  ? 340 HOH A O     1 
HETATM 4048 O O     . HOH H 6 .   ? -5.807  76.911 44.523  1.00 58.70  ? 341 HOH A O     1 
HETATM 4049 O O     . HOH H 6 .   ? -9.497  70.267 42.069  1.00 68.43  ? 342 HOH A O     1 
HETATM 4050 O O     . HOH H 6 .   ? 7.015   82.620 67.429  1.00 75.95  ? 343 HOH A O     1 
HETATM 4051 O O     . HOH H 6 .   ? 6.360   76.930 70.706  1.00 73.27  ? 344 HOH A O     1 
HETATM 4052 O O     . HOH H 6 .   ? 14.729  81.582 70.138  1.00 67.90  ? 345 HOH A O     1 
HETATM 4053 O O     . HOH H 6 .   ? 11.721  72.091 76.358  1.00 99.00  ? 346 HOH A O     1 
HETATM 4054 O O     . HOH H 6 .   ? 1.896   56.354 65.834  1.00 71.02  ? 347 HOH A O     1 
HETATM 4055 O O     . HOH H 6 .   ? 3.817   55.415 64.392  1.00 54.91  ? 348 HOH A O     1 
HETATM 4056 O O     . HOH H 6 .   ? -22.590 80.808 62.279  1.00 66.33  ? 349 HOH A O     1 
HETATM 4057 O O     . HOH H 6 .   ? -21.664 96.708 59.428  1.00 4.24   ? 350 HOH A O     1 
HETATM 4058 O O     . HOH H 6 .   ? -16.904 80.784 65.355  1.00 75.89  ? 351 HOH A O     1 
HETATM 4059 O O     . HOH H 6 .   ? -18.156 94.198 56.102  1.00 72.84  ? 352 HOH A O     1 
HETATM 4060 O O     . HOH H 6 .   ? 11.719  85.574 59.710  1.00 70.28  ? 353 HOH A O     1 
HETATM 4061 O O     . HOH H 6 .   ? 3.285   71.587 67.252  1.00 48.87  ? 354 HOH A O     1 
HETATM 4062 O O     . HOH H 6 .   ? 22.835  70.946 63.776  1.00 74.83  ? 355 HOH A O     1 
HETATM 4063 O O     . HOH H 6 .   ? 2.355   74.515 49.790  1.00 47.10  ? 356 HOH A O     1 
HETATM 4064 O O     . HOH H 6 .   ? 5.170   71.635 45.921  1.00 81.20  ? 357 HOH A O     1 
HETATM 4065 O O     . HOH H 6 .   ? -10.872 90.493 45.046  1.00 60.15  ? 358 HOH A O     1 
HETATM 4066 O O     . HOH H 6 .   ? -15.625 90.905 44.800  1.00 51.69  ? 359 HOH A O     1 
HETATM 4067 O O     . HOH I 6 .   ? 8.338   52.068 75.358  1.00 49.28  ? 123 HOH B O     1 
HETATM 4068 O O     . HOH I 6 .   ? 5.408   38.998 83.802  1.00 36.39  ? 124 HOH B O     1 
HETATM 4069 O O     . HOH I 6 .   ? -6.026  27.582 85.484  1.00 72.98  ? 125 HOH B O     1 
HETATM 4070 O O     . HOH I 6 .   ? 10.685  42.630 96.143  1.00 63.43  ? 126 HOH B O     1 
HETATM 4071 O O     . HOH I 6 .   ? -0.895  52.852 70.844  1.00 50.22  ? 127 HOH B O     1 
HETATM 4072 O O     . HOH I 6 .   ? 12.518  48.107 86.669  1.00 60.72  ? 128 HOH B O     1 
HETATM 4073 O O     . HOH I 6 .   ? 18.855  36.860 96.440  1.00 71.99  ? 129 HOH B O     1 
HETATM 4074 O O     . HOH I 6 .   ? -4.599  32.743 89.724  1.00 63.76  ? 130 HOH B O     1 
HETATM 4075 O O     . HOH I 6 .   ? -4.108  50.864 67.153  1.00 67.53  ? 131 HOH B O     1 
HETATM 4076 O O     . HOH I 6 .   ? -10.670 40.554 87.577  1.00 68.84  ? 132 HOH B O     1 
HETATM 4077 O O     . HOH I 6 .   ? 25.871  21.482 84.912  1.00 79.70  ? 133 HOH B O     1 
HETATM 4078 O O     . HOH I 6 .   ? 9.610   35.812 70.322  1.00 66.11  ? 134 HOH B O     1 
HETATM 4079 O O     . HOH I 6 .   ? -0.481  28.314 78.922  1.00 99.12  ? 135 HOH B O     1 
HETATM 4080 O O     . HOH I 6 .   ? 14.758  58.398 90.271  1.00 101.50 ? 136 HOH B O     1 
HETATM 4081 O O     . HOH I 6 .   ? 6.144   61.198 69.313  1.00 57.76  ? 137 HOH B O     1 
HETATM 4082 O O     . HOH I 6 .   ? 12.414  38.639 83.692  1.00 76.39  ? 138 HOH B O     1 
HETATM 4083 O O     . HOH I 6 .   ? 9.040   47.747 95.142  1.00 75.62  ? 139 HOH B O     1 
HETATM 4084 O O     . HOH I 6 .   ? -10.689 54.128 86.726  1.00 63.23  ? 140 HOH B O     1 
HETATM 4085 O O     . HOH I 6 .   ? 21.313  21.564 91.006  1.00 52.93  ? 141 HOH B O     1 
HETATM 4086 O O     . HOH I 6 .   ? 7.164   42.751 78.592  1.00 58.03  ? 142 HOH B O     1 
HETATM 4087 O O     . HOH I 6 .   ? 11.806  47.619 89.334  1.00 65.03  ? 143 HOH B O     1 
HETATM 4088 O O     . HOH I 6 .   ? 16.454  34.389 88.924  1.00 66.62  ? 144 HOH B O     1 
HETATM 4089 O O     . HOH I 6 .   ? 13.751  41.446 87.791  1.00 61.24  ? 145 HOH B O     1 
HETATM 4090 O O     . HOH I 6 .   ? 17.174  22.257 88.382  1.00 45.00  ? 146 HOH B O     1 
HETATM 4091 O O     . HOH I 6 .   ? 2.487   38.370 81.524  1.00 59.73  ? 147 HOH B O     1 
HETATM 4092 O O     . HOH I 6 .   ? -1.069  40.919 82.143  1.00 53.10  ? 148 HOH B O     1 
HETATM 4093 O O     . HOH I 6 .   ? -4.161  66.260 89.345  1.00 72.25  ? 149 HOH B O     1 
HETATM 4094 O O     . HOH I 6 .   ? 10.717  45.909 96.477  1.00 64.63  ? 150 HOH B O     1 
HETATM 4095 O O     . HOH I 6 .   ? 10.944  51.564 81.582  1.00 65.29  ? 151 HOH B O     1 
HETATM 4096 O O     . HOH I 6 .   ? 14.905  43.264 77.389  1.00 93.23  ? 152 HOH B O     1 
HETATM 4097 O O     . HOH I 6 .   ? -3.735  39.964 82.292  1.00 43.12  ? 153 HOH B O     1 
HETATM 4098 O O     . HOH I 6 .   ? 18.086  36.625 85.437  1.00 95.99  ? 154 HOH B O     1 
HETATM 4099 O O     . HOH I 6 .   ? 17.061  33.553 86.779  1.00 64.13  ? 155 HOH B O     1 
HETATM 4100 O O     . HOH I 6 .   ? -12.068 46.410 95.179  1.00 72.22  ? 156 HOH B O     1 
HETATM 4101 O O     . HOH I 6 .   ? 7.278   28.530 79.512  1.00 74.34  ? 157 HOH B O     1 
HETATM 4102 O O     . HOH I 6 .   ? 14.740  56.145 85.662  1.00 93.63  ? 158 HOH B O     1 
HETATM 4103 O O     . HOH I 6 .   ? -9.548  44.151 67.790  1.00 73.72  ? 159 HOH B O     1 
HETATM 4104 O O     . HOH I 6 .   ? 15.980  22.210 85.160  1.00 46.63  ? 160 HOH B O     1 
HETATM 4105 O O     . HOH I 6 .   ? 16.251  60.799 87.787  1.00 79.47  ? 161 HOH B O     1 
HETATM 4106 O O     . HOH I 6 .   ? -10.302 57.423 98.290  1.00 75.98  ? 162 HOH B O     1 
HETATM 4107 O O     . HOH I 6 .   ? 9.889   48.799 74.471  1.00 79.22  ? 163 HOH B O     1 
HETATM 4108 O O     . HOH I 6 .   ? 22.570  21.286 97.643  1.00 63.96  ? 164 HOH B O     1 
HETATM 4109 O O     . HOH I 6 .   ? 4.198   30.702 80.637  1.00 75.17  ? 165 HOH B O     1 
HETATM 4110 O O     . HOH I 6 .   ? -17.482 55.051 98.712  1.00 74.49  ? 166 HOH B O     1 
HETATM 4111 O O     . HOH I 6 .   ? 16.901  62.356 95.466  1.00 80.83  ? 167 HOH B O     1 
HETATM 4112 O O     . HOH I 6 .   ? 10.198  44.114 80.567  1.00 75.27  ? 168 HOH B O     1 
HETATM 4113 O O     . HOH I 6 .   ? 7.608   34.706 79.561  1.00 55.54  ? 169 HOH B O     1 
HETATM 4114 O O     . HOH I 6 .   ? 12.722  41.103 97.404  1.00 65.95  ? 170 HOH B O     1 
HETATM 4115 O O     . HOH I 6 .   ? 0.801   38.928 79.613  1.00 61.71  ? 171 HOH B O     1 
HETATM 4116 O O     . HOH I 6 .   ? -10.911 40.902 83.968  1.00 72.48  ? 172 HOH B O     1 
HETATM 4117 O O     . HOH I 6 .   ? -3.893  35.901 80.201  1.00 68.21  ? 173 HOH B O     1 
HETATM 4118 O O     . HOH I 6 .   ? 7.303   40.803 77.100  1.00 81.20  ? 174 HOH B O     1 
HETATM 4119 O O     . HOH I 6 .   ? 10.129  46.757 77.826  1.00 58.72  ? 175 HOH B O     1 
HETATM 4120 O O     . HOH I 6 .   ? -9.368  43.460 63.535  1.00 68.23  ? 176 HOH B O     1 
HETATM 4121 O O     . HOH I 6 .   ? 10.783  64.945 94.856  1.00 66.99  ? 177 HOH B O     1 
HETATM 4122 O O     . HOH I 6 .   ? -1.317  66.302 90.146  1.00 60.48  ? 178 HOH B O     1 
HETATM 4123 O O     . HOH I 6 .   ? 22.707  32.797 92.301  1.00 72.41  ? 179 HOH B O     1 
HETATM 4124 O O     . HOH I 6 .   ? 9.433   37.756 71.877  1.00 78.35  ? 180 HOH B O     1 
HETATM 4125 O O     . HOH I 6 .   ? -13.529 48.880 94.446  1.00 68.67  ? 181 HOH B O     1 
HETATM 4126 O O     . HOH I 6 .   ? 7.190   27.187 72.407  1.00 72.91  ? 182 HOH B O     1 
HETATM 4127 O O     . HOH I 6 .   ? 19.376  35.934 87.555  1.00 71.61  ? 183 HOH B O     1 
HETATM 4128 O O     . HOH I 6 .   ? -5.007  67.308 86.967  1.00 35.47  ? 184 HOH B O     1 
HETATM 4129 O O     . HOH J 6 .   ? 15.388  47.808 99.694  1.00 74.57  ? 287 HOH C O     1 
HETATM 4130 O O     . HOH J 6 .   ? 9.677   73.682 78.306  1.00 69.20  ? 288 HOH C O     1 
HETATM 4131 O O     . HOH J 6 .   ? 1.763   66.945 71.405  1.00 63.05  ? 289 HOH C O     1 
HETATM 4132 O O     . HOH J 6 .   ? 13.227  57.142 91.739  1.00 89.03  ? 290 HOH C O     1 
HETATM 4133 O O     . HOH J 6 .   ? -4.466  50.054 71.544  1.00 51.12  ? 291 HOH C O     1 
HETATM 4134 O O     . HOH J 6 .   ? -8.684  46.680 98.078  1.00 56.73  ? 292 HOH C O     1 
HETATM 4135 O O     . HOH J 6 .   ? -13.301 48.228 106.648 1.00 88.26  ? 293 HOH C O     1 
HETATM 4136 O O     . HOH J 6 .   ? -6.583  39.365 101.313 1.00 82.52  ? 294 HOH C O     1 
HETATM 4137 O O     . HOH J 6 .   ? -4.007  38.509 102.984 1.00 63.67  ? 295 HOH C O     1 
HETATM 4138 O O     . HOH J 6 .   ? 2.320   17.375 96.267  1.00 70.53  ? 296 HOH C O     1 
HETATM 4139 O O     . HOH J 6 .   ? 7.991   53.316 95.633  1.00 59.33  ? 297 HOH C O     1 
HETATM 4140 O O     . HOH J 6 .   ? -5.019  56.795 68.840  1.00 65.65  ? 298 HOH C O     1 
HETATM 4141 O O     . HOH J 6 .   ? -8.290  56.661 76.624  1.00 61.00  ? 299 HOH C O     1 
HETATM 4142 O O     . HOH J 6 .   ? 2.816   65.233 73.471  1.00 54.78  ? 300 HOH C O     1 
HETATM 4143 O O     . HOH J 6 .   ? -2.565  70.668 74.840  1.00 57.72  ? 301 HOH C O     1 
HETATM 4144 O O     . HOH J 6 .   ? 16.231  15.200 85.496  1.00 65.78  ? 302 HOH C O     1 
HETATM 4145 O O     . HOH J 6 .   ? -1.728  58.117 70.181  1.00 53.95  ? 303 HOH C O     1 
HETATM 4146 O O     . HOH J 6 .   ? -4.998  69.316 79.786  1.00 87.06  ? 304 HOH C O     1 
HETATM 4147 O O     . HOH J 6 .   ? 8.162   30.242 108.291 1.00 61.46  ? 305 HOH C O     1 
HETATM 4148 O O     . HOH J 6 .   ? 2.656   21.218 88.195  1.00 58.02  ? 306 HOH C O     1 
HETATM 4149 O O     . HOH J 6 .   ? 12.442  32.324 107.268 1.00 56.60  ? 307 HOH C O     1 
HETATM 4150 O O     . HOH J 6 .   ? 16.942  34.342 101.564 1.00 85.24  ? 308 HOH C O     1 
HETATM 4151 O O     . HOH J 6 .   ? 14.179  47.501 108.290 1.00 71.35  ? 309 HOH C O     1 
HETATM 4152 O O     . HOH J 6 .   ? 10.219  41.140 107.727 1.00 79.68  ? 310 HOH C O     1 
HETATM 4153 O O     . HOH J 6 .   ? -6.665  67.794 67.200  1.00 76.24  ? 311 HOH C O     1 
HETATM 4154 O O     . HOH J 6 .   ? 22.743  66.360 75.846  1.00 96.37  ? 312 HOH C O     1 
HETATM 4155 O O     . HOH J 6 .   ? 0.991   27.584 83.650  1.00 90.54  ? 313 HOH C O     1 
HETATM 4156 O O     . HOH J 6 .   ? 8.136   47.789 91.607  1.00 59.97  ? 314 HOH C O     1 
HETATM 4157 O O     . HOH J 6 .   ? 10.933  49.567 90.897  1.00 71.85  ? 315 HOH C O     1 
HETATM 4158 O O     . HOH J 6 .   ? -0.623  48.408 100.082 1.00 62.16  ? 316 HOH C O     1 
HETATM 4159 O O     . HOH J 6 .   ? -0.504  49.788 69.378  1.00 68.27  ? 317 HOH C O     1 
HETATM 4160 O O     . HOH J 6 .   ? 4.814   12.841 102.235 1.00 81.09  ? 318 HOH C O     1 
HETATM 4161 O O     . HOH J 6 .   ? 13.365  13.921 94.470  1.00 80.04  ? 319 HOH C O     1 
HETATM 4162 O O     . HOH J 6 .   ? 15.503  43.406 103.090 1.00 68.20  ? 320 HOH C O     1 
HETATM 4163 O O     . HOH J 6 .   ? 12.711  41.612 100.069 1.00 50.60  ? 321 HOH C O     1 
HETATM 4164 O O     . HOH J 6 .   ? 4.638   42.683 105.343 1.00 57.29  ? 322 HOH C O     1 
HETATM 4165 O O     . HOH J 6 .   ? -3.654  66.641 68.442  1.00 53.17  ? 323 HOH C O     1 
HETATM 4166 O O     . HOH J 6 .   ? 5.167   46.587 91.858  1.00 52.47  ? 324 HOH C O     1 
HETATM 4167 O O     . HOH J 6 .   ? 11.972  20.837 84.709  1.00 47.54  ? 325 HOH C O     1 
HETATM 4168 O O     . HOH J 6 .   ? -8.959  39.445 95.270  1.00 57.59  ? 326 HOH C O     1 
HETATM 4169 O O     . HOH J 6 .   ? 4.454   67.415 82.372  1.00 87.75  ? 327 HOH C O     1 
HETATM 4170 O O     . HOH J 6 .   ? -3.528  52.509 71.747  1.00 52.44  ? 328 HOH C O     1 
HETATM 4171 O O     . HOH J 6 .   ? -3.631  26.839 92.216  1.00 80.27  ? 329 HOH C O     1 
HETATM 4172 O O     . HOH J 6 .   ? 7.668   19.341 102.271 1.00 59.78  ? 330 HOH C O     1 
HETATM 4173 O O     . HOH J 6 .   ? -1.672  55.589 69.390  1.00 64.50  ? 331 HOH C O     1 
HETATM 4174 O O     . HOH J 6 .   ? 11.080  16.198 99.627  1.00 52.72  ? 332 HOH C O     1 
HETATM 4175 O O     . HOH J 6 .   ? -6.917  63.496 74.929  1.00 79.85  ? 333 HOH C O     1 
HETATM 4176 O O     . HOH J 6 .   ? 8.233   16.896 102.217 1.00 69.47  ? 334 HOH C O     1 
HETATM 4177 O O     . HOH J 6 .   ? 16.898  47.415 91.657  1.00 77.71  ? 335 HOH C O     1 
HETATM 4178 O O     . HOH J 6 .   ? 18.144  19.670 88.274  1.00 56.54  ? 336 HOH C O     1 
HETATM 4179 O O     . HOH J 6 .   ? 5.599   26.139 102.347 1.00 54.93  ? 337 HOH C O     1 
HETATM 4180 O O     . HOH J 6 .   ? 19.055  52.717 101.083 1.00 95.56  ? 338 HOH C O     1 
HETATM 4181 O O     . HOH J 6 .   ? 24.622  70.587 76.803  1.00 86.80  ? 339 HOH C O     1 
HETATM 4182 O O     . HOH J 6 .   ? 27.614  58.755 87.982  1.00 4.28   ? 340 HOH C O     1 
HETATM 4183 O O     . HOH J 6 .   ? -5.215  60.124 69.633  1.00 57.83  ? 341 HOH C O     1 
HETATM 4184 O O     . HOH J 6 .   ? 9.516   17.045 93.301  1.00 57.85  ? 342 HOH C O     1 
HETATM 4185 O O     . HOH J 6 .   ? 11.156  12.626 85.657  1.00 57.67  ? 343 HOH C O     1 
HETATM 4186 O O     . HOH J 6 .   ? 9.878   30.798 105.599 1.00 94.74  ? 344 HOH C O     1 
HETATM 4187 O O     . HOH J 6 .   ? 16.051  37.619 102.499 1.00 78.03  ? 345 HOH C O     1 
HETATM 4188 O O     . HOH J 6 .   ? 15.661  20.584 100.322 1.00 73.78  ? 346 HOH C O     1 
HETATM 4189 O O     . HOH J 6 .   ? 6.077   50.953 103.873 1.00 73.81  ? 347 HOH C O     1 
HETATM 4190 O O     . HOH J 6 .   ? 1.526   18.289 89.855  1.00 64.24  ? 348 HOH C O     1 
HETATM 4191 O O     . HOH J 6 .   ? 8.786   77.335 81.141  1.00 87.10  ? 349 HOH C O     1 
HETATM 4192 O O     . HOH J 6 .   ? 9.795   22.057 81.761  1.00 65.12  ? 350 HOH C O     1 
HETATM 4193 O O     . HOH J 6 .   ? 2.782   71.280 75.374  1.00 74.65  ? 351 HOH C O     1 
HETATM 4194 O O     . HOH J 6 .   ? -2.574  74.380 72.341  1.00 74.19  ? 352 HOH C O     1 
HETATM 4195 O O     . HOH J 6 .   ? 0.112   32.333 99.547  1.00 66.53  ? 353 HOH C O     1 
HETATM 4196 O O     . HOH J 6 .   ? -5.808  48.453 94.949  1.00 77.47  ? 354 HOH C O     1 
HETATM 4197 O O     . HOH J 6 .   ? -9.813  40.729 97.292  1.00 84.22  ? 355 HOH C O     1 
HETATM 4198 O O     . HOH J 6 .   ? -10.084 45.033 81.652  1.00 84.21  ? 356 HOH C O     1 
HETATM 4199 O O     . HOH J 6 .   ? 17.169  38.810 97.656  1.00 35.47  ? 357 HOH C O     1 
HETATM 4200 O O     . HOH J 6 .   ? 17.436  36.621 106.862 1.00 35.47  ? 358 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   D . n 
A 1 2   DT  2   2   2   DT  T   D . n 
A 1 3   DC  3   3   3   DC  C   D . n 
A 1 4   DG  4   4   4   DG  G   D . n 
A 1 5   DA  5   5   5   DA  A   D . n 
A 1 6   DT  6   6   6   DT  T   D . n 
A 1 7   DC  7   7   7   DC  C   D . n 
A 1 8   DG  8   8   8   DG  G   D . n 
A 1 9   DA  9   9   9   DA  A   D . n 
A 1 10  DT  10  10  10  DT  T   D . n 
A 1 11  DA  11  11  11  DA  A   D . n 
A 1 12  DT  12  12  12  DT  T   D . n 
A 1 13  DA  13  13  13  DA  A   D . n 
A 1 14  DA  14  14  14  DA  A   D . n 
A 1 15  DA  15  15  15  DA  A   D . n 
A 1 16  DA  16  16  16  DA  A   D . n 
A 1 17  DC  17  17  17  DC  C   D . n 
A 1 18  DG  18  18  18  DG  G   D . n 
B 2 1   DC  1   19  19  DC  C   E . n 
B 2 2   DG  2   20  20  DG  G   E . n 
B 2 3   DT  3   21  21  DT  T   E . n 
B 2 4   DT  4   22  22  DT  T   E . n 
B 2 5   DT  5   23  23  DT  T   E . n 
B 2 6   DT  6   24  24  DT  T   E . n 
B 2 7   DA  7   25  25  DA  A   E . n 
B 2 8   DT  8   26  26  DT  T   E . n 
B 2 9   DA  9   27  27  DA  A   E . n 
B 2 10  DT  10  28  28  DT  T   E . n 
B 2 11  DC  11  29  29  DC  C   E . n 
B 2 12  DG  12  30  30  DG  G   E . n 
B 2 13  DA  13  31  31  DA  A   E . n 
B 2 14  DT  14  32  32  DT  T   E . n 
B 2 15  DC  15  33  33  DC  C   E . n 
B 2 16  DG  16  34  34  DG  G   E . n 
B 2 17  DA  17  35  35  DA  A   E . n 
B 2 18  DT  18  36  36  DT  T   E . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   ALA 2   2   ?   ?   ?   A . n 
C 3 3   ASP 3   3   ?   ?   ?   A . n 
C 3 4   GLU 4   4   ?   ?   ?   A . n 
C 3 5   GLU 5   5   ?   ?   ?   A . n 
C 3 6   ARG 6   6   ?   ?   ?   A . n 
C 3 7   LEU 7   7   ?   ?   ?   A . n 
C 3 8   LYS 8   8   ?   ?   ?   A . n 
C 3 9   GLU 9   9   ?   ?   ?   A . n 
C 3 10  PHE 10  10  ?   ?   ?   A . n 
C 3 11  LYS 11  11  ?   ?   ?   A . n 
C 3 12  GLU 12  12  ?   ?   ?   A . n 
C 3 13  ALA 13  13  ?   ?   ?   A . n 
C 3 14  ASN 14  14  ?   ?   ?   A . n 
C 3 15  LYS 15  15  ?   ?   ?   A . n 
C 3 16  ILE 16  16  ?   ?   ?   A . n 
C 3 17  VAL 17  17  ?   ?   ?   A . n 
C 3 18  PHE 18  18  ?   ?   ?   A . n 
C 3 19  ASP 19  19  ?   ?   ?   A . n 
C 3 20  PRO 20  20  ?   ?   ?   A . n 
C 3 21  ASN 21  21  ?   ?   ?   A . n 
C 3 22  THR 22  22  ?   ?   ?   A . n 
C 3 23  ARG 23  23  ?   ?   ?   A . n 
C 3 24  GLN 24  24  ?   ?   ?   A . n 
C 3 25  VAL 25  25  ?   ?   ?   A . n 
C 3 26  TRP 26  26  ?   ?   ?   A . n 
C 3 27  GLU 27  27  ?   ?   ?   A . n 
C 3 28  ASN 28  28  ?   ?   ?   A . n 
C 3 29  GLN 29  29  ?   ?   ?   A . n 
C 3 30  ASN 30  30  ?   ?   ?   A . n 
C 3 31  ARG 31  31  ?   ?   ?   A . n 
C 3 32  ASP 32  32  ?   ?   ?   A . n 
C 3 33  GLY 33  33  ?   ?   ?   A . n 
C 3 34  THR 34  34  ?   ?   ?   A . n 
C 3 35  LYS 35  35  ?   ?   ?   A . n 
C 3 36  PRO 36  36  ?   ?   ?   A . n 
C 3 37  ALA 37  37  ?   ?   ?   A . n 
C 3 38  THR 38  38  ?   ?   ?   A . n 
C 3 39  THR 39  39  ?   ?   ?   A . n 
C 3 40  PHE 40  40  ?   ?   ?   A . n 
C 3 41  GLN 41  41  ?   ?   ?   A . n 
C 3 42  SER 42  42  ?   ?   ?   A . n 
C 3 43  GLU 43  43  ?   ?   ?   A . n 
C 3 44  GLU 44  44  ?   ?   ?   A . n 
C 3 45  ASP 45  45  ?   ?   ?   A . n 
C 3 46  ILE 46  46  ?   ?   ?   A . n 
C 3 47  LYS 47  47  ?   ?   ?   A . n 
C 3 48  ARG 48  48  ?   ?   ?   A . n 
C 3 49  ALA 49  49  ?   ?   ?   A . n 
C 3 50  ALA 50  50  ?   ?   ?   A . n 
C 3 51  PRO 51  51  ?   ?   ?   A . n 
C 3 52  GLU 52  52  ?   ?   ?   A . n 
C 3 53  SER 53  53  ?   ?   ?   A . n 
C 3 54  GLU 54  54  ?   ?   ?   A . n 
C 3 55  LYS 55  55  ?   ?   ?   A . n 
C 3 56  ASP 56  56  ?   ?   ?   A . n 
C 3 57  THR 57  57  ?   ?   ?   A . n 
C 3 58  SER 58  58  ?   ?   ?   A . n 
C 3 59  ALA 59  59  ?   ?   ?   A . n 
C 3 60  THR 60  60  ?   ?   ?   A . n 
C 3 61  SER 61  61  61  SER SER A . n 
C 3 62  GLY 62  62  62  GLY GLY A . n 
C 3 63  ILE 63  63  63  ILE ILE A . n 
C 3 64  VAL 64  64  64  VAL VAL A . n 
C 3 65  PRO 65  65  65  PRO PRO A . n 
C 3 66  THR 66  66  66  THR THR A . n 
C 3 67  LEU 67  67  67  LEU LEU A . n 
C 3 68  GLN 68  68  68  GLN GLN A . n 
C 3 69  ASN 69  69  69  ASN ASN A . n 
C 3 70  ILE 70  70  70  ILE ILE A . n 
C 3 71  VAL 71  71  71  VAL VAL A . n 
C 3 72  ALA 72  72  72  ALA ALA A . n 
C 3 73  THR 73  73  73  THR THR A . n 
C 3 74  VAL 74  74  74  VAL VAL A . n 
C 3 75  THR 75  75  75  THR THR A . n 
C 3 76  LEU 76  76  76  LEU LEU A . n 
C 3 77  GLY 77  77  77  GLY GLY A . n 
C 3 78  CYS 78  78  78  CYS CYS A . n 
C 3 79  ARG 79  79  79  ARG ARG A . n 
C 3 80  LEU 80  80  80  LEU LEU A . n 
C 3 81  ASP 81  81  81  ASP ASP A . n 
C 3 82  LEU 82  82  82  LEU LEU A . n 
C 3 83  LYS 83  83  83  LYS LYS A . n 
C 3 84  THR 84  84  84  THR THR A . n 
C 3 85  VAL 85  85  85  VAL VAL A . n 
C 3 86  ALA 86  86  86  ALA ALA A . n 
C 3 87  LEU 87  87  87  LEU LEU A . n 
C 3 88  HIS 88  88  88  HIS HIS A . n 
C 3 89  ALA 89  89  89  ALA ALA A . n 
C 3 90  ARG 90  90  90  ARG ARG A . n 
C 3 91  ASN 91  91  91  ASN ASN A . n 
C 3 92  ALA 92  92  92  ALA ALA A . n 
C 3 93  GLU 93  93  93  GLU GLU A . n 
C 3 94  TYR 94  94  94  TYR TYR A . n 
C 3 95  ASN 95  95  95  ASN ASN A . n 
C 3 96  PRO 96  96  96  PRO PRO A . n 
C 3 97  LYS 97  97  97  LYS LYS A . n 
C 3 98  ARG 98  98  98  ARG ARG A . n 
C 3 99  PHE 99  99  99  PHE PHE A . n 
C 3 100 ALA 100 100 100 ALA ALA A . n 
C 3 101 ALA 101 101 101 ALA ALA A . n 
C 3 102 VAL 102 102 102 VAL VAL A . n 
C 3 103 ILE 103 103 103 ILE ILE A . n 
C 3 104 MET 104 104 104 MET MET A . n 
C 3 105 ARG 105 105 105 ARG ARG A . n 
C 3 106 ILE 106 106 106 ILE ILE A . n 
C 3 107 ARG 107 107 107 ARG ARG A . n 
C 3 108 GLU 108 108 108 GLU GLU A . n 
C 3 109 PRO 109 109 109 PRO PRO A . n 
C 3 110 LYS 110 110 110 LYS LYS A . n 
C 3 111 THR 111 111 111 THR THR A . n 
C 3 112 THR 112 112 112 THR THR A . n 
C 3 113 ALA 113 113 113 ALA ALA A . n 
C 3 114 LEU 114 114 114 LEU LEU A . n 
C 3 115 ILE 115 115 115 ILE ILE A . n 
C 3 116 PHE 116 116 116 PHE PHE A . n 
C 3 117 ALA 117 117 117 ALA ALA A . n 
C 3 118 SER 118 118 118 SER SER A . n 
C 3 119 GLY 119 119 119 GLY GLY A . n 
C 3 120 LYS 120 120 120 LYS LYS A . n 
C 3 121 MET 121 121 121 MET MET A . n 
C 3 122 VAL 122 122 122 VAL VAL A . n 
C 3 123 VAL 123 123 123 VAL VAL A . n 
C 3 124 THR 124 124 124 THR THR A . n 
C 3 125 GLY 125 125 125 GLY GLY A . n 
C 3 126 ALA 126 126 126 ALA ALA A . n 
C 3 127 LYS 127 127 127 LYS LYS A . n 
C 3 128 SER 128 128 128 SER SER A . n 
C 3 129 GLU 129 129 129 GLU GLU A . n 
C 3 130 ASP 130 130 130 ASP ASP A . n 
C 3 131 ASP 131 131 131 ASP ASP A . n 
C 3 132 SER 132 132 132 SER SER A . n 
C 3 133 LYS 133 133 133 LYS LYS A . n 
C 3 134 LEU 134 134 134 LEU LEU A . n 
C 3 135 ALA 135 135 135 ALA ALA A . n 
C 3 136 SER 136 136 136 SER SER A . n 
C 3 137 ARG 137 137 137 ARG ARG A . n 
C 3 138 LYS 138 138 138 LYS LYS A . n 
C 3 139 TYR 139 139 139 TYR TYR A . n 
C 3 140 ALA 140 140 140 ALA ALA A . n 
C 3 141 ARG 141 141 141 ARG ARG A . n 
C 3 142 ILE 142 142 142 ILE ILE A . n 
C 3 143 ILE 143 143 143 ILE ILE A . n 
C 3 144 GLN 144 144 144 GLN GLN A . n 
C 3 145 LYS 145 145 145 LYS LYS A . n 
C 3 146 ILE 146 146 146 ILE ILE A . n 
C 3 147 GLY 147 147 147 GLY GLY A . n 
C 3 148 PHE 148 148 148 PHE PHE A . n 
C 3 149 ALA 149 149 149 ALA ALA A . n 
C 3 150 ALA 150 150 150 ALA ALA A . n 
C 3 151 LYS 151 151 151 LYS LYS A . n 
C 3 152 PHE 152 152 152 PHE PHE A . n 
C 3 153 THR 153 153 153 THR THR A . n 
C 3 154 ASP 154 154 154 ASP ASP A . n 
C 3 155 PHE 155 155 155 PHE PHE A . n 
C 3 156 LYS 156 156 156 LYS LYS A . n 
C 3 157 ILE 157 157 157 ILE ILE A . n 
C 3 158 GLN 158 158 158 GLN GLN A . n 
C 3 159 ASN 159 159 159 ASN ASN A . n 
C 3 160 ILE 160 160 160 ILE ILE A . n 
C 3 161 VAL 161 161 161 VAL VAL A . n 
C 3 162 GLY 162 162 162 GLY GLY A . n 
C 3 163 SER 163 163 163 SER SER A . n 
C 3 164 CYS 164 164 164 CYS CYS A . n 
C 3 165 ASP 165 165 165 ASP ASP A . n 
C 3 166 VAL 166 166 166 VAL VAL A . n 
C 3 167 LYS 167 167 167 LYS LYS A . n 
C 3 168 PHE 168 168 168 PHE PHE A . n 
C 3 169 PRO 169 169 169 PRO PRO A . n 
C 3 170 ILE 170 170 170 ILE ILE A . n 
C 3 171 ARG 171 171 171 ARG ARG A . n 
C 3 172 LEU 172 172 172 LEU LEU A . n 
C 3 173 GLU 173 173 173 GLU GLU A . n 
C 3 174 GLY 174 174 174 GLY GLY A . n 
C 3 175 LEU 175 175 175 LEU LEU A . n 
C 3 176 ALA 176 176 176 ALA ALA A . n 
C 3 177 PHE 177 177 177 PHE PHE A . n 
C 3 178 SER 178 178 178 SER SER A . n 
C 3 179 HIS 179 179 179 HIS HIS A . n 
C 3 180 GLY 180 180 180 GLY GLY A . n 
C 3 181 THR 181 181 181 THR THR A . n 
C 3 182 PHE 182 182 182 PHE PHE A . n 
C 3 183 SER 183 183 183 SER SER A . n 
C 3 184 SER 184 184 184 SER SER A . n 
C 3 185 TYR 185 185 185 TYR TYR A . n 
C 3 186 GLU 186 186 186 GLU GLU A . n 
C 3 187 PRO 187 187 187 PRO PRO A . n 
C 3 188 GLU 188 188 188 GLU GLU A . n 
C 3 189 LEU 189 189 189 LEU LEU A . n 
C 3 190 PHE 190 190 190 PHE PHE A . n 
C 3 191 PRO 191 191 191 PRO PRO A . n 
C 3 192 GLY 192 192 192 GLY GLY A . n 
C 3 193 LEU 193 193 193 LEU LEU A . n 
C 3 194 ILE 194 194 194 ILE ILE A . n 
C 3 195 TYR 195 195 195 TYR TYR A . n 
C 3 196 ARG 196 196 196 ARG ARG A . n 
C 3 197 MET 197 197 197 MET MET A . n 
C 3 198 VAL 198 198 198 VAL VAL A . n 
C 3 199 LYS 199 199 199 LYS LYS A . n 
C 3 200 PRO 200 200 200 PRO PRO A . n 
C 3 201 LYS 201 201 201 LYS LYS A . n 
C 3 202 ILE 202 202 202 ILE ILE A . n 
C 3 203 VAL 203 203 203 VAL VAL A . n 
C 3 204 LEU 204 204 204 LEU LEU A . n 
C 3 205 LEU 205 205 205 LEU LEU A . n 
C 3 206 ILE 206 206 206 ILE ILE A . n 
C 3 207 PHE 207 207 207 PHE PHE A . n 
C 3 208 VAL 208 208 208 VAL VAL A . n 
C 3 209 SER 209 209 209 SER SER A . n 
C 3 210 GLY 210 210 210 GLY GLY A . n 
C 3 211 LYS 211 211 211 LYS LYS A . n 
C 3 212 ILE 212 212 212 ILE ILE A . n 
C 3 213 VAL 213 213 213 VAL VAL A . n 
C 3 214 LEU 214 214 214 LEU LEU A . n 
C 3 215 THR 215 215 215 THR THR A . n 
C 3 216 GLY 216 216 216 GLY GLY A . n 
C 3 217 ALA 217 217 217 ALA ALA A . n 
C 3 218 LYS 218 218 218 LYS LYS A . n 
C 3 219 GLN 219 219 219 GLN GLN A . n 
C 3 220 ARG 220 220 220 ARG ARG A . n 
C 3 221 GLU 221 221 221 GLU GLU A . n 
C 3 222 GLU 222 222 222 GLU GLU A . n 
C 3 223 ILE 223 223 223 ILE ILE A . n 
C 3 224 TYR 224 224 224 TYR TYR A . n 
C 3 225 GLN 225 225 225 GLN GLN A . n 
C 3 226 ALA 226 226 226 ALA ALA A . n 
C 3 227 PHE 227 227 227 PHE PHE A . n 
C 3 228 GLU 228 228 228 GLU GLU A . n 
C 3 229 ALA 229 229 229 ALA ALA A . n 
C 3 230 ILE 230 230 230 ILE ILE A . n 
C 3 231 TYR 231 231 231 TYR TYR A . n 
C 3 232 PRO 232 232 232 PRO PRO A . n 
C 3 233 VAL 233 233 233 VAL VAL A . n 
C 3 234 LEU 234 234 234 LEU LEU A . n 
C 3 235 SER 235 235 235 SER SER A . n 
C 3 236 GLU 236 236 236 GLU GLU A . n 
C 3 237 PHE 237 237 237 PHE PHE A . n 
C 3 238 ARG 238 238 238 ARG ARG A . n 
C 3 239 LYS 239 239 239 LYS LYS A . n 
C 3 240 MET 240 240 240 MET MET A . n 
D 4 1   MET 1   1   ?   ?   ?   B . n 
D 4 2   ALA 2   2   ?   ?   ?   B . n 
D 4 3   VAL 3   3   ?   ?   ?   B . n 
D 4 4   PRO 4   4   4   PRO PRO B . n 
D 4 5   GLY 5   5   5   GLY GLY B . n 
D 4 6   TYR 6   6   6   TYR TYR B . n 
D 4 7   TYR 7   7   7   TYR TYR B . n 
D 4 8   GLU 8   8   8   GLU GLU B . n 
D 4 9   LEU 9   9   9   LEU LEU B . n 
D 4 10  TYR 10  10  10  TYR TYR B . n 
D 4 11  ARG 11  11  11  ARG ARG B . n 
D 4 12  ARG 12  12  12  ARG ARG B . n 
D 4 13  SER 13  13  13  SER SER B . n 
D 4 14  THR 14  14  14  THR THR B . n 
D 4 15  ILE 15  15  15  ILE ILE B . n 
D 4 16  GLY 16  16  16  GLY GLY B . n 
D 4 17  ASN 17  17  17  ASN ASN B . n 
D 4 18  SER 18  18  18  SER SER B . n 
D 4 19  LEU 19  19  19  LEU LEU B . n 
D 4 20  VAL 20  20  20  VAL VAL B . n 
D 4 21  ASP 21  21  21  ASP ASP B . n 
D 4 22  ALA 22  22  22  ALA ALA B . n 
D 4 23  LEU 23  23  23  LEU LEU B . n 
D 4 24  ASP 24  24  24  ASP ASP B . n 
D 4 25  THR 25  25  25  THR THR B . n 
D 4 26  LEU 26  26  26  LEU LEU B . n 
D 4 27  ILE 27  27  27  ILE ILE B . n 
D 4 28  SER 28  28  28  SER SER B . n 
D 4 29  ASP 29  29  29  ASP ASP B . n 
D 4 30  GLY 30  30  30  GLY GLY B . n 
D 4 31  ARG 31  31  31  ARG ARG B . n 
D 4 32  ILE 32  32  32  ILE ILE B . n 
D 4 33  GLU 33  33  33  GLU GLU B . n 
D 4 34  ALA 34  34  34  ALA ALA B . n 
D 4 35  SER 35  35  35  SER SER B . n 
D 4 36  LEU 36  36  36  LEU LEU B . n 
D 4 37  ALA 37  37  37  ALA ALA B . n 
D 4 38  MET 38  38  38  MET MET B . n 
D 4 39  ARG 39  39  39  ARG ARG B . n 
D 4 40  VAL 40  40  40  VAL VAL B . n 
D 4 41  LEU 41  41  41  LEU LEU B . n 
D 4 42  GLU 42  42  42  GLU GLU B . n 
D 4 43  THR 43  43  43  THR THR B . n 
D 4 44  PHE 44  44  44  PHE PHE B . n 
D 4 45  ASP 45  45  45  ASP ASP B . n 
D 4 46  LYS 46  46  46  LYS LYS B . n 
D 4 47  VAL 47  47  47  VAL VAL B . n 
D 4 48  VAL 48  48  48  VAL VAL B . n 
D 4 49  ALA 49  49  49  ALA ALA B . n 
D 4 50  GLU 50  50  50  GLU GLU B . n 
D 4 51  THR 51  51  51  THR THR B . n 
D 4 52  LEU 52  52  52  LEU LEU B . n 
D 4 53  LYS 53  53  53  LYS LYS B . n 
D 4 54  ASP 54  54  54  ASP ASP B . n 
D 4 55  ASN 55  55  55  ASN ASN B . n 
D 4 56  THR 56  56  56  THR THR B . n 
D 4 57  GLN 57  57  57  GLN GLN B . n 
D 4 58  SER 58  58  58  SER SER B . n 
D 4 59  LYS 59  59  59  LYS LYS B . n 
D 4 60  LEU 60  60  60  LEU LEU B . n 
D 4 61  THR 61  61  61  THR THR B . n 
D 4 62  VAL 62  62  62  VAL VAL B . n 
D 4 63  LYS 63  63  63  LYS LYS B . n 
D 4 64  GLY 64  64  64  GLY GLY B . n 
D 4 65  ASN 65  65  65  ASN ASN B . n 
D 4 66  LEU 66  66  66  LEU LEU B . n 
D 4 67  ASP 67  67  67  ASP ASP B . n 
D 4 68  THR 68  68  68  THR THR B . n 
D 4 69  TYR 69  69  69  TYR TYR B . n 
D 4 70  GLY 70  70  70  GLY GLY B . n 
D 4 71  PHE 71  71  71  PHE PHE B . n 
D 4 72  CYS 72  72  72  CYS CYS B . n 
D 4 73  ASP 73  73  73  ASP ASP B . n 
D 4 74  ASP 74  74  74  ASP ASP B . n 
D 4 75  VAL 75  75  75  VAL VAL B . n 
D 4 76  TRP 76  76  76  TRP TRP B . n 
D 4 77  THR 77  77  77  THR THR B . n 
D 4 78  PHE 78  78  78  PHE PHE B . n 
D 4 79  ILE 79  79  79  ILE ILE B . n 
D 4 80  VAL 80  80  80  VAL VAL B . n 
D 4 81  LYS 81  81  81  LYS LYS B . n 
D 4 82  ASN 82  82  82  ASN ASN B . n 
D 4 83  CYS 83  83  83  CYS CYS B . n 
D 4 84  GLN 84  84  84  GLN GLN B . n 
D 4 85  VAL 85  85  85  VAL VAL B . n 
D 4 86  THR 86  86  86  THR THR B . n 
D 4 87  VAL 87  87  87  VAL VAL B . n 
D 4 88  GLU 88  88  88  GLU GLU B . n 
D 4 89  ASP 89  89  ?   ?   ?   B . n 
D 4 90  SER 90  90  ?   ?   ?   B . n 
D 4 91  HIS 91  91  ?   ?   ?   B . n 
D 4 92  ARG 92  92  ?   ?   ?   B . n 
D 4 93  ASP 93  93  ?   ?   ?   B . n 
D 4 94  ALA 94  94  ?   ?   ?   B . n 
D 4 95  SER 95  95  ?   ?   ?   B . n 
D 4 96  GLN 96  96  ?   ?   ?   B . n 
D 4 97  ASN 97  97  ?   ?   ?   B . n 
D 4 98  GLY 98  98  ?   ?   ?   B . n 
D 4 99  SER 99  99  ?   ?   ?   B . n 
D 4 100 GLY 100 100 ?   ?   ?   B . n 
D 4 101 ASP 101 101 ?   ?   ?   B . n 
D 4 102 SER 102 102 ?   ?   ?   B . n 
D 4 103 GLN 103 103 ?   ?   ?   B . n 
D 4 104 SER 104 104 ?   ?   ?   B . n 
D 4 105 VAL 105 105 105 VAL VAL B . n 
D 4 106 ILE 106 106 106 ILE ILE B . n 
D 4 107 SER 107 107 107 SER SER B . n 
D 4 108 VAL 108 108 108 VAL VAL B . n 
D 4 109 ASP 109 109 109 ASP ASP B . n 
D 4 110 LYS 110 110 110 LYS LYS B . n 
D 4 111 LEU 111 111 111 LEU LEU B . n 
D 4 112 ARG 112 112 112 ARG ARG B . n 
D 4 113 ILE 113 113 113 ILE ILE B . n 
D 4 114 VAL 114 114 114 VAL VAL B . n 
D 4 115 ALA 115 115 115 ALA ALA B . n 
D 4 116 CYS 116 116 116 CYS CYS B . n 
D 4 117 ASN 117 117 117 ASN ASN B . n 
D 4 118 SER 118 118 118 SER SER B . n 
D 4 119 LYS 119 119 119 LYS LYS B . n 
D 4 120 LYS 120 120 120 LYS LYS B . n 
D 4 121 SER 121 121 ?   ?   ?   B . n 
D 4 122 GLU 122 122 ?   ?   ?   B . n 
E 5 1   MET 1   1   ?   ?   ?   C . n 
E 5 2   SER 2   2   2   SER SER C . n 
E 5 3   ASN 3   3   3   ASN ASN C . n 
E 5 4   ALA 4   4   4   ALA ALA C . n 
E 5 5   GLU 5   5   5   GLU GLU C . n 
E 5 6   ALA 6   6   6   ALA ALA C . n 
E 5 7   SER 7   7   7   SER SER C . n 
E 5 8   ARG 8   8   8   ARG ARG C . n 
E 5 9   VAL 9   9   9   VAL VAL C . n 
E 5 10  TYR 10  10  10  TYR TYR C . n 
E 5 11  GLU 11  11  11  GLU GLU C . n 
E 5 12  ILE 12  12  12  ILE ILE C . n 
E 5 13  ILE 13  13  13  ILE ILE C . n 
E 5 14  VAL 14  14  14  VAL VAL C . n 
E 5 15  GLU 15  15  15  GLU GLU C . n 
E 5 16  SER 16  16  16  SER SER C . n 
E 5 17  VAL 17  17  17  VAL VAL C . n 
E 5 18  VAL 18  18  18  VAL VAL C . n 
E 5 19  ASN 19  19  19  ASN ASN C . n 
E 5 20  GLU 20  20  20  GLU GLU C . n 
E 5 21  VAL 21  21  21  VAL VAL C . n 
E 5 22  ARG 22  22  22  ARG ARG C . n 
E 5 23  GLU 23  23  23  GLU GLU C . n 
E 5 24  ASP 24  24  24  ASP ASP C . n 
E 5 25  PHE 25  25  25  PHE PHE C . n 
E 5 26  GLU 26  26  26  GLU GLU C . n 
E 5 27  ASN 27  27  27  ASN ASN C . n 
E 5 28  ALA 28  28  28  ALA ALA C . n 
E 5 29  GLY 29  29  29  GLY GLY C . n 
E 5 30  ILE 30  30  30  ILE ILE C . n 
E 5 31  ASP 31  31  31  ASP ASP C . n 
E 5 32  GLU 32  32  32  GLU GLU C . n 
E 5 33  GLN 33  33  33  GLN GLN C . n 
E 5 34  THR 34  34  34  THR THR C . n 
E 5 35  LEU 35  35  35  LEU LEU C . n 
E 5 36  GLN 36  36  36  GLN GLN C . n 
E 5 37  ASP 37  37  37  ASP ASP C . n 
E 5 38  LEU 38  38  38  LEU LEU C . n 
E 5 39  LYS 39  39  39  LYS LYS C . n 
E 5 40  ASN 40  40  40  ASN ASN C . n 
E 5 41  ILE 41  41  41  ILE ILE C . n 
E 5 42  TRP 42  42  42  TRP TRP C . n 
E 5 43  GLN 43  43  43  GLN GLN C . n 
E 5 44  LYS 44  44  44  LYS LYS C . n 
E 5 45  LYS 45  45  45  LYS LYS C . n 
E 5 46  LEU 46  46  46  LEU LEU C . n 
E 5 47  THR 47  47  47  THR THR C . n 
E 5 48  GLU 48  48  48  GLU GLU C . n 
E 5 49  THR 49  49  49  THR THR C . n 
E 5 50  LYS 50  50  50  LYS LYS C . n 
E 5 51  VAL 51  51  51  VAL VAL C . n 
E 5 52  THR 52  52  52  THR THR C . n 
E 5 53  THR 53  53  53  THR THR C . n 
E 5 54  PHE 54  54  54  PHE PHE C . n 
E 5 55  SER 55  55  55  SER SER C . n 
E 5 56  TRP 56  56  56  TRP TRP C . n 
E 5 57  ASP 57  57  57  ASP ASP C . n 
E 5 58  ASN 58  58  58  ASN ASN C . n 
E 5 59  GLN 59  59  59  GLN GLN C . n 
E 5 60  PHE 60  60  60  PHE PHE C . n 
E 5 61  ASN 61  61  61  ASN ASN C . n 
E 5 62  GLU 62  62  ?   ?   ?   C . n 
E 5 63  GLY 63  63  ?   ?   ?   C . n 
E 5 64  ASN 64  64  ?   ?   ?   C . n 
E 5 65  ILE 65  65  ?   ?   ?   C . n 
E 5 66  ASN 66  66  ?   ?   ?   C . n 
E 5 67  GLY 67  67  ?   ?   ?   C . n 
E 5 68  VAL 68  68  ?   ?   ?   C . n 
E 5 69  GLN 69  69  ?   ?   ?   C . n 
E 5 70  ASN 70  70  ?   ?   ?   C . n 
E 5 71  ASP 71  71  ?   ?   ?   C . n 
E 5 72  LEU 72  72  ?   ?   ?   C . n 
E 5 73  ASN 73  73  ?   ?   ?   C . n 
E 5 74  PHE 74  74  ?   ?   ?   C . n 
E 5 75  ASN 75  75  ?   ?   ?   C . n 
E 5 76  LEU 76  76  ?   ?   ?   C . n 
E 5 77  ALA 77  77  ?   ?   ?   C . n 
E 5 78  THR 78  78  ?   ?   ?   C . n 
E 5 79  PRO 79  79  ?   ?   ?   C . n 
E 5 80  GLY 80  80  ?   ?   ?   C . n 
E 5 81  VAL 81  81  ?   ?   ?   C . n 
E 5 82  ASN 82  82  ?   ?   ?   C . n 
E 5 83  SER 83  83  ?   ?   ?   C . n 
E 5 84  SER 84  84  ?   ?   ?   C . n 
E 5 85  GLU 85  85  ?   ?   ?   C . n 
E 5 86  PHE 86  86  ?   ?   ?   C . n 
E 5 87  ASN 87  87  ?   ?   ?   C . n 
E 5 88  ILE 88  88  ?   ?   ?   C . n 
E 5 89  LYS 89  89  ?   ?   ?   C . n 
E 5 90  GLU 90  90  ?   ?   ?   C . n 
E 5 91  GLU 91  91  ?   ?   ?   C . n 
E 5 92  ASN 92  92  ?   ?   ?   C . n 
E 5 93  THR 93  93  ?   ?   ?   C . n 
E 5 94  GLY 94  94  ?   ?   ?   C . n 
E 5 95  ASN 95  95  ?   ?   ?   C . n 
E 5 96  GLU 96  96  ?   ?   ?   C . n 
E 5 97  GLY 97  97  ?   ?   ?   C . n 
E 5 98  LEU 98  98  ?   ?   ?   C . n 
E 5 99  ILE 99  99  ?   ?   ?   C . n 
E 5 100 LEU 100 100 ?   ?   ?   C . n 
E 5 101 PRO 101 101 ?   ?   ?   C . n 
E 5 102 ASN 102 102 ?   ?   ?   C . n 
E 5 103 ILE 103 103 ?   ?   ?   C . n 
E 5 104 ASN 104 104 ?   ?   ?   C . n 
E 5 105 SER 105 105 ?   ?   ?   C . n 
E 5 106 ASN 106 106 ?   ?   ?   C . n 
E 5 107 ASN 107 107 ?   ?   ?   C . n 
E 5 108 ASN 108 108 ?   ?   ?   C . n 
E 5 109 ILE 109 109 ?   ?   ?   C . n 
E 5 110 PRO 110 110 ?   ?   ?   C . n 
E 5 111 HIS 111 111 ?   ?   ?   C . n 
E 5 112 SER 112 112 ?   ?   ?   C . n 
E 5 113 GLY 113 113 ?   ?   ?   C . n 
E 5 114 GLU 114 114 ?   ?   ?   C . n 
E 5 115 THR 115 115 ?   ?   ?   C . n 
E 5 116 ASN 116 116 ?   ?   ?   C . n 
E 5 117 ILE 117 117 ?   ?   ?   C . n 
E 5 118 ASN 118 118 ?   ?   ?   C . n 
E 5 119 THR 119 119 ?   ?   ?   C . n 
E 5 120 ASN 120 120 ?   ?   ?   C . n 
E 5 121 THR 121 121 ?   ?   ?   C . n 
E 5 122 VAL 122 122 ?   ?   ?   C . n 
E 5 123 GLU 123 123 ?   ?   ?   C . n 
E 5 124 ALA 124 124 ?   ?   ?   C . n 
E 5 125 THR 125 125 ?   ?   ?   C . n 
E 5 126 ASN 126 126 ?   ?   ?   C . n 
E 5 127 ASN 127 127 ?   ?   ?   C . n 
E 5 128 SER 128 128 ?   ?   ?   C . n 
E 5 129 GLY 129 129 ?   ?   ?   C . n 
E 5 130 ALA 130 130 ?   ?   ?   C . n 
E 5 131 THR 131 131 ?   ?   ?   C . n 
E 5 132 LEU 132 132 ?   ?   ?   C . n 
E 5 133 ASN 133 133 ?   ?   ?   C . n 
E 5 134 THR 134 134 ?   ?   ?   C . n 
E 5 135 ASN 135 135 ?   ?   ?   C . n 
E 5 136 THR 136 136 ?   ?   ?   C . n 
E 5 137 SER 137 137 ?   ?   ?   C . n 
E 5 138 GLY 138 138 ?   ?   ?   C . n 
E 5 139 ASN 139 139 ?   ?   ?   C . n 
E 5 140 THR 140 140 ?   ?   ?   C . n 
E 5 141 ASN 141 141 ?   ?   ?   C . n 
E 5 142 ALA 142 142 ?   ?   ?   C . n 
E 5 143 ASP 143 143 ?   ?   ?   C . n 
E 5 144 VAL 144 144 ?   ?   ?   C . n 
E 5 145 THR 145 145 ?   ?   ?   C . n 
E 5 146 SER 146 146 ?   ?   ?   C . n 
E 5 147 GLN 147 147 ?   ?   ?   C . n 
E 5 148 PRO 148 148 ?   ?   ?   C . n 
E 5 149 LYS 149 149 ?   ?   ?   C . n 
E 5 150 ILE 150 150 ?   ?   ?   C . n 
E 5 151 GLU 151 151 ?   ?   ?   C . n 
E 5 152 VAL 152 152 ?   ?   ?   C . n 
E 5 153 LYS 153 153 ?   ?   ?   C . n 
E 5 154 PRO 154 154 ?   ?   ?   C . n 
E 5 155 GLU 155 155 ?   ?   ?   C . n 
E 5 156 ILE 156 156 ?   ?   ?   C . n 
E 5 157 GLU 157 157 ?   ?   ?   C . n 
E 5 158 LEU 158 158 ?   ?   ?   C . n 
E 5 159 THR 159 159 ?   ?   ?   C . n 
E 5 160 ILE 160 160 ?   ?   ?   C . n 
E 5 161 ASN 161 161 ?   ?   ?   C . n 
E 5 162 ASN 162 162 ?   ?   ?   C . n 
E 5 163 ALA 163 163 ?   ?   ?   C . n 
E 5 164 ASN 164 164 ?   ?   ?   C . n 
E 5 165 ILE 165 165 ?   ?   ?   C . n 
E 5 166 THR 166 166 ?   ?   ?   C . n 
E 5 167 THR 167 167 ?   ?   ?   C . n 
E 5 168 VAL 168 168 ?   ?   ?   C . n 
E 5 169 GLU 169 169 ?   ?   ?   C . n 
E 5 170 ASN 170 170 ?   ?   ?   C . n 
E 5 171 ILE 171 171 ?   ?   ?   C . n 
E 5 172 ASP 172 172 ?   ?   ?   C . n 
E 5 173 ASP 173 173 ?   ?   ?   C . n 
E 5 174 GLU 174 174 ?   ?   ?   C . n 
E 5 175 SER 175 175 ?   ?   ?   C . n 
E 5 176 GLU 176 176 ?   ?   ?   C . n 
E 5 177 LYS 177 177 ?   ?   ?   C . n 
E 5 178 LYS 178 178 ?   ?   ?   C . n 
E 5 179 ASP 179 179 ?   ?   ?   C . n 
E 5 180 ASP 180 180 ?   ?   ?   C . n 
E 5 181 GLU 181 181 ?   ?   ?   C . n 
E 5 182 GLU 182 182 ?   ?   ?   C . n 
E 5 183 LYS 183 183 ?   ?   ?   C . n 
E 5 184 GLU 184 184 ?   ?   ?   C . n 
E 5 185 GLU 185 185 ?   ?   ?   C . n 
E 5 186 ASP 186 186 ?   ?   ?   C . n 
E 5 187 VAL 187 187 ?   ?   ?   C . n 
E 5 188 GLU 188 188 ?   ?   ?   C . n 
E 5 189 LYS 189 189 ?   ?   ?   C . n 
E 5 190 THR 190 190 ?   ?   ?   C . n 
E 5 191 ARG 191 191 ?   ?   ?   C . n 
E 5 192 LYS 192 192 ?   ?   ?   C . n 
E 5 193 GLU 193 193 ?   ?   ?   C . n 
E 5 194 LYS 194 194 ?   ?   ?   C . n 
E 5 195 GLU 195 195 ?   ?   ?   C . n 
E 5 196 GLN 196 196 ?   ?   ?   C . n 
E 5 197 ILE 197 197 ?   ?   ?   C . n 
E 5 198 GLU 198 198 ?   ?   ?   C . n 
E 5 199 GLN 199 199 ?   ?   ?   C . n 
E 5 200 VAL 200 200 ?   ?   ?   C . n 
E 5 201 LYS 201 201 ?   ?   ?   C . n 
E 5 202 LEU 202 202 ?   ?   ?   C . n 
E 5 203 GLN 203 203 ?   ?   ?   C . n 
E 5 204 ALA 204 204 ?   ?   ?   C . n 
E 5 205 LYS 205 205 ?   ?   ?   C . n 
E 5 206 LYS 206 206 ?   ?   ?   C . n 
E 5 207 GLU 207 207 ?   ?   ?   C . n 
E 5 208 LYS 208 208 ?   ?   ?   C . n 
E 5 209 ARG 209 209 ?   ?   ?   C . n 
E 5 210 SER 210 210 ?   ?   ?   C . n 
E 5 211 ALA 211 211 ?   ?   ?   C . n 
E 5 212 LEU 212 212 ?   ?   ?   C . n 
E 5 213 LEU 213 213 ?   ?   ?   C . n 
E 5 214 ASP 214 214 ?   ?   ?   C . n 
E 5 215 THR 215 215 ?   ?   ?   C . n 
E 5 216 ASP 216 216 ?   ?   ?   C . n 
E 5 217 GLU 217 217 ?   ?   ?   C . n 
E 5 218 VAL 218 218 ?   ?   ?   C . n 
E 5 219 GLY 219 219 ?   ?   ?   C . n 
E 5 220 SER 220 220 ?   ?   ?   C . n 
E 5 221 GLU 221 221 ?   ?   ?   C . n 
E 5 222 LEU 222 222 ?   ?   ?   C . n 
E 5 223 ASP 223 223 ?   ?   ?   C . n 
E 5 224 ASP 224 224 ?   ?   ?   C . n 
E 5 225 SER 225 225 ?   ?   ?   C . n 
E 5 226 ASP 226 226 ?   ?   ?   C . n 
E 5 227 ASP 227 227 ?   ?   ?   C . n 
E 5 228 ASP 228 228 228 ASP ASP C . n 
E 5 229 TYR 229 229 229 TYR TYR C . n 
E 5 230 LEU 230 230 230 LEU LEU C . n 
E 5 231 ILE 231 231 231 ILE ILE C . n 
E 5 232 SER 232 232 232 SER SER C . n 
E 5 233 GLU 233 233 ?   ?   ?   C . n 
E 5 234 GLY 234 234 ?   ?   ?   C . n 
E 5 235 GLU 235 235 ?   ?   ?   C . n 
E 5 236 GLU 236 236 236 GLU GLU C . n 
E 5 237 ASP 237 237 237 ASP ASP C . n 
E 5 238 GLY 238 238 238 GLY GLY C . n 
E 5 239 PRO 239 239 239 PRO PRO C . n 
E 5 240 ASP 240 240 240 ASP ASP C . n 
E 5 241 GLU 241 241 241 GLU GLU C . n 
E 5 242 ASN 242 242 242 ASN ASN C . n 
E 5 243 LEU 243 243 243 LEU LEU C . n 
E 5 244 MET 244 244 244 MET MET C . n 
E 5 245 LEU 245 245 245 LEU LEU C . n 
E 5 246 CYS 246 246 246 CYS CYS C . n 
E 5 247 LEU 247 247 247 LEU LEU C . n 
E 5 248 TYR 248 248 248 TYR TYR C . n 
E 5 249 ASP 249 249 249 ASP ASP C . n 
E 5 250 LYS 250 250 250 LYS LYS C . n 
E 5 251 VAL 251 251 251 VAL VAL C . n 
E 5 252 THR 252 252 252 THR THR C . n 
E 5 253 ARG 253 253 253 ARG ARG C . n 
E 5 254 THR 254 254 254 THR THR C . n 
E 5 255 LYS 255 255 255 LYS LYS C . n 
E 5 256 ALA 256 256 256 ALA ALA C . n 
E 5 257 ARG 257 257 257 ARG ARG C . n 
E 5 258 TRP 258 258 258 TRP TRP C . n 
E 5 259 LYS 259 259 259 LYS LYS C . n 
E 5 260 CYS 260 260 260 CYS CYS C . n 
E 5 261 SER 261 261 261 SER SER C . n 
E 5 262 LEU 262 262 262 LEU LEU C . n 
E 5 263 LYS 263 263 263 LYS LYS C . n 
E 5 264 ASP 264 264 264 ASP ASP C . n 
E 5 265 GLY 265 265 265 GLY GLY C . n 
E 5 266 VAL 266 266 266 VAL VAL C . n 
E 5 267 VAL 267 267 267 VAL VAL C . n 
E 5 268 THR 268 268 268 THR THR C . n 
E 5 269 ILE 269 269 269 ILE ILE C . n 
E 5 270 ASN 270 270 270 ASN ASN C . n 
E 5 271 ARG 271 271 271 ARG ARG C . n 
E 5 272 ASN 272 272 272 ASN ASN C . n 
E 5 273 ASP 273 273 273 ASP ASP C . n 
E 5 274 TYR 274 274 274 TYR TYR C . n 
E 5 275 THR 275 275 275 THR THR C . n 
E 5 276 PHE 276 276 276 PHE PHE C . n 
E 5 277 GLN 277 277 277 GLN GLN C . n 
E 5 278 LYS 278 278 278 LYS LYS C . n 
E 5 279 ALA 279 279 279 ALA ALA C . n 
E 5 280 GLN 280 280 280 GLN GLN C . n 
E 5 281 VAL 281 281 281 VAL VAL C . n 
E 5 282 GLU 282 282 282 GLU GLU C . n 
E 5 283 ALA 283 283 283 ALA ALA C . n 
E 5 284 GLU 284 284 284 GLU GLU C . n 
E 5 285 TRP 285 285 285 TRP TRP C . n 
E 5 286 VAL 286 286 286 VAL VAL C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-26 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
X-PLOR    'model building' . ? 3 
CNS       refinement       . ? 4 
X-PLOR    phasing          . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 78  ? ? 165.98  130.60  
2  1 LYS A 110 ? ? -51.40  99.80   
3  1 ALA A 149 ? ? -81.81  43.79   
4  1 ASP A 154 ? ? 28.51   38.38   
5  1 LYS A 167 ? ? 76.16   -18.59  
6  1 HIS A 179 ? ? -111.10 57.29   
7  1 GLU A 186 ? ? -155.51 83.73   
8  1 ILE C 231 ? ? -49.22  151.34  
9  1 CYS C 246 ? ? -171.60 -164.99 
10 1 LYS C 255 ? ? 62.32   -116.97 
11 1 ASP C 264 ? ? 33.70   71.34   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DT D 10 ? ? 0.064 'SIDE CHAIN' 
2 1 DA D 15 ? ? 0.074 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? C MET 1   
2   1 Y 1 A ALA 2   ? C ALA 2   
3   1 Y 1 A ASP 3   ? C ASP 3   
4   1 Y 1 A GLU 4   ? C GLU 4   
5   1 Y 1 A GLU 5   ? C GLU 5   
6   1 Y 1 A ARG 6   ? C ARG 6   
7   1 Y 1 A LEU 7   ? C LEU 7   
8   1 Y 1 A LYS 8   ? C LYS 8   
9   1 Y 1 A GLU 9   ? C GLU 9   
10  1 Y 1 A PHE 10  ? C PHE 10  
11  1 Y 1 A LYS 11  ? C LYS 11  
12  1 Y 1 A GLU 12  ? C GLU 12  
13  1 Y 1 A ALA 13  ? C ALA 13  
14  1 Y 1 A ASN 14  ? C ASN 14  
15  1 Y 1 A LYS 15  ? C LYS 15  
16  1 Y 1 A ILE 16  ? C ILE 16  
17  1 Y 1 A VAL 17  ? C VAL 17  
18  1 Y 1 A PHE 18  ? C PHE 18  
19  1 Y 1 A ASP 19  ? C ASP 19  
20  1 Y 1 A PRO 20  ? C PRO 20  
21  1 Y 1 A ASN 21  ? C ASN 21  
22  1 Y 1 A THR 22  ? C THR 22  
23  1 Y 1 A ARG 23  ? C ARG 23  
24  1 Y 1 A GLN 24  ? C GLN 24  
25  1 Y 1 A VAL 25  ? C VAL 25  
26  1 Y 1 A TRP 26  ? C TRP 26  
27  1 Y 1 A GLU 27  ? C GLU 27  
28  1 Y 1 A ASN 28  ? C ASN 28  
29  1 Y 1 A GLN 29  ? C GLN 29  
30  1 Y 1 A ASN 30  ? C ASN 30  
31  1 Y 1 A ARG 31  ? C ARG 31  
32  1 Y 1 A ASP 32  ? C ASP 32  
33  1 Y 1 A GLY 33  ? C GLY 33  
34  1 Y 1 A THR 34  ? C THR 34  
35  1 Y 1 A LYS 35  ? C LYS 35  
36  1 Y 1 A PRO 36  ? C PRO 36  
37  1 Y 1 A ALA 37  ? C ALA 37  
38  1 Y 1 A THR 38  ? C THR 38  
39  1 Y 1 A THR 39  ? C THR 39  
40  1 Y 1 A PHE 40  ? C PHE 40  
41  1 Y 1 A GLN 41  ? C GLN 41  
42  1 Y 1 A SER 42  ? C SER 42  
43  1 Y 1 A GLU 43  ? C GLU 43  
44  1 Y 1 A GLU 44  ? C GLU 44  
45  1 Y 1 A ASP 45  ? C ASP 45  
46  1 Y 1 A ILE 46  ? C ILE 46  
47  1 Y 1 A LYS 47  ? C LYS 47  
48  1 Y 1 A ARG 48  ? C ARG 48  
49  1 Y 1 A ALA 49  ? C ALA 49  
50  1 Y 1 A ALA 50  ? C ALA 50  
51  1 Y 1 A PRO 51  ? C PRO 51  
52  1 Y 1 A GLU 52  ? C GLU 52  
53  1 Y 1 A SER 53  ? C SER 53  
54  1 Y 1 A GLU 54  ? C GLU 54  
55  1 Y 1 A LYS 55  ? C LYS 55  
56  1 Y 1 A ASP 56  ? C ASP 56  
57  1 Y 1 A THR 57  ? C THR 57  
58  1 Y 1 A SER 58  ? C SER 58  
59  1 Y 1 A ALA 59  ? C ALA 59  
60  1 Y 1 A THR 60  ? C THR 60  
61  1 Y 1 B MET 1   ? D MET 1   
62  1 Y 1 B ALA 2   ? D ALA 2   
63  1 Y 1 B VAL 3   ? D VAL 3   
64  1 Y 1 B ASP 89  ? D ASP 89  
65  1 Y 1 B SER 90  ? D SER 90  
66  1 Y 1 B HIS 91  ? D HIS 91  
67  1 Y 1 B ARG 92  ? D ARG 92  
68  1 Y 1 B ASP 93  ? D ASP 93  
69  1 Y 1 B ALA 94  ? D ALA 94  
70  1 Y 1 B SER 95  ? D SER 95  
71  1 Y 1 B GLN 96  ? D GLN 96  
72  1 Y 1 B ASN 97  ? D ASN 97  
73  1 Y 1 B GLY 98  ? D GLY 98  
74  1 Y 1 B SER 99  ? D SER 99  
75  1 Y 1 B GLY 100 ? D GLY 100 
76  1 Y 1 B ASP 101 ? D ASP 101 
77  1 Y 1 B SER 102 ? D SER 102 
78  1 Y 1 B GLN 103 ? D GLN 103 
79  1 Y 1 B SER 104 ? D SER 104 
80  1 Y 1 B SER 121 ? D SER 121 
81  1 Y 1 B GLU 122 ? D GLU 122 
82  1 Y 1 C MET 1   ? E MET 1   
83  1 Y 1 C GLU 62  ? E GLU 62  
84  1 Y 1 C GLY 63  ? E GLY 63  
85  1 Y 1 C ASN 64  ? E ASN 64  
86  1 Y 1 C ILE 65  ? E ILE 65  
87  1 Y 1 C ASN 66  ? E ASN 66  
88  1 Y 1 C GLY 67  ? E GLY 67  
89  1 Y 1 C VAL 68  ? E VAL 68  
90  1 Y 1 C GLN 69  ? E GLN 69  
91  1 Y 1 C ASN 70  ? E ASN 70  
92  1 Y 1 C ASP 71  ? E ASP 71  
93  1 Y 1 C LEU 72  ? E LEU 72  
94  1 Y 1 C ASN 73  ? E ASN 73  
95  1 Y 1 C PHE 74  ? E PHE 74  
96  1 Y 1 C ASN 75  ? E ASN 75  
97  1 Y 1 C LEU 76  ? E LEU 76  
98  1 Y 1 C ALA 77  ? E ALA 77  
99  1 Y 1 C THR 78  ? E THR 78  
100 1 Y 1 C PRO 79  ? E PRO 79  
101 1 Y 1 C GLY 80  ? E GLY 80  
102 1 Y 1 C VAL 81  ? E VAL 81  
103 1 Y 1 C ASN 82  ? E ASN 82  
104 1 Y 1 C SER 83  ? E SER 83  
105 1 Y 1 C SER 84  ? E SER 84  
106 1 Y 1 C GLU 85  ? E GLU 85  
107 1 Y 1 C PHE 86  ? E PHE 86  
108 1 Y 1 C ASN 87  ? E ASN 87  
109 1 Y 1 C ILE 88  ? E ILE 88  
110 1 Y 1 C LYS 89  ? E LYS 89  
111 1 Y 1 C GLU 90  ? E GLU 90  
112 1 Y 1 C GLU 91  ? E GLU 91  
113 1 Y 1 C ASN 92  ? E ASN 92  
114 1 Y 1 C THR 93  ? E THR 93  
115 1 Y 1 C GLY 94  ? E GLY 94  
116 1 Y 1 C ASN 95  ? E ASN 95  
117 1 Y 1 C GLU 96  ? E GLU 96  
118 1 Y 1 C GLY 97  ? E GLY 97  
119 1 Y 1 C LEU 98  ? E LEU 98  
120 1 Y 1 C ILE 99  ? E ILE 99  
121 1 Y 1 C LEU 100 ? E LEU 100 
122 1 Y 1 C PRO 101 ? E PRO 101 
123 1 Y 1 C ASN 102 ? E ASN 102 
124 1 Y 1 C ILE 103 ? E ILE 103 
125 1 Y 1 C ASN 104 ? E ASN 104 
126 1 Y 1 C SER 105 ? E SER 105 
127 1 Y 1 C ASN 106 ? E ASN 106 
128 1 Y 1 C ASN 107 ? E ASN 107 
129 1 Y 1 C ASN 108 ? E ASN 108 
130 1 Y 1 C ILE 109 ? E ILE 109 
131 1 Y 1 C PRO 110 ? E PRO 110 
132 1 Y 1 C HIS 111 ? E HIS 111 
133 1 Y 1 C SER 112 ? E SER 112 
134 1 Y 1 C GLY 113 ? E GLY 113 
135 1 Y 1 C GLU 114 ? E GLU 114 
136 1 Y 1 C THR 115 ? E THR 115 
137 1 Y 1 C ASN 116 ? E ASN 116 
138 1 Y 1 C ILE 117 ? E ILE 117 
139 1 Y 1 C ASN 118 ? E ASN 118 
140 1 Y 1 C THR 119 ? E THR 119 
141 1 Y 1 C ASN 120 ? E ASN 120 
142 1 Y 1 C THR 121 ? E THR 121 
143 1 Y 1 C VAL 122 ? E VAL 122 
144 1 Y 1 C GLU 123 ? E GLU 123 
145 1 Y 1 C ALA 124 ? E ALA 124 
146 1 Y 1 C THR 125 ? E THR 125 
147 1 Y 1 C ASN 126 ? E ASN 126 
148 1 Y 1 C ASN 127 ? E ASN 127 
149 1 Y 1 C SER 128 ? E SER 128 
150 1 Y 1 C GLY 129 ? E GLY 129 
151 1 Y 1 C ALA 130 ? E ALA 130 
152 1 Y 1 C THR 131 ? E THR 131 
153 1 Y 1 C LEU 132 ? E LEU 132 
154 1 Y 1 C ASN 133 ? E ASN 133 
155 1 Y 1 C THR 134 ? E THR 134 
156 1 Y 1 C ASN 135 ? E ASN 135 
157 1 Y 1 C THR 136 ? E THR 136 
158 1 Y 1 C SER 137 ? E SER 137 
159 1 Y 1 C GLY 138 ? E GLY 138 
160 1 Y 1 C ASN 139 ? E ASN 139 
161 1 Y 1 C THR 140 ? E THR 140 
162 1 Y 1 C ASN 141 ? E ASN 141 
163 1 Y 1 C ALA 142 ? E ALA 142 
164 1 Y 1 C ASP 143 ? E ASP 143 
165 1 Y 1 C VAL 144 ? E VAL 144 
166 1 Y 1 C THR 145 ? E THR 145 
167 1 Y 1 C SER 146 ? E SER 146 
168 1 Y 1 C GLN 147 ? E GLN 147 
169 1 Y 1 C PRO 148 ? E PRO 148 
170 1 Y 1 C LYS 149 ? E LYS 149 
171 1 Y 1 C ILE 150 ? E ILE 150 
172 1 Y 1 C GLU 151 ? E GLU 151 
173 1 Y 1 C VAL 152 ? E VAL 152 
174 1 Y 1 C LYS 153 ? E LYS 153 
175 1 Y 1 C PRO 154 ? E PRO 154 
176 1 Y 1 C GLU 155 ? E GLU 155 
177 1 Y 1 C ILE 156 ? E ILE 156 
178 1 Y 1 C GLU 157 ? E GLU 157 
179 1 Y 1 C LEU 158 ? E LEU 158 
180 1 Y 1 C THR 159 ? E THR 159 
181 1 Y 1 C ILE 160 ? E ILE 160 
182 1 Y 1 C ASN 161 ? E ASN 161 
183 1 Y 1 C ASN 162 ? E ASN 162 
184 1 Y 1 C ALA 163 ? E ALA 163 
185 1 Y 1 C ASN 164 ? E ASN 164 
186 1 Y 1 C ILE 165 ? E ILE 165 
187 1 Y 1 C THR 166 ? E THR 166 
188 1 Y 1 C THR 167 ? E THR 167 
189 1 Y 1 C VAL 168 ? E VAL 168 
190 1 Y 1 C GLU 169 ? E GLU 169 
191 1 Y 1 C ASN 170 ? E ASN 170 
192 1 Y 1 C ILE 171 ? E ILE 171 
193 1 Y 1 C ASP 172 ? E ASP 172 
194 1 Y 1 C ASP 173 ? E ASP 173 
195 1 Y 1 C GLU 174 ? E GLU 174 
196 1 Y 1 C SER 175 ? E SER 175 
197 1 Y 1 C GLU 176 ? E GLU 176 
198 1 Y 1 C LYS 177 ? E LYS 177 
199 1 Y 1 C LYS 178 ? E LYS 178 
200 1 Y 1 C ASP 179 ? E ASP 179 
201 1 Y 1 C ASP 180 ? E ASP 180 
202 1 Y 1 C GLU 181 ? E GLU 181 
203 1 Y 1 C GLU 182 ? E GLU 182 
204 1 Y 1 C LYS 183 ? E LYS 183 
205 1 Y 1 C GLU 184 ? E GLU 184 
206 1 Y 1 C GLU 185 ? E GLU 185 
207 1 Y 1 C ASP 186 ? E ASP 186 
208 1 Y 1 C VAL 187 ? E VAL 187 
209 1 Y 1 C GLU 188 ? E GLU 188 
210 1 Y 1 C LYS 189 ? E LYS 189 
211 1 Y 1 C THR 190 ? E THR 190 
212 1 Y 1 C ARG 191 ? E ARG 191 
213 1 Y 1 C LYS 192 ? E LYS 192 
214 1 Y 1 C GLU 193 ? E GLU 193 
215 1 Y 1 C LYS 194 ? E LYS 194 
216 1 Y 1 C GLU 195 ? E GLU 195 
217 1 Y 1 C GLN 196 ? E GLN 196 
218 1 Y 1 C ILE 197 ? E ILE 197 
219 1 Y 1 C GLU 198 ? E GLU 198 
220 1 Y 1 C GLN 199 ? E GLN 199 
221 1 Y 1 C VAL 200 ? E VAL 200 
222 1 Y 1 C LYS 201 ? E LYS 201 
223 1 Y 1 C LEU 202 ? E LEU 202 
224 1 Y 1 C GLN 203 ? E GLN 203 
225 1 Y 1 C ALA 204 ? E ALA 204 
226 1 Y 1 C LYS 205 ? E LYS 205 
227 1 Y 1 C LYS 206 ? E LYS 206 
228 1 Y 1 C GLU 207 ? E GLU 207 
229 1 Y 1 C LYS 208 ? E LYS 208 
230 1 Y 1 C ARG 209 ? E ARG 209 
231 1 Y 1 C SER 210 ? E SER 210 
232 1 Y 1 C ALA 211 ? E ALA 211 
233 1 Y 1 C LEU 212 ? E LEU 212 
234 1 Y 1 C LEU 213 ? E LEU 213 
235 1 Y 1 C ASP 214 ? E ASP 214 
236 1 Y 1 C THR 215 ? E THR 215 
237 1 Y 1 C ASP 216 ? E ASP 216 
238 1 Y 1 C GLU 217 ? E GLU 217 
239 1 Y 1 C VAL 218 ? E VAL 218 
240 1 Y 1 C GLY 219 ? E GLY 219 
241 1 Y 1 C SER 220 ? E SER 220 
242 1 Y 1 C GLU 221 ? E GLU 221 
243 1 Y 1 C LEU 222 ? E LEU 222 
244 1 Y 1 C ASP 223 ? E ASP 223 
245 1 Y 1 C ASP 224 ? E ASP 224 
246 1 Y 1 C SER 225 ? E SER 225 
247 1 Y 1 C ASP 226 ? E ASP 226 
248 1 Y 1 C ASP 227 ? E ASP 227 
249 1 Y 1 C GLU 233 ? E GLU 233 
250 1 Y 1 C GLY 234 ? E GLY 234 
251 1 Y 1 C GLU 235 ? E GLU 235 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RM1 'double helix'        
1RM1 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 1  1_555 B DT 18 1_555 -0.920 -0.322 0.033  6.148   -10.341 4.813   1  D_DA1:DT36_E  D 1  ? E 36 ? 20 1 
1 A DT 2  1_555 B DA 17 1_555 -0.995 -0.180 -0.228 7.518   -15.861 18.538  2  D_DT2:DA35_E  D 2  ? E 35 ? 20 1 
1 A DC 3  1_555 B DG 16 1_555 0.218  0.144  -0.247 5.358   -16.032 4.941   3  D_DC3:DG34_E  D 3  ? E 34 ? 19 1 
1 A DG 4  1_555 B DC 15 1_555 -0.717 -0.184 -0.576 10.391  -3.654  2.990   4  D_DG4:DC33_E  D 4  ? E 33 ? 19 1 
1 A DA 5  1_555 B DT 14 1_555 0.022  0.204  -0.592 -16.958 -15.452 9.000   5  D_DA5:DT32_E  D 5  ? E 32 ? 20 1 
1 A DT 6  1_555 B DA 13 1_555 0.232  -0.449 0.098  -0.728  -14.442 0.309   6  D_DT6:DA31_E  D 6  ? E 31 ? 20 1 
1 A DC 7  1_555 B DG 12 1_555 1.043  -0.818 0.072  -7.353  -11.577 -0.407  7  D_DC7:DG30_E  D 7  ? E 30 ? 19 1 
1 A DG 8  1_555 B DC 11 1_555 -1.216 -0.048 -0.269 -17.212 -10.827 0.280   8  D_DG8:DC29_E  D 8  ? E 29 ? 19 1 
1 A DA 9  1_555 B DT 10 1_555 -0.356 -0.243 -0.464 -10.086 -6.639  -8.227  9  D_DA9:DT28_E  D 9  ? E 28 ? 20 1 
1 A DT 10 1_555 B DA 9  1_555 -0.524 -0.325 -0.471 5.355   4.631   2.070   10 D_DT10:DA27_E D 10 ? E 27 ? 20 1 
1 A DA 11 1_555 B DT 8  1_555 0.530  0.013  -0.428 -40.536 17.874  -2.255  11 D_DA11:DT26_E D 11 ? E 26 ? 20 1 
1 A DT 12 1_555 B DA 7  1_555 -0.206 -0.198 -0.049 -26.843 -2.557  -3.497  12 D_DT12:DA25_E D 12 ? E 25 ? 20 1 
1 A DA 13 1_555 B DT 6  1_555 0.243  -0.087 -0.532 0.484   -0.799  -7.191  13 D_DA13:DT24_E D 13 ? E 24 ? 20 1 
1 A DA 14 1_555 B DT 5  1_555 -0.122 -0.093 -0.096 13.344  12.376  -1.120  14 D_DA14:DT23_E D 14 ? E 23 ? 20 1 
1 A DA 15 1_555 B DT 4  1_555 -0.135 -0.211 -0.131 21.116  -2.793  -1.184  15 D_DA15:DT22_E D 15 ? E 22 ? 20 1 
1 A DA 16 1_555 B DT 3  1_555 -0.373 -0.004 -0.040 40.952  -6.684  4.218   16 D_DA16:DT21_E D 16 ? E 21 ? 20 1 
1 A DC 17 1_555 B DG 2  1_555 -0.575 -0.347 -0.324 16.058  10.016  -3.438  17 D_DC17:DG20_E D 17 ? E 20 ? 19 1 
1 A DG 18 1_555 B DC 1  1_555 -0.031 -0.921 -0.090 14.999  -14.423 133.095 18 D_DG18:DC19_E D 18 ? E 19 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 18 1_555 A DT 2  1_555 B DA 17 1_555 0.213  0.082  3.158 3.015   6.321   41.970  -0.507 0.002  3.145 8.751  
-4.175 42.525   1  DD_DA1DT2:DA35DT36_EE   D 1  ? E 36 ? D 2  ? E 35 ? 
1 A DT 2  1_555 B DA 17 1_555 A DC 3  1_555 B DG 16 1_555 -1.508 0.044  3.304 -2.045  1.256   42.637  -0.068 1.862  3.370 1.725  
2.810  42.701   2  DD_DT2DC3:DG34DA35_EE   D 2  ? E 35 ? D 3  ? E 34 ? 
1 A DC 3  1_555 B DG 16 1_555 A DG 4  1_555 B DC 15 1_555 -0.331 2.263  3.178 5.592   9.409   32.395  2.272  1.503  3.573 16.295 
-9.684 34.147   3  DD_DC3DG4:DC33DG34_EE   D 3  ? E 34 ? D 4  ? E 33 ? 
1 A DG 4  1_555 B DC 15 1_555 A DA 5  1_555 B DT 14 1_555 0.316  -1.325 3.752 0.011   15.511  33.506  -4.343 -0.498 2.882 25.290 
-0.017 36.828   4  DD_DG4DA5:DT32DC33_EE   D 4  ? E 33 ? D 5  ? E 32 ? 
1 A DA 5  1_555 B DT 14 1_555 A DT 6  1_555 B DA 13 1_555 -0.171 1.178  2.762 -8.988  -0.478  37.889  1.819  -0.670 2.717 -0.724 
13.609 38.905   5  DD_DA5DT6:DA31DT32_EE   D 5  ? E 32 ? D 6  ? E 31 ? 
1 A DT 6  1_555 B DA 13 1_555 A DC 7  1_555 B DG 12 1_555 -0.522 -0.798 3.439 0.697   5.742   39.694  -1.841 0.843  3.288 8.401  
-1.020 40.097   6  DD_DT6DC7:DG30DA31_EE   D 6  ? E 31 ? D 7  ? E 30 ? 
1 A DC 7  1_555 B DG 12 1_555 A DG 8  1_555 B DC 11 1_555 -0.124 -0.200 3.368 -0.672  12.164  21.445  -4.267 0.082  2.844 29.792 
1.645  24.628   7  DD_DC7DG8:DC29DG30_EE   D 7  ? E 30 ? D 8  ? E 29 ? 
1 A DG 8  1_555 B DC 11 1_555 A DA 9  1_555 B DT 10 1_555 -0.184 -0.225 3.206 -0.775  5.130   35.142  -1.101 0.192  3.146 8.440  
1.276  35.511   8  DD_DG8DA9:DT28DC29_EE   D 8  ? E 29 ? D 9  ? E 28 ? 
1 A DA 9  1_555 B DT 10 1_555 A DT 10 1_555 B DA 9  1_555 0.937  -0.384 3.012 -0.921  3.470   31.518  -1.284 -1.868 2.926 6.362  
1.688  31.717   9  DD_DA9DT10:DA27DT28_EE  D 9  ? E 28 ? D 10 ? E 27 ? 
1 A DT 10 1_555 B DA 9  1_555 A DA 11 1_555 B DT 8  1_555 -0.121 -0.169 5.341 -4.227  43.884  22.674  -5.724 -0.387 2.378 63.809 
6.145  49.317   10 DD_DT10DA11:DT26DA27_EE D 10 ? E 27 ? D 11 ? E 26 ? 
1 A DA 11 1_555 B DT 8  1_555 A DT 12 1_555 B DA 7  1_555 -1.051 -0.414 3.509 0.459   22.310  11.709  -7.534 2.548  1.258 62.639 
-1.290 25.166   11 DD_DA11DT12:DA25DT26_EE D 11 ? E 26 ? D 12 ? E 25 ? 
1 A DT 12 1_555 B DA 7  1_555 A DA 13 1_555 B DT 6  1_555 -0.135 2.115  2.844 2.406   12.215  25.653  1.464  0.833  3.449 25.672 
-5.056 28.469   12 DD_DT12DA13:DT24DA25_EE D 12 ? E 25 ? D 13 ? E 24 ? 
1 A DA 13 1_555 B DT 6  1_555 A DA 14 1_555 B DT 5  1_555 0.281  1.292  3.392 -3.730  27.819  5.418   -6.086 -1.736 1.869 78.590 
10.537 28.576   13 DD_DA13DA14:DT23DT24_EE D 13 ? E 24 ? D 14 ? E 23 ? 
1 A DA 14 1_555 B DT 5  1_555 A DA 15 1_555 B DT 4  1_555 -0.398 1.383  3.673 1.531   18.094  20.433  -2.883 1.335  3.649 41.869 
-3.542 27.272   14 DD_DA14DA15:DT22DT23_EE D 14 ? E 23 ? D 15 ? E 22 ? 
1 A DA 15 1_555 B DT 4  1_555 A DA 16 1_555 B DT 3  1_555 0.456  0.643  3.261 3.811   14.842  20.261  -3.161 0.149  3.054 36.234 
-9.305 25.355   15 DD_DA15DA16:DT21DT22_EE D 15 ? E 22 ? D 16 ? E 21 ? 
1 A DA 16 1_555 B DT 3  1_555 A DC 17 1_555 B DG 2  1_555 0.122  0.502  4.806 0.095   37.468  15.156  -6.164 -0.160 2.303 68.752 
-0.175 40.315   16 DD_DA16DC17:DG20DT21_EE D 16 ? E 21 ? D 17 ? E 20 ? 
1 A DC 17 1_555 B DG 2  1_555 A DG 18 1_555 B DC 1  1_555 -0.908 3.793  0.039 170.115 -31.674 -81.170 -1.845 -0.167 1.229 16.059 
86.252 -174.715 17 DD_DC17DG18:DC19DG20_EE D 17 ? E 20 ? D 18 ? E 19 ? 
# 
_pdbx_entity_nonpoly.entity_id   6 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 6 HOH 1   19  14  HOH HOH D . 
F 6 HOH 2   20  17  HOH HOH D . 
F 6 HOH 3   21  20  HOH HOH D . 
F 6 HOH 4   22  45  HOH HOH D . 
F 6 HOH 5   23  48  HOH HOH D . 
F 6 HOH 6   24  49  HOH HOH D . 
F 6 HOH 7   25  74  HOH HOH D . 
F 6 HOH 8   26  75  HOH HOH D . 
F 6 HOH 9   27  88  HOH HOH D . 
F 6 HOH 10  28  100 HOH HOH D . 
F 6 HOH 11  29  110 HOH HOH D . 
F 6 HOH 12  30  112 HOH HOH D . 
F 6 HOH 13  31  113 HOH HOH D . 
F 6 HOH 14  32  114 HOH HOH D . 
F 6 HOH 15  33  162 HOH HOH D . 
F 6 HOH 16  34  176 HOH HOH D . 
F 6 HOH 17  35  177 HOH HOH D . 
F 6 HOH 18  36  179 HOH HOH D . 
F 6 HOH 19  37  191 HOH HOH D . 
F 6 HOH 20  38  194 HOH HOH D . 
F 6 HOH 21  39  217 HOH HOH D . 
F 6 HOH 22  40  229 HOH HOH D . 
F 6 HOH 23  41  231 HOH HOH D . 
F 6 HOH 24  42  251 HOH HOH D . 
G 6 HOH 1   37  15  HOH HOH E . 
G 6 HOH 2   38  21  HOH HOH E . 
G 6 HOH 3   39  32  HOH HOH E . 
G 6 HOH 4   40  47  HOH HOH E . 
G 6 HOH 5   41  72  HOH HOH E . 
G 6 HOH 6   42  73  HOH HOH E . 
G 6 HOH 7   43  115 HOH HOH E . 
G 6 HOH 8   44  123 HOH HOH E . 
G 6 HOH 9   45  141 HOH HOH E . 
G 6 HOH 10  46  142 HOH HOH E . 
G 6 HOH 11  47  168 HOH HOH E . 
G 6 HOH 12  48  175 HOH HOH E . 
G 6 HOH 13  49  196 HOH HOH E . 
G 6 HOH 14  50  199 HOH HOH E . 
G 6 HOH 15  51  216 HOH HOH E . 
G 6 HOH 16  52  218 HOH HOH E . 
G 6 HOH 17  53  223 HOH HOH E . 
G 6 HOH 18  54  232 HOH HOH E . 
G 6 HOH 19  55  233 HOH HOH E . 
G 6 HOH 20  56  245 HOH HOH E . 
G 6 HOH 21  57  269 HOH HOH E . 
G 6 HOH 22  58  291 HOH HOH E . 
G 6 HOH 23  59  306 HOH HOH E . 
G 6 HOH 24  60  307 HOH HOH E . 
H 6 HOH 1   241 1   HOH HOH A . 
H 6 HOH 2   242 2   HOH HOH A . 
H 6 HOH 3   243 3   HOH HOH A . 
H 6 HOH 4   244 4   HOH HOH A . 
H 6 HOH 5   245 5   HOH HOH A . 
H 6 HOH 6   246 6   HOH HOH A . 
H 6 HOH 7   247 7   HOH HOH A . 
H 6 HOH 8   248 9   HOH HOH A . 
H 6 HOH 9   249 11  HOH HOH A . 
H 6 HOH 10  250 12  HOH HOH A . 
H 6 HOH 11  251 13  HOH HOH A . 
H 6 HOH 12  252 16  HOH HOH A . 
H 6 HOH 13  253 22  HOH HOH A . 
H 6 HOH 14  254 23  HOH HOH A . 
H 6 HOH 15  255 24  HOH HOH A . 
H 6 HOH 16  256 25  HOH HOH A . 
H 6 HOH 17  257 27  HOH HOH A . 
H 6 HOH 18  258 29  HOH HOH A . 
H 6 HOH 19  259 31  HOH HOH A . 
H 6 HOH 20  260 33  HOH HOH A . 
H 6 HOH 21  261 34  HOH HOH A . 
H 6 HOH 22  262 46  HOH HOH A . 
H 6 HOH 23  263 50  HOH HOH A . 
H 6 HOH 24  264 52  HOH HOH A . 
H 6 HOH 25  265 53  HOH HOH A . 
H 6 HOH 26  266 54  HOH HOH A . 
H 6 HOH 27  267 55  HOH HOH A . 
H 6 HOH 28  268 56  HOH HOH A . 
H 6 HOH 29  269 57  HOH HOH A . 
H 6 HOH 30  270 58  HOH HOH A . 
H 6 HOH 31  271 59  HOH HOH A . 
H 6 HOH 32  272 67  HOH HOH A . 
H 6 HOH 33  273 69  HOH HOH A . 
H 6 HOH 34  274 76  HOH HOH A . 
H 6 HOH 35  275 77  HOH HOH A . 
H 6 HOH 36  276 78  HOH HOH A . 
H 6 HOH 37  277 79  HOH HOH A . 
H 6 HOH 38  278 80  HOH HOH A . 
H 6 HOH 39  279 81  HOH HOH A . 
H 6 HOH 40  280 82  HOH HOH A . 
H 6 HOH 41  281 83  HOH HOH A . 
H 6 HOH 42  282 84  HOH HOH A . 
H 6 HOH 43  283 85  HOH HOH A . 
H 6 HOH 44  284 91  HOH HOH A . 
H 6 HOH 45  285 99  HOH HOH A . 
H 6 HOH 46  286 102 HOH HOH A . 
H 6 HOH 47  287 103 HOH HOH A . 
H 6 HOH 48  288 106 HOH HOH A . 
H 6 HOH 49  289 107 HOH HOH A . 
H 6 HOH 50  290 108 HOH HOH A . 
H 6 HOH 51  291 111 HOH HOH A . 
H 6 HOH 52  292 116 HOH HOH A . 
H 6 HOH 53  293 117 HOH HOH A . 
H 6 HOH 54  294 118 HOH HOH A . 
H 6 HOH 55  295 119 HOH HOH A . 
H 6 HOH 56  296 120 HOH HOH A . 
H 6 HOH 57  297 121 HOH HOH A . 
H 6 HOH 58  298 129 HOH HOH A . 
H 6 HOH 59  299 139 HOH HOH A . 
H 6 HOH 60  300 152 HOH HOH A . 
H 6 HOH 61  301 159 HOH HOH A . 
H 6 HOH 62  302 160 HOH HOH A . 
H 6 HOH 63  303 161 HOH HOH A . 
H 6 HOH 64  304 163 HOH HOH A . 
H 6 HOH 65  305 165 HOH HOH A . 
H 6 HOH 66  306 166 HOH HOH A . 
H 6 HOH 67  307 167 HOH HOH A . 
H 6 HOH 68  308 169 HOH HOH A . 
H 6 HOH 69  309 171 HOH HOH A . 
H 6 HOH 70  310 178 HOH HOH A . 
H 6 HOH 71  311 180 HOH HOH A . 
H 6 HOH 72  312 181 HOH HOH A . 
H 6 HOH 73  313 182 HOH HOH A . 
H 6 HOH 74  314 193 HOH HOH A . 
H 6 HOH 75  315 195 HOH HOH A . 
H 6 HOH 76  316 197 HOH HOH A . 
H 6 HOH 77  317 198 HOH HOH A . 
H 6 HOH 78  318 200 HOH HOH A . 
H 6 HOH 79  319 201 HOH HOH A . 
H 6 HOH 80  320 203 HOH HOH A . 
H 6 HOH 81  321 204 HOH HOH A . 
H 6 HOH 82  322 205 HOH HOH A . 
H 6 HOH 83  323 207 HOH HOH A . 
H 6 HOH 84  324 208 HOH HOH A . 
H 6 HOH 85  325 214 HOH HOH A . 
H 6 HOH 86  326 234 HOH HOH A . 
H 6 HOH 87  327 235 HOH HOH A . 
H 6 HOH 88  328 236 HOH HOH A . 
H 6 HOH 89  329 237 HOH HOH A . 
H 6 HOH 90  330 246 HOH HOH A . 
H 6 HOH 91  331 253 HOH HOH A . 
H 6 HOH 92  332 265 HOH HOH A . 
H 6 HOH 93  333 266 HOH HOH A . 
H 6 HOH 94  334 270 HOH HOH A . 
H 6 HOH 95  335 271 HOH HOH A . 
H 6 HOH 96  336 272 HOH HOH A . 
H 6 HOH 97  337 273 HOH HOH A . 
H 6 HOH 98  338 274 HOH HOH A . 
H 6 HOH 99  339 275 HOH HOH A . 
H 6 HOH 100 340 279 HOH HOH A . 
H 6 HOH 101 341 280 HOH HOH A . 
H 6 HOH 102 342 281 HOH HOH A . 
H 6 HOH 103 343 284 HOH HOH A . 
H 6 HOH 104 344 285 HOH HOH A . 
H 6 HOH 105 345 286 HOH HOH A . 
H 6 HOH 106 346 287 HOH HOH A . 
H 6 HOH 107 347 288 HOH HOH A . 
H 6 HOH 108 348 289 HOH HOH A . 
H 6 HOH 109 349 290 HOH HOH A . 
H 6 HOH 110 350 292 HOH HOH A . 
H 6 HOH 111 351 293 HOH HOH A . 
H 6 HOH 112 352 294 HOH HOH A . 
H 6 HOH 113 353 295 HOH HOH A . 
H 6 HOH 114 354 296 HOH HOH A . 
H 6 HOH 115 355 297 HOH HOH A . 
H 6 HOH 116 356 298 HOH HOH A . 
H 6 HOH 117 357 299 HOH HOH A . 
H 6 HOH 118 358 300 HOH HOH A . 
H 6 HOH 119 359 301 HOH HOH A . 
I 6 HOH 1   123 28  HOH HOH B . 
I 6 HOH 2   124 35  HOH HOH B . 
I 6 HOH 3   125 40  HOH HOH B . 
I 6 HOH 4   126 43  HOH HOH B . 
I 6 HOH 5   127 51  HOH HOH B . 
I 6 HOH 6   128 60  HOH HOH B . 
I 6 HOH 7   129 61  HOH HOH B . 
I 6 HOH 8   130 62  HOH HOH B . 
I 6 HOH 9   131 64  HOH HOH B . 
I 6 HOH 10  132 68  HOH HOH B . 
I 6 HOH 11  133 87  HOH HOH B . 
I 6 HOH 12  134 89  HOH HOH B . 
I 6 HOH 13  135 92  HOH HOH B . 
I 6 HOH 14  136 105 HOH HOH B . 
I 6 HOH 15  137 109 HOH HOH B . 
I 6 HOH 16  138 122 HOH HOH B . 
I 6 HOH 17  139 127 HOH HOH B . 
I 6 HOH 18  140 131 HOH HOH B . 
I 6 HOH 19  141 134 HOH HOH B . 
I 6 HOH 20  142 143 HOH HOH B . 
I 6 HOH 21  143 144 HOH HOH B . 
I 6 HOH 22  144 145 HOH HOH B . 
I 6 HOH 23  145 146 HOH HOH B . 
I 6 HOH 24  146 147 HOH HOH B . 
I 6 HOH 25  147 149 HOH HOH B . 
I 6 HOH 26  148 150 HOH HOH B . 
I 6 HOH 27  149 154 HOH HOH B . 
I 6 HOH 28  150 158 HOH HOH B . 
I 6 HOH 29  151 173 HOH HOH B . 
I 6 HOH 30  152 183 HOH HOH B . 
I 6 HOH 31  153 184 HOH HOH B . 
I 6 HOH 32  154 185 HOH HOH B . 
I 6 HOH 33  155 186 HOH HOH B . 
I 6 HOH 34  156 187 HOH HOH B . 
I 6 HOH 35  157 188 HOH HOH B . 
I 6 HOH 36  158 190 HOH HOH B . 
I 6 HOH 37  159 192 HOH HOH B . 
I 6 HOH 38  160 209 HOH HOH B . 
I 6 HOH 39  161 210 HOH HOH B . 
I 6 HOH 40  162 211 HOH HOH B . 
I 6 HOH 41  163 215 HOH HOH B . 
I 6 HOH 42  164 222 HOH HOH B . 
I 6 HOH 43  165 224 HOH HOH B . 
I 6 HOH 44  166 225 HOH HOH B . 
I 6 HOH 45  167 226 HOH HOH B . 
I 6 HOH 46  168 228 HOH HOH B . 
I 6 HOH 47  169 238 HOH HOH B . 
I 6 HOH 48  170 239 HOH HOH B . 
I 6 HOH 49  171 249 HOH HOH B . 
I 6 HOH 50  172 255 HOH HOH B . 
I 6 HOH 51  173 256 HOH HOH B . 
I 6 HOH 52  174 257 HOH HOH B . 
I 6 HOH 53  175 258 HOH HOH B . 
I 6 HOH 54  176 263 HOH HOH B . 
I 6 HOH 55  177 267 HOH HOH B . 
I 6 HOH 56  178 268 HOH HOH B . 
I 6 HOH 57  179 276 HOH HOH B . 
I 6 HOH 58  180 278 HOH HOH B . 
I 6 HOH 59  181 282 HOH HOH B . 
I 6 HOH 60  182 302 HOH HOH B . 
I 6 HOH 61  183 303 HOH HOH B . 
I 6 HOH 62  184 308 HOH HOH B . 
J 6 HOH 1   287 8   HOH HOH C . 
J 6 HOH 2   288 10  HOH HOH C . 
J 6 HOH 3   289 19  HOH HOH C . 
J 6 HOH 4   290 26  HOH HOH C . 
J 6 HOH 5   291 30  HOH HOH C . 
J 6 HOH 6   292 36  HOH HOH C . 
J 6 HOH 7   293 37  HOH HOH C . 
J 6 HOH 8   294 38  HOH HOH C . 
J 6 HOH 9   295 39  HOH HOH C . 
J 6 HOH 10  296 41  HOH HOH C . 
J 6 HOH 11  297 42  HOH HOH C . 
J 6 HOH 12  298 44  HOH HOH C . 
J 6 HOH 13  299 63  HOH HOH C . 
J 6 HOH 14  300 65  HOH HOH C . 
J 6 HOH 15  301 66  HOH HOH C . 
J 6 HOH 16  302 70  HOH HOH C . 
J 6 HOH 17  303 71  HOH HOH C . 
J 6 HOH 18  304 90  HOH HOH C . 
J 6 HOH 19  305 93  HOH HOH C . 
J 6 HOH 20  306 94  HOH HOH C . 
J 6 HOH 21  307 95  HOH HOH C . 
J 6 HOH 22  308 96  HOH HOH C . 
J 6 HOH 23  309 97  HOH HOH C . 
J 6 HOH 24  310 98  HOH HOH C . 
J 6 HOH 25  311 101 HOH HOH C . 
J 6 HOH 26  312 104 HOH HOH C . 
J 6 HOH 27  313 124 HOH HOH C . 
J 6 HOH 28  314 125 HOH HOH C . 
J 6 HOH 29  315 126 HOH HOH C . 
J 6 HOH 30  316 128 HOH HOH C . 
J 6 HOH 31  317 130 HOH HOH C . 
J 6 HOH 32  318 132 HOH HOH C . 
J 6 HOH 33  319 133 HOH HOH C . 
J 6 HOH 34  320 135 HOH HOH C . 
J 6 HOH 35  321 136 HOH HOH C . 
J 6 HOH 36  322 137 HOH HOH C . 
J 6 HOH 37  323 138 HOH HOH C . 
J 6 HOH 38  324 140 HOH HOH C . 
J 6 HOH 39  325 148 HOH HOH C . 
J 6 HOH 40  326 151 HOH HOH C . 
J 6 HOH 41  327 153 HOH HOH C . 
J 6 HOH 42  328 155 HOH HOH C . 
J 6 HOH 43  329 156 HOH HOH C . 
J 6 HOH 44  330 157 HOH HOH C . 
J 6 HOH 45  331 170 HOH HOH C . 
J 6 HOH 46  332 172 HOH HOH C . 
J 6 HOH 47  333 174 HOH HOH C . 
J 6 HOH 48  334 189 HOH HOH C . 
J 6 HOH 49  335 206 HOH HOH C . 
J 6 HOH 50  336 212 HOH HOH C . 
J 6 HOH 51  337 213 HOH HOH C . 
J 6 HOH 52  338 219 HOH HOH C . 
J 6 HOH 53  339 220 HOH HOH C . 
J 6 HOH 54  340 227 HOH HOH C . 
J 6 HOH 55  341 230 HOH HOH C . 
J 6 HOH 56  342 240 HOH HOH C . 
J 6 HOH 57  343 241 HOH HOH C . 
J 6 HOH 58  344 242 HOH HOH C . 
J 6 HOH 59  345 243 HOH HOH C . 
J 6 HOH 60  346 244 HOH HOH C . 
J 6 HOH 61  347 247 HOH HOH C . 
J 6 HOH 62  348 248 HOH HOH C . 
J 6 HOH 63  349 250 HOH HOH C . 
J 6 HOH 64  350 254 HOH HOH C . 
J 6 HOH 65  351 259 HOH HOH C . 
J 6 HOH 66  352 260 HOH HOH C . 
J 6 HOH 67  353 261 HOH HOH C . 
J 6 HOH 68  354 262 HOH HOH C . 
J 6 HOH 69  355 277 HOH HOH C . 
J 6 HOH 70  356 283 HOH HOH C . 
J 6 HOH 71  357 304 HOH HOH C . 
J 6 HOH 72  358 305 HOH HOH C . 
#