data_1RMO
# 
_entry.id   1RMO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RMO         
RCSB  RCSB020886   
WWPDB D_1000020886 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EMG 'The same protein incorporated with different noncanonical amino acid' unspecified 
PDB 1RM9 .                                                                      unspecified 
PDB 1RMM .                                                                      unspecified 
PDB 1RMP .                                                                      unspecified 
# 
_pdbx_database_status.entry_id                        1RMO 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Budisa, N.'    1 
'Pal, P.P.'     2 
'Alefelder, S.' 3 
'Birle, P.'     4 
'Krywcun, T.'   5 
'Rubini, M.'    6 
'Wenger, W.'    7 
'Bae, J.H.'     8 
'Steiner, T.'   9 
# 
_citation.id                        primary 
_citation.title                     
'Probing the role of tryptophans in Aequorea victoria green fluorescent proteins with an expanded genetic code' 
_citation.journal_abbrev            Biol.Chem. 
_citation.journal_volume            385 
_citation.page_first                191 
_citation.page_last                 202 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1431-6730 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15101562 
_citation.pdbx_database_id_DOI      10.1515/BC.2004.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Budisa, N.'    1 
primary 'Pal, P.P.'     2 
primary 'Alefelder, S.' 3 
primary 'Birle, P.'     4 
primary 'Krywcun, T.'   5 
primary 'Rubini, M.'    6 
primary 'Wenger, W.'    7 
primary 'Bae, J.H.'     8 
primary 'Steiner, T.'   9 
# 
_cell.entry_id           1RMO 
_cell.length_a           51.793 
_cell.length_b           62.773 
_cell.length_c           70.536 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1RMO 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'wunen-nonfunctional GFP fusion protein' 26831.275 1  ? ? ? '[3,2]Tpa-containing' 
2 water   nat water                                    18.015    64 ? ? ? ?                     
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cyan Fluorescent Protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVP(32T)PTLVTTL(CRO)VQCFSRY
PDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMA
DKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMD
ELYK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPXPTLVTTLTYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   SER n 
1 3   LYS n 
1 4   GLY n 
1 5   GLU n 
1 6   GLU n 
1 7   LEU n 
1 8   PHE n 
1 9   THR n 
1 10  GLY n 
1 11  VAL n 
1 12  VAL n 
1 13  PRO n 
1 14  ILE n 
1 15  LEU n 
1 16  VAL n 
1 17  GLU n 
1 18  LEU n 
1 19  ASP n 
1 20  GLY n 
1 21  ASP n 
1 22  VAL n 
1 23  ASN n 
1 24  GLY n 
1 25  HIS n 
1 26  LYS n 
1 27  PHE n 
1 28  SER n 
1 29  VAL n 
1 30  SER n 
1 31  GLY n 
1 32  GLU n 
1 33  GLY n 
1 34  GLU n 
1 35  GLY n 
1 36  ASP n 
1 37  ALA n 
1 38  THR n 
1 39  TYR n 
1 40  GLY n 
1 41  LYS n 
1 42  LEU n 
1 43  THR n 
1 44  LEU n 
1 45  LYS n 
1 46  PHE n 
1 47  ILE n 
1 48  CYS n 
1 49  THR n 
1 50  THR n 
1 51  GLY n 
1 52  LYS n 
1 53  LEU n 
1 54  PRO n 
1 55  VAL n 
1 56  PRO n 
1 57  32T n 
1 58  PRO n 
1 59  THR n 
1 60  LEU n 
1 61  VAL n 
1 62  THR n 
1 63  THR n 
1 64  LEU n 
1 65  CRO n 
1 66  VAL n 
1 67  GLN n 
1 68  CYS n 
1 69  PHE n 
1 70  SER n 
1 71  ARG n 
1 72  TYR n 
1 73  PRO n 
1 74  ASP n 
1 75  HIS n 
1 76  MET n 
1 77  LYS n 
1 78  GLN n 
1 79  HIS n 
1 80  ASP n 
1 81  PHE n 
1 82  PHE n 
1 83  LYS n 
1 84  SER n 
1 85  ALA n 
1 86  MET n 
1 87  PRO n 
1 88  GLU n 
1 89  GLY n 
1 90  TYR n 
1 91  VAL n 
1 92  GLN n 
1 93  GLU n 
1 94  ARG n 
1 95  THR n 
1 96  ILE n 
1 97  PHE n 
1 98  PHE n 
1 99  LYS n 
1 100 ASP n 
1 101 ASP n 
1 102 GLY n 
1 103 ASN n 
1 104 TYR n 
1 105 LYS n 
1 106 THR n 
1 107 ARG n 
1 108 ALA n 
1 109 GLU n 
1 110 VAL n 
1 111 LYS n 
1 112 PHE n 
1 113 GLU n 
1 114 GLY n 
1 115 ASP n 
1 116 THR n 
1 117 LEU n 
1 118 VAL n 
1 119 ASN n 
1 120 ARG n 
1 121 ILE n 
1 122 GLU n 
1 123 LEU n 
1 124 LYS n 
1 125 GLY n 
1 126 ILE n 
1 127 ASP n 
1 128 PHE n 
1 129 LYS n 
1 130 GLU n 
1 131 ASP n 
1 132 GLY n 
1 133 ASN n 
1 134 ILE n 
1 135 LEU n 
1 136 GLY n 
1 137 HIS n 
1 138 LYS n 
1 139 LEU n 
1 140 GLU n 
1 141 TYR n 
1 142 ASN n 
1 143 TYR n 
1 144 ASN n 
1 145 SER n 
1 146 HIS n 
1 147 ASN n 
1 148 VAL n 
1 149 TYR n 
1 150 ILE n 
1 151 MET n 
1 152 ALA n 
1 153 ASP n 
1 154 LYS n 
1 155 GLN n 
1 156 LYS n 
1 157 ASN n 
1 158 GLY n 
1 159 ILE n 
1 160 LYS n 
1 161 VAL n 
1 162 ASN n 
1 163 PHE n 
1 164 LYS n 
1 165 ILE n 
1 166 ARG n 
1 167 HIS n 
1 168 ASN n 
1 169 ILE n 
1 170 GLU n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 VAL n 
1 175 GLN n 
1 176 LEU n 
1 177 ALA n 
1 178 ASP n 
1 179 HIS n 
1 180 TYR n 
1 181 GLN n 
1 182 GLN n 
1 183 ASN n 
1 184 THR n 
1 185 PRO n 
1 186 ILE n 
1 187 GLY n 
1 188 ASP n 
1 189 GLY n 
1 190 PRO n 
1 191 VAL n 
1 192 LEU n 
1 193 LEU n 
1 194 PRO n 
1 195 ASP n 
1 196 ASN n 
1 197 HIS n 
1 198 TYR n 
1 199 LEU n 
1 200 SER n 
1 201 THR n 
1 202 GLN n 
1 203 SER n 
1 204 ALA n 
1 205 LEU n 
1 206 SER n 
1 207 LYS n 
1 208 ASP n 
1 209 PRO n 
1 210 ASN n 
1 211 GLU n 
1 212 LYS n 
1 213 ARG n 
1 214 ASP n 
1 215 HIS n 
1 216 MET n 
1 217 VAL n 
1 218 LEU n 
1 219 LEU n 
1 220 GLU n 
1 221 PHE n 
1 222 VAL n 
1 223 THR n 
1 224 ALA n 
1 225 ALA n 
1 226 GLY n 
1 227 ILE n 
1 228 THR n 
1 229 LEU n 
1 230 GLY n 
1 231 MET n 
1 232 ASP n 
1 233 GLU n 
1 234 LEU n 
1 235 TYR n 
1 236 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aequorea 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aequorea victoria' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6100 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pECFP 
_entity_src_gen.plasmid_details                    'plasmid bought from BD Clontech' 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GFP_AEQVI 
_struct_ref.pdbx_db_accession          P42212 
_struct_ref.pdbx_align_begin           314 
_struct_ref.pdbx_seq_one_letter_code   
;VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RMO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 234 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P42212 
_struct_ref_seq.db_align_beg                  314 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  551 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       236 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RMO 32T A 57 ? UNP P42212 TRP 370 'MODIFIED RESIDUE' 57 1 
1 1RMO CRO A 65 ? UNP P42212 THR 378 CHROMOPHORE        66 2 
1 1RMO CRO A 65 ? UNP P42212 TYR 379 CHROMOPHORE        66 3 
1 1RMO CRO A 65 ? UNP P42212 GLY 380 CHROMOPHORE        66 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
32T 'L-peptide linking' . '(S)-2-AMINO-3-(4H-THIENO[3,2-B]-PYRROL-6-YL)-PROPIONIC ACID' ?                             
'C9 H10 N2 O2 S' 210.253 
ALA 'L-peptide linking' y ALANINE ?                             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                             'C4 H7 N O4'     133.103 
CRO 'L-peptide linking' n 
'{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 
'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5'  319.313 
CYS 'L-peptide linking' y CYSTEINE ?                             'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                             'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                             'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                             'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                             'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                             'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                             'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RMO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   42.45 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    '14% PEG 1000, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-10-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1RMO 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             17.69 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   20540 
_reflns.number_all                   21939 
_reflns.percent_possible_obs         93.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        14.7 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   92.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RMO 
_refine.ls_number_reflns_obs                     18494 
_refine.ls_number_reflns_all                     20540 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1616341.55 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             17.69 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    93.7 
_refine.ls_R_factor_obs                          0.1851 
_refine.ls_R_factor_all                          0.222 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  2046 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.2 
_refine.aniso_B[1][1]                            0.08 
_refine.aniso_B[2][2]                            -0.90 
_refine.aniso_B[3][3]                            0.82 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.348582 
_refine.solvent_model_param_bsol                 42.8698 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1EMG 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RMO 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.10 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.16 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1795 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             64 
_refine_hist.number_atoms_total               1859 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        17.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006525 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.43545  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 27.5     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.38     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        4.87     1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       6.09     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        12.59    2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       16.39    2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             2836 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               88.6 
_refine_ls_shell.R_factor_R_free                  0.295 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            10.8 
_refine_ls_shell.number_reflns_R_free             343 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
2 PRO_CRO_SUL     PRO_CRO_SUL 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RMO 
_struct.title                     
'Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code' 
_struct.pdbx_descriptor           'wunen-nonfunctional GFP fusion protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RMO 
_struct_keywords.pdbx_keywords   'LUMINESCENT PROTEIN' 
_struct_keywords.text            'Beta-barrel; GFP; Noncanonical amino acid, LUMINESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 4   ? THR A 9   ? GLY A 4   THR A 9   5 ? 6 
HELX_P HELX_P2 2 PRO A 56  ? VAL A 61  ? PRO A 56  VAL A 61  5 ? 6 
HELX_P HELX_P3 3 VAL A 66  ? SER A 70  ? VAL A 68  SER A 72  5 ? 5 
HELX_P HELX_P4 4 PRO A 73  ? HIS A 79  ? PRO A 75  HIS A 81  5 ? 7 
HELX_P HELX_P5 5 ASP A 80  ? ALA A 85  ? ASP A 82  ALA A 87  1 ? 6 
HELX_P HELX_P6 6 LYS A 154 ? ASN A 157 ? LYS A 156 ASN A 159 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A PRO 56 C  ? ? ? 1_555 A 32T 57 N  ? ? A PRO 56 A 32T 57 1_555 ? ? ? ? ? ? ? 1.390 ? 
covale2 covale ? ? A 32T 57 C  ? ? ? 1_555 A PRO 58 N  ? ? A 32T 57 A PRO 58 1_555 ? ? ? ? ? ? ? 1.349 ? 
covale3 covale ? ? A LEU 64 C  ? ? ? 1_555 A CRO 65 N1 ? ? A LEU 64 A CRO 66 1_555 ? ? ? ? ? ? ? 1.471 ? 
covale4 covale ? ? A CRO 65 C3 ? ? ? 1_555 A VAL 66 N  ? ? A CRO 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.436 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           86 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            88 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    87 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     89 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.76 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   12 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 12  ? VAL A 22  ? VAL A 12  VAL A 22  
A 2  HIS A 25  ? ASP A 36  ? HIS A 25  ASP A 36  
A 3  LYS A 41  ? CYS A 48  ? LYS A 41  CYS A 48  
A 4  HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 
A 5  HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 
A 6  HIS A 146 ? ASP A 153 ? HIS A 148 ASP A 155 
A 7  GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 
A 8  VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 
A 9  TYR A 90  ? PHE A 98  ? TYR A 92  PHE A 100 
A 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 
A 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 
A 12 VAL A 12  ? VAL A 22  ? VAL A 12  VAL A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N LEU A 18  ? N LEU A 18  O VAL A 29  ? O VAL A 29  
A 2  3  N ASP A 36  ? N ASP A 36  O LYS A 41  ? O LYS A 41  
A 3  4  N LEU A 44  ? N LEU A 44  O LEU A 218 ? O LEU A 220 
A 4  5  O ALA A 225 ? O ALA A 227 N TYR A 198 ? N TYR A 200 
A 5  6  O THR A 201 ? O THR A 203 N HIS A 146 ? N HIS A 148 
A 6  7  N ASP A 153 ? N ASP A 155 O GLY A 158 ? O GLY A 160 
A 7  8  N PHE A 163 ? N PHE A 165 O HIS A 179 ? O HIS A 181 
A 8  9  O THR A 184 ? O THR A 186 N VAL A 91  ? N VAL A 93  
A 9  10 N ILE A 96  ? N ILE A 98  O TYR A 104 ? O TYR A 106 
A 10 11 N LYS A 111 ? N LYS A 113 O VAL A 118 ? O VAL A 120 
A 11 12 O GLY A 125 ? O GLY A 127 N ASP A 21  ? N ASP A 21  
# 
_atom_sites.entry_id                    1RMO 
_atom_sites.fract_transf_matrix[1][1]   0.019308 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015930 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014177 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 4   ? 25.420 10.403 49.624 1.00 53.99  ? 4   GLY A N   1 
ATOM   2    C CA  . GLY A 1 4   ? 25.233 11.339 48.453 1.00 46.99  ? 4   GLY A CA  1 
ATOM   3    C C   . GLY A 1 4   ? 26.167 11.094 47.276 1.00 32.39  ? 4   GLY A C   1 
ATOM   4    O O   . GLY A 1 4   ? 25.761 11.176 46.116 1.00 29.39  ? 4   GLY A O   1 
ATOM   5    N N   . GLU A 1 5   ? 27.428 10.779 47.586 1.00 26.14  ? 5   GLU A N   1 
ATOM   6    C CA  . GLU A 1 5   ? 28.491 10.521 46.613 1.00 30.87  ? 5   GLU A CA  1 
ATOM   7    C C   . GLU A 1 5   ? 28.160 9.469  45.540 1.00 33.29  ? 5   GLU A C   1 
ATOM   8    O O   . GLU A 1 5   ? 28.484 9.632  44.360 1.00 28.29  ? 5   GLU A O   1 
ATOM   9    C CB  . GLU A 1 5   ? 29.717 10.107 47.411 1.00 58.49  ? 5   GLU A CB  1 
ATOM   10   C CG  . GLU A 1 5   ? 31.006 9.985  46.683 1.00 60.94  ? 5   GLU A CG  1 
ATOM   11   C CD  . GLU A 1 5   ? 32.102 9.567  47.654 1.00 87.53  ? 5   GLU A CD  1 
ATOM   12   O OE1 . GLU A 1 5   ? 32.231 10.219 48.715 1.00 82.72  ? 5   GLU A OE1 1 
ATOM   13   O OE2 . GLU A 1 5   ? 32.825 8.585  47.373 1.00 43.85  ? 5   GLU A OE2 1 
ATOM   14   N N   . GLU A 1 6   ? 27.498 8.375  45.964 1.00 29.05  ? 6   GLU A N   1 
ATOM   15   C CA  . GLU A 1 6   ? 27.121 7.267  45.080 1.00 30.19  ? 6   GLU A CA  1 
ATOM   16   C C   . GLU A 1 6   ? 26.240 7.720  43.879 1.00 25.93  ? 6   GLU A C   1 
ATOM   17   O O   . GLU A 1 6   ? 26.250 7.125  42.794 1.00 26.27  ? 6   GLU A O   1 
ATOM   18   C CB  . GLU A 1 6   ? 26.359 6.233  45.932 1.00 95.25  ? 6   GLU A CB  1 
ATOM   19   C CG  . GLU A 1 6   ? 26.345 4.792  45.426 1.00 80.23  ? 6   GLU A CG  1 
ATOM   20   C CD  . GLU A 1 6   ? 27.068 3.817  46.374 1.00 80.23  ? 6   GLU A CD  1 
ATOM   21   O OE1 . GLU A 1 6   ? 26.901 3.926  47.611 1.00 80.23  ? 6   GLU A OE1 1 
ATOM   22   O OE2 . GLU A 1 6   ? 27.798 2.933  45.877 1.00 80.23  ? 6   GLU A OE2 1 
ATOM   23   N N   . LEU A 1 7   ? 25.475 8.782  44.065 1.00 26.17  ? 7   LEU A N   1 
ATOM   24   C CA  . LEU A 1 7   ? 24.596 9.238  42.996 1.00 25.64  ? 7   LEU A CA  1 
ATOM   25   C C   . LEU A 1 7   ? 25.335 9.955  41.887 1.00 25.44  ? 7   LEU A C   1 
ATOM   26   O O   . LEU A 1 7   ? 24.755 10.236 40.834 1.00 26.09  ? 7   LEU A O   1 
ATOM   27   C CB  . LEU A 1 7   ? 23.537 10.192 43.566 1.00 20.21  ? 7   LEU A CB  1 
ATOM   28   C CG  . LEU A 1 7   ? 22.655 9.605  44.661 1.00 29.39  ? 7   LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 7   ? 21.973 10.723 45.374 1.00 31.44  ? 7   LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 7   ? 21.637 8.616  44.038 1.00 34.33  ? 7   LEU A CD2 1 
ATOM   31   N N   . PHE A 1 8   ? 26.623 10.265 42.116 1.00 18.25  ? 8   PHE A N   1 
ATOM   32   C CA  . PHE A 1 8   ? 27.406 11.025 41.131 1.00 22.23  ? 8   PHE A CA  1 
ATOM   33   C C   . PHE A 1 8   ? 28.573 10.290 40.479 1.00 30.74  ? 8   PHE A C   1 
ATOM   34   O O   . PHE A 1 8   ? 29.442 10.915 39.864 1.00 30.08  ? 8   PHE A O   1 
ATOM   35   C CB  . PHE A 1 8   ? 27.917 12.318 41.786 1.00 22.19  ? 8   PHE A CB  1 
ATOM   36   C CG  . PHE A 1 8   ? 26.827 13.280 42.109 1.00 18.90  ? 8   PHE A CG  1 
ATOM   37   C CD1 . PHE A 1 8   ? 26.382 14.190 41.152 1.00 18.67  ? 8   PHE A CD1 1 
ATOM   38   C CD2 . PHE A 1 8   ? 26.202 13.258 43.363 1.00 17.53  ? 8   PHE A CD2 1 
ATOM   39   C CE1 . PHE A 1 8   ? 25.323 15.064 41.440 1.00 21.69  ? 8   PHE A CE1 1 
ATOM   40   C CE2 . PHE A 1 8   ? 25.148 14.120 43.662 1.00 20.65  ? 8   PHE A CE2 1 
ATOM   41   C CZ  . PHE A 1 8   ? 24.694 15.028 42.699 1.00 15.82  ? 8   PHE A CZ  1 
ATOM   42   N N   . THR A 1 9   ? 28.562 8.948  40.554 1.00 24.15  ? 9   THR A N   1 
ATOM   43   C CA  . THR A 1 9   ? 29.665 8.181  40.012 1.00 28.17  ? 9   THR A CA  1 
ATOM   44   C C   . THR A 1 9   ? 29.579 8.009  38.519 1.00 30.24  ? 9   THR A C   1 
ATOM   45   O O   . THR A 1 9   ? 30.565 7.611  37.889 1.00 35.26  ? 9   THR A O   1 
ATOM   46   C CB  . THR A 1 9   ? 29.723 6.757  40.678 1.00 41.06  ? 9   THR A CB  1 
ATOM   47   O OG1 . THR A 1 9   ? 28.470 6.087  40.511 1.00 56.48  ? 9   THR A OG1 1 
ATOM   48   C CG2 . THR A 1 9   ? 30.034 6.892  42.141 1.00 29.53  ? 9   THR A CG2 1 
ATOM   49   N N   . GLY A 1 10  ? 28.378 8.269  37.938 1.00 23.81  ? 10  GLY A N   1 
ATOM   50   C CA  . GLY A 1 10  ? 28.212 8.148  36.495 1.00 24.03  ? 10  GLY A CA  1 
ATOM   51   C C   . GLY A 1 10  ? 27.814 9.493  35.851 1.00 22.95  ? 10  GLY A C   1 
ATOM   52   O O   . GLY A 1 10  ? 27.960 10.578 36.455 1.00 29.41  ? 10  GLY A O   1 
ATOM   53   N N   . VAL A 1 11  ? 27.328 9.421  34.585 1.00 18.52  ? 11  VAL A N   1 
ATOM   54   C CA  . VAL A 1 11  ? 26.887 10.659 33.915 1.00 21.34  ? 11  VAL A CA  1 
ATOM   55   C C   . VAL A 1 11  ? 25.446 10.848 34.353 1.00 29.60  ? 11  VAL A C   1 
ATOM   56   O O   . VAL A 1 11  ? 24.629 9.908  34.256 1.00 25.80  ? 11  VAL A O   1 
ATOM   57   C CB  . VAL A 1 11  ? 26.981 10.484 32.406 1.00 25.72  ? 11  VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 11  ? 26.389 11.691 31.696 1.00 25.66  ? 11  VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 11  ? 28.443 10.294 32.027 1.00 28.35  ? 11  VAL A CG2 1 
ATOM   60   N N   . VAL A 1 12  ? 25.125 12.072 34.873 1.00 18.16  ? 12  VAL A N   1 
ATOM   61   C CA  . VAL A 1 12  ? 23.785 12.385 35.350 1.00 11.21  ? 12  VAL A CA  1 
ATOM   62   C C   . VAL A 1 12  ? 23.079 13.442 34.463 1.00 17.81  ? 12  VAL A C   1 
ATOM   63   O O   . VAL A 1 12  ? 23.662 14.487 34.110 1.00 17.11  ? 12  VAL A O   1 
ATOM   64   C CB  . VAL A 1 12  ? 23.862 12.944 36.775 1.00 16.73  ? 12  VAL A CB  1 
ATOM   65   C CG1 . VAL A 1 12  ? 22.441 13.425 37.260 1.00 17.48  ? 12  VAL A CG1 1 
ATOM   66   C CG2 . VAL A 1 12  ? 24.439 11.858 37.685 1.00 17.37  ? 12  VAL A CG2 1 
ATOM   67   N N   . PRO A 1 13  ? 21.849 13.171 34.065 1.00 16.95  ? 13  PRO A N   1 
ATOM   68   C CA  . PRO A 1 13  ? 21.189 14.195 33.228 1.00 13.92  ? 13  PRO A CA  1 
ATOM   69   C C   . PRO A 1 13  ? 20.766 15.362 34.087 1.00 13.30  ? 13  PRO A C   1 
ATOM   70   O O   . PRO A 1 13  ? 20.333 15.183 35.241 1.00 17.56  ? 13  PRO A O   1 
ATOM   71   C CB  . PRO A 1 13  ? 19.978 13.451 32.644 1.00 22.96  ? 13  PRO A CB  1 
ATOM   72   C CG  . PRO A 1 13  ? 19.637 12.434 33.754 1.00 25.80  ? 13  PRO A CG  1 
ATOM   73   C CD  . PRO A 1 13  ? 21.006 11.960 34.208 1.00 21.68  ? 13  PRO A CD  1 
ATOM   74   N N   . ILE A 1 14  ? 20.814 16.599 33.481 1.00 14.96  ? 14  ILE A N   1 
ATOM   75   C CA  . ILE A 1 14  ? 20.471 17.792 34.228 1.00 13.21  ? 14  ILE A CA  1 
ATOM   76   C C   . ILE A 1 14  ? 19.356 18.559 33.516 1.00 15.30  ? 14  ILE A C   1 
ATOM   77   O O   . ILE A 1 14  ? 19.379 18.606 32.304 1.00 14.79  ? 14  ILE A O   1 
ATOM   78   C CB  . ILE A 1 14  ? 21.693 18.759 34.308 1.00 15.99  ? 14  ILE A CB  1 
ATOM   79   C CG1 . ILE A 1 14  ? 22.868 18.010 35.025 1.00 18.94  ? 14  ILE A CG1 1 
ATOM   80   C CG2 . ILE A 1 14  ? 21.288 20.073 35.058 1.00 9.62   ? 14  ILE A CG2 1 
ATOM   81   C CD1 . ILE A 1 14  ? 24.257 18.748 34.762 1.00 16.45  ? 14  ILE A CD1 1 
ATOM   82   N N   . LEU A 1 15  ? 18.401 19.115 34.306 1.00 14.90  ? 15  LEU A N   1 
ATOM   83   C CA  . LEU A 1 15  ? 17.326 19.979 33.763 1.00 15.25  ? 15  LEU A CA  1 
ATOM   84   C C   . LEU A 1 15  ? 17.416 21.281 34.543 1.00 13.03  ? 15  LEU A C   1 
ATOM   85   O O   . LEU A 1 15  ? 17.520 21.259 35.765 1.00 12.68  ? 15  LEU A O   1 
ATOM   86   C CB  . LEU A 1 15  ? 15.920 19.424 34.035 1.00 16.40  ? 15  LEU A CB  1 
ATOM   87   C CG  . LEU A 1 15  ? 15.551 18.192 33.265 1.00 29.13  ? 15  LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 15  ? 14.115 17.795 33.716 1.00 35.61  ? 15  LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 15  ? 15.585 18.467 31.738 1.00 35.43  ? 15  LEU A CD2 1 
ATOM   90   N N   . VAL A 1 16  ? 17.389 22.427 33.855 1.00 15.43  ? 16  VAL A N   1 
ATOM   91   C CA  . VAL A 1 16  ? 17.437 23.714 34.527 1.00 12.68  ? 16  VAL A CA  1 
ATOM   92   C C   . VAL A 1 16  ? 16.193 24.499 34.047 1.00 13.37  ? 16  VAL A C   1 
ATOM   93   O O   . VAL A 1 16  ? 15.853 24.503 32.852 1.00 19.41  ? 16  VAL A O   1 
ATOM   94   C CB  . VAL A 1 16  ? 18.703 24.524 34.140 1.00 14.13  ? 16  VAL A CB  1 
ATOM   95   C CG1 . VAL A 1 16  ? 18.689 25.838 34.889 1.00 14.26  ? 16  VAL A CG1 1 
ATOM   96   C CG2 . VAL A 1 16  ? 19.936 23.740 34.593 1.00 13.30  ? 16  VAL A CG2 1 
ATOM   97   N N   . GLU A 1 17  ? 15.496 25.146 35.020 1.00 13.20  ? 17  GLU A N   1 
ATOM   98   C CA  . GLU A 1 17  ? 14.304 25.918 34.681 1.00 13.58  ? 17  GLU A CA  1 
ATOM   99   C C   . GLU A 1 17  ? 14.443 27.216 35.483 1.00 14.73  ? 17  GLU A C   1 
ATOM   100  O O   . GLU A 1 17  ? 14.547 27.192 36.721 1.00 18.57  ? 17  GLU A O   1 
ATOM   101  C CB  . GLU A 1 17  ? 13.038 25.168 35.131 1.00 25.31  ? 17  GLU A CB  1 
ATOM   102  C CG  . GLU A 1 17  ? 12.744 23.879 34.341 1.00 46.97  ? 17  GLU A CG  1 
ATOM   103  C CD  . GLU A 1 17  ? 12.477 24.106 32.836 1.00 60.84  ? 17  GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 17  ? 11.750 25.066 32.479 1.00 32.68  ? 17  GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 17  ? 12.978 23.315 32.004 1.00 57.10  ? 17  GLU A OE2 1 
ATOM   106  N N   . LEU A 1 18  ? 14.492 28.382 34.754 1.00 19.83  ? 18  LEU A N   1 
ATOM   107  C CA  . LEU A 1 18  ? 14.647 29.679 35.428 1.00 17.79  ? 18  LEU A CA  1 
ATOM   108  C C   . LEU A 1 18  ? 13.524 30.642 35.037 1.00 15.28  ? 18  LEU A C   1 
ATOM   109  O O   . LEU A 1 18  ? 13.179 30.703 33.854 1.00 13.94  ? 18  LEU A O   1 
ATOM   110  C CB  . LEU A 1 18  ? 15.991 30.297 35.044 1.00 18.40  ? 18  LEU A CB  1 
ATOM   111  C CG  . LEU A 1 18  ? 16.324 31.731 35.498 1.00 28.19  ? 18  LEU A CG  1 
ATOM   112  C CD1 . LEU A 1 18  ? 17.851 31.940 35.276 1.00 31.18  ? 18  LEU A CD1 1 
ATOM   113  C CD2 . LEU A 1 18  ? 15.609 32.748 34.667 1.00 27.68  ? 18  LEU A CD2 1 
ATOM   114  N N   . ASP A 1 19  ? 12.960 31.400 36.018 1.00 19.86  ? 19  ASP A N   1 
ATOM   115  C CA  . ASP A 1 19  ? 11.912 32.386 35.705 1.00 18.70  ? 19  ASP A CA  1 
ATOM   116  C C   . ASP A 1 19  ? 12.516 33.628 36.266 1.00 15.83  ? 19  ASP A C   1 
ATOM   117  O O   . ASP A 1 19  ? 12.943 33.638 37.443 1.00 16.83  ? 19  ASP A O   1 
ATOM   118  C CB  . ASP A 1 19  ? 10.593 32.078 36.423 1.00 25.59  ? 19  ASP A CB  1 
ATOM   119  C CG  . ASP A 1 19  ? 9.889  30.879 35.809 1.00 53.99  ? 19  ASP A CG  1 
ATOM   120  O OD1 . ASP A 1 19  ? 9.867  30.798 34.554 1.00 40.47  ? 19  ASP A OD1 1 
ATOM   121  O OD2 . ASP A 1 19  ? 9.372  30.024 36.559 1.00 85.69  ? 19  ASP A OD2 1 
ATOM   122  N N   . GLY A 1 20  ? 12.606 34.686 35.393 1.00 15.77  ? 20  GLY A N   1 
ATOM   123  C CA  . GLY A 1 20  ? 13.254 35.910 35.833 1.00 15.97  ? 20  GLY A CA  1 
ATOM   124  C C   . GLY A 1 20  ? 12.483 37.172 35.490 1.00 20.00  ? 20  GLY A C   1 
ATOM   125  O O   . GLY A 1 20  ? 11.635 37.187 34.609 1.00 17.04  ? 20  GLY A O   1 
ATOM   126  N N   . ASP A 1 21  ? 12.786 38.219 36.215 1.00 19.46  ? 21  ASP A N   1 
ATOM   127  C CA  . ASP A 1 21  ? 12.171 39.536 35.995 1.00 18.66  ? 21  ASP A CA  1 
ATOM   128  C C   . ASP A 1 21  ? 13.284 40.497 36.311 1.00 18.29  ? 21  ASP A C   1 
ATOM   129  O O   . ASP A 1 21  ? 13.721 40.591 37.476 1.00 20.47  ? 21  ASP A O   1 
ATOM   130  C CB  . ASP A 1 21  ? 11.057 39.773 36.997 1.00 17.13  ? 21  ASP A CB  1 
ATOM   131  C CG  . ASP A 1 21  ? 10.408 41.130 36.821 1.00 26.28  ? 21  ASP A CG  1 
ATOM   132  O OD1 . ASP A 1 21  ? 11.138 42.075 36.407 1.00 19.85  ? 21  ASP A OD1 1 
ATOM   133  O OD2 . ASP A 1 21  ? 9.211  41.232 37.110 1.00 32.68  ? 21  ASP A OD2 1 
ATOM   134  N N   . VAL A 1 22  ? 13.772 41.185 35.295 1.00 22.04  ? 22  VAL A N   1 
ATOM   135  C CA  . VAL A 1 22  ? 14.824 42.164 35.482 1.00 23.72  ? 22  VAL A CA  1 
ATOM   136  C C   . VAL A 1 22  ? 14.295 43.550 35.060 1.00 22.56  ? 22  VAL A C   1 
ATOM   137  O O   . VAL A 1 22  ? 14.050 43.759 33.877 1.00 15.20  ? 22  VAL A O   1 
ATOM   138  C CB  . VAL A 1 22  ? 16.028 41.807 34.624 1.00 21.02  ? 22  VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 22  ? 16.957 42.988 34.532 1.00 21.45  ? 22  VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 22  ? 16.731 40.593 35.242 1.00 17.95  ? 22  VAL A CG2 1 
ATOM   141  N N   . ASN A 1 23  ? 14.111 44.479 36.015 1.00 23.92  ? 23  ASN A N   1 
ATOM   142  C CA  . ASN A 1 23  ? 13.563 45.809 35.674 1.00 27.95  ? 23  ASN A CA  1 
ATOM   143  C C   . ASN A 1 23  ? 12.246 45.713 34.951 1.00 29.02  ? 23  ASN A C   1 
ATOM   144  O O   . ASN A 1 23  ? 11.981 46.511 34.035 1.00 25.60  ? 23  ASN A O   1 
ATOM   145  C CB  . ASN A 1 23  ? 14.545 46.603 34.807 1.00 16.46  ? 23  ASN A CB  1 
ATOM   146  C CG  . ASN A 1 23  ? 15.556 47.339 35.655 1.00 22.39  ? 23  ASN A CG  1 
ATOM   147  O OD1 . ASN A 1 23  ? 16.046 46.817 36.683 1.00 22.60  ? 23  ASN A OD1 1 
ATOM   148  N ND2 . ASN A 1 23  ? 15.909 48.542 35.228 1.00 22.39  ? 23  ASN A ND2 1 
ATOM   149  N N   . GLY A 1 24  ? 11.385 44.730 35.328 1.00 24.24  ? 24  GLY A N   1 
ATOM   150  C CA  . GLY A 1 24  ? 10.108 44.680 34.622 1.00 21.21  ? 24  GLY A CA  1 
ATOM   151  C C   . GLY A 1 24  ? 10.106 43.775 33.401 1.00 24.80  ? 24  GLY A C   1 
ATOM   152  O O   . GLY A 1 24  ? 9.038  43.430 32.870 1.00 31.03  ? 24  GLY A O   1 
ATOM   153  N N   . HIS A 1 25  ? 11.300 43.388 32.914 1.00 22.32  ? 25  HIS A N   1 
ATOM   154  C CA  . HIS A 1 25  ? 11.369 42.522 31.764 1.00 23.76  ? 25  HIS A CA  1 
ATOM   155  C C   . HIS A 1 25  ? 11.332 41.097 32.251 1.00 28.50  ? 25  HIS A C   1 
ATOM   156  O O   . HIS A 1 25  ? 12.331 40.619 32.794 1.00 23.54  ? 25  HIS A O   1 
ATOM   157  C CB  . HIS A 1 25  ? 12.668 42.667 30.991 1.00 18.61  ? 25  HIS A CB  1 
ATOM   158  C CG  . HIS A 1 25  ? 12.851 44.007 30.367 1.00 28.81  ? 25  HIS A CG  1 
ATOM   159  N ND1 . HIS A 1 25  ? 13.607 45.004 30.950 1.00 35.88  ? 25  HIS A ND1 1 
ATOM   160  C CD2 . HIS A 1 25  ? 12.284 44.554 29.267 1.00 37.94  ? 25  HIS A CD2 1 
ATOM   161  C CE1 . HIS A 1 25  ? 13.486 46.114 30.235 1.00 37.01  ? 25  HIS A CE1 1 
ATOM   162  N NE2 . HIS A 1 25  ? 12.690 45.867 29.213 1.00 39.73  ? 25  HIS A NE2 1 
ATOM   163  N N   . LYS A 1 26  ? 10.214 40.382 31.915 1.00 20.59  ? 26  LYS A N   1 
ATOM   164  C CA  . LYS A 1 26  ? 9.990  38.996 32.341 1.00 24.22  ? 26  LYS A CA  1 
ATOM   165  C C   . LYS A 1 26  ? 10.489 38.016 31.306 1.00 27.06  ? 26  LYS A C   1 
ATOM   166  O O   . LYS A 1 26  ? 10.296 38.220 30.119 1.00 28.54  ? 26  LYS A O   1 
ATOM   167  C CB  . LYS A 1 26  ? 8.505  38.764 32.618 1.00 40.14  ? 26  LYS A CB  1 
ATOM   168  C CG  . LYS A 1 26  ? 7.991  39.544 33.835 1.00 44.68  ? 26  LYS A CG  1 
ATOM   169  C CD  . LYS A 1 26  ? 6.534  39.241 34.065 1.00 68.78  ? 26  LYS A CD  1 
ATOM   170  C CE  . LYS A 1 26  ? 6.145  39.543 35.493 1.00 68.49  ? 26  LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 26  ? 6.324  40.989 35.776 1.00 38.78  ? 26  LYS A NZ  1 
ATOM   172  N N   . PHE A 1 27  ? 11.182 36.927 31.760 1.00 21.81  ? 27  PHE A N   1 
ATOM   173  C CA  . PHE A 1 27  ? 11.699 35.964 30.768 1.00 18.88  ? 27  PHE A CA  1 
ATOM   174  C C   . PHE A 1 27  ? 11.837 34.601 31.444 1.00 18.09  ? 27  PHE A C   1 
ATOM   175  O O   . PHE A 1 27  ? 11.822 34.525 32.683 1.00 18.19  ? 27  PHE A O   1 
ATOM   176  C CB  . PHE A 1 27  ? 13.081 36.403 30.225 1.00 19.10  ? 27  PHE A CB  1 
ATOM   177  C CG  . PHE A 1 27  ? 14.147 36.578 31.283 1.00 20.50  ? 27  PHE A CG  1 
ATOM   178  C CD1 . PHE A 1 27  ? 14.216 37.761 32.031 1.00 24.74  ? 27  PHE A CD1 1 
ATOM   179  C CD2 . PHE A 1 27  ? 15.057 35.568 31.546 1.00 23.89  ? 27  PHE A CD2 1 
ATOM   180  C CE1 . PHE A 1 27  ? 15.195 37.931 33.038 1.00 26.90  ? 27  PHE A CE1 1 
ATOM   181  C CE2 . PHE A 1 27  ? 16.047 35.738 32.575 1.00 23.99  ? 27  PHE A CE2 1 
ATOM   182  C CZ  . PHE A 1 27  ? 16.092 36.917 33.293 1.00 22.50  ? 27  PHE A CZ  1 
ATOM   183  N N   . SER A 1 28  ? 11.935 33.505 30.612 1.00 18.19  ? 28  SER A N   1 
ATOM   184  C CA  . SER A 1 28  ? 12.141 32.172 31.164 1.00 20.72  ? 28  SER A CA  1 
ATOM   185  C C   . SER A 1 28  ? 13.242 31.513 30.381 1.00 17.58  ? 28  SER A C   1 
ATOM   186  O O   . SER A 1 28  ? 13.408 31.743 29.184 1.00 21.39  ? 28  SER A O   1 
ATOM   187  C CB  . SER A 1 28  ? 10.859 31.273 31.101 1.00 17.41  ? 28  SER A CB  1 
ATOM   188  O OG  . SER A 1 28  ? 9.831  31.806 31.914 1.00 39.87  ? 28  SER A OG  1 
ATOM   189  N N   . VAL A 1 29  ? 14.040 30.687 31.073 1.00 17.64  ? 29  VAL A N   1 
ATOM   190  C CA  . VAL A 1 29  ? 15.083 29.949 30.380 1.00 18.54  ? 29  VAL A CA  1 
ATOM   191  C C   . VAL A 1 29  ? 14.956 28.482 30.814 1.00 12.78  ? 29  VAL A C   1 
ATOM   192  O O   . VAL A 1 29  ? 14.695 28.169 31.998 1.00 14.09  ? 29  VAL A O   1 
ATOM   193  C CB  . VAL A 1 29  ? 16.512 30.458 30.755 1.00 21.17  ? 29  VAL A CB  1 
ATOM   194  C CG1 . VAL A 1 29  ? 17.567 29.506 30.233 1.00 15.59  ? 29  VAL A CG1 1 
ATOM   195  C CG2 . VAL A 1 29  ? 16.751 31.848 30.131 1.00 21.65  ? 29  VAL A CG2 1 
ATOM   196  N N   . SER A 1 30  ? 15.139 27.596 29.827 1.00 15.04  ? 30  SER A N   1 
ATOM   197  C CA  . SER A 1 30  ? 15.125 26.205 30.111 1.00 20.20  ? 30  SER A CA  1 
ATOM   198  C C   . SER A 1 30  ? 16.461 25.624 29.595 1.00 21.42  ? 30  SER A C   1 
ATOM   199  O O   . SER A 1 30  ? 16.952 26.001 28.532 1.00 18.67  ? 30  SER A O   1 
ATOM   200  C CB  . SER A 1 30  ? 13.870 25.643 29.409 1.00 28.27  ? 30  SER A CB  1 
ATOM   201  O OG  . SER A 1 30  ? 14.093 24.341 29.036 1.00 33.93  ? 30  SER A OG  1 
ATOM   202  N N   . GLY A 1 31  ? 17.107 24.730 30.361 1.00 13.26  ? 31  GLY A N   1 
ATOM   203  C CA  . GLY A 1 31  ? 18.309 24.108 29.847 1.00 16.19  ? 31  GLY A CA  1 
ATOM   204  C C   . GLY A 1 31  ? 18.307 22.597 30.147 1.00 15.64  ? 31  GLY A C   1 
ATOM   205  O O   . GLY A 1 31  ? 17.612 22.071 31.055 1.00 14.14  ? 31  GLY A O   1 
ATOM   206  N N   . GLU A 1 32  ? 19.101 21.892 29.321 1.00 12.25  ? 32  GLU A N   1 
ATOM   207  C CA  . GLU A 1 32  ? 19.247 20.453 29.406 1.00 13.27  ? 32  GLU A CA  1 
ATOM   208  C C   . GLU A 1 32  ? 20.689 20.083 29.122 1.00 17.88  ? 32  GLU A C   1 
ATOM   209  O O   . GLU A 1 32  ? 21.365 20.700 28.290 1.00 20.59  ? 32  GLU A O   1 
ATOM   210  C CB  . GLU A 1 32  ? 18.415 19.760 28.296 1.00 13.01  ? 32  GLU A CB  1 
ATOM   211  C CG  . GLU A 1 32  ? 16.936 20.055 28.401 1.00 28.18  ? 32  GLU A CG  1 
ATOM   212  C CD  . GLU A 1 32  ? 16.081 19.279 27.365 1.00 28.69  ? 32  GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 32  ? 16.592 18.350 26.753 1.00 25.49  ? 32  GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 32  ? 14.880 19.578 27.208 1.00 25.19  ? 32  GLU A OE2 1 
ATOM   215  N N   . GLY A 1 33  ? 21.179 19.031 29.809 1.00 13.19  ? 33  GLY A N   1 
ATOM   216  C CA  . GLY A 1 33  ? 22.500 18.581 29.471 1.00 11.44  ? 33  GLY A CA  1 
ATOM   217  C C   . GLY A 1 33  ? 22.847 17.447 30.418 1.00 15.60  ? 33  GLY A C   1 
ATOM   218  O O   . GLY A 1 33  ? 21.969 16.721 30.929 1.00 18.30  ? 33  GLY A O   1 
ATOM   219  N N   . GLU A 1 34  ? 24.142 17.300 30.655 1.00 16.01  ? 34  GLU A N   1 
ATOM   220  C CA  . GLU A 1 34  ? 24.604 16.228 31.527 1.00 16.91  ? 34  GLU A CA  1 
ATOM   221  C C   . GLU A 1 34  ? 25.819 16.653 32.350 1.00 20.72  ? 34  GLU A C   1 
ATOM   222  O O   . GLU A 1 34  ? 26.622 17.513 31.934 1.00 18.01  ? 34  GLU A O   1 
ATOM   223  C CB  . GLU A 1 34  ? 24.955 14.993 30.718 1.00 28.13  ? 34  GLU A CB  1 
ATOM   224  C CG  . GLU A 1 34  ? 25.485 15.207 29.380 1.00 38.59  ? 34  GLU A CG  1 
ATOM   225  C CD  . GLU A 1 34  ? 25.665 13.849 28.676 1.00 40.46  ? 34  GLU A CD  1 
ATOM   226  O OE1 . GLU A 1 34  ? 24.720 13.047 28.717 1.00 30.65  ? 34  GLU A OE1 1 
ATOM   227  O OE2 . GLU A 1 34  ? 26.740 13.566 28.120 1.00 46.90  ? 34  GLU A OE2 1 
ATOM   228  N N   . GLY A 1 35  ? 25.983 16.004 33.516 1.00 14.05  ? 35  GLY A N   1 
ATOM   229  C CA  . GLY A 1 35  ? 27.121 16.379 34.351 1.00 12.59  ? 35  GLY A CA  1 
ATOM   230  C C   . GLY A 1 35  ? 27.888 15.109 34.699 1.00 22.53  ? 35  GLY A C   1 
ATOM   231  O O   . GLY A 1 35  ? 27.259 14.071 34.917 1.00 17.43  ? 35  GLY A O   1 
ATOM   232  N N   . ASP A 1 36  ? 29.239 15.202 34.775 1.00 18.09  ? 36  ASP A N   1 
ATOM   233  C CA  . ASP A 1 36  ? 30.049 14.038 35.127 1.00 13.88  ? 36  ASP A CA  1 
ATOM   234  C C   . ASP A 1 36  ? 31.014 14.515 36.221 1.00 18.33  ? 36  ASP A C   1 
ATOM   235  O O   . ASP A 1 36  ? 32.113 15.001 35.949 1.00 18.15  ? 36  ASP A O   1 
ATOM   236  C CB  . ASP A 1 36  ? 30.735 13.546 33.832 1.00 18.18  ? 36  ASP A CB  1 
ATOM   237  C CG  . ASP A 1 36  ? 31.470 12.235 34.006 1.00 36.28  ? 36  ASP A CG  1 
ATOM   238  O OD1 . ASP A 1 36  ? 31.576 11.776 35.182 1.00 26.95  ? 36  ASP A OD1 1 
ATOM   239  O OD2 . ASP A 1 36  ? 31.946 11.705 32.959 1.00 37.28  ? 36  ASP A OD2 1 
ATOM   240  N N   . ALA A 1 37  ? 30.606 14.325 37.533 1.00 14.91  ? 37  ALA A N   1 
ATOM   241  C CA  . ALA A 1 37  ? 31.416 14.825 38.634 1.00 14.49  ? 37  ALA A CA  1 
ATOM   242  C C   . ALA A 1 37  ? 32.755 14.115 38.711 1.00 22.27  ? 37  ALA A C   1 
ATOM   243  O O   . ALA A 1 37  ? 33.646 14.628 39.309 1.00 16.16  ? 37  ALA A O   1 
ATOM   244  C CB  . ALA A 1 37  ? 30.647 14.681 40.016 1.00 13.29  ? 37  ALA A CB  1 
ATOM   245  N N   . THR A 1 38  ? 32.914 12.937 38.094 1.00 14.43  ? 38  THR A N   1 
ATOM   246  C CA  . THR A 1 38  ? 34.235 12.263 38.181 1.00 17.02  ? 38  THR A CA  1 
ATOM   247  C C   . THR A 1 38  ? 35.302 13.148 37.513 1.00 21.70  ? 38  THR A C   1 
ATOM   248  O O   . THR A 1 38  ? 36.468 13.133 37.907 1.00 16.69  ? 38  THR A O   1 
ATOM   249  C CB  . THR A 1 38  ? 34.176 10.880 37.483 1.00 23.65  ? 38  THR A CB  1 
ATOM   250  O OG1 . THR A 1 38  ? 33.273 10.082 38.223 1.00 27.60  ? 38  THR A OG1 1 
ATOM   251  C CG2 . THR A 1 38  ? 35.528 10.137 37.538 1.00 19.89  ? 38  THR A CG2 1 
ATOM   252  N N   . TYR A 1 39  ? 34.894 13.913 36.476 1.00 15.10  ? 39  TYR A N   1 
ATOM   253  C CA  . TYR A 1 39  ? 35.819 14.853 35.757 1.00 14.90  ? 39  TYR A CA  1 
ATOM   254  C C   . TYR A 1 39  ? 35.494 16.334 36.006 1.00 16.05  ? 39  TYR A C   1 
ATOM   255  O O   . TYR A 1 39  ? 36.149 17.232 35.455 1.00 19.41  ? 39  TYR A O   1 
ATOM   256  C CB  . TYR A 1 39  ? 35.801 14.578 34.247 1.00 19.88  ? 39  TYR A CB  1 
ATOM   257  C CG  . TYR A 1 39  ? 36.136 13.123 33.950 1.00 33.63  ? 39  TYR A CG  1 
ATOM   258  C CD1 . TYR A 1 39  ? 37.424 12.628 34.174 1.00 36.96  ? 39  TYR A CD1 1 
ATOM   259  C CD2 . TYR A 1 39  ? 35.169 12.227 33.513 1.00 46.29  ? 39  TYR A CD2 1 
ATOM   260  C CE1 . TYR A 1 39  ? 37.738 11.276 33.980 1.00 39.18  ? 39  TYR A CE1 1 
ATOM   261  C CE2 . TYR A 1 39  ? 35.477 10.870 33.313 1.00 54.38  ? 39  TYR A CE2 1 
ATOM   262  C CZ  . TYR A 1 39  ? 36.772 10.405 33.555 1.00 50.36  ? 39  TYR A CZ  1 
ATOM   263  O OH  . TYR A 1 39  ? 37.106 9.050  33.385 1.00 30.09  ? 39  TYR A OH  1 
ATOM   264  N N   . GLY A 1 40  ? 34.457 16.568 36.850 1.00 17.12  ? 40  GLY A N   1 
ATOM   265  C CA  . GLY A 1 40  ? 34.064 17.920 37.188 1.00 11.28  ? 40  GLY A CA  1 
ATOM   266  C C   . GLY A 1 40  ? 33.563 18.638 35.944 1.00 14.96  ? 40  GLY A C   1 
ATOM   267  O O   . GLY A 1 40  ? 33.567 19.858 35.883 1.00 18.68  ? 40  GLY A O   1 
ATOM   268  N N   . LYS A 1 41  ? 32.964 17.841 35.003 1.00 14.01  ? 41  LYS A N   1 
ATOM   269  C CA  . LYS A 1 41  ? 32.506 18.374 33.749 1.00 16.47  ? 41  LYS A CA  1 
ATOM   270  C C   . LYS A 1 41  ? 30.992 18.559 33.598 1.00 30.15  ? 41  LYS A C   1 
ATOM   271  O O   . LYS A 1 41  ? 30.205 17.707 33.967 1.00 22.09  ? 41  LYS A O   1 
ATOM   272  C CB  . LYS A 1 41  ? 33.002 17.411 32.668 1.00 12.33  ? 41  LYS A CB  1 
ATOM   273  C CG  . LYS A 1 41  ? 32.610 17.752 31.230 1.00 18.12  ? 41  LYS A CG  1 
ATOM   274  C CD  . LYS A 1 41  ? 33.150 16.588 30.363 1.00 22.69  ? 41  LYS A CD  1 
ATOM   275  C CE  . LYS A 1 41  ? 33.284 17.010 28.914 1.00 36.42  ? 41  LYS A CE  1 
ATOM   276  N NZ  . LYS A 1 41  ? 34.074 16.032 28.103 1.00 55.91  ? 41  LYS A NZ  1 
ATOM   277  N N   . LEU A 1 42  ? 30.592 19.717 32.978 1.00 14.94  ? 42  LEU A N   1 
ATOM   278  C CA  . LEU A 1 42  ? 29.194 19.985 32.694 1.00 14.00  ? 42  LEU A CA  1 
ATOM   279  C C   . LEU A 1 42  ? 29.074 20.364 31.230 1.00 12.07  ? 42  LEU A C   1 
ATOM   280  O O   . LEU A 1 42  ? 29.908 21.160 30.748 1.00 15.48  ? 42  LEU A O   1 
ATOM   281  C CB  . LEU A 1 42  ? 28.784 21.244 33.461 1.00 20.34  ? 42  LEU A CB  1 
ATOM   282  C CG  . LEU A 1 42  ? 28.608 21.076 34.945 1.00 25.71  ? 42  LEU A CG  1 
ATOM   283  C CD1 . LEU A 1 42  ? 28.335 22.429 35.592 1.00 22.11  ? 42  LEU A CD1 1 
ATOM   284  C CD2 . LEU A 1 42  ? 27.435 20.135 35.143 1.00 19.28  ? 42  LEU A CD2 1 
ATOM   285  N N   . THR A 1 43  ? 28.055 19.795 30.516 1.00 11.64  ? 43  THR A N   1 
ATOM   286  C CA  . THR A 1 43  ? 27.821 20.216 29.111 1.00 13.35  ? 43  THR A CA  1 
ATOM   287  C C   . THR A 1 43  ? 26.332 20.495 29.104 1.00 21.35  ? 43  THR A C   1 
ATOM   288  O O   . THR A 1 43  ? 25.535 19.615 29.458 1.00 16.08  ? 43  THR A O   1 
ATOM   289  C CB  . THR A 1 43  ? 28.218 19.088 28.126 1.00 25.53  ? 43  THR A CB  1 
ATOM   290  O OG1 . THR A 1 43  ? 27.537 17.884 28.493 1.00 36.38  ? 43  THR A OG1 1 
ATOM   291  C CG2 . THR A 1 43  ? 29.730 18.815 28.252 1.00 18.15  ? 43  THR A CG2 1 
ATOM   292  N N   . LEU A 1 44  ? 25.927 21.773 28.779 1.00 12.69  ? 44  LEU A N   1 
ATOM   293  C CA  . LEU A 1 44  ? 24.504 22.118 28.797 1.00 16.51  ? 44  LEU A CA  1 
ATOM   294  C C   . LEU A 1 44  ? 24.185 23.067 27.672 1.00 21.67  ? 44  LEU A C   1 
ATOM   295  O O   . LEU A 1 44  ? 25.049 23.810 27.229 1.00 16.95  ? 44  LEU A O   1 
ATOM   296  C CB  . LEU A 1 44  ? 24.157 22.900 30.104 1.00 20.95  ? 44  LEU A CB  1 
ATOM   297  C CG  . LEU A 1 44  ? 23.979 22.226 31.480 1.00 27.77  ? 44  LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 44  ? 22.639 21.543 31.469 1.00 25.18  ? 44  LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 44  ? 25.085 21.318 31.825 1.00 49.50  ? 44  LEU A CD2 1 
ATOM   300  N N   . LYS A 1 45  ? 22.913 23.037 27.252 1.00 12.60  ? 45  LYS A N   1 
ATOM   301  C CA  . LYS A 1 45  ? 22.402 23.980 26.245 1.00 14.34  ? 45  LYS A CA  1 
ATOM   302  C C   . LYS A 1 45  ? 21.177 24.623 26.872 1.00 20.77  ? 45  LYS A C   1 
ATOM   303  O O   . LYS A 1 45  ? 20.275 23.922 27.368 1.00 19.05  ? 45  LYS A O   1 
ATOM   304  C CB  . LYS A 1 45  ? 22.010 23.253 24.981 1.00 15.47  ? 45  LYS A CB  1 
ATOM   305  C CG  . LYS A 1 45  ? 21.417 24.258 23.987 1.00 12.08  ? 45  LYS A CG  1 
ATOM   306  C CD  . LYS A 1 45  ? 20.968 23.522 22.668 1.00 23.74  ? 45  LYS A CD  1 
ATOM   307  C CE  . LYS A 1 45  ? 20.217 24.472 21.748 1.00 31.12  ? 45  LYS A CE  1 
ATOM   308  N NZ  . LYS A 1 45  ? 19.776 23.690 20.557 1.00 18.05  ? 45  LYS A NZ  1 
ATOM   309  N N   . PHE A 1 46  ? 21.152 25.988 26.886 1.00 10.93  ? 46  PHE A N   1 
ATOM   310  C CA  . PHE A 1 46  ? 20.068 26.763 27.445 1.00 15.41  ? 46  PHE A CA  1 
ATOM   311  C C   . PHE A 1 46  ? 19.377 27.492 26.330 1.00 22.91  ? 46  PHE A C   1 
ATOM   312  O O   . PHE A 1 46  ? 20.035 27.961 25.402 1.00 19.34  ? 46  PHE A O   1 
ATOM   313  C CB  . PHE A 1 46  ? 20.585 27.831 28.436 1.00 15.83  ? 46  PHE A CB  1 
ATOM   314  C CG  . PHE A 1 46  ? 21.345 27.226 29.570 1.00 17.43  ? 46  PHE A CG  1 
ATOM   315  C CD1 . PHE A 1 46  ? 22.741 27.060 29.496 1.00 20.45  ? 46  PHE A CD1 1 
ATOM   316  C CD2 . PHE A 1 46  ? 20.647 26.799 30.679 1.00 14.72  ? 46  PHE A CD2 1 
ATOM   317  C CE1 . PHE A 1 46  ? 23.446 26.463 30.554 1.00 17.91  ? 46  PHE A CE1 1 
ATOM   318  C CE2 . PHE A 1 46  ? 21.307 26.190 31.758 1.00 13.12  ? 46  PHE A CE2 1 
ATOM   319  C CZ  . PHE A 1 46  ? 22.719 26.021 31.695 1.00 12.73  ? 46  PHE A CZ  1 
ATOM   320  N N   . ILE A 1 47  ? 18.069 27.646 26.494 1.00 16.38  ? 47  ILE A N   1 
ATOM   321  C CA  . ILE A 1 47  ? 17.267 28.360 25.453 1.00 17.34  ? 47  ILE A CA  1 
ATOM   322  C C   . ILE A 1 47  ? 16.350 29.358 26.126 1.00 19.29  ? 47  ILE A C   1 
ATOM   323  O O   . ILE A 1 47  ? 15.827 29.080 27.189 1.00 14.22  ? 47  ILE A O   1 
ATOM   324  C CB  . ILE A 1 47  ? 16.394 27.383 24.682 1.00 28.55  ? 47  ILE A CB  1 
ATOM   325  C CG1 . ILE A 1 47  ? 17.293 26.459 23.862 1.00 27.74  ? 47  ILE A CG1 1 
ATOM   326  C CG2 . ILE A 1 47  ? 15.514 28.138 23.741 1.00 30.69  ? 47  ILE A CG2 1 
ATOM   327  C CD1 . ILE A 1 47  ? 16.558 25.315 23.254 1.00 41.12  ? 47  ILE A CD1 1 
ATOM   328  N N   . CYS A 1 48  ? 16.130 30.554 25.539 1.00 14.31  ? 48  CYS A N   1 
ATOM   329  C CA  . CYS A 1 48  ? 15.235 31.520 26.191 1.00 17.17  ? 48  CYS A CA  1 
ATOM   330  C C   . CYS A 1 48  ? 13.896 31.148 25.580 1.00 22.57  ? 48  CYS A C   1 
ATOM   331  O O   . CYS A 1 48  ? 13.710 31.314 24.383 1.00 19.66  ? 48  CYS A O   1 
ATOM   332  C CB  . CYS A 1 48  ? 15.574 32.975 25.833 1.00 15.60  ? 48  CYS A CB  1 
ATOM   333  S SG  . CYS A 1 48  ? 14.386 34.058 26.608 1.00 21.74  ? 48  CYS A SG  1 
ATOM   334  N N   . THR A 1 49  ? 13.004 30.603 26.387 1.00 20.10  ? 49  THR A N   1 
ATOM   335  C CA  . THR A 1 49  ? 11.741 30.134 25.851 1.00 25.01  ? 49  THR A CA  1 
ATOM   336  C C   . THR A 1 49  ? 10.689 31.217 25.662 1.00 29.21  ? 49  THR A C   1 
ATOM   337  O O   . THR A 1 49  ? 9.611  30.932 25.134 1.00 27.96  ? 49  THR A O   1 
ATOM   338  C CB  . THR A 1 49  ? 11.132 29.031 26.747 1.00 20.25  ? 49  THR A CB  1 
ATOM   339  O OG1 . THR A 1 49  ? 10.743 29.612 27.991 1.00 23.47  ? 49  THR A OG1 1 
ATOM   340  C CG2 . THR A 1 49  ? 12.162 27.918 27.006 1.00 20.87  ? 49  THR A CG2 1 
ATOM   341  N N   . THR A 1 50  ? 11.014 32.472 26.037 1.00 22.69  ? 50  THR A N   1 
ATOM   342  C CA  . THR A 1 50  ? 10.039 33.559 25.929 1.00 20.07  ? 50  THR A CA  1 
ATOM   343  C C   . THR A 1 50  ? 10.390 34.563 24.830 1.00 29.32  ? 50  THR A C   1 
ATOM   344  O O   . THR A 1 50  ? 9.753  35.602 24.711 1.00 31.76  ? 50  THR A O   1 
ATOM   345  C CB  . THR A 1 50  ? 9.928  34.305 27.261 1.00 27.49  ? 50  THR A CB  1 
ATOM   346  O OG1 . THR A 1 50  ? 11.255 34.580 27.792 1.00 27.01  ? 50  THR A OG1 1 
ATOM   347  C CG2 . THR A 1 50  ? 9.147  33.481 28.233 1.00 20.67  ? 50  THR A CG2 1 
ATOM   348  N N   . GLY A 1 51  ? 11.391 34.257 24.011 1.00 26.99  ? 51  GLY A N   1 
ATOM   349  C CA  . GLY A 1 51  ? 11.784 35.211 22.970 1.00 30.15  ? 51  GLY A CA  1 
ATOM   350  C C   . GLY A 1 51  ? 13.257 35.611 23.144 1.00 39.11  ? 51  GLY A C   1 
ATOM   351  O O   . GLY A 1 51  ? 14.127 34.754 23.401 1.00 49.35  ? 51  GLY A O   1 
ATOM   352  N N   . LYS A 1 52  ? 13.553 36.944 22.992 1.00 24.38  ? 52  LYS A N   1 
ATOM   353  C CA  . LYS A 1 52  ? 14.936 37.416 23.138 1.00 27.93  ? 52  LYS A CA  1 
ATOM   354  C C   . LYS A 1 52  ? 15.215 37.608 24.631 1.00 22.27  ? 52  LYS A C   1 
ATOM   355  O O   . LYS A 1 52  ? 14.341 38.061 25.417 1.00 24.86  ? 52  LYS A O   1 
ATOM   356  C CB  . LYS A 1 52  ? 15.214 38.711 22.342 1.00 84.83  ? 52  LYS A CB  1 
ATOM   357  C CG  . LYS A 1 52  ? 14.217 39.862 22.497 1.00 68.95  ? 52  LYS A CG  1 
ATOM   358  C CD  . LYS A 1 52  ? 12.897 39.645 21.703 1.00 68.95  ? 52  LYS A CD  1 
ATOM   359  C CE  . LYS A 1 52  ? 12.377 40.943 21.040 1.00 68.95  ? 52  LYS A CE  1 
ATOM   360  N NZ  . LYS A 1 52  ? 12.231 42.116 21.964 1.00 68.95  ? 52  LYS A NZ  1 
ATOM   361  N N   . LEU A 1 53  ? 16.431 37.176 25.042 1.00 21.53  ? 53  LEU A N   1 
ATOM   362  C CA  . LEU A 1 53  ? 16.791 37.296 26.468 1.00 20.76  ? 53  LEU A CA  1 
ATOM   363  C C   . LEU A 1 53  ? 17.030 38.799 26.672 1.00 22.39  ? 53  LEU A C   1 
ATOM   364  O O   . LEU A 1 53  ? 17.691 39.436 25.872 1.00 23.74  ? 53  LEU A O   1 
ATOM   365  C CB  . LEU A 1 53  ? 18.086 36.504 26.723 1.00 24.52  ? 53  LEU A CB  1 
ATOM   366  C CG  . LEU A 1 53  ? 18.470 36.407 28.190 1.00 21.50  ? 53  LEU A CG  1 
ATOM   367  C CD1 . LEU A 1 53  ? 17.469 35.533 28.958 1.00 20.00  ? 53  LEU A CD1 1 
ATOM   368  C CD2 . LEU A 1 53  ? 19.848 35.803 28.282 1.00 16.85  ? 53  LEU A CD2 1 
ATOM   369  N N   . PRO A 1 54  ? 16.517 39.371 27.743 1.00 22.35  ? 54  PRO A N   1 
ATOM   370  C CA  . PRO A 1 54  ? 16.722 40.801 27.945 1.00 21.19  ? 54  PRO A CA  1 
ATOM   371  C C   . PRO A 1 54  ? 17.987 41.263 28.578 1.00 24.32  ? 54  PRO A C   1 
ATOM   372  O O   . PRO A 1 54  ? 18.216 42.475 28.656 1.00 20.80  ? 54  PRO A O   1 
ATOM   373  C CB  . PRO A 1 54  ? 15.539 41.199 28.788 1.00 23.48  ? 54  PRO A CB  1 
ATOM   374  C CG  . PRO A 1 54  ? 15.274 40.012 29.615 1.00 29.48  ? 54  PRO A CG  1 
ATOM   375  C CD  . PRO A 1 54  ? 15.384 38.907 28.571 1.00 25.98  ? 54  PRO A CD  1 
ATOM   376  N N   . VAL A 1 55  ? 18.771 40.289 29.068 1.00 19.29  ? 55  VAL A N   1 
ATOM   377  C CA  . VAL A 1 55  ? 20.048 40.545 29.657 1.00 11.31  ? 55  VAL A CA  1 
ATOM   378  C C   . VAL A 1 55  ? 21.074 39.690 28.933 1.00 17.54  ? 55  VAL A C   1 
ATOM   379  O O   . VAL A 1 55  ? 20.717 38.757 28.238 1.00 20.35  ? 55  VAL A O   1 
ATOM   380  C CB  . VAL A 1 55  ? 20.085 40.207 31.152 1.00 18.69  ? 55  VAL A CB  1 
ATOM   381  C CG1 . VAL A 1 55  ? 19.163 41.151 31.895 1.00 19.04  ? 55  VAL A CG1 1 
ATOM   382  C CG2 . VAL A 1 55  ? 19.770 38.690 31.386 1.00 21.20  ? 55  VAL A CG2 1 
ATOM   383  N N   . PRO A 1 56  ? 22.367 40.019 29.075 1.00 18.97  ? 56  PRO A N   1 
ATOM   384  C CA  . PRO A 1 56  ? 23.337 39.179 28.379 1.00 15.40  ? 56  PRO A CA  1 
ATOM   385  C C   . PRO A 1 56  ? 23.427 37.782 28.996 1.00 9.53   ? 56  PRO A C   1 
ATOM   386  O O   . PRO A 1 56  ? 23.473 37.579 30.227 1.00 14.09  ? 56  PRO A O   1 
ATOM   387  C CB  . PRO A 1 56  ? 24.674 39.956 28.516 1.00 18.19  ? 56  PRO A CB  1 
ATOM   388  C CG  . PRO A 1 56  ? 24.226 41.418 28.664 1.00 22.06  ? 56  PRO A CG  1 
ATOM   389  C CD  . PRO A 1 56  ? 23.033 41.217 29.655 1.00 13.42  ? 56  PRO A CD  1 
HETATM 390  N N   . 32T A 1 57  ? 23.575 36.760 28.066 1.00 12.17  ? 57  32T A N   1 
HETATM 391  C CA  . 32T A 1 57  ? 23.719 35.399 28.617 1.00 13.36  ? 57  32T A CA  1 
HETATM 392  C CB  . 32T A 1 57  ? 23.948 34.391 27.489 1.00 29.30  ? 57  32T A CB  1 
HETATM 393  C CG  . 32T A 1 57  ? 22.730 34.023 26.716 1.00 40.44  ? 57  32T A CG  1 
HETATM 394  C CD2 . 32T A 1 57  ? 21.687 33.101 27.105 1.00 40.44  ? 57  32T A CD2 1 
HETATM 395  C CE2 . 32T A 1 57  ? 20.776 33.032 26.048 1.00 40.44  ? 57  32T A CE2 1 
HETATM 396  S SUL . 32T A 1 57  ? 21.088 32.026 28.343 1.00 29.24  ? 57  32T A SUL 1 
HETATM 397  C CD1 . 32T A 1 57  ? 22.389 34.462 25.459 1.00 40.44  ? 57  32T A CD1 1 
HETATM 398  N NE1 . 32T A 1 57  ? 21.220 33.867 25.058 1.00 40.44  ? 57  32T A NE1 1 
HETATM 399  C CZ2 . 32T A 1 57  ? 19.667 32.226 26.123 1.00 40.44  ? 57  32T A CZ2 1 
HETATM 400  C CZ3 . 32T A 1 57  ? 19.678 31.611 27.291 1.00 29.24  ? 57  32T A CZ3 1 
HETATM 401  C C   . 32T A 1 57  ? 24.852 35.209 29.652 1.00 14.89  ? 57  32T A C   1 
HETATM 402  O O   . 32T A 1 57  ? 24.664 34.483 30.650 1.00 14.43  ? 57  32T A O   1 
ATOM   403  N N   . PRO A 1 58  ? 26.015 35.866 29.461 1.00 14.22  ? 58  PRO A N   1 
ATOM   404  C CA  . PRO A 1 58  ? 27.063 35.629 30.464 1.00 9.94   ? 58  PRO A CA  1 
ATOM   405  C C   . PRO A 1 58  ? 26.645 36.016 31.856 1.00 10.04  ? 58  PRO A C   1 
ATOM   406  O O   . PRO A 1 58  ? 27.188 35.440 32.838 1.00 15.76  ? 58  PRO A O   1 
ATOM   407  C CB  . PRO A 1 58  ? 28.246 36.579 30.047 1.00 11.97  ? 58  PRO A CB  1 
ATOM   408  C CG  . PRO A 1 58  ? 28.081 36.695 28.543 1.00 17.71  ? 58  PRO A CG  1 
ATOM   409  C CD  . PRO A 1 58  ? 26.580 36.492 28.224 1.00 14.86  ? 58  PRO A CD  1 
ATOM   410  N N   . THR A 1 59  ? 25.726 36.983 31.969 1.00 11.81  ? 59  THR A N   1 
ATOM   411  C CA  . THR A 1 59  ? 25.374 37.396 33.329 1.00 7.27   ? 59  THR A CA  1 
ATOM   412  C C   . THR A 1 59  ? 24.559 36.310 34.060 1.00 11.82  ? 59  THR A C   1 
ATOM   413  O O   . THR A 1 59  ? 24.367 36.394 35.313 1.00 15.71  ? 59  THR A O   1 
ATOM   414  C CB  . THR A 1 59  ? 24.559 38.712 33.344 1.00 17.24  ? 59  THR A CB  1 
ATOM   415  O OG1 . THR A 1 59  ? 23.273 38.463 32.776 1.00 12.42  ? 59  THR A OG1 1 
ATOM   416  C CG2 . THR A 1 59  ? 25.361 39.899 32.526 1.00 14.36  ? 59  THR A CG2 1 
ATOM   417  N N   . LEU A 1 60  ? 24.041 35.306 33.267 1.00 8.44   ? 60  LEU A N   1 
ATOM   418  C CA  . LEU A 1 60  ? 23.261 34.222 33.914 1.00 13.26  ? 60  LEU A CA  1 
ATOM   419  C C   . LEU A 1 60  ? 24.010 32.922 34.267 1.00 19.43  ? 60  LEU A C   1 
ATOM   420  O O   . LEU A 1 60  ? 23.447 32.075 34.966 1.00 13.89  ? 60  LEU A O   1 
ATOM   421  C CB  . LEU A 1 60  ? 22.062 33.815 33.024 1.00 14.98  ? 60  LEU A CB  1 
ATOM   422  C CG  . LEU A 1 60  ? 21.078 34.984 32.818 1.00 18.72  ? 60  LEU A CG  1 
ATOM   423  C CD1 . LEU A 1 60  ? 19.953 34.417 31.934 1.00 16.20  ? 60  LEU A CD1 1 
ATOM   424  C CD2 . LEU A 1 60  ? 20.471 35.564 34.144 1.00 13.92  ? 60  LEU A CD2 1 
ATOM   425  N N   . VAL A 1 61  ? 25.245 32.764 33.782 1.00 15.96  ? 61  VAL A N   1 
ATOM   426  C CA  . VAL A 1 61  ? 25.988 31.485 33.939 1.00 10.22  ? 61  VAL A CA  1 
ATOM   427  C C   . VAL A 1 61  ? 26.052 31.026 35.388 1.00 13.06  ? 61  VAL A C   1 
ATOM   428  O O   . VAL A 1 61  ? 25.750 29.881 35.699 1.00 13.88  ? 61  VAL A O   1 
ATOM   429  C CB  . VAL A 1 61  ? 27.421 31.692 33.424 1.00 13.75  ? 61  VAL A CB  1 
ATOM   430  C CG1 . VAL A 1 61  ? 28.330 30.527 33.800 1.00 12.72  ? 61  VAL A CG1 1 
ATOM   431  C CG2 . VAL A 1 61  ? 27.353 31.865 31.860 1.00 13.11  ? 61  VAL A CG2 1 
ATOM   432  N N   . THR A 1 62  ? 26.428 31.979 36.339 1.00 12.88  ? 62  THR A N   1 
ATOM   433  C CA  . THR A 1 62  ? 26.555 31.491 37.704 1.00 12.00  ? 62  THR A CA  1 
ATOM   434  C C   . THR A 1 62  ? 25.229 31.042 38.324 1.00 11.86  ? 62  THR A C   1 
ATOM   435  O O   . THR A 1 62  ? 25.179 30.193 39.259 1.00 10.64  ? 62  THR A O   1 
ATOM   436  C CB  . THR A 1 62  ? 27.184 32.545 38.609 1.00 24.70  ? 62  THR A CB  1 
ATOM   437  O OG1 . THR A 1 62  ? 26.419 33.755 38.533 1.00 13.75  ? 62  THR A OG1 1 
ATOM   438  C CG2 . THR A 1 62  ? 28.621 32.814 38.178 1.00 9.78   ? 62  THR A CG2 1 
ATOM   439  N N   . THR A 1 63  ? 24.159 31.630 37.849 1.00 11.89  ? 63  THR A N   1 
ATOM   440  C CA  . THR A 1 63  ? 22.823 31.253 38.390 1.00 10.99  ? 63  THR A CA  1 
ATOM   441  C C   . THR A 1 63  ? 22.351 29.942 37.796 1.00 6.82   ? 63  THR A C   1 
ATOM   442  O O   . THR A 1 63  ? 21.795 29.058 38.475 1.00 16.08  ? 63  THR A O   1 
ATOM   443  C CB  . THR A 1 63  ? 21.782 32.380 37.995 1.00 13.06  ? 63  THR A CB  1 
ATOM   444  O OG1 . THR A 1 63  ? 22.138 33.607 38.660 1.00 13.80  ? 63  THR A OG1 1 
ATOM   445  C CG2 . THR A 1 63  ? 20.310 31.967 38.391 1.00 12.84  ? 63  THR A CG2 1 
ATOM   446  N N   . LEU A 1 64  ? 22.612 29.782 36.457 1.00 12.83  ? 64  LEU A N   1 
ATOM   447  C CA  . LEU A 1 64  ? 22.113 28.581 35.804 1.00 10.17  ? 64  LEU A CA  1 
ATOM   448  C C   . LEU A 1 64  ? 22.957 27.478 36.137 1.00 27.06  ? 64  LEU A C   1 
ATOM   449  O O   . LEU A 1 64  ? 22.469 26.257 36.266 1.00 15.78  ? 64  LEU A O   1 
ATOM   450  C CB  . LEU A 1 64  ? 22.301 28.713 34.298 1.00 11.09  ? 64  LEU A CB  1 
ATOM   451  C CG  . LEU A 1 64  ? 21.305 29.748 33.804 1.00 14.19  ? 64  LEU A CG  1 
ATOM   452  C CD1 . LEU A 1 64  ? 21.780 30.149 32.378 1.00 17.85  ? 64  LEU A CD1 1 
ATOM   453  C CD2 . LEU A 1 64  ? 19.791 29.128 33.785 1.00 11.34  ? 64  LEU A CD2 1 
HETATM 454  N N1  . CRO A 1 65  ? 24.413 27.623 36.287 1.00 11.38  ? 66  CRO A N1  1 
HETATM 455  C CA1 . CRO A 1 65  ? 25.361 26.569 36.760 1.00 10.56  ? 66  CRO A CA1 1 
HETATM 456  C CB1 . CRO A 1 65  ? 26.298 26.081 35.625 1.00 25.43  ? 66  CRO A CB1 1 
HETATM 457  C CG1 . CRO A 1 65  ? 25.532 25.447 34.455 1.00 25.43  ? 66  CRO A CG1 1 
HETATM 458  O OG1 . CRO A 1 65  ? 27.065 27.215 35.123 1.00 25.43  ? 66  CRO A OG1 1 
HETATM 459  C C1  . CRO A 1 65  ? 26.055 27.107 37.941 1.00 16.26  ? 66  CRO A C1  1 
HETATM 460  N N2  . CRO A 1 65  ? 27.248 27.656 37.935 1.00 14.31  ? 66  CRO A N2  1 
HETATM 461  N N3  . CRO A 1 65  ? 25.505 27.142 39.197 1.00 14.77  ? 66  CRO A N3  1 
HETATM 462  C C2  . CRO A 1 65  ? 26.467 27.742 40.062 1.00 11.89  ? 66  CRO A C2  1 
HETATM 463  O O2  . CRO A 1 65  ? 26.360 27.978 41.290 1.00 25.43  ? 66  CRO A O2  1 
HETATM 464  C CA2 . CRO A 1 65  ? 27.602 28.092 39.181 1.00 25.43  ? 66  CRO A CA2 1 
HETATM 465  C CA3 . CRO A 1 65  ? 24.147 26.710 39.588 1.00 13.42  ? 66  CRO A CA3 1 
HETATM 466  C C3  . CRO A 1 65  ? 23.989 25.419 40.110 1.00 23.57  ? 66  CRO A C3  1 
HETATM 467  O O3  . CRO A 1 65  ? 23.013 24.952 40.920 1.00 25.43  ? 66  CRO A O3  1 
HETATM 468  C CB2 . CRO A 1 65  ? 28.687 28.743 39.621 1.00 25.43  ? 66  CRO A CB2 1 
HETATM 469  C CG2 . CRO A 1 65  ? 29.792 29.215 38.911 1.00 25.43  ? 66  CRO A CG2 1 
HETATM 470  C CD1 . CRO A 1 65  ? 30.806 29.928 39.650 1.00 25.43  ? 66  CRO A CD1 1 
HETATM 471  C CD2 . CRO A 1 65  ? 29.990 29.079 37.520 1.00 25.43  ? 66  CRO A CD2 1 
HETATM 472  C CE1 . CRO A 1 65  ? 31.915 30.466 39.054 1.00 25.43  ? 66  CRO A CE1 1 
HETATM 473  C CE2 . CRO A 1 65  ? 31.162 29.633 36.871 1.00 25.43  ? 66  CRO A CE2 1 
HETATM 474  C CZ  . CRO A 1 65  ? 32.128 30.334 37.650 1.00 25.43  ? 66  CRO A CZ  1 
HETATM 475  O OH  . CRO A 1 65  ? 33.159 30.836 37.114 1.00 25.43  ? 66  CRO A OH  1 
ATOM   476  N N   . VAL A 1 66  ? 24.933 24.381 39.803 1.00 11.93  ? 68  VAL A N   1 
ATOM   477  C CA  . VAL A 1 66  ? 24.838 22.970 40.097 1.00 14.03  ? 68  VAL A CA  1 
ATOM   478  C C   . VAL A 1 66  ? 26.230 22.507 40.549 1.00 14.86  ? 68  VAL A C   1 
ATOM   479  O O   . VAL A 1 66  ? 26.840 21.663 39.977 1.00 12.62  ? 68  VAL A O   1 
ATOM   480  C CB  . VAL A 1 66  ? 24.278 22.106 38.936 1.00 17.64  ? 68  VAL A CB  1 
ATOM   481  C CG1 . VAL A 1 66  ? 22.737 22.417 38.761 1.00 17.97  ? 68  VAL A CG1 1 
ATOM   482  C CG2 . VAL A 1 66  ? 25.001 22.430 37.612 1.00 15.35  ? 68  VAL A CG2 1 
ATOM   483  N N   . GLN A 1 67  ? 26.681 23.095 41.641 1.00 9.84   ? 69  GLN A N   1 
ATOM   484  C CA  . GLN A 1 67  ? 28.028 22.834 42.135 1.00 13.71  ? 69  GLN A CA  1 
ATOM   485  C C   . GLN A 1 67  ? 28.238 21.425 42.708 1.00 19.51  ? 69  GLN A C   1 
ATOM   486  O O   . GLN A 1 67  ? 29.366 21.066 43.040 1.00 13.70  ? 69  GLN A O   1 
ATOM   487  C CB  . GLN A 1 67  ? 28.409 23.950 43.137 1.00 9.50   ? 69  GLN A CB  1 
ATOM   488  C CG  . GLN A 1 67  ? 28.471 25.338 42.397 1.00 13.94  ? 69  GLN A CG  1 
ATOM   489  C CD  . GLN A 1 67  ? 28.612 26.485 43.381 1.00 21.53  ? 69  GLN A CD  1 
ATOM   490  O OE1 . GLN A 1 67  ? 27.835 26.563 44.316 1.00 15.85  ? 69  GLN A OE1 1 
ATOM   491  N NE2 . GLN A 1 67  ? 29.594 27.358 43.195 1.00 14.09  ? 69  GLN A NE2 1 
ATOM   492  N N   . CYS A 1 68  ? 27.161 20.600 42.755 1.00 13.11  ? 70  CYS A N   1 
ATOM   493  C CA  . CYS A 1 68  ? 27.308 19.211 43.191 1.00 13.52  ? 70  CYS A CA  1 
ATOM   494  C C   . CYS A 1 68  ? 28.081 18.447 42.061 1.00 13.74  ? 70  CYS A C   1 
ATOM   495  O O   . CYS A 1 68  ? 28.502 17.313 42.262 1.00 13.70  ? 70  CYS A O   1 
ATOM   496  C CB  . CYS A 1 68  ? 25.937 18.557 43.403 1.00 13.93  ? 70  CYS A CB  1 
ATOM   497  S SG  . CYS A 1 68  ? 24.736 18.990 42.049 1.00 17.23  ? 70  CYS A SG  1 
ATOM   498  N N   . PHE A 1 69  ? 28.283 19.091 40.860 1.00 12.91  ? 71  PHE A N   1 
ATOM   499  C CA  . PHE A 1 69  ? 29.041 18.409 39.792 1.00 12.52  ? 71  PHE A CA  1 
ATOM   500  C C   . PHE A 1 69  ? 30.538 18.740 39.837 1.00 22.86  ? 71  PHE A C   1 
ATOM   501  O O   . PHE A 1 69  ? 31.305 18.387 38.956 1.00 15.50  ? 71  PHE A O   1 
ATOM   502  C CB  . PHE A 1 69  ? 28.420 18.720 38.418 1.00 11.09  ? 71  PHE A CB  1 
ATOM   503  C CG  . PHE A 1 69  ? 27.138 17.949 38.177 1.00 17.72  ? 71  PHE A CG  1 
ATOM   504  C CD1 . PHE A 1 69  ? 27.194 16.557 37.988 1.00 18.79  ? 71  PHE A CD1 1 
ATOM   505  C CD2 . PHE A 1 69  ? 25.906 18.568 38.250 1.00 16.54  ? 71  PHE A CD2 1 
ATOM   506  C CE1 . PHE A 1 69  ? 26.034 15.803 37.881 1.00 21.91  ? 71  PHE A CE1 1 
ATOM   507  C CE2 . PHE A 1 69  ? 24.708 17.828 38.155 1.00 18.29  ? 71  PHE A CE2 1 
ATOM   508  C CZ  . PHE A 1 69  ? 24.793 16.444 37.967 1.00 17.05  ? 71  PHE A CZ  1 
ATOM   509  N N   . SER A 1 70  ? 30.967 19.410 40.892 1.00 15.96  ? 72  SER A N   1 
ATOM   510  C CA  . SER A 1 70  ? 32.404 19.741 41.023 1.00 13.98  ? 72  SER A CA  1 
ATOM   511  C C   . SER A 1 70  ? 33.181 18.457 41.312 1.00 19.51  ? 72  SER A C   1 
ATOM   512  O O   . SER A 1 70  ? 32.665 17.513 41.968 1.00 15.41  ? 72  SER A O   1 
ATOM   513  C CB  . SER A 1 70  ? 32.572 20.703 42.208 1.00 12.04  ? 72  SER A CB  1 
ATOM   514  O OG  . SER A 1 70  ? 31.855 21.898 41.931 1.00 17.52  ? 72  SER A OG  1 
ATOM   515  N N   . ARG A 1 71  ? 34.425 18.410 40.861 1.00 16.67  ? 73  ARG A N   1 
ATOM   516  C CA  . ARG A 1 71  ? 35.214 17.235 41.161 1.00 14.65  ? 73  ARG A CA  1 
ATOM   517  C C   . ARG A 1 71  ? 35.928 17.523 42.453 1.00 15.91  ? 73  ARG A C   1 
ATOM   518  O O   . ARG A 1 71  ? 36.667 18.473 42.529 1.00 15.35  ? 73  ARG A O   1 
ATOM   519  C CB  . ARG A 1 71  ? 36.316 16.995 40.105 1.00 15.68  ? 73  ARG A CB  1 
ATOM   520  C CG  . ARG A 1 71  ? 37.169 15.717 40.464 1.00 22.23  ? 73  ARG A CG  1 
ATOM   521  C CD  . ARG A 1 71  ? 38.120 15.306 39.337 1.00 26.99  ? 73  ARG A CD  1 
ATOM   522  N NE  . ARG A 1 71  ? 39.253 16.210 39.205 1.00 27.15  ? 73  ARG A NE  1 
ATOM   523  C CZ  . ARG A 1 71  ? 40.356 16.189 40.007 1.00 31.53  ? 73  ARG A CZ  1 
ATOM   524  N NH1 . ARG A 1 71  ? 40.431 15.312 41.007 1.00 23.13  ? 73  ARG A NH1 1 
ATOM   525  N NH2 . ARG A 1 71  ? 41.379 16.997 39.749 1.00 44.03  ? 73  ARG A NH2 1 
ATOM   526  N N   . TYR A 1 72  ? 35.700 16.676 43.502 1.00 14.56  ? 74  TYR A N   1 
ATOM   527  C CA  . TYR A 1 72  ? 36.449 16.868 44.754 1.00 13.51  ? 74  TYR A CA  1 
ATOM   528  C C   . TYR A 1 72  ? 37.507 15.747 44.770 1.00 22.29  ? 74  TYR A C   1 
ATOM   529  O O   . TYR A 1 72  ? 37.159 14.569 44.643 1.00 24.14  ? 74  TYR A O   1 
ATOM   530  C CB  . TYR A 1 72  ? 35.556 16.654 45.979 1.00 16.58  ? 74  TYR A CB  1 
ATOM   531  C CG  . TYR A 1 72  ? 34.916 17.955 46.463 1.00 15.17  ? 74  TYR A CG  1 
ATOM   532  C CD1 . TYR A 1 72  ? 33.939 18.563 45.694 1.00 12.46  ? 74  TYR A CD1 1 
ATOM   533  C CD2 . TYR A 1 72  ? 35.338 18.554 47.631 1.00 15.52  ? 74  TYR A CD2 1 
ATOM   534  C CE1 . TYR A 1 72  ? 33.345 19.814 46.094 1.00 9.63   ? 74  TYR A CE1 1 
ATOM   535  C CE2 . TYR A 1 72  ? 34.807 19.788 48.068 1.00 18.94  ? 74  TYR A CE2 1 
ATOM   536  C CZ  . TYR A 1 72  ? 33.805 20.409 47.289 1.00 20.69  ? 74  TYR A CZ  1 
ATOM   537  O OH  . TYR A 1 72  ? 33.314 21.624 47.705 1.00 19.69  ? 74  TYR A OH  1 
ATOM   538  N N   . PRO A 1 73  ? 38.782 16.107 44.933 1.00 22.04  ? 75  PRO A N   1 
ATOM   539  C CA  . PRO A 1 73  ? 39.872 15.119 44.982 1.00 21.61  ? 75  PRO A CA  1 
ATOM   540  C C   . PRO A 1 73  ? 39.560 14.137 46.124 1.00 18.51  ? 75  PRO A C   1 
ATOM   541  O O   . PRO A 1 73  ? 38.924 14.476 47.110 1.00 16.50  ? 75  PRO A O   1 
ATOM   542  C CB  . PRO A 1 73  ? 41.108 15.957 45.311 1.00 21.90  ? 75  PRO A CB  1 
ATOM   543  C CG  . PRO A 1 73  ? 40.788 17.327 44.690 1.00 24.77  ? 75  PRO A CG  1 
ATOM   544  C CD  . PRO A 1 73  ? 39.302 17.485 44.991 1.00 17.60  ? 75  PRO A CD  1 
ATOM   545  N N   . ASP A 1 74  ? 40.090 12.913 46.014 1.00 19.22  ? 76  ASP A N   1 
ATOM   546  C CA  . ASP A 1 74  ? 39.805 11.918 47.022 1.00 18.23  ? 76  ASP A CA  1 
ATOM   547  C C   . ASP A 1 74  ? 40.123 12.404 48.475 1.00 18.65  ? 76  ASP A C   1 
ATOM   548  O O   . ASP A 1 74  ? 39.378 12.123 49.394 1.00 20.31  ? 76  ASP A O   1 
ATOM   549  C CB  . ASP A 1 74  ? 40.628 10.669 46.685 1.00 16.20  ? 76  ASP A CB  1 
ATOM   550  C CG  . ASP A 1 74  ? 40.392 9.554  47.699 1.00 28.85  ? 76  ASP A CG  1 
ATOM   551  O OD1 . ASP A 1 74  ? 39.359 8.872  47.634 1.00 37.81  ? 76  ASP A OD1 1 
ATOM   552  O OD2 . ASP A 1 74  ? 41.245 9.401  48.583 1.00 25.55  ? 76  ASP A OD2 1 
ATOM   553  N N   . HIS A 1 75  ? 41.246 13.119 48.657 1.00 21.83  ? 77  HIS A N   1 
ATOM   554  C CA  . HIS A 1 75  ? 41.667 13.542 49.991 1.00 21.92  ? 77  HIS A CA  1 
ATOM   555  C C   . HIS A 1 75  ? 40.787 14.628 50.586 1.00 26.19  ? 77  HIS A C   1 
ATOM   556  O O   . HIS A 1 75  ? 40.856 14.916 51.749 1.00 27.45  ? 77  HIS A O   1 
ATOM   557  C CB  . HIS A 1 75  ? 43.116 13.987 50.007 1.00 23.87  ? 77  HIS A CB  1 
ATOM   558  C CG  . HIS A 1 75  ? 43.366 15.298 49.345 1.00 21.93  ? 77  HIS A CG  1 
ATOM   559  N ND1 . HIS A 1 75  ? 43.523 15.429 47.975 1.00 24.37  ? 77  HIS A ND1 1 
ATOM   560  C CD2 . HIS A 1 75  ? 43.506 16.547 49.862 1.00 24.94  ? 77  HIS A CD2 1 
ATOM   561  C CE1 . HIS A 1 75  ? 43.755 16.695 47.686 1.00 25.59  ? 77  HIS A CE1 1 
ATOM   562  N NE2 . HIS A 1 75  ? 43.750 17.391 48.808 1.00 24.48  ? 77  HIS A NE2 1 
ATOM   563  N N   . MET A 1 76  ? 39.946 15.213 49.747 1.00 16.45  ? 78  MET A N   1 
ATOM   564  C CA  . MET A 1 76  ? 39.036 16.268 50.188 1.00 17.71  ? 78  MET A CA  1 
ATOM   565  C C   . MET A 1 76  ? 37.543 15.884 50.180 1.00 22.58  ? 78  MET A C   1 
ATOM   566  O O   . MET A 1 76  ? 36.688 16.748 50.431 1.00 25.57  ? 78  MET A O   1 
ATOM   567  C CB  . MET A 1 76  ? 39.201 17.492 49.243 1.00 16.58  ? 78  MET A CB  1 
ATOM   568  C CG  . MET A 1 76  ? 40.445 18.306 49.458 1.00 19.54  ? 78  MET A CG  1 
ATOM   569  S SD  . MET A 1 76  ? 40.426 19.631 48.172 1.00 23.30  ? 78  MET A SD  1 
ATOM   570  C CE  . MET A 1 76  ? 39.206 20.754 48.838 1.00 20.66  ? 78  MET A CE  1 
ATOM   571  N N   . LYS A 1 77  ? 37.209 14.612 49.900 1.00 19.22  ? 79  LYS A N   1 
ATOM   572  C CA  . LYS A 1 77  ? 35.801 14.228 49.826 1.00 21.60  ? 79  LYS A CA  1 
ATOM   573  C C   . LYS A 1 77  ? 34.944 14.506 51.054 1.00 22.02  ? 79  LYS A C   1 
ATOM   574  O O   . LYS A 1 77  ? 33.731 14.649 50.934 1.00 19.02  ? 79  LYS A O   1 
ATOM   575  C CB  . LYS A 1 77  ? 35.662 12.756 49.456 1.00 39.28  ? 79  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 77  ? 36.030 12.485 48.010 1.00 59.84  ? 79  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 77  ? 35.399 11.208 47.508 1.00 52.31  ? 79  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 77  ? 36.017 10.787 46.200 1.00 82.94  ? 79  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 77  ? 36.126 11.971 45.320 1.00 30.25  ? 79  LYS A NZ  1 
ATOM   580  N N   . GLN A 1 78  ? 35.554 14.590 52.249 1.00 23.35  ? 80  GLN A N   1 
ATOM   581  C CA  . GLN A 1 78  ? 34.707 14.824 53.441 1.00 24.09  ? 80  GLN A CA  1 
ATOM   582  C C   . GLN A 1 78  ? 34.298 16.291 53.552 1.00 25.70  ? 80  GLN A C   1 
ATOM   583  O O   . GLN A 1 78  ? 33.622 16.706 54.516 1.00 22.12  ? 80  GLN A O   1 
ATOM   584  C CB  . GLN A 1 78  ? 35.439 14.371 54.709 1.00 81.77  ? 80  GLN A CB  1 
ATOM   585  C CG  . GLN A 1 78  ? 36.658 15.184 55.090 1.00 94.36  ? 80  GLN A CG  1 
ATOM   586  C CD  . GLN A 1 78  ? 37.661 14.259 55.785 1.00 77.23  ? 80  GLN A CD  1 
ATOM   587  N N   . HIS A 1 79  ? 34.741 17.115 52.553 1.00 17.40  ? 81  HIS A N   1 
ATOM   588  C CA  . HIS A 1 79  ? 34.448 18.537 52.523 1.00 19.61  ? 81  HIS A CA  1 
ATOM   589  C C   . HIS A 1 79  ? 33.406 18.913 51.448 1.00 20.95  ? 81  HIS A C   1 
ATOM   590  O O   . HIS A 1 79  ? 33.170 20.123 51.177 1.00 16.71  ? 81  HIS A O   1 
ATOM   591  C CB  . HIS A 1 79  ? 35.746 19.314 52.251 1.00 18.21  ? 81  HIS A CB  1 
ATOM   592  C CG  . HIS A 1 79  ? 36.752 19.154 53.341 1.00 23.30  ? 81  HIS A CG  1 
ATOM   593  N ND1 . HIS A 1 79  ? 36.617 19.769 54.571 1.00 26.67  ? 81  HIS A ND1 1 
ATOM   594  C CD2 . HIS A 1 79  ? 37.836 18.345 53.439 1.00 23.11  ? 81  HIS A CD2 1 
ATOM   595  C CE1 . HIS A 1 79  ? 37.572 19.347 55.379 1.00 23.63  ? 81  HIS A CE1 1 
ATOM   596  N NE2 . HIS A 1 79  ? 38.327 18.480 54.720 1.00 23.07  ? 81  HIS A NE2 1 
ATOM   597  N N   . ASP A 1 80  ? 32.804 17.900 50.849 1.00 16.51  ? 82  ASP A N   1 
ATOM   598  C CA  . ASP A 1 80  ? 31.836 18.125 49.729 1.00 14.82  ? 82  ASP A CA  1 
ATOM   599  C C   . ASP A 1 80  ? 30.397 18.207 50.229 1.00 23.85  ? 82  ASP A C   1 
ATOM   600  O O   . ASP A 1 80  ? 29.619 17.247 50.187 1.00 14.24  ? 82  ASP A O   1 
ATOM   601  C CB  . ASP A 1 80  ? 32.008 16.986 48.694 1.00 17.26  ? 82  ASP A CB  1 
ATOM   602  C CG  . ASP A 1 80  ? 31.168 17.197 47.423 1.00 16.18  ? 82  ASP A CG  1 
ATOM   603  O OD1 . ASP A 1 80  ? 30.309 18.135 47.370 1.00 20.06  ? 82  ASP A OD1 1 
ATOM   604  O OD2 . ASP A 1 80  ? 31.368 16.373 46.482 1.00 12.93  ? 82  ASP A OD2 1 
ATOM   605  N N   . PHE A 1 81  ? 30.046 19.376 50.725 1.00 16.38  ? 83  PHE A N   1 
ATOM   606  C CA  . PHE A 1 81  ? 28.695 19.608 51.215 1.00 13.88  ? 83  PHE A CA  1 
ATOM   607  C C   . PHE A 1 81  ? 27.623 19.341 50.146 1.00 13.92  ? 83  PHE A C   1 
ATOM   608  O O   . PHE A 1 81  ? 26.543 18.795 50.423 1.00 13.64  ? 83  PHE A O   1 
ATOM   609  C CB  . PHE A 1 81  ? 28.582 21.088 51.607 1.00 18.79  ? 83  PHE A CB  1 
ATOM   610  C CG  . PHE A 1 81  ? 27.158 21.568 51.762 1.00 19.18  ? 83  PHE A CG  1 
ATOM   611  C CD1 . PHE A 1 81  ? 26.503 21.452 52.964 1.00 19.16  ? 83  PHE A CD1 1 
ATOM   612  C CD2 . PHE A 1 81  ? 26.483 22.126 50.687 1.00 19.73  ? 83  PHE A CD2 1 
ATOM   613  C CE1 . PHE A 1 81  ? 25.149 21.893 53.100 1.00 22.98  ? 83  PHE A CE1 1 
ATOM   614  C CE2 . PHE A 1 81  ? 25.165 22.565 50.799 1.00 20.64  ? 83  PHE A CE2 1 
ATOM   615  C CZ  . PHE A 1 81  ? 24.501 22.444 52.003 1.00 23.63  ? 83  PHE A CZ  1 
ATOM   616  N N   . PHE A 1 82  ? 27.930 19.746 48.912 1.00 12.59  ? 84  PHE A N   1 
ATOM   617  C CA  . PHE A 1 82  ? 26.936 19.677 47.856 1.00 10.16  ? 84  PHE A CA  1 
ATOM   618  C C   . PHE A 1 82  ? 26.346 18.316 47.570 1.00 28.11  ? 84  PHE A C   1 
ATOM   619  O O   . PHE A 1 82  ? 25.139 18.163 47.424 1.00 21.58  ? 84  PHE A O   1 
ATOM   620  C CB  . PHE A 1 82  ? 27.525 20.209 46.568 1.00 8.54   ? 84  PHE A CB  1 
ATOM   621  C CG  . PHE A 1 82  ? 28.064 21.620 46.694 1.00 14.29  ? 84  PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 82  ? 27.222 22.722 46.684 1.00 17.99  ? 84  PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 82  ? 29.443 21.813 46.764 1.00 12.67  ? 84  PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 82  ? 27.764 24.045 46.745 1.00 18.57  ? 84  PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 82  ? 29.981 23.084 46.823 1.00 13.80  ? 84  PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 82  ? 29.116 24.217 46.811 1.00 15.15  ? 84  PHE A CZ  1 
ATOM   627  N N   . LYS A 1 83  ? 27.222 17.328 47.426 1.00 19.39  ? 85  LYS A N   1 
ATOM   628  C CA  . LYS A 1 83  ? 26.747 15.982 47.139 1.00 15.47  ? 85  LYS A CA  1 
ATOM   629  C C   . LYS A 1 83  ? 26.160 15.366 48.432 1.00 14.45  ? 85  LYS A C   1 
ATOM   630  O O   . LYS A 1 83  ? 25.203 14.551 48.343 1.00 16.05  ? 85  LYS A O   1 
ATOM   631  C CB  . LYS A 1 83  ? 27.899 15.070 46.644 1.00 17.79  ? 85  LYS A CB  1 
ATOM   632  C CG  . LYS A 1 83  ? 28.477 15.506 45.272 1.00 14.09  ? 85  LYS A CG  1 
ATOM   633  C CD  . LYS A 1 83  ? 29.466 14.409 44.735 1.00 14.46  ? 85  LYS A CD  1 
ATOM   634  C CE  . LYS A 1 83  ? 30.254 14.962 43.463 1.00 11.34  ? 85  LYS A CE  1 
ATOM   635  N NZ  . LYS A 1 83  ? 30.965 16.214 43.834 1.00 15.45  ? 85  LYS A NZ  1 
ATOM   636  N N   . SER A 1 84  ? 26.668 15.827 49.602 1.00 14.03  ? 86  SER A N   1 
ATOM   637  C CA  . SER A 1 84  ? 26.226 15.228 50.881 1.00 14.44  ? 86  SER A CA  1 
ATOM   638  C C   . SER A 1 84  ? 24.747 15.532 51.159 1.00 30.83  ? 86  SER A C   1 
ATOM   639  O O   . SER A 1 84  ? 24.082 14.799 51.892 1.00 24.78  ? 86  SER A O   1 
ATOM   640  C CB  . SER A 1 84  ? 27.111 15.721 52.077 1.00 17.20  ? 86  SER A CB  1 
ATOM   641  O OG  . SER A 1 84  ? 26.680 17.002 52.536 1.00 19.37  ? 86  SER A OG  1 
ATOM   642  N N   . ALA A 1 85  ? 24.222 16.598 50.542 1.00 21.89  ? 87  ALA A N   1 
ATOM   643  C CA  . ALA A 1 85  ? 22.814 17.004 50.742 1.00 21.38  ? 87  ALA A CA  1 
ATOM   644  C C   . ALA A 1 85  ? 21.813 16.267 49.862 1.00 22.28  ? 87  ALA A C   1 
ATOM   645  O O   . ALA A 1 85  ? 20.587 16.436 50.022 1.00 21.46  ? 87  ALA A O   1 
ATOM   646  C CB  . ALA A 1 85  ? 22.659 18.580 50.478 1.00 17.69  ? 87  ALA A CB  1 
ATOM   647  N N   . MET A 1 86  ? 22.318 15.423 48.923 1.00 14.14  ? 88  MET A N   1 
ATOM   648  C CA  . MET A 1 86  ? 21.453 14.755 47.932 1.00 13.06  ? 88  MET A CA  1 
ATOM   649  C C   . MET A 1 86  ? 20.972 13.406 48.489 1.00 23.54  ? 88  MET A C   1 
ATOM   650  O O   . MET A 1 86  ? 21.612 12.852 49.344 1.00 27.76  ? 88  MET A O   1 
ATOM   651  C CB  . MET A 1 86  ? 22.286 14.543 46.663 1.00 13.85  ? 88  MET A CB  1 
ATOM   652  C CG  . MET A 1 86  ? 22.723 15.868 46.079 1.00 15.69  ? 88  MET A CG  1 
ATOM   653  S SD  . MET A 1 86  ? 21.194 16.663 45.378 1.00 21.77  ? 88  MET A SD  1 
ATOM   654  C CE  . MET A 1 86  ? 21.885 18.460 45.175 1.00 21.56  ? 88  MET A CE  1 
ATOM   655  N N   . PRO A 1 87  ? 19.861 12.860 47.956 1.00 20.82  ? 89  PRO A N   1 
ATOM   656  C CA  . PRO A 1 87  ? 19.036 13.404 46.865 1.00 22.10  ? 89  PRO A CA  1 
ATOM   657  C C   . PRO A 1 87  ? 18.017 14.466 47.228 1.00 16.78  ? 89  PRO A C   1 
ATOM   658  O O   . PRO A 1 87  ? 17.454 15.095 46.314 1.00 21.47  ? 89  PRO A O   1 
ATOM   659  C CB  . PRO A 1 87  ? 18.346 12.160 46.261 1.00 26.38  ? 89  PRO A CB  1 
ATOM   660  C CG  . PRO A 1 87  ? 18.174 11.254 47.513 1.00 28.20  ? 89  PRO A CG  1 
ATOM   661  C CD  . PRO A 1 87  ? 19.475 11.472 48.315 1.00 25.28  ? 89  PRO A CD  1 
ATOM   662  N N   . GLU A 1 88  ? 17.812 14.695 48.581 1.00 15.55  ? 90  GLU A N   1 
ATOM   663  C CA  . GLU A 1 88  ? 16.776 15.643 48.990 1.00 20.54  ? 90  GLU A CA  1 
ATOM   664  C C   . GLU A 1 88  ? 17.096 16.980 48.429 1.00 29.68  ? 90  GLU A C   1 
ATOM   665  O O   . GLU A 1 88  ? 16.197 17.679 48.017 1.00 27.76  ? 90  GLU A O   1 
ATOM   666  C CB  . GLU A 1 88  ? 16.616 15.708 50.508 1.00 27.64  ? 90  GLU A CB  1 
ATOM   667  C CG  . GLU A 1 88  ? 16.336 14.344 51.139 1.00 41.52  ? 90  GLU A CG  1 
ATOM   668  C CD  . GLU A 1 88  ? 17.555 13.818 51.893 1.00 82.02  ? 90  GLU A CD  1 
ATOM   669  O OE1 . GLU A 1 88  ? 18.629 13.624 51.262 1.00 52.08  ? 90  GLU A OE1 1 
ATOM   670  O OE2 . GLU A 1 88  ? 17.438 13.613 53.123 1.00 99.21  ? 90  GLU A OE2 1 
ATOM   671  N N   . GLY A 1 89  ? 18.404 17.337 48.402 1.00 20.68  ? 91  GLY A N   1 
ATOM   672  C CA  . GLY A 1 89  ? 18.770 18.594 47.777 1.00 18.59  ? 91  GLY A CA  1 
ATOM   673  C C   . GLY A 1 89  ? 19.133 19.730 48.698 1.00 18.07  ? 91  GLY A C   1 
ATOM   674  O O   . GLY A 1 89  ? 19.220 19.564 49.880 1.00 16.20  ? 91  GLY A O   1 
ATOM   675  N N   . TYR A 1 90  ? 19.410 20.910 48.118 1.00 14.90  ? 92  TYR A N   1 
ATOM   676  C CA  . TYR A 1 90  ? 19.706 22.087 48.900 1.00 11.70  ? 92  TYR A CA  1 
ATOM   677  C C   . TYR A 1 90  ? 19.134 23.338 48.245 1.00 13.12  ? 92  TYR A C   1 
ATOM   678  O O   . TYR A 1 90  ? 18.779 23.339 47.050 1.00 16.72  ? 92  TYR A O   1 
ATOM   679  C CB  . TYR A 1 90  ? 21.220 22.297 49.118 1.00 14.83  ? 92  TYR A CB  1 
ATOM   680  C CG  . TYR A 1 90  ? 22.073 22.306 47.832 1.00 15.93  ? 92  TYR A CG  1 
ATOM   681  C CD1 . TYR A 1 90  ? 22.086 23.396 46.968 1.00 18.72  ? 92  TYR A CD1 1 
ATOM   682  C CD2 . TYR A 1 90  ? 22.839 21.195 47.502 1.00 13.52  ? 92  TYR A CD2 1 
ATOM   683  C CE1 . TYR A 1 90  ? 22.884 23.366 45.780 1.00 11.99  ? 92  TYR A CE1 1 
ATOM   684  C CE2 . TYR A 1 90  ? 23.607 21.168 46.332 1.00 11.35  ? 92  TYR A CE2 1 
ATOM   685  C CZ  . TYR A 1 90  ? 23.625 22.270 45.475 1.00 23.16  ? 92  TYR A CZ  1 
ATOM   686  O OH  . TYR A 1 90  ? 24.419 22.254 44.337 1.00 18.35  ? 92  TYR A OH  1 
ATOM   687  N N   . VAL A 1 91  ? 18.943 24.397 49.112 1.00 14.29  ? 93  VAL A N   1 
ATOM   688  C CA  . VAL A 1 91  ? 18.470 25.656 48.634 1.00 15.55  ? 93  VAL A CA  1 
ATOM   689  C C   . VAL A 1 91  ? 19.722 26.488 48.379 1.00 15.48  ? 93  VAL A C   1 
ATOM   690  O O   . VAL A 1 91  ? 20.681 26.466 49.137 1.00 18.25  ? 93  VAL A O   1 
ATOM   691  C CB  . VAL A 1 91  ? 17.602 26.351 49.680 1.00 22.32  ? 93  VAL A CB  1 
ATOM   692  C CG1 . VAL A 1 91  ? 17.105 27.696 49.147 1.00 23.07  ? 93  VAL A CG1 1 
ATOM   693  C CG2 . VAL A 1 91  ? 16.375 25.451 49.938 1.00 23.81  ? 93  VAL A CG2 1 
ATOM   694  N N   . GLN A 1 92  ? 19.723 27.189 47.286 1.00 12.34  ? 94  GLN A N   1 
ATOM   695  C CA  . GLN A 1 92  ? 20.887 28.030 46.966 1.00 11.08  ? 94  GLN A CA  1 
ATOM   696  C C   . GLN A 1 92  ? 20.358 29.412 46.725 1.00 17.19  ? 94  GLN A C   1 
ATOM   697  O O   . GLN A 1 92  ? 19.564 29.607 45.831 1.00 17.15  ? 94  GLN A O   1 
ATOM   698  C CB  . GLN A 1 92  ? 21.592 27.530 45.667 1.00 10.44  ? 94  GLN A CB  1 
ATOM   699  C CG  . GLN A 1 92  ? 22.752 28.470 45.287 1.00 14.66  ? 94  GLN A CG  1 
ATOM   700  C CD  . GLN A 1 92  ? 23.774 27.779 44.416 1.00 11.55  ? 94  GLN A CD  1 
ATOM   701  O OE1 . GLN A 1 92  ? 24.295 26.708 44.796 1.00 15.88  ? 94  GLN A OE1 1 
ATOM   702  N NE2 . GLN A 1 92  ? 24.082 28.379 43.225 1.00 10.06  ? 94  GLN A NE2 1 
ATOM   703  N N   . GLU A 1 93  ? 20.779 30.361 47.592 1.00 9.87   ? 95  GLU A N   1 
ATOM   704  C CA  . GLU A 1 93  ? 20.335 31.744 47.412 1.00 8.92   ? 95  GLU A CA  1 
ATOM   705  C C   . GLU A 1 93  ? 21.547 32.624 47.153 1.00 18.84  ? 95  GLU A C   1 
ATOM   706  O O   . GLU A 1 93  ? 22.607 32.334 47.632 1.00 17.52  ? 95  GLU A O   1 
ATOM   707  C CB  . GLU A 1 93  ? 19.631 32.274 48.658 1.00 18.50  ? 95  GLU A CB  1 
ATOM   708  C CG  . GLU A 1 93  ? 18.548 31.366 49.131 1.00 31.11  ? 95  GLU A CG  1 
ATOM   709  C CD  . GLU A 1 93  ? 18.011 31.796 50.493 1.00 37.72  ? 95  GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 93  ? 17.140 32.667 50.476 1.00 28.51  ? 95  GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 93  ? 18.458 31.287 51.554 1.00 51.85  ? 95  GLU A OE2 1 
ATOM   712  N N   . ARG A 1 94  ? 21.371 33.686 46.351 1.00 14.02  ? 96  ARG A N   1 
ATOM   713  C CA  . ARG A 1 94  ? 22.435 34.646 46.110 1.00 14.60  ? 96  ARG A CA  1 
ATOM   714  C C   . ARG A 1 94  ? 21.929 36.094 45.986 1.00 14.15  ? 96  ARG A C   1 
ATOM   715  O O   . ARG A 1 94  ? 20.735 36.313 45.650 1.00 12.07  ? 96  ARG A O   1 
ATOM   716  C CB  . ARG A 1 94  ? 23.125 34.403 44.737 1.00 17.88  ? 96  ARG A CB  1 
ATOM   717  C CG  . ARG A 1 94  ? 23.803 33.069 44.558 1.00 22.53  ? 96  ARG A CG  1 
ATOM   718  C CD  . ARG A 1 94  ? 25.052 33.332 43.693 1.00 12.58  ? 96  ARG A CD  1 
ATOM   719  N NE  . ARG A 1 94  ? 25.975 32.188 43.604 1.00 14.03  ? 96  ARG A NE  1 
ATOM   720  C CZ  . ARG A 1 94  ? 25.899 31.253 42.650 1.00 25.78  ? 96  ARG A CZ  1 
ATOM   721  N NH1 . ARG A 1 94  ? 24.949 31.343 41.749 1.00 12.48  ? 96  ARG A NH1 1 
ATOM   722  N NH2 . ARG A 1 94  ? 26.817 30.269 42.563 1.00 12.41  ? 96  ARG A NH2 1 
ATOM   723  N N   . THR A 1 95  ? 22.843 37.061 46.259 1.00 12.80  ? 97  THR A N   1 
ATOM   724  C CA  . THR A 1 95  ? 22.593 38.456 45.819 1.00 14.99  ? 97  THR A CA  1 
ATOM   725  C C   . THR A 1 95  ? 23.846 38.663 44.960 1.00 15.47  ? 97  THR A C   1 
ATOM   726  O O   . THR A 1 95  ? 24.947 38.290 45.397 1.00 14.11  ? 97  THR A O   1 
ATOM   727  C CB  . THR A 1 95  ? 22.597 39.420 46.957 1.00 24.07  ? 97  THR A CB  1 
ATOM   728  O OG1 . THR A 1 95  ? 21.480 39.132 47.796 1.00 28.62  ? 97  THR A OG1 1 
ATOM   729  C CG2 . THR A 1 95  ? 22.409 40.851 46.423 1.00 12.32  ? 97  THR A CG2 1 
ATOM   730  N N   . ILE A 1 96  ? 23.703 39.243 43.767 1.00 13.10  ? 98  ILE A N   1 
ATOM   731  C CA  . ILE A 1 96  ? 24.820 39.424 42.881 1.00 13.60  ? 98  ILE A CA  1 
ATOM   732  C C   . ILE A 1 96  ? 24.792 40.880 42.626 1.00 18.96  ? 98  ILE A C   1 
ATOM   733  O O   . ILE A 1 96  ? 23.812 41.376 42.100 1.00 11.08  ? 98  ILE A O   1 
ATOM   734  C CB  . ILE A 1 96  ? 24.619 38.678 41.547 1.00 13.09  ? 98  ILE A CB  1 
ATOM   735  C CG1 . ILE A 1 96  ? 24.642 37.165 41.784 1.00 15.80  ? 98  ILE A CG1 1 
ATOM   736  C CG2 . ILE A 1 96  ? 25.784 39.033 40.594 1.00 11.11  ? 98  ILE A CG2 1 
ATOM   737  C CD1 . ILE A 1 96  ? 24.206 36.407 40.513 1.00 14.23  ? 98  ILE A CD1 1 
ATOM   738  N N   . PHE A 1 97  ? 25.830 41.601 43.046 1.00 13.36  ? 99  PHE A N   1 
ATOM   739  C CA  . PHE A 1 97  ? 25.842 43.055 42.855 1.00 9.04   ? 99  PHE A CA  1 
ATOM   740  C C   . PHE A 1 97  ? 26.689 43.438 41.650 1.00 12.96  ? 99  PHE A C   1 
ATOM   741  O O   . PHE A 1 97  ? 27.887 43.202 41.653 1.00 15.62  ? 99  PHE A O   1 
ATOM   742  C CB  . PHE A 1 97  ? 26.484 43.708 44.070 1.00 12.45  ? 99  PHE A CB  1 
ATOM   743  C CG  . PHE A 1 97  ? 25.702 43.542 45.340 1.00 19.34  ? 99  PHE A CG  1 
ATOM   744  C CD1 . PHE A 1 97  ? 26.000 42.521 46.222 1.00 21.57  ? 99  PHE A CD1 1 
ATOM   745  C CD2 . PHE A 1 97  ? 24.691 44.451 45.668 1.00 22.01  ? 99  PHE A CD2 1 
ATOM   746  C CE1 . PHE A 1 97  ? 25.310 42.385 47.442 1.00 26.56  ? 99  PHE A CE1 1 
ATOM   747  C CE2 . PHE A 1 97  ? 23.990 44.314 46.907 1.00 22.11  ? 99  PHE A CE2 1 
ATOM   748  C CZ  . PHE A 1 97  ? 24.312 43.297 47.756 1.00 23.71  ? 99  PHE A CZ  1 
ATOM   749  N N   . PHE A 1 98  ? 26.079 44.020 40.634 1.00 14.00  ? 100 PHE A N   1 
ATOM   750  C CA  . PHE A 1 98  ? 26.892 44.451 39.491 1.00 10.22  ? 100 PHE A CA  1 
ATOM   751  C C   . PHE A 1 98  ? 27.447 45.828 39.810 1.00 22.13  ? 100 PHE A C   1 
ATOM   752  O O   . PHE A 1 98  ? 26.698 46.760 40.088 1.00 16.51  ? 100 PHE A O   1 
ATOM   753  C CB  . PHE A 1 98  ? 26.066 44.456 38.189 1.00 8.48   ? 100 PHE A CB  1 
ATOM   754  C CG  . PHE A 1 98  ? 25.738 43.049 37.713 1.00 14.33  ? 100 PHE A CG  1 
ATOM   755  C CD1 . PHE A 1 98  ? 24.617 42.373 38.201 1.00 16.93  ? 100 PHE A CD1 1 
ATOM   756  C CD2 . PHE A 1 98  ? 26.609 42.381 36.860 1.00 18.10  ? 100 PHE A CD2 1 
ATOM   757  C CE1 . PHE A 1 98  ? 24.348 41.003 37.838 1.00 14.99  ? 100 PHE A CE1 1 
ATOM   758  C CE2 . PHE A 1 98  ? 26.380 41.033 36.488 1.00 25.90  ? 100 PHE A CE2 1 
ATOM   759  C CZ  . PHE A 1 98  ? 25.268 40.351 36.966 1.00 20.96  ? 100 PHE A CZ  1 
ATOM   760  N N   . LYS A 1 99  ? 28.778 45.959 39.770 1.00 17.39  ? 101 LYS A N   1 
ATOM   761  C CA  . LYS A 1 99  ? 29.405 47.223 40.157 1.00 15.68  ? 101 LYS A CA  1 
ATOM   762  C C   . LYS A 1 99  ? 28.857 48.352 39.316 1.00 15.80  ? 101 LYS A C   1 
ATOM   763  O O   . LYS A 1 99  ? 28.749 48.243 38.074 1.00 16.12  ? 101 LYS A O   1 
ATOM   764  C CB  . LYS A 1 99  ? 30.930 47.169 40.025 1.00 32.89  ? 101 LYS A CB  1 
ATOM   765  C CG  . LYS A 1 99  ? 31.662 48.414 40.561 1.00 34.49  ? 101 LYS A CG  1 
ATOM   766  C CD  . LYS A 1 99  ? 33.167 48.176 40.554 1.00 55.16  ? 101 LYS A CD  1 
ATOM   767  C CE  . LYS A 1 99  ? 33.973 49.391 40.999 1.00 45.33  ? 101 LYS A CE  1 
ATOM   768  N NZ  . LYS A 1 99  ? 33.693 49.777 42.407 1.00 38.17  ? 101 LYS A NZ  1 
ATOM   769  N N   . ASP A 1 100 ? 28.521 49.494 40.004 1.00 18.83  ? 102 ASP A N   1 
ATOM   770  C CA  . ASP A 1 100 ? 27.969 50.658 39.295 1.00 20.07  ? 102 ASP A CA  1 
ATOM   771  C C   . ASP A 1 100 ? 26.711 50.365 38.481 1.00 27.90  ? 102 ASP A C   1 
ATOM   772  O O   . ASP A 1 100 ? 26.387 51.065 37.529 1.00 23.20  ? 102 ASP A O   1 
ATOM   773  C CB  . ASP A 1 100 ? 29.027 51.301 38.415 1.00 16.41  ? 102 ASP A CB  1 
ATOM   774  C CG  . ASP A 1 100 ? 30.197 51.816 39.231 1.00 47.54  ? 102 ASP A CG  1 
ATOM   775  O OD1 . ASP A 1 100 ? 29.959 52.317 40.353 1.00 46.70  ? 102 ASP A OD1 1 
ATOM   776  O OD2 . ASP A 1 100 ? 31.350 51.714 38.761 1.00 39.50  ? 102 ASP A OD2 1 
ATOM   777  N N   . ASP A 1 101 ? 25.958 49.337 38.892 1.00 17.92  ? 103 ASP A N   1 
ATOM   778  C CA  . ASP A 1 101 ? 24.723 48.991 38.198 1.00 13.50  ? 103 ASP A CA  1 
ATOM   779  C C   . ASP A 1 101 ? 23.793 48.295 39.183 1.00 18.37  ? 103 ASP A C   1 
ATOM   780  O O   . ASP A 1 101 ? 23.938 48.465 40.413 1.00 14.29  ? 103 ASP A O   1 
ATOM   781  C CB  . ASP A 1 101 ? 25.035 48.123 36.965 1.00 22.00  ? 103 ASP A CB  1 
ATOM   782  C CG  . ASP A 1 101 ? 24.048 48.326 35.828 1.00 29.25  ? 103 ASP A CG  1 
ATOM   783  O OD1 . ASP A 1 101 ? 22.906 48.706 36.079 1.00 23.65  ? 103 ASP A OD1 1 
ATOM   784  O OD2 . ASP A 1 101 ? 24.403 48.081 34.654 1.00 20.30  ? 103 ASP A OD2 1 
ATOM   785  N N   . GLY A 1 102 ? 22.828 47.488 38.646 1.00 15.26  ? 104 GLY A N   1 
ATOM   786  C CA  . GLY A 1 102 ? 21.824 46.826 39.494 1.00 19.32  ? 104 GLY A CA  1 
ATOM   787  C C   . GLY A 1 102 ? 22.270 45.536 40.183 1.00 17.85  ? 104 GLY A C   1 
ATOM   788  O O   . GLY A 1 102 ? 23.457 45.172 40.196 1.00 13.09  ? 104 GLY A O   1 
ATOM   789  N N   . ASN A 1 103 ? 21.300 44.818 40.781 1.00 11.06  ? 105 ASN A N   1 
ATOM   790  C CA  . ASN A 1 103 ? 21.649 43.533 41.442 1.00 10.21  ? 105 ASN A CA  1 
ATOM   791  C C   . ASN A 1 103 ? 20.609 42.477 41.138 1.00 23.00  ? 105 ASN A C   1 
ATOM   792  O O   . ASN A 1 103 ? 19.448 42.801 40.830 1.00 15.27  ? 105 ASN A O   1 
ATOM   793  C CB  . ASN A 1 103 ? 21.754 43.739 42.921 1.00 8.98   ? 105 ASN A CB  1 
ATOM   794  C CG  . ASN A 1 103 ? 20.461 44.217 43.563 1.00 38.41  ? 105 ASN A CG  1 
ATOM   795  O OD1 . ASN A 1 103 ? 19.571 43.431 43.841 1.00 29.26  ? 105 ASN A OD1 1 
ATOM   796  N ND2 . ASN A 1 103 ? 20.371 45.508 43.811 1.00 34.51  ? 105 ASN A ND2 1 
ATOM   797  N N   . TYR A 1 104 ? 21.063 41.202 41.133 1.00 16.49  ? 106 TYR A N   1 
ATOM   798  C CA  . TYR A 1 104 ? 20.127 40.102 40.968 1.00 11.59  ? 106 TYR A CA  1 
ATOM   799  C C   . TYR A 1 104 ? 20.043 39.445 42.375 1.00 12.00  ? 106 TYR A C   1 
ATOM   800  O O   . TYR A 1 104 ? 21.020 39.346 43.142 1.00 14.22  ? 106 TYR A O   1 
ATOM   801  C CB  . TYR A 1 104 ? 20.633 38.995 40.038 1.00 15.63  ? 106 TYR A CB  1 
ATOM   802  C CG  . TYR A 1 104 ? 20.892 39.302 38.577 1.00 14.00  ? 106 TYR A CG  1 
ATOM   803  C CD1 . TYR A 1 104 ? 20.239 40.339 37.910 1.00 14.04  ? 106 TYR A CD1 1 
ATOM   804  C CD2 . TYR A 1 104 ? 21.696 38.440 37.817 1.00 15.08  ? 106 TYR A CD2 1 
ATOM   805  C CE1 . TYR A 1 104 ? 20.349 40.504 36.550 1.00 11.71  ? 106 TYR A CE1 1 
ATOM   806  C CE2 . TYR A 1 104 ? 21.803 38.595 36.415 1.00 14.41  ? 106 TYR A CE2 1 
ATOM   807  C CZ  . TYR A 1 104 ? 21.131 39.629 35.787 1.00 22.83  ? 106 TYR A CZ  1 
ATOM   808  O OH  . TYR A 1 104 ? 21.280 39.811 34.402 1.00 17.29  ? 106 TYR A OH  1 
ATOM   809  N N   . LYS A 1 105 ? 18.864 38.961 42.668 1.00 12.96  ? 107 LYS A N   1 
ATOM   810  C CA  . LYS A 1 105 ? 18.639 38.214 43.888 1.00 11.43  ? 107 LYS A CA  1 
ATOM   811  C C   . LYS A 1 105 ? 18.081 36.919 43.328 1.00 21.54  ? 107 LYS A C   1 
ATOM   812  O O   . LYS A 1 105 ? 17.115 36.936 42.549 1.00 15.53  ? 107 LYS A O   1 
ATOM   813  C CB  . LYS A 1 105 ? 17.561 38.909 44.749 1.00 35.34  ? 107 LYS A CB  1 
ATOM   814  C CG  . LYS A 1 105 ? 18.077 39.708 45.953 1.00 49.04  ? 107 LYS A CG  1 
ATOM   815  C CD  . LYS A 1 105 ? 18.484 41.123 45.644 1.00 72.36  ? 107 LYS A CD  1 
ATOM   816  C CE  . LYS A 1 105 ? 18.345 42.028 46.896 1.00 40.80  ? 107 LYS A CE  1 
ATOM   817  N NZ  . LYS A 1 105 ? 19.237 41.694 48.063 1.00 40.80  ? 107 LYS A NZ  1 
ATOM   818  N N   . THR A 1 106 ? 18.639 35.763 43.732 1.00 15.75  ? 108 THR A N   1 
ATOM   819  C CA  . THR A 1 106 ? 18.147 34.501 43.163 1.00 16.32  ? 108 THR A CA  1 
ATOM   820  C C   . THR A 1 106 ? 17.873 33.504 44.301 1.00 16.26  ? 108 THR A C   1 
ATOM   821  O O   . THR A 1 106 ? 18.508 33.581 45.374 1.00 16.37  ? 108 THR A O   1 
ATOM   822  C CB  . THR A 1 106 ? 19.211 33.892 42.242 1.00 20.09  ? 108 THR A CB  1 
ATOM   823  O OG1 . THR A 1 106 ? 20.403 33.638 43.000 1.00 14.51  ? 108 THR A OG1 1 
ATOM   824  C CG2 . THR A 1 106 ? 19.538 34.880 41.068 1.00 12.25  ? 108 THR A CG2 1 
ATOM   825  N N   . ARG A 1 107 ? 16.902 32.617 44.059 1.00 15.08  ? 109 ARG A N   1 
ATOM   826  C CA  . ARG A 1 107 ? 16.593 31.565 45.045 1.00 11.10  ? 109 ARG A CA  1 
ATOM   827  C C   . ARG A 1 107 ? 16.402 30.344 44.159 1.00 13.96  ? 109 ARG A C   1 
ATOM   828  O O   . ARG A 1 107 ? 15.656 30.416 43.173 1.00 17.61  ? 109 ARG A O   1 
ATOM   829  C CB  . ARG A 1 107 ? 15.314 31.908 45.786 1.00 21.44  ? 109 ARG A CB  1 
ATOM   830  C CG  . ARG A 1 107 ? 14.945 30.798 46.766 1.00 23.81  ? 109 ARG A CG  1 
ATOM   831  C CD  . ARG A 1 107 ? 13.581 31.066 47.386 1.00 43.29  ? 109 ARG A CD  1 
ATOM   832  N NE  . ARG A 1 107 ? 12.955 29.766 47.476 1.00 56.10  ? 109 ARG A NE  1 
ATOM   833  C CZ  . ARG A 1 107 ? 13.256 28.905 48.427 1.00 75.53  ? 109 ARG A CZ  1 
ATOM   834  N NH1 . ARG A 1 107 ? 14.121 29.250 49.361 1.00 57.70  ? 109 ARG A NH1 1 
ATOM   835  N NH2 . ARG A 1 107 ? 12.799 27.671 48.371 1.00 31.34  ? 109 ARG A NH2 1 
ATOM   836  N N   . ALA A 1 108 ? 17.087 29.199 44.486 1.00 10.00  ? 110 ALA A N   1 
ATOM   837  C CA  . ALA A 1 108 ? 16.992 28.001 43.623 1.00 11.67  ? 110 ALA A CA  1 
ATOM   838  C C   . ALA A 1 108 ? 16.922 26.774 44.497 1.00 15.20  ? 110 ALA A C   1 
ATOM   839  O O   . ALA A 1 108 ? 17.393 26.814 45.616 1.00 19.86  ? 110 ALA A O   1 
ATOM   840  C CB  . ALA A 1 108 ? 18.267 27.869 42.715 1.00 16.85  ? 110 ALA A CB  1 
ATOM   841  N N   . GLU A 1 109 ? 16.277 25.690 43.987 1.00 16.53  ? 111 GLU A N   1 
ATOM   842  C CA  . GLU A 1 109 ? 16.241 24.458 44.740 1.00 15.88  ? 111 GLU A CA  1 
ATOM   843  C C   . GLU A 1 109 ? 16.947 23.506 43.800 1.00 12.27  ? 111 GLU A C   1 
ATOM   844  O O   . GLU A 1 109 ? 16.597 23.440 42.617 1.00 17.16  ? 111 GLU A O   1 
ATOM   845  C CB  . GLU A 1 109 ? 14.805 23.993 44.975 1.00 19.08  ? 111 GLU A CB  1 
ATOM   846  C CG  . GLU A 1 109 ? 14.213 24.614 46.208 1.00 35.29  ? 111 GLU A CG  1 
ATOM   847  C CD  . GLU A 1 109 ? 12.809 24.132 46.475 1.00 62.67  ? 111 GLU A CD  1 
ATOM   848  O OE1 . GLU A 1 109 ? 12.534 22.930 46.272 1.00 73.52  ? 111 GLU A OE1 1 
ATOM   849  O OE2 . GLU A 1 109 ? 11.986 24.972 46.895 1.00 53.37  ? 111 GLU A OE2 1 
ATOM   850  N N   . VAL A 1 110 ? 17.978 22.765 44.313 1.00 13.82  ? 112 VAL A N   1 
ATOM   851  C CA  . VAL A 1 110 ? 18.683 21.826 43.437 1.00 14.60  ? 112 VAL A CA  1 
ATOM   852  C C   . VAL A 1 110 ? 18.477 20.465 44.092 1.00 12.06  ? 112 VAL A C   1 
ATOM   853  O O   . VAL A 1 110 ? 18.782 20.317 45.290 1.00 15.94  ? 112 VAL A O   1 
ATOM   854  C CB  . VAL A 1 110 ? 20.138 22.160 43.396 1.00 26.78  ? 112 VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 110 ? 20.314 23.620 43.072 1.00 22.58  ? 112 VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 110 ? 20.711 21.908 44.699 1.00 25.03  ? 112 VAL A CG2 1 
ATOM   857  N N   . LYS A 1 111 ? 17.931 19.524 43.329 1.00 17.05  ? 113 LYS A N   1 
ATOM   858  C CA  . LYS A 1 111 ? 17.612 18.214 43.900 1.00 17.76  ? 113 LYS A CA  1 
ATOM   859  C C   . LYS A 1 111 ? 17.345 17.240 42.815 1.00 10.11  ? 113 LYS A C   1 
ATOM   860  O O   . LYS A 1 111 ? 17.150 17.593 41.632 1.00 19.65  ? 113 LYS A O   1 
ATOM   861  C CB  . LYS A 1 111 ? 16.341 18.336 44.735 1.00 22.31  ? 113 LYS A CB  1 
ATOM   862  C CG  . LYS A 1 111 ? 15.112 18.721 43.937 1.00 38.04  ? 113 LYS A CG  1 
ATOM   863  C CD  . LYS A 1 111 ? 13.834 18.237 44.632 1.00 55.62  ? 113 LYS A CD  1 
ATOM   864  C CE  . LYS A 1 111 ? 13.029 19.334 45.296 1.00 56.16  ? 113 LYS A CE  1 
ATOM   865  N NZ  . LYS A 1 111 ? 11.804 18.699 45.967 1.00 28.35  ? 113 LYS A NZ  1 
ATOM   866  N N   . PHE A 1 112 ? 17.261 15.962 43.186 1.00 15.54  ? 114 PHE A N   1 
ATOM   867  C CA  . PHE A 1 112 ? 16.954 14.944 42.177 1.00 16.73  ? 114 PHE A CA  1 
ATOM   868  C C   . PHE A 1 112 ? 15.439 14.783 42.051 1.00 21.40  ? 114 PHE A C   1 
ATOM   869  O O   . PHE A 1 112 ? 14.702 14.898 43.026 1.00 21.48  ? 114 PHE A O   1 
ATOM   870  C CB  . PHE A 1 112 ? 17.544 13.597 42.607 1.00 18.16  ? 114 PHE A CB  1 
ATOM   871  C CG  . PHE A 1 112 ? 18.953 13.398 42.150 1.00 20.24  ? 114 PHE A CG  1 
ATOM   872  C CD1 . PHE A 1 112 ? 19.211 12.843 40.903 1.00 23.01  ? 114 PHE A CD1 1 
ATOM   873  C CD2 . PHE A 1 112 ? 20.012 13.774 42.959 1.00 19.53  ? 114 PHE A CD2 1 
ATOM   874  C CE1 . PHE A 1 112 ? 20.528 12.644 40.451 1.00 24.99  ? 114 PHE A CE1 1 
ATOM   875  C CE2 . PHE A 1 112 ? 21.373 13.583 42.530 1.00 23.05  ? 114 PHE A CE2 1 
ATOM   876  C CZ  . PHE A 1 112 ? 21.611 13.020 41.284 1.00 22.35  ? 114 PHE A CZ  1 
ATOM   877  N N   . GLU A 1 113 ? 14.990 14.552 40.824 1.00 19.53  ? 115 GLU A N   1 
ATOM   878  C CA  . GLU A 1 113 ? 13.597 14.245 40.504 1.00 16.97  ? 115 GLU A CA  1 
ATOM   879  C C   . GLU A 1 113 ? 13.829 12.972 39.735 1.00 20.74  ? 115 GLU A C   1 
ATOM   880  O O   . GLU A 1 113 ? 14.153 13.000 38.516 1.00 22.55  ? 115 GLU A O   1 
ATOM   881  C CB  . GLU A 1 113 ? 12.991 15.321 39.588 1.00 14.04  ? 115 GLU A CB  1 
ATOM   882  C CG  . GLU A 1 113 ? 12.564 16.593 40.325 1.00 21.43  ? 115 GLU A CG  1 
ATOM   883  C CD  . GLU A 1 113 ? 11.423 16.342 41.330 1.00 32.93  ? 115 GLU A CD  1 
ATOM   884  O OE1 . GLU A 1 113 ? 10.920 15.207 41.430 1.00 76.06  ? 115 GLU A OE1 1 
ATOM   885  O OE2 . GLU A 1 113 ? 11.063 17.337 42.010 1.00 32.27  ? 115 GLU A OE2 1 
ATOM   886  N N   . GLY A 1 114 ? 13.692 11.820 40.440 1.00 20.76  ? 116 GLY A N   1 
ATOM   887  C CA  . GLY A 1 114 ? 13.935 10.573 39.733 1.00 20.83  ? 116 GLY A CA  1 
ATOM   888  C C   . GLY A 1 114 ? 15.442 10.523 39.497 1.00 22.64  ? 116 GLY A C   1 
ATOM   889  O O   . GLY A 1 114 ? 16.194 10.759 40.429 1.00 22.91  ? 116 GLY A O   1 
ATOM   890  N N   . ASP A 1 115 ? 15.932 10.211 38.294 1.00 26.20  ? 117 ASP A N   1 
ATOM   891  C CA  . ASP A 1 115 ? 17.391 10.206 38.228 1.00 32.83  ? 117 ASP A CA  1 
ATOM   892  C C   . ASP A 1 115 ? 17.901 11.422 37.495 1.00 27.71  ? 117 ASP A C   1 
ATOM   893  O O   . ASP A 1 115 ? 18.988 11.405 36.997 1.00 21.55  ? 117 ASP A O   1 
ATOM   894  C CB  . ASP A 1 115 ? 17.984 8.925  37.625 1.00 48.49  ? 117 ASP A CB  1 
ATOM   895  C CG  . ASP A 1 115 ? 17.134 8.331  36.577 1.00 73.29  ? 117 ASP A CG  1 
ATOM   896  O OD1 . ASP A 1 115 ? 16.905 9.014  35.560 1.00 74.35  ? 117 ASP A OD1 1 
ATOM   897  O OD2 . ASP A 1 115 ? 16.704 7.175  36.778 1.00 89.46  ? 117 ASP A OD2 1 
ATOM   898  N N   . THR A 1 116 ? 17.094 12.474 37.478 1.00 19.29  ? 118 THR A N   1 
ATOM   899  C CA  . THR A 1 116 ? 17.490 13.744 36.822 1.00 18.66  ? 118 THR A CA  1 
ATOM   900  C C   . THR A 1 116 ? 17.806 14.770 37.888 1.00 20.92  ? 118 THR A C   1 
ATOM   901  O O   . THR A 1 116 ? 17.049 14.912 38.819 1.00 18.91  ? 118 THR A O   1 
ATOM   902  C CB  . THR A 1 116 ? 16.359 14.274 35.984 1.00 24.56  ? 118 THR A CB  1 
ATOM   903  O OG1 . THR A 1 116 ? 15.980 13.273 35.053 1.00 26.03  ? 118 THR A OG1 1 
ATOM   904  C CG2 . THR A 1 116 ? 16.780 15.480 35.232 1.00 20.16  ? 118 THR A CG2 1 
ATOM   905  N N   . LEU A 1 117 ? 18.987 15.448 37.777 1.00 17.85  ? 119 LEU A N   1 
ATOM   906  C CA  . LEU A 1 117 ? 19.344 16.490 38.762 1.00 14.14  ? 119 LEU A CA  1 
ATOM   907  C C   . LEU A 1 117 ? 18.679 17.759 38.211 1.00 11.25  ? 119 LEU A C   1 
ATOM   908  O O   . LEU A 1 117 ? 18.932 18.185 37.042 1.00 15.91  ? 119 LEU A O   1 
ATOM   909  C CB  . LEU A 1 117 ? 20.860 16.644 38.818 1.00 17.95  ? 119 LEU A CB  1 
ATOM   910  C CG  . LEU A 1 117 ? 21.430 17.593 39.885 1.00 15.67  ? 119 LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 117 ? 21.268 19.076 39.412 1.00 15.12  ? 119 LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 117 ? 20.769 17.261 41.229 1.00 17.16  ? 119 LEU A CD2 1 
ATOM   913  N N   . VAL A 1 118 ? 17.826 18.381 39.058 1.00 16.36  ? 120 VAL A N   1 
ATOM   914  C CA  . VAL A 1 118 ? 17.076 19.558 38.618 1.00 14.71  ? 120 VAL A CA  1 
ATOM   915  C C   . VAL A 1 118 ? 17.517 20.824 39.377 1.00 11.82  ? 120 VAL A C   1 
ATOM   916  O O   . VAL A 1 118 ? 17.770 20.768 40.578 1.00 15.81  ? 120 VAL A O   1 
ATOM   917  C CB  . VAL A 1 118 ? 15.551 19.347 38.917 1.00 21.84  ? 120 VAL A CB  1 
ATOM   918  C CG1 . VAL A 1 118 ? 14.749 20.611 38.574 1.00 22.07  ? 120 VAL A CG1 1 
ATOM   919  C CG2 . VAL A 1 118 ? 15.019 18.160 38.065 1.00 20.56  ? 120 VAL A CG2 1 
ATOM   920  N N   . ASN A 1 119 ? 17.603 21.970 38.637 1.00 15.50  ? 121 ASN A N   1 
ATOM   921  C CA  . ASN A 1 119 ? 17.949 23.243 39.284 1.00 17.89  ? 121 ASN A CA  1 
ATOM   922  C C   . ASN A 1 119 ? 16.779 24.146 38.876 1.00 15.62  ? 121 ASN A C   1 
ATOM   923  O O   . ASN A 1 119 ? 16.698 24.506 37.693 1.00 15.11  ? 121 ASN A O   1 
ATOM   924  C CB  . ASN A 1 119 ? 19.248 23.755 38.667 1.00 14.87  ? 121 ASN A CB  1 
ATOM   925  C CG  . ASN A 1 119 ? 19.677 25.093 39.250 1.00 13.34  ? 121 ASN A CG  1 
ATOM   926  O OD1 . ASN A 1 119 ? 19.255 25.460 40.313 1.00 14.96  ? 121 ASN A OD1 1 
ATOM   927  N ND2 . ASN A 1 119 ? 20.553 25.793 38.561 1.00 17.90  ? 121 ASN A ND2 1 
ATOM   928  N N   . ARG A 1 120 ? 15.880 24.539 39.848 1.00 12.93  ? 122 ARG A N   1 
ATOM   929  C CA  . ARG A 1 120 ? 14.682 25.374 39.565 1.00 14.17  ? 122 ARG A CA  1 
ATOM   930  C C   . ARG A 1 120 ? 15.001 26.692 40.254 1.00 12.80  ? 122 ARG A C   1 
ATOM   931  O O   . ARG A 1 120 ? 15.186 26.724 41.476 1.00 16.17  ? 122 ARG A O   1 
ATOM   932  C CB  . ARG A 1 120 ? 13.410 24.788 40.232 1.00 55.04  ? 122 ARG A CB  1 
ATOM   933  C CG  . ARG A 1 120 ? 12.733 23.631 39.520 1.00 71.71  ? 122 ARG A CG  1 
ATOM   934  C CD  . ARG A 1 120 ? 11.461 23.084 40.269 1.00 61.15  ? 122 ARG A CD  1 
ATOM   935  N NE  . ARG A 1 120 ? 11.776 22.330 41.498 1.00 61.15  ? 122 ARG A NE  1 
ATOM   936  C CZ  . ARG A 1 120 ? 10.843 21.720 42.348 1.00 61.15  ? 122 ARG A CZ  1 
ATOM   937  N NH1 . ARG A 1 120 ? 9.536  21.782 42.080 1.00 61.15  ? 122 ARG A NH1 1 
ATOM   938  N NH2 . ARG A 1 120 ? 11.250 21.079 43.454 1.00 61.15  ? 122 ARG A NH2 1 
ATOM   939  N N   . ILE A 1 121 ? 15.035 27.769 39.443 1.00 17.18  ? 123 ILE A N   1 
ATOM   940  C CA  . ILE A 1 121 ? 15.472 29.086 39.910 1.00 19.35  ? 123 ILE A CA  1 
ATOM   941  C C   . ILE A 1 121 ? 14.437 30.172 39.676 1.00 18.18  ? 123 ILE A C   1 
ATOM   942  O O   . ILE A 1 121 ? 13.785 30.186 38.635 1.00 16.07  ? 123 ILE A O   1 
ATOM   943  C CB  . ILE A 1 121 ? 16.682 29.557 39.058 1.00 24.13  ? 123 ILE A CB  1 
ATOM   944  C CG1 . ILE A 1 121 ? 17.707 28.425 38.902 1.00 21.55  ? 123 ILE A CG1 1 
ATOM   945  C CG2 . ILE A 1 121 ? 17.282 30.810 39.651 1.00 20.20  ? 123 ILE A CG2 1 
ATOM   946  C CD1 . ILE A 1 121 ? 18.365 28.371 37.463 1.00 12.28  ? 123 ILE A CD1 1 
ATOM   947  N N   . GLU A 1 122 ? 14.375 31.097 40.635 1.00 12.20  ? 124 GLU A N   1 
ATOM   948  C CA  . GLU A 1 122 ? 13.556 32.308 40.534 1.00 15.84  ? 124 GLU A CA  1 
ATOM   949  C C   . GLU A 1 122 ? 14.613 33.420 40.615 1.00 13.99  ? 124 GLU A C   1 
ATOM   950  O O   . GLU A 1 122 ? 15.431 33.419 41.538 1.00 17.28  ? 124 GLU A O   1 
ATOM   951  C CB  . GLU A 1 122 ? 12.608 32.429 41.720 1.00 58.41  ? 124 GLU A CB  1 
ATOM   952  C CG  . GLU A 1 122 ? 11.355 31.593 41.575 1.00 103.51 ? 124 GLU A CG  1 
ATOM   953  C CD  . GLU A 1 122 ? 10.455 31.680 42.794 1.00 60.15  ? 124 GLU A CD  1 
ATOM   954  O OE1 . GLU A 1 122 ? 10.675 30.912 43.770 1.00 60.15  ? 124 GLU A OE1 1 
ATOM   955  O OE2 . GLU A 1 122 ? 9.542  32.534 42.769 1.00 60.15  ? 124 GLU A OE2 1 
ATOM   956  N N   . LEU A 1 123 ? 14.573 34.404 39.676 1.00 12.21  ? 125 LEU A N   1 
ATOM   957  C CA  . LEU A 1 123 ? 15.553 35.487 39.651 1.00 15.08  ? 125 LEU A CA  1 
ATOM   958  C C   . LEU A 1 123 ? 14.825 36.827 39.588 1.00 16.28  ? 125 LEU A C   1 
ATOM   959  O O   . LEU A 1 123 ? 13.870 36.983 38.831 1.00 19.20  ? 125 LEU A O   1 
ATOM   960  C CB  . LEU A 1 123 ? 16.452 35.358 38.417 1.00 17.06  ? 125 LEU A CB  1 
ATOM   961  C CG  . LEU A 1 123 ? 17.506 36.462 38.156 1.00 20.90  ? 125 LEU A CG  1 
ATOM   962  C CD1 . LEU A 1 123 ? 18.745 35.861 37.402 1.00 18.47  ? 125 LEU A CD1 1 
ATOM   963  C CD2 . LEU A 1 123 ? 16.858 37.615 37.336 1.00 16.12  ? 125 LEU A CD2 1 
ATOM   964  N N   . LYS A 1 124 ? 15.262 37.778 40.406 1.00 12.89  ? 126 LYS A N   1 
ATOM   965  C CA  . LYS A 1 124 ? 14.639 39.114 40.360 1.00 13.59  ? 126 LYS A CA  1 
ATOM   966  C C   . LYS A 1 124 ? 15.800 40.118 40.263 1.00 21.74  ? 126 LYS A C   1 
ATOM   967  O O   . LYS A 1 124 ? 16.676 40.103 41.096 1.00 20.85  ? 126 LYS A O   1 
ATOM   968  C CB  . LYS A 1 124 ? 13.858 39.358 41.648 1.00 17.21  ? 126 LYS A CB  1 
ATOM   969  C CG  . LYS A 1 124 ? 13.075 40.686 41.638 1.00 41.06  ? 126 LYS A CG  1 
ATOM   970  C CD  . LYS A 1 124 ? 11.641 40.494 41.116 1.00 60.06  ? 126 LYS A CD  1 
ATOM   971  C CE  . LYS A 1 124 ? 10.856 41.840 41.014 1.00 34.80  ? 126 LYS A CE  1 
ATOM   972  N NZ  . LYS A 1 124 ? 11.223 42.791 42.088 1.00 50.33  ? 126 LYS A NZ  1 
ATOM   973  N N   . GLY A 1 125 ? 15.792 40.980 39.242 1.00 15.05  ? 127 GLY A N   1 
ATOM   974  C CA  . GLY A 1 125 ? 16.851 41.969 39.083 1.00 12.79  ? 127 GLY A CA  1 
ATOM   975  C C   . GLY A 1 125 ? 16.242 43.357 39.228 1.00 20.33  ? 127 GLY A C   1 
ATOM   976  O O   . GLY A 1 125 ? 15.132 43.551 38.749 1.00 15.98  ? 127 GLY A O   1 
ATOM   977  N N   . ILE A 1 126 ? 16.912 44.283 39.971 1.00 15.32  ? 128 ILE A N   1 
ATOM   978  C CA  . ILE A 1 126 ? 16.351 45.624 40.112 1.00 14.01  ? 128 ILE A CA  1 
ATOM   979  C C   . ILE A 1 126 ? 17.455 46.642 40.045 1.00 21.91  ? 128 ILE A C   1 
ATOM   980  O O   . ILE A 1 126 ? 18.632 46.298 40.135 1.00 19.36  ? 128 ILE A O   1 
ATOM   981  C CB  . ILE A 1 126 ? 15.599 45.802 41.439 1.00 21.46  ? 128 ILE A CB  1 
ATOM   982  C CG1 . ILE A 1 126 ? 16.578 45.764 42.608 1.00 22.03  ? 128 ILE A CG1 1 
ATOM   983  C CG2 . ILE A 1 126 ? 14.514 44.738 41.546 1.00 24.02  ? 128 ILE A CG2 1 
ATOM   984  C CD1 . ILE A 1 126 ? 15.903 45.731 43.957 1.00 30.94  ? 128 ILE A CD1 1 
ATOM   985  N N   . ASP A 1 127 ? 17.057 47.911 39.801 1.00 17.95  ? 129 ASP A N   1 
ATOM   986  C CA  . ASP A 1 127 ? 18.022 49.004 39.765 1.00 15.01  ? 129 ASP A CA  1 
ATOM   987  C C   . ASP A 1 127 ? 19.065 48.989 38.693 1.00 12.58  ? 129 ASP A C   1 
ATOM   988  O O   . ASP A 1 127 ? 20.115 49.619 38.841 1.00 21.64  ? 129 ASP A O   1 
ATOM   989  C CB  . ASP A 1 127 ? 18.687 49.151 41.133 1.00 16.23  ? 129 ASP A CB  1 
ATOM   990  C CG  . ASP A 1 127 ? 17.740 49.724 42.180 1.00 43.14  ? 129 ASP A CG  1 
ATOM   991  O OD1 . ASP A 1 127 ? 16.777 50.431 41.792 1.00 54.69  ? 129 ASP A OD1 1 
ATOM   992  O OD2 . ASP A 1 127 ? 17.969 49.468 43.381 1.00 45.04  ? 129 ASP A OD2 1 
ATOM   993  N N   . PHE A 1 128 ? 18.775 48.269 37.572 1.00 13.07  ? 130 PHE A N   1 
ATOM   994  C CA  . PHE A 1 128 ? 19.698 48.298 36.451 1.00 15.36  ? 130 PHE A CA  1 
ATOM   995  C C   . PHE A 1 128 ? 19.521 49.571 35.630 1.00 29.32  ? 130 PHE A C   1 
ATOM   996  O O   . PHE A 1 128 ? 18.380 50.047 35.477 1.00 27.37  ? 130 PHE A O   1 
ATOM   997  C CB  . PHE A 1 128 ? 19.450 47.095 35.540 1.00 15.77  ? 130 PHE A CB  1 
ATOM   998  C CG  . PHE A 1 128 ? 20.039 45.839 36.113 1.00 16.40  ? 130 PHE A CG  1 
ATOM   999  C CD1 . PHE A 1 128 ? 19.278 45.031 36.984 1.00 14.74  ? 130 PHE A CD1 1 
ATOM   1000 C CD2 . PHE A 1 128 ? 21.405 45.557 35.916 1.00 16.26  ? 130 PHE A CD2 1 
ATOM   1001 C CE1 . PHE A 1 128 ? 19.853 43.961 37.673 1.00 21.93  ? 130 PHE A CE1 1 
ATOM   1002 C CE2 . PHE A 1 128 ? 22.014 44.475 36.617 1.00 18.10  ? 130 PHE A CE2 1 
ATOM   1003 C CZ  . PHE A 1 128 ? 21.218 43.682 37.499 1.00 19.60  ? 130 PHE A CZ  1 
ATOM   1004 N N   . LYS A 1 129 ? 20.661 50.135 35.157 1.00 21.24  ? 131 LYS A N   1 
ATOM   1005 C CA  . LYS A 1 129 ? 20.652 51.343 34.303 1.00 18.17  ? 131 LYS A CA  1 
ATOM   1006 C C   . LYS A 1 129 ? 20.254 50.941 32.881 1.00 22.30  ? 131 LYS A C   1 
ATOM   1007 O O   . LYS A 1 129 ? 20.806 50.000 32.306 1.00 16.82  ? 131 LYS A O   1 
ATOM   1008 C CB  . LYS A 1 129 ? 22.014 52.018 34.330 1.00 42.83  ? 131 LYS A CB  1 
ATOM   1009 C CG  . LYS A 1 129 ? 22.335 52.456 35.749 1.00 48.96  ? 131 LYS A CG  1 
ATOM   1010 C CD  . LYS A 1 129 ? 23.314 53.588 35.834 1.00 74.74  ? 131 LYS A CD  1 
ATOM   1011 C CE  . LYS A 1 129 ? 24.698 53.107 35.555 1.00 35.90  ? 131 LYS A CE  1 
ATOM   1012 N NZ  . LYS A 1 129 ? 25.751 54.036 36.150 1.00 35.90  ? 131 LYS A NZ  1 
ATOM   1013 N N   . GLU A 1 130 ? 19.271 51.609 32.282 1.00 28.74  ? 132 GLU A N   1 
ATOM   1014 C CA  . GLU A 1 130 ? 18.868 51.212 30.909 1.00 32.38  ? 132 GLU A CA  1 
ATOM   1015 C C   . GLU A 1 130 ? 20.005 51.339 29.897 1.00 37.06  ? 132 GLU A C   1 
ATOM   1016 O O   . GLU A 1 130 ? 20.031 50.664 28.873 1.00 38.34  ? 132 GLU A O   1 
ATOM   1017 C CB  . GLU A 1 130 ? 17.655 52.026 30.440 1.00 88.37  ? 132 GLU A CB  1 
ATOM   1018 C CG  . GLU A 1 130 ? 17.462 53.330 31.176 1.00 75.45  ? 132 GLU A CG  1 
ATOM   1019 C CD  . GLU A 1 130 ? 17.089 53.108 32.627 1.00 75.45  ? 132 GLU A CD  1 
ATOM   1020 O OE1 . GLU A 1 130 ? 17.837 53.577 33.520 1.00 75.45  ? 132 GLU A OE1 1 
ATOM   1021 O OE2 . GLU A 1 130 ? 16.046 52.452 32.860 1.00 75.45  ? 132 GLU A OE2 1 
ATOM   1022 N N   . ASP A 1 131 ? 20.949 52.195 30.200 1.00 30.65  ? 133 ASP A N   1 
ATOM   1023 C CA  . ASP A 1 131 ? 22.087 52.447 29.319 1.00 35.23  ? 133 ASP A CA  1 
ATOM   1024 C C   . ASP A 1 131 ? 23.368 51.767 29.784 1.00 39.03  ? 133 ASP A C   1 
ATOM   1025 O O   . ASP A 1 131 ? 24.434 51.978 29.193 1.00 39.87  ? 133 ASP A O   1 
ATOM   1026 C CB  . ASP A 1 131 ? 22.320 53.953 29.290 1.00 86.06  ? 133 ASP A CB  1 
ATOM   1027 C CG  . ASP A 1 131 ? 22.022 54.599 30.643 1.00 83.96  ? 133 ASP A CG  1 
ATOM   1028 O OD1 . ASP A 1 131 ? 20.823 54.750 30.985 1.00 61.85  ? 133 ASP A OD1 1 
ATOM   1029 O OD2 . ASP A 1 131 ? 22.973 54.933 31.379 1.00 61.85  ? 133 ASP A OD2 1 
ATOM   1030 N N   . GLY A 1 132 ? 23.262 50.950 30.871 1.00 39.62  ? 134 GLY A N   1 
ATOM   1031 C CA  . GLY A 1 132 ? 24.426 50.294 31.423 1.00 32.94  ? 134 GLY A CA  1 
ATOM   1032 C C   . GLY A 1 132 ? 24.960 49.140 30.598 1.00 25.17  ? 134 GLY A C   1 
ATOM   1033 O O   . GLY A 1 132 ? 24.486 48.864 29.487 1.00 22.34  ? 134 GLY A O   1 
ATOM   1034 N N   . ASN A 1 133 ? 25.965 48.418 31.170 1.00 20.92  ? 135 ASN A N   1 
ATOM   1035 C CA  . ASN A 1 133 ? 26.558 47.326 30.420 1.00 18.33  ? 135 ASN A CA  1 
ATOM   1036 C C   . ASN A 1 133 ? 25.626 46.152 30.283 1.00 17.59  ? 135 ASN A C   1 
ATOM   1037 O O   . ASN A 1 133 ? 25.776 45.378 29.364 1.00 20.25  ? 135 ASN A O   1 
ATOM   1038 C CB  . ASN A 1 133 ? 27.845 46.849 31.090 1.00 17.88  ? 135 ASN A CB  1 
ATOM   1039 C CG  . ASN A 1 133 ? 28.929 47.929 31.107 1.00 25.31  ? 135 ASN A CG  1 
ATOM   1040 O OD1 . ASN A 1 133 ? 29.073 48.646 30.132 1.00 31.00  ? 135 ASN A OD1 1 
ATOM   1041 N ND2 . ASN A 1 133 ? 29.695 48.037 32.235 1.00 16.32  ? 135 ASN A ND2 1 
ATOM   1042 N N   . ILE A 1 134 ? 24.686 46.003 31.235 1.00 17.37  ? 136 ILE A N   1 
ATOM   1043 C CA  . ILE A 1 134 ? 23.789 44.845 31.245 1.00 17.91  ? 136 ILE A CA  1 
ATOM   1044 C C   . ILE A 1 134 ? 22.583 45.059 30.353 1.00 21.50  ? 136 ILE A C   1 
ATOM   1045 O O   . ILE A 1 134 ? 22.429 44.357 29.363 1.00 17.33  ? 136 ILE A O   1 
ATOM   1046 C CB  . ILE A 1 134 ? 23.323 44.481 32.722 1.00 19.32  ? 136 ILE A CB  1 
ATOM   1047 C CG1 . ILE A 1 134 ? 24.567 44.012 33.524 1.00 20.37  ? 136 ILE A CG1 1 
ATOM   1048 C CG2 . ILE A 1 134 ? 22.367 43.258 32.707 1.00 21.38  ? 136 ILE A CG2 1 
ATOM   1049 C CD1 . ILE A 1 134 ? 25.316 45.149 34.149 1.00 29.59  ? 136 ILE A CD1 1 
ATOM   1050 N N   . LEU A 1 135 ? 21.737 46.048 30.675 1.00 19.34  ? 137 LEU A N   1 
ATOM   1051 C CA  . LEU A 1 135 ? 20.567 46.288 29.822 1.00 21.20  ? 137 LEU A CA  1 
ATOM   1052 C C   . LEU A 1 135 ? 20.962 46.787 28.450 1.00 23.48  ? 137 LEU A C   1 
ATOM   1053 O O   . LEU A 1 135 ? 20.201 46.632 27.503 1.00 27.36  ? 137 LEU A O   1 
ATOM   1054 C CB  . LEU A 1 135 ? 19.590 47.285 30.461 1.00 21.62  ? 137 LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 135 ? 18.906 46.670 31.704 1.00 26.03  ? 137 LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 135 ? 17.808 47.580 32.189 1.00 23.33  ? 137 LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 135 ? 18.303 45.272 31.308 1.00 37.49  ? 137 LEU A CD2 1 
ATOM   1058 N N   . GLY A 1 136 ? 22.164 47.371 28.337 1.00 21.70  ? 138 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 136 ? 22.624 47.858 27.045 1.00 22.10  ? 138 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 136 ? 23.418 46.843 26.261 1.00 26.65  ? 138 GLY A C   1 
ATOM   1061 O O   . GLY A 1 136 ? 24.030 47.186 25.244 1.00 27.49  ? 138 GLY A O   1 
ATOM   1062 N N   . HIS A 1 137 ? 23.473 45.560 26.770 1.00 19.91  ? 139 HIS A N   1 
ATOM   1063 C CA  . HIS A 1 137 ? 24.174 44.508 26.050 1.00 18.68  ? 139 HIS A CA  1 
ATOM   1064 C C   . HIS A 1 137 ? 25.580 44.834 25.569 1.00 20.26  ? 139 HIS A C   1 
ATOM   1065 O O   . HIS A 1 137 ? 25.927 44.690 24.384 1.00 17.88  ? 139 HIS A O   1 
ATOM   1066 C CB  . HIS A 1 137 ? 23.254 44.066 24.905 1.00 19.12  ? 139 HIS A CB  1 
ATOM   1067 C CG  . HIS A 1 137 ? 21.986 43.447 25.398 1.00 25.99  ? 139 HIS A CG  1 
ATOM   1068 N ND1 . HIS A 1 137 ? 21.864 42.087 25.623 1.00 27.63  ? 139 HIS A ND1 1 
ATOM   1069 C CD2 . HIS A 1 137 ? 20.779 43.982 25.679 1.00 31.98  ? 139 HIS A CD2 1 
ATOM   1070 C CE1 . HIS A 1 137 ? 20.634 41.813 26.012 1.00 30.16  ? 139 HIS A CE1 1 
ATOM   1071 N NE2 . HIS A 1 137 ? 19.953 42.945 26.055 1.00 32.39  ? 139 HIS A NE2 1 
ATOM   1072 N N   . LYS A 1 138 ? 26.447 45.230 26.516 1.00 17.96  ? 140 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 138 ? 27.802 45.603 26.150 1.00 19.13  ? 140 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 138 ? 28.814 44.560 26.586 1.00 23.05  ? 140 LYS A C   1 
ATOM   1075 O O   . LYS A 1 138 ? 30.026 44.799 26.536 1.00 16.96  ? 140 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 138 ? 28.128 46.971 26.803 1.00 17.26  ? 140 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 138 ? 27.157 48.102 26.373 1.00 22.61  ? 140 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 138 ? 27.537 49.462 26.936 1.00 57.05  ? 140 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 138 ? 26.395 50.442 26.686 1.00 39.10  ? 140 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 138 ? 26.658 51.842 27.101 1.00 56.70  ? 140 LYS A NZ  1 
ATOM   1081 N N   . LEU A 1 139 ? 28.329 43.365 27.032 1.00 17.49  ? 141 LEU A N   1 
ATOM   1082 C CA  . LEU A 1 139 ? 29.270 42.340 27.490 1.00 15.26  ? 141 LEU A CA  1 
ATOM   1083 C C   . LEU A 1 139 ? 29.612 41.395 26.345 1.00 19.03  ? 141 LEU A C   1 
ATOM   1084 O O   . LEU A 1 139 ? 28.752 41.003 25.525 1.00 16.56  ? 141 LEU A O   1 
ATOM   1085 C CB  . LEU A 1 139 ? 28.656 41.529 28.634 1.00 16.60  ? 141 LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 139 ? 28.257 42.372 29.863 1.00 19.05  ? 141 LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 139 ? 27.806 41.361 30.897 1.00 23.11  ? 141 LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 139 ? 29.405 43.255 30.375 1.00 26.48  ? 141 LEU A CD2 1 
ATOM   1089 N N   . GLU A 1 140 ? 30.882 41.018 26.281 1.00 15.15  ? 142 GLU A N   1 
ATOM   1090 C CA  . GLU A 1 140 ? 31.340 40.065 25.269 1.00 13.56  ? 142 GLU A CA  1 
ATOM   1091 C C   . GLU A 1 140 ? 30.811 38.712 25.637 1.00 16.36  ? 142 GLU A C   1 
ATOM   1092 O O   . GLU A 1 140 ? 30.596 38.417 26.818 1.00 15.15  ? 142 GLU A O   1 
ATOM   1093 C CB  . GLU A 1 140 ? 32.873 40.001 25.271 1.00 7.79   ? 142 GLU A CB  1 
ATOM   1094 C CG  . GLU A 1 140 ? 33.527 41.320 24.761 1.00 20.89  ? 142 GLU A CG  1 
ATOM   1095 C CD  . GLU A 1 140 ? 35.041 41.293 24.696 1.00 43.25  ? 142 GLU A CD  1 
ATOM   1096 O OE1 . GLU A 1 140 ? 35.651 40.430 25.322 1.00 25.85  ? 142 GLU A OE1 1 
ATOM   1097 O OE2 . GLU A 1 140 ? 35.644 42.151 24.030 1.00 38.70  ? 142 GLU A OE2 1 
ATOM   1098 N N   . TYR A 1 141 ? 30.660 37.844 24.597 1.00 18.35  ? 143 TYR A N   1 
ATOM   1099 C CA  . TYR A 1 141 ? 30.155 36.503 24.784 1.00 19.53  ? 143 TYR A CA  1 
ATOM   1100 C C   . TYR A 1 141 ? 31.348 35.570 25.020 1.00 16.08  ? 143 TYR A C   1 
ATOM   1101 O O   . TYR A 1 141 ? 31.834 34.878 24.116 1.00 19.02  ? 143 TYR A O   1 
ATOM   1102 C CB  . TYR A 1 141 ? 29.396 36.093 23.517 1.00 18.67  ? 143 TYR A CB  1 
ATOM   1103 C CG  . TYR A 1 141 ? 28.655 34.791 23.704 1.00 16.51  ? 143 TYR A CG  1 
ATOM   1104 C CD1 . TYR A 1 141 ? 27.501 34.732 24.500 1.00 18.03  ? 143 TYR A CD1 1 
ATOM   1105 C CD2 . TYR A 1 141 ? 29.087 33.629 23.033 1.00 15.77  ? 143 TYR A CD2 1 
ATOM   1106 C CE1 . TYR A 1 141 ? 26.785 33.512 24.605 1.00 17.72  ? 143 TYR A CE1 1 
ATOM   1107 C CE2 . TYR A 1 141 ? 28.392 32.426 23.134 1.00 17.60  ? 143 TYR A CE2 1 
ATOM   1108 C CZ  . TYR A 1 141 ? 27.226 32.397 23.931 1.00 21.23  ? 143 TYR A CZ  1 
ATOM   1109 O OH  . TYR A 1 141 ? 26.474 31.263 24.010 1.00 24.95  ? 143 TYR A OH  1 
ATOM   1110 N N   . ASN A 1 142 ? 31.919 35.631 26.247 1.00 14.70  ? 144 ASN A N   1 
ATOM   1111 C CA  . ASN A 1 142 ? 33.017 34.764 26.625 1.00 12.93  ? 144 ASN A CA  1 
ATOM   1112 C C   . ASN A 1 142 ? 32.947 34.733 28.154 1.00 17.92  ? 144 ASN A C   1 
ATOM   1113 O O   . ASN A 1 142 ? 32.034 35.319 28.779 1.00 15.77  ? 144 ASN A O   1 
ATOM   1114 C CB  . ASN A 1 142 ? 34.414 35.274 26.177 1.00 13.44  ? 144 ASN A CB  1 
ATOM   1115 C CG  . ASN A 1 142 ? 34.616 36.743 26.417 1.00 26.13  ? 144 ASN A CG  1 
ATOM   1116 O OD1 . ASN A 1 142 ? 34.291 37.261 27.489 1.00 20.60  ? 144 ASN A OD1 1 
ATOM   1117 N ND2 . ASN A 1 142 ? 35.182 37.447 25.409 1.00 30.67  ? 144 ASN A ND2 1 
ATOM   1118 N N   . TYR A 1 143 ? 33.896 34.017 28.756 1.00 16.41  ? 145 TYR A N   1 
ATOM   1119 C CA  . TYR A 1 143 ? 33.829 33.877 30.198 1.00 16.15  ? 145 TYR A CA  1 
ATOM   1120 C C   . TYR A 1 143 ? 35.207 33.569 30.736 1.00 21.83  ? 145 TYR A C   1 
ATOM   1121 O O   . TYR A 1 143 ? 35.963 32.821 30.108 1.00 26.31  ? 145 TYR A O   1 
ATOM   1122 C CB  . TYR A 1 143 ? 32.906 32.691 30.542 1.00 14.42  ? 145 TYR A CB  1 
ATOM   1123 C CG  . TYR A 1 143 ? 32.156 32.977 31.822 1.00 14.91  ? 145 TYR A CG  1 
ATOM   1124 C CD1 . TYR A 1 143 ? 30.994 33.703 31.799 1.00 17.30  ? 145 TYR A CD1 1 
ATOM   1125 C CD2 . TYR A 1 143 ? 32.634 32.491 33.047 1.00 14.86  ? 145 TYR A CD2 1 
ATOM   1126 C CE1 . TYR A 1 143 ? 30.294 33.949 32.943 1.00 10.32  ? 145 TYR A CE1 1 
ATOM   1127 C CE2 . TYR A 1 143 ? 31.943 32.739 34.242 1.00 16.14  ? 145 TYR A CE2 1 
ATOM   1128 C CZ  . TYR A 1 143 ? 30.780 33.450 34.204 1.00 13.02  ? 145 TYR A CZ  1 
ATOM   1129 O OH  . TYR A 1 143 ? 30.062 33.673 35.365 1.00 17.41  ? 145 TYR A OH  1 
ATOM   1130 N N   . ASN A 1 144 ? 35.506 34.112 31.962 1.00 18.40  ? 146 ASN A N   1 
ATOM   1131 C CA  . ASN A 1 144 ? 36.824 33.926 32.550 1.00 17.42  ? 146 ASN A CA  1 
ATOM   1132 C C   . ASN A 1 144 ? 36.805 32.812 33.576 1.00 19.99  ? 146 ASN A C   1 
ATOM   1133 O O   . ASN A 1 144 ? 35.739 32.274 33.899 1.00 18.78  ? 146 ASN A O   1 
ATOM   1134 C CB  . ASN A 1 144 ? 37.283 35.256 33.186 1.00 17.37  ? 146 ASN A CB  1 
ATOM   1135 C CG  . ASN A 1 144 ? 37.478 36.328 32.163 1.00 36.10  ? 146 ASN A CG  1 
ATOM   1136 O OD1 . ASN A 1 144 ? 38.287 36.182 31.254 1.00 32.71  ? 146 ASN A OD1 1 
ATOM   1137 N ND2 . ASN A 1 144 ? 36.729 37.411 32.287 1.00 21.82  ? 146 ASN A ND2 1 
ATOM   1138 N N   . SER A 1 145 ? 38.033 32.419 34.027 1.00 14.58  ? 147 SER A N   1 
ATOM   1139 C CA  . SER A 1 145 ? 38.157 31.339 35.061 1.00 10.02  ? 147 SER A CA  1 
ATOM   1140 C C   . SER A 1 145 ? 38.091 32.095 36.393 1.00 13.31  ? 147 SER A C   1 
ATOM   1141 O O   . SER A 1 145 ? 38.625 33.210 36.502 1.00 21.07  ? 147 SER A O   1 
ATOM   1142 C CB  . SER A 1 145 ? 39.516 30.652 34.954 1.00 24.07  ? 147 SER A CB  1 
ATOM   1143 O OG  . SER A 1 145 ? 39.621 29.991 33.714 1.00 42.26  ? 147 SER A OG  1 
ATOM   1144 N N   . HIS A 1 146 ? 37.490 31.449 37.451 1.00 13.33  ? 148 HIS A N   1 
ATOM   1145 C CA  . HIS A 1 146 ? 37.380 32.162 38.726 1.00 12.42  ? 148 HIS A CA  1 
ATOM   1146 C C   . HIS A 1 146 ? 37.579 31.152 39.881 1.00 21.90  ? 148 HIS A C   1 
ATOM   1147 O O   . HIS A 1 146 ? 37.478 29.930 39.704 1.00 18.17  ? 148 HIS A O   1 
ATOM   1148 C CB  . HIS A 1 146 ? 35.974 32.741 38.905 1.00 16.42  ? 148 HIS A CB  1 
ATOM   1149 C CG  . HIS A 1 146 ? 35.593 33.724 37.851 1.00 20.03  ? 148 HIS A CG  1 
ATOM   1150 N ND1 . HIS A 1 146 ? 34.890 33.375 36.710 1.00 22.34  ? 148 HIS A ND1 1 
ATOM   1151 C CD2 . HIS A 1 146 ? 35.860 35.047 37.743 1.00 17.60  ? 148 HIS A CD2 1 
ATOM   1152 C CE1 . HIS A 1 146 ? 34.757 34.445 35.945 1.00 18.60  ? 148 HIS A CE1 1 
ATOM   1153 N NE2 . HIS A 1 146 ? 35.333 35.470 36.543 1.00 16.60  ? 148 HIS A NE2 1 
ATOM   1154 N N   . ASN A 1 147 ? 37.845 31.689 41.034 1.00 18.33  ? 149 ASN A N   1 
ATOM   1155 C CA  . ASN A 1 147 ? 37.984 30.849 42.249 1.00 19.93  ? 149 ASN A CA  1 
ATOM   1156 C C   . ASN A 1 147 ? 36.761 31.205 43.078 1.00 21.20  ? 149 ASN A C   1 
ATOM   1157 O O   . ASN A 1 147 ? 36.460 32.364 43.266 1.00 17.90  ? 149 ASN A O   1 
ATOM   1158 C CB  . ASN A 1 147 ? 39.242 31.245 43.005 1.00 13.46  ? 149 ASN A CB  1 
ATOM   1159 C CG  . ASN A 1 147 ? 40.523 30.703 42.357 1.00 24.25  ? 149 ASN A CG  1 
ATOM   1160 O OD1 . ASN A 1 147 ? 41.582 31.288 42.496 1.00 69.03  ? 149 ASN A OD1 1 
ATOM   1161 N ND2 . ASN A 1 147 ? 40.411 29.576 41.668 1.00 23.97  ? 149 ASN A ND2 1 
ATOM   1162 N N   . VAL A 1 148 ? 36.104 30.201 43.631 1.00 13.90  ? 150 VAL A N   1 
ATOM   1163 C CA  . VAL A 1 148 ? 34.861 30.323 44.400 1.00 12.03  ? 150 VAL A CA  1 
ATOM   1164 C C   . VAL A 1 148 ? 35.203 29.838 45.788 1.00 15.89  ? 150 VAL A C   1 
ATOM   1165 O O   . VAL A 1 148 ? 35.480 28.650 45.995 1.00 13.30  ? 150 VAL A O   1 
ATOM   1166 C CB  . VAL A 1 148 ? 33.754 29.371 43.740 1.00 16.98  ? 150 VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 148 ? 32.457 29.347 44.583 1.00 14.01  ? 150 VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 148 ? 33.433 29.922 42.281 1.00 13.77  ? 150 VAL A CG2 1 
ATOM   1169 N N   . TYR A 1 149 ? 35.131 30.767 46.758 1.00 15.29  ? 151 TYR A N   1 
ATOM   1170 C CA  . TYR A 1 149 ? 35.530 30.465 48.152 1.00 13.24  ? 151 TYR A CA  1 
ATOM   1171 C C   . TYR A 1 149 ? 34.387 29.993 49.003 1.00 16.03  ? 151 TYR A C   1 
ATOM   1172 O O   . TYR A 1 149 ? 33.372 30.660 49.096 1.00 15.28  ? 151 TYR A O   1 
ATOM   1173 C CB  . TYR A 1 149 ? 36.133 31.743 48.765 1.00 11.11  ? 151 TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 149 ? 37.382 32.141 47.984 1.00 19.11  ? 151 TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 149 ? 38.598 31.457 48.170 1.00 19.49  ? 151 TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 149 ? 37.331 33.130 47.006 1.00 23.46  ? 151 TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 149 ? 39.742 31.760 47.374 1.00 23.79  ? 151 TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 149 ? 38.448 33.435 46.222 1.00 28.98  ? 151 TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 149 ? 39.644 32.751 46.406 1.00 37.65  ? 151 TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 149 ? 40.733 33.061 45.623 1.00 47.62  ? 151 TYR A OH  1 
ATOM   1181 N N   . ILE A 1 150 ? 34.565 28.823 49.689 1.00 11.70  ? 152 ILE A N   1 
ATOM   1182 C CA  . ILE A 1 150 ? 33.511 28.224 50.517 1.00 11.40  ? 152 ILE A CA  1 
ATOM   1183 C C   . ILE A 1 150 ? 33.931 28.167 52.006 1.00 13.85  ? 152 ILE A C   1 
ATOM   1184 O O   . ILE A 1 150 ? 35.071 27.892 52.321 1.00 19.58  ? 152 ILE A O   1 
ATOM   1185 C CB  . ILE A 1 150 ? 33.279 26.781 50.047 1.00 21.00  ? 152 ILE A CB  1 
ATOM   1186 C CG1 . ILE A 1 150 ? 32.876 26.800 48.565 1.00 15.55  ? 152 ILE A CG1 1 
ATOM   1187 C CG2 . ILE A 1 150 ? 32.260 26.062 50.948 1.00 23.94  ? 152 ILE A CG2 1 
ATOM   1188 C CD1 . ILE A 1 150 ? 32.875 25.414 47.994 1.00 14.01  ? 152 ILE A CD1 1 
ATOM   1189 N N   . MET A 1 151 ? 32.942 28.453 52.903 1.00 14.85  ? 153 MET A N   1 
ATOM   1190 C CA  . MET A 1 151 ? 33.216 28.394 54.369 1.00 17.74  ? 153 MET A CA  1 
ATOM   1191 C C   . MET A 1 151 ? 31.996 27.743 54.923 1.00 26.67  ? 153 MET A C   1 
ATOM   1192 O O   . MET A 1 151 ? 30.919 27.893 54.376 1.00 21.71  ? 153 MET A O   1 
ATOM   1193 C CB  . MET A 1 151 ? 33.307 29.772 55.028 1.00 51.28  ? 153 MET A CB  1 
ATOM   1194 C CG  . MET A 1 151 ? 34.001 30.861 54.315 1.00 63.75  ? 153 MET A CG  1 
ATOM   1195 S SD  . MET A 1 151 ? 34.049 32.237 55.510 1.00 52.58  ? 153 MET A SD  1 
ATOM   1196 C CE  . MET A 1 151 ? 32.223 32.665 55.698 1.00 52.58  ? 153 MET A CE  1 
ATOM   1197 N N   . ALA A 1 152 ? 32.144 26.997 56.024 1.00 16.90  ? 154 ALA A N   1 
ATOM   1198 C CA  . ALA A 1 152 ? 30.964 26.402 56.583 1.00 16.47  ? 154 ALA A CA  1 
ATOM   1199 C C   . ALA A 1 152 ? 30.221 27.481 57.375 1.00 19.29  ? 154 ALA A C   1 
ATOM   1200 O O   . ALA A 1 152 ? 30.820 28.414 57.900 1.00 19.78  ? 154 ALA A O   1 
ATOM   1201 C CB  . ALA A 1 152 ? 31.387 25.230 57.538 1.00 30.48  ? 154 ALA A CB  1 
ATOM   1202 N N   . ASP A 1 153 ? 28.919 27.331 57.466 1.00 15.52  ? 155 ASP A N   1 
ATOM   1203 C CA  . ASP A 1 153 ? 28.047 28.203 58.258 1.00 19.90  ? 155 ASP A CA  1 
ATOM   1204 C C   . ASP A 1 153 ? 27.438 27.188 59.245 1.00 38.09  ? 155 ASP A C   1 
ATOM   1205 O O   . ASP A 1 153 ? 26.360 26.639 59.021 1.00 32.87  ? 155 ASP A O   1 
ATOM   1206 C CB  . ASP A 1 153 ? 26.933 28.787 57.395 1.00 29.39  ? 155 ASP A CB  1 
ATOM   1207 C CG  . ASP A 1 153 ? 26.138 29.868 58.139 1.00 39.47  ? 155 ASP A CG  1 
ATOM   1208 O OD1 . ASP A 1 153 ? 26.312 29.965 59.377 1.00 38.79  ? 155 ASP A OD1 1 
ATOM   1209 O OD2 . ASP A 1 153 ? 25.362 30.592 57.485 1.00 66.43  ? 155 ASP A OD2 1 
ATOM   1210 N N   . LYS A 1 154 ? 28.175 26.898 60.341 1.00 25.54  ? 156 LYS A N   1 
ATOM   1211 C CA  . LYS A 1 154 ? 27.701 25.880 61.286 1.00 32.85  ? 156 LYS A CA  1 
ATOM   1212 C C   . LYS A 1 154 ? 26.355 26.183 61.896 1.00 44.25  ? 156 LYS A C   1 
ATOM   1213 O O   . LYS A 1 154 ? 25.584 25.269 62.210 1.00 45.92  ? 156 LYS A O   1 
ATOM   1214 C CB  . LYS A 1 154 ? 28.712 25.655 62.408 1.00 120.33 ? 156 LYS A CB  1 
ATOM   1215 C CG  . LYS A 1 154 ? 29.932 24.910 61.958 1.00 77.50  ? 156 LYS A CG  1 
ATOM   1216 C CD  . LYS A 1 154 ? 30.754 24.403 63.130 1.00 77.50  ? 156 LYS A CD  1 
ATOM   1217 C CE  . LYS A 1 154 ? 32.124 23.982 62.643 1.00 77.50  ? 156 LYS A CE  1 
ATOM   1218 N NZ  . LYS A 1 154 ? 32.744 25.124 61.903 1.00 77.50  ? 156 LYS A NZ  1 
ATOM   1219 N N   . GLN A 1 155 ? 26.070 27.485 62.053 1.00 41.32  ? 157 GLN A N   1 
ATOM   1220 C CA  . GLN A 1 155 ? 24.814 27.884 62.648 1.00 39.93  ? 157 GLN A CA  1 
ATOM   1221 C C   . GLN A 1 155 ? 23.596 27.404 61.871 1.00 45.07  ? 157 GLN A C   1 
ATOM   1222 O O   . GLN A 1 155 ? 22.602 26.960 62.464 1.00 50.59  ? 157 GLN A O   1 
ATOM   1223 C CB  . GLN A 1 155 ? 24.735 29.399 62.776 1.00 96.14  ? 157 GLN A CB  1 
ATOM   1224 C CG  . GLN A 1 155 ? 23.417 29.823 63.392 1.00 96.14  ? 157 GLN A CG  1 
ATOM   1225 C CD  . GLN A 1 155 ? 23.084 31.269 63.146 1.00 96.14  ? 157 GLN A CD  1 
ATOM   1226 O OE1 . GLN A 1 155 ? 23.005 31.715 61.999 1.00 96.14  ? 157 GLN A OE1 1 
ATOM   1227 N NE2 . GLN A 1 155 ? 22.875 32.015 64.222 1.00 96.14  ? 157 GLN A NE2 1 
ATOM   1228 N N   . LYS A 1 156 ? 23.670 27.490 60.524 1.00 48.85  ? 158 LYS A N   1 
ATOM   1229 C CA  . LYS A 1 156 ? 22.548 27.073 59.692 1.00 44.69  ? 158 LYS A CA  1 
ATOM   1230 C C   . LYS A 1 156 ? 22.709 25.688 59.088 1.00 37.99  ? 158 LYS A C   1 
ATOM   1231 O O   . LYS A 1 156 ? 21.904 25.276 58.246 1.00 27.89  ? 158 LYS A O   1 
ATOM   1232 C CB  . LYS A 1 156 ? 22.349 28.065 58.556 1.00 55.71  ? 158 LYS A CB  1 
ATOM   1233 C CG  . LYS A 1 156 ? 22.320 29.475 59.035 1.00 55.71  ? 158 LYS A CG  1 
ATOM   1234 C CD  . LYS A 1 156 ? 22.256 30.416 57.873 1.00 55.71  ? 158 LYS A CD  1 
ATOM   1235 C CE  . LYS A 1 156 ? 22.594 31.804 58.344 1.00 55.71  ? 158 LYS A CE  1 
ATOM   1236 N NZ  . LYS A 1 156 ? 23.129 32.636 57.236 1.00 55.71  ? 158 LYS A NZ  1 
ATOM   1237 N N   . ASN A 1 157 ? 23.749 24.970 59.496 1.00 28.98  ? 159 ASN A N   1 
ATOM   1238 C CA  . ASN A 1 157 ? 23.968 23.642 58.957 1.00 28.28  ? 159 ASN A CA  1 
ATOM   1239 C C   . ASN A 1 157 ? 24.129 23.779 57.426 1.00 25.45  ? 159 ASN A C   1 
ATOM   1240 O O   . ASN A 1 157 ? 23.696 22.902 56.671 1.00 21.33  ? 159 ASN A O   1 
ATOM   1241 C CB  . ASN A 1 157 ? 22.762 22.758 59.294 1.00 64.67  ? 159 ASN A CB  1 
ATOM   1242 C CG  . ASN A 1 157 ? 23.083 21.288 59.227 1.00 67.22  ? 159 ASN A CG  1 
ATOM   1243 O OD1 . ASN A 1 157 ? 24.170 20.858 59.641 1.00 37.92  ? 159 ASN A OD1 1 
ATOM   1244 N ND2 . ASN A 1 157 ? 22.137 20.495 58.721 1.00 72.39  ? 159 ASN A ND2 1 
ATOM   1245 N N   . GLY A 1 158 ? 24.809 24.888 56.984 1.00 20.94  ? 160 GLY A N   1 
ATOM   1246 C CA  . GLY A 1 158 ? 25.005 25.109 55.559 1.00 17.78  ? 160 GLY A CA  1 
ATOM   1247 C C   . GLY A 1 158 ? 26.362 25.697 55.265 1.00 21.16  ? 160 GLY A C   1 
ATOM   1248 O O   . GLY A 1 158 ? 27.298 25.576 56.034 1.00 19.61  ? 160 GLY A O   1 
ATOM   1249 N N   . ILE A 1 159 ? 26.490 26.385 54.097 1.00 19.38  ? 161 ILE A N   1 
ATOM   1250 C CA  . ILE A 1 159 ? 27.780 26.974 53.760 1.00 14.50  ? 161 ILE A CA  1 
ATOM   1251 C C   . ILE A 1 159 ? 27.502 28.370 53.279 1.00 13.85  ? 161 ILE A C   1 
ATOM   1252 O O   . ILE A 1 159 ? 26.350 28.655 52.916 1.00 16.70  ? 161 ILE A O   1 
ATOM   1253 C CB  . ILE A 1 159 ? 28.495 26.188 52.633 1.00 15.63  ? 161 ILE A CB  1 
ATOM   1254 C CG1 . ILE A 1 159 ? 27.578 25.966 51.409 1.00 14.35  ? 161 ILE A CG1 1 
ATOM   1255 C CG2 . ILE A 1 159 ? 28.919 24.814 53.173 1.00 16.25  ? 161 ILE A CG2 1 
ATOM   1256 C CD1 . ILE A 1 159 ? 28.445 25.530 50.158 1.00 15.99  ? 161 ILE A CD1 1 
ATOM   1257 N N   . LYS A 1 160 ? 28.530 29.217 53.330 1.00 15.14  ? 162 LYS A N   1 
ATOM   1258 C CA  . LYS A 1 160 ? 28.449 30.580 52.826 1.00 16.00  ? 162 LYS A CA  1 
ATOM   1259 C C   . LYS A 1 160 ? 29.505 30.569 51.769 1.00 16.96  ? 162 LYS A C   1 
ATOM   1260 O O   . LYS A 1 160 ? 30.588 30.000 51.955 1.00 20.28  ? 162 LYS A O   1 
ATOM   1261 C CB  . LYS A 1 160 ? 28.814 31.580 53.931 1.00 42.20  ? 162 LYS A CB  1 
ATOM   1262 C CG  . LYS A 1 160 ? 27.776 31.635 55.012 1.00 61.50  ? 162 LYS A CG  1 
ATOM   1263 C CD  . LYS A 1 160 ? 27.439 33.063 55.372 1.00 80.68  ? 162 LYS A CD  1 
ATOM   1264 C CE  . LYS A 1 160 ? 28.385 33.617 56.421 1.00 47.38  ? 162 LYS A CE  1 
ATOM   1265 N NZ  . LYS A 1 160 ? 27.779 33.580 57.850 1.00 47.38  ? 162 LYS A NZ  1 
ATOM   1266 N N   . VAL A 1 161 ? 29.249 31.259 50.646 1.00 12.09  ? 163 VAL A N   1 
ATOM   1267 C CA  . VAL A 1 161 ? 30.230 31.185 49.535 1.00 11.75  ? 163 VAL A CA  1 
ATOM   1268 C C   . VAL A 1 161 ? 30.340 32.578 48.974 1.00 20.01  ? 163 VAL A C   1 
ATOM   1269 O O   . VAL A 1 161 ? 29.334 33.282 48.903 1.00 23.26  ? 163 VAL A O   1 
ATOM   1270 C CB  . VAL A 1 161 ? 29.628 30.258 48.399 1.00 17.58  ? 163 VAL A CB  1 
ATOM   1271 C CG1 . VAL A 1 161 ? 30.485 30.295 47.078 1.00 12.98  ? 163 VAL A CG1 1 
ATOM   1272 C CG2 . VAL A 1 161 ? 29.476 28.821 48.952 1.00 17.81  ? 163 VAL A CG2 1 
ATOM   1273 N N   . ASN A 1 162 ? 31.551 33.014 48.601 1.00 15.68  ? 164 ASN A N   1 
ATOM   1274 C CA  . ASN A 1 162 ? 31.642 34.363 48.027 1.00 13.60  ? 164 ASN A CA  1 
ATOM   1275 C C   . ASN A 1 162 ? 32.731 34.350 46.951 1.00 15.67  ? 164 ASN A C   1 
ATOM   1276 O O   . ASN A 1 162 ? 33.661 33.552 47.001 1.00 19.00  ? 164 ASN A O   1 
ATOM   1277 C CB  . ASN A 1 162 ? 31.942 35.414 49.105 1.00 41.63  ? 164 ASN A CB  1 
ATOM   1278 C CG  . ASN A 1 162 ? 33.361 35.467 49.442 1.00 78.16  ? 164 ASN A CG  1 
ATOM   1279 O OD1 . ASN A 1 162 ? 33.883 34.531 50.016 1.00 47.60  ? 164 ASN A OD1 1 
ATOM   1280 N ND2 . ASN A 1 162 ? 34.029 36.552 49.069 1.00 98.03  ? 164 ASN A ND2 1 
ATOM   1281 N N   . PHE A 1 163 ? 32.514 35.173 45.916 1.00 13.76  ? 165 PHE A N   1 
ATOM   1282 C CA  . PHE A 1 163 ? 33.469 35.274 44.831 1.00 9.81   ? 165 PHE A CA  1 
ATOM   1283 C C   . PHE A 1 163 ? 33.086 36.448 43.987 1.00 12.40  ? 165 PHE A C   1 
ATOM   1284 O O   . PHE A 1 163 ? 31.967 36.990 44.136 1.00 15.50  ? 165 PHE A O   1 
ATOM   1285 C CB  . PHE A 1 163 ? 33.525 33.981 43.982 1.00 13.51  ? 165 PHE A CB  1 
ATOM   1286 C CG  . PHE A 1 163 ? 32.208 33.514 43.452 1.00 14.13  ? 165 PHE A CG  1 
ATOM   1287 C CD1 . PHE A 1 163 ? 31.331 32.798 44.269 1.00 14.26  ? 165 PHE A CD1 1 
ATOM   1288 C CD2 . PHE A 1 163 ? 31.851 33.773 42.115 1.00 14.50  ? 165 PHE A CD2 1 
ATOM   1289 C CE1 . PHE A 1 163 ? 30.092 32.329 43.789 1.00 14.83  ? 165 PHE A CE1 1 
ATOM   1290 C CE2 . PHE A 1 163 ? 30.635 33.328 41.593 1.00 20.01  ? 165 PHE A CE2 1 
ATOM   1291 C CZ  . PHE A 1 163 ? 29.747 32.614 42.425 1.00 12.25  ? 165 PHE A CZ  1 
ATOM   1292 N N   . LYS A 1 164 ? 34.039 36.860 43.123 1.00 11.19  ? 166 LYS A N   1 
ATOM   1293 C CA  . LYS A 1 164 ? 33.803 37.981 42.230 1.00 11.76  ? 166 LYS A CA  1 
ATOM   1294 C C   . LYS A 1 164 ? 33.979 37.457 40.811 1.00 19.25  ? 166 LYS A C   1 
ATOM   1295 O O   . LYS A 1 164 ? 34.941 36.783 40.513 1.00 21.61  ? 166 LYS A O   1 
ATOM   1296 C CB  . LYS A 1 164 ? 34.831 39.070 42.446 1.00 22.44  ? 166 LYS A CB  1 
ATOM   1297 C CG  . LYS A 1 164 ? 34.812 39.705 43.797 1.00 32.20  ? 166 LYS A CG  1 
ATOM   1298 C CD  . LYS A 1 164 ? 35.828 40.850 43.754 1.00 53.78  ? 166 LYS A CD  1 
ATOM   1299 C CE  . LYS A 1 164 ? 35.557 41.872 44.816 1.00 55.95  ? 166 LYS A CE  1 
ATOM   1300 N NZ  . LYS A 1 164 ? 35.694 41.236 46.143 1.00 32.94  ? 166 LYS A NZ  1 
ATOM   1301 N N   . ILE A 1 165 ? 32.969 37.753 39.928 1.00 10.05  ? 167 ILE A N   1 
ATOM   1302 C CA  . ILE A 1 165 ? 33.055 37.313 38.527 1.00 11.80  ? 167 ILE A CA  1 
ATOM   1303 C C   . ILE A 1 165 ? 33.489 38.605 37.797 1.00 17.48  ? 167 ILE A C   1 
ATOM   1304 O O   . ILE A 1 165 ? 33.009 39.690 38.107 1.00 19.96  ? 167 ILE A O   1 
ATOM   1305 C CB  . ILE A 1 165 ? 31.645 36.918 37.994 1.00 20.25  ? 167 ILE A CB  1 
ATOM   1306 C CG1 . ILE A 1 165 ? 31.174 35.616 38.649 1.00 17.55  ? 167 ILE A CG1 1 
ATOM   1307 C CG2 . ILE A 1 165 ? 31.643 36.823 36.487 1.00 13.72  ? 167 ILE A CG2 1 
ATOM   1308 C CD1 . ILE A 1 165 ? 32.164 34.431 38.398 1.00 23.94  ? 167 ILE A CD1 1 
ATOM   1309 N N   . ARG A 1 166 ? 34.388 38.456 36.832 1.00 11.13  ? 168 ARG A N   1 
ATOM   1310 C CA  . ARG A 1 166 ? 34.851 39.594 36.018 1.00 15.65  ? 168 ARG A CA  1 
ATOM   1311 C C   . ARG A 1 166 ? 34.272 39.338 34.624 1.00 19.29  ? 168 ARG A C   1 
ATOM   1312 O O   . ARG A 1 166 ? 34.624 38.326 34.014 1.00 19.43  ? 168 ARG A O   1 
ATOM   1313 C CB  . ARG A 1 166 ? 36.397 39.588 35.948 1.00 44.42  ? 168 ARG A CB  1 
ATOM   1314 C CG  . ARG A 1 166 ? 37.083 40.077 37.226 1.00 52.57  ? 168 ARG A CG  1 
ATOM   1315 C CD  . ARG A 1 166 ? 38.365 39.309 37.539 1.00 71.31  ? 168 ARG A CD  1 
ATOM   1316 N NE  . ARG A 1 166 ? 39.082 38.952 36.320 1.00 78.63  ? 168 ARG A NE  1 
ATOM   1317 C CZ  . ARG A 1 166 ? 39.324 37.664 35.898 1.00 47.25  ? 168 ARG A CZ  1 
ATOM   1318 N NH1 . ARG A 1 166 ? 39.979 37.465 34.758 1.00 47.25  ? 168 ARG A NH1 1 
ATOM   1319 N NH2 . ARG A 1 166 ? 38.919 36.608 36.620 1.00 47.25  ? 168 ARG A NH2 1 
ATOM   1320 N N   . HIS A 1 167 ? 33.333 40.216 34.154 1.00 16.48  ? 169 HIS A N   1 
ATOM   1321 C CA  . HIS A 1 167 ? 32.758 40.087 32.816 1.00 15.53  ? 169 HIS A CA  1 
ATOM   1322 C C   . HIS A 1 167 ? 33.513 41.042 31.865 1.00 14.12  ? 169 HIS A C   1 
ATOM   1323 O O   . HIS A 1 167 ? 33.659 42.217 32.165 1.00 18.91  ? 169 HIS A O   1 
ATOM   1324 C CB  . HIS A 1 167 ? 31.276 40.507 32.840 1.00 9.87   ? 169 HIS A CB  1 
ATOM   1325 C CG  . HIS A 1 167 ? 30.409 39.550 33.631 1.00 10.97  ? 169 HIS A CG  1 
ATOM   1326 N ND1 . HIS A 1 167 ? 30.163 38.260 33.210 1.00 13.70  ? 169 HIS A ND1 1 
ATOM   1327 C CD2 . HIS A 1 167 ? 29.668 39.727 34.757 1.00 15.88  ? 169 HIS A CD2 1 
ATOM   1328 C CE1 . HIS A 1 167 ? 29.291 37.681 34.040 1.00 13.71  ? 169 HIS A CE1 1 
ATOM   1329 N NE2 . HIS A 1 167 ? 28.967 38.553 34.983 1.00 15.99  ? 169 HIS A NE2 1 
ATOM   1330 N N   . ASN A 1 168 ? 33.969 40.535 30.709 1.00 10.74  ? 170 ASN A N   1 
ATOM   1331 C CA  . ASN A 1 168 ? 34.695 41.430 29.784 1.00 16.34  ? 170 ASN A CA  1 
ATOM   1332 C C   . ASN A 1 168 ? 33.679 42.304 29.072 1.00 25.75  ? 170 ASN A C   1 
ATOM   1333 O O   . ASN A 1 168 ? 32.666 41.806 28.612 1.00 18.11  ? 170 ASN A O   1 
ATOM   1334 C CB  . ASN A 1 168 ? 35.440 40.599 28.684 1.00 15.95  ? 170 ASN A CB  1 
ATOM   1335 C CG  . ASN A 1 168 ? 36.590 39.760 29.241 1.00 16.64  ? 170 ASN A CG  1 
ATOM   1336 O OD1 . ASN A 1 168 ? 37.009 38.788 28.623 1.00 52.54  ? 170 ASN A OD1 1 
ATOM   1337 N ND2 . ASN A 1 168 ? 37.101 40.149 30.397 1.00 17.88  ? 170 ASN A ND2 1 
ATOM   1338 N N   . ILE A 1 169 ? 33.940 43.608 28.956 1.00 15.32  ? 171 ILE A N   1 
ATOM   1339 C CA  . ILE A 1 169 ? 33.011 44.507 28.228 1.00 13.84  ? 171 ILE A CA  1 
ATOM   1340 C C   . ILE A 1 169 ? 33.626 44.692 26.841 1.00 15.46  ? 171 ILE A C   1 
ATOM   1341 O O   . ILE A 1 169 ? 34.849 44.672 26.701 1.00 14.97  ? 171 ILE A O   1 
ATOM   1342 C CB  . ILE A 1 169 ? 32.915 45.820 28.950 1.00 21.58  ? 171 ILE A CB  1 
ATOM   1343 C CG1 . ILE A 1 169 ? 32.426 45.548 30.384 1.00 24.74  ? 171 ILE A CG1 1 
ATOM   1344 C CG2 . ILE A 1 169 ? 31.958 46.767 28.257 1.00 17.89  ? 171 ILE A CG2 1 
ATOM   1345 C CD1 . ILE A 1 169 ? 32.655 46.740 31.306 1.00 53.28  ? 171 ILE A CD1 1 
ATOM   1346 N N   . GLU A 1 170 ? 32.783 44.953 25.820 1.00 16.33  ? 172 GLU A N   1 
ATOM   1347 C CA  . GLU A 1 170 ? 33.327 45.034 24.450 1.00 17.20  ? 172 GLU A CA  1 
ATOM   1348 C C   . GLU A 1 170 ? 34.340 46.177 24.207 1.00 23.96  ? 172 GLU A C   1 
ATOM   1349 O O   . GLU A 1 170 ? 35.033 46.157 23.205 1.00 30.12  ? 172 GLU A O   1 
ATOM   1350 C CB  . GLU A 1 170 ? 32.177 45.111 23.463 1.00 51.68  ? 172 GLU A CB  1 
ATOM   1351 C CG  . GLU A 1 170 ? 31.265 46.244 23.747 1.00 68.67  ? 172 GLU A CG  1 
ATOM   1352 C CD  . GLU A 1 170 ? 30.020 46.199 22.897 1.00 52.11  ? 172 GLU A CD  1 
ATOM   1353 O OE1 . GLU A 1 170 ? 29.572 47.303 22.511 1.00 52.11  ? 172 GLU A OE1 1 
ATOM   1354 O OE2 . GLU A 1 170 ? 29.497 45.085 22.637 1.00 52.11  ? 172 GLU A OE2 1 
ATOM   1355 N N   . ASP A 1 171 ? 34.433 47.206 25.143 1.00 19.34  ? 173 ASP A N   1 
ATOM   1356 C CA  . ASP A 1 171 ? 35.457 48.287 24.892 1.00 17.98  ? 173 ASP A CA  1 
ATOM   1357 C C   . ASP A 1 171 ? 36.792 47.898 25.531 1.00 24.59  ? 173 ASP A C   1 
ATOM   1358 O O   . ASP A 1 171 ? 37.741 48.679 25.553 1.00 26.08  ? 173 ASP A O   1 
ATOM   1359 C CB  . ASP A 1 171 ? 34.992 49.607 25.468 1.00 22.38  ? 173 ASP A CB  1 
ATOM   1360 C CG  . ASP A 1 171 ? 34.872 49.560 26.970 1.00 28.78  ? 173 ASP A CG  1 
ATOM   1361 O OD1 . ASP A 1 171 ? 35.134 48.494 27.577 1.00 37.92  ? 173 ASP A OD1 1 
ATOM   1362 O OD2 . ASP A 1 171 ? 34.507 50.616 27.527 1.00 29.50  ? 173 ASP A OD2 1 
ATOM   1363 N N   . GLY A 1 172 ? 36.866 46.643 26.092 1.00 26.71  ? 174 GLY A N   1 
ATOM   1364 C CA  . GLY A 1 172 ? 38.113 46.160 26.688 1.00 19.61  ? 174 GLY A CA  1 
ATOM   1365 C C   . GLY A 1 172 ? 38.163 46.259 28.208 1.00 18.45  ? 174 GLY A C   1 
ATOM   1366 O O   . GLY A 1 172 ? 39.076 45.734 28.843 1.00 18.11  ? 174 GLY A O   1 
ATOM   1367 N N   . SER A 1 173 ? 37.156 46.954 28.795 1.00 14.46  ? 175 SER A N   1 
ATOM   1368 C CA  . SER A 1 173 ? 37.180 47.094 30.250 1.00 12.39  ? 175 SER A CA  1 
ATOM   1369 C C   . SER A 1 173 ? 36.540 45.853 30.908 1.00 17.67  ? 175 SER A C   1 
ATOM   1370 O O   . SER A 1 173 ? 36.278 44.850 30.251 1.00 18.76  ? 175 SER A O   1 
ATOM   1371 C CB  . SER A 1 173 ? 36.452 48.350 30.644 1.00 13.38  ? 175 SER A CB  1 
ATOM   1372 O OG  . SER A 1 173 ? 36.733 48.581 32.028 1.00 23.92  ? 175 SER A OG  1 
ATOM   1373 N N   . VAL A 1 174 ? 36.293 45.950 32.226 1.00 13.79  ? 176 VAL A N   1 
ATOM   1374 C CA  . VAL A 1 174 ? 35.745 44.798 32.996 1.00 14.82  ? 176 VAL A CA  1 
ATOM   1375 C C   . VAL A 1 174 ? 34.507 45.242 33.798 1.00 21.82  ? 176 VAL A C   1 
ATOM   1376 O O   . VAL A 1 174 ? 34.482 46.333 34.346 1.00 19.52  ? 176 VAL A O   1 
ATOM   1377 C CB  . VAL A 1 174 ? 36.800 44.229 33.995 1.00 23.33  ? 176 VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 174 ? 36.130 43.321 34.978 1.00 28.21  ? 176 VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 174 ? 37.864 43.394 33.226 1.00 25.34  ? 176 VAL A CG2 1 
ATOM   1380 N N   . GLN A 1 175 ? 33.466 44.379 33.845 1.00 17.38  ? 177 GLN A N   1 
ATOM   1381 C CA  . GLN A 1 175 ? 32.266 44.678 34.664 1.00 15.77  ? 177 GLN A CA  1 
ATOM   1382 C C   . GLN A 1 175 ? 32.355 43.657 35.826 1.00 13.53  ? 177 GLN A C   1 
ATOM   1383 O O   . GLN A 1 175 ? 32.327 42.452 35.583 1.00 12.82  ? 177 GLN A O   1 
ATOM   1384 C CB  . GLN A 1 175 ? 30.980 44.411 33.863 1.00 16.19  ? 177 GLN A CB  1 
ATOM   1385 C CG  . GLN A 1 175 ? 29.692 44.341 34.745 1.00 15.51  ? 177 GLN A CG  1 
ATOM   1386 C CD  . GLN A 1 175 ? 29.328 45.686 35.366 1.00 20.78  ? 177 GLN A CD  1 
ATOM   1387 O OE1 . GLN A 1 175 ? 28.984 46.639 34.663 1.00 22.31  ? 177 GLN A OE1 1 
ATOM   1388 N NE2 . GLN A 1 175 ? 29.411 45.770 36.698 1.00 15.67  ? 177 GLN A NE2 1 
ATOM   1389 N N   . LEU A 1 176 ? 32.482 44.139 37.081 1.00 9.43   ? 178 LEU A N   1 
ATOM   1390 C CA  . LEU A 1 176 ? 32.596 43.231 38.246 1.00 16.46  ? 178 LEU A CA  1 
ATOM   1391 C C   . LEU A 1 176 ? 31.202 42.826 38.725 1.00 20.70  ? 178 LEU A C   1 
ATOM   1392 O O   . LEU A 1 176 ? 30.276 43.643 38.670 1.00 17.79  ? 178 LEU A O   1 
ATOM   1393 C CB  . LEU A 1 176 ? 33.296 43.998 39.356 1.00 21.25  ? 178 LEU A CB  1 
ATOM   1394 C CG  . LEU A 1 176 ? 34.576 43.413 39.905 1.00 41.50  ? 178 LEU A CG  1 
ATOM   1395 C CD1 . LEU A 1 176 ? 34.258 42.212 40.758 1.00 45.57  ? 178 LEU A CD1 1 
ATOM   1396 C CD2 . LEU A 1 176 ? 35.478 43.062 38.731 1.00 52.81  ? 178 LEU A CD2 1 
ATOM   1397 N N   . ALA A 1 177 ? 31.042 41.551 39.157 1.00 16.55  ? 179 ALA A N   1 
ATOM   1398 C CA  . ALA A 1 177 ? 29.741 41.081 39.680 1.00 13.81  ? 179 ALA A CA  1 
ATOM   1399 C C   . ALA A 1 177 ? 30.108 40.349 40.972 1.00 13.27  ? 179 ALA A C   1 
ATOM   1400 O O   . ALA A 1 177 ? 30.642 39.288 40.926 1.00 12.86  ? 179 ALA A O   1 
ATOM   1401 C CB  . ALA A 1 177 ? 29.094 40.119 38.711 1.00 15.57  ? 179 ALA A CB  1 
ATOM   1402 N N   . ASP A 1 178 ? 29.862 41.011 42.139 1.00 9.16   ? 180 ASP A N   1 
ATOM   1403 C CA  . ASP A 1 178 ? 30.234 40.443 43.444 1.00 8.62   ? 180 ASP A CA  1 
ATOM   1404 C C   . ASP A 1 178 ? 29.127 39.486 43.851 1.00 18.21  ? 180 ASP A C   1 
ATOM   1405 O O   . ASP A 1 178 ? 27.990 39.887 43.950 1.00 16.21  ? 180 ASP A O   1 
ATOM   1406 C CB  . ASP A 1 178 ? 30.242 41.557 44.434 1.00 10.99  ? 180 ASP A CB  1 
ATOM   1407 C CG  . ASP A 1 178 ? 31.608 42.187 44.605 1.00 41.07  ? 180 ASP A CG  1 
ATOM   1408 O OD1 . ASP A 1 178 ? 32.447 41.581 45.311 1.00 61.11  ? 180 ASP A OD1 1 
ATOM   1409 O OD2 . ASP A 1 178 ? 31.811 43.292 44.045 1.00 43.55  ? 180 ASP A OD2 1 
ATOM   1410 N N   . HIS A 1 179 ? 29.475 38.245 44.123 1.00 10.64  ? 181 HIS A N   1 
ATOM   1411 C CA  . HIS A 1 179 ? 28.456 37.237 44.492 1.00 7.21   ? 181 HIS A CA  1 
ATOM   1412 C C   . HIS A 1 179 ? 28.525 36.880 45.993 1.00 10.58  ? 181 HIS A C   1 
ATOM   1413 O O   . HIS A 1 179 ? 29.617 36.548 46.512 1.00 12.66  ? 181 HIS A O   1 
ATOM   1414 C CB  . HIS A 1 179 ? 28.758 35.926 43.735 1.00 10.43  ? 181 HIS A CB  1 
ATOM   1415 C CG  . HIS A 1 179 ? 28.389 35.933 42.273 1.00 11.87  ? 181 HIS A CG  1 
ATOM   1416 N ND1 . HIS A 1 179 ? 28.895 36.839 41.358 1.00 14.32  ? 181 HIS A ND1 1 
ATOM   1417 C CD2 . HIS A 1 179 ? 27.551 35.126 41.579 1.00 12.75  ? 181 HIS A CD2 1 
ATOM   1418 C CE1 . HIS A 1 179 ? 28.373 36.583 40.161 1.00 12.12  ? 181 HIS A CE1 1 
ATOM   1419 N NE2 . HIS A 1 179 ? 27.565 35.547 40.264 1.00 12.66  ? 181 HIS A NE2 1 
ATOM   1420 N N   . TYR A 1 180 ? 27.368 36.963 46.701 1.00 10.77  ? 182 TYR A N   1 
ATOM   1421 C CA  . TYR A 1 180 ? 27.254 36.533 48.105 1.00 14.87  ? 182 TYR A CA  1 
ATOM   1422 C C   . TYR A 1 180 ? 26.264 35.363 47.965 1.00 19.81  ? 182 TYR A C   1 
ATOM   1423 O O   . TYR A 1 180 ? 25.203 35.512 47.379 1.00 17.56  ? 182 TYR A O   1 
ATOM   1424 C CB  . TYR A 1 180 ? 26.688 37.660 48.961 1.00 17.17  ? 182 TYR A CB  1 
ATOM   1425 C CG  . TYR A 1 180 ? 27.729 38.737 49.039 1.00 33.90  ? 182 TYR A CG  1 
ATOM   1426 C CD1 . TYR A 1 180 ? 28.616 38.796 50.107 1.00 37.81  ? 182 TYR A CD1 1 
ATOM   1427 C CD2 . TYR A 1 180 ? 27.897 39.644 47.992 1.00 41.46  ? 182 TYR A CD2 1 
ATOM   1428 C CE1 . TYR A 1 180 ? 29.656 39.744 50.132 1.00 42.97  ? 182 TYR A CE1 1 
ATOM   1429 C CE2 . TYR A 1 180 ? 28.928 40.577 48.010 1.00 43.62  ? 182 TYR A CE2 1 
ATOM   1430 C CZ  . TYR A 1 180 ? 29.799 40.621 49.085 1.00 48.31  ? 182 TYR A CZ  1 
ATOM   1431 O OH  . TYR A 1 180 ? 30.800 41.550 49.118 1.00 62.07  ? 182 TYR A OH  1 
ATOM   1432 N N   . GLN A 1 181 ? 26.579 34.221 48.564 1.00 12.93  ? 183 GLN A N   1 
ATOM   1433 C CA  . GLN A 1 181 ? 25.777 33.000 48.374 1.00 11.67  ? 183 GLN A CA  1 
ATOM   1434 C C   . GLN A 1 181 ? 25.642 32.225 49.687 1.00 14.47  ? 183 GLN A C   1 
ATOM   1435 O O   . GLN A 1 181 ? 26.590 32.172 50.495 1.00 13.64  ? 183 GLN A O   1 
ATOM   1436 C CB  . GLN A 1 181 ? 26.580 32.098 47.373 1.00 10.28  ? 183 GLN A CB  1 
ATOM   1437 C CG  . GLN A 1 181 ? 25.927 30.759 47.079 1.00 14.05  ? 183 GLN A CG  1 
ATOM   1438 C CD  . GLN A 1 181 ? 26.747 29.887 46.117 1.00 20.01  ? 183 GLN A CD  1 
ATOM   1439 O OE1 . GLN A 1 181 ? 27.429 30.414 45.252 1.00 12.58  ? 183 GLN A OE1 1 
ATOM   1440 N NE2 . GLN A 1 181 ? 26.654 28.566 46.235 1.00 11.58  ? 183 GLN A NE2 1 
ATOM   1441 N N   . GLN A 1 182 ? 24.485 31.607 49.864 1.00 15.84  ? 184 GLN A N   1 
ATOM   1442 C CA  . GLN A 1 182 ? 24.189 30.740 51.061 1.00 13.56  ? 184 GLN A CA  1 
ATOM   1443 C C   . GLN A 1 182 ? 23.519 29.495 50.552 1.00 16.85  ? 184 GLN A C   1 
ATOM   1444 O O   . GLN A 1 182 ? 22.614 29.571 49.728 1.00 16.79  ? 184 GLN A O   1 
ATOM   1445 C CB  . GLN A 1 182 ? 23.199 31.422 52.015 1.00 59.98  ? 184 GLN A CB  1 
ATOM   1446 C CG  . GLN A 1 182 ? 23.805 32.186 53.159 1.00 78.97  ? 184 GLN A CG  1 
ATOM   1447 C CD  . GLN A 1 182 ? 24.120 31.305 54.363 1.00 65.36  ? 184 GLN A CD  1 
ATOM   1448 O OE1 . GLN A 1 182 ? 24.630 31.790 55.383 1.00 65.36  ? 184 GLN A OE1 1 
ATOM   1449 N NE2 . GLN A 1 182 ? 23.826 30.005 54.252 1.00 65.36  ? 184 GLN A NE2 1 
ATOM   1450 N N   . ASN A 1 183 ? 23.917 28.304 51.090 1.00 12.11  ? 185 ASN A N   1 
ATOM   1451 C CA  . ASN A 1 183 ? 23.255 27.078 50.704 1.00 10.56  ? 185 ASN A CA  1 
ATOM   1452 C C   . ASN A 1 183 ? 22.839 26.382 52.010 1.00 22.35  ? 185 ASN A C   1 
ATOM   1453 O O   . ASN A 1 183 ? 23.620 26.281 52.953 1.00 23.47  ? 185 ASN A O   1 
ATOM   1454 C CB  . ASN A 1 183 ? 24.203 26.133 49.995 1.00 17.10  ? 185 ASN A CB  1 
ATOM   1455 C CG  . ASN A 1 183 ? 24.628 26.647 48.626 1.00 17.86  ? 185 ASN A CG  1 
ATOM   1456 O OD1 . ASN A 1 183 ? 25.239 27.696 48.501 1.00 25.50  ? 185 ASN A OD1 1 
ATOM   1457 N ND2 . ASN A 1 183 ? 24.316 25.852 47.577 1.00 15.95  ? 185 ASN A ND2 1 
ATOM   1458 N N   . THR A 1 184 ? 21.644 25.864 52.016 1.00 15.40  ? 186 THR A N   1 
ATOM   1459 C CA  . THR A 1 184 ? 21.172 25.134 53.210 1.00 14.19  ? 186 THR A CA  1 
ATOM   1460 C C   . THR A 1 184 ? 20.454 23.915 52.710 1.00 17.28  ? 186 THR A C   1 
ATOM   1461 O O   . THR A 1 184 ? 19.753 23.941 51.692 1.00 20.02  ? 186 THR A O   1 
ATOM   1462 C CB  . THR A 1 184 ? 20.198 26.013 54.029 1.00 24.12  ? 186 THR A CB  1 
ATOM   1463 O OG1 . THR A 1 184 ? 19.237 26.596 53.147 1.00 35.54  ? 186 THR A OG1 1 
ATOM   1464 C CG2 . THR A 1 184 ? 20.978 27.125 54.726 1.00 20.94  ? 186 THR A CG2 1 
ATOM   1465 N N   . PRO A 1 185 ? 20.568 22.818 53.444 1.00 13.93  ? 187 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 185 ? 19.909 21.588 52.998 1.00 14.91  ? 187 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 185 ? 18.379 21.672 53.059 1.00 19.58  ? 187 PRO A C   1 
ATOM   1468 O O   . PRO A 1 185 ? 17.822 22.373 53.911 1.00 24.42  ? 187 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 185 ? 20.477 20.529 53.939 1.00 25.60  ? 187 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 185 ? 20.814 21.286 55.184 1.00 31.09  ? 187 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 185 ? 21.220 22.670 54.767 1.00 25.11  ? 187 PRO A CD  1 
ATOM   1472 N N   . ILE A 1 186 ? 17.719 20.937 52.185 1.00 16.23  ? 188 ILE A N   1 
ATOM   1473 C CA  . ILE A 1 186 ? 16.232 20.842 52.156 1.00 15.87  ? 188 ILE A CA  1 
ATOM   1474 C C   . ILE A 1 186 ? 15.842 19.749 53.183 1.00 26.13  ? 188 ILE A C   1 
ATOM   1475 O O   . ILE A 1 186 ? 14.915 19.927 53.964 1.00 33.75  ? 188 ILE A O   1 
ATOM   1476 C CB  . ILE A 1 186 ? 15.759 20.442 50.751 1.00 20.78  ? 188 ILE A CB  1 
ATOM   1477 C CG1 . ILE A 1 186 ? 16.017 21.623 49.822 1.00 18.98  ? 188 ILE A CG1 1 
ATOM   1478 C CG2 . ILE A 1 186 ? 14.268 20.021 50.734 1.00 26.20  ? 188 ILE A CG2 1 
ATOM   1479 C CD1 . ILE A 1 186 ? 15.645 21.397 48.364 1.00 22.68  ? 188 ILE A CD1 1 
ATOM   1480 N N   . GLY A 1 187 ? 16.565 18.630 53.216 1.00 38.56  ? 189 GLY A N   1 
ATOM   1481 C CA  . GLY A 1 187 ? 16.193 17.622 54.202 1.00 40.40  ? 189 GLY A CA  1 
ATOM   1482 C C   . GLY A 1 187 ? 16.535 17.991 55.643 1.00 45.60  ? 189 GLY A C   1 
ATOM   1483 O O   . GLY A 1 187 ? 17.081 19.070 55.926 1.00 39.19  ? 189 GLY A O   1 
ATOM   1484 N N   . ASP A 1 188 ? 16.175 17.101 56.595 1.00 46.58  ? 190 ASP A N   1 
ATOM   1485 C CA  . ASP A 1 188 ? 16.549 17.325 57.989 1.00 51.35  ? 190 ASP A CA  1 
ATOM   1486 C C   . ASP A 1 188 ? 17.686 16.313 58.271 1.00 54.03  ? 190 ASP A C   1 
ATOM   1487 O O   . ASP A 1 188 ? 18.120 16.121 59.397 1.00 57.60  ? 190 ASP A O   1 
ATOM   1488 C CB  . ASP A 1 188 ? 15.348 17.098 58.913 1.00 102.36 ? 190 ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 188 ? 14.530 15.884 58.517 1.00 113.40 ? 190 ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 188 ? 13.278 15.973 58.535 1.00 115.39 ? 190 ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 188 ? 15.138 14.840 58.194 1.00 70.49  ? 190 ASP A OD2 1 
ATOM   1492 N N   . GLY A 1 189 ? 18.162 15.671 57.179 1.00 36.83  ? 191 GLY A N   1 
ATOM   1493 C CA  . GLY A 1 189 ? 19.226 14.689 57.244 1.00 35.69  ? 191 GLY A CA  1 
ATOM   1494 C C   . GLY A 1 189 ? 20.572 15.340 57.474 1.00 28.10  ? 191 GLY A C   1 
ATOM   1495 O O   . GLY A 1 189 ? 20.716 16.570 57.385 1.00 29.76  ? 191 GLY A O   1 
ATOM   1496 N N   . PRO A 1 190 ? 21.596 14.525 57.789 1.00 24.40  ? 192 PRO A N   1 
ATOM   1497 C CA  . PRO A 1 190 ? 22.895 15.162 58.013 1.00 22.65  ? 192 PRO A CA  1 
ATOM   1498 C C   . PRO A 1 190 ? 23.633 15.556 56.742 1.00 23.51  ? 192 PRO A C   1 
ATOM   1499 O O   . PRO A 1 190 ? 23.466 14.928 55.686 1.00 23.83  ? 192 PRO A O   1 
ATOM   1500 C CB  . PRO A 1 190 ? 23.685 14.118 58.792 1.00 23.50  ? 192 PRO A CB  1 
ATOM   1501 C CG  . PRO A 1 190 ? 23.002 12.817 58.526 1.00 25.70  ? 192 PRO A CG  1 
ATOM   1502 C CD  . PRO A 1 190 ? 21.531 13.149 58.335 1.00 24.05  ? 192 PRO A CD  1 
ATOM   1503 N N   . VAL A 1 191 ? 24.456 16.615 56.871 1.00 16.81  ? 193 VAL A N   1 
ATOM   1504 C CA  . VAL A 1 191 ? 25.300 16.998 55.727 1.00 15.20  ? 193 VAL A CA  1 
ATOM   1505 C C   . VAL A 1 191 ? 26.727 17.179 56.234 1.00 22.45  ? 193 VAL A C   1 
ATOM   1506 O O   . VAL A 1 191 ? 26.947 17.299 57.433 1.00 25.31  ? 193 VAL A O   1 
ATOM   1507 C CB  . VAL A 1 191 ? 24.826 18.308 55.100 1.00 27.62  ? 193 VAL A CB  1 
ATOM   1508 C CG1 . VAL A 1 191 ? 23.480 18.113 54.465 1.00 25.24  ? 193 VAL A CG1 1 
ATOM   1509 C CG2 . VAL A 1 191 ? 24.762 19.392 56.161 1.00 27.82  ? 193 VAL A CG2 1 
ATOM   1510 N N   . LEU A 1 192 ? 27.723 17.256 55.271 1.00 17.52  ? 194 LEU A N   1 
ATOM   1511 C CA  . LEU A 1 192 ? 29.117 17.459 55.619 1.00 17.05  ? 194 LEU A CA  1 
ATOM   1512 C C   . LEU A 1 192 ? 29.375 18.928 55.656 1.00 19.20  ? 194 LEU A C   1 
ATOM   1513 O O   . LEU A 1 192 ? 29.030 19.625 54.712 1.00 20.57  ? 194 LEU A O   1 
ATOM   1514 C CB  . LEU A 1 192 ? 30.020 16.788 54.548 1.00 29.04  ? 194 LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 192 ? 30.307 15.295 54.663 1.00 34.04  ? 194 LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 192 ? 29.105 14.590 55.194 1.00 39.94  ? 194 LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 192 ? 30.735 14.729 53.278 1.00 27.32  ? 194 LEU A CD2 1 
ATOM   1518 N N   . LEU A 1 193 ? 29.983 19.435 56.769 1.00 18.43  ? 195 LEU A N   1 
ATOM   1519 C CA  . LEU A 1 193 ? 30.288 20.868 56.874 1.00 19.29  ? 195 LEU A CA  1 
ATOM   1520 C C   . LEU A 1 193 ? 31.778 20.938 56.578 1.00 26.04  ? 195 LEU A C   1 
ATOM   1521 O O   . LEU A 1 193 ? 32.576 20.329 57.274 1.00 25.83  ? 195 LEU A O   1 
ATOM   1522 C CB  . LEU A 1 193 ? 29.945 21.398 58.273 1.00 27.62  ? 195 LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 193 ? 28.417 21.382 58.431 1.00 34.48  ? 195 LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 193 ? 28.016 21.951 59.790 1.00 41.92  ? 195 LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 193 ? 27.754 22.189 57.312 1.00 30.42  ? 195 LEU A CD2 1 
ATOM   1526 N N   . PRO A 1 194 ? 32.171 21.720 55.540 1.00 12.31  ? 196 PRO A N   1 
ATOM   1527 C CA  . PRO A 1 194 ? 33.588 21.800 55.180 1.00 11.61  ? 196 PRO A CA  1 
ATOM   1528 C C   . PRO A 1 194 ? 34.523 22.741 55.873 1.00 21.41  ? 196 PRO A C   1 
ATOM   1529 O O   . PRO A 1 194 ? 34.125 23.746 56.441 1.00 20.89  ? 196 PRO A O   1 
ATOM   1530 C CB  . PRO A 1 194 ? 33.543 22.213 53.705 1.00 19.59  ? 196 PRO A CB  1 
ATOM   1531 C CG  . PRO A 1 194 ? 32.328 23.246 53.709 1.00 20.98  ? 196 PRO A CG  1 
ATOM   1532 C CD  . PRO A 1 194 ? 31.325 22.600 54.680 1.00 18.12  ? 196 PRO A CD  1 
ATOM   1533 N N   . ASP A 1 195 ? 35.791 22.418 55.752 1.00 19.07  ? 197 ASP A N   1 
ATOM   1534 C CA  . ASP A 1 195 ? 36.846 23.348 56.163 1.00 14.76  ? 197 ASP A CA  1 
ATOM   1535 C C   . ASP A 1 195 ? 36.864 24.342 54.962 1.00 20.84  ? 197 ASP A C   1 
ATOM   1536 O O   . ASP A 1 195 ? 36.370 24.027 53.839 1.00 18.37  ? 197 ASP A O   1 
ATOM   1537 C CB  . ASP A 1 195 ? 38.242 22.666 56.162 1.00 20.96  ? 197 ASP A CB  1 
ATOM   1538 C CG  . ASP A 1 195 ? 38.605 22.039 57.507 1.00 32.49  ? 197 ASP A CG  1 
ATOM   1539 O OD1 . ASP A 1 195 ? 37.688 21.687 58.266 1.00 43.91  ? 197 ASP A OD1 1 
ATOM   1540 O OD2 . ASP A 1 195 ? 39.838 21.914 57.749 1.00 31.48  ? 197 ASP A OD2 1 
ATOM   1541 N N   . ASN A 1 196 ? 37.525 25.471 55.155 1.00 19.75  ? 198 ASN A N   1 
ATOM   1542 C CA  . ASN A 1 196 ? 37.607 26.495 54.110 1.00 13.67  ? 198 ASN A CA  1 
ATOM   1543 C C   . ASN A 1 196 ? 38.373 25.956 52.914 1.00 17.09  ? 198 ASN A C   1 
ATOM   1544 O O   . ASN A 1 196 ? 39.479 25.408 53.029 1.00 20.89  ? 198 ASN A O   1 
ATOM   1545 C CB  . ASN A 1 196 ? 38.367 27.713 54.596 1.00 13.30  ? 198 ASN A CB  1 
ATOM   1546 C CG  . ASN A 1 196 ? 37.597 28.522 55.621 1.00 31.19  ? 198 ASN A CG  1 
ATOM   1547 O OD1 . ASN A 1 196 ? 36.650 28.052 56.210 1.00 29.88  ? 198 ASN A OD1 1 
ATOM   1548 N ND2 . ASN A 1 196 ? 38.040 29.737 55.848 1.00 49.89  ? 198 ASN A ND2 1 
ATOM   1549 N N   . HIS A 1 197 ? 37.749 26.079 51.714 1.00 14.74  ? 199 HIS A N   1 
ATOM   1550 C CA  . HIS A 1 197 ? 38.456 25.660 50.518 1.00 13.68  ? 199 HIS A CA  1 
ATOM   1551 C C   . HIS A 1 197 ? 37.866 26.459 49.345 1.00 17.70  ? 199 HIS A C   1 
ATOM   1552 O O   . HIS A 1 197 ? 37.122 27.388 49.556 1.00 18.82  ? 199 HIS A O   1 
ATOM   1553 C CB  . HIS A 1 197 ? 38.337 24.162 50.249 1.00 14.11  ? 199 HIS A CB  1 
ATOM   1554 C CG  . HIS A 1 197 ? 36.932 23.656 50.057 1.00 19.56  ? 199 HIS A CG  1 
ATOM   1555 N ND1 . HIS A 1 197 ? 36.010 23.586 51.075 1.00 21.69  ? 199 HIS A ND1 1 
ATOM   1556 C CD2 . HIS A 1 197 ? 36.295 23.226 48.941 1.00 21.10  ? 199 HIS A CD2 1 
ATOM   1557 C CE1 . HIS A 1 197 ? 34.860 23.131 50.594 1.00 19.36  ? 199 HIS A CE1 1 
ATOM   1558 N NE2 . HIS A 1 197 ? 35.005 22.909 49.296 1.00 18.28  ? 199 HIS A NE2 1 
ATOM   1559 N N   . TYR A 1 198 ? 38.293 26.129 48.129 1.00 11.78  ? 200 TYR A N   1 
ATOM   1560 C CA  . TYR A 1 198 ? 37.678 26.855 46.989 1.00 15.46  ? 200 TYR A CA  1 
ATOM   1561 C C   . TYR A 1 198 ? 37.519 25.915 45.805 1.00 17.22  ? 200 TYR A C   1 
ATOM   1562 O O   . TYR A 1 198 ? 38.083 24.816 45.763 1.00 19.99  ? 200 TYR A O   1 
ATOM   1563 C CB  . TYR A 1 198 ? 38.509 28.073 46.607 1.00 19.76  ? 200 TYR A CB  1 
ATOM   1564 C CG  . TYR A 1 198 ? 39.902 27.762 46.160 1.00 20.69  ? 200 TYR A CG  1 
ATOM   1565 C CD1 . TYR A 1 198 ? 40.209 27.579 44.798 1.00 20.91  ? 200 TYR A CD1 1 
ATOM   1566 C CD2 . TYR A 1 198 ? 40.937 27.655 47.105 1.00 24.58  ? 200 TYR A CD2 1 
ATOM   1567 C CE1 . TYR A 1 198 ? 41.512 27.293 44.388 1.00 31.14  ? 200 TYR A CE1 1 
ATOM   1568 C CE2 . TYR A 1 198 ? 42.225 27.381 46.711 1.00 25.72  ? 200 TYR A CE2 1 
ATOM   1569 C CZ  . TYR A 1 198 ? 42.524 27.197 45.346 1.00 41.47  ? 200 TYR A CZ  1 
ATOM   1570 O OH  . TYR A 1 198 ? 43.830 26.946 44.954 1.00 45.38  ? 200 TYR A OH  1 
ATOM   1571 N N   . LEU A 1 199 ? 36.690 26.404 44.807 1.00 13.86  ? 201 LEU A N   1 
ATOM   1572 C CA  . LEU A 1 199 ? 36.459 25.625 43.587 1.00 11.90  ? 201 LEU A CA  1 
ATOM   1573 C C   . LEU A 1 199 ? 37.110 26.488 42.523 1.00 20.00  ? 201 LEU A C   1 
ATOM   1574 O O   . LEU A 1 199 ? 36.948 27.726 42.548 1.00 16.06  ? 201 LEU A O   1 
ATOM   1575 C CB  . LEU A 1 199 ? 34.976 25.546 43.271 1.00 10.54  ? 201 LEU A CB  1 
ATOM   1576 C CG  . LEU A 1 199 ? 34.133 24.860 44.369 1.00 16.24  ? 201 LEU A CG  1 
ATOM   1577 C CD1 . LEU A 1 199 ? 32.679 24.754 43.844 1.00 16.60  ? 201 LEU A CD1 1 
ATOM   1578 C CD2 . LEU A 1 199 ? 34.661 23.442 44.710 1.00 21.32  ? 201 LEU A CD2 1 
ATOM   1579 N N   . SER A 1 200 ? 37.834 25.847 41.613 1.00 14.71  ? 202 SER A N   1 
ATOM   1580 C CA  . SER A 1 200 ? 38.511 26.534 40.489 1.00 10.17  ? 202 SER A CA  1 
ATOM   1581 C C   . SER A 1 200 ? 37.597 26.238 39.308 1.00 14.29  ? 202 SER A C   1 
ATOM   1582 O O   . SER A 1 200 ? 37.359 25.082 38.973 1.00 15.86  ? 202 SER A O   1 
ATOM   1583 C CB  . SER A 1 200 ? 39.895 25.894 40.246 1.00 14.74  ? 202 SER A CB  1 
ATOM   1584 O OG  . SER A 1 200 ? 40.517 26.532 39.176 1.00 30.79  ? 202 SER A OG  1 
ATOM   1585 N N   . THR A 1 201 ? 37.129 27.305 38.618 1.00 16.41  ? 203 THR A N   1 
ATOM   1586 C CA  . THR A 1 201 ? 36.171 27.080 37.541 1.00 18.08  ? 203 THR A CA  1 
ATOM   1587 C C   . THR A 1 201 ? 36.678 27.603 36.246 1.00 19.06  ? 203 THR A C   1 
ATOM   1588 O O   . THR A 1 201 ? 37.473 28.518 36.200 1.00 21.10  ? 203 THR A O   1 
ATOM   1589 C CB  . THR A 1 201 ? 34.839 27.832 37.832 1.00 26.84  ? 203 THR A CB  1 
ATOM   1590 O OG1 . THR A 1 201 ? 35.091 29.240 37.726 1.00 24.80  ? 203 THR A OG1 1 
ATOM   1591 C CG2 . THR A 1 201 ? 34.373 27.552 39.203 1.00 10.81  ? 203 THR A CG2 1 
ATOM   1592 N N   . GLN A 1 202 ? 36.260 26.965 35.192 1.00 11.25  ? 204 GLN A N   1 
ATOM   1593 C CA  . GLN A 1 202 ? 36.597 27.409 33.820 1.00 15.77  ? 204 GLN A CA  1 
ATOM   1594 C C   . GLN A 1 202 ? 35.360 27.084 32.982 1.00 21.40  ? 204 GLN A C   1 
ATOM   1595 O O   . GLN A 1 202 ? 34.743 26.027 33.128 1.00 22.46  ? 204 GLN A O   1 
ATOM   1596 C CB  . GLN A 1 202 ? 37.858 26.715 33.285 1.00 26.29  ? 204 GLN A CB  1 
ATOM   1597 C CG  . GLN A 1 202 ? 37.867 25.235 33.373 1.00 52.32  ? 204 GLN A CG  1 
ATOM   1598 C CD  . GLN A 1 202 ? 39.221 24.664 32.979 1.00 73.19  ? 204 GLN A CD  1 
ATOM   1599 O OE1 . GLN A 1 202 ? 39.689 24.885 31.863 1.00 47.24  ? 204 GLN A OE1 1 
ATOM   1600 N NE2 . GLN A 1 202 ? 39.855 23.933 33.896 1.00 68.68  ? 204 GLN A NE2 1 
ATOM   1601 N N   . SER A 1 203 ? 34.975 28.030 32.113 1.00 15.24  ? 205 SER A N   1 
ATOM   1602 C CA  . SER A 1 203 ? 33.733 27.897 31.331 1.00 13.89  ? 205 SER A CA  1 
ATOM   1603 C C   . SER A 1 203 ? 34.022 28.353 29.892 1.00 20.04  ? 205 SER A C   1 
ATOM   1604 O O   . SER A 1 203 ? 34.830 29.279 29.694 1.00 22.22  ? 205 SER A O   1 
ATOM   1605 C CB  . SER A 1 203 ? 32.647 28.802 31.936 1.00 14.05  ? 205 SER A CB  1 
ATOM   1606 O OG  . SER A 1 203 ? 32.374 28.482 33.295 1.00 19.45  ? 205 SER A OG  1 
ATOM   1607 N N   . ALA A 1 204 ? 33.411 27.672 28.896 1.00 18.49  ? 206 ALA A N   1 
ATOM   1608 C CA  . ALA A 1 204 ? 33.559 28.058 27.460 1.00 14.97  ? 206 ALA A CA  1 
ATOM   1609 C C   . ALA A 1 204 ? 32.146 28.197 26.968 1.00 20.78  ? 206 ALA A C   1 
ATOM   1610 O O   . ALA A 1 204 ? 31.396 27.246 27.088 1.00 16.60  ? 206 ALA A O   1 
ATOM   1611 C CB  . ALA A 1 204 ? 34.239 26.933 26.664 1.00 15.43  ? 206 ALA A CB  1 
ATOM   1612 N N   . LEU A 1 205 ? 31.783 29.335 26.350 1.00 14.36  ? 207 LEU A N   1 
ATOM   1613 C CA  . LEU A 1 205 ? 30.394 29.523 25.862 1.00 9.96   ? 207 LEU A CA  1 
ATOM   1614 C C   . LEU A 1 205 ? 30.450 29.429 24.328 1.00 18.48  ? 207 LEU A C   1 
ATOM   1615 O O   . LEU A 1 205 ? 31.401 29.931 23.689 1.00 17.45  ? 207 LEU A O   1 
ATOM   1616 C CB  . LEU A 1 205 ? 29.916 30.937 26.162 1.00 16.81  ? 207 LEU A CB  1 
ATOM   1617 C CG  . LEU A 1 205 ? 30.147 31.389 27.597 1.00 20.84  ? 207 LEU A CG  1 
ATOM   1618 C CD1 . LEU A 1 205 ? 29.588 32.857 27.778 1.00 22.36  ? 207 LEU A CD1 1 
ATOM   1619 C CD2 . LEU A 1 205 ? 29.490 30.446 28.491 1.00 26.26  ? 207 LEU A CD2 1 
ATOM   1620 N N   . SER A 1 206 ? 29.449 28.827 23.741 1.00 15.95  ? 208 SER A N   1 
ATOM   1621 C CA  . SER A 1 206 ? 29.482 28.729 22.280 1.00 15.75  ? 208 SER A CA  1 
ATOM   1622 C C   . SER A 1 206 ? 28.065 28.805 21.800 1.00 18.38  ? 208 SER A C   1 
ATOM   1623 O O   . SER A 1 206 ? 27.134 29.094 22.558 1.00 16.98  ? 208 SER A O   1 
ATOM   1624 C CB  . SER A 1 206 ? 30.161 27.415 21.835 1.00 19.49  ? 208 SER A CB  1 
ATOM   1625 O OG  . SER A 1 206 ? 29.517 26.295 22.400 1.00 44.85  ? 208 SER A OG  1 
ATOM   1626 N N   . LYS A 1 207 ? 27.877 28.638 20.445 1.00 15.49  ? 209 LYS A N   1 
ATOM   1627 C CA  . LYS A 1 207 ? 26.484 28.696 19.912 1.00 19.46  ? 209 LYS A CA  1 
ATOM   1628 C C   . LYS A 1 207 ? 26.304 27.451 19.043 1.00 32.17  ? 209 LYS A C   1 
ATOM   1629 O O   . LYS A 1 207 ? 27.278 26.874 18.563 1.00 32.34  ? 209 LYS A O   1 
ATOM   1630 C CB  . LYS A 1 207 ? 26.261 29.914 19.016 1.00 19.25  ? 209 LYS A CB  1 
ATOM   1631 C CG  . LYS A 1 207 ? 26.367 31.296 19.692 1.00 33.49  ? 209 LYS A CG  1 
ATOM   1632 C CD  . LYS A 1 207 ? 25.149 31.594 20.516 1.00 27.47  ? 209 LYS A CD  1 
ATOM   1633 C CE  . LYS A 1 207 ? 25.184 33.016 21.061 1.00 14.82  ? 209 LYS A CE  1 
ATOM   1634 N NZ  . LYS A 1 207 ? 24.054 33.275 22.000 1.00 25.38  ? 209 LYS A NZ  1 
ATOM   1635 N N   . ASP A 1 208 ? 25.034 27.070 18.867 1.00 31.44  ? 210 ASP A N   1 
ATOM   1636 C CA  . ASP A 1 208 ? 24.644 25.905 18.063 1.00 25.31  ? 210 ASP A CA  1 
ATOM   1637 C C   . ASP A 1 208 ? 24.343 26.576 16.698 1.00 28.63  ? 210 ASP A C   1 
ATOM   1638 O O   . ASP A 1 208 ? 23.476 27.476 16.571 1.00 23.22  ? 210 ASP A O   1 
ATOM   1639 C CB  . ASP A 1 208 ? 23.428 25.272 18.740 1.00 24.37  ? 210 ASP A CB  1 
ATOM   1640 C CG  . ASP A 1 208 ? 22.797 24.131 17.925 1.00 36.41  ? 210 ASP A CG  1 
ATOM   1641 O OD1 . ASP A 1 208 ? 23.259 23.921 16.794 1.00 32.79  ? 210 ASP A OD1 1 
ATOM   1642 O OD2 . ASP A 1 208 ? 21.850 23.483 18.418 1.00 50.42  ? 210 ASP A OD2 1 
ATOM   1643 N N   . PRO A 1 209 ? 25.101 26.185 15.668 1.00 37.98  ? 211 PRO A N   1 
ATOM   1644 C CA  . PRO A 1 209 ? 24.877 26.794 14.351 1.00 38.25  ? 211 PRO A CA  1 
ATOM   1645 C C   . PRO A 1 209 ? 23.480 26.596 13.787 1.00 42.78  ? 211 PRO A C   1 
ATOM   1646 O O   . PRO A 1 209 ? 22.998 27.426 13.025 1.00 41.32  ? 211 PRO A O   1 
ATOM   1647 C CB  . PRO A 1 209 ? 25.961 26.158 13.483 1.00 44.29  ? 211 PRO A CB  1 
ATOM   1648 C CG  . PRO A 1 209 ? 26.251 24.832 14.189 1.00 50.19  ? 211 PRO A CG  1 
ATOM   1649 C CD  . PRO A 1 209 ? 26.189 25.195 15.641 1.00 44.78  ? 211 PRO A CD  1 
ATOM   1650 N N   . ASN A 1 210 ? 22.808 25.513 14.203 1.00 39.96  ? 212 ASN A N   1 
ATOM   1651 C CA  . ASN A 1 210 ? 21.475 25.221 13.679 1.00 42.24  ? 212 ASN A CA  1 
ATOM   1652 C C   . ASN A 1 210 ? 20.325 25.742 14.501 1.00 45.08  ? 212 ASN A C   1 
ATOM   1653 O O   . ASN A 1 210 ? 19.145 25.586 14.145 1.00 42.67  ? 212 ASN A O   1 
ATOM   1654 C CB  . ASN A 1 210 ? 21.341 23.715 13.484 1.00 88.33  ? 212 ASN A CB  1 
ATOM   1655 C CG  . ASN A 1 210 ? 22.284 23.189 12.412 1.00 102.49 ? 212 ASN A CG  1 
ATOM   1656 O OD1 . ASN A 1 210 ? 23.508 23.296 12.532 1.00 70.79  ? 212 ASN A OD1 1 
ATOM   1657 N ND2 . ASN A 1 210 ? 21.715 22.627 11.350 1.00 70.79  ? 212 ASN A ND2 1 
ATOM   1658 N N   . GLU A 1 211 ? 20.654 26.410 15.600 1.00 29.51  ? 213 GLU A N   1 
ATOM   1659 C CA  . GLU A 1 211 ? 19.596 26.897 16.456 1.00 20.43  ? 213 GLU A CA  1 
ATOM   1660 C C   . GLU A 1 211 ? 19.177 28.312 16.185 1.00 32.10  ? 213 GLU A C   1 
ATOM   1661 O O   . GLU A 1 211 ? 20.006 29.205 16.172 1.00 36.92  ? 213 GLU A O   1 
ATOM   1662 C CB  . GLU A 1 211 ? 20.057 26.713 17.931 1.00 18.28  ? 213 GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 211 ? 19.094 27.215 18.927 1.00 18.15  ? 213 GLU A CG  1 
ATOM   1664 C CD  . GLU A 1 211 ? 17.788 26.443 18.905 1.00 35.52  ? 213 GLU A CD  1 
ATOM   1665 O OE1 . GLU A 1 211 ? 17.803 25.249 19.236 1.00 25.67  ? 213 GLU A OE1 1 
ATOM   1666 O OE2 . GLU A 1 211 ? 16.743 27.025 18.601 1.00 28.90  ? 213 GLU A OE2 1 
ATOM   1667 N N   . LYS A 1 212 ? 17.856 28.548 16.039 1.00 28.21  ? 214 LYS A N   1 
ATOM   1668 C CA  . LYS A 1 212 ? 17.375 29.901 15.764 1.00 31.36  ? 214 LYS A CA  1 
ATOM   1669 C C   . LYS A 1 212 ? 16.865 30.637 16.999 1.00 29.52  ? 214 LYS A C   1 
ATOM   1670 O O   . LYS A 1 212 ? 16.666 31.846 17.001 1.00 31.11  ? 214 LYS A O   1 
ATOM   1671 C CB  . LYS A 1 212 ? 16.293 29.841 14.670 1.00 67.45  ? 214 LYS A CB  1 
ATOM   1672 C CG  . LYS A 1 212 ? 16.761 29.118 13.419 1.00 112.20 ? 214 LYS A CG  1 
ATOM   1673 C CD  . LYS A 1 212 ? 15.769 29.273 12.296 1.00 124.45 ? 214 LYS A CD  1 
ATOM   1674 C CE  . LYS A 1 212 ? 15.632 30.734 11.909 1.00 55.36  ? 214 LYS A CE  1 
ATOM   1675 N NZ  . LYS A 1 212 ? 16.888 31.288 11.296 1.00 55.36  ? 214 LYS A NZ  1 
ATOM   1676 N N   . ARG A 1 213 ? 16.620 29.884 18.075 1.00 15.74  ? 215 ARG A N   1 
ATOM   1677 C CA  . ARG A 1 213 ? 16.189 30.492 19.303 1.00 16.70  ? 215 ARG A CA  1 
ATOM   1678 C C   . ARG A 1 213 ? 17.380 31.152 20.012 1.00 19.73  ? 215 ARG A C   1 
ATOM   1679 O O   . ARG A 1 213 ? 18.502 30.794 19.767 1.00 23.05  ? 215 ARG A O   1 
ATOM   1680 C CB  . ARG A 1 213 ? 15.548 29.406 20.177 1.00 20.82  ? 215 ARG A CB  1 
ATOM   1681 C CG  . ARG A 1 213 ? 14.164 28.999 19.575 1.00 22.87  ? 215 ARG A CG  1 
ATOM   1682 C CD  . ARG A 1 213 ? 13.615 27.804 20.359 1.00 22.43  ? 215 ARG A CD  1 
ATOM   1683 N NE  . ARG A 1 213 ? 14.561 26.719 20.192 1.00 27.51  ? 215 ARG A NE  1 
ATOM   1684 C CZ  . ARG A 1 213 ? 14.453 25.501 20.788 1.00 29.42  ? 215 ARG A CZ  1 
ATOM   1685 N NH1 . ARG A 1 213 ? 13.427 25.236 21.597 1.00 23.54  ? 215 ARG A NH1 1 
ATOM   1686 N NH2 . ARG A 1 213 ? 15.364 24.579 20.519 1.00 21.52  ? 215 ARG A NH2 1 
ATOM   1687 N N   . ASP A 1 214 ? 17.102 32.110 20.897 1.00 16.92  ? 216 ASP A N   1 
ATOM   1688 C CA  . ASP A 1 214 ? 18.163 32.850 21.636 1.00 19.11  ? 216 ASP A CA  1 
ATOM   1689 C C   . ASP A 1 214 ? 18.662 31.769 22.589 1.00 23.25  ? 216 ASP A C   1 
ATOM   1690 O O   . ASP A 1 214 ? 17.856 31.222 23.347 1.00 17.97  ? 216 ASP A O   1 
ATOM   1691 C CB  . ASP A 1 214 ? 17.551 34.024 22.391 1.00 19.85  ? 216 ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 214 ? 18.596 35.056 22.824 1.00 23.45  ? 216 ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 214 ? 19.832 34.704 22.744 1.00 19.09  ? 216 ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 214 ? 18.179 36.154 23.220 1.00 31.66  ? 216 ASP A OD2 1 
ATOM   1695 N N   . HIS A 1 215 ? 19.988 31.428 22.532 1.00 18.34  ? 217 HIS A N   1 
ATOM   1696 C CA  . HIS A 1 215 ? 20.499 30.310 23.361 1.00 16.80  ? 217 HIS A CA  1 
ATOM   1697 C C   . HIS A 1 215 ? 21.944 30.449 23.734 1.00 20.80  ? 217 HIS A C   1 
ATOM   1698 O O   . HIS A 1 215 ? 22.636 31.345 23.264 1.00 18.15  ? 217 HIS A O   1 
ATOM   1699 C CB  . HIS A 1 215 ? 20.351 28.984 22.572 1.00 16.41  ? 217 HIS A CB  1 
ATOM   1700 C CG  . HIS A 1 215 ? 21.269 28.868 21.384 1.00 16.02  ? 217 HIS A CG  1 
ATOM   1701 N ND1 . HIS A 1 215 ? 21.118 29.661 20.248 1.00 18.91  ? 217 HIS A ND1 1 
ATOM   1702 C CD2 . HIS A 1 215 ? 22.405 28.156 21.195 1.00 21.54  ? 217 HIS A CD2 1 
ATOM   1703 C CE1 . HIS A 1 215 ? 22.137 29.458 19.436 1.00 19.99  ? 217 HIS A CE1 1 
ATOM   1704 N NE2 . HIS A 1 215 ? 22.938 28.555 19.982 1.00 22.97  ? 217 HIS A NE2 1 
ATOM   1705 N N   . MET A 1 216 ? 22.413 29.536 24.556 1.00 10.66  ? 218 MET A N   1 
ATOM   1706 C CA  . MET A 1 216 ? 23.835 29.525 24.935 1.00 11.46  ? 218 MET A CA  1 
ATOM   1707 C C   . MET A 1 216 ? 24.204 28.047 25.172 1.00 23.37  ? 218 MET A C   1 
ATOM   1708 O O   . MET A 1 216 ? 23.458 27.352 25.831 1.00 17.11  ? 218 MET A O   1 
ATOM   1709 C CB  . MET A 1 216 ? 24.004 30.287 26.285 1.00 14.34  ? 218 MET A CB  1 
ATOM   1710 C CG  . MET A 1 216 ? 25.398 30.043 26.891 1.00 16.47  ? 218 MET A CG  1 
ATOM   1711 S SD  . MET A 1 216 ? 25.666 31.048 28.423 1.00 18.16  ? 218 MET A SD  1 
ATOM   1712 C CE  . MET A 1 216 ? 24.376 30.356 29.700 1.00 14.19  ? 218 MET A CE  1 
ATOM   1713 N N   . VAL A 1 217 ? 25.331 27.584 24.641 1.00 17.74  ? 219 VAL A N   1 
ATOM   1714 C CA  . VAL A 1 217 ? 25.857 26.236 24.881 1.00 13.46  ? 219 VAL A CA  1 
ATOM   1715 C C   . VAL A 1 217 ? 27.002 26.481 25.825 1.00 15.37  ? 219 VAL A C   1 
ATOM   1716 O O   . VAL A 1 217 ? 27.807 27.386 25.608 1.00 13.70  ? 219 VAL A O   1 
ATOM   1717 C CB  . VAL A 1 217 ? 26.393 25.596 23.620 1.00 18.53  ? 219 VAL A CB  1 
ATOM   1718 C CG1 . VAL A 1 217 ? 27.010 24.263 23.959 1.00 19.47  ? 219 VAL A CG1 1 
ATOM   1719 C CG2 . VAL A 1 217 ? 25.254 25.463 22.623 1.00 17.95  ? 219 VAL A CG2 1 
ATOM   1720 N N   . LEU A 1 218 ? 27.158 25.600 26.824 1.00 11.78  ? 220 LEU A N   1 
ATOM   1721 C CA  . LEU A 1 218 ? 28.135 25.872 27.832 1.00 10.92  ? 220 LEU A CA  1 
ATOM   1722 C C   . LEU A 1 218 ? 28.897 24.618 28.145 1.00 23.33  ? 220 LEU A C   1 
ATOM   1723 O O   . LEU A 1 218 ? 28.274 23.565 28.261 1.00 20.78  ? 220 LEU A O   1 
ATOM   1724 C CB  . LEU A 1 218 ? 27.374 26.330 29.096 1.00 15.24  ? 220 LEU A CB  1 
ATOM   1725 C CG  . LEU A 1 218 ? 28.221 26.433 30.352 1.00 25.33  ? 220 LEU A CG  1 
ATOM   1726 C CD1 . LEU A 1 218 ? 29.181 27.601 30.226 1.00 29.91  ? 220 LEU A CD1 1 
ATOM   1727 C CD2 . LEU A 1 218 ? 27.295 26.576 31.587 1.00 21.69  ? 220 LEU A CD2 1 
ATOM   1728 N N   . LEU A 1 219 ? 30.244 24.719 28.249 1.00 16.26  ? 221 LEU A N   1 
ATOM   1729 C CA  . LEU A 1 219 ? 31.084 23.602 28.649 1.00 11.31  ? 221 LEU A CA  1 
ATOM   1730 C C   . LEU A 1 219 ? 31.851 24.153 29.872 1.00 15.19  ? 221 LEU A C   1 
ATOM   1731 O O   . LEU A 1 219 ? 32.457 25.225 29.785 1.00 15.79  ? 221 LEU A O   1 
ATOM   1732 C CB  . LEU A 1 219 ? 32.076 23.230 27.539 1.00 16.76  ? 221 LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 219 ? 33.224 22.308 27.978 1.00 23.14  ? 221 LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 219 ? 32.712 20.921 28.323 1.00 20.97  ? 221 LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 219 ? 34.253 22.210 26.812 1.00 31.80  ? 221 LEU A CD2 1 
ATOM   1736 N N   . GLU A 1 220 ? 31.823 23.421 31.023 1.00 11.46  ? 222 GLU A N   1 
ATOM   1737 C CA  . GLU A 1 220 ? 32.458 23.963 32.196 1.00 9.59   ? 222 GLU A CA  1 
ATOM   1738 C C   . GLU A 1 220 ? 33.181 22.865 32.957 1.00 15.56  ? 222 GLU A C   1 
ATOM   1739 O O   . GLU A 1 220 ? 32.697 21.726 33.005 1.00 16.33  ? 222 GLU A O   1 
ATOM   1740 C CB  . GLU A 1 220 ? 31.302 24.529 33.057 1.00 19.34  ? 222 GLU A CB  1 
ATOM   1741 C CG  . GLU A 1 220 ? 31.659 25.257 34.320 1.00 24.79  ? 222 GLU A CG  1 
ATOM   1742 C CD  . GLU A 1 220 ? 30.393 25.918 34.925 1.00 21.33  ? 222 GLU A CD  1 
ATOM   1743 O OE1 . GLU A 1 220 ? 29.655 26.600 34.187 1.00 31.51  ? 222 GLU A OE1 1 
ATOM   1744 O OE2 . GLU A 1 220 ? 30.146 25.758 36.127 1.00 23.86  ? 222 GLU A OE2 1 
ATOM   1745 N N   . PHE A 1 221 ? 34.329 23.192 33.551 1.00 14.31  ? 223 PHE A N   1 
ATOM   1746 C CA  . PHE A 1 221 ? 35.091 22.244 34.365 1.00 10.14  ? 223 PHE A CA  1 
ATOM   1747 C C   . PHE A 1 221 ? 35.286 22.879 35.728 1.00 14.98  ? 223 PHE A C   1 
ATOM   1748 O O   . PHE A 1 221 ? 35.702 24.009 35.807 1.00 18.24  ? 223 PHE A O   1 
ATOM   1749 C CB  . PHE A 1 221 ? 36.454 21.997 33.742 1.00 13.60  ? 223 PHE A CB  1 
ATOM   1750 C CG  . PHE A 1 221 ? 36.368 21.161 32.501 1.00 15.30  ? 223 PHE A CG  1 
ATOM   1751 C CD1 . PHE A 1 221 ? 36.218 19.778 32.579 1.00 21.56  ? 223 PHE A CD1 1 
ATOM   1752 C CD2 . PHE A 1 221 ? 36.395 21.775 31.236 1.00 18.23  ? 223 PHE A CD2 1 
ATOM   1753 C CE1 . PHE A 1 221 ? 36.088 19.024 31.407 1.00 21.98  ? 223 PHE A CE1 1 
ATOM   1754 C CE2 . PHE A 1 221 ? 36.266 20.994 30.058 1.00 24.30  ? 223 PHE A CE2 1 
ATOM   1755 C CZ  . PHE A 1 221 ? 36.112 19.647 30.164 1.00 21.93  ? 223 PHE A CZ  1 
ATOM   1756 N N   . VAL A 1 222 ? 35.021 22.129 36.809 1.00 10.39  ? 224 VAL A N   1 
ATOM   1757 C CA  . VAL A 1 222 ? 35.169 22.730 38.127 1.00 13.75  ? 224 VAL A CA  1 
ATOM   1758 C C   . VAL A 1 222 ? 35.851 21.711 39.024 1.00 19.31  ? 224 VAL A C   1 
ATOM   1759 O O   . VAL A 1 222 ? 35.419 20.559 39.098 1.00 16.41  ? 224 VAL A O   1 
ATOM   1760 C CB  . VAL A 1 222 ? 33.789 23.021 38.759 1.00 20.46  ? 224 VAL A CB  1 
ATOM   1761 C CG1 . VAL A 1 222 ? 34.008 23.779 40.146 1.00 19.26  ? 224 VAL A CG1 1 
ATOM   1762 C CG2 . VAL A 1 222 ? 32.926 23.876 37.795 1.00 19.23  ? 224 VAL A CG2 1 
ATOM   1763 N N   . THR A 1 223 ? 36.918 22.096 39.676 1.00 13.12  ? 225 THR A N   1 
ATOM   1764 C CA  . THR A 1 223 ? 37.549 21.118 40.629 1.00 13.43  ? 225 THR A CA  1 
ATOM   1765 C C   . THR A 1 223 ? 37.856 21.810 41.956 1.00 18.22  ? 225 THR A C   1 
ATOM   1766 O O   . THR A 1 223 ? 38.187 22.977 41.984 1.00 16.73  ? 225 THR A O   1 
ATOM   1767 C CB  . THR A 1 223 ? 38.812 20.477 40.073 1.00 41.65  ? 225 THR A CB  1 
ATOM   1768 O OG1 . THR A 1 223 ? 39.939 21.129 40.605 1.00 44.80  ? 225 THR A OG1 1 
ATOM   1769 C CG2 . THR A 1 223 ? 38.862 20.600 38.625 1.00 22.03  ? 225 THR A CG2 1 
ATOM   1770 N N   . ALA A 1 224 ? 37.725 21.063 43.075 1.00 9.77   ? 226 ALA A N   1 
ATOM   1771 C CA  . ALA A 1 224 ? 37.903 21.669 44.402 1.00 15.89  ? 226 ALA A CA  1 
ATOM   1772 C C   . ALA A 1 224 ? 39.387 21.672 44.685 1.00 19.10  ? 226 ALA A C   1 
ATOM   1773 O O   . ALA A 1 224 ? 40.114 20.779 44.221 1.00 20.32  ? 226 ALA A O   1 
ATOM   1774 C CB  . ALA A 1 224 ? 37.156 20.794 45.507 1.00 18.08  ? 226 ALA A CB  1 
ATOM   1775 N N   . ALA A 1 225 ? 39.836 22.660 45.462 1.00 12.25  ? 227 ALA A N   1 
ATOM   1776 C CA  . ALA A 1 225 ? 41.271 22.754 45.808 1.00 17.48  ? 227 ALA A CA  1 
ATOM   1777 C C   . ALA A 1 225 ? 41.379 23.531 47.103 1.00 22.77  ? 227 ALA A C   1 
ATOM   1778 O O   . ALA A 1 225 ? 40.366 24.021 47.637 1.00 22.74  ? 227 ALA A O   1 
ATOM   1779 C CB  . ALA A 1 225 ? 41.999 23.523 44.698 1.00 29.28  ? 227 ALA A CB  1 
ATOM   1780 N N   . GLY A 1 226 ? 42.645 23.653 47.633 1.00 21.46  ? 228 GLY A N   1 
ATOM   1781 C CA  . GLY A 1 226 ? 42.812 24.472 48.824 1.00 24.23  ? 228 GLY A CA  1 
ATOM   1782 C C   . GLY A 1 226 ? 43.186 23.724 50.082 1.00 29.29  ? 228 GLY A C   1 
ATOM   1783 O O   . GLY A 1 226 ? 43.497 24.353 51.084 1.00 34.30  ? 228 GLY A O   1 
ATOM   1784 N N   . ILE A 1 227 ? 43.129 22.379 50.009 1.00 28.76  ? 229 ILE A N   1 
ATOM   1785 C CA  . ILE A 1 227 ? 43.455 21.472 51.094 1.00 31.93  ? 229 ILE A CA  1 
ATOM   1786 C C   . ILE A 1 227 ? 44.302 20.323 50.472 1.00 33.56  ? 229 ILE A C   1 
ATOM   1787 O O   . ILE A 1 227 ? 45.487 20.144 50.819 1.00 69.18  ? 229 ILE A O   1 
ATOM   1788 C CB  . ILE A 1 227 ? 42.157 20.883 51.712 1.00 37.21  ? 229 ILE A CB  1 
ATOM   1789 C CG1 . ILE A 1 227 ? 41.308 21.981 52.359 1.00 34.75  ? 229 ILE A CG1 1 
ATOM   1790 C CG2 . ILE A 1 227 ? 42.507 19.816 52.740 1.00 35.63  ? 229 ILE A CG2 1 
ATOM   1791 C CD1 . ILE A 1 227 ? 39.971 21.460 52.884 1.00 34.37  ? 229 ILE A CD1 1 
HETATM 1792 O O   . HOH B 2 .   ? 39.736 20.958 59.869 1.00 10.84  ? 239 HOH A O   1 
HETATM 1793 O O   . HOH B 2 .   ? 27.523 34.837 35.387 1.00 15.85  ? 240 HOH A O   1 
HETATM 1794 O O   . HOH B 2 .   ? 24.180 34.633 37.265 1.00 17.79  ? 241 HOH A O   1 
HETATM 1795 O O   . HOH B 2 .   ? 34.279 29.962 34.707 1.00 19.43  ? 242 HOH A O   1 
HETATM 1796 O O   . HOH B 2 .   ? 27.549 24.487 38.638 1.00 21.72  ? 243 HOH A O   1 
HETATM 1797 O O   . HOH B 2 .   ? 21.176 26.789 41.860 1.00 20.39  ? 244 HOH A O   1 
HETATM 1798 O O   . HOH B 2 .   ? 31.541 37.253 30.936 1.00 19.67  ? 245 HOH A O   1 
HETATM 1799 O O   . HOH B 2 .   ? 22.641 33.142 41.455 1.00 20.24  ? 246 HOH A O   1 
HETATM 1800 O O   . HOH B 2 .   ? 21.700 29.361 41.541 1.00 18.87  ? 247 HOH A O   1 
HETATM 1801 O O   . HOH B 2 .   ? 27.391 37.210 36.892 1.00 18.04  ? 248 HOH A O   1 
HETATM 1802 O O   . HOH B 2 .   ? 24.735 24.646 43.105 1.00 26.44  ? 249 HOH A O   1 
HETATM 1803 O O   . HOH B 2 .   ? 30.318 18.890 44.687 1.00 19.62  ? 250 HOH A O   1 
HETATM 1804 O O   . HOH B 2 .   ? 31.389 26.758 40.931 1.00 21.88  ? 251 HOH A O   1 
HETATM 1805 O O   . HOH B 2 .   ? 28.101 12.815 38.077 1.00 23.15  ? 252 HOH A O   1 
HETATM 1806 O O   . HOH B 2 .   ? 22.486 47.765 32.788 1.00 24.35  ? 253 HOH A O   1 
HETATM 1807 O O   . HOH B 2 .   ? 31.223 39.237 29.123 1.00 21.36  ? 254 HOH A O   1 
HETATM 1808 O O   . HOH B 2 .   ? 33.451 35.797 33.076 1.00 24.55  ? 255 HOH A O   1 
HETATM 1809 O O   . HOH B 2 .   ? 36.935 30.143 31.694 1.00 29.73  ? 256 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 20.559 30.987 43.519 1.00 23.48  ? 257 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 12.408 43.295 38.642 1.00 28.87  ? 258 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? 33.231 46.880 37.075 1.00 24.63  ? 259 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? 26.035 41.648 25.906 1.00 27.27  ? 260 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? 34.698 26.398 57.075 1.00 28.95  ? 261 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? 37.460 11.980 40.214 1.00 30.40  ? 262 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? 31.492 22.002 49.925 1.00 23.10  ? 263 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? 32.729 14.094 46.900 1.00 29.28  ? 264 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? 23.934 40.316 24.967 1.00 25.89  ? 265 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? 21.631 33.211 20.593 1.00 30.89  ? 266 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? 33.870 31.396 26.213 1.00 29.21  ? 267 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? 21.065 9.855  37.465 1.00 30.40  ? 268 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 34.273 37.732 30.283 1.00 25.85  ? 269 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? 42.964 12.734 46.578 1.00 33.23  ? 270 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? 36.604 35.314 43.484 1.00 26.47  ? 271 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 19.248 17.676 52.199 1.00 26.81  ? 272 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? 25.313 46.712 42.741 1.00 30.39  ? 273 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? 12.034 36.980 26.740 1.00 31.95  ? 274 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? 38.582 22.993 36.776 1.00 35.93  ? 275 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? 18.001 22.720 25.691 1.00 31.87  ? 276 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? 8.633  43.760 37.969 1.00 29.32  ? 277 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? 38.079 42.787 28.917 1.00 36.08  ? 278 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? 39.046 13.550 42.137 1.00 33.99  ? 279 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? 14.428 32.586 21.722 1.00 33.28  ? 280 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? 24.791 37.433 25.390 1.00 32.94  ? 281 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? 29.906 44.974 42.862 1.00 32.63  ? 282 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? 22.868 47.277 43.703 1.00 31.08  ? 283 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? 31.201 20.760 37.134 1.00 30.20  ? 284 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 28.316 49.902 42.567 1.00 31.95  ? 285 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? 29.654 14.328 49.852 1.00 30.47  ? 286 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 27.191 38.445 25.516 1.00 36.43  ? 287 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? 17.078 42.197 43.085 1.00 27.44  ? 288 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? 38.699 39.924 25.726 1.00 30.90  ? 289 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? 31.364 38.741 21.986 1.00 28.89  ? 290 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? 30.946 25.804 24.704 1.00 31.73  ? 291 HOH A O   1 
HETATM 1845 O O   . HOH B 2 .   ? 26.782 48.902 33.870 1.00 40.54  ? 292 HOH A O   1 
HETATM 1846 O O   . HOH B 2 .   ? 14.506 48.573 39.087 1.00 28.88  ? 293 HOH A O   1 
HETATM 1847 O O   . HOH B 2 .   ? 29.982 25.712 38.556 1.00 34.37  ? 294 HOH A O   1 
HETATM 1848 O O   . HOH B 2 .   ? 24.411 35.872 22.826 1.00 34.79  ? 295 HOH A O   1 
HETATM 1849 O O   . HOH B 2 .   ? 38.939 34.441 41.129 1.00 31.61  ? 296 HOH A O   1 
HETATM 1850 O O   . HOH B 2 .   ? 32.939 32.449 23.472 1.00 37.20  ? 297 HOH A O   1 
HETATM 1851 O O   . HOH B 2 .   ? 20.191 29.001 51.681 1.00 34.08  ? 298 HOH A O   1 
HETATM 1852 O O   . HOH B 2 .   ? 38.169 14.302 53.229 1.00 33.23  ? 299 HOH A O   1 
HETATM 1853 O O   . HOH B 2 .   ? 37.583 29.743 51.629 1.00 34.92  ? 300 HOH A O   1 
HETATM 1854 O O   . HOH B 2 .   ? 16.010 23.598 26.919 1.00 31.87  ? 301 HOH A O   1 
HETATM 1855 O O   . HOH B 2 .   ? 18.407 17.690 24.321 1.00 31.87  ? 302 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  32T 57  57  57  32T 32T A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  CRO 65  66  66  CRO CRO A . n 
A 1 66  VAL 66  68  68  VAL VAL A . n 
A 1 67  GLN 67  69  69  GLN GLN A . n 
A 1 68  CYS 68  70  70  CYS CYS A . n 
A 1 69  PHE 69  71  71  PHE PHE A . n 
A 1 70  SER 70  72  72  SER SER A . n 
A 1 71  ARG 71  73  73  ARG ARG A . n 
A 1 72  TYR 72  74  74  TYR TYR A . n 
A 1 73  PRO 73  75  75  PRO PRO A . n 
A 1 74  ASP 74  76  76  ASP ASP A . n 
A 1 75  HIS 75  77  77  HIS HIS A . n 
A 1 76  MET 76  78  78  MET MET A . n 
A 1 77  LYS 77  79  79  LYS LYS A . n 
A 1 78  GLN 78  80  80  GLN GLN A . n 
A 1 79  HIS 79  81  81  HIS HIS A . n 
A 1 80  ASP 80  82  82  ASP ASP A . n 
A 1 81  PHE 81  83  83  PHE PHE A . n 
A 1 82  PHE 82  84  84  PHE PHE A . n 
A 1 83  LYS 83  85  85  LYS LYS A . n 
A 1 84  SER 84  86  86  SER SER A . n 
A 1 85  ALA 85  87  87  ALA ALA A . n 
A 1 86  MET 86  88  88  MET MET A . n 
A 1 87  PRO 87  89  89  PRO PRO A . n 
A 1 88  GLU 88  90  90  GLU GLU A . n 
A 1 89  GLY 89  91  91  GLY GLY A . n 
A 1 90  TYR 90  92  92  TYR TYR A . n 
A 1 91  VAL 91  93  93  VAL VAL A . n 
A 1 92  GLN 92  94  94  GLN GLN A . n 
A 1 93  GLU 93  95  95  GLU GLU A . n 
A 1 94  ARG 94  96  96  ARG ARG A . n 
A 1 95  THR 95  97  97  THR THR A . n 
A 1 96  ILE 96  98  98  ILE ILE A . n 
A 1 97  PHE 97  99  99  PHE PHE A . n 
A 1 98  PHE 98  100 100 PHE PHE A . n 
A 1 99  LYS 99  101 101 LYS LYS A . n 
A 1 100 ASP 100 102 102 ASP ASP A . n 
A 1 101 ASP 101 103 103 ASP ASP A . n 
A 1 102 GLY 102 104 104 GLY GLY A . n 
A 1 103 ASN 103 105 105 ASN ASN A . n 
A 1 104 TYR 104 106 106 TYR TYR A . n 
A 1 105 LYS 105 107 107 LYS LYS A . n 
A 1 106 THR 106 108 108 THR THR A . n 
A 1 107 ARG 107 109 109 ARG ARG A . n 
A 1 108 ALA 108 110 110 ALA ALA A . n 
A 1 109 GLU 109 111 111 GLU GLU A . n 
A 1 110 VAL 110 112 112 VAL VAL A . n 
A 1 111 LYS 111 113 113 LYS LYS A . n 
A 1 112 PHE 112 114 114 PHE PHE A . n 
A 1 113 GLU 113 115 115 GLU GLU A . n 
A 1 114 GLY 114 116 116 GLY GLY A . n 
A 1 115 ASP 115 117 117 ASP ASP A . n 
A 1 116 THR 116 118 118 THR THR A . n 
A 1 117 LEU 117 119 119 LEU LEU A . n 
A 1 118 VAL 118 120 120 VAL VAL A . n 
A 1 119 ASN 119 121 121 ASN ASN A . n 
A 1 120 ARG 120 122 122 ARG ARG A . n 
A 1 121 ILE 121 123 123 ILE ILE A . n 
A 1 122 GLU 122 124 124 GLU GLU A . n 
A 1 123 LEU 123 125 125 LEU LEU A . n 
A 1 124 LYS 124 126 126 LYS LYS A . n 
A 1 125 GLY 125 127 127 GLY GLY A . n 
A 1 126 ILE 126 128 128 ILE ILE A . n 
A 1 127 ASP 127 129 129 ASP ASP A . n 
A 1 128 PHE 128 130 130 PHE PHE A . n 
A 1 129 LYS 129 131 131 LYS LYS A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 ASP 131 133 133 ASP ASP A . n 
A 1 132 GLY 132 134 134 GLY GLY A . n 
A 1 133 ASN 133 135 135 ASN ASN A . n 
A 1 134 ILE 134 136 136 ILE ILE A . n 
A 1 135 LEU 135 137 137 LEU LEU A . n 
A 1 136 GLY 136 138 138 GLY GLY A . n 
A 1 137 HIS 137 139 139 HIS HIS A . n 
A 1 138 LYS 138 140 140 LYS LYS A . n 
A 1 139 LEU 139 141 141 LEU LEU A . n 
A 1 140 GLU 140 142 142 GLU GLU A . n 
A 1 141 TYR 141 143 143 TYR TYR A . n 
A 1 142 ASN 142 144 144 ASN ASN A . n 
A 1 143 TYR 143 145 145 TYR TYR A . n 
A 1 144 ASN 144 146 146 ASN ASN A . n 
A 1 145 SER 145 147 147 SER SER A . n 
A 1 146 HIS 146 148 148 HIS HIS A . n 
A 1 147 ASN 147 149 149 ASN ASN A . n 
A 1 148 VAL 148 150 150 VAL VAL A . n 
A 1 149 TYR 149 151 151 TYR TYR A . n 
A 1 150 ILE 150 152 152 ILE ILE A . n 
A 1 151 MET 151 153 153 MET MET A . n 
A 1 152 ALA 152 154 154 ALA ALA A . n 
A 1 153 ASP 153 155 155 ASP ASP A . n 
A 1 154 LYS 154 156 156 LYS LYS A . n 
A 1 155 GLN 155 157 157 GLN GLN A . n 
A 1 156 LYS 156 158 158 LYS LYS A . n 
A 1 157 ASN 157 159 159 ASN ASN A . n 
A 1 158 GLY 158 160 160 GLY GLY A . n 
A 1 159 ILE 159 161 161 ILE ILE A . n 
A 1 160 LYS 160 162 162 LYS LYS A . n 
A 1 161 VAL 161 163 163 VAL VAL A . n 
A 1 162 ASN 162 164 164 ASN ASN A . n 
A 1 163 PHE 163 165 165 PHE PHE A . n 
A 1 164 LYS 164 166 166 LYS LYS A . n 
A 1 165 ILE 165 167 167 ILE ILE A . n 
A 1 166 ARG 166 168 168 ARG ARG A . n 
A 1 167 HIS 167 169 169 HIS HIS A . n 
A 1 168 ASN 168 170 170 ASN ASN A . n 
A 1 169 ILE 169 171 171 ILE ILE A . n 
A 1 170 GLU 170 172 172 GLU GLU A . n 
A 1 171 ASP 171 173 173 ASP ASP A . n 
A 1 172 GLY 172 174 174 GLY GLY A . n 
A 1 173 SER 173 175 175 SER SER A . n 
A 1 174 VAL 174 176 176 VAL VAL A . n 
A 1 175 GLN 175 177 177 GLN GLN A . n 
A 1 176 LEU 176 178 178 LEU LEU A . n 
A 1 177 ALA 177 179 179 ALA ALA A . n 
A 1 178 ASP 178 180 180 ASP ASP A . n 
A 1 179 HIS 179 181 181 HIS HIS A . n 
A 1 180 TYR 180 182 182 TYR TYR A . n 
A 1 181 GLN 181 183 183 GLN GLN A . n 
A 1 182 GLN 182 184 184 GLN GLN A . n 
A 1 183 ASN 183 185 185 ASN ASN A . n 
A 1 184 THR 184 186 186 THR THR A . n 
A 1 185 PRO 185 187 187 PRO PRO A . n 
A 1 186 ILE 186 188 188 ILE ILE A . n 
A 1 187 GLY 187 189 189 GLY GLY A . n 
A 1 188 ASP 188 190 190 ASP ASP A . n 
A 1 189 GLY 189 191 191 GLY GLY A . n 
A 1 190 PRO 190 192 192 PRO PRO A . n 
A 1 191 VAL 191 193 193 VAL VAL A . n 
A 1 192 LEU 192 194 194 LEU LEU A . n 
A 1 193 LEU 193 195 195 LEU LEU A . n 
A 1 194 PRO 194 196 196 PRO PRO A . n 
A 1 195 ASP 195 197 197 ASP ASP A . n 
A 1 196 ASN 196 198 198 ASN ASN A . n 
A 1 197 HIS 197 199 199 HIS HIS A . n 
A 1 198 TYR 198 200 200 TYR TYR A . n 
A 1 199 LEU 199 201 201 LEU LEU A . n 
A 1 200 SER 200 202 202 SER SER A . n 
A 1 201 THR 201 203 203 THR THR A . n 
A 1 202 GLN 202 204 204 GLN GLN A . n 
A 1 203 SER 203 205 205 SER SER A . n 
A 1 204 ALA 204 206 206 ALA ALA A . n 
A 1 205 LEU 205 207 207 LEU LEU A . n 
A 1 206 SER 206 208 208 SER SER A . n 
A 1 207 LYS 207 209 209 LYS LYS A . n 
A 1 208 ASP 208 210 210 ASP ASP A . n 
A 1 209 PRO 209 211 211 PRO PRO A . n 
A 1 210 ASN 210 212 212 ASN ASN A . n 
A 1 211 GLU 211 213 213 GLU GLU A . n 
A 1 212 LYS 212 214 214 LYS LYS A . n 
A 1 213 ARG 213 215 215 ARG ARG A . n 
A 1 214 ASP 214 216 216 ASP ASP A . n 
A 1 215 HIS 215 217 217 HIS HIS A . n 
A 1 216 MET 216 218 218 MET MET A . n 
A 1 217 VAL 217 219 219 VAL VAL A . n 
A 1 218 LEU 218 220 220 LEU LEU A . n 
A 1 219 LEU 219 221 221 LEU LEU A . n 
A 1 220 GLU 220 222 222 GLU GLU A . n 
A 1 221 PHE 221 223 223 PHE PHE A . n 
A 1 222 VAL 222 224 224 VAL VAL A . n 
A 1 223 THR 223 225 225 THR THR A . n 
A 1 224 ALA 224 226 226 ALA ALA A . n 
A 1 225 ALA 225 227 227 ALA ALA A . n 
A 1 226 GLY 226 228 228 GLY GLY A . n 
A 1 227 ILE 227 229 229 ILE ILE A . n 
A 1 228 THR 228 230 ?   ?   ?   A . n 
A 1 229 LEU 229 231 ?   ?   ?   A . n 
A 1 230 GLY 230 232 ?   ?   ?   A . n 
A 1 231 MET 231 233 ?   ?   ?   A . n 
A 1 232 ASP 232 234 ?   ?   ?   A . n 
A 1 233 GLU 233 235 ?   ?   ?   A . n 
A 1 234 LEU 234 236 ?   ?   ?   A . n 
A 1 235 TYR 235 237 ?   ?   ?   A . n 
A 1 236 LYS 236 238 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CRO 65 A CRO 66 ? GLY ? 
2 A CRO 65 A CRO 66 ? TYR ? 
3 A CRO 65 A CRO 66 ? GLY ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     270 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     302 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_556 
_pdbx_validate_symm_contact.dist              1.69 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     103 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -153.70 
_pdbx_validate_torsion.psi             -157.26 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 80 ? OE1 ? A GLN 78 OE1 
2 1 Y 1 A GLN 80 ? NE2 ? A GLN 78 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A LYS 3   ? A LYS 3   
4  1 Y 1 A THR 230 ? A THR 228 
5  1 Y 1 A LEU 231 ? A LEU 229 
6  1 Y 1 A GLY 232 ? A GLY 230 
7  1 Y 1 A MET 233 ? A MET 231 
8  1 Y 1 A ASP 234 ? A ASP 232 
9  1 Y 1 A GLU 235 ? A GLU 233 
10 1 Y 1 A LEU 236 ? A LEU 234 
11 1 Y 1 A TYR 237 ? A TYR 235 
12 1 Y 1 A LYS 238 ? A LYS 236 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  239 1  HOH HOH A . 
B 2 HOH 2  240 2  HOH HOH A . 
B 2 HOH 3  241 3  HOH HOH A . 
B 2 HOH 4  242 4  HOH HOH A . 
B 2 HOH 5  243 5  HOH HOH A . 
B 2 HOH 6  244 6  HOH HOH A . 
B 2 HOH 7  245 7  HOH HOH A . 
B 2 HOH 8  246 8  HOH HOH A . 
B 2 HOH 9  247 9  HOH HOH A . 
B 2 HOH 10 248 10 HOH HOH A . 
B 2 HOH 11 249 11 HOH HOH A . 
B 2 HOH 12 250 13 HOH HOH A . 
B 2 HOH 13 251 14 HOH HOH A . 
B 2 HOH 14 252 15 HOH HOH A . 
B 2 HOH 15 253 16 HOH HOH A . 
B 2 HOH 16 254 17 HOH HOH A . 
B 2 HOH 17 255 18 HOH HOH A . 
B 2 HOH 18 256 19 HOH HOH A . 
B 2 HOH 19 257 20 HOH HOH A . 
B 2 HOH 20 258 21 HOH HOH A . 
B 2 HOH 21 259 22 HOH HOH A . 
B 2 HOH 22 260 23 HOH HOH A . 
B 2 HOH 23 261 24 HOH HOH A . 
B 2 HOH 24 262 25 HOH HOH A . 
B 2 HOH 25 263 26 HOH HOH A . 
B 2 HOH 26 264 27 HOH HOH A . 
B 2 HOH 27 265 28 HOH HOH A . 
B 2 HOH 28 266 29 HOH HOH A . 
B 2 HOH 29 267 30 HOH HOH A . 
B 2 HOH 30 268 31 HOH HOH A . 
B 2 HOH 31 269 32 HOH HOH A . 
B 2 HOH 32 270 33 HOH HOH A . 
B 2 HOH 33 271 34 HOH HOH A . 
B 2 HOH 34 272 35 HOH HOH A . 
B 2 HOH 35 273 36 HOH HOH A . 
B 2 HOH 36 274 37 HOH HOH A . 
B 2 HOH 37 275 38 HOH HOH A . 
B 2 HOH 38 276 39 HOH HOH A . 
B 2 HOH 39 277 40 HOH HOH A . 
B 2 HOH 40 278 41 HOH HOH A . 
B 2 HOH 41 279 42 HOH HOH A . 
B 2 HOH 42 280 43 HOH HOH A . 
B 2 HOH 43 281 44 HOH HOH A . 
B 2 HOH 44 282 46 HOH HOH A . 
B 2 HOH 45 283 49 HOH HOH A . 
B 2 HOH 46 284 50 HOH HOH A . 
B 2 HOH 47 285 51 HOH HOH A . 
B 2 HOH 48 286 52 HOH HOH A . 
B 2 HOH 49 287 54 HOH HOH A . 
B 2 HOH 50 288 55 HOH HOH A . 
B 2 HOH 51 289 56 HOH HOH A . 
B 2 HOH 52 290 57 HOH HOH A . 
B 2 HOH 53 291 59 HOH HOH A . 
B 2 HOH 54 292 63 HOH HOH A . 
B 2 HOH 55 293 64 HOH HOH A . 
B 2 HOH 56 294 66 HOH HOH A . 
B 2 HOH 57 295 67 HOH HOH A . 
B 2 HOH 58 296 68 HOH HOH A . 
B 2 HOH 59 297 71 HOH HOH A . 
B 2 HOH 60 298 72 HOH HOH A . 
B 2 HOH 61 299 73 HOH HOH A . 
B 2 HOH 62 300 75 HOH HOH A . 
B 2 HOH 63 301 78 HOH HOH A . 
B 2 HOH 64 302 79 HOH HOH A . 
#