data_1RP1
# 
_entry.id   1RP1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RP1         
WWPDB D_1000176171 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RP1 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-02 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Roussel, A.'   1 
'Cambillau, C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Reactivation of the totally inactive pancreatic lipase RP1 by structure-predicted point mutations.' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            32 
_citation.page_first                523 
_citation.page_last                 531 
_citation.year                      1998 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9726421 
_citation.pdbx_database_id_DOI      '10.1002/(SICI)1097-0134(19980901)32:4<523::AID-PROT10>3.3.CO;2-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Roussel, A.'   1 ? 
primary 'de Caro, J.'   2 ? 
primary 'Bezzine, S.'   3 ? 
primary 'Gastinel, L.'  4 ? 
primary 'de Caro, A.'   5 ? 
primary 'Carriere, F.'  6 ? 
primary 'Leydier, S.'   7 ? 
primary 'Verger, R.'    8 ? 
primary 'Cambillau, C.' 9 ? 
# 
_cell.entry_id           1RP1 
_cell.length_a           54.026 
_cell.length_b           150.748 
_cell.length_c           132.006 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RP1 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PANCREATIC LIPASE RELATED PROTEIN 1'    49676.816 1   3.1.1.3 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ? ? 
3 non-polymer syn 'CALCIUM ION'                            40.078    1   ?       ? ? ? 
4 water       nat water                                    18.015    358 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFI
DKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVA
GEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKK
NALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQGCPQMGHYADKFAVKTS
DETQKYFLNTGDSSNFARWRYGVSITLSGKRATGQAKVALFGSKGNTHQFNIFKGILKPGSTHSNEFDAKLDVGTIEKVK
FLWNNNVVNPTFPKVGAAKITVQKGEEKTVHSFCSESTVREDVLLTLTPC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFI
DKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVA
GEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKK
NALSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQGCPQMGHYADKFAVKTS
DETQKYFLNTGDSSNFARWRYGVSITLSGKRATGQAKVALFGSKGNTHQFNIFKGILKPGSTHSNEFDAKLDVGTIEKVK
FLWNNNVVNPTFPKVGAAKITVQKGEEKTVHSFCSESTVREDVLLTLTPC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   VAL n 
1 4   CYS n 
1 5   TYR n 
1 6   GLU n 
1 7   GLN n 
1 8   ILE n 
1 9   GLY n 
1 10  CYS n 
1 11  PHE n 
1 12  SER n 
1 13  ASP n 
1 14  ALA n 
1 15  GLU n 
1 16  PRO n 
1 17  TRP n 
1 18  ALA n 
1 19  GLY n 
1 20  THR n 
1 21  ALA n 
1 22  ILE n 
1 23  ARG n 
1 24  PRO n 
1 25  LEU n 
1 26  LYS n 
1 27  VAL n 
1 28  LEU n 
1 29  PRO n 
1 30  TRP n 
1 31  SER n 
1 32  PRO n 
1 33  GLU n 
1 34  ARG n 
1 35  ILE n 
1 36  GLY n 
1 37  THR n 
1 38  ARG n 
1 39  PHE n 
1 40  LEU n 
1 41  LEU n 
1 42  TYR n 
1 43  THR n 
1 44  ASN n 
1 45  LYS n 
1 46  ASN n 
1 47  PRO n 
1 48  ASN n 
1 49  ASN n 
1 50  PHE n 
1 51  GLN n 
1 52  THR n 
1 53  LEU n 
1 54  LEU n 
1 55  PRO n 
1 56  SER n 
1 57  ASP n 
1 58  PRO n 
1 59  SER n 
1 60  THR n 
1 61  ILE n 
1 62  GLY n 
1 63  ALA n 
1 64  SER n 
1 65  ASN n 
1 66  PHE n 
1 67  GLN n 
1 68  THR n 
1 69  ASP n 
1 70  LYS n 
1 71  LYS n 
1 72  THR n 
1 73  ARG n 
1 74  PHE n 
1 75  ILE n 
1 76  ILE n 
1 77  HIS n 
1 78  GLY n 
1 79  PHE n 
1 80  ILE n 
1 81  ASP n 
1 82  LYS n 
1 83  GLY n 
1 84  GLU n 
1 85  GLU n 
1 86  ASN n 
1 87  TRP n 
1 88  LEU n 
1 89  LEU n 
1 90  ASP n 
1 91  MET n 
1 92  CYS n 
1 93  LYS n 
1 94  ASN n 
1 95  MET n 
1 96  PHE n 
1 97  LYS n 
1 98  VAL n 
1 99  GLU n 
1 100 GLU n 
1 101 VAL n 
1 102 ASN n 
1 103 CYS n 
1 104 ILE n 
1 105 CYS n 
1 106 VAL n 
1 107 ASP n 
1 108 TRP n 
1 109 LYS n 
1 110 LYS n 
1 111 GLY n 
1 112 SER n 
1 113 GLN n 
1 114 THR n 
1 115 SER n 
1 116 TYR n 
1 117 THR n 
1 118 GLN n 
1 119 ALA n 
1 120 ALA n 
1 121 ASN n 
1 122 ASN n 
1 123 VAL n 
1 124 ARG n 
1 125 VAL n 
1 126 VAL n 
1 127 GLY n 
1 128 ALA n 
1 129 GLN n 
1 130 VAL n 
1 131 ALA n 
1 132 GLN n 
1 133 MET n 
1 134 LEU n 
1 135 SER n 
1 136 MET n 
1 137 LEU n 
1 138 SER n 
1 139 ALA n 
1 140 ASN n 
1 141 TYR n 
1 142 SER n 
1 143 TYR n 
1 144 SER n 
1 145 PRO n 
1 146 SER n 
1 147 GLN n 
1 148 VAL n 
1 149 GLN n 
1 150 LEU n 
1 151 ILE n 
1 152 GLY n 
1 153 HIS n 
1 154 SER n 
1 155 LEU n 
1 156 GLY n 
1 157 ALA n 
1 158 HIS n 
1 159 VAL n 
1 160 ALA n 
1 161 GLY n 
1 162 GLU n 
1 163 ALA n 
1 164 GLY n 
1 165 SER n 
1 166 ARG n 
1 167 THR n 
1 168 PRO n 
1 169 GLY n 
1 170 LEU n 
1 171 GLY n 
1 172 ARG n 
1 173 ILE n 
1 174 THR n 
1 175 GLY n 
1 176 LEU n 
1 177 ASP n 
1 178 PRO n 
1 179 VAL n 
1 180 GLU n 
1 181 ALA n 
1 182 SER n 
1 183 PHE n 
1 184 GLN n 
1 185 GLY n 
1 186 THR n 
1 187 PRO n 
1 188 GLU n 
1 189 GLU n 
1 190 VAL n 
1 191 ARG n 
1 192 LEU n 
1 193 ASP n 
1 194 PRO n 
1 195 THR n 
1 196 ASP n 
1 197 ALA n 
1 198 ASP n 
1 199 PHE n 
1 200 VAL n 
1 201 ASP n 
1 202 VAL n 
1 203 ILE n 
1 204 HIS n 
1 205 THR n 
1 206 ASP n 
1 207 ALA n 
1 208 ALA n 
1 209 PRO n 
1 210 LEU n 
1 211 ILE n 
1 212 PRO n 
1 213 PHE n 
1 214 LEU n 
1 215 GLY n 
1 216 PHE n 
1 217 GLY n 
1 218 THR n 
1 219 SER n 
1 220 GLN n 
1 221 GLN n 
1 222 MET n 
1 223 GLY n 
1 224 HIS n 
1 225 LEU n 
1 226 ASP n 
1 227 PHE n 
1 228 PHE n 
1 229 PRO n 
1 230 ASN n 
1 231 GLY n 
1 232 GLY n 
1 233 GLU n 
1 234 GLU n 
1 235 MET n 
1 236 PRO n 
1 237 GLY n 
1 238 CYS n 
1 239 LYS n 
1 240 LYS n 
1 241 ASN n 
1 242 ALA n 
1 243 LEU n 
1 244 SER n 
1 245 GLN n 
1 246 ILE n 
1 247 VAL n 
1 248 ASP n 
1 249 LEU n 
1 250 ASP n 
1 251 GLY n 
1 252 ILE n 
1 253 TRP n 
1 254 GLU n 
1 255 GLY n 
1 256 THR n 
1 257 ARG n 
1 258 ASP n 
1 259 PHE n 
1 260 VAL n 
1 261 ALA n 
1 262 CYS n 
1 263 ASN n 
1 264 HIS n 
1 265 LEU n 
1 266 ARG n 
1 267 SER n 
1 268 TYR n 
1 269 LYS n 
1 270 TYR n 
1 271 TYR n 
1 272 SER n 
1 273 GLU n 
1 274 SER n 
1 275 ILE n 
1 276 LEU n 
1 277 ASN n 
1 278 PRO n 
1 279 ASP n 
1 280 GLY n 
1 281 PHE n 
1 282 ALA n 
1 283 SER n 
1 284 TYR n 
1 285 PRO n 
1 286 CYS n 
1 287 ALA n 
1 288 SER n 
1 289 TYR n 
1 290 ARG n 
1 291 ALA n 
1 292 PHE n 
1 293 GLU n 
1 294 SER n 
1 295 ASN n 
1 296 LYS n 
1 297 CYS n 
1 298 PHE n 
1 299 PRO n 
1 300 CYS n 
1 301 PRO n 
1 302 ASP n 
1 303 GLN n 
1 304 GLY n 
1 305 CYS n 
1 306 PRO n 
1 307 GLN n 
1 308 MET n 
1 309 GLY n 
1 310 HIS n 
1 311 TYR n 
1 312 ALA n 
1 313 ASP n 
1 314 LYS n 
1 315 PHE n 
1 316 ALA n 
1 317 VAL n 
1 318 LYS n 
1 319 THR n 
1 320 SER n 
1 321 ASP n 
1 322 GLU n 
1 323 THR n 
1 324 GLN n 
1 325 LYS n 
1 326 TYR n 
1 327 PHE n 
1 328 LEU n 
1 329 ASN n 
1 330 THR n 
1 331 GLY n 
1 332 ASP n 
1 333 SER n 
1 334 SER n 
1 335 ASN n 
1 336 PHE n 
1 337 ALA n 
1 338 ARG n 
1 339 TRP n 
1 340 ARG n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 SER n 
1 345 ILE n 
1 346 THR n 
1 347 LEU n 
1 348 SER n 
1 349 GLY n 
1 350 LYS n 
1 351 ARG n 
1 352 ALA n 
1 353 THR n 
1 354 GLY n 
1 355 GLN n 
1 356 ALA n 
1 357 LYS n 
1 358 VAL n 
1 359 ALA n 
1 360 LEU n 
1 361 PHE n 
1 362 GLY n 
1 363 SER n 
1 364 LYS n 
1 365 GLY n 
1 366 ASN n 
1 367 THR n 
1 368 HIS n 
1 369 GLN n 
1 370 PHE n 
1 371 ASN n 
1 372 ILE n 
1 373 PHE n 
1 374 LYS n 
1 375 GLY n 
1 376 ILE n 
1 377 LEU n 
1 378 LYS n 
1 379 PRO n 
1 380 GLY n 
1 381 SER n 
1 382 THR n 
1 383 HIS n 
1 384 SER n 
1 385 ASN n 
1 386 GLU n 
1 387 PHE n 
1 388 ASP n 
1 389 ALA n 
1 390 LYS n 
1 391 LEU n 
1 392 ASP n 
1 393 VAL n 
1 394 GLY n 
1 395 THR n 
1 396 ILE n 
1 397 GLU n 
1 398 LYS n 
1 399 VAL n 
1 400 LYS n 
1 401 PHE n 
1 402 LEU n 
1 403 TRP n 
1 404 ASN n 
1 405 ASN n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 ASN n 
1 410 PRO n 
1 411 THR n 
1 412 PHE n 
1 413 PRO n 
1 414 LYS n 
1 415 VAL n 
1 416 GLY n 
1 417 ALA n 
1 418 ALA n 
1 419 LYS n 
1 420 ILE n 
1 421 THR n 
1 422 VAL n 
1 423 GLN n 
1 424 LYS n 
1 425 GLY n 
1 426 GLU n 
1 427 GLU n 
1 428 LYS n 
1 429 THR n 
1 430 VAL n 
1 431 HIS n 
1 432 SER n 
1 433 PHE n 
1 434 CYS n 
1 435 SER n 
1 436 GLU n 
1 437 SER n 
1 438 THR n 
1 439 VAL n 
1 440 ARG n 
1 441 GLU n 
1 442 ASP n 
1 443 VAL n 
1 444 LEU n 
1 445 LEU n 
1 446 THR n 
1 447 LEU n 
1 448 THR n 
1 449 PRO n 
1 450 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                dog 
_entity_src_nat.pdbx_organism_scientific   'Canis lupus familiaris' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9615 
_entity_src_nat.genus                      Canis 
_entity_src_nat.species                    'Canis lupus' 
_entity_src_nat.strain                     familiaris 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             'PANCREATIC JUICE' 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 PANCREAS 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LIP1_CANFA 
_struct_ref.pdbx_db_accession          P06857 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           18 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RP1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 450 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06857 
_struct_ref_seq.db_align_beg                  18 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  467 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       449 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1RP1 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      62 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P06857 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          79 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            60 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RP1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   53. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLIZED FROM 20% PEG 8000 WITH 25MM POTASSIUM PHOSPHATE BUFFER AT PH 4.2.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SPHERICAL GRATING MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE DW32' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   DW32 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RP1 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             9.0 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   30017 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              0.067 
_reflns.pdbx_netI_over_sigmaI        11.2 
_reflns.B_iso_Wilson_estimate        33.17 
_reflns.pdbx_redundancy              3.4 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           0.368 
_reflns_shell.pdbx_Rsym_value        0.368 
_reflns_shell.meanI_over_sigI_obs    3. 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1RP1 
_refine.ls_number_reflns_obs                     30055 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1300 
_refine.pdbx_data_cutoff_low_absF                70. 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             9.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    97.3 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.195 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5. 
_refine.ls_number_reflns_R_free                  1540 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               31.01 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1THG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3425 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             358 
_refine_hist.number_atoms_total               3798 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        9.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.4  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.17 
_refine_ls_shell.number_reflns_R_work             1359 
_refine_ls_shell.R_factor_R_work                  0.183 
_refine_ls_shell.percent_reflns_obs               95.15 
_refine_ls_shell.R_factor_R_free                  0.2697 
_refine_ls_shell.R_factor_R_free_error            0.032 
_refine_ls_shell.percent_reflns_R_free            5.01 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO   TOPH19X.PRO  'X-RAY DIFFRACTION' 
2 PARHCSDX.PRO   TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
3 PARAM3_MOD.CHO TOPH3.CHO    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RP1 
_struct.title                     'DOG PANCREATIC LIPASE RELATED PROTEIN 1' 
_struct.pdbx_descriptor           'PANCREATIC LIPASE RELATED PROTEIN 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RP1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, LIPID DEGRADATION, PANCREATIC LIPASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 58  ? GLY A 62  ? PRO A 56  GLY A 60  5 ? 5  
HELX_P HELX_P2 2 TRP A 87  ? LYS A 97  ? TRP A 85  LYS A 95  1 ? 11 
HELX_P HELX_P3 3 TYR A 116 ? TYR A 141 ? TYR A 114 TYR A 139 1 ? 26 
HELX_P HELX_P4 4 SER A 154 ? SER A 165 ? SER A 152 SER A 163 5 ? 12 
HELX_P HELX_P5 5 LEU A 249 ? TRP A 253 ? LEU A 248 TRP A 252 1 ? 5  
HELX_P HELX_P6 6 CYS A 262 ? LEU A 276 ? CYS A 261 LEU A 275 1 ? 15 
HELX_P HELX_P7 7 TYR A 289 ? GLU A 293 ? TYR A 288 GLU A 292 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A CYS 10  SG ? ? A CYS 4   A CYS 10  1_555 ? ? ? ? ? ? ? 2.016 ? ?               
disulf2 disulf ?   ? A CYS 92  SG  ? ? ? 1_555 A CYS 103 SG ? ? A CYS 90  A CYS 101 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf3 disulf ?   ? A CYS 238 SG  ? ? ? 1_555 A CYS 262 SG ? ? A CYS 237 A CYS 261 1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf4 disulf ?   ? A CYS 286 SG  ? ? ? 1_555 A CYS 297 SG ? ? A CYS 285 A CYS 296 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf5 disulf ?   ? A CYS 300 SG  ? ? ? 1_555 A CYS 305 SG ? ? A CYS 299 A CYS 304 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf6 disulf ?   ? A CYS 434 SG  ? ? ? 1_555 A CYS 450 SG ? ? A CYS 433 A CYS 449 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
covale1 covale one ? A ASN 140 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 138 A NAG 500 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
metalc1 metalc ?   ? A GLU 33  OE1 ? ? ? 8_555 C CA  .   CA ? ? A GLU 32  A CA  501 1_555 ? ? ? ? ? ? ? 2.735 ? ?               
metalc2 metalc ?   ? A GLU 188 O   ? ? ? 1_555 C CA  .   CA ? ? A GLU 187 A CA  501 1_555 ? ? ? ? ? ? ? 2.243 ? ?               
metalc3 metalc ?   ? A ARG 191 O   ? ? ? 1_555 C CA  .   CA ? ? A ARG 190 A CA  501 1_555 ? ? ? ? ? ? ? 2.293 ? ?               
metalc4 metalc ?   ? A ASP 193 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASP 192 A CA  501 1_555 ? ? ? ? ? ? ? 2.371 ? ?               
metalc5 metalc ?   ? A ASP 196 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASP 195 A CA  501 1_555 ? ? ? ? ? ? ? 2.528 ? ?               
metalc6 metalc ?   ? A ASP 196 OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 195 A CA  501 1_555 ? ? ? ? ? ? ? 2.548 ? ?               
metalc7 metalc ?   ? C CA  .   CA  ? ? ? 1_555 D HOH .   O  ? ? A CA  501 A HOH 722 1_555 ? ? ? ? ? ? ? 2.264 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15  A . ? GLU 15  A PRO 16  A ? PRO 16  A 1 0.59 
2 ILE 211 A . ? ILE 210 A PRO 212 A ? PRO 211 A 1 0.46 
3 PHE 298 A . ? PHE 297 A PRO 299 A ? PRO 298 A 1 0.79 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
B 8 9 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 2   ? TYR A 5   ? GLU A 2   TYR A 5   
A 2 GLY A 9   ? SER A 12  ? GLY A 9   SER A 12  
B 1 GLN A 51  ? LEU A 53  ? GLN A 50  LEU A 52  
B 2 ARG A 38  ? THR A 43  ? ARG A 37  THR A 42  
B 3 VAL A 101 ? ASP A 107 ? VAL A 99  ASP A 105 
B 4 LYS A 71  ? ILE A 76  ? LYS A 69  ILE A 74  
B 5 VAL A 148 ? HIS A 153 ? VAL A 146 HIS A 151 
B 6 ARG A 172 ? LEU A 176 ? ARG A 171 LEU A 175 
B 7 PHE A 199 ? ILE A 203 ? PHE A 198 ILE A 202 
B 8 LEU A 225 ? PRO A 229 ? LEU A 224 PRO A 228 
B 9 LYS A 325 ? LEU A 328 ? LYS A 324 LEU A 327 
C 1 THR A 382 ? ALA A 389 ? THR A 381 ALA A 388 
C 2 TRP A 339 ? GLY A 349 ? TRP A 338 GLY A 348 
C 3 VAL A 415 ? LYS A 424 ? VAL A 415 LYS A 424 
C 4 HIS A 431 ? CYS A 434 ? HIS A 701 CYS A 433 
D 1 LEU A 445 ? THR A 448 ? LEU A 444 THR A 447 
D 2 ILE A 396 ? ASN A 405 ? ILE A 395 ASN A 404 
D 3 ALA A 352 ? GLY A 362 ? ALA A 351 GLY A 361 
D 4 PHE A 370 ? LEU A 377 ? PHE A 369 LEU A 376 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 3   ? O VAL A 3   N PHE A 11  ? N PHE A 11  
B 1 2 O GLN A 51  ? O GLN A 50  N LEU A 41  ? N LEU A 40  
B 2 3 O ARG A 38  ? O ARG A 37  N ASP A 107 ? N ASP A 105 
B 3 4 O ASN A 102 ? O ASN A 100 N LYS A 71  ? N LYS A 69  
B 4 5 O THR A 72  ? O THR A 70  N GLN A 149 ? N GLN A 147 
B 5 6 O LEU A 150 ? O LEU A 148 N ARG A 172 ? N ARG A 171 
B 6 7 O ILE A 173 ? O ILE A 172 N PHE A 199 ? N PHE A 198 
B 7 8 O VAL A 202 ? O VAL A 201 N LEU A 225 ? N LEU A 224 
B 8 9 O ASP A 226 ? O ASP A 225 N TYR A 326 ? N TYR A 325 
C 1 2 O HIS A 383 ? O HIS A 382 N ILE A 345 ? N ILE A 344 
C 2 3 O GLY A 342 ? O GLY A 341 N GLN A 423 ? N GLN A 423 
C 3 4 O ILE A 420 ? O ILE A 420 N PHE A 433 ? N PHE A 432 
D 1 2 O LEU A 445 ? O LEU A 444 N PHE A 401 ? N PHE A 400 
D 2 3 O GLU A 397 ? O GLU A 396 N PHE A 361 ? N PHE A 360 
D 3 4 O ALA A 352 ? O ALA A 351 N LEU A 377 ? N LEU A 376 
# 
_database_PDB_matrix.entry_id          1RP1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RP1 
_atom_sites.fract_transf_matrix[1][1]   0.018510 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006634 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007575 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 1   ? 2.624   39.658  -15.985 1.00 44.83 ? 1    LYS A N   1 
ATOM   2    C  CA  . LYS A 1 1   ? 1.345   40.165  -15.393 1.00 46.28 ? 1    LYS A CA  1 
ATOM   3    C  C   . LYS A 1 1   ? 1.549   40.309  -13.891 1.00 45.13 ? 1    LYS A C   1 
ATOM   4    O  O   . LYS A 1 1   ? 2.399   39.629  -13.307 1.00 44.53 ? 1    LYS A O   1 
ATOM   5    C  CB  . LYS A 1 1   ? 0.181   39.212  -15.704 1.00 46.75 ? 1    LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 1   ? -1.207  39.743  -15.329 1.00 47.90 ? 1    LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 1   ? -2.302  38.892  -15.991 1.00 49.57 ? 1    LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 1   ? -3.711  39.170  -15.442 1.00 50.41 ? 1    LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 1   ? -4.184  40.591  -15.590 1.00 51.85 ? 1    LYS A NZ  1 
ATOM   10   N  N   . GLU A 1 2   ? 0.760   41.173  -13.273 1.00 43.62 ? 2    GLU A N   1 
ATOM   11   C  CA  . GLU A 1 2   ? 0.895   41.417  -11.851 1.00 42.48 ? 2    GLU A CA  1 
ATOM   12   C  C   . GLU A 1 2   ? -0.445  41.807  -11.263 1.00 41.92 ? 2    GLU A C   1 
ATOM   13   O  O   . GLU A 1 2   ? -1.230  42.493  -11.926 1.00 40.83 ? 2    GLU A O   1 
ATOM   14   C  CB  . GLU A 1 2   ? 1.904   42.551  -11.655 1.00 42.77 ? 2    GLU A CB  1 
ATOM   15   C  CG  . GLU A 1 2   ? 2.086   43.028  -10.244 1.00 43.34 ? 2    GLU A CG  1 
ATOM   16   C  CD  . GLU A 1 2   ? 2.846   44.345  -10.178 1.00 43.52 ? 2    GLU A CD  1 
ATOM   17   O  OE1 . GLU A 1 2   ? 2.352   45.353  -10.725 1.00 43.62 ? 2    GLU A OE1 1 
ATOM   18   O  OE2 . GLU A 1 2   ? 3.923   44.374  -9.566  1.00 43.92 ? 2    GLU A OE2 1 
ATOM   19   N  N   . VAL A 1 3   ? -0.738  41.304  -10.062 1.00 39.52 ? 3    VAL A N   1 
ATOM   20   C  CA  . VAL A 1 3   ? -1.977  41.654  -9.365  1.00 38.24 ? 3    VAL A CA  1 
ATOM   21   C  C   . VAL A 1 3   ? -1.595  42.319  -8.059  1.00 36.70 ? 3    VAL A C   1 
ATOM   22   O  O   . VAL A 1 3   ? -0.668  41.884  -7.383  1.00 36.41 ? 3    VAL A O   1 
ATOM   23   C  CB  . VAL A 1 3   ? -2.895  40.441  -9.066  1.00 36.42 ? 3    VAL A CB  1 
ATOM   24   C  CG1 . VAL A 1 3   ? -3.489  39.930  -10.336 1.00 39.14 ? 3    VAL A CG1 1 
ATOM   25   C  CG2 . VAL A 1 3   ? -2.141  39.348  -8.335  1.00 36.39 ? 3    VAL A CG2 1 
ATOM   26   N  N   . CYS A 1 4   ? -2.297  43.389  -7.722  1.00 37.38 ? 4    CYS A N   1 
ATOM   27   C  CA  . CYS A 1 4   ? -2.026  44.143  -6.512  1.00 36.22 ? 4    CYS A CA  1 
ATOM   28   C  C   . CYS A 1 4   ? -3.282  44.201  -5.680  1.00 34.39 ? 4    CYS A C   1 
ATOM   29   O  O   . CYS A 1 4   ? -4.367  44.500  -6.187  1.00 32.99 ? 4    CYS A O   1 
ATOM   30   C  CB  . CYS A 1 4   ? -1.568  45.566  -6.862  1.00 36.50 ? 4    CYS A CB  1 
ATOM   31   S  SG  . CYS A 1 4   ? -0.090  45.620  -7.917  1.00 37.20 ? 4    CYS A SG  1 
ATOM   32   N  N   . TYR A 1 5   ? -3.131  43.915  -4.403  1.00 33.03 ? 5    TYR A N   1 
ATOM   33   C  CA  . TYR A 1 5   ? -4.248  43.921  -3.488  1.00 33.12 ? 5    TYR A CA  1 
ATOM   34   C  C   . TYR A 1 5   ? -4.026  44.950  -2.394  1.00 32.46 ? 5    TYR A C   1 
ATOM   35   O  O   . TYR A 1 5   ? -2.905  45.163  -1.965  1.00 33.90 ? 5    TYR A O   1 
ATOM   36   C  CB  . TYR A 1 5   ? -4.419  42.520  -2.899  1.00 30.06 ? 5    TYR A CB  1 
ATOM   37   C  CG  . TYR A 1 5   ? -4.702  41.487  -3.961  1.00 27.91 ? 5    TYR A CG  1 
ATOM   38   C  CD1 . TYR A 1 5   ? -5.801  41.615  -4.790  1.00 25.30 ? 5    TYR A CD1 1 
ATOM   39   C  CD2 . TYR A 1 5   ? -3.868  40.381  -4.136  1.00 26.50 ? 5    TYR A CD2 1 
ATOM   40   C  CE1 . TYR A 1 5   ? -6.074  40.662  -5.774  1.00 26.58 ? 5    TYR A CE1 1 
ATOM   41   C  CE2 . TYR A 1 5   ? -4.132  39.427  -5.116  1.00 25.60 ? 5    TYR A CE2 1 
ATOM   42   C  CZ  . TYR A 1 5   ? -5.233  39.571  -5.925  1.00 25.65 ? 5    TYR A CZ  1 
ATOM   43   O  OH  . TYR A 1 5   ? -5.542  38.635  -6.880  1.00 23.70 ? 5    TYR A OH  1 
ATOM   44   N  N   . GLU A 1 6   ? -5.109  45.553  -1.916  1.00 34.10 ? 6    GLU A N   1 
ATOM   45   C  CA  . GLU A 1 6   ? -5.029  46.561  -0.867  1.00 34.09 ? 6    GLU A CA  1 
ATOM   46   C  C   . GLU A 1 6   ? -4.196  46.135  0.328   1.00 35.50 ? 6    GLU A C   1 
ATOM   47   O  O   . GLU A 1 6   ? -4.347  45.021  0.833   1.00 37.95 ? 6    GLU A O   1 
ATOM   48   C  CB  . GLU A 1 6   ? -6.429  46.904  -0.379  1.00 35.44 ? 6    GLU A CB  1 
ATOM   49   C  CG  . GLU A 1 6   ? -7.262  47.670  -1.391  1.00 35.10 ? 6    GLU A CG  1 
ATOM   50   C  CD  . GLU A 1 6   ? -8.624  47.996  -0.874  1.00 34.11 ? 6    GLU A CD  1 
ATOM   51   O  OE1 . GLU A 1 6   ? -8.723  48.447  0.276   1.00 35.97 ? 6    GLU A OE1 1 
ATOM   52   O  OE2 . GLU A 1 6   ? -9.605  47.824  -1.618  1.00 34.51 ? 6    GLU A OE2 1 
ATOM   53   N  N   . GLN A 1 7   ? -3.294  47.015  0.749   1.00 35.06 ? 7    GLN A N   1 
ATOM   54   C  CA  . GLN A 1 7   ? -2.430  46.824  1.917   1.00 35.87 ? 7    GLN A CA  1 
ATOM   55   C  C   . GLN A 1 7   ? -1.437  45.660  1.930   1.00 35.77 ? 7    GLN A C   1 
ATOM   56   O  O   . GLN A 1 7   ? -0.519  45.663  2.739   1.00 33.52 ? 7    GLN A O   1 
ATOM   57   C  CB  . GLN A 1 7   ? -3.264  46.802  3.203   1.00 39.03 ? 7    GLN A CB  1 
ATOM   58   C  CG  . GLN A 1 7   ? -3.905  48.147  3.574   1.00 41.36 ? 7    GLN A CG  1 
ATOM   59   C  CD  . GLN A 1 7   ? -5.154  47.981  4.430   1.00 44.15 ? 7    GLN A CD  1 
ATOM   60   O  OE1 . GLN A 1 7   ? -5.624  46.865  4.649   1.00 45.66 ? 7    GLN A OE1 1 
ATOM   61   N  NE2 . GLN A 1 7   ? -5.705  49.084  4.903   1.00 41.50 ? 7    GLN A NE2 1 
ATOM   62   N  N   . ILE A 1 8   ? -1.585  44.686  1.033   1.00 34.25 ? 8    ILE A N   1 
ATOM   63   C  CA  . ILE A 1 8   ? -0.657  43.560  1.029   1.00 31.65 ? 8    ILE A CA  1 
ATOM   64   C  C   . ILE A 1 8   ? 0.292   43.554  -0.156  1.00 31.12 ? 8    ILE A C   1 
ATOM   65   O  O   . ILE A 1 8   ? 1.094   42.629  -0.331  1.00 31.70 ? 8    ILE A O   1 
ATOM   66   C  CB  . ILE A 1 8   ? -1.415  42.221  1.209   1.00 30.49 ? 8    ILE A CB  1 
ATOM   67   C  CG1 . ILE A 1 8   ? -2.346  41.943  0.012   1.00 29.97 ? 8    ILE A CG1 1 
ATOM   68   C  CG2 . ILE A 1 8   ? -2.252  42.303  2.476   1.00 28.04 ? 8    ILE A CG2 1 
ATOM   69   C  CD1 . ILE A 1 8   ? -3.057  40.612  0.107   1.00 29.84 ? 8    ILE A CD1 1 
ATOM   70   N  N   . GLY A 1 9   ? 0.231   44.617  -0.950  1.00 30.07 ? 9    GLY A N   1 
ATOM   71   C  CA  . GLY A 1 9   ? 1.111   44.738  -2.095  1.00 29.09 ? 9    GLY A CA  1 
ATOM   72   C  C   . GLY A 1 9   ? 0.719   44.004  -3.374  1.00 28.42 ? 9    GLY A C   1 
ATOM   73   O  O   . GLY A 1 9   ? -0.445  43.648  -3.565  1.00 26.45 ? 9    GLY A O   1 
ATOM   74   N  N   . CYS A 1 10  ? 1.726   43.702  -4.192  1.00 28.27 ? 10   CYS A N   1 
ATOM   75   C  CA  . CYS A 1 10  ? 1.539   43.043  -5.477  1.00 32.09 ? 10   CYS A CA  1 
ATOM   76   C  C   . CYS A 1 10  ? 2.226   41.678  -5.574  1.00 30.49 ? 10   CYS A C   1 
ATOM   77   O  O   . CYS A 1 10  ? 3.145   41.383  -4.824  1.00 30.00 ? 10   CYS A O   1 
ATOM   78   C  CB  . CYS A 1 10  ? 2.072   43.950  -6.602  1.00 33.85 ? 10   CYS A CB  1 
ATOM   79   S  SG  . CYS A 1 10  ? 1.433   45.664  -6.597  1.00 36.35 ? 10   CYS A SG  1 
ATOM   80   N  N   . PHE A 1 11  ? 1.764   40.858  -6.516  1.00 28.75 ? 11   PHE A N   1 
ATOM   81   C  CA  . PHE A 1 11  ? 2.287   39.515  -6.768  1.00 27.45 ? 11   PHE A CA  1 
ATOM   82   C  C   . PHE A 1 11  ? 2.365   39.349  -8.281  1.00 28.40 ? 11   PHE A C   1 
ATOM   83   O  O   . PHE A 1 11  ? 1.405   39.626  -8.978  1.00 29.03 ? 11   PHE A O   1 
ATOM   84   C  CB  . PHE A 1 11  ? 1.327   38.476  -6.180  1.00 25.09 ? 11   PHE A CB  1 
ATOM   85   C  CG  . PHE A 1 11  ? 0.966   38.740  -4.729  1.00 23.74 ? 11   PHE A CG  1 
ATOM   86   C  CD1 . PHE A 1 11  ? 0.003   39.685  -4.413  1.00 21.35 ? 11   PHE A CD1 1 
ATOM   87   C  CD2 . PHE A 1 11  ? 1.652   38.107  -3.700  1.00 23.29 ? 11   PHE A CD2 1 
ATOM   88   C  CE1 . PHE A 1 11  ? -0.274  40.006  -3.092  1.00 23.28 ? 11   PHE A CE1 1 
ATOM   89   C  CE2 . PHE A 1 11  ? 1.387   38.418  -2.360  1.00 23.78 ? 11   PHE A CE2 1 
ATOM   90   C  CZ  . PHE A 1 11  ? 0.421   39.371  -2.048  1.00 24.50 ? 11   PHE A CZ  1 
ATOM   91   N  N   . SER A 1 12  ? 3.519   38.953  -8.786  1.00 30.97 ? 12   SER A N   1 
ATOM   92   C  CA  . SER A 1 12  ? 3.686   38.745  -10.209 1.00 33.92 ? 12   SER A CA  1 
ATOM   93   C  C   . SER A 1 12  ? 3.849   37.262  -10.503 1.00 36.00 ? 12   SER A C   1 
ATOM   94   O  O   . SER A 1 12  ? 4.061   36.453  -9.598  1.00 34.51 ? 12   SER A O   1 
ATOM   95   C  CB  . SER A 1 12  ? 4.916   39.499  -10.731 1.00 34.99 ? 12   SER A CB  1 
ATOM   96   O  OG  . SER A 1 12  ? 6.112   38.742  -10.594 1.00 36.49 ? 12   SER A OG  1 
ATOM   97   N  N   . ASP A 1 13  ? 3.733   36.908  -11.779 1.00 38.98 ? 13   ASP A N   1 
ATOM   98   C  CA  . ASP A 1 13  ? 3.898   35.535  -12.215 1.00 38.94 ? 13   ASP A CA  1 
ATOM   99   C  C   . ASP A 1 13  ? 5.277   35.379  -12.846 1.00 40.59 ? 13   ASP A C   1 
ATOM   100  O  O   . ASP A 1 13  ? 5.520   34.456  -13.624 1.00 40.24 ? 13   ASP A O   1 
ATOM   101  C  CB  . ASP A 1 13  ? 2.784   35.141  -13.192 1.00 40.67 ? 13   ASP A CB  1 
ATOM   102  C  CG  . ASP A 1 13  ? 2.742   36.005  -14.450 1.00 40.21 ? 13   ASP A CG  1 
ATOM   103  O  OD1 . ASP A 1 13  ? 3.560   36.929  -14.613 1.00 42.40 ? 13   ASP A OD1 1 
ATOM   104  O  OD2 . ASP A 1 13  ? 1.864   35.736  -15.289 1.00 40.80 ? 13   ASP A OD2 1 
ATOM   105  N  N   . ALA A 1 14  ? 6.156   36.336  -12.553 1.00 40.04 ? 14   ALA A N   1 
ATOM   106  C  CA  . ALA A 1 14  ? 7.521   36.316  -13.048 1.00 40.46 ? 14   ALA A CA  1 
ATOM   107  C  C   . ALA A 1 14  ? 8.236   35.194  -12.320 1.00 39.14 ? 14   ALA A C   1 
ATOM   108  O  O   . ALA A 1 14  ? 7.726   34.659  -11.342 1.00 40.94 ? 14   ALA A O   1 
ATOM   109  C  CB  . ALA A 1 14  ? 8.213   37.653  -12.743 1.00 41.94 ? 14   ALA A CB  1 
ATOM   110  N  N   . GLU A 1 15  ? 9.401   34.814  -12.811 1.00 37.92 ? 15   GLU A N   1 
ATOM   111  C  CA  . GLU A 1 15  ? 10.172  33.762  -12.167 1.00 37.83 ? 15   GLU A CA  1 
ATOM   112  C  C   . GLU A 1 15  ? 10.639  34.329  -10.822 1.00 36.91 ? 15   GLU A C   1 
ATOM   113  O  O   . GLU A 1 15  ? 10.890  35.544  -10.709 1.00 36.16 ? 15   GLU A O   1 
ATOM   114  C  CB  . GLU A 1 15  ? 11.350  33.302  -13.057 1.00 37.72 ? 15   GLU A CB  1 
ATOM   115  C  CG  . GLU A 1 15  ? 11.781  34.251  -14.201 1.00 39.08 ? 15   GLU A CG  1 
ATOM   116  C  CD  . GLU A 1 15  ? 10.854  34.259  -15.414 1.00 38.12 ? 15   GLU A CD  1 
ATOM   117  O  OE1 . GLU A 1 15  ? 11.024  33.407  -16.313 1.00 38.58 ? 15   GLU A OE1 1 
ATOM   118  O  OE2 . GLU A 1 15  ? 9.973   35.144  -15.506 1.00 38.58 ? 15   GLU A OE2 1 
ATOM   119  N  N   . PRO A 1 16  ? 10.743  33.476  -9.782  1.00 35.14 ? 16   PRO A N   1 
ATOM   120  C  CA  . PRO A 1 16  ? 10.476  32.029  -9.749  1.00 33.76 ? 16   PRO A CA  1 
ATOM   121  C  C   . PRO A 1 16  ? 9.031   31.604  -9.460  1.00 34.60 ? 16   PRO A C   1 
ATOM   122  O  O   . PRO A 1 16  ? 8.783   30.436  -9.114  1.00 35.05 ? 16   PRO A O   1 
ATOM   123  C  CB  . PRO A 1 16  ? 11.369  31.570  -8.610  1.00 35.54 ? 16   PRO A CB  1 
ATOM   124  C  CG  . PRO A 1 16  ? 11.151  32.686  -7.584  1.00 34.89 ? 16   PRO A CG  1 
ATOM   125  C  CD  . PRO A 1 16  ? 11.101  33.972  -8.442  1.00 33.84 ? 16   PRO A CD  1 
ATOM   126  N  N   . TRP A 1 17  ? 8.082   32.516  -9.580  1.00 32.47 ? 17   TRP A N   1 
ATOM   127  C  CA  . TRP A 1 17  ? 6.693   32.175  -9.269  1.00 34.38 ? 17   TRP A CA  1 
ATOM   128  C  C   . TRP A 1 17  ? 6.055   31.298  -10.331 1.00 35.68 ? 17   TRP A C   1 
ATOM   129  O  O   . TRP A 1 17  ? 5.157   30.498  -10.035 1.00 35.68 ? 17   TRP A O   1 
ATOM   130  C  CB  . TRP A 1 17  ? 5.886   33.461  -9.049  1.00 33.06 ? 17   TRP A CB  1 
ATOM   131  C  CG  . TRP A 1 17  ? 6.564   34.317  -8.074  1.00 34.53 ? 17   TRP A CG  1 
ATOM   132  C  CD1 . TRP A 1 17  ? 7.288   35.447  -8.335  1.00 36.10 ? 17   TRP A CD1 1 
ATOM   133  C  CD2 . TRP A 1 17  ? 6.731   34.044  -6.677  1.00 35.73 ? 17   TRP A CD2 1 
ATOM   134  N  NE1 . TRP A 1 17  ? 7.923   35.876  -7.192  1.00 36.08 ? 17   TRP A NE1 1 
ATOM   135  C  CE2 . TRP A 1 17  ? 7.595   35.041  -6.159  1.00 35.48 ? 17   TRP A CE2 1 
ATOM   136  C  CE3 . TRP A 1 17  ? 6.247   33.051  -5.813  1.00 35.09 ? 17   TRP A CE3 1 
ATOM   137  C  CZ2 . TRP A 1 17  ? 7.984   35.071  -4.821  1.00 35.71 ? 17   TRP A CZ2 1 
ATOM   138  C  CZ3 . TRP A 1 17  ? 6.634   33.081  -4.475  1.00 35.43 ? 17   TRP A CZ3 1 
ATOM   139  C  CH2 . TRP A 1 17  ? 7.497   34.089  -3.994  1.00 37.03 ? 17   TRP A CH2 1 
ATOM   140  N  N   . ALA A 1 18  ? 6.501   31.490  -11.564 1.00 35.93 ? 18   ALA A N   1 
ATOM   141  C  CA  . ALA A 1 18  ? 6.023   30.726  -12.721 1.00 39.43 ? 18   ALA A CA  1 
ATOM   142  C  C   . ALA A 1 18  ? 7.079   30.849  -13.828 1.00 39.64 ? 18   ALA A C   1 
ATOM   143  O  O   . ALA A 1 18  ? 8.116   31.482  -13.630 1.00 39.70 ? 18   ALA A O   1 
ATOM   144  C  CB  . ALA A 1 18  ? 4.684   31.261  -13.201 1.00 37.90 ? 18   ALA A CB  1 
ATOM   145  N  N   . GLY A 1 19  ? 6.849   30.196  -14.959 1.00 41.03 ? 19   GLY A N   1 
ATOM   146  C  CA  . GLY A 1 19  ? 7.790   30.286  -16.065 1.00 40.43 ? 19   GLY A CA  1 
ATOM   147  C  C   . GLY A 1 19  ? 9.088   29.530  -15.841 1.00 40.03 ? 19   GLY A C   1 
ATOM   148  O  O   . GLY A 1 19  ? 10.057  29.710  -16.598 1.00 38.30 ? 19   GLY A O   1 
ATOM   149  N  N   . THR A 1 20  ? 9.135   28.713  -14.789 1.00 40.64 ? 20   THR A N   1 
ATOM   150  C  CA  . THR A 1 20  ? 10.325  27.909  -14.481 1.00 41.18 ? 20   THR A CA  1 
ATOM   151  C  C   . THR A 1 20  ? 9.946   26.446  -14.652 1.00 41.21 ? 20   THR A C   1 
ATOM   152  O  O   . THR A 1 20  ? 8.765   26.106  -14.733 1.00 42.46 ? 20   THR A O   1 
ATOM   153  C  CB  . THR A 1 20  ? 10.846  28.118  -13.017 1.00 41.63 ? 20   THR A CB  1 
ATOM   154  O  OG1 . THR A 1 20  ? 9.915   27.563  -12.075 1.00 42.06 ? 20   THR A OG1 1 
ATOM   155  C  CG2 . THR A 1 20  ? 11.080  29.599  -12.722 1.00 41.02 ? 20   THR A CG2 1 
ATOM   156  N  N   . ALA A 1 21  ? 10.941  25.569  -14.622 1.00 43.21 ? 21   ALA A N   1 
ATOM   157  C  CA  . ALA A 1 21  ? 10.690  24.144  -14.770 1.00 42.32 ? 21   ALA A CA  1 
ATOM   158  C  C   . ALA A 1 21  ? 9.982   23.566  -13.555 1.00 42.43 ? 21   ALA A C   1 
ATOM   159  O  O   . ALA A 1 21  ? 9.248   22.585  -13.665 1.00 44.82 ? 21   ALA A O   1 
ATOM   160  C  CB  . ALA A 1 21  ? 12.007  23.407  -15.024 1.00 42.49 ? 21   ALA A CB  1 
ATOM   161  N  N   . ILE A 1 22  ? 10.237  24.137  -12.384 1.00 42.75 ? 22   ILE A N   1 
ATOM   162  C  CA  . ILE A 1 22  ? 9.600   23.658  -11.153 1.00 41.69 ? 22   ILE A CA  1 
ATOM   163  C  C   . ILE A 1 22  ? 8.195   24.231  -10.974 1.00 41.12 ? 22   ILE A C   1 
ATOM   164  O  O   . ILE A 1 22  ? 7.316   23.604  -10.370 1.00 40.01 ? 22   ILE A O   1 
ATOM   165  C  CB  . ILE A 1 22  ? 10.478  23.935  -9.928  1.00 41.90 ? 22   ILE A CB  1 
ATOM   166  C  CG1 . ILE A 1 22  ? 11.813  23.201  -10.088 1.00 42.63 ? 22   ILE A CG1 1 
ATOM   167  C  CG2 . ILE A 1 22  ? 9.765   23.509  -8.641  1.00 42.71 ? 22   ILE A CG2 1 
ATOM   168  C  CD1 . ILE A 1 22  ? 12.708  23.251  -8.875  1.00 42.72 ? 22   ILE A CD1 1 
ATOM   169  N  N   . ARG A 1 23  ? 7.975   25.417  -11.532 1.00 41.01 ? 23   ARG A N   1 
ATOM   170  C  CA  . ARG A 1 23  ? 6.675   26.070  -11.456 1.00 41.47 ? 23   ARG A CA  1 
ATOM   171  C  C   . ARG A 1 23  ? 6.381   26.609  -12.854 1.00 42.19 ? 23   ARG A C   1 
ATOM   172  O  O   . ARG A 1 23  ? 6.498   27.808  -13.107 1.00 44.91 ? 23   ARG A O   1 
ATOM   173  C  CB  . ARG A 1 23  ? 6.703   27.195  -10.403 1.00 39.22 ? 23   ARG A CB  1 
ATOM   174  C  CG  . ARG A 1 23  ? 6.953   26.679  -8.982  1.00 38.35 ? 23   ARG A CG  1 
ATOM   175  C  CD  . ARG A 1 23  ? 7.116   27.772  -7.922  1.00 38.04 ? 23   ARG A CD  1 
ATOM   176  N  NE  . ARG A 1 23  ? 5.963   28.659  -7.805  1.00 36.24 ? 23   ARG A NE  1 
ATOM   177  C  CZ  . ARG A 1 23  ? 5.227   28.817  -6.704  1.00 36.21 ? 23   ARG A CZ  1 
ATOM   178  N  NH1 . ARG A 1 23  ? 5.488   28.130  -5.595  1.00 33.36 ? 23   ARG A NH1 1 
ATOM   179  N  NH2 . ARG A 1 23  ? 4.297   29.762  -6.672  1.00 36.43 ? 23   ARG A NH2 1 
ATOM   180  N  N   . PRO A 1 24  ? 6.033   25.711  -13.802 1.00 43.08 ? 24   PRO A N   1 
ATOM   181  C  CA  . PRO A 1 24  ? 5.736   26.102  -15.186 1.00 43.10 ? 24   PRO A CA  1 
ATOM   182  C  C   . PRO A 1 24  ? 4.569   27.047  -15.419 1.00 43.03 ? 24   PRO A C   1 
ATOM   183  O  O   . PRO A 1 24  ? 4.708   28.045  -16.118 1.00 44.10 ? 24   PRO A O   1 
ATOM   184  C  CB  . PRO A 1 24  ? 5.495   24.752  -15.879 1.00 43.64 ? 24   PRO A CB  1 
ATOM   185  C  CG  . PRO A 1 24  ? 5.000   23.872  -14.767 1.00 42.47 ? 24   PRO A CG  1 
ATOM   186  C  CD  . PRO A 1 24  ? 5.934   24.245  -13.648 1.00 42.81 ? 24   PRO A CD  1 
ATOM   187  N  N   . LEU A 1 25  ? 3.423   26.712  -14.842 1.00 42.25 ? 25   LEU A N   1 
ATOM   188  C  CA  . LEU A 1 25  ? 2.196   27.486  -15.030 1.00 43.12 ? 25   LEU A CA  1 
ATOM   189  C  C   . LEU A 1 25  ? 2.123   28.929  -14.492 1.00 40.71 ? 25   LEU A C   1 
ATOM   190  O  O   . LEU A 1 25  ? 2.348   29.187  -13.310 1.00 39.66 ? 25   LEU A O   1 
ATOM   191  C  CB  . LEU A 1 25  ? 1.005   26.663  -14.528 1.00 43.50 ? 25   LEU A CB  1 
ATOM   192  C  CG  . LEU A 1 25  ? 0.358   25.641  -15.486 1.00 45.59 ? 25   LEU A CG  1 
ATOM   193  C  CD1 . LEU A 1 25  ? -0.722  26.308  -16.343 1.00 46.22 ? 25   LEU A CD1 1 
ATOM   194  C  CD2 . LEU A 1 25  ? 1.387   24.965  -16.358 1.00 46.95 ? 25   LEU A CD2 1 
ATOM   195  N  N   . LYS A 1 26  ? 1.774   29.867  -15.359 1.00 40.94 ? 26   LYS A N   1 
ATOM   196  C  CA  . LYS A 1 26  ? 1.650   31.260  -14.928 1.00 40.08 ? 26   LYS A CA  1 
ATOM   197  C  C   . LYS A 1 26  ? 0.272   31.520  -14.321 1.00 38.11 ? 26   LYS A C   1 
ATOM   198  O  O   . LYS A 1 26  ? -0.698  31.756  -15.035 1.00 38.17 ? 26   LYS A O   1 
ATOM   199  C  CB  . LYS A 1 26  ? 1.984   32.215  -16.073 1.00 40.78 ? 26   LYS A CB  1 
ATOM   200  C  CG  . LYS A 1 26  ? 3.414   32.018  -16.534 1.00 41.55 ? 26   LYS A CG  1 
ATOM   201  C  CD  . LYS A 1 26  ? 3.871   33.015  -17.556 1.00 44.26 ? 26   LYS A CD  1 
ATOM   202  C  CE  . LYS A 1 26  ? 5.372   32.815  -17.818 1.00 44.69 ? 26   LYS A CE  1 
ATOM   203  N  NZ  . LYS A 1 26  ? 5.941   33.799  -18.796 1.00 46.73 ? 26   LYS A NZ  1 
ATOM   204  N  N   . VAL A 1 27  ? 0.194   31.400  -12.997 1.00 36.42 ? 27   VAL A N   1 
ATOM   205  C  CA  . VAL A 1 27  ? -1.046  31.591  -12.241 1.00 35.15 ? 27   VAL A CA  1 
ATOM   206  C  C   . VAL A 1 27  ? -0.825  32.558  -11.085 1.00 35.61 ? 27   VAL A C   1 
ATOM   207  O  O   . VAL A 1 27  ? 0.063   32.366  -10.253 1.00 35.74 ? 27   VAL A O   1 
ATOM   208  C  CB  . VAL A 1 27  ? -1.554  30.244  -11.631 1.00 34.70 ? 27   VAL A CB  1 
ATOM   209  C  CG1 . VAL A 1 27  ? -2.900  30.434  -10.976 1.00 32.79 ? 27   VAL A CG1 1 
ATOM   210  C  CG2 . VAL A 1 27  ? -1.653  29.180  -12.703 1.00 34.28 ? 27   VAL A CG2 1 
ATOM   211  N  N   . LEU A 1 28  ? -1.675  33.574  -11.006 1.00 34.49 ? 28   LEU A N   1 
ATOM   212  C  CA  . LEU A 1 28  ? -1.582  34.574  -9.951  1.00 31.62 ? 28   LEU A CA  1 
ATOM   213  C  C   . LEU A 1 28  ? -2.496  34.207  -8.791  1.00 30.03 ? 28   LEU A C   1 
ATOM   214  O  O   . LEU A 1 28  ? -3.533  33.574  -8.995  1.00 28.63 ? 28   LEU A O   1 
ATOM   215  C  CB  . LEU A 1 28  ? -1.997  35.947  -10.497 1.00 32.59 ? 28   LEU A CB  1 
ATOM   216  C  CG  . LEU A 1 28  ? -1.065  36.546  -11.559 1.00 33.92 ? 28   LEU A CG  1 
ATOM   217  C  CD1 . LEU A 1 28  ? -1.837  37.577  -12.362 1.00 34.66 ? 28   LEU A CD1 1 
ATOM   218  C  CD2 . LEU A 1 28  ? 0.169   37.173  -10.890 1.00 32.25 ? 28   LEU A CD2 1 
ATOM   219  N  N   . PRO A 1 29  ? -2.155  34.668  -7.573  1.00 29.30 ? 29   PRO A N   1 
ATOM   220  C  CA  . PRO A 1 29  ? -2.917  34.419  -6.346  1.00 30.57 ? 29   PRO A CA  1 
ATOM   221  C  C   . PRO A 1 29  ? -4.313  35.031  -6.473  1.00 30.87 ? 29   PRO A C   1 
ATOM   222  O  O   . PRO A 1 29  ? -4.468  36.103  -7.062  1.00 29.93 ? 29   PRO A O   1 
ATOM   223  C  CB  . PRO A 1 29  ? -2.140  35.208  -5.287  1.00 29.37 ? 29   PRO A CB  1 
ATOM   224  C  CG  . PRO A 1 29  ? -0.821  35.447  -5.874  1.00 29.58 ? 29   PRO A CG  1 
ATOM   225  C  CD  . PRO A 1 29  ? -1.095  35.650  -7.318  1.00 28.83 ? 29   PRO A CD  1 
ATOM   226  N  N   . TRP A 1 30  ? -5.308  34.366  -5.903  1.00 30.11 ? 30   TRP A N   1 
ATOM   227  C  CA  . TRP A 1 30  ? -6.674  34.857  -5.899  1.00 28.83 ? 30   TRP A CA  1 
ATOM   228  C  C   . TRP A 1 30  ? -6.670  36.112  -5.018  1.00 28.12 ? 30   TRP A C   1 
ATOM   229  O  O   . TRP A 1 30  ? -5.697  36.375  -4.323  1.00 28.10 ? 30   TRP A O   1 
ATOM   230  C  CB  . TRP A 1 30  ? -7.609  33.817  -5.268  1.00 28.38 ? 30   TRP A CB  1 
ATOM   231  C  CG  . TRP A 1 30  ? -8.043  32.638  -6.165  1.00 27.88 ? 30   TRP A CG  1 
ATOM   232  C  CD1 . TRP A 1 30  ? -7.809  32.471  -7.500  1.00 27.62 ? 30   TRP A CD1 1 
ATOM   233  C  CD2 . TRP A 1 30  ? -8.870  31.541  -5.769  1.00 27.18 ? 30   TRP A CD2 1 
ATOM   234  N  NE1 . TRP A 1 30  ? -8.460  31.350  -7.964  1.00 27.17 ? 30   TRP A NE1 1 
ATOM   235  C  CE2 . TRP A 1 30  ? -9.115  30.759  -6.921  1.00 25.45 ? 30   TRP A CE2 1 
ATOM   236  C  CE3 . TRP A 1 30  ? -9.440  31.147  -4.548  1.00 28.02 ? 30   TRP A CE3 1 
ATOM   237  C  CZ2 . TRP A 1 30  ? -9.904  29.617  -6.891  1.00 27.14 ? 30   TRP A CZ2 1 
ATOM   238  C  CZ3 . TRP A 1 30  ? -10.235 29.997  -4.527  1.00 28.73 ? 30   TRP A CZ3 1 
ATOM   239  C  CH2 . TRP A 1 30  ? -10.457 29.250  -5.696  1.00 26.30 ? 30   TRP A CH2 1 
ATOM   240  N  N   . SER A 1 31  A -7.781  36.836  -4.987  1.00 26.46 ? 30   SER A N   1 
ATOM   241  C  CA  . SER A 1 31  A -7.882  38.052  -4.180  1.00 28.09 ? 30   SER A CA  1 
ATOM   242  C  C   . SER A 1 31  A -8.191  37.702  -2.732  1.00 28.24 ? 30   SER A C   1 
ATOM   243  O  O   . SER A 1 31  A -8.570  36.574  -2.428  1.00 26.87 ? 30   SER A O   1 
ATOM   244  C  CB  . SER A 1 31  A -9.043  38.935  -4.684  1.00 27.47 ? 30   SER A CB  1 
ATOM   245  O  OG  . SER A 1 31  A -10.290 38.285  -4.448  1.00 27.55 ? 30   SER A OG  1 
ATOM   246  N  N   . PRO A 1 32  ? -7.940  38.646  -1.806  1.00 28.69 ? 31   PRO A N   1 
ATOM   247  C  CA  . PRO A 1 32  ? -8.230  38.405  -0.401  1.00 27.58 ? 31   PRO A CA  1 
ATOM   248  C  C   . PRO A 1 32  ? -9.701  38.045  -0.231  1.00 27.48 ? 31   PRO A C   1 
ATOM   249  O  O   . PRO A 1 32  ? -10.015 37.117  0.505   1.00 28.27 ? 31   PRO A O   1 
ATOM   250  C  CB  . PRO A 1 32  ? -7.898  39.751  0.222   1.00 26.64 ? 31   PRO A CB  1 
ATOM   251  C  CG  . PRO A 1 32  ? -6.645  40.077  -0.452  1.00 26.81 ? 31   PRO A CG  1 
ATOM   252  C  CD  . PRO A 1 32  ? -6.950  39.738  -1.921  1.00 27.69 ? 31   PRO A CD  1 
ATOM   253  N  N   . GLU A 1 33  ? -10.611 38.741  -0.912  1.00 26.86 ? 32   GLU A N   1 
ATOM   254  C  CA  . GLU A 1 33  ? -12.035 38.400  -0.750  1.00 24.99 ? 32   GLU A CA  1 
ATOM   255  C  C   . GLU A 1 33  ? -12.488 37.056  -1.362  1.00 25.33 ? 32   GLU A C   1 
ATOM   256  O  O   . GLU A 1 33  ? -13.436 36.480  -0.870  1.00 24.08 ? 32   GLU A O   1 
ATOM   257  C  CB  . GLU A 1 33  ? -12.967 39.525  -1.210  1.00 25.04 ? 32   GLU A CB  1 
ATOM   258  C  CG  . GLU A 1 33  ? -12.886 39.801  -2.672  1.00 24.99 ? 32   GLU A CG  1 
ATOM   259  C  CD  . GLU A 1 33  ? -13.993 40.705  -3.152  1.00 24.79 ? 32   GLU A CD  1 
ATOM   260  O  OE1 . GLU A 1 33  ? -14.564 41.469  -2.345  1.00 24.31 ? 32   GLU A OE1 1 
ATOM   261  O  OE2 . GLU A 1 33  ? -14.279 40.618  -4.339  1.00 22.15 ? 32   GLU A OE2 1 
ATOM   262  N  N   . ARG A 1 34  ? -11.849 36.585  -2.433  1.00 27.76 ? 33   ARG A N   1 
ATOM   263  C  CA  . ARG A 1 34  ? -12.216 35.287  -3.013  1.00 27.72 ? 33   ARG A CA  1 
ATOM   264  C  C   . ARG A 1 34  ? -11.732 34.186  -2.055  1.00 30.21 ? 33   ARG A C   1 
ATOM   265  O  O   . ARG A 1 34  ? -12.438 33.196  -1.818  1.00 29.32 ? 33   ARG A O   1 
ATOM   266  C  CB  . ARG A 1 34  ? -11.562 35.062  -4.372  1.00 30.50 ? 33   ARG A CB  1 
ATOM   267  C  CG  . ARG A 1 34  ? -12.035 33.794  -5.082  1.00 30.81 ? 33   ARG A CG  1 
ATOM   268  C  CD  . ARG A 1 34  ? -11.572 33.755  -6.537  1.00 32.23 ? 33   ARG A CD  1 
ATOM   269  N  NE  . ARG A 1 34  ? -11.964 32.516  -7.207  1.00 30.61 ? 33   ARG A NE  1 
ATOM   270  C  CZ  . ARG A 1 34  ? -11.719 32.242  -8.482  1.00 31.49 ? 33   ARG A CZ  1 
ATOM   271  N  NH1 . ARG A 1 34  ? -11.069 33.110  -9.259  1.00 31.71 ? 33   ARG A NH1 1 
ATOM   272  N  NH2 . ARG A 1 34  ? -12.173 31.116  -9.001  1.00 34.61 ? 33   ARG A NH2 1 
ATOM   273  N  N   . ILE A 1 35  ? -10.534 34.378  -1.502  1.00 30.12 ? 34   ILE A N   1 
ATOM   274  C  CA  . ILE A 1 35  ? -9.942  33.443  -0.552  1.00 31.36 ? 34   ILE A CA  1 
ATOM   275  C  C   . ILE A 1 35  ? -10.732 33.450  0.757   1.00 31.67 ? 34   ILE A C   1 
ATOM   276  O  O   . ILE A 1 35  ? -10.971 32.393  1.358   1.00 34.37 ? 34   ILE A O   1 
ATOM   277  C  CB  . ILE A 1 35  ? -8.453  33.764  -0.306  1.00 29.72 ? 34   ILE A CB  1 
ATOM   278  C  CG1 . ILE A 1 35  ? -7.681  33.616  -1.612  1.00 31.42 ? 34   ILE A CG1 1 
ATOM   279  C  CG2 . ILE A 1 35  ? -7.858  32.797  0.697   1.00 30.33 ? 34   ILE A CG2 1 
ATOM   280  C  CD1 . ILE A 1 35  ? -6.256  34.144  -1.575  1.00 29.80 ? 34   ILE A CD1 1 
ATOM   281  N  N   . GLY A 1 36  ? -11.130 34.641  1.198   1.00 31.23 ? 35   GLY A N   1 
ATOM   282  C  CA  . GLY A 1 36  ? -11.913 34.791  2.411   1.00 26.87 ? 35   GLY A CA  1 
ATOM   283  C  C   . GLY A 1 36  ? -11.194 34.451  3.694   1.00 26.69 ? 35   GLY A C   1 
ATOM   284  O  O   . GLY A 1 36  ? -11.795 33.928  4.633   1.00 25.65 ? 35   GLY A O   1 
ATOM   285  N  N   . THR A 1 37  ? -9.932  34.842  3.783   1.00 25.06 ? 36   THR A N   1 
ATOM   286  C  CA  . THR A 1 37  ? -9.124  34.555  4.954   1.00 24.96 ? 36   THR A CA  1 
ATOM   287  C  C   . THR A 1 37  ? -9.736  35.076  6.270   1.00 27.76 ? 36   THR A C   1 
ATOM   288  O  O   . THR A 1 37  ? -10.114 36.267  6.379   1.00 25.22 ? 36   THR A O   1 
ATOM   289  C  CB  . THR A 1 37  ? -7.714  35.128  4.767   1.00 22.85 ? 36   THR A CB  1 
ATOM   290  O  OG1 . THR A 1 37  ? -7.214  34.707  3.487   1.00 23.84 ? 36   THR A OG1 1 
ATOM   291  C  CG2 . THR A 1 37  ? -6.804  34.640  5.835   1.00 21.82 ? 36   THR A CG2 1 
ATOM   292  N  N   . ARG A 1 38  ? -9.858  34.177  7.254   1.00 26.36 ? 37   ARG A N   1 
ATOM   293  C  CA  . ARG A 1 38  ? -10.401 34.558  8.548   1.00 25.83 ? 37   ARG A CA  1 
ATOM   294  C  C   . ARG A 1 38  ? -9.370  34.310  9.637   1.00 27.12 ? 37   ARG A C   1 
ATOM   295  O  O   . ARG A 1 38  ? -8.607  33.325  9.591   1.00 25.42 ? 37   ARG A O   1 
ATOM   296  C  CB  . ARG A 1 38  ? -11.696 33.804  8.855   1.00 30.04 ? 37   ARG A CB  1 
ATOM   297  C  CG  . ARG A 1 38  ? -12.688 33.834  7.695   1.00 34.36 ? 37   ARG A CG  1 
ATOM   298  C  CD  . ARG A 1 38  ? -14.162 33.836  8.121   1.00 37.98 ? 37   ARG A CD  1 
ATOM   299  N  NE  . ARG A 1 38  ? -14.469 32.865  9.168   1.00 40.93 ? 37   ARG A NE  1 
ATOM   300  C  CZ  . ARG A 1 38  ? -14.535 31.547  8.989   1.00 43.76 ? 37   ARG A CZ  1 
ATOM   301  N  NH1 . ARG A 1 38  ? -14.314 31.020  7.785   1.00 45.42 ? 37   ARG A NH1 1 
ATOM   302  N  NH2 . ARG A 1 38  ? -14.822 30.752  10.017  1.00 43.26 ? 37   ARG A NH2 1 
ATOM   303  N  N   . PHE A 1 39  ? -9.293  35.252  10.571  1.00 23.98 ? 38   PHE A N   1 
ATOM   304  C  CA  . PHE A 1 39  ? -8.395  35.141  11.691  1.00 23.54 ? 38   PHE A CA  1 
ATOM   305  C  C   . PHE A 1 39  ? -9.311  34.932  12.882  1.00 26.30 ? 38   PHE A C   1 
ATOM   306  O  O   . PHE A 1 39  ? -10.055 35.846  13.285  1.00 26.68 ? 38   PHE A O   1 
ATOM   307  C  CB  . PHE A 1 39  ? -7.560  36.401  11.833  1.00 21.69 ? 38   PHE A CB  1 
ATOM   308  C  CG  . PHE A 1 39  ? -6.558  36.578  10.730  1.00 22.91 ? 38   PHE A CG  1 
ATOM   309  C  CD1 . PHE A 1 39  ? -6.952  37.039  9.484   1.00 21.94 ? 38   PHE A CD1 1 
ATOM   310  C  CD2 . PHE A 1 39  ? -5.225  36.235  10.928  1.00 21.39 ? 38   PHE A CD2 1 
ATOM   311  C  CE1 . PHE A 1 39  ? -6.039  37.163  8.449   1.00 23.50 ? 38   PHE A CE1 1 
ATOM   312  C  CE2 . PHE A 1 39  ? -4.309  36.347  9.914   1.00 23.65 ? 38   PHE A CE2 1 
ATOM   313  C  CZ  . PHE A 1 39  ? -4.711  36.820  8.660   1.00 23.44 ? 38   PHE A CZ  1 
ATOM   314  N  N   . LEU A 1 40  ? -9.352  33.688  13.357  1.00 25.40 ? 39   LEU A N   1 
ATOM   315  C  CA  . LEU A 1 40  ? -10.201 33.314  14.483  1.00 26.99 ? 39   LEU A CA  1 
ATOM   316  C  C   . LEU A 1 40  ? -9.377  33.249  15.750  1.00 27.42 ? 39   LEU A C   1 
ATOM   317  O  O   . LEU A 1 40  ? -8.491  32.404  15.869  1.00 28.08 ? 39   LEU A O   1 
ATOM   318  C  CB  . LEU A 1 40  ? -10.850 31.953  14.236  1.00 27.60 ? 39   LEU A CB  1 
ATOM   319  C  CG  . LEU A 1 40  ? -11.457 31.748  12.850  1.00 29.19 ? 39   LEU A CG  1 
ATOM   320  C  CD1 . LEU A 1 40  ? -12.089 30.356  12.761  1.00 30.00 ? 39   LEU A CD1 1 
ATOM   321  C  CD2 . LEU A 1 40  ? -12.503 32.810  12.613  1.00 29.63 ? 39   LEU A CD2 1 
ATOM   322  N  N   . LEU A 1 41  ? -9.685  34.125  16.696  1.00 27.56 ? 40   LEU A N   1 
ATOM   323  C  CA  . LEU A 1 41  ? -8.975  34.164  17.950  1.00 29.46 ? 40   LEU A CA  1 
ATOM   324  C  C   . LEU A 1 41  ? -9.658  33.372  19.058  1.00 30.76 ? 40   LEU A C   1 
ATOM   325  O  O   . LEU A 1 41  ? -10.871 33.482  19.285  1.00 30.72 ? 40   LEU A O   1 
ATOM   326  C  CB  . LEU A 1 41  ? -8.774  35.604  18.421  1.00 27.55 ? 40   LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 41  ? -8.213  35.787  19.831  1.00 29.35 ? 40   LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 41  ? -6.737  35.462  19.888  1.00 29.43 ? 40   LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 41  ? -8.459  37.213  20.267  1.00 30.43 ? 40   LEU A CD2 1 
ATOM   330  N  N   . TYR A 1 42  ? -8.855  32.560  19.733  1.00 33.22 ? 41   TYR A N   1 
ATOM   331  C  CA  . TYR A 1 42  ? -9.319  31.784  20.870  1.00 33.30 ? 41   TYR A CA  1 
ATOM   332  C  C   . TYR A 1 42  ? -8.298  32.071  21.958  1.00 33.00 ? 41   TYR A C   1 
ATOM   333  O  O   . TYR A 1 42  ? -7.109  32.230  21.666  1.00 32.46 ? 41   TYR A O   1 
ATOM   334  C  CB  . TYR A 1 42  ? -9.331  30.296  20.550  1.00 32.76 ? 41   TYR A CB  1 
ATOM   335  C  CG  . TYR A 1 42  ? -10.319 29.901  19.491  1.00 33.03 ? 41   TYR A CG  1 
ATOM   336  C  CD1 . TYR A 1 42  ? -11.626 29.584  19.821  1.00 32.79 ? 41   TYR A CD1 1 
ATOM   337  C  CD2 . TYR A 1 42  ? -9.938  29.807  18.161  1.00 33.52 ? 41   TYR A CD2 1 
ATOM   338  C  CE1 . TYR A 1 42  ? -12.533 29.173  18.854  1.00 32.25 ? 41   TYR A CE1 1 
ATOM   339  C  CE2 . TYR A 1 42  ? -10.838 29.408  17.185  1.00 32.90 ? 41   TYR A CE2 1 
ATOM   340  C  CZ  . TYR A 1 42  ? -12.129 29.088  17.541  1.00 33.04 ? 41   TYR A CZ  1 
ATOM   341  O  OH  . TYR A 1 42  ? -13.024 28.656  16.594  1.00 31.52 ? 41   TYR A OH  1 
ATOM   342  N  N   . THR A 1 43  ? -8.766  32.240  23.193  1.00 32.86 ? 42   THR A N   1 
ATOM   343  C  CA  . THR A 1 43  ? -7.887  32.486  24.328  1.00 32.09 ? 42   THR A CA  1 
ATOM   344  C  C   . THR A 1 43  ? -8.420  31.638  25.483  1.00 32.48 ? 42   THR A C   1 
ATOM   345  O  O   . THR A 1 43  ? -9.505  31.067  25.385  1.00 32.51 ? 42   THR A O   1 
ATOM   346  C  CB  . THR A 1 43  ? -7.878  33.995  24.717  1.00 31.44 ? 42   THR A CB  1 
ATOM   347  O  OG1 . THR A 1 43  ? -9.171  34.375  25.178  1.00 31.15 ? 42   THR A OG1 1 
ATOM   348  C  CG2 . THR A 1 43  ? -7.514  34.884  23.505  1.00 30.92 ? 42   THR A CG2 1 
ATOM   349  N  N   . ASN A 1 44  ? -7.683  31.551  26.581  1.00 33.89 ? 43   ASN A N   1 
ATOM   350  C  CA  . ASN A 1 44  ? -8.170  30.737  27.695  1.00 37.29 ? 43   ASN A CA  1 
ATOM   351  C  C   . ASN A 1 44  ? -9.522  31.276  28.160  1.00 37.58 ? 43   ASN A C   1 
ATOM   352  O  O   . ASN A 1 44  ? -10.380 30.512  28.580  1.00 37.20 ? 43   ASN A O   1 
ATOM   353  C  CB  . ASN A 1 44  ? -7.177  30.734  28.855  1.00 38.09 ? 43   ASN A CB  1 
ATOM   354  C  CG  . ASN A 1 44  ? -5.809  30.202  28.454  1.00 40.13 ? 43   ASN A CG  1 
ATOM   355  O  OD1 . ASN A 1 44  ? -5.146  30.766  27.578  1.00 41.55 ? 43   ASN A OD1 1 
ATOM   356  N  ND2 . ASN A 1 44  ? -5.347  29.175  29.144  1.00 39.35 ? 43   ASN A ND2 1 
ATOM   357  N  N   . LYS A 1 45  ? -9.729  32.588  28.017  1.00 38.72 ? 44   LYS A N   1 
ATOM   358  C  CA  . LYS A 1 45  ? -10.996 33.195  28.427  1.00 38.97 ? 44   LYS A CA  1 
ATOM   359  C  C   . LYS A 1 45  ? -12.089 32.756  27.475  1.00 38.04 ? 44   LYS A C   1 
ATOM   360  O  O   . LYS A 1 45  ? -13.217 32.533  27.894  1.00 39.15 ? 44   LYS A O   1 
ATOM   361  C  CB  . LYS A 1 45  ? -10.915 34.720  28.442  1.00 39.13 ? 44   LYS A CB  1 
ATOM   362  C  CG  . LYS A 1 45  ? -9.747  35.278  29.217  1.00 42.27 ? 44   LYS A CG  1 
ATOM   363  C  CD  . LYS A 1 45  ? -10.183 35.969  30.499  1.00 42.08 ? 44   LYS A CD  1 
ATOM   364  C  CE  . LYS A 1 45  ? -8.991  36.592  31.177  1.00 43.69 ? 44   LYS A CE  1 
ATOM   365  N  NZ  . LYS A 1 45  ? -8.002  35.588  31.685  1.00 43.30 ? 44   LYS A NZ  1 
ATOM   366  N  N   . ASN A 1 46  ? -11.765 32.651  26.190  1.00 37.83 ? 45   ASN A N   1 
ATOM   367  C  CA  . ASN A 1 46  ? -12.755 32.214  25.196  1.00 36.12 ? 45   ASN A CA  1 
ATOM   368  C  C   . ASN A 1 46  ? -12.233 31.010  24.402  1.00 37.60 ? 45   ASN A C   1 
ATOM   369  O  O   . ASN A 1 46  ? -11.960 31.103  23.211  1.00 36.28 ? 45   ASN A O   1 
ATOM   370  C  CB  . ASN A 1 46  ? -13.219 33.386  24.290  1.00 35.41 ? 45   ASN A CB  1 
ATOM   371  C  CG  . ASN A 1 46  ? -12.118 33.921  23.370  1.00 32.94 ? 45   ASN A CG  1 
ATOM   372  O  OD1 . ASN A 1 46  ? -12.177 33.763  22.161  1.00 34.33 ? 45   ASN A OD1 1 
ATOM   373  N  ND2 . ASN A 1 46  ? -11.142 34.570  23.940  1.00 30.79 ? 45   ASN A ND2 1 
ATOM   374  N  N   . PRO A 1 47  ? -12.145 29.832  25.064  1.00 37.89 ? 46   PRO A N   1 
ATOM   375  C  CA  . PRO A 1 47  ? -11.655 28.593  24.456  1.00 36.70 ? 46   PRO A CA  1 
ATOM   376  C  C   . PRO A 1 47  ? -12.572 27.878  23.485  1.00 38.09 ? 46   PRO A C   1 
ATOM   377  O  O   . PRO A 1 47  ? -12.117 27.032  22.718  1.00 36.83 ? 46   PRO A O   1 
ATOM   378  C  CB  . PRO A 1 47  ? -11.373 27.712  25.667  1.00 38.19 ? 46   PRO A CB  1 
ATOM   379  C  CG  . PRO A 1 47  ? -12.456 28.111  26.644  1.00 37.29 ? 46   PRO A CG  1 
ATOM   380  C  CD  . PRO A 1 47  ? -12.443 29.627  26.502  1.00 38.04 ? 46   PRO A CD  1 
ATOM   381  N  N   . ASN A 1 48  ? -13.849 28.232  23.474  1.00 37.47 ? 47   ASN A N   1 
ATOM   382  C  CA  . ASN A 1 48  ? -14.792 27.539  22.605  1.00 38.39 ? 47   ASN A CA  1 
ATOM   383  C  C   . ASN A 1 48  ? -15.330 28.312  21.406  1.00 37.74 ? 47   ASN A C   1 
ATOM   384  O  O   . ASN A 1 48  ? -15.581 27.726  20.368  1.00 37.64 ? 47   ASN A O   1 
ATOM   385  C  CB  . ASN A 1 48  ? -15.965 27.014  23.454  1.00 39.43 ? 47   ASN A CB  1 
ATOM   386  C  CG  . ASN A 1 48  ? -15.523 25.982  24.466  1.00 40.65 ? 47   ASN A CG  1 
ATOM   387  O  OD1 . ASN A 1 48  ? -15.394 24.811  24.136  1.00 41.51 ? 47   ASN A OD1 1 
ATOM   388  N  ND2 . ASN A 1 48  ? -15.280 26.411  25.704  1.00 40.55 ? 47   ASN A ND2 1 
ATOM   389  N  N   . ASN A 1 49  ? -15.542 29.617  21.564  1.00 38.69 ? 48   ASN A N   1 
ATOM   390  C  CA  . ASN A 1 49  ? -16.082 30.444  20.484  1.00 37.72 ? 48   ASN A CA  1 
ATOM   391  C  C   . ASN A 1 49  ? -15.105 31.534  20.062  1.00 37.25 ? 48   ASN A C   1 
ATOM   392  O  O   . ASN A 1 49  ? -14.550 32.243  20.903  1.00 36.87 ? 48   ASN A O   1 
ATOM   393  C  CB  . ASN A 1 49  ? -17.416 31.051  20.918  1.00 38.70 ? 48   ASN A CB  1 
ATOM   394  C  CG  . ASN A 1 49  ? -18.477 29.985  21.186  1.00 38.54 ? 48   ASN A CG  1 
ATOM   395  O  OD1 . ASN A 1 49  ? -18.998 29.364  20.261  1.00 39.18 ? 48   ASN A OD1 1 
ATOM   396  N  ND2 . ASN A 1 49  ? -18.785 29.762  22.455  1.00 38.83 ? 48   ASN A ND2 1 
ATOM   397  N  N   . PHE A 1 50  ? -14.927 31.691  18.756  1.00 35.10 ? 49   PHE A N   1 
ATOM   398  C  CA  . PHE A 1 50  ? -13.992 32.679  18.241  1.00 35.68 ? 49   PHE A CA  1 
ATOM   399  C  C   . PHE A 1 50  ? -14.435 34.133  18.279  1.00 34.76 ? 49   PHE A C   1 
ATOM   400  O  O   . PHE A 1 50  ? -15.631 34.455  18.358  1.00 34.71 ? 49   PHE A O   1 
ATOM   401  C  CB  . PHE A 1 50  ? -13.572 32.355  16.803  1.00 32.51 ? 49   PHE A CB  1 
ATOM   402  C  CG  . PHE A 1 50  ? -14.706 32.415  15.787  1.00 33.82 ? 49   PHE A CG  1 
ATOM   403  C  CD1 . PHE A 1 50  ? -15.085 33.622  15.201  1.00 32.85 ? 49   PHE A CD1 1 
ATOM   404  C  CD2 . PHE A 1 50  ? -15.361 31.257  15.396  1.00 32.85 ? 49   PHE A CD2 1 
ATOM   405  C  CE1 . PHE A 1 50  ? -16.087 33.674  14.247  1.00 30.89 ? 49   PHE A CE1 1 
ATOM   406  C  CE2 . PHE A 1 50  ? -16.368 31.292  14.444  1.00 33.56 ? 49   PHE A CE2 1 
ATOM   407  C  CZ  . PHE A 1 50  ? -16.737 32.519  13.858  1.00 33.10 ? 49   PHE A CZ  1 
ATOM   408  N  N   . GLN A 1 51  ? -13.434 34.999  18.208  1.00 34.12 ? 50   GLN A N   1 
ATOM   409  C  CA  . GLN A 1 51  ? -13.622 36.427  18.109  1.00 34.54 ? 50   GLN A CA  1 
ATOM   410  C  C   . GLN A 1 51  ? -12.914 36.714  16.789  1.00 33.24 ? 50   GLN A C   1 
ATOM   411  O  O   . GLN A 1 51  ? -11.835 36.200  16.534  1.00 33.27 ? 50   GLN A O   1 
ATOM   412  C  CB  . GLN A 1 51  ? -12.975 37.150  19.281  1.00 34.48 ? 50   GLN A CB  1 
ATOM   413  C  CG  . GLN A 1 51  ? -13.731 36.909  20.569  1.00 35.49 ? 50   GLN A CG  1 
ATOM   414  C  CD  . GLN A 1 51  ? -13.123 37.640  21.729  1.00 34.78 ? 50   GLN A CD  1 
ATOM   415  O  OE1 . GLN A 1 51  ? -11.912 37.612  21.928  1.00 33.31 ? 50   GLN A OE1 1 
ATOM   416  N  NE2 . GLN A 1 51  ? -13.958 38.325  22.496  1.00 35.25 ? 50   GLN A NE2 1 
ATOM   417  N  N   . THR A 1 52  ? -13.577 37.432  15.902  1.00 33.67 ? 51   THR A N   1 
ATOM   418  C  CA  . THR A 1 52  ? -12.993 37.720  14.609  1.00 33.01 ? 51   THR A CA  1 
ATOM   419  C  C   . THR A 1 52  ? -12.008 38.882  14.607  1.00 32.33 ? 51   THR A C   1 
ATOM   420  O  O   . THR A 1 52  ? -12.341 39.992  15.036  1.00 31.36 ? 51   THR A O   1 
ATOM   421  C  CB  . THR A 1 52  ? -14.085 37.970  13.581  1.00 34.32 ? 51   THR A CB  1 
ATOM   422  O  OG1 . THR A 1 52  ? -15.048 36.916  13.662  1.00 35.40 ? 51   THR A OG1 1 
ATOM   423  C  CG2 . THR A 1 52  ? -13.510 37.996  12.165  1.00 34.90 ? 51   THR A CG2 1 
ATOM   424  N  N   . LEU A 1 53  ? -10.794 38.624  14.123  1.00 31.03 ? 52   LEU A N   1 
ATOM   425  C  CA  . LEU A 1 53  ? -9.784  39.668  14.048  1.00 28.78 ? 52   LEU A CA  1 
ATOM   426  C  C   . LEU A 1 53  ? -9.595  39.996  12.578  1.00 29.57 ? 52   LEU A C   1 
ATOM   427  O  O   . LEU A 1 53  ? -9.664  39.110  11.711  1.00 27.95 ? 52   LEU A O   1 
ATOM   428  C  CB  . LEU A 1 53  ? -8.453  39.233  14.660  1.00 29.49 ? 52   LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 53  ? -8.392  38.564  16.030  1.00 29.97 ? 52   LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 53  ? -6.910  38.370  16.358  1.00 28.01 ? 52   LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 53  ? -9.098  39.403  17.117  1.00 29.38 ? 52   LEU A CD2 1 
ATOM   432  N  N   . LEU A 1 54  ? -9.389  41.281  12.298  1.00 27.54 ? 53   LEU A N   1 
ATOM   433  C  CA  . LEU A 1 54  ? -9.187  41.776  10.942  1.00 28.24 ? 53   LEU A CA  1 
ATOM   434  C  C   . LEU A 1 54  ? -7.835  42.449  10.960  1.00 25.73 ? 53   LEU A C   1 
ATOM   435  O  O   . LEU A 1 54  ? -7.582  43.309  11.802  1.00 27.70 ? 53   LEU A O   1 
ATOM   436  C  CB  . LEU A 1 54  ? -10.283 42.800  10.560  1.00 28.16 ? 53   LEU A CB  1 
ATOM   437  C  CG  . LEU A 1 54  ? -11.727 42.305  10.711  1.00 28.10 ? 53   LEU A CG  1 
ATOM   438  C  CD1 . LEU A 1 54  ? -12.709 43.470  10.625  1.00 30.04 ? 53   LEU A CD1 1 
ATOM   439  C  CD2 . LEU A 1 54  ? -12.045 41.204  9.660   1.00 27.58 ? 53   LEU A CD2 1 
ATOM   440  N  N   . PRO A 1 55  ? -6.952  42.082  10.038  1.00 25.87 ? 54   PRO A N   1 
ATOM   441  C  CA  . PRO A 1 55  ? -5.626  42.704  10.028  1.00 25.78 ? 54   PRO A CA  1 
ATOM   442  C  C   . PRO A 1 55  ? -5.627  44.156  9.569   1.00 30.79 ? 54   PRO A C   1 
ATOM   443  O  O   . PRO A 1 55  ? -4.668  44.890  9.825   1.00 33.36 ? 54   PRO A O   1 
ATOM   444  C  CB  . PRO A 1 55  ? -4.829  41.798  9.109   1.00 22.42 ? 54   PRO A CB  1 
ATOM   445  C  CG  . PRO A 1 55  ? -5.846  41.253  8.175   1.00 22.78 ? 54   PRO A CG  1 
ATOM   446  C  CD  . PRO A 1 55  ? -7.097  41.064  8.981   1.00 23.46 ? 54   PRO A CD  1 
ATOM   447  N  N   . SER A 1 56  ? -6.720  44.581  8.938   1.00 31.16 ? 700  SER A N   1 
ATOM   448  C  CA  . SER A 1 56  ? -6.831  45.952  8.457   1.00 35.79 ? 700  SER A CA  1 
ATOM   449  C  C   . SER A 1 56  ? -7.570  46.845  9.481   1.00 35.98 ? 700  SER A C   1 
ATOM   450  O  O   . SER A 1 56  ? -7.694  48.053  9.277   1.00 38.49 ? 700  SER A O   1 
ATOM   451  C  CB  . SER A 1 56  ? -7.581  45.959  7.116   1.00 35.42 ? 700  SER A CB  1 
ATOM   452  O  OG  . SER A 1 56  ? -8.943  45.612  7.302   1.00 37.36 ? 700  SER A OG  1 
ATOM   453  N  N   . ASP A 1 57  ? -8.012  46.257  10.592  1.00 34.11 ? 55   ASP A N   1 
ATOM   454  C  CA  . ASP A 1 57  ? -8.770  46.988  11.600  1.00 32.67 ? 55   ASP A CA  1 
ATOM   455  C  C   . ASP A 1 57  ? -8.297  46.723  13.034  1.00 33.38 ? 55   ASP A C   1 
ATOM   456  O  O   . ASP A 1 57  ? -8.825  45.849  13.715  1.00 31.80 ? 55   ASP A O   1 
ATOM   457  C  CB  . ASP A 1 57  ? -10.254 46.631  11.447  1.00 29.36 ? 55   ASP A CB  1 
ATOM   458  C  CG  . ASP A 1 57  ? -11.157 47.437  12.351  1.00 29.65 ? 55   ASP A CG  1 
ATOM   459  O  OD1 . ASP A 1 57  ? -10.660 48.236  13.165  1.00 29.13 ? 55   ASP A OD1 1 
ATOM   460  O  OD2 . ASP A 1 57  ? -12.386 47.263  12.240  1.00 30.91 ? 55   ASP A OD2 1 
ATOM   461  N  N   . PRO A 1 58  ? -7.414  47.591  13.557  1.00 34.33 ? 56   PRO A N   1 
ATOM   462  C  CA  . PRO A 1 58  ? -6.866  47.469  14.909  1.00 35.49 ? 56   PRO A CA  1 
ATOM   463  C  C   . PRO A 1 58  ? -7.932  47.323  15.980  1.00 36.68 ? 56   PRO A C   1 
ATOM   464  O  O   . PRO A 1 58  ? -7.714  46.640  16.978  1.00 36.95 ? 56   PRO A O   1 
ATOM   465  C  CB  . PRO A 1 58  ? -6.098  48.778  15.084  1.00 35.36 ? 56   PRO A CB  1 
ATOM   466  C  CG  . PRO A 1 58  ? -5.711  49.126  13.709  1.00 34.14 ? 56   PRO A CG  1 
ATOM   467  C  CD  . PRO A 1 58  ? -6.960  48.845  12.940  1.00 34.80 ? 56   PRO A CD  1 
ATOM   468  N  N   . SER A 1 59  ? -9.098  47.936  15.762  1.00 38.32 ? 57   SER A N   1 
ATOM   469  C  CA  . SER A 1 59  ? -10.169 47.862  16.749  1.00 36.82 ? 57   SER A CA  1 
ATOM   470  C  C   . SER A 1 59  ? -10.623 46.440  17.091  1.00 36.10 ? 57   SER A C   1 
ATOM   471  O  O   . SER A 1 59  ? -11.069 46.180  18.224  1.00 35.09 ? 57   SER A O   1 
ATOM   472  C  CB  . SER A 1 59  ? -11.369 48.746  16.347  1.00 37.09 ? 57   SER A CB  1 
ATOM   473  O  OG  . SER A 1 59  ? -12.201 48.145  15.369  1.00 37.86 ? 57   SER A OG  1 
ATOM   474  N  N   . THR A 1 60  ? -10.490 45.506  16.146  1.00 36.25 ? 58   THR A N   1 
ATOM   475  C  CA  . THR A 1 60  ? -10.905 44.137  16.424  1.00 32.11 ? 58   THR A CA  1 
ATOM   476  C  C   . THR A 1 60  ? -10.081 43.546  17.557  1.00 32.87 ? 58   THR A C   1 
ATOM   477  O  O   . THR A 1 60  ? -10.574 42.717  18.314  1.00 33.02 ? 58   THR A O   1 
ATOM   478  C  CB  . THR A 1 60  ? -10.830 43.226  15.181  1.00 30.89 ? 58   THR A CB  1 
ATOM   479  O  OG1 . THR A 1 60  ? -9.519  43.281  14.597  1.00 27.43 ? 58   THR A OG1 1 
ATOM   480  C  CG2 . THR A 1 60  ? -11.906 43.610  14.173  1.00 27.61 ? 58   THR A CG2 1 
ATOM   481  N  N   . ILE A 1 61  ? -8.851  44.025  17.704  1.00 34.00 ? 59   ILE A N   1 
ATOM   482  C  CA  . ILE A 1 61  ? -7.953  43.569  18.748  1.00 35.73 ? 59   ILE A CA  1 
ATOM   483  C  C   . ILE A 1 61  ? -8.401  44.154  20.083  1.00 37.48 ? 59   ILE A C   1 
ATOM   484  O  O   . ILE A 1 61  ? -8.182  43.565  21.128  1.00 38.33 ? 59   ILE A O   1 
ATOM   485  C  CB  . ILE A 1 61  ? -6.517  44.017  18.491  1.00 35.68 ? 59   ILE A CB  1 
ATOM   486  C  CG1 . ILE A 1 61  ? -6.039  43.574  17.098  1.00 37.11 ? 59   ILE A CG1 1 
ATOM   487  C  CG2 . ILE A 1 61  ? -5.605  43.544  19.611  1.00 36.96 ? 59   ILE A CG2 1 
ATOM   488  C  CD1 . ILE A 1 61  ? -5.901  42.078  16.918  1.00 38.66 ? 59   ILE A CD1 1 
ATOM   489  N  N   . GLY A 1 62  ? -9.026  45.330  20.035  1.00 20.00 ? 60   GLY A N   1 
ATOM   490  C  CA  . GLY A 1 62  ? -9.507  45.992  21.255  1.00 20.00 ? 60   GLY A CA  1 
ATOM   491  C  C   . GLY A 1 62  ? -10.815 45.379  21.668  1.00 20.00 ? 60   GLY A C   1 
ATOM   492  O  O   . GLY A 1 62  ? -11.129 45.269  22.861  1.00 20.00 ? 60   GLY A O   1 
ATOM   493  N  N   . ALA A 1 63  ? -11.594 44.965  20.671  1.00 39.86 ? 61   ALA A N   1 
ATOM   494  C  CA  . ALA A 1 63  ? -12.881 44.328  20.896  1.00 40.54 ? 61   ALA A CA  1 
ATOM   495  C  C   . ALA A 1 63  ? -12.746 42.804  21.081  1.00 40.29 ? 61   ALA A C   1 
ATOM   496  O  O   . ALA A 1 63  ? -13.716 42.063  20.888  1.00 41.82 ? 61   ALA A O   1 
ATOM   497  C  CB  . ALA A 1 63  ? -13.813 44.631  19.725  1.00 39.40 ? 61   ALA A CB  1 
ATOM   498  N  N   . SER A 1 64  ? -11.566 42.344  21.489  1.00 38.20 ? 62   SER A N   1 
ATOM   499  C  CA  . SER A 1 64  ? -11.344 40.913  21.671  1.00 37.01 ? 62   SER A CA  1 
ATOM   500  C  C   . SER A 1 64  ? -10.683 40.652  23.002  1.00 37.02 ? 62   SER A C   1 
ATOM   501  O  O   . SER A 1 64  ? -10.341 41.597  23.735  1.00 34.61 ? 62   SER A O   1 
ATOM   502  C  CB  . SER A 1 64  ? -10.425 40.378  20.575  1.00 34.80 ? 62   SER A CB  1 
ATOM   503  O  OG  . SER A 1 64  ? -9.073  40.568  20.939  1.00 33.49 ? 62   SER A OG  1 
ATOM   504  N  N   . ASN A 1 65  ? -10.445 39.368  23.284  1.00 35.73 ? 63   ASN A N   1 
ATOM   505  C  CA  . ASN A 1 65  ? -9.776  38.950  24.516  1.00 35.69 ? 63   ASN A CA  1 
ATOM   506  C  C   . ASN A 1 65  ? -8.267  38.851  24.323  1.00 35.09 ? 63   ASN A C   1 
ATOM   507  O  O   . ASN A 1 65  ? -7.578  38.274  25.166  1.00 36.41 ? 63   ASN A O   1 
ATOM   508  C  CB  . ASN A 1 65  ? -10.329 37.599  25.009  1.00 37.00 ? 63   ASN A CB  1 
ATOM   509  C  CG  . ASN A 1 65  ? -11.662 37.732  25.710  1.00 36.55 ? 63   ASN A CG  1 
ATOM   510  O  OD1 . ASN A 1 65  ? -11.786 38.453  26.681  1.00 38.03 ? 63   ASN A OD1 1 
ATOM   511  N  ND2 . ASN A 1 65  ? -12.654 37.021  25.230  1.00 39.62 ? 63   ASN A ND2 1 
ATOM   512  N  N   . PHE A 1 66  ? -7.770  39.379  23.206  1.00 34.46 ? 64   PHE A N   1 
ATOM   513  C  CA  . PHE A 1 66  ? -6.346  39.370  22.894  1.00 33.00 ? 64   PHE A CA  1 
ATOM   514  C  C   . PHE A 1 66  ? -5.556  40.021  24.033  1.00 34.74 ? 64   PHE A C   1 
ATOM   515  O  O   . PHE A 1 66  ? -5.892  41.107  24.484  1.00 33.76 ? 64   PHE A O   1 
ATOM   516  C  CB  . PHE A 1 66  ? -6.086  40.142  21.587  1.00 30.46 ? 64   PHE A CB  1 
ATOM   517  C  CG  . PHE A 1 66  ? -4.677  40.025  21.075  1.00 29.24 ? 64   PHE A CG  1 
ATOM   518  C  CD1 . PHE A 1 66  ? -3.650  40.780  21.624  1.00 27.41 ? 64   PHE A CD1 1 
ATOM   519  C  CD2 . PHE A 1 66  ? -4.366  39.119  20.066  1.00 29.10 ? 64   PHE A CD2 1 
ATOM   520  C  CE1 . PHE A 1 66  ? -2.328  40.623  21.177  1.00 27.21 ? 64   PHE A CE1 1 
ATOM   521  C  CE2 . PHE A 1 66  ? -3.050  38.960  19.610  1.00 27.32 ? 64   PHE A CE2 1 
ATOM   522  C  CZ  . PHE A 1 66  ? -2.035  39.716  20.178  1.00 26.90 ? 64   PHE A CZ  1 
ATOM   523  N  N   . GLN A 1 67  ? -4.459  39.399  24.447  1.00 36.71 ? 65   GLN A N   1 
ATOM   524  C  CA  . GLN A 1 67  ? -3.639  39.965  25.520  1.00 37.01 ? 65   GLN A CA  1 
ATOM   525  C  C   . GLN A 1 67  ? -2.236  40.304  25.022  1.00 36.03 ? 65   GLN A C   1 
ATOM   526  O  O   . GLN A 1 67  ? -1.507  39.419  24.550  1.00 35.22 ? 65   GLN A O   1 
ATOM   527  C  CB  . GLN A 1 67  ? -3.572  38.982  26.693  1.00 37.71 ? 65   GLN A CB  1 
ATOM   528  C  CG  . GLN A 1 67  ? -3.904  39.628  28.026  1.00 41.50 ? 65   GLN A CG  1 
ATOM   529  C  CD  . GLN A 1 67  ? -4.884  38.807  28.837  1.00 43.46 ? 65   GLN A CD  1 
ATOM   530  O  OE1 . GLN A 1 67  ? -4.514  38.158  29.808  1.00 43.85 ? 65   GLN A OE1 1 
ATOM   531  N  NE2 . GLN A 1 67  ? -6.138  38.809  28.419  1.00 46.22 ? 65   GLN A NE2 1 
ATOM   532  N  N   . THR A 1 68  ? -1.848  41.571  25.131  1.00 34.95 ? 66   THR A N   1 
ATOM   533  C  CA  . THR A 1 68  ? -0.514  42.007  24.679  1.00 34.53 ? 66   THR A CA  1 
ATOM   534  C  C   . THR A 1 68  ? 0.628   41.474  25.539  1.00 34.78 ? 66   THR A C   1 
ATOM   535  O  O   . THR A 1 68  ? 1.787   41.513  25.140  1.00 35.43 ? 66   THR A O   1 
ATOM   536  C  CB  . THR A 1 68  ? -0.387  43.549  24.606  1.00 33.79 ? 66   THR A CB  1 
ATOM   537  O  OG1 . THR A 1 68  ? -0.759  44.127  25.867  1.00 32.65 ? 66   THR A OG1 1 
ATOM   538  C  CG2 . THR A 1 68  ? -1.269  44.107  23.519  1.00 32.65 ? 66   THR A CG2 1 
ATOM   539  N  N   . ASP A 1 69  ? 0.302   40.995  26.737  1.00 36.50 ? 67   ASP A N   1 
ATOM   540  C  CA  . ASP A 1 69  ? 1.318   40.443  27.636  1.00 37.82 ? 67   ASP A CA  1 
ATOM   541  C  C   . ASP A 1 69  ? 1.442   38.908  27.561  1.00 37.38 ? 67   ASP A C   1 
ATOM   542  O  O   . ASP A 1 69  ? 2.015   38.279  28.457  1.00 39.91 ? 67   ASP A O   1 
ATOM   543  C  CB  . ASP A 1 69  ? 1.067   40.905  29.075  1.00 38.89 ? 67   ASP A CB  1 
ATOM   544  C  CG  . ASP A 1 69  ? -0.299  40.493  29.615  1.00 40.99 ? 67   ASP A CG  1 
ATOM   545  O  OD1 . ASP A 1 69  ? -1.051  39.755  28.955  1.00 42.77 ? 67   ASP A OD1 1 
ATOM   546  O  OD2 . ASP A 1 69  ? -0.633  40.919  30.737  1.00 44.32 ? 67   ASP A OD2 1 
ATOM   547  N  N   . LYS A 1 70  ? 0.897   38.308  26.507  1.00 35.79 ? 68   LYS A N   1 
ATOM   548  C  CA  . LYS A 1 70  ? 0.965   36.854  26.334  1.00 34.61 ? 68   LYS A CA  1 
ATOM   549  C  C   . LYS A 1 70  ? 1.597   36.517  24.998  1.00 34.54 ? 68   LYS A C   1 
ATOM   550  O  O   . LYS A 1 70  ? 1.821   37.407  24.169  1.00 30.77 ? 68   LYS A O   1 
ATOM   551  C  CB  . LYS A 1 70  ? -0.440  36.236  26.418  1.00 35.97 ? 68   LYS A CB  1 
ATOM   552  C  CG  . LYS A 1 70  ? -1.161  36.492  27.751  1.00 36.98 ? 68   LYS A CG  1 
ATOM   553  C  CD  . LYS A 1 70  ? -0.413  35.850  28.918  1.00 38.94 ? 68   LYS A CD  1 
ATOM   554  C  CE  . LYS A 1 70  ? -0.936  36.346  30.287  1.00 40.70 ? 68   LYS A CE  1 
ATOM   555  N  NZ  . LYS A 1 70  ? 0.035   35.985  31.374  1.00 42.31 ? 68   LYS A NZ  1 
ATOM   556  N  N   . LYS A 1 71  ? 1.946   35.248  24.813  1.00 32.08 ? 69   LYS A N   1 
ATOM   557  C  CA  . LYS A 1 71  ? 2.521   34.824  23.555  1.00 32.66 ? 69   LYS A CA  1 
ATOM   558  C  C   . LYS A 1 71  ? 1.328   34.626  22.636  1.00 29.78 ? 69   LYS A C   1 
ATOM   559  O  O   . LYS A 1 71  ? 0.182   34.573  23.100  1.00 30.91 ? 69   LYS A O   1 
ATOM   560  C  CB  . LYS A 1 71  ? 3.293   33.499  23.708  1.00 33.24 ? 69   LYS A CB  1 
ATOM   561  C  CG  . LYS A 1 71  ? 4.509   33.560  24.638  1.00 34.66 ? 69   LYS A CG  1 
ATOM   562  C  CD  . LYS A 1 71  ? 5.586   34.450  24.084  1.00 34.92 ? 69   LYS A CD  1 
ATOM   563  C  CE  . LYS A 1 71  ? 6.642   34.790  25.143  1.00 36.79 ? 69   LYS A CE  1 
ATOM   564  N  NZ  . LYS A 1 71  ? 7.774   35.567  24.563  1.00 37.04 ? 69   LYS A NZ  1 
ATOM   565  N  N   . THR A 1 72  ? 1.601   34.626  21.342  1.00 28.35 ? 70   THR A N   1 
ATOM   566  C  CA  . THR A 1 72  ? 0.590   34.420  20.324  1.00 27.08 ? 70   THR A CA  1 
ATOM   567  C  C   . THR A 1 72  ? 1.058   33.275  19.441  1.00 25.72 ? 70   THR A C   1 
ATOM   568  O  O   . THR A 1 72  ? 2.231   33.196  19.085  1.00 26.58 ? 70   THR A O   1 
ATOM   569  C  CB  . THR A 1 72  ? 0.402   35.688  19.430  1.00 26.62 ? 70   THR A CB  1 
ATOM   570  O  OG1 . THR A 1 72  ? -0.005  36.775  20.267  1.00 26.30 ? 70   THR A OG1 1 
ATOM   571  C  CG2 . THR A 1 72  ? -0.715  35.463  18.414  1.00 24.02 ? 70   THR A CG2 1 
ATOM   572  N  N   . ARG A 1 73  ? 0.132   32.407  19.072  1.00 26.01 ? 71   ARG A N   1 
ATOM   573  C  CA  . ARG A 1 73  ? 0.457   31.275  18.227  1.00 26.43 ? 71   ARG A CA  1 
ATOM   574  C  C   . ARG A 1 73  ? -0.611  31.156  17.161  1.00 24.98 ? 71   ARG A C   1 
ATOM   575  O  O   . ARG A 1 73  ? -1.775  30.897  17.452  1.00 23.33 ? 71   ARG A O   1 
ATOM   576  C  CB  . ARG A 1 73  ? 0.529   29.965  19.055  1.00 26.29 ? 71   ARG A CB  1 
ATOM   577  C  CG  . ARG A 1 73  ? 1.651   29.940  20.101  1.00 26.60 ? 71   ARG A CG  1 
ATOM   578  C  CD  . ARG A 1 73  ? 1.596   28.705  20.968  1.00 26.09 ? 71   ARG A CD  1 
ATOM   579  N  NE  . ARG A 1 73  ? 2.430   28.854  22.161  1.00 28.70 ? 71   ARG A NE  1 
ATOM   580  C  CZ  . ARG A 1 73  ? 3.757   28.853  22.190  1.00 27.86 ? 71   ARG A CZ  1 
ATOM   581  N  NH1 . ARG A 1 73  ? 4.464   28.717  21.080  1.00 28.95 ? 71   ARG A NH1 1 
ATOM   582  N  NH2 . ARG A 1 73  ? 4.388   28.974  23.359  1.00 28.54 ? 71   ARG A NH2 1 
ATOM   583  N  N   . PHE A 1 74  ? -0.221  31.379  15.914  1.00 24.60 ? 72   PHE A N   1 
ATOM   584  C  CA  . PHE A 1 74  ? -1.151  31.259  14.805  1.00 23.40 ? 72   PHE A CA  1 
ATOM   585  C  C   . PHE A 1 74  ? -1.106  29.807  14.316  1.00 23.59 ? 72   PHE A C   1 
ATOM   586  O  O   . PHE A 1 74  ? -0.032  29.227  14.207  1.00 24.00 ? 72   PHE A O   1 
ATOM   587  C  CB  . PHE A 1 74  ? -0.695  32.158  13.629  1.00 23.16 ? 72   PHE A CB  1 
ATOM   588  C  CG  . PHE A 1 74  ? -0.881  33.628  13.854  1.00 24.03 ? 72   PHE A CG  1 
ATOM   589  C  CD1 . PHE A 1 74  ? -0.052  34.327  14.734  1.00 24.62 ? 72   PHE A CD1 1 
ATOM   590  C  CD2 . PHE A 1 74  ? -1.795  34.341  13.087  1.00 24.23 ? 72   PHE A CD2 1 
ATOM   591  C  CE1 . PHE A 1 74  ? -0.129  35.718  14.827  1.00 24.87 ? 72   PHE A CE1 1 
ATOM   592  C  CE2 . PHE A 1 74  ? -1.880  35.743  13.174  1.00 23.76 ? 72   PHE A CE2 1 
ATOM   593  C  CZ  . PHE A 1 74  ? -1.043  36.425  14.044  1.00 22.53 ? 72   PHE A CZ  1 
ATOM   594  N  N   . ILE A 1 75  ? -2.258  29.263  13.977  1.00 22.03 ? 73   ILE A N   1 
ATOM   595  C  CA  . ILE A 1 75  ? -2.351  27.916  13.442  1.00 22.85 ? 73   ILE A CA  1 
ATOM   596  C  C   . ILE A 1 75  ? -2.912  28.086  12.047  1.00 21.03 ? 73   ILE A C   1 
ATOM   597  O  O   . ILE A 1 75  ? -4.021  28.595  11.838  1.00 21.52 ? 73   ILE A O   1 
ATOM   598  C  CB  . ILE A 1 75  ? -3.252  26.978  14.318  1.00 22.62 ? 73   ILE A CB  1 
ATOM   599  C  CG1 . ILE A 1 75  ? -2.623  26.850  15.721  1.00 22.30 ? 73   ILE A CG1 1 
ATOM   600  C  CG2 . ILE A 1 75  ? -3.272  25.587  13.702  1.00 24.50 ? 73   ILE A CG2 1 
ATOM   601  C  CD1 . ILE A 1 75  ? -3.510  26.135  16.772  1.00 23.67 ? 73   ILE A CD1 1 
ATOM   602  N  N   . ILE A 1 76  ? -2.088  27.718  11.084  1.00 21.18 ? 74   ILE A N   1 
ATOM   603  C  CA  . ILE A 1 76  ? -2.432  27.832  9.695   1.00 22.02 ? 74   ILE A CA  1 
ATOM   604  C  C   . ILE A 1 76  ? -2.426  26.458  9.058   1.00 24.14 ? 74   ILE A C   1 
ATOM   605  O  O   . ILE A 1 76  ? -1.388  25.809  8.910   1.00 24.63 ? 74   ILE A O   1 
ATOM   606  C  CB  . ILE A 1 76  ? -1.400  28.713  8.972   1.00 21.78 ? 74   ILE A CB  1 
ATOM   607  C  CG1 . ILE A 1 76  ? -1.085  29.947  9.819   1.00 19.81 ? 74   ILE A CG1 1 
ATOM   608  C  CG2 . ILE A 1 76  ? -1.905  29.064  7.591   1.00 20.00 ? 74   ILE A CG2 1 
ATOM   609  C  CD1 . ILE A 1 76  ? 0.197   30.551  9.432   1.00 21.54 ? 74   ILE A CD1 1 
ATOM   610  N  N   . HIS A 1 77  ? -3.593  26.069  8.586   1.00 25.84 ? 75   HIS A N   1 
ATOM   611  C  CA  . HIS A 1 77  ? -3.777  24.771  7.980   1.00 25.08 ? 75   HIS A CA  1 
ATOM   612  C  C   . HIS A 1 77  ? -3.317  24.732  6.522   1.00 25.39 ? 75   HIS A C   1 
ATOM   613  O  O   . HIS A 1 77  ? -2.829  25.704  5.962   1.00 24.94 ? 75   HIS A O   1 
ATOM   614  C  CB  . HIS A 1 77  ? -5.259  24.398  8.054   1.00 23.00 ? 75   HIS A CB  1 
ATOM   615  C  CG  . HIS A 1 77  ? -6.116  25.188  7.105   1.00 22.75 ? 75   HIS A CG  1 
ATOM   616  N  ND1 . HIS A 1 77  ? -6.776  26.340  7.482   1.00 22.28 ? 75   HIS A ND1 1 
ATOM   617  C  CD2 . HIS A 1 77  ? -6.411  24.992  5.797   1.00 21.42 ? 75   HIS A CD2 1 
ATOM   618  C  CE1 . HIS A 1 77  ? -7.438  26.812  6.441   1.00 22.49 ? 75   HIS A CE1 1 
ATOM   619  N  NE2 . HIS A 1 77  ? -7.239  26.019  5.410   1.00 22.33 ? 75   HIS A NE2 1 
ATOM   620  N  N   . GLY A 1 78  ? -3.458  23.548  5.946   1.00 23.57 ? 76   GLY A N   1 
ATOM   621  C  CA  . GLY A 1 78  ? -3.150  23.316  4.560   1.00 26.50 ? 76   GLY A CA  1 
ATOM   622  C  C   . GLY A 1 78  ? -4.294  22.411  4.138   1.00 28.32 ? 76   GLY A C   1 
ATOM   623  O  O   . GLY A 1 78  ? -5.458  22.790  4.289   1.00 27.29 ? 76   GLY A O   1 
ATOM   624  N  N   . PHE A 1 79  ? -3.957  21.176  3.769   1.00 28.98 ? 77   PHE A N   1 
ATOM   625  C  CA  . PHE A 1 79  ? -4.939  20.169  3.353   1.00 29.17 ? 77   PHE A CA  1 
ATOM   626  C  C   . PHE A 1 79  ? -5.907  19.824  4.474   1.00 27.47 ? 77   PHE A C   1 
ATOM   627  O  O   . PHE A 1 79  ? -5.474  19.434  5.556   1.00 26.47 ? 77   PHE A O   1 
ATOM   628  C  CB  . PHE A 1 79  ? -4.224  18.877  2.916   1.00 29.24 ? 77   PHE A CB  1 
ATOM   629  C  CG  . PHE A 1 79  ? -5.150  17.851  2.291   1.00 30.63 ? 77   PHE A CG  1 
ATOM   630  C  CD1 . PHE A 1 79  ? -5.830  16.927  3.085   1.00 31.14 ? 77   PHE A CD1 1 
ATOM   631  C  CD2 . PHE A 1 79  ? -5.365  17.838  0.922   1.00 30.97 ? 77   PHE A CD2 1 
ATOM   632  C  CE1 . PHE A 1 79  ? -6.704  16.013  2.528   1.00 30.72 ? 77   PHE A CE1 1 
ATOM   633  C  CE2 . PHE A 1 79  ? -6.248  16.920  0.351   1.00 33.13 ? 77   PHE A CE2 1 
ATOM   634  C  CZ  . PHE A 1 79  ? -6.920  16.003  1.157   1.00 30.28 ? 77   PHE A CZ  1 
ATOM   635  N  N   . ILE A 1 80  ? -7.199  20.015  4.230   1.00 27.32 ? 78   ILE A N   1 
ATOM   636  C  CA  . ILE A 1 80  ? -8.225  19.654  5.192   1.00 30.76 ? 78   ILE A CA  1 
ATOM   637  C  C   . ILE A 1 80  ? -8.895  18.341  4.691   1.00 32.64 ? 78   ILE A C   1 
ATOM   638  O  O   . ILE A 1 80  ? -9.437  18.292  3.587   1.00 33.34 ? 78   ILE A O   1 
ATOM   639  C  CB  . ILE A 1 80  ? -9.316  20.757  5.323   1.00 31.26 ? 78   ILE A CB  1 
ATOM   640  C  CG1 . ILE A 1 80  ? -8.707  22.071  5.880   1.00 32.49 ? 78   ILE A CG1 1 
ATOM   641  C  CG2 . ILE A 1 80  ? -10.472 20.252  6.194   1.00 28.51 ? 78   ILE A CG2 1 
ATOM   642  C  CD1 . ILE A 1 80  ? -8.269  22.020  7.345   1.00 30.92 ? 78   ILE A CD1 1 
ATOM   643  N  N   . ASP A 1 81  ? -8.827  17.277  5.491   1.00 34.21 ? 79   ASP A N   1 
ATOM   644  C  CA  . ASP A 1 81  ? -9.434  15.965  5.142   1.00 34.74 ? 79   ASP A CA  1 
ATOM   645  C  C   . ASP A 1 81  ? -10.823 15.922  5.811   1.00 33.61 ? 79   ASP A C   1 
ATOM   646  O  O   . ASP A 1 81  ? -11.015 16.522  6.867   1.00 29.16 ? 79   ASP A O   1 
ATOM   647  C  CB  . ASP A 1 81  ? -8.529  14.844  5.713   1.00 35.46 ? 79   ASP A CB  1 
ATOM   648  C  CG  . ASP A 1 81  ? -8.762  13.465  5.062   1.00 36.02 ? 79   ASP A CG  1 
ATOM   649  O  OD1 . ASP A 1 81  ? -9.358  13.358  3.955   1.00 35.09 ? 79   ASP A OD1 1 
ATOM   650  O  OD2 . ASP A 1 81  ? -8.283  12.470  5.656   1.00 37.11 ? 79   ASP A OD2 1 
ATOM   651  N  N   . LYS A 1 82  ? -11.795 15.241  5.208   1.00 35.77 ? 80   LYS A N   1 
ATOM   652  C  CA  . LYS A 1 82  ? -13.126 15.175  5.822   1.00 37.57 ? 80   LYS A CA  1 
ATOM   653  C  C   . LYS A 1 82  ? -13.012 14.706  7.272   1.00 36.82 ? 80   LYS A C   1 
ATOM   654  O  O   . LYS A 1 82  ? -12.203 13.821  7.586   1.00 35.97 ? 80   LYS A O   1 
ATOM   655  C  CB  . LYS A 1 82  ? -14.098 14.274  5.034   1.00 40.84 ? 80   LYS A CB  1 
ATOM   656  C  CG  . LYS A 1 82  ? -13.567 12.884  4.651   1.00 44.70 ? 80   LYS A CG  1 
ATOM   657  C  CD  . LYS A 1 82  ? -14.725 11.936  4.245   1.00 46.80 ? 80   LYS A CD  1 
ATOM   658  C  CE  . LYS A 1 82  ? -15.523 11.455  5.480   1.00 47.43 ? 80   LYS A CE  1 
ATOM   659  N  NZ  . LYS A 1 82  ? -16.760 10.670  5.126   1.00 47.97 ? 80   LYS A NZ  1 
ATOM   660  N  N   . GLY A 1 83  ? -13.780 15.357  8.146   1.00 34.13 ? 81   GLY A N   1 
ATOM   661  C  CA  . GLY A 1 83  ? -13.763 15.053  9.563   1.00 34.89 ? 81   GLY A CA  1 
ATOM   662  C  C   . GLY A 1 83  ? -12.646 15.765  10.310  1.00 36.25 ? 81   GLY A C   1 
ATOM   663  O  O   . GLY A 1 83  ? -12.612 15.759  11.546  1.00 37.00 ? 81   GLY A O   1 
ATOM   664  N  N   . GLU A 1 84  ? -11.780 16.468  9.581   1.00 36.44 ? 82   GLU A N   1 
ATOM   665  C  CA  . GLU A 1 84  ? -10.637 17.139  10.204  1.00 37.60 ? 82   GLU A CA  1 
ATOM   666  C  C   . GLU A 1 84  ? -10.736 18.656  10.450  1.00 38.09 ? 82   GLU A C   1 
ATOM   667  O  O   . GLU A 1 84  ? -9.826  19.249  11.032  1.00 37.72 ? 82   GLU A O   1 
ATOM   668  C  CB  . GLU A 1 84  ? -9.352  16.810  9.418   1.00 36.41 ? 82   GLU A CB  1 
ATOM   669  C  CG  . GLU A 1 84  ? -8.852  15.342  9.534   1.00 35.11 ? 82   GLU A CG  1 
ATOM   670  C  CD  . GLU A 1 84  ? -8.620  14.923  10.982  1.00 33.50 ? 82   GLU A CD  1 
ATOM   671  O  OE1 . GLU A 1 84  ? -7.687  15.436  11.637  1.00 32.08 ? 82   GLU A OE1 1 
ATOM   672  O  OE2 . GLU A 1 84  ? -9.404  14.105  11.479  1.00 33.06 ? 82   GLU A OE2 1 
ATOM   673  N  N   . GLU A 1 85  ? -11.871 19.254  10.101  1.00 38.98 ? 83   GLU A N   1 
ATOM   674  C  CA  . GLU A 1 85  ? -12.062 20.702  10.250  1.00 39.80 ? 83   GLU A CA  1 
ATOM   675  C  C   . GLU A 1 85  ? -11.753 21.319  11.616  1.00 38.09 ? 83   GLU A C   1 
ATOM   676  O  O   . GLU A 1 85  ? -11.244 22.442  11.694  1.00 37.71 ? 83   GLU A O   1 
ATOM   677  C  CB  . GLU A 1 85  ? -13.458 21.131  9.791   1.00 42.15 ? 83   GLU A CB  1 
ATOM   678  C  CG  . GLU A 1 85  ? -13.842 20.678  8.380   1.00 44.62 ? 83   GLU A CG  1 
ATOM   679  C  CD  . GLU A 1 85  ? -14.530 19.301  8.342   1.00 46.29 ? 83   GLU A CD  1 
ATOM   680  O  OE1 . GLU A 1 85  ? -14.638 18.637  9.400   1.00 45.78 ? 83   GLU A OE1 1 
ATOM   681  O  OE2 . GLU A 1 85  ? -14.978 18.903  7.243   1.00 48.11 ? 83   GLU A OE2 1 
ATOM   682  N  N   . ASN A 1 86  ? -11.986 20.596  12.697  1.00 36.77 ? 84   ASN A N   1 
ATOM   683  C  CA  . ASN A 1 86  ? -11.719 21.176  14.015  1.00 34.83 ? 84   ASN A CA  1 
ATOM   684  C  C   . ASN A 1 86  ? -10.337 20.970  14.601  1.00 32.11 ? 84   ASN A C   1 
ATOM   685  O  O   . ASN A 1 86  ? -10.105 21.313  15.768  1.00 31.85 ? 84   ASN A O   1 
ATOM   686  C  CB  . ASN A 1 86  ? -12.762 20.703  15.031  1.00 39.14 ? 84   ASN A CB  1 
ATOM   687  C  CG  . ASN A 1 86  ? -14.117 21.309  14.778  1.00 41.54 ? 84   ASN A CG  1 
ATOM   688  O  OD1 . ASN A 1 86  ? -15.112 20.604  14.637  1.00 43.49 ? 84   ASN A OD1 1 
ATOM   689  N  ND2 . ASN A 1 86  ? -14.159 22.635  14.693  1.00 43.12 ? 84   ASN A ND2 1 
ATOM   690  N  N   . TRP A 1 87  ? -9.393  20.466  13.808  1.00 29.14 ? 85   TRP A N   1 
ATOM   691  C  CA  . TRP A 1 87  ? -8.062  20.204  14.342  1.00 25.31 ? 85   TRP A CA  1 
ATOM   692  C  C   . TRP A 1 87  ? -7.325  21.395  14.895  1.00 26.02 ? 85   TRP A C   1 
ATOM   693  O  O   . TRP A 1 87  ? -6.627  21.277  15.906  1.00 21.68 ? 85   TRP A O   1 
ATOM   694  C  CB  . TRP A 1 87  ? -7.170  19.452  13.328  1.00 22.97 ? 85   TRP A CB  1 
ATOM   695  C  CG  . TRP A 1 87  ? -6.447  20.253  12.251  1.00 20.58 ? 85   TRP A CG  1 
ATOM   696  C  CD1 . TRP A 1 87  ? -6.732  20.264  10.931  1.00 18.49 ? 85   TRP A CD1 1 
ATOM   697  C  CD2 . TRP A 1 87  ? -5.228  21.002  12.398  1.00 19.50 ? 85   TRP A CD2 1 
ATOM   698  N  NE1 . TRP A 1 87  ? -5.759  20.926  10.236  1.00 20.95 ? 85   TRP A NE1 1 
ATOM   699  C  CE2 . TRP A 1 87  ? -4.825  21.403  11.120  1.00 20.75 ? 85   TRP A CE2 1 
ATOM   700  C  CE3 . TRP A 1 87  ? -4.428  21.360  13.495  1.00 18.89 ? 85   TRP A CE3 1 
ATOM   701  C  CZ2 . TRP A 1 87  ? -3.666  22.149  10.895  1.00 21.47 ? 85   TRP A CZ2 1 
ATOM   702  C  CZ3 . TRP A 1 87  ? -3.302  22.083  13.290  1.00 18.15 ? 85   TRP A CZ3 1 
ATOM   703  C  CH2 . TRP A 1 87  ? -2.916  22.479  11.993  1.00 19.62 ? 85   TRP A CH2 1 
ATOM   704  N  N   . LEU A 1 88  ? -7.450  22.530  14.208  1.00 25.66 ? 86   LEU A N   1 
ATOM   705  C  CA  . LEU A 1 88  ? -6.768  23.771  14.614  1.00 26.86 ? 86   LEU A CA  1 
ATOM   706  C  C   . LEU A 1 88  ? -7.237  24.225  15.994  1.00 25.94 ? 86   LEU A C   1 
ATOM   707  O  O   . LEU A 1 88  ? -6.427  24.616  16.844  1.00 27.60 ? 86   LEU A O   1 
ATOM   708  C  CB  . LEU A 1 88  ? -6.991  24.880  13.555  1.00 27.22 ? 86   LEU A CB  1 
ATOM   709  C  CG  . LEU A 1 88  ? -6.522  24.597  12.119  1.00 27.69 ? 86   LEU A CG  1 
ATOM   710  C  CD1 . LEU A 1 88  ? -7.575  23.790  11.345  1.00 26.24 ? 86   LEU A CD1 1 
ATOM   711  C  CD2 . LEU A 1 88  ? -6.273  25.916  11.377  1.00 28.96 ? 86   LEU A CD2 1 
ATOM   712  N  N   . LEU A 1 89  ? -8.543  24.144  16.208  1.00 26.66 ? 87   LEU A N   1 
ATOM   713  C  CA  . LEU A 1 89  ? -9.168  24.484  17.482  1.00 25.89 ? 87   LEU A CA  1 
ATOM   714  C  C   . LEU A 1 89  ? -8.824  23.392  18.517  1.00 27.21 ? 87   LEU A C   1 
ATOM   715  O  O   . LEU A 1 89  ? -8.597  23.674  19.690  1.00 25.73 ? 87   LEU A O   1 
ATOM   716  C  CB  . LEU A 1 89  ? -10.684 24.606  17.303  1.00 25.69 ? 87   LEU A CB  1 
ATOM   717  C  CG  . LEU A 1 89  ? -11.536 24.964  18.532  1.00 25.96 ? 87   LEU A CG  1 
ATOM   718  C  CD1 . LEU A 1 89  ? -10.912 26.102  19.350  1.00 25.03 ? 87   LEU A CD1 1 
ATOM   719  C  CD2 . LEU A 1 89  ? -12.973 25.295  18.088  1.00 25.56 ? 87   LEU A CD2 1 
ATOM   720  N  N   . ASP A 1 90  ? -8.769  22.140  18.074  1.00 27.38 ? 88   ASP A N   1 
ATOM   721  C  CA  . ASP A 1 90  ? -8.405  21.066  18.981  1.00 28.59 ? 88   ASP A CA  1 
ATOM   722  C  C   . ASP A 1 90  ? -7.010  21.334  19.503  1.00 26.09 ? 88   ASP A C   1 
ATOM   723  O  O   . ASP A 1 90  ? -6.733  21.117  20.680  1.00 27.23 ? 88   ASP A O   1 
ATOM   724  C  CB  . ASP A 1 90  ? -8.451  19.710  18.278  1.00 29.41 ? 88   ASP A CB  1 
ATOM   725  C  CG  . ASP A 1 90  ? -9.847  19.143  18.191  1.00 31.63 ? 88   ASP A CG  1 
ATOM   726  O  OD1 . ASP A 1 90  ? -10.708 19.481  19.039  1.00 32.03 ? 88   ASP A OD1 1 
ATOM   727  O  OD2 . ASP A 1 90  ? -10.089 18.367  17.245  1.00 33.11 ? 88   ASP A OD2 1 
ATOM   728  N  N   . MET A 1 91  ? -6.144  21.862  18.632  1.00 23.46 ? 89   MET A N   1 
ATOM   729  C  CA  . MET A 1 91  ? -4.780  22.177  19.027  1.00 23.01 ? 89   MET A CA  1 
ATOM   730  C  C   . MET A 1 91  ? -4.727  23.375  20.002  1.00 24.36 ? 89   MET A C   1 
ATOM   731  O  O   . MET A 1 91  ? -3.964  23.327  20.987  1.00 26.71 ? 89   MET A O   1 
ATOM   732  C  CB  . MET A 1 91  ? -3.901  22.407  17.791  1.00 22.89 ? 89   MET A CB  1 
ATOM   733  C  CG  . MET A 1 91  ? -2.442  22.472  18.128  1.00 23.73 ? 89   MET A CG  1 
ATOM   734  S  SD  . MET A 1 91  ? -1.361  22.812  16.731  1.00 27.60 ? 89   MET A SD  1 
ATOM   735  C  CE  . MET A 1 91  ? -1.177  21.189  16.115  1.00 23.21 ? 89   MET A CE  1 
ATOM   736  N  N   . CYS A 1 92  ? -5.488  24.447  19.732  1.00 23.28 ? 90   CYS A N   1 
ATOM   737  C  CA  . CYS A 1 92  ? -5.534  25.602  20.652  1.00 23.63 ? 90   CYS A CA  1 
ATOM   738  C  C   . CYS A 1 92  ? -5.946  25.098  22.042  1.00 24.12 ? 90   CYS A C   1 
ATOM   739  O  O   . CYS A 1 92  ? -5.350  25.464  23.051  1.00 24.68 ? 90   CYS A O   1 
ATOM   740  C  CB  . CYS A 1 92  ? -6.612  26.641  20.226  1.00 24.25 ? 90   CYS A CB  1 
ATOM   741  S  SG  . CYS A 1 92  ? -6.263  27.659  18.712  1.00 27.37 ? 90   CYS A SG  1 
ATOM   742  N  N   . LYS A 1 93  ? -7.001  24.287  22.089  1.00 25.52 ? 91   LYS A N   1 
ATOM   743  C  CA  . LYS A 1 93  ? -7.497  23.738  23.355  1.00 30.27 ? 91   LYS A CA  1 
ATOM   744  C  C   . LYS A 1 93  ? -6.471  23.037  24.228  1.00 29.68 ? 91   LYS A C   1 
ATOM   745  O  O   . LYS A 1 93  ? -6.514  23.179  25.448  1.00 31.86 ? 91   LYS A O   1 
ATOM   746  C  CB  . LYS A 1 93  ? -8.736  22.888  23.116  1.00 31.53 ? 91   LYS A CB  1 
ATOM   747  C  CG  . LYS A 1 93  ? -9.980  23.731  23.104  1.00 32.05 ? 91   LYS A CG  1 
ATOM   748  C  CD  . LYS A 1 93  ? -11.079 23.094  22.313  1.00 32.93 ? 91   LYS A CD  1 
ATOM   749  C  CE  . LYS A 1 93  ? -12.374 23.827  22.555  1.00 32.81 ? 91   LYS A CE  1 
ATOM   750  N  NZ  . LYS A 1 93  ? -13.434 23.230  21.722  1.00 33.12 ? 91   LYS A NZ  1 
ATOM   751  N  N   . ASN A 1 94  ? -5.510  22.354  23.610  1.00 31.52 ? 92   ASN A N   1 
ATOM   752  C  CA  . ASN A 1 94  ? -4.416  21.691  24.337  1.00 30.44 ? 92   ASN A CA  1 
ATOM   753  C  C   . ASN A 1 94  ? -3.426  22.748  24.838  1.00 32.42 ? 92   ASN A C   1 
ATOM   754  O  O   . ASN A 1 94  ? -2.804  22.574  25.889  1.00 32.99 ? 92   ASN A O   1 
ATOM   755  C  CB  . ASN A 1 94  ? -3.715  20.634  23.442  1.00 29.88 ? 92   ASN A CB  1 
ATOM   756  C  CG  . ASN A 1 94  ? -4.528  19.360  23.332  1.00 29.75 ? 92   ASN A CG  1 
ATOM   757  O  OD1 . ASN A 1 94  ? -5.554  19.249  23.975  1.00 29.48 ? 92   ASN A OD1 1 
ATOM   758  N  ND2 . ASN A 1 94  ? -4.081  18.400  22.527  1.00 29.21 ? 92   ASN A ND2 1 
ATOM   759  N  N   . MET A 1 95  ? -3.283  23.862  24.107  1.00 31.01 ? 93   MET A N   1 
ATOM   760  C  CA  . MET A 1 95  ? -2.401  24.934  24.560  1.00 29.76 ? 93   MET A CA  1 
ATOM   761  C  C   . MET A 1 95  ? -2.962  25.551  25.835  1.00 30.94 ? 93   MET A C   1 
ATOM   762  O  O   . MET A 1 95  ? -2.209  25.893  26.740  1.00 32.53 ? 93   MET A O   1 
ATOM   763  C  CB  . MET A 1 95  ? -2.273  26.036  23.508  1.00 30.46 ? 93   MET A CB  1 
ATOM   764  C  CG  . MET A 1 95  ? -1.469  25.657  22.301  1.00 32.04 ? 93   MET A CG  1 
ATOM   765  S  SD  . MET A 1 95  ? -1.633  26.841  20.953  1.00 35.24 ? 93   MET A SD  1 
ATOM   766  C  CE  . MET A 1 95  ? -1.059  25.805  19.592  1.00 34.27 ? 93   MET A CE  1 
ATOM   767  N  N   . PHE A 1 96  ? -4.284  25.699  25.896  1.00 29.34 ? 94   PHE A N   1 
ATOM   768  C  CA  . PHE A 1 96  ? -4.919  26.291  27.067  1.00 32.02 ? 94   PHE A CA  1 
ATOM   769  C  C   . PHE A 1 96  ? -4.753  25.456  28.342  1.00 32.84 ? 94   PHE A C   1 
ATOM   770  O  O   . PHE A 1 96  ? -4.928  25.965  29.447  1.00 33.16 ? 94   PHE A O   1 
ATOM   771  C  CB  . PHE A 1 96  ? -6.407  26.561  26.814  1.00 30.58 ? 94   PHE A CB  1 
ATOM   772  C  CG  . PHE A 1 96  ? -6.688  27.435  25.612  1.00 30.66 ? 94   PHE A CG  1 
ATOM   773  C  CD1 . PHE A 1 96  ? -5.835  28.481  25.261  1.00 28.70 ? 94   PHE A CD1 1 
ATOM   774  C  CD2 . PHE A 1 96  ? -7.817  27.211  24.832  1.00 30.49 ? 94   PHE A CD2 1 
ATOM   775  C  CE1 . PHE A 1 96  ? -6.105  29.274  24.169  1.00 29.07 ? 94   PHE A CE1 1 
ATOM   776  C  CE2 . PHE A 1 96  ? -8.100  28.015  23.714  1.00 30.01 ? 94   PHE A CE2 1 
ATOM   777  C  CZ  . PHE A 1 96  ? -7.242  29.045  23.388  1.00 29.08 ? 94   PHE A CZ  1 
ATOM   778  N  N   . LYS A 1 97  ? -4.433  24.174  28.187  1.00 33.65 ? 95   LYS A N   1 
ATOM   779  C  CA  . LYS A 1 97  ? -4.237  23.274  29.330  1.00 34.20 ? 95   LYS A CA  1 
ATOM   780  C  C   . LYS A 1 97  ? -2.867  23.473  29.926  1.00 34.39 ? 95   LYS A C   1 
ATOM   781  O  O   . LYS A 1 97  ? -2.613  23.014  31.033  1.00 35.23 ? 95   LYS A O   1 
ATOM   782  C  CB  . LYS A 1 97  ? -4.376  21.808  28.906  1.00 33.48 ? 95   LYS A CB  1 
ATOM   783  C  CG  . LYS A 1 97  ? -5.741  21.461  28.361  1.00 34.11 ? 95   LYS A CG  1 
ATOM   784  C  CD  . LYS A 1 97  ? -5.766  20.063  27.786  1.00 35.71 ? 95   LYS A CD  1 
ATOM   785  C  CE  . LYS A 1 97  ? -7.176  19.706  27.378  1.00 36.73 ? 95   LYS A CE  1 
ATOM   786  N  NZ  . LYS A 1 97  ? -7.267  18.297  26.971  1.00 37.79 ? 95   LYS A NZ  1 
ATOM   787  N  N   . VAL A 1 98  ? -1.968  24.120  29.185  1.00 34.26 ? 96   VAL A N   1 
ATOM   788  C  CA  . VAL A 1 98  ? -0.617  24.352  29.685  1.00 33.62 ? 96   VAL A CA  1 
ATOM   789  C  C   . VAL A 1 98  ? -0.148  25.774  29.678  1.00 34.71 ? 96   VAL A C   1 
ATOM   790  O  O   . VAL A 1 98  ? 0.972   26.032  30.113  1.00 34.48 ? 96   VAL A O   1 
ATOM   791  C  CB  . VAL A 1 98  ? 0.470   23.545  28.918  1.00 33.96 ? 96   VAL A CB  1 
ATOM   792  C  CG1 . VAL A 1 98  ? 0.224   22.036  29.048  1.00 33.77 ? 96   VAL A CG1 1 
ATOM   793  C  CG2 . VAL A 1 98  ? 0.524   23.975  27.449  1.00 33.58 ? 96   VAL A CG2 1 
ATOM   794  N  N   . GLU A 1 99  ? -0.956  26.697  29.147  1.00 34.67 ? 97   GLU A N   1 
ATOM   795  C  CA  . GLU A 1 99  ? -0.549  28.111  29.097  1.00 33.49 ? 97   GLU A CA  1 
ATOM   796  C  C   . GLU A 1 99  ? -1.662  29.088  28.747  1.00 32.82 ? 97   GLU A C   1 
ATOM   797  O  O   . GLU A 1 99  ? -2.692  28.716  28.178  1.00 31.24 ? 97   GLU A O   1 
ATOM   798  C  CB  . GLU A 1 99  ? 0.566   28.305  28.062  1.00 33.23 ? 97   GLU A CB  1 
ATOM   799  C  CG  . GLU A 1 99  ? 0.171   27.847  26.664  1.00 33.90 ? 97   GLU A CG  1 
ATOM   800  C  CD  . GLU A 1 99  ? 1.101   28.343  25.558  1.00 35.68 ? 97   GLU A CD  1 
ATOM   801  O  OE1 . GLU A 1 99  ? 2.184   28.894  25.867  1.00 37.08 ? 97   GLU A OE1 1 
ATOM   802  O  OE2 . GLU A 1 99  ? 0.735   28.181  24.378  1.00 34.42 ? 97   GLU A OE2 1 
ATOM   803  N  N   . GLU A 1 100 ? -1.400  30.346  29.075  1.00 33.78 ? 98   GLU A N   1 
ATOM   804  C  CA  . GLU A 1 100 ? -2.276  31.489  28.801  1.00 36.45 ? 98   GLU A CA  1 
ATOM   805  C  C   . GLU A 1 100 ? -1.700  32.020  27.485  1.00 33.31 ? 98   GLU A C   1 
ATOM   806  O  O   . GLU A 1 100 ? -0.561  32.495  27.466  1.00 32.25 ? 98   GLU A O   1 
ATOM   807  C  CB  . GLU A 1 100 ? -2.066  32.564  29.888  1.00 39.19 ? 98   GLU A CB  1 
ATOM   808  C  CG  . GLU A 1 100 ? -2.379  32.111  31.292  1.00 43.33 ? 98   GLU A CG  1 
ATOM   809  C  CD  . GLU A 1 100 ? -3.694  32.647  31.770  1.00 45.90 ? 98   GLU A CD  1 
ATOM   810  O  OE1 . GLU A 1 100 ? -3.696  33.800  32.263  1.00 47.06 ? 98   GLU A OE1 1 
ATOM   811  O  OE2 . GLU A 1 100 ? -4.723  31.943  31.620  1.00 47.18 ? 98   GLU A OE2 1 
ATOM   812  N  N   . VAL A 1 101 ? -2.479  31.975  26.407  1.00 31.29 ? 99   VAL A N   1 
ATOM   813  C  CA  . VAL A 1 101 ? -1.973  32.396  25.114  1.00 28.63 ? 99   VAL A CA  1 
ATOM   814  C  C   . VAL A 1 101 ? -3.069  32.840  24.161  1.00 28.18 ? 99   VAL A C   1 
ATOM   815  O  O   . VAL A 1 101 ? -4.240  32.542  24.384  1.00 27.15 ? 99   VAL A O   1 
ATOM   816  C  CB  . VAL A 1 101 ? -1.178  31.189  24.473  1.00 27.17 ? 99   VAL A CB  1 
ATOM   817  C  CG1 . VAL A 1 101 ? -2.121  30.025  24.131  1.00 28.54 ? 99   VAL A CG1 1 
ATOM   818  C  CG2 . VAL A 1 101 ? -0.347  31.619  23.278  1.00 28.89 ? 99   VAL A CG2 1 
ATOM   819  N  N   . ASN A 1 102 ? -2.688  33.606  23.133  1.00 27.35 ? 100  ASN A N   1 
ATOM   820  C  CA  . ASN A 1 102 ? -3.652  34.041  22.111  1.00 25.48 ? 100  ASN A CA  1 
ATOM   821  C  C   . ASN A 1 102 ? -3.436  33.015  21.018  1.00 24.28 ? 100  ASN A C   1 
ATOM   822  O  O   . ASN A 1 102 ? -2.341  32.888  20.487  1.00 23.47 ? 100  ASN A O   1 
ATOM   823  C  CB  . ASN A 1 102 ? -3.300  35.443  21.573  1.00 24.51 ? 100  ASN A CB  1 
ATOM   824  C  CG  . ASN A 1 102 ? -3.170  36.462  22.664  1.00 22.78 ? 100  ASN A CG  1 
ATOM   825  O  OD1 . ASN A 1 102 ? -4.111  36.683  23.400  1.00 23.95 ? 100  ASN A OD1 1 
ATOM   826  N  ND2 . ASN A 1 102 ? -2.005  37.070  22.793  1.00 22.25 ? 100  ASN A ND2 1 
ATOM   827  N  N   . CYS A 1 103 ? -4.469  32.266  20.683  1.00 24.54 ? 101  CYS A N   1 
ATOM   828  C  CA  . CYS A 1 103 ? -4.337  31.252  19.684  1.00 24.74 ? 101  CYS A CA  1 
ATOM   829  C  C   . CYS A 1 103 ? -5.197  31.681  18.523  1.00 23.60 ? 101  CYS A C   1 
ATOM   830  O  O   . CYS A 1 103 ? -6.417  31.717  18.631  1.00 24.01 ? 101  CYS A O   1 
ATOM   831  C  CB  . CYS A 1 103 ? -4.807  29.907  20.249  1.00 26.63 ? 101  CYS A CB  1 
ATOM   832  S  SG  . CYS A 1 103 ? -4.458  28.488  19.139  1.00 23.01 ? 101  CYS A SG  1 
ATOM   833  N  N   . ILE A 1 104 ? -4.554  32.050  17.429  1.00 24.04 ? 102  ILE A N   1 
ATOM   834  C  CA  . ILE A 1 104 ? -5.282  32.504  16.261  1.00 23.09 ? 102  ILE A CA  1 
ATOM   835  C  C   . ILE A 1 104 ? -5.285  31.433  15.173  1.00 21.76 ? 102  ILE A C   1 
ATOM   836  O  O   . ILE A 1 104 ? -4.230  31.081  14.632  1.00 22.67 ? 102  ILE A O   1 
ATOM   837  C  CB  . ILE A 1 104 ? -4.654  33.814  15.686  1.00 23.86 ? 102  ILE A CB  1 
ATOM   838  C  CG1 . ILE A 1 104 ? -4.578  34.889  16.786  1.00 25.56 ? 102  ILE A CG1 1 
ATOM   839  C  CG2 . ILE A 1 104 ? -5.465  34.298  14.525  1.00 22.87 ? 102  ILE A CG2 1 
ATOM   840  C  CD1 . ILE A 1 104 ? -3.695  36.078  16.445  1.00 24.33 ? 102  ILE A CD1 1 
ATOM   841  N  N   . CYS A 1 105 ? -6.459  30.930  14.851  1.00 21.85 ? 103  CYS A N   1 
ATOM   842  C  CA  . CYS A 1 105 ? -6.601  29.967  13.760  1.00 23.49 ? 103  CYS A CA  1 
ATOM   843  C  C   . CYS A 1 105 ? -6.805  30.764  12.474  1.00 25.64 ? 103  CYS A C   1 
ATOM   844  O  O   . CYS A 1 105 ? -7.662  31.640  12.401  1.00 26.53 ? 103  CYS A O   1 
ATOM   845  C  CB  . CYS A 1 105 ? -7.806  29.063  13.975  1.00 24.67 ? 103  CYS A CB  1 
ATOM   846  S  SG  . CYS A 1 105 ? -7.614  28.020  15.431  1.00 26.68 ? 103  CYS A SG  1 
ATOM   847  N  N   . VAL A 1 106 ? -6.018  30.457  11.460  1.00 25.11 ? 104  VAL A N   1 
ATOM   848  C  CA  . VAL A 1 106 ? -6.130  31.139  10.184  1.00 23.54 ? 104  VAL A CA  1 
ATOM   849  C  C   . VAL A 1 106 ? -6.804  30.191  9.193   1.00 23.67 ? 104  VAL A C   1 
ATOM   850  O  O   . VAL A 1 106 ? -6.204  29.244  8.699   1.00 24.61 ? 104  VAL A O   1 
ATOM   851  C  CB  . VAL A 1 106 ? -4.745  31.586  9.677   1.00 23.32 ? 104  VAL A CB  1 
ATOM   852  C  CG1 . VAL A 1 106 ? -4.857  32.282  8.324   1.00 21.12 ? 104  VAL A CG1 1 
ATOM   853  C  CG2 . VAL A 1 106 ? -4.066  32.506  10.714  1.00 19.71 ? 104  VAL A CG2 1 
ATOM   854  N  N   . ASP A 1 107 ? -8.068  30.469  8.909   1.00 24.13 ? 105  ASP A N   1 
ATOM   855  C  CA  . ASP A 1 107 ? -8.837  29.677  8.002   1.00 25.27 ? 105  ASP A CA  1 
ATOM   856  C  C   . ASP A 1 107 ? -8.882  30.326  6.615   1.00 26.10 ? 105  ASP A C   1 
ATOM   857  O  O   . ASP A 1 107 ? -9.457  31.383  6.452   1.00 26.29 ? 105  ASP A O   1 
ATOM   858  C  CB  . ASP A 1 107 ? -10.249 29.507  8.560   1.00 28.76 ? 105  ASP A CB  1 
ATOM   859  C  CG  . ASP A 1 107 ? -11.185 28.834  7.592   1.00 31.19 ? 105  ASP A CG  1 
ATOM   860  O  OD1 . ASP A 1 107 ? -10.713 28.078  6.726   1.00 34.38 ? 105  ASP A OD1 1 
ATOM   861  O  OD2 . ASP A 1 107 ? -12.408 29.040  7.700   1.00 34.13 ? 105  ASP A OD2 1 
ATOM   862  N  N   . TRP A 1 108 ? -8.361  29.622  5.618   1.00 25.71 ? 106  TRP A N   1 
ATOM   863  C  CA  . TRP A 1 108 ? -8.364  30.068  4.238   1.00 25.99 ? 106  TRP A CA  1 
ATOM   864  C  C   . TRP A 1 108 ? -8.782  28.892  3.342   1.00 28.16 ? 106  TRP A C   1 
ATOM   865  O  O   . TRP A 1 108 ? -8.326  28.758  2.200   1.00 27.69 ? 106  TRP A O   1 
ATOM   866  C  CB  . TRP A 1 108 ? -6.968  30.564  3.868   1.00 23.81 ? 106  TRP A CB  1 
ATOM   867  C  CG  . TRP A 1 108 ? -5.871  29.504  3.934   1.00 21.17 ? 106  TRP A CG  1 
ATOM   868  C  CD1 . TRP A 1 108 ? -5.251  29.012  5.050   1.00 19.61 ? 106  TRP A CD1 1 
ATOM   869  C  CD2 . TRP A 1 108 ? -5.204  28.917  2.814   1.00 18.87 ? 106  TRP A CD2 1 
ATOM   870  N  NE1 . TRP A 1 108 ? -4.222  28.177  4.690   1.00 18.45 ? 106  TRP A NE1 1 
ATOM   871  C  CE2 . TRP A 1 108 ? -4.169  28.102  3.318   1.00 19.44 ? 106  TRP A CE2 1 
ATOM   872  C  CE3 . TRP A 1 108 ? -5.378  29.010  1.424   1.00 18.30 ? 106  TRP A CE3 1 
ATOM   873  C  CZ2 . TRP A 1 108 ? -3.301  27.384  2.483   1.00 18.60 ? 106  TRP A CZ2 1 
ATOM   874  C  CZ3 . TRP A 1 108 ? -4.517  28.300  0.589   1.00 20.82 ? 106  TRP A CZ3 1 
ATOM   875  C  CH2 . TRP A 1 108 ? -3.481  27.494  1.132   1.00 19.26 ? 106  TRP A CH2 1 
ATOM   876  N  N   . LYS A 1 109 ? -9.669  28.048  3.867   1.00 29.78 ? 107  LYS A N   1 
ATOM   877  C  CA  . LYS A 1 109 ? -10.124 26.867  3.137   1.00 32.13 ? 107  LYS A CA  1 
ATOM   878  C  C   . LYS A 1 109 ? -10.567 27.055  1.693   1.00 32.10 ? 107  LYS A C   1 
ATOM   879  O  O   . LYS A 1 109 ? -10.189 26.258  0.825   1.00 33.31 ? 107  LYS A O   1 
ATOM   880  C  CB  . LYS A 1 109 ? -11.192 26.116  3.929   1.00 34.90 ? 107  LYS A CB  1 
ATOM   881  C  CG  . LYS A 1 109 ? -11.051 24.582  3.796   1.00 36.56 ? 107  LYS A CG  1 
ATOM   882  C  CD  . LYS A 1 109 ? -11.902 23.842  4.821   1.00 38.88 ? 107  LYS A CD  1 
ATOM   883  C  CE  . LYS A 1 109 ? -13.372 24.151  4.633   1.00 40.74 ? 107  LYS A CE  1 
ATOM   884  N  NZ  . LYS A 1 109 ? -14.247 23.456  5.632   1.00 42.70 ? 107  LYS A NZ  1 
ATOM   885  N  N   . LYS A 1 110 ? -11.345 28.095  1.411   1.00 29.81 ? 108  LYS A N   1 
ATOM   886  C  CA  . LYS A 1 110 ? -11.785 28.342  0.032   1.00 29.37 ? 108  LYS A CA  1 
ATOM   887  C  C   . LYS A 1 110 ? -10.598 28.551  -0.892  1.00 27.26 ? 108  LYS A C   1 
ATOM   888  O  O   . LYS A 1 110 ? -10.649 28.195  -2.066  1.00 26.16 ? 108  LYS A O   1 
ATOM   889  C  CB  . LYS A 1 110 ? -12.710 29.568  -0.065  1.00 31.18 ? 108  LYS A CB  1 
ATOM   890  C  CG  . LYS A 1 110 ? -14.056 29.419  0.639   1.00 33.84 ? 108  LYS A CG  1 
ATOM   891  C  CD  . LYS A 1 110 ? -14.983 30.629  0.410   1.00 37.05 ? 108  LYS A CD  1 
ATOM   892  C  CE  . LYS A 1 110 ? -14.532 31.909  1.157   1.00 36.86 ? 108  LYS A CE  1 
ATOM   893  N  NZ  . LYS A 1 110 ? -15.659 32.908  1.273   1.00 36.95 ? 108  LYS A NZ  1 
ATOM   894  N  N   . GLY A 1 111 ? -9.523  29.135  -0.361  1.00 27.41 ? 109  GLY A N   1 
ATOM   895  C  CA  . GLY A 1 111 ? -8.350  29.383  -1.168  1.00 24.88 ? 109  GLY A CA  1 
ATOM   896  C  C   . GLY A 1 111 ? -7.485  28.155  -1.348  1.00 25.40 ? 109  GLY A C   1 
ATOM   897  O  O   . GLY A 1 111 ? -6.612  28.155  -2.195  1.00 21.96 ? 109  GLY A O   1 
ATOM   898  N  N   . SER A 1 112 ? -7.688  27.126  -0.517  1.00 26.13 ? 110  SER A N   1 
ATOM   899  C  CA  . SER A 1 112 ? -6.913  25.890  -0.606  1.00 27.34 ? 110  SER A CA  1 
ATOM   900  C  C   . SER A 1 112 ? -7.613  24.785  -1.430  1.00 29.77 ? 110  SER A C   1 
ATOM   901  O  O   . SER A 1 112 ? -6.932  23.925  -2.019  1.00 29.07 ? 110  SER A O   1 
ATOM   902  C  CB  . SER A 1 112 ? -6.576  25.375  0.798   1.00 28.27 ? 110  SER A CB  1 
ATOM   903  O  OG  . SER A 1 112 ? -7.745  25.155  1.587   1.00 29.85 ? 110  SER A OG  1 
ATOM   904  N  N   . GLN A 1 113 ? -8.949  24.829  -1.479  1.00 30.82 ? 111  GLN A N   1 
ATOM   905  C  CA  . GLN A 1 113 ? -9.787  23.861  -2.205  1.00 32.57 ? 111  GLN A CA  1 
ATOM   906  C  C   . GLN A 1 113 ? -10.006 24.240  -3.661  1.00 32.52 ? 111  GLN A C   1 
ATOM   907  O  O   . GLN A 1 113 ? -11.102 24.633  -4.077  1.00 33.54 ? 111  GLN A O   1 
ATOM   908  C  CB  . GLN A 1 113 ? -11.139 23.674  -1.507  1.00 33.14 ? 111  GLN A CB  1 
ATOM   909  C  CG  . GLN A 1 113 ? -11.009 23.220  -0.045  1.00 38.21 ? 111  GLN A CG  1 
ATOM   910  C  CD  . GLN A 1 113 ? -12.346 23.018  0.681   1.00 40.62 ? 111  GLN A CD  1 
ATOM   911  O  OE1 . GLN A 1 113 ? -12.447 22.166  1.568   1.00 43.74 ? 111  GLN A OE1 1 
ATOM   912  N  NE2 . GLN A 1 113 ? -13.343 23.826  0.358   1.00 40.79 ? 111  GLN A NE2 1 
ATOM   913  N  N   . THR A 1 114 ? -8.956  24.067  -4.443  1.00 33.18 ? 112  THR A N   1 
ATOM   914  C  CA  . THR A 1 114 ? -8.970  24.372  -5.864  1.00 32.72 ? 112  THR A CA  1 
ATOM   915  C  C   . THR A 1 114 ? -7.796  23.579  -6.432  1.00 32.00 ? 112  THR A C   1 
ATOM   916  O  O   . THR A 1 114 ? -7.232  22.738  -5.732  1.00 32.27 ? 112  THR A O   1 
ATOM   917  C  CB  . THR A 1 114 ? -8.828  25.915  -6.101  1.00 31.04 ? 112  THR A CB  1 
ATOM   918  O  OG1 . THR A 1 114 ? -8.704  26.191  -7.500  1.00 31.00 ? 112  THR A OG1 1 
ATOM   919  C  CG2 . THR A 1 114 ? -7.642  26.482  -5.370  1.00 29.26 ? 112  THR A CG2 1 
ATOM   920  N  N   . SER A 1 115 ? -7.468  23.806  -7.695  1.00 31.34 ? 113  SER A N   1 
ATOM   921  C  CA  . SER A 1 115 ? -6.358  23.119  -8.346  1.00 32.52 ? 113  SER A CA  1 
ATOM   922  C  C   . SER A 1 115 ? -5.101  23.388  -7.521  1.00 32.67 ? 113  SER A C   1 
ATOM   923  O  O   . SER A 1 115 ? -5.037  24.403  -6.813  1.00 32.04 ? 113  SER A O   1 
ATOM   924  C  CB  . SER A 1 115 ? -6.197  23.616  -9.790  1.00 34.07 ? 113  SER A CB  1 
ATOM   925  O  OG  . SER A 1 115 ? -5.799  24.976  -9.857  1.00 37.95 ? 113  SER A OG  1 
ATOM   926  N  N   . TYR A 1 116 ? -4.091  22.509  -7.612  1.00 31.77 ? 114  TYR A N   1 
ATOM   927  C  CA  . TYR A 1 116 ? -2.875  22.675  -6.809  1.00 30.08 ? 114  TYR A CA  1 
ATOM   928  C  C   . TYR A 1 116 ? -2.030  23.912  -7.112  1.00 30.46 ? 114  TYR A C   1 
ATOM   929  O  O   . TYR A 1 116 ? -1.553  24.577  -6.199  1.00 27.95 ? 114  TYR A O   1 
ATOM   930  C  CB  . TYR A 1 116 ? -1.996  21.410  -6.832  1.00 30.23 ? 114  TYR A CB  1 
ATOM   931  C  CG  . TYR A 1 116 ? -0.844  21.460  -5.840  1.00 28.43 ? 114  TYR A CG  1 
ATOM   932  C  CD1 . TYR A 1 116 ? -1.071  21.437  -4.465  1.00 30.11 ? 114  TYR A CD1 1 
ATOM   933  C  CD2 . TYR A 1 116 ? 0.471   21.577  -6.282  1.00 30.26 ? 114  TYR A CD2 1 
ATOM   934  C  CE1 . TYR A 1 116 ? -0.009  21.522  -3.554  1.00 29.90 ? 114  TYR A CE1 1 
ATOM   935  C  CE2 . TYR A 1 116 ? 1.534   21.666  -5.385  1.00 29.13 ? 114  TYR A CE2 1 
ATOM   936  C  CZ  . TYR A 1 116 ? 1.285   21.642  -4.030  1.00 28.87 ? 114  TYR A CZ  1 
ATOM   937  O  OH  . TYR A 1 116 ? 2.337   21.788  -3.160  1.00 32.15 ? 114  TYR A OH  1 
ATOM   938  N  N   . THR A 1 117 ? -1.806  24.218  -8.377  1.00 29.67 ? 115  THR A N   1 
ATOM   939  C  CA  . THR A 1 117 ? -1.001  25.389  -8.713  1.00 31.76 ? 115  THR A CA  1 
ATOM   940  C  C   . THR A 1 117 ? -1.657  26.671  -8.181  1.00 29.03 ? 115  THR A C   1 
ATOM   941  O  O   . THR A 1 117 ? -0.989  27.568  -7.661  1.00 29.28 ? 115  THR A O   1 
ATOM   942  C  CB  . THR A 1 117 ? -0.787  25.473  -10.233 1.00 33.04 ? 115  THR A CB  1 
ATOM   943  O  OG1 . THR A 1 117 ? -1.923  24.905  -10.885 1.00 36.84 ? 115  THR A OG1 1 
ATOM   944  C  CG2 . THR A 1 117 ? 0.436   24.690  -10.645 1.00 34.13 ? 115  THR A CG2 1 
ATOM   945  N  N   . GLN A 1 118 ? -2.983  26.703  -8.213  1.00 28.94 ? 116  GLN A N   1 
ATOM   946  C  CA  . GLN A 1 118 ? -3.739  27.847  -7.734  1.00 28.27 ? 116  GLN A CA  1 
ATOM   947  C  C   . GLN A 1 118 ? -3.680  27.884  -6.228  1.00 29.36 ? 116  GLN A C   1 
ATOM   948  O  O   . GLN A 1 118 ? -3.520  28.956  -5.654  1.00 30.96 ? 116  GLN A O   1 
ATOM   949  C  CB  . GLN A 1 118 ? -5.193  27.800  -8.205  1.00 27.48 ? 116  GLN A CB  1 
ATOM   950  C  CG  . GLN A 1 118 ? -6.009  29.059  -7.844  1.00 27.55 ? 116  GLN A CG  1 
ATOM   951  C  CD  . GLN A 1 118 ? -5.452  30.322  -8.515  1.00 27.10 ? 116  GLN A CD  1 
ATOM   952  O  OE1 . GLN A 1 118 ? -5.703  30.547  -9.690  1.00 27.02 ? 116  GLN A OE1 1 
ATOM   953  N  NE2 . GLN A 1 118 ? -4.659  31.099  -7.795  1.00 24.74 ? 116  GLN A NE2 1 
ATOM   954  N  N   . ALA A 1 119 ? -3.760  26.721  -5.575  1.00 27.65 ? 117  ALA A N   1 
ATOM   955  C  CA  . ALA A 1 119 ? -3.698  26.696  -4.120  1.00 25.79 ? 117  ALA A CA  1 
ATOM   956  C  C   . ALA A 1 119 ? -2.300  27.061  -3.628  1.00 23.32 ? 117  ALA A C   1 
ATOM   957  O  O   . ALA A 1 119 ? -2.128  27.750  -2.612  1.00 19.49 ? 117  ALA A O   1 
ATOM   958  C  CB  . ALA A 1 119 ? -4.122  25.340  -3.580  1.00 23.88 ? 117  ALA A CB  1 
ATOM   959  N  N   . ALA A 1 120 ? -1.303  26.628  -4.381  1.00 24.37 ? 118  ALA A N   1 
ATOM   960  C  CA  . ALA A 1 120 ? 0.098   26.874  -4.076  1.00 24.83 ? 118  ALA A CA  1 
ATOM   961  C  C   . ALA A 1 120 ? 0.401   28.380  -4.154  1.00 25.06 ? 118  ALA A C   1 
ATOM   962  O  O   . ALA A 1 120 ? 1.198   28.920  -3.382  1.00 25.41 ? 118  ALA A O   1 
ATOM   963  C  CB  . ALA A 1 120 ? 0.959   26.133  -5.123  1.00 24.42 ? 118  ALA A CB  1 
ATOM   964  N  N   . ASN A 1 121 ? -0.177  29.029  -5.145  1.00 23.70 ? 119  ASN A N   1 
ATOM   965  C  CA  . ASN A 1 121 ? 0.034   30.454  -5.342  1.00 25.55 ? 119  ASN A CA  1 
ATOM   966  C  C   . ASN A 1 121 ? -0.807  31.282  -4.378  1.00 25.32 ? 119  ASN A C   1 
ATOM   967  O  O   . ASN A 1 121 ? -0.373  32.337  -3.955  1.00 25.79 ? 119  ASN A O   1 
ATOM   968  C  CB  . ASN A 1 121 ? -0.221  30.857  -6.790  1.00 24.92 ? 119  ASN A CB  1 
ATOM   969  C  CG  . ASN A 1 121 ? 0.972   30.551  -7.693  1.00 28.36 ? 119  ASN A CG  1 
ATOM   970  O  OD1 . ASN A 1 121 ? 1.936   31.322  -7.755  1.00 29.17 ? 119  ASN A OD1 1 
ATOM   971  N  ND2 . ASN A 1 121 ? 0.916   29.418  -8.392  1.00 28.26 ? 119  ASN A ND2 1 
ATOM   972  N  N   . ASN A 1 122 ? -1.943  30.751  -3.926  1.00 24.87 ? 120  ASN A N   1 
ATOM   973  C  CA  . ASN A 1 122 ? -2.810  31.494  -3.006  1.00 22.98 ? 120  ASN A CA  1 
ATOM   974  C  C   . ASN A 1 122 ? -2.164  31.673  -1.667  1.00 24.02 ? 120  ASN A C   1 
ATOM   975  O  O   . ASN A 1 122 ? -2.556  32.539  -0.870  1.00 22.42 ? 120  ASN A O   1 
ATOM   976  C  CB  . ASN A 1 122 ? -4.151  30.808  -2.837  1.00 23.27 ? 120  ASN A CB  1 
ATOM   977  C  CG  . ASN A 1 122 ? -5.048  30.993  -4.028  1.00 23.28 ? 120  ASN A CG  1 
ATOM   978  O  OD1 . ASN A 1 122 ? -4.742  31.767  -4.956  1.00 21.47 ? 120  ASN A OD1 1 
ATOM   979  N  ND2 . ASN A 1 122 ? -6.150  30.262  -4.041  1.00 21.09 ? 120  ASN A ND2 1 
ATOM   980  N  N   . VAL A 1 123 ? -1.179  30.829  -1.409  1.00 24.54 ? 121  VAL A N   1 
ATOM   981  C  CA  . VAL A 1 123 ? -0.374  30.820  -0.178  1.00 22.88 ? 121  VAL A CA  1 
ATOM   982  C  C   . VAL A 1 123 ? 0.296   32.187  -0.031  1.00 22.61 ? 121  VAL A C   1 
ATOM   983  O  O   . VAL A 1 123 ? 0.427   32.715  1.064   1.00 23.51 ? 121  VAL A O   1 
ATOM   984  C  CB  . VAL A 1 123 ? 0.728   29.728  -0.354  1.00 23.74 ? 121  VAL A CB  1 
ATOM   985  C  CG1 . VAL A 1 123 ? 2.002   30.087  0.344   1.00 20.70 ? 121  VAL A CG1 1 
ATOM   986  C  CG2 . VAL A 1 123 ? 0.196   28.389  0.064   1.00 23.62 ? 121  VAL A CG2 1 
ATOM   987  N  N   . ARG A 1 124 ? 0.727   32.733  -1.167  1.00 24.04 ? 122  ARG A N   1 
ATOM   988  C  CA  . ARG A 1 124 ? 1.405   34.018  -1.204  1.00 24.72 ? 122  ARG A CA  1 
ATOM   989  C  C   . ARG A 1 124 ? 0.585   35.117  -0.537  1.00 23.28 ? 122  ARG A C   1 
ATOM   990  O  O   . ARG A 1 124 ? 1.093   35.849  0.307   1.00 23.15 ? 122  ARG A O   1 
ATOM   991  C  CB  . ARG A 1 124 ? 1.720   34.379  -2.653  1.00 25.37 ? 122  ARG A CB  1 
ATOM   992  C  CG  . ARG A 1 124 ? 2.660   33.393  -3.329  1.00 27.72 ? 122  ARG A CG  1 
ATOM   993  C  CD  . ARG A 1 124 ? 3.392   34.077  -4.468  1.00 29.50 ? 122  ARG A CD  1 
ATOM   994  N  NE  . ARG A 1 124 ? 2.789   33.844  -5.762  1.00 31.28 ? 122  ARG A NE  1 
ATOM   995  C  CZ  . ARG A 1 124 ? 3.008   34.611  -6.834  1.00 32.44 ? 122  ARG A CZ  1 
ATOM   996  N  NH1 . ARG A 1 124 ? 3.777   35.699  -6.740  1.00 30.00 ? 122  ARG A NH1 1 
ATOM   997  N  NH2 . ARG A 1 124 ? 2.422   34.296  -7.991  1.00 31.26 ? 122  ARG A NH2 1 
ATOM   998  N  N   . VAL A 1 125 ? -0.689  35.180  -0.896  1.00 21.70 ? 123  VAL A N   1 
ATOM   999  C  CA  . VAL A 1 125 ? -1.641  36.152  -0.372  1.00 22.04 ? 123  VAL A CA  1 
ATOM   1000 C  C   . VAL A 1 125 ? -1.974  35.915  1.096   1.00 22.82 ? 123  VAL A C   1 
ATOM   1001 O  O   . VAL A 1 125 ? -1.916  36.846  1.933   1.00 24.79 ? 123  VAL A O   1 
ATOM   1002 C  CB  . VAL A 1 125 ? -2.919  36.175  -1.254  1.00 21.53 ? 123  VAL A CB  1 
ATOM   1003 C  CG1 . VAL A 1 125 ? -4.083  36.877  -0.573  1.00 23.19 ? 123  VAL A CG1 1 
ATOM   1004 C  CG2 . VAL A 1 125 ? -2.589  36.917  -2.550  1.00 22.37 ? 123  VAL A CG2 1 
ATOM   1005 N  N   . VAL A 1 126 ? -2.275  34.677  1.453   1.00 22.57 ? 124  VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 126 ? -2.569  34.380  2.851   1.00 22.10 ? 124  VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 126 ? -1.360  34.758  3.730   1.00 20.06 ? 124  VAL A C   1 
ATOM   1008 O  O   . VAL A 1 126 ? -1.534  35.358  4.780   1.00 21.46 ? 124  VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 126 ? -2.971  32.888  3.051   1.00 22.84 ? 124  VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 126 ? -3.425  32.647  4.510   1.00 21.48 ? 124  VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 126 ? -4.084  32.515  2.077   1.00 19.71 ? 124  VAL A CG2 1 
ATOM   1012 N  N   . GLY A 1 127 ? -0.143  34.458  3.265   1.00 21.63 ? 125  GLY A N   1 
ATOM   1013 C  CA  . GLY A 1 127 ? 1.054   34.786  4.041   1.00 19.80 ? 125  GLY A CA  1 
ATOM   1014 C  C   . GLY A 1 127 ? 1.242   36.298  4.186   1.00 20.10 ? 125  GLY A C   1 
ATOM   1015 O  O   . GLY A 1 127 ? 1.711   36.799  5.233   1.00 19.20 ? 125  GLY A O   1 
ATOM   1016 N  N   . ALA A 1 128 ? 0.871   37.035  3.143   1.00 20.06 ? 126  ALA A N   1 
ATOM   1017 C  CA  . ALA A 1 128 ? 0.937   38.505  3.148   1.00 21.51 ? 126  ALA A CA  1 
ATOM   1018 C  C   . ALA A 1 128 ? -0.105  39.065  4.131   1.00 20.66 ? 126  ALA A C   1 
ATOM   1019 O  O   . ALA A 1 128 ? 0.152   40.065  4.811   1.00 22.44 ? 126  ALA A O   1 
ATOM   1020 C  CB  . ALA A 1 128 ? 0.693   39.074  1.727   1.00 18.02 ? 126  ALA A CB  1 
ATOM   1021 N  N   . GLN A 1 129 ? -1.244  38.385  4.276   1.00 22.07 ? 127  GLN A N   1 
ATOM   1022 C  CA  . GLN A 1 129 ? -2.283  38.825  5.214   1.00 21.50 ? 127  GLN A CA  1 
ATOM   1023 C  C   . GLN A 1 129 ? -1.893  38.556  6.655   1.00 22.36 ? 127  GLN A C   1 
ATOM   1024 O  O   . GLN A 1 129 ? -2.307  39.296  7.579   1.00 20.52 ? 127  GLN A O   1 
ATOM   1025 C  CB  . GLN A 1 129 ? -3.631  38.172  4.888   1.00 23.61 ? 127  GLN A CB  1 
ATOM   1026 C  CG  . GLN A 1 129 ? -4.154  38.487  3.495   1.00 24.31 ? 127  GLN A CG  1 
ATOM   1027 C  CD  . GLN A 1 129 ? -5.465  37.793  3.235   1.00 28.20 ? 127  GLN A CD  1 
ATOM   1028 O  OE1 . GLN A 1 129 ? -5.521  36.563  3.150   1.00 27.32 ? 127  GLN A OE1 1 
ATOM   1029 N  NE2 . GLN A 1 129 ? -6.537  38.563  3.150   1.00 27.18 ? 127  GLN A NE2 1 
ATOM   1030 N  N   . VAL A 1 130 ? -1.165  37.450  6.862   1.00 22.11 ? 128  VAL A N   1 
ATOM   1031 C  CA  . VAL A 1 130 ? -0.663  37.092  8.186   1.00 20.29 ? 128  VAL A CA  1 
ATOM   1032 C  C   . VAL A 1 130 ? 0.431   38.124  8.527   1.00 20.11 ? 128  VAL A C   1 
ATOM   1033 O  O   . VAL A 1 130 ? 0.501   38.601  9.644   1.00 20.41 ? 128  VAL A O   1 
ATOM   1034 C  CB  . VAL A 1 130 ? -0.081  35.618  8.231   1.00 21.85 ? 128  VAL A CB  1 
ATOM   1035 C  CG1 . VAL A 1 130 ? 0.678   35.372  9.550   1.00 19.82 ? 128  VAL A CG1 1 
ATOM   1036 C  CG2 . VAL A 1 130 ? -1.223  34.544  8.066   1.00 18.66 ? 128  VAL A CG2 1 
ATOM   1037 N  N   . ALA A 1 131 ? 1.301   38.465  7.573   1.00 19.44 ? 129  ALA A N   1 
ATOM   1038 C  CA  . ALA A 1 131 ? 2.326   39.484  7.829   1.00 21.91 ? 129  ALA A CA  1 
ATOM   1039 C  C   . ALA A 1 131 ? 1.648   40.830  8.116   1.00 23.81 ? 129  ALA A C   1 
ATOM   1040 O  O   . ALA A 1 131 ? 2.133   41.612  8.921   1.00 24.37 ? 129  ALA A O   1 
ATOM   1041 C  CB  . ALA A 1 131 ? 3.281   39.604  6.676   1.00 18.58 ? 129  ALA A CB  1 
ATOM   1042 N  N   . GLN A 1 132 ? 0.501   41.064  7.481   1.00 24.96 ? 130  GLN A N   1 
ATOM   1043 C  CA  . GLN A 1 132 ? -0.268  42.288  7.652   1.00 28.14 ? 130  GLN A CA  1 
ATOM   1044 C  C   . GLN A 1 132 ? -0.785  42.351  9.083   1.00 29.15 ? 130  GLN A C   1 
ATOM   1045 O  O   . GLN A 1 132 ? -0.653  43.381  9.750   1.00 30.44 ? 130  GLN A O   1 
ATOM   1046 C  CB  . GLN A 1 132 ? -1.429  42.379  6.649   1.00 28.18 ? 130  GLN A CB  1 
ATOM   1047 C  CG  . GLN A 1 132 ? -2.198  43.694  6.747   1.00 30.77 ? 130  GLN A CG  1 
ATOM   1048 C  CD  . GLN A 1 132 ? -3.443  43.762  5.920   1.00 30.21 ? 130  GLN A CD  1 
ATOM   1049 O  OE1 . GLN A 1 132 ? -3.867  42.795  5.292   1.00 32.69 ? 130  GLN A OE1 1 
ATOM   1050 N  NE2 . GLN A 1 132 ? -4.080  44.914  5.956   1.00 33.39 ? 130  GLN A NE2 1 
ATOM   1051 N  N   . MET A 1 133 ? -1.337  41.248  9.574   1.00 29.03 ? 131  MET A N   1 
ATOM   1052 C  CA  . MET A 1 133 ? -1.813  41.177  10.949  1.00 28.41 ? 131  MET A CA  1 
ATOM   1053 C  C   . MET A 1 133 ? -0.664  41.472  11.906  1.00 28.09 ? 131  MET A C   1 
ATOM   1054 O  O   . MET A 1 133 ? -0.847  42.187  12.901  1.00 27.67 ? 131  MET A O   1 
ATOM   1055 C  CB  . MET A 1 133 ? -2.382  39.794  11.259  1.00 29.11 ? 131  MET A CB  1 
ATOM   1056 C  CG  . MET A 1 133 ? -2.858  39.619  12.690  1.00 26.17 ? 131  MET A CG  1 
ATOM   1057 S  SD  . MET A 1 133 ? -4.350  40.585  13.025  1.00 26.83 ? 131  MET A SD  1 
ATOM   1058 C  CE  . MET A 1 133 ? -5.575  39.506  12.440  1.00 20.82 ? 131  MET A CE  1 
ATOM   1059 N  N   . LEU A 1 134 ? 0.503   40.888  11.630  1.00 27.04 ? 132  LEU A N   1 
ATOM   1060 C  CA  . LEU A 1 134 ? 1.703   41.086  12.442  1.00 27.68 ? 132  LEU A CA  1 
ATOM   1061 C  C   . LEU A 1 134 ? 2.238   42.544  12.405  1.00 28.82 ? 132  LEU A C   1 
ATOM   1062 O  O   . LEU A 1 134 ? 2.656   43.084  13.435  1.00 27.03 ? 132  LEU A O   1 
ATOM   1063 C  CB  . LEU A 1 134 ? 2.817   40.082  12.030  1.00 25.87 ? 132  LEU A CB  1 
ATOM   1064 C  CG  . LEU A 1 134 ? 2.527   38.582  12.346  1.00 25.70 ? 132  LEU A CG  1 
ATOM   1065 C  CD1 . LEU A 1 134 ? 3.593   37.669  11.779  1.00 25.13 ? 132  LEU A CD1 1 
ATOM   1066 C  CD2 . LEU A 1 134 ? 2.453   38.391  13.849  1.00 25.49 ? 132  LEU A CD2 1 
ATOM   1067 N  N   . SER A 1 135 ? 2.238   43.183  11.234  1.00 30.10 ? 133  SER A N   1 
ATOM   1068 C  CA  . SER A 1 135 ? 2.717   44.572  11.153  1.00 32.34 ? 133  SER A CA  1 
ATOM   1069 C  C   . SER A 1 135 ? 1.736   45.478  11.897  1.00 32.12 ? 133  SER A C   1 
ATOM   1070 O  O   . SER A 1 135 ? 2.147   46.416  12.536  1.00 31.57 ? 133  SER A O   1 
ATOM   1071 C  CB  . SER A 1 135 ? 2.928   45.033  9.712   1.00 31.58 ? 133  SER A CB  1 
ATOM   1072 O  OG  . SER A 1 135 ? 1.781   44.789  8.930   1.00 35.40 ? 133  SER A OG  1 
ATOM   1073 N  N   . MET A 1 136 ? 0.449   45.147  11.858  1.00 32.80 ? 134  MET A N   1 
ATOM   1074 C  CA  . MET A 1 136 ? -0.545  45.923  12.574  1.00 33.38 ? 134  MET A CA  1 
ATOM   1075 C  C   . MET A 1 136 ? -0.373  45.800  14.097  1.00 34.45 ? 134  MET A C   1 
ATOM   1076 O  O   . MET A 1 136 ? -0.529  46.789  14.811  1.00 33.53 ? 134  MET A O   1 
ATOM   1077 C  CB  . MET A 1 136 ? -1.957  45.515  12.179  1.00 33.40 ? 134  MET A CB  1 
ATOM   1078 C  CG  . MET A 1 136 ? -3.050  46.323  12.883  1.00 34.18 ? 134  MET A CG  1 
ATOM   1079 S  SD  . MET A 1 136 ? -4.021  45.451  14.151  1.00 37.33 ? 134  MET A SD  1 
ATOM   1080 C  CE  . MET A 1 136 ? -3.133  45.605  15.497  1.00 32.80 ? 134  MET A CE  1 
ATOM   1081 N  N   . LEU A 1 137 ? -0.152  44.583  14.608  1.00 33.57 ? 135  LEU A N   1 
ATOM   1082 C  CA  . LEU A 1 137 ? 0.044   44.377  16.047  1.00 34.35 ? 135  LEU A CA  1 
ATOM   1083 C  C   . LEU A 1 137 ? 1.262   45.158  16.488  1.00 34.48 ? 135  LEU A C   1 
ATOM   1084 O  O   . LEU A 1 137 ? 1.245   45.846  17.502  1.00 35.24 ? 135  LEU A O   1 
ATOM   1085 C  CB  . LEU A 1 137 ? 0.231   42.889  16.382  1.00 34.69 ? 135  LEU A CB  1 
ATOM   1086 C  CG  . LEU A 1 137 ? -0.970  41.959  16.198  1.00 35.08 ? 135  LEU A CG  1 
ATOM   1087 C  CD1 . LEU A 1 137 ? -0.552  40.523  16.339  1.00 34.45 ? 135  LEU A CD1 1 
ATOM   1088 C  CD2 . LEU A 1 137 ? -2.065  42.316  17.199  1.00 34.17 ? 135  LEU A CD2 1 
ATOM   1089 N  N   . SER A 1 138 ? 2.331   45.025  15.719  1.00 35.88 ? 136  SER A N   1 
ATOM   1090 C  CA  . SER A 1 138 ? 3.572   45.733  15.977  1.00 38.15 ? 136  SER A CA  1 
ATOM   1091 C  C   . SER A 1 138 ? 3.301   47.253  16.017  1.00 40.17 ? 136  SER A C   1 
ATOM   1092 O  O   . SER A 1 138 ? 3.486   47.893  17.046  1.00 40.53 ? 136  SER A O   1 
ATOM   1093 C  CB  . SER A 1 138 ? 4.578   45.403  14.869  1.00 37.60 ? 136  SER A CB  1 
ATOM   1094 O  OG  . SER A 1 138 ? 5.737   46.202  14.954  1.00 34.93 ? 136  SER A OG  1 
ATOM   1095 N  N   . ALA A 1 139 ? 2.749   47.778  14.926  1.00 40.42 ? 137  ALA A N   1 
ATOM   1096 C  CA  . ALA A 1 139 ? 2.445   49.198  14.794  1.00 40.65 ? 137  ALA A CA  1 
ATOM   1097 C  C   . ALA A 1 139 ? 1.470   49.786  15.822  1.00 40.52 ? 137  ALA A C   1 
ATOM   1098 O  O   . ALA A 1 139 ? 1.858   50.652  16.619  1.00 40.98 ? 137  ALA A O   1 
ATOM   1099 C  CB  . ALA A 1 139 ? 1.959   49.501  13.362  1.00 40.30 ? 137  ALA A CB  1 
ATOM   1100 N  N   . ASN A 1 140 ? 0.236   49.291  15.851  1.00 39.75 ? 138  ASN A N   1 
ATOM   1101 C  CA  . ASN A 1 140 ? -0.779  49.827  16.761  1.00 38.83 ? 138  ASN A CA  1 
ATOM   1102 C  C   . ASN A 1 140 ? -0.801  49.350  18.221  1.00 38.45 ? 138  ASN A C   1 
ATOM   1103 O  O   . ASN A 1 140 ? -1.483  49.957  19.044  1.00 36.96 ? 138  ASN A O   1 
ATOM   1104 C  CB  . ASN A 1 140 ? -2.185  49.696  16.145  1.00 41.73 ? 138  ASN A CB  1 
ATOM   1105 C  CG  . ASN A 1 140 ? -2.271  50.295  14.744  1.00 43.69 ? 138  ASN A CG  1 
ATOM   1106 O  OD1 . ASN A 1 140 ? -2.533  49.564  13.794  1.00 45.91 ? 138  ASN A OD1 1 
ATOM   1107 N  ND2 . ASN A 1 140 ? -2.101  51.613  14.612  1.00 43.71 ? 138  ASN A ND2 1 
ATOM   1108 N  N   . TYR A 1 141 ? -0.055  48.295  18.555  1.00 36.86 ? 139  TYR A N   1 
ATOM   1109 C  CA  . TYR A 1 141 ? -0.038  47.782  19.929  1.00 34.84 ? 139  TYR A CA  1 
ATOM   1110 C  C   . TYR A 1 141 ? 1.350   47.490  20.448  1.00 35.26 ? 139  TYR A C   1 
ATOM   1111 O  O   . TYR A 1 141 ? 1.497   46.871  21.502  1.00 35.22 ? 139  TYR A O   1 
ATOM   1112 C  CB  . TYR A 1 141 ? -0.895  46.515  20.069  1.00 34.29 ? 139  TYR A CB  1 
ATOM   1113 C  CG  . TYR A 1 141 ? -2.382  46.736  19.903  1.00 30.93 ? 139  TYR A CG  1 
ATOM   1114 C  CD1 . TYR A 1 141 ? -3.163  47.184  20.977  1.00 32.00 ? 139  TYR A CD1 1 
ATOM   1115 C  CD2 . TYR A 1 141 ? -3.003  46.554  18.672  1.00 30.65 ? 139  TYR A CD2 1 
ATOM   1116 C  CE1 . TYR A 1 141 ? -4.527  47.441  20.824  1.00 30.54 ? 139  TYR A CE1 1 
ATOM   1117 C  CE2 . TYR A 1 141 ? -4.376  46.819  18.508  1.00 28.47 ? 139  TYR A CE2 1 
ATOM   1118 C  CZ  . TYR A 1 141 ? -5.126  47.265  19.577  1.00 30.55 ? 139  TYR A CZ  1 
ATOM   1119 O  OH  . TYR A 1 141 ? -6.480  47.565  19.411  1.00 30.21 ? 139  TYR A OH  1 
ATOM   1120 N  N   . SER A 1 142 ? 2.374   47.934  19.726  1.00 34.75 ? 140  SER A N   1 
ATOM   1121 C  CA  . SER A 1 142 ? 3.763   47.702  20.133  1.00 37.35 ? 140  SER A CA  1 
ATOM   1122 C  C   . SER A 1 142 ? 4.054   46.249  20.584  1.00 37.41 ? 140  SER A C   1 
ATOM   1123 O  O   . SER A 1 142 ? 4.873   46.018  21.486  1.00 36.87 ? 140  SER A O   1 
ATOM   1124 C  CB  . SER A 1 142 ? 4.149   48.691  21.247  1.00 39.64 ? 140  SER A CB  1 
ATOM   1125 O  OG  . SER A 1 142 ? 3.993   50.033  20.813  1.00 40.65 ? 140  SER A OG  1 
ATOM   1126 N  N   . TYR A 1 143 ? 3.407   45.284  19.909  1.00 36.90 ? 141  TYR A N   1 
ATOM   1127 C  CA  . TYR A 1 143 ? 3.534   43.844  20.184  1.00 35.05 ? 141  TYR A CA  1 
ATOM   1128 C  C   . TYR A 1 143 ? 4.522   43.282  19.164  1.00 34.28 ? 141  TYR A C   1 
ATOM   1129 O  O   . TYR A 1 143 ? 4.198   43.156  17.980  1.00 32.67 ? 141  TYR A O   1 
ATOM   1130 C  CB  . TYR A 1 143 ? 2.163   43.161  20.033  1.00 34.77 ? 141  TYR A CB  1 
ATOM   1131 C  CG  . TYR A 1 143 ? 2.132   41.710  20.465  1.00 33.96 ? 141  TYR A CG  1 
ATOM   1132 C  CD1 . TYR A 1 143 ? 1.963   41.370  21.804  1.00 33.15 ? 141  TYR A CD1 1 
ATOM   1133 C  CD2 . TYR A 1 143 ? 2.295   40.680  19.540  1.00 34.75 ? 141  TYR A CD2 1 
ATOM   1134 C  CE1 . TYR A 1 143 ? 1.962   40.044  22.218  1.00 34.04 ? 141  TYR A CE1 1 
ATOM   1135 C  CE2 . TYR A 1 143 ? 2.292   39.341  19.947  1.00 35.18 ? 141  TYR A CE2 1 
ATOM   1136 C  CZ  . TYR A 1 143 ? 2.122   39.035  21.290  1.00 34.46 ? 141  TYR A CZ  1 
ATOM   1137 O  OH  . TYR A 1 143 ? 2.125   37.718  21.696  1.00 34.40 ? 141  TYR A OH  1 
ATOM   1138 N  N   . SER A 1 144 ? 5.710   42.940  19.636  1.00 34.16 ? 142  SER A N   1 
ATOM   1139 C  CA  . SER A 1 144 ? 6.790   42.440  18.777  1.00 33.81 ? 142  SER A CA  1 
ATOM   1140 C  C   . SER A 1 144 ? 6.534   41.030  18.239  1.00 32.32 ? 142  SER A C   1 
ATOM   1141 O  O   . SER A 1 144 ? 5.958   40.185  18.929  1.00 30.54 ? 142  SER A O   1 
ATOM   1142 C  CB  . SER A 1 144 ? 8.120   42.458  19.543  1.00 34.10 ? 142  SER A CB  1 
ATOM   1143 O  OG  . SER A 1 144 ? 9.212   42.033  18.713  1.00 34.42 ? 142  SER A OG  1 
ATOM   1144 N  N   . PRO A 1 145 ? 6.925   40.781  16.982  1.00 32.02 ? 143  PRO A N   1 
ATOM   1145 C  CA  . PRO A 1 145 ? 6.756   39.475  16.326  1.00 31.80 ? 143  PRO A CA  1 
ATOM   1146 C  C   . PRO A 1 145 ? 7.646   38.385  16.959  1.00 31.07 ? 143  PRO A C   1 
ATOM   1147 O  O   . PRO A 1 145 ? 7.499   37.203  16.655  1.00 32.47 ? 143  PRO A O   1 
ATOM   1148 C  CB  . PRO A 1 145 ? 7.134   39.770  14.865  1.00 29.90 ? 143  PRO A CB  1 
ATOM   1149 C  CG  . PRO A 1 145 ? 8.066   40.912  14.975  1.00 30.78 ? 143  PRO A CG  1 
ATOM   1150 C  CD  . PRO A 1 145 ? 7.397   41.786  16.013  1.00 30.20 ? 143  PRO A CD  1 
ATOM   1151 N  N   . SER A 1 146 ? 8.557   38.792  17.845  1.00 31.32 ? 144  SER A N   1 
ATOM   1152 C  CA  . SER A 1 146 ? 9.428   37.861  18.542  1.00 30.93 ? 144  SER A CA  1 
ATOM   1153 C  C   . SER A 1 146 ? 8.569   37.040  19.533  1.00 32.17 ? 144  SER A C   1 
ATOM   1154 O  O   . SER A 1 146 ? 8.965   35.948  19.953  1.00 30.93 ? 144  SER A O   1 
ATOM   1155 C  CB  . SER A 1 146 ? 10.490  38.628  19.315  1.00 31.55 ? 144  SER A CB  1 
ATOM   1156 O  OG  . SER A 1 146 ? 9.902   39.433  20.322  1.00 31.70 ? 144  SER A OG  1 
ATOM   1157 N  N   . GLN A 1 147 ? 7.378   37.559  19.842  1.00 32.17 ? 145  GLN A N   1 
ATOM   1158 C  CA  . GLN A 1 147 ? 6.418   36.950  20.781  1.00 31.72 ? 145  GLN A CA  1 
ATOM   1159 C  C   . GLN A 1 147 ? 5.416   36.088  20.052  1.00 29.71 ? 145  GLN A C   1 
ATOM   1160 O  O   . GLN A 1 147 ? 4.393   35.695  20.621  1.00 30.35 ? 145  GLN A O   1 
ATOM   1161 C  CB  . GLN A 1 147 ? 5.605   38.055  21.481  1.00 33.54 ? 145  GLN A CB  1 
ATOM   1162 C  CG  . GLN A 1 147 ? 6.407   39.062  22.255  1.00 36.47 ? 145  GLN A CG  1 
ATOM   1163 C  CD  . GLN A 1 147 ? 7.015   38.454  23.500  1.00 38.24 ? 145  GLN A CD  1 
ATOM   1164 O  OE1 . GLN A 1 147 ? 6.297   38.147  24.462  1.00 40.45 ? 145  GLN A OE1 1 
ATOM   1165 N  NE2 . GLN A 1 147 ? 8.338   38.241  23.481  1.00 37.71 ? 145  GLN A NE2 1 
ATOM   1166 N  N   . VAL A 1 148 ? 5.700   35.802  18.787  1.00 30.25 ? 146  VAL A N   1 
ATOM   1167 C  CA  . VAL A 1 148 ? 4.791   35.035  17.961  1.00 25.83 ? 146  VAL A CA  1 
ATOM   1168 C  C   . VAL A 1 148 ? 5.393   33.786  17.315  1.00 26.54 ? 146  VAL A C   1 
ATOM   1169 O  O   . VAL A 1 148 ? 6.568   33.755  16.935  1.00 24.37 ? 146  VAL A O   1 
ATOM   1170 C  CB  . VAL A 1 148 ? 4.240   35.939  16.800  1.00 26.98 ? 146  VAL A CB  1 
ATOM   1171 C  CG1 . VAL A 1 148 ? 3.385   35.124  15.832  1.00 22.34 ? 146  VAL A CG1 1 
ATOM   1172 C  CG2 . VAL A 1 148 ? 3.447   37.125  17.378  1.00 24.73 ? 146  VAL A CG2 1 
ATOM   1173 N  N   . GLN A 1 149 ? 4.567   32.744  17.236  1.00 24.64 ? 147  GLN A N   1 
ATOM   1174 C  CA  . GLN A 1 149 ? 4.936   31.501  16.579  1.00 23.44 ? 147  GLN A CA  1 
ATOM   1175 C  C   . GLN A 1 149 ? 3.870   31.292  15.518  1.00 21.37 ? 147  GLN A C   1 
ATOM   1176 O  O   . GLN A 1 149 ? 2.701   31.583  15.742  1.00 19.84 ? 147  GLN A O   1 
ATOM   1177 C  CB  . GLN A 1 149 ? 4.899   30.295  17.557  1.00 23.10 ? 147  GLN A CB  1 
ATOM   1178 C  CG  . GLN A 1 149 ? 5.064   28.951  16.823  1.00 23.23 ? 147  GLN A CG  1 
ATOM   1179 C  CD  . GLN A 1 149 ? 4.796   27.721  17.684  1.00 20.43 ? 147  GLN A CD  1 
ATOM   1180 O  OE1 . GLN A 1 149 ? 5.342   26.664  17.436  1.00 25.57 ? 147  GLN A OE1 1 
ATOM   1181 N  NE2 . GLN A 1 149 ? 3.946   27.852  18.665  1.00 18.83 ? 147  GLN A NE2 1 
ATOM   1182 N  N   . LEU A 1 150 ? 4.286   30.838  14.348  1.00 20.59 ? 148  LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 150 ? 3.350   30.531  13.279  1.00 21.27 ? 148  LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 150 ? 3.505   29.010  13.099  1.00 23.42 ? 148  LEU A C   1 
ATOM   1185 O  O   . LEU A 1 150 ? 4.620   28.515  12.930  1.00 21.33 ? 148  LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 150 ? 3.735   31.243  11.969  1.00 20.16 ? 148  LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 150 ? 3.869   32.769  11.988  1.00 21.16 ? 148  LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 150 ? 4.130   33.296  10.561  1.00 21.39 ? 148  LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 150 ? 2.605   33.418  12.557  1.00 19.94 ? 148  LEU A CD2 1 
ATOM   1190 N  N   . ILE A 1 151 ? 2.405   28.280  13.261  1.00 23.41 ? 149  ILE A N   1 
ATOM   1191 C  CA  . ILE A 1 151 ? 2.404   26.836  13.077  1.00 24.55 ? 149  ILE A CA  1 
ATOM   1192 C  C   . ILE A 1 151 ? 1.713   26.597  11.755  1.00 21.93 ? 149  ILE A C   1 
ATOM   1193 O  O   . ILE A 1 151 ? 0.559   26.930  11.596  1.00 23.75 ? 149  ILE A O   1 
ATOM   1194 C  CB  . ILE A 1 151 ? 1.619   26.104  14.193  1.00 23.50 ? 149  ILE A CB  1 
ATOM   1195 C  CG1 . ILE A 1 151 ? 2.351   26.283  15.514  1.00 22.30 ? 149  ILE A CG1 1 
ATOM   1196 C  CG2 . ILE A 1 151 ? 1.506   24.602  13.857  1.00 21.55 ? 149  ILE A CG2 1 
ATOM   1197 C  CD1 . ILE A 1 151 ? 1.444   26.160  16.715  1.00 20.27 ? 149  ILE A CD1 1 
ATOM   1198 N  N   . GLY A 1 152 ? 2.444   26.115  10.777  1.00 23.63 ? 150  GLY A N   1 
ATOM   1199 C  CA  . GLY A 1 152 ? 1.812   25.924  9.498   1.00 22.63 ? 150  GLY A CA  1 
ATOM   1200 C  C   . GLY A 1 152 ? 1.886   24.475  9.098   1.00 23.98 ? 150  GLY A C   1 
ATOM   1201 O  O   . GLY A 1 152 ? 2.967   23.918  9.087   1.00 21.45 ? 150  GLY A O   1 
ATOM   1202 N  N   . HIS A 1 153 ? 0.739   23.858  8.821   1.00 24.55 ? 151  HIS A N   1 
ATOM   1203 C  CA  . HIS A 1 153 ? 0.680   22.462  8.403   1.00 23.18 ? 151  HIS A CA  1 
ATOM   1204 C  C   . HIS A 1 153 ? 0.500   22.384  6.899   1.00 23.50 ? 151  HIS A C   1 
ATOM   1205 O  O   . HIS A 1 153 ? -0.297  23.153  6.335   1.00 22.77 ? 151  HIS A O   1 
ATOM   1206 C  CB  . HIS A 1 153 ? -0.514  21.745  9.067   1.00 23.44 ? 151  HIS A CB  1 
ATOM   1207 C  CG  . HIS A 1 153 ? -0.757  20.363  8.523   1.00 24.39 ? 151  HIS A CG  1 
ATOM   1208 N  ND1 . HIS A 1 153 ? -1.888  20.033  7.800   1.00 24.33 ? 151  HIS A ND1 1 
ATOM   1209 C  CD2 . HIS A 1 153 ? 0.027   19.260  8.513   1.00 25.30 ? 151  HIS A CD2 1 
ATOM   1210 C  CE1 . HIS A 1 153 ? -1.776  18.796  7.362   1.00 24.31 ? 151  HIS A CE1 1 
ATOM   1211 N  NE2 . HIS A 1 153 ? -0.630  18.298  7.775   1.00 26.11 ? 151  HIS A NE2 1 
ATOM   1212 N  N   . SER A 1 154 ? 1.283   21.536  6.228   1.00 20.69 ? 152  SER A N   1 
ATOM   1213 C  CA  . SER A 1 154 ? 1.078   21.349  4.793   1.00 20.04 ? 152  SER A CA  1 
ATOM   1214 C  C   . SER A 1 154 ? 1.367   22.654  4.004   1.00 22.05 ? 152  SER A C   1 
ATOM   1215 O  O   . SER A 1 154 ? 2.451   23.246  4.108   1.00 21.35 ? 152  SER A O   1 
ATOM   1216 C  CB  . SER A 1 154 ? -0.385  20.888  4.647   1.00 19.83 ? 152  SER A CB  1 
ATOM   1217 O  OG  . SER A 1 154 ? -0.755  20.520  3.338   1.00 24.39 ? 152  SER A OG  1 
ATOM   1218 N  N   . LEU A 1 155 ? 0.441   23.039  3.135   1.00 23.04 ? 153  LEU A N   1 
ATOM   1219 C  CA  . LEU A 1 155 ? 0.565   24.285  2.369   1.00 24.52 ? 153  LEU A CA  1 
ATOM   1220 C  C   . LEU A 1 155 ? 0.703   25.472  3.390   1.00 23.19 ? 153  LEU A C   1 
ATOM   1221 O  O   . LEU A 1 155 ? 1.447   26.430  3.166   1.00 23.02 ? 153  LEU A O   1 
ATOM   1222 C  CB  . LEU A 1 155 ? -0.667  24.417  1.471   1.00 23.78 ? 153  LEU A CB  1 
ATOM   1223 C  CG  . LEU A 1 155 ? -0.717  24.753  -0.023  1.00 25.56 ? 153  LEU A CG  1 
ATOM   1224 C  CD1 . LEU A 1 155 ? 0.523   24.376  -0.805  1.00 21.92 ? 153  LEU A CD1 1 
ATOM   1225 C  CD2 . LEU A 1 155 ? -2.009  24.118  -0.656  1.00 25.11 ? 153  LEU A CD2 1 
ATOM   1226 N  N   . GLY A 1 156 ? 0.053   25.334  4.541   1.00 23.15 ? 154  GLY A N   1 
ATOM   1227 C  CA  . GLY A 1 156 ? 0.133   26.343  5.591   1.00 21.39 ? 154  GLY A CA  1 
ATOM   1228 C  C   . GLY A 1 156 ? 1.555   26.623  6.057   1.00 22.98 ? 154  GLY A C   1 
ATOM   1229 O  O   . GLY A 1 156 ? 1.864   27.726  6.542   1.00 21.84 ? 154  GLY A O   1 
ATOM   1230 N  N   . ALA A 1 157 ? 2.448   25.637  5.892   1.00 21.50 ? 155  ALA A N   1 
ATOM   1231 C  CA  . ALA A 1 157 ? 3.851   25.819  6.275   1.00 21.95 ? 155  ALA A CA  1 
ATOM   1232 C  C   . ALA A 1 157 ? 4.500   26.885  5.377   1.00 21.85 ? 155  ALA A C   1 
ATOM   1233 O  O   . ALA A 1 157 ? 5.402   27.620  5.798   1.00 19.53 ? 155  ALA A O   1 
ATOM   1234 C  CB  . ALA A 1 157 ? 4.615   24.517  6.130   1.00 24.37 ? 155  ALA A CB  1 
ATOM   1235 N  N   . HIS A 1 158 ? 4.080   26.924  4.124   1.00 20.80 ? 156  HIS A N   1 
ATOM   1236 C  CA  . HIS A 1 158 ? 4.631   27.900  3.192   1.00 22.28 ? 156  HIS A CA  1 
ATOM   1237 C  C   . HIS A 1 158 ? 3.931   29.264  3.363   1.00 22.36 ? 156  HIS A C   1 
ATOM   1238 O  O   . HIS A 1 158 ? 4.536   30.298  3.114   1.00 24.14 ? 156  HIS A O   1 
ATOM   1239 C  CB  . HIS A 1 158 ? 4.575   27.353  1.774   1.00 20.76 ? 156  HIS A CB  1 
ATOM   1240 C  CG  . HIS A 1 158 ? 5.347   26.088  1.612   1.00 20.65 ? 156  HIS A CG  1 
ATOM   1241 N  ND1 . HIS A 1 158 ? 6.693   25.989  1.897   1.00 18.67 ? 156  HIS A ND1 1 
ATOM   1242 C  CD2 . HIS A 1 158 ? 4.961   24.833  1.242   1.00 21.29 ? 156  HIS A CD2 1 
ATOM   1243 C  CE1 . HIS A 1 158 ? 7.102   24.744  1.716   1.00 19.70 ? 156  HIS A CE1 1 
ATOM   1244 N  NE2 . HIS A 1 158 ? 6.067   24.029  1.317   1.00 21.06 ? 156  HIS A NE2 1 
ATOM   1245 N  N   . VAL A 1 159 ? 2.677   29.238  3.823   1.00 22.65 ? 157  VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 159 ? 1.915   30.440  4.162   1.00 22.61 ? 157  VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 159 ? 2.742   31.109  5.300   1.00 22.97 ? 157  VAL A C   1 
ATOM   1248 O  O   . VAL A 1 159 ? 3.066   32.277  5.202   1.00 25.03 ? 157  VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 159 ? 0.510   30.086  4.715   1.00 24.43 ? 157  VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 159 ? -0.177  31.356  5.265   1.00 23.28 ? 157  VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 159 ? -0.370  29.460  3.639   1.00 22.88 ? 157  VAL A CG2 1 
ATOM   1252 N  N   . ALA A 1 160 ? 3.136   30.336  6.325   1.00 19.83 ? 158  ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 160 ? 3.958   30.812  7.451   1.00 18.53 ? 158  ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 160 ? 5.299   31.327  6.955   1.00 20.23 ? 158  ALA A C   1 
ATOM   1255 O  O   . ALA A 1 160 ? 5.766   32.376  7.400   1.00 20.79 ? 158  ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 160 ? 4.186   29.690  8.517   1.00 18.28 ? 158  ALA A CB  1 
ATOM   1257 N  N   . GLY A 1 161 ? 5.919   30.580  6.043   1.00 18.55 ? 159  GLY A N   1 
ATOM   1258 C  CA  . GLY A 1 161 ? 7.179   30.971  5.448   1.00 20.42 ? 159  GLY A CA  1 
ATOM   1259 C  C   . GLY A 1 161 ? 7.067   32.376  4.843   1.00 20.76 ? 159  GLY A C   1 
ATOM   1260 O  O   . GLY A 1 161 ? 7.917   33.238  5.117   1.00 22.64 ? 159  GLY A O   1 
ATOM   1261 N  N   . GLU A 1 162 ? 6.020   32.605  4.067   1.00 20.65 ? 160  GLU A N   1 
ATOM   1262 C  CA  . GLU A 1 162 ? 5.765   33.912  3.422   1.00 23.57 ? 160  GLU A CA  1 
ATOM   1263 C  C   . GLU A 1 162 ? 5.639   35.008  4.470   1.00 24.90 ? 160  GLU A C   1 
ATOM   1264 O  O   . GLU A 1 162 ? 6.337   36.008  4.392   1.00 23.84 ? 160  GLU A O   1 
ATOM   1265 C  CB  . GLU A 1 162 ? 4.479   33.867  2.589   1.00 23.06 ? 160  GLU A CB  1 
ATOM   1266 C  CG  . GLU A 1 162 ? 4.655   33.349  1.153   1.00 28.22 ? 160  GLU A CG  1 
ATOM   1267 C  CD  . GLU A 1 162 ? 5.273   34.373  0.172   1.00 29.76 ? 160  GLU A CD  1 
ATOM   1268 O  OE1 . GLU A 1 162 ? 5.721   35.452  0.597   1.00 29.54 ? 160  GLU A OE1 1 
ATOM   1269 O  OE2 . GLU A 1 162 ? 5.339   34.076  -1.030  1.00 32.30 ? 160  GLU A OE2 1 
ATOM   1270 N  N   . ALA A 1 163 ? 4.812   34.772  5.487   1.00 21.54 ? 161  ALA A N   1 
ATOM   1271 C  CA  . ALA A 1 163 ? 4.617   35.722  6.576   1.00 22.34 ? 161  ALA A CA  1 
ATOM   1272 C  C   . ALA A 1 163 ? 5.955   36.080  7.215   1.00 23.33 ? 161  ALA A C   1 
ATOM   1273 O  O   . ALA A 1 163 ? 6.223   37.249  7.464   1.00 20.94 ? 161  ALA A O   1 
ATOM   1274 C  CB  . ALA A 1 163 ? 3.638   35.147  7.640   1.00 20.70 ? 161  ALA A CB  1 
ATOM   1275 N  N   . GLY A 1 164 ? 6.758   35.063  7.543   1.00 22.59 ? 162  GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 164 ? 8.073   35.273  8.115   1.00 22.68 ? 162  GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 164 ? 8.972   36.081  7.189   1.00 24.53 ? 162  GLY A C   1 
ATOM   1278 O  O   . GLY A 1 164 ? 9.655   37.011  7.625   1.00 23.90 ? 162  GLY A O   1 
ATOM   1279 N  N   . SER A 1 165 ? 9.002   35.712  5.920   1.00 26.00 ? 163  SER A N   1 
ATOM   1280 C  CA  . SER A 1 165 ? 9.778   36.432  4.926   1.00 29.23 ? 163  SER A CA  1 
ATOM   1281 C  C   . SER A 1 165 ? 9.455   37.943  4.959   1.00 29.85 ? 163  SER A C   1 
ATOM   1282 O  O   . SER A 1 165 ? 10.341  38.761  4.765   1.00 28.48 ? 163  SER A O   1 
ATOM   1283 C  CB  . SER A 1 165 ? 9.442   35.904  3.532   1.00 29.39 ? 163  SER A CB  1 
ATOM   1284 O  OG  . SER A 1 165 ? 10.288  36.502  2.538   1.00 33.12 ? 163  SER A OG  1 
ATOM   1285 N  N   . ARG A 1 166 ? 8.187   38.282  5.217   1.00 30.93 ? 164  ARG A N   1 
ATOM   1286 C  CA  . ARG A 1 166 ? 7.710   39.649  5.252   1.00 29.54 ? 164  ARG A CA  1 
ATOM   1287 C  C   . ARG A 1 166 ? 7.715   40.284  6.623   1.00 30.28 ? 164  ARG A C   1 
ATOM   1288 O  O   . ARG A 1 166 ? 7.405   41.464  6.762   1.00 29.78 ? 164  ARG A O   1 
ATOM   1289 C  CB  . ARG A 1 166 ? 6.289   39.679  4.714   1.00 29.90 ? 164  ARG A CB  1 
ATOM   1290 C  CG  . ARG A 1 166 ? 6.180   39.115  3.291   1.00 28.36 ? 164  ARG A CG  1 
ATOM   1291 C  CD  . ARG A 1 166 ? 4.732   38.842  2.910   1.00 28.84 ? 164  ARG A CD  1 
ATOM   1292 N  NE  . ARG A 1 166 ? 4.636   38.330  1.550   1.00 28.92 ? 164  ARG A NE  1 
ATOM   1293 C  CZ  . ARG A 1 166 ? 4.342   39.082  0.490   1.00 30.73 ? 164  ARG A CZ  1 
ATOM   1294 N  NH1 . ARG A 1 166 ? 4.102   40.371  0.639   1.00 29.98 ? 164  ARG A NH1 1 
ATOM   1295 N  NH2 . ARG A 1 166 ? 4.311   38.546  -0.723  1.00 31.45 ? 164  ARG A NH2 1 
ATOM   1296 N  N   . THR A 1 167 ? 8.112   39.533  7.641   1.00 29.01 ? 165  THR A N   1 
ATOM   1297 C  CA  . THR A 1 167 ? 8.101   40.058  9.000   1.00 26.02 ? 165  THR A CA  1 
ATOM   1298 C  C   . THR A 1 167 ? 9.423   39.800  9.684   1.00 28.34 ? 165  THR A C   1 
ATOM   1299 O  O   . THR A 1 167 ? 9.573   38.823  10.428  1.00 28.02 ? 165  THR A O   1 
ATOM   1300 C  CB  . THR A 1 167 ? 6.999   39.365  9.846   1.00 27.12 ? 165  THR A CB  1 
ATOM   1301 O  OG1 . THR A 1 167 ? 5.752   39.385  9.146   1.00 24.18 ? 165  THR A OG1 1 
ATOM   1302 C  CG2 . THR A 1 167 ? 6.826   40.061  11.180  1.00 25.61 ? 165  THR A CG2 1 
ATOM   1303 N  N   . PRO A 1 168 ? 10.380  40.725  9.525   1.00 28.36 ? 166  PRO A N   1 
ATOM   1304 C  CA  . PRO A 1 168 ? 11.693  40.569  10.160  1.00 28.10 ? 166  PRO A CA  1 
ATOM   1305 C  C   . PRO A 1 168 ? 11.545  40.349  11.674  1.00 26.23 ? 166  PRO A C   1 
ATOM   1306 O  O   . PRO A 1 168 ? 10.702  40.974  12.327  1.00 26.35 ? 166  PRO A O   1 
ATOM   1307 C  CB  . PRO A 1 168 ? 12.361  41.915  9.881   1.00 27.86 ? 166  PRO A CB  1 
ATOM   1308 C  CG  . PRO A 1 168 ? 11.757  42.331  8.576   1.00 26.68 ? 166  PRO A CG  1 
ATOM   1309 C  CD  . PRO A 1 168 ? 10.306  41.987  8.774   1.00 27.92 ? 166  PRO A CD  1 
ATOM   1310 N  N   . GLY A 1 169 ? 12.372  39.484  12.236  1.00 24.47 ? 168  GLY A N   1 
ATOM   1311 C  CA  . GLY A 1 169 ? 12.314  39.211  13.664  1.00 23.80 ? 168  GLY A CA  1 
ATOM   1312 C  C   . GLY A 1 169 ? 11.194  38.339  14.209  1.00 24.79 ? 168  GLY A C   1 
ATOM   1313 O  O   . GLY A 1 169 ? 10.909  38.382  15.418  1.00 24.11 ? 168  GLY A O   1 
ATOM   1314 N  N   . LEU A 1 170 ? 10.534  37.562  13.349  1.00 24.24 ? 169  LEU A N   1 
ATOM   1315 C  CA  . LEU A 1 170 ? 9.478   36.644  13.805  1.00 21.09 ? 169  LEU A CA  1 
ATOM   1316 C  C   . LEU A 1 170 ? 10.169  35.591  14.704  1.00 21.97 ? 169  LEU A C   1 
ATOM   1317 O  O   . LEU A 1 170 ? 11.191  35.029  14.331  1.00 24.20 ? 169  LEU A O   1 
ATOM   1318 C  CB  . LEU A 1 170 ? 8.771   35.982  12.601  1.00 20.37 ? 169  LEU A CB  1 
ATOM   1319 C  CG  . LEU A 1 170 ? 7.696   34.901  12.858  1.00 19.17 ? 169  LEU A CG  1 
ATOM   1320 C  CD1 . LEU A 1 170 ? 6.509   35.456  13.590  1.00 15.40 ? 169  LEU A CD1 1 
ATOM   1321 C  CD2 . LEU A 1 170 ? 7.209   34.265  11.546  1.00 16.63 ? 169  LEU A CD2 1 
ATOM   1322 N  N   . GLY A 1 171 ? 9.626   35.343  15.894  1.00 22.01 ? 170  GLY A N   1 
ATOM   1323 C  CA  . GLY A 1 171 ? 10.255  34.396  16.798  1.00 26.11 ? 170  GLY A CA  1 
ATOM   1324 C  C   . GLY A 1 171 ? 10.328  32.954  16.309  1.00 24.39 ? 170  GLY A C   1 
ATOM   1325 O  O   . GLY A 1 171 ? 11.403  32.349  16.280  1.00 25.65 ? 170  GLY A O   1 
ATOM   1326 N  N   . ARG A 1 172 ? 9.196   32.404  15.882  1.00 24.58 ? 171  ARG A N   1 
ATOM   1327 C  CA  . ARG A 1 172 ? 9.212   31.020  15.454  1.00 24.86 ? 171  ARG A CA  1 
ATOM   1328 C  C   . ARG A 1 172 ? 8.158   30.608  14.450  1.00 22.55 ? 171  ARG A C   1 
ATOM   1329 O  O   . ARG A 1 172 ? 7.058   31.162  14.409  1.00 23.40 ? 171  ARG A O   1 
ATOM   1330 C  CB  . ARG A 1 172 ? 9.166   30.061  16.689  1.00 24.00 ? 171  ARG A CB  1 
ATOM   1331 C  CG  . ARG A 1 172 ? 8.708   28.637  16.337  1.00 25.67 ? 171  ARG A CG  1 
ATOM   1332 C  CD  . ARG A 1 172 ? 9.288   27.478  17.161  1.00 29.15 ? 171  ARG A CD  1 
ATOM   1333 N  NE  . ARG A 1 172 ? 8.582   27.269  18.402  1.00 31.84 ? 171  ARG A NE  1 
ATOM   1334 C  CZ  . ARG A 1 172 ? 8.237   26.088  18.933  1.00 32.06 ? 171  ARG A CZ  1 
ATOM   1335 N  NH1 . ARG A 1 172 ? 8.465   24.937  18.312  1.00 29.48 ? 171  ARG A NH1 1 
ATOM   1336 N  NH2 . ARG A 1 172 ? 7.607   26.085  20.097  1.00 28.61 ? 171  ARG A NH2 1 
ATOM   1337 N  N   . ILE A 1 173 ? 8.559   29.652  13.611  1.00 21.82 ? 172  ILE A N   1 
ATOM   1338 C  CA  . ILE A 1 173 ? 7.683   29.025  12.626  1.00 20.69 ? 172  ILE A CA  1 
ATOM   1339 C  C   . ILE A 1 173 ? 7.884   27.515  12.767  1.00 21.69 ? 172  ILE A C   1 
ATOM   1340 O  O   . ILE A 1 173 ? 9.002   27.016  12.759  1.00 18.91 ? 172  ILE A O   1 
ATOM   1341 C  CB  . ILE A 1 173 ? 8.057   29.371  11.182  1.00 20.87 ? 172  ILE A CB  1 
ATOM   1342 C  CG1 . ILE A 1 173 ? 7.608   30.818  10.823  1.00 19.39 ? 172  ILE A CG1 1 
ATOM   1343 C  CG2 . ILE A 1 173 ? 7.406   28.383  10.217  1.00 21.59 ? 172  ILE A CG2 1 
ATOM   1344 C  CD1 . ILE A 1 173 ? 8.174   31.251  9.442   1.00 14.37 ? 172  ILE A CD1 1 
ATOM   1345 N  N   . THR A 1 174 ? 6.798   26.796  12.966  1.00 21.37 ? 173  THR A N   1 
ATOM   1346 C  CA  . THR A 1 174 ? 6.900   25.370  13.023  1.00 22.09 ? 173  THR A CA  1 
ATOM   1347 C  C   . THR A 1 174 ? 6.216   24.870  11.748  1.00 20.30 ? 173  THR A C   1 
ATOM   1348 O  O   . THR A 1 174 ? 5.089   25.243  11.481  1.00 20.70 ? 173  THR A O   1 
ATOM   1349 C  CB  . THR A 1 174 ? 6.196   24.831  14.261  1.00 24.63 ? 173  THR A CB  1 
ATOM   1350 O  OG1 . THR A 1 174 ? 6.900   25.282  15.451  1.00 22.01 ? 173  THR A OG1 1 
ATOM   1351 C  CG2 . THR A 1 174 ? 6.100   23.324  14.200  1.00 21.33 ? 173  THR A CG2 1 
ATOM   1352 N  N   . GLY A 1 175 ? 6.938   24.085  10.947  1.00 19.79 ? 174  GLY A N   1 
ATOM   1353 C  CA  . GLY A 1 175 ? 6.368   23.495  9.745   1.00 19.55 ? 174  GLY A CA  1 
ATOM   1354 C  C   . GLY A 1 175 ? 5.948   22.056  10.030  1.00 21.78 ? 174  GLY A C   1 
ATOM   1355 O  O   . GLY A 1 175 ? 6.770   21.209  10.474  1.00 22.56 ? 174  GLY A O   1 
ATOM   1356 N  N   . LEU A 1 176 ? 4.662   21.766  9.847   1.00 19.52 ? 175  LEU A N   1 
ATOM   1357 C  CA  . LEU A 1 176 ? 4.146   20.421  10.098  1.00 20.57 ? 175  LEU A CA  1 
ATOM   1358 C  C   . LEU A 1 176 ? 3.952   19.771  8.735   1.00 20.18 ? 175  LEU A C   1 
ATOM   1359 O  O   . LEU A 1 176 ? 3.040   20.120  7.996   1.00 21.64 ? 175  LEU A O   1 
ATOM   1360 C  CB  . LEU A 1 176 ? 2.834   20.499  10.897  1.00 17.74 ? 175  LEU A CB  1 
ATOM   1361 C  CG  . LEU A 1 176 ? 2.942   21.286  12.196  1.00 16.79 ? 175  LEU A CG  1 
ATOM   1362 C  CD1 . LEU A 1 176 ? 1.594   21.406  12.850  1.00 15.11 ? 175  LEU A CD1 1 
ATOM   1363 C  CD2 . LEU A 1 176 ? 3.968   20.676  13.147  1.00 17.60 ? 175  LEU A CD2 1 
ATOM   1364 N  N   . ASP A 1 177 ? 4.880   18.899  8.368   1.00 21.78 ? 176  ASP A N   1 
ATOM   1365 C  CA  . ASP A 1 177 ? 4.878   18.231  7.054   1.00 21.34 ? 176  ASP A CA  1 
ATOM   1366 C  C   . ASP A 1 177 ? 4.609   19.175  5.880   1.00 22.22 ? 176  ASP A C   1 
ATOM   1367 O  O   . ASP A 1 177 ? 3.579   19.071  5.209   1.00 23.38 ? 176  ASP A O   1 
ATOM   1368 C  CB  . ASP A 1 177 ? 3.922   17.014  6.964   1.00 21.42 ? 176  ASP A CB  1 
ATOM   1369 C  CG  . ASP A 1 177 ? 4.415   15.976  5.954   1.00 19.29 ? 176  ASP A CG  1 
ATOM   1370 O  OD1 . ASP A 1 177 ? 5.622   15.700  5.972   1.00 20.70 ? 176  ASP A OD1 1 
ATOM   1371 O  OD2 . ASP A 1 177 ? 3.661   15.522  5.064   1.00 21.24 ? 176  ASP A OD2 1 
ATOM   1372 N  N   . PRO A 1 178 ? 5.551   20.097  5.595   1.00 21.84 ? 177  PRO A N   1 
ATOM   1373 C  CA  . PRO A 1 178 ? 5.409   21.052  4.494   1.00 20.04 ? 177  PRO A CA  1 
ATOM   1374 C  C   . PRO A 1 178 ? 5.309   20.334  3.160   1.00 22.74 ? 177  PRO A C   1 
ATOM   1375 O  O   . PRO A 1 178 ? 6.061   19.393  2.894   1.00 24.70 ? 177  PRO A O   1 
ATOM   1376 C  CB  . PRO A 1 178 ? 6.735   21.829  4.543   1.00 19.20 ? 177  PRO A CB  1 
ATOM   1377 C  CG  . PRO A 1 178 ? 7.159   21.712  5.923   1.00 21.47 ? 177  PRO A CG  1 
ATOM   1378 C  CD  . PRO A 1 178 ? 6.826   20.292  6.294   1.00 20.95 ? 177  PRO A CD  1 
ATOM   1379 N  N   . VAL A 1 179 ? 4.455   20.826  2.280   1.00 24.49 ? 178  VAL A N   1 
ATOM   1380 C  CA  . VAL A 1 179 ? 4.335   20.203  0.967   1.00 25.56 ? 178  VAL A CA  1 
ATOM   1381 C  C   . VAL A 1 179 ? 5.592   20.451  0.132   1.00 26.53 ? 178  VAL A C   1 
ATOM   1382 O  O   . VAL A 1 179 ? 6.304   21.425  0.364   1.00 26.32 ? 178  VAL A O   1 
ATOM   1383 C  CB  . VAL A 1 179 ? 3.049   20.649  0.270   1.00 26.59 ? 178  VAL A CB  1 
ATOM   1384 C  CG1 . VAL A 1 179 ? 1.876   19.941  0.961   1.00 22.70 ? 178  VAL A CG1 1 
ATOM   1385 C  CG2 . VAL A 1 179 ? 2.877   22.190  0.370   1.00 26.24 ? 178  VAL A CG2 1 
ATOM   1386 N  N   . GLU A 1 180 ? 5.933   19.516  -0.760  1.00 27.33 ? 179  GLU A N   1 
ATOM   1387 C  CA  . GLU A 1 180 ? 7.133   19.640  -1.580  1.00 27.60 ? 179  GLU A CA  1 
ATOM   1388 C  C   . GLU A 1 180 ? 6.924   20.233  -2.979  1.00 28.36 ? 179  GLU A C   1 
ATOM   1389 O  O   . GLU A 1 180 ? 7.724   21.074  -3.448  1.00 26.30 ? 179  GLU A O   1 
ATOM   1390 C  CB  . GLU A 1 180 ? 7.825   18.268  -1.709  1.00 31.98 ? 179  GLU A CB  1 
ATOM   1391 C  CG  . GLU A 1 180 ? 9.318   18.323  -2.075  1.00 36.89 ? 179  GLU A CG  1 
ATOM   1392 C  CD  . GLU A 1 180 ? 9.968   16.930  -2.198  1.00 40.56 ? 179  GLU A CD  1 
ATOM   1393 O  OE1 . GLU A 1 180 ? 9.564   16.174  -3.117  1.00 43.70 ? 179  GLU A OE1 1 
ATOM   1394 O  OE2 . GLU A 1 180 ? 10.878  16.585  -1.394  1.00 40.24 ? 179  GLU A OE2 1 
ATOM   1395 N  N   . ALA A 1 181 ? 5.875   19.766  -3.649  1.00 28.26 ? 180  ALA A N   1 
ATOM   1396 C  CA  . ALA A 1 181 ? 5.539   20.178  -5.009  1.00 30.86 ? 180  ALA A CA  1 
ATOM   1397 C  C   . ALA A 1 181 ? 5.377   21.688  -5.188  1.00 30.34 ? 180  ALA A C   1 
ATOM   1398 O  O   . ALA A 1 181 ? 4.701   22.357  -4.404  1.00 30.96 ? 180  ALA A O   1 
ATOM   1399 C  CB  . ALA A 1 181 ? 4.277   19.445  -5.466  1.00 29.60 ? 180  ALA A CB  1 
ATOM   1400 N  N   . SER A 1 182 ? 6.067   22.217  -6.189  1.00 31.80 ? 181  SER A N   1 
ATOM   1401 C  CA  . SER A 1 182 ? 6.054   23.648  -6.524  1.00 31.08 ? 181  SER A CA  1 
ATOM   1402 C  C   . SER A 1 182 ? 6.830   24.512  -5.525  1.00 31.81 ? 181  SER A C   1 
ATOM   1403 O  O   . SER A 1 182 ? 6.899   25.730  -5.700  1.00 27.82 ? 181  SER A O   1 
ATOM   1404 C  CB  . SER A 1 182 ? 4.618   24.181  -6.677  1.00 30.81 ? 181  SER A CB  1 
ATOM   1405 O  OG  . SER A 1 182 ? 3.856   23.406  -7.597  1.00 33.01 ? 181  SER A OG  1 
ATOM   1406 N  N   . PHE A 1 183 ? 7.452   23.883  -4.520  1.00 30.12 ? 182  PHE A N   1 
ATOM   1407 C  CA  . PHE A 1 183 ? 8.228   24.617  -3.520  1.00 30.64 ? 182  PHE A CA  1 
ATOM   1408 C  C   . PHE A 1 183 ? 9.700   24.206  -3.433  1.00 35.67 ? 182  PHE A C   1 
ATOM   1409 O  O   . PHE A 1 183 ? 10.580  25.056  -3.236  1.00 36.00 ? 182  PHE A O   1 
ATOM   1410 C  CB  . PHE A 1 183 ? 7.555   24.548  -2.132  1.00 27.82 ? 182  PHE A CB  1 
ATOM   1411 C  CG  . PHE A 1 183 ? 6.243   25.294  -2.064  1.00 24.35 ? 182  PHE A CG  1 
ATOM   1412 C  CD1 . PHE A 1 183 ? 6.213   26.671  -1.814  1.00 24.27 ? 182  PHE A CD1 1 
ATOM   1413 C  CD2 . PHE A 1 183 ? 5.029   24.633  -2.293  1.00 21.79 ? 182  PHE A CD2 1 
ATOM   1414 C  CE1 . PHE A 1 183 ? 4.987   27.380  -1.798  1.00 20.19 ? 182  PHE A CE1 1 
ATOM   1415 C  CE2 . PHE A 1 183 ? 3.816   25.327  -2.279  1.00 22.29 ? 182  PHE A CE2 1 
ATOM   1416 C  CZ  . PHE A 1 183 ? 3.789   26.715  -2.035  1.00 21.35 ? 182  PHE A CZ  1 
ATOM   1417 N  N   . GLN A 1 184 ? 9.982   22.911  -3.589  1.00 37.51 ? 183  GLN A N   1 
ATOM   1418 C  CA  . GLN A 1 184 ? 11.358  22.438  -3.548  1.00 38.73 ? 183  GLN A CA  1 
ATOM   1419 C  C   . GLN A 1 184 ? 12.140  22.942  -4.763  1.00 37.02 ? 183  GLN A C   1 
ATOM   1420 O  O   . GLN A 1 184 ? 11.639  22.935  -5.887  1.00 35.65 ? 183  GLN A O   1 
ATOM   1421 C  CB  . GLN A 1 184 ? 11.414  20.912  -3.491  1.00 39.54 ? 183  GLN A CB  1 
ATOM   1422 C  CG  . GLN A 1 184 ? 12.834  20.371  -3.407  1.00 42.81 ? 183  GLN A CG  1 
ATOM   1423 C  CD  . GLN A 1 184 ? 12.910  18.853  -3.296  1.00 44.85 ? 183  GLN A CD  1 
ATOM   1424 O  OE1 . GLN A 1 184 ? 13.402  18.320  -2.292  1.00 48.31 ? 183  GLN A OE1 1 
ATOM   1425 N  NE2 . GLN A 1 184 ? 12.457  18.149  -4.333  1.00 44.67 ? 183  GLN A NE2 1 
ATOM   1426 N  N   . GLY A 1 185 ? 13.372  23.379  -4.527  1.00 35.88 ? 184  GLY A N   1 
ATOM   1427 C  CA  . GLY A 1 185 ? 14.212  23.872  -5.605  1.00 34.44 ? 184  GLY A CA  1 
ATOM   1428 C  C   . GLY A 1 185 ? 13.999  25.332  -5.946  1.00 34.04 ? 184  GLY A C   1 
ATOM   1429 O  O   . GLY A 1 185 ? 14.631  25.852  -6.862  1.00 35.41 ? 184  GLY A O   1 
ATOM   1430 N  N   . THR A 1 186 ? 13.144  26.020  -5.202  1.00 34.04 ? 185  THR A N   1 
ATOM   1431 C  CA  . THR A 1 186 ? 12.877  27.422  -5.495  1.00 32.01 ? 185  THR A CA  1 
ATOM   1432 C  C   . THR A 1 186 ? 13.724  28.324  -4.590  1.00 32.98 ? 185  THR A C   1 
ATOM   1433 O  O   . THR A 1 186 ? 14.391  27.840  -3.667  1.00 31.93 ? 185  THR A O   1 
ATOM   1434 C  CB  . THR A 1 186 ? 11.378  27.753  -5.269  1.00 32.84 ? 185  THR A CB  1 
ATOM   1435 O  OG1 . THR A 1 186 ? 11.069  27.636  -3.870  1.00 30.98 ? 185  THR A OG1 1 
ATOM   1436 C  CG2 . THR A 1 186 ? 10.474  26.798  -6.044  1.00 32.14 ? 185  THR A CG2 1 
ATOM   1437 N  N   . PRO A 1 187 ? 13.826  29.626  -4.927  1.00 32.19 ? 186  PRO A N   1 
ATOM   1438 C  CA  . PRO A 1 187 ? 14.604  30.517  -4.066  1.00 32.80 ? 186  PRO A CA  1 
ATOM   1439 C  C   . PRO A 1 187 ? 13.873  30.530  -2.697  1.00 32.20 ? 186  PRO A C   1 
ATOM   1440 O  O   . PRO A 1 187 ? 12.644  30.404  -2.629  1.00 29.95 ? 186  PRO A O   1 
ATOM   1441 C  CB  . PRO A 1 187 ? 14.480  31.873  -4.773  1.00 33.17 ? 186  PRO A CB  1 
ATOM   1442 C  CG  . PRO A 1 187 ? 14.383  31.494  -6.237  1.00 31.42 ? 186  PRO A CG  1 
ATOM   1443 C  CD  . PRO A 1 187 ? 13.457  30.285  -6.203  1.00 32.41 ? 186  PRO A CD  1 
ATOM   1444 N  N   . GLU A 1 188 ? 14.624  30.740  -1.618  1.00 32.87 ? 187  GLU A N   1 
ATOM   1445 C  CA  . GLU A 1 188 ? 14.060  30.762  -0.267  1.00 32.86 ? 187  GLU A CA  1 
ATOM   1446 C  C   . GLU A 1 188 ? 12.811  31.624  -0.101  1.00 30.10 ? 187  GLU A C   1 
ATOM   1447 O  O   . GLU A 1 188 ? 11.978  31.400  0.787   1.00 30.82 ? 187  GLU A O   1 
ATOM   1448 C  CB  . GLU A 1 188 ? 15.134  31.145  0.761   1.00 34.14 ? 187  GLU A CB  1 
ATOM   1449 C  CG  . GLU A 1 188 ? 16.006  32.290  0.382   1.00 35.59 ? 187  GLU A CG  1 
ATOM   1450 C  CD  . GLU A 1 188 ? 17.342  31.861  -0.218  1.00 36.31 ? 187  GLU A CD  1 
ATOM   1451 O  OE1 . GLU A 1 188 ? 17.369  31.486  -1.409  1.00 37.25 ? 187  GLU A OE1 1 
ATOM   1452 O  OE2 . GLU A 1 188 ? 18.377  31.938  0.473   1.00 36.07 ? 187  GLU A OE2 1 
ATOM   1453 N  N   . GLU A 1 189 ? 12.650  32.557  -1.018  1.00 29.27 ? 188  GLU A N   1 
ATOM   1454 C  CA  . GLU A 1 189 ? 11.528  33.488  -1.068  1.00 30.97 ? 188  GLU A CA  1 
ATOM   1455 C  C   . GLU A 1 189 ? 10.170  32.777  -1.227  1.00 28.72 ? 188  GLU A C   1 
ATOM   1456 O  O   . GLU A 1 189 ? 9.137   33.216  -0.708  1.00 27.50 ? 188  GLU A O   1 
ATOM   1457 C  CB  . GLU A 1 189 ? 11.754  34.401  -2.296  1.00 34.07 ? 188  GLU A CB  1 
ATOM   1458 C  CG  . GLU A 1 189 ? 10.785  35.528  -2.430  1.00 36.67 ? 188  GLU A CG  1 
ATOM   1459 C  CD  . GLU A 1 189 ? 10.981  36.348  -3.711  1.00 38.84 ? 188  GLU A CD  1 
ATOM   1460 O  OE1 . GLU A 1 189 ? 11.665  35.896  -4.659  1.00 39.17 ? 188  GLU A OE1 1 
ATOM   1461 O  OE2 . GLU A 1 189 ? 10.406  37.449  -3.765  1.00 40.42 ? 188  GLU A OE2 1 
ATOM   1462 N  N   . VAL A 1 190 ? 10.190  31.670  -1.956  1.00 27.81 ? 189  VAL A N   1 
ATOM   1463 C  CA  . VAL A 1 190 ? 8.986   30.918  -2.257  1.00 23.81 ? 189  VAL A CA  1 
ATOM   1464 C  C   . VAL A 1 190 ? 8.533   29.921  -1.177  1.00 24.25 ? 189  VAL A C   1 
ATOM   1465 O  O   . VAL A 1 190 ? 7.337   29.725  -0.938  1.00 24.84 ? 189  VAL A O   1 
ATOM   1466 C  CB  . VAL A 1 190 ? 9.202   30.170  -3.611  1.00 23.62 ? 189  VAL A CB  1 
ATOM   1467 C  CG1 . VAL A 1 190 ? 7.943   29.495  -4.101  1.00 21.95 ? 189  VAL A CG1 1 
ATOM   1468 C  CG2 . VAL A 1 190 ? 9.709   31.145  -4.661  1.00 24.61 ? 189  VAL A CG2 1 
ATOM   1469 N  N   . ARG A 1 191 ? 9.501   29.394  -0.442  1.00 25.38 ? 190  ARG A N   1 
ATOM   1470 C  CA  . ARG A 1 191 ? 9.248   28.335  0.525   1.00 25.63 ? 190  ARG A CA  1 
ATOM   1471 C  C   . ARG A 1 191 ? 9.696   28.614  1.933   1.00 24.00 ? 190  ARG A C   1 
ATOM   1472 O  O   . ARG A 1 191 ? 10.512  29.467  2.169   1.00 24.70 ? 190  ARG A O   1 
ATOM   1473 C  CB  . ARG A 1 191 ? 10.022  27.115  0.045   1.00 23.93 ? 190  ARG A CB  1 
ATOM   1474 C  CG  . ARG A 1 191 ? 11.469  27.512  -0.275  1.00 25.49 ? 190  ARG A CG  1 
ATOM   1475 C  CD  . ARG A 1 191 ? 12.383  26.352  -0.649  1.00 25.14 ? 190  ARG A CD  1 
ATOM   1476 N  NE  . ARG A 1 191 ? 13.625  26.871  -1.220  1.00 23.18 ? 190  ARG A NE  1 
ATOM   1477 C  CZ  . ARG A 1 191 ? 14.746  27.025  -0.539  1.00 23.01 ? 190  ARG A CZ  1 
ATOM   1478 N  NH1 . ARG A 1 191 ? 14.822  26.601  0.709   1.00 24.19 ? 190  ARG A NH1 1 
ATOM   1479 N  NH2 . ARG A 1 191 ? 15.822  27.531  -1.135  1.00 27.31 ? 190  ARG A NH2 1 
ATOM   1480 N  N   . LEU A 1 192 ? 9.179   27.853  2.883   1.00 24.64 ? 191  LEU A N   1 
ATOM   1481 C  CA  . LEU A 1 192 ? 9.584   27.976  4.282   1.00 23.94 ? 191  LEU A CA  1 
ATOM   1482 C  C   . LEU A 1 192 ? 11.020  27.494  4.303   1.00 22.28 ? 191  LEU A C   1 
ATOM   1483 O  O   . LEU A 1 192 ? 11.323  26.498  3.657   1.00 22.06 ? 191  LEU A O   1 
ATOM   1484 C  CB  . LEU A 1 192 ? 8.728   27.038  5.128   1.00 27.10 ? 191  LEU A CB  1 
ATOM   1485 C  CG  . LEU A 1 192 ? 9.197   26.717  6.544   1.00 26.90 ? 191  LEU A CG  1 
ATOM   1486 C  CD1 . LEU A 1 192 ? 9.212   28.010  7.368   1.00 27.81 ? 191  LEU A CD1 1 
ATOM   1487 C  CD2 . LEU A 1 192 ? 8.241   25.705  7.140   1.00 25.92 ? 191  LEU A CD2 1 
ATOM   1488 N  N   . ASP A 1 193 ? 11.892  28.212  5.010   1.00 19.83 ? 192  ASP A N   1 
ATOM   1489 C  CA  . ASP A 1 193 ? 13.319  27.883  5.123   1.00 21.81 ? 192  ASP A CA  1 
ATOM   1490 C  C   . ASP A 1 193 ? 13.765  28.574  6.411   1.00 21.21 ? 192  ASP A C   1 
ATOM   1491 O  O   . ASP A 1 193 ? 13.015  29.406  6.926   1.00 21.03 ? 192  ASP A O   1 
ATOM   1492 C  CB  . ASP A 1 193 ? 14.103  28.377  3.893   1.00 23.56 ? 192  ASP A CB  1 
ATOM   1493 C  CG  . ASP A 1 193 ? 14.259  29.888  3.851   1.00 24.94 ? 192  ASP A CG  1 
ATOM   1494 O  OD1 . ASP A 1 193 ? 13.328  30.596  3.433   1.00 23.17 ? 192  ASP A OD1 1 
ATOM   1495 O  OD2 . ASP A 1 193 ? 15.344  30.356  4.209   1.00 28.38 ? 192  ASP A OD2 1 
ATOM   1496 N  N   . PRO A 1 194 ? 14.965  28.270  6.933   1.00 21.84 ? 193  PRO A N   1 
ATOM   1497 C  CA  . PRO A 1 194 ? 15.429  28.885  8.182   1.00 23.14 ? 193  PRO A CA  1 
ATOM   1498 C  C   . PRO A 1 194 ? 15.435  30.420  8.291   1.00 23.88 ? 193  PRO A C   1 
ATOM   1499 O  O   . PRO A 1 194 ? 15.259  30.953  9.403   1.00 23.57 ? 193  PRO A O   1 
ATOM   1500 C  CB  . PRO A 1 194 ? 16.837  28.305  8.350   1.00 21.69 ? 193  PRO A CB  1 
ATOM   1501 C  CG  . PRO A 1 194 ? 16.744  26.991  7.623   1.00 21.44 ? 193  PRO A CG  1 
ATOM   1502 C  CD  . PRO A 1 194 ? 16.025  27.417  6.371   1.00 21.81 ? 193  PRO A CD  1 
ATOM   1503 N  N   . THR A 1 195 ? 15.611  31.125  7.165   1.00 23.69 ? 194  THR A N   1 
ATOM   1504 C  CA  . THR A 1 195 ? 15.657  32.597  7.160   1.00 22.85 ? 194  THR A CA  1 
ATOM   1505 C  C   . THR A 1 195 ? 14.330  33.281  7.427   1.00 23.72 ? 194  THR A C   1 
ATOM   1506 O  O   . THR A 1 195 ? 14.283  34.501  7.636   1.00 22.08 ? 194  THR A O   1 
ATOM   1507 C  CB  . THR A 1 195 ? 16.243  33.188  5.850   1.00 20.57 ? 194  THR A CB  1 
ATOM   1508 O  OG1 . THR A 1 195 ? 15.468  32.771  4.715   1.00 21.51 ? 194  THR A OG1 1 
ATOM   1509 C  CG2 . THR A 1 195 ? 17.667  32.754  5.680   1.00 22.45 ? 194  THR A CG2 1 
ATOM   1510 N  N   . ASP A 1 196 ? 13.251  32.504  7.452   1.00 23.39 ? 195  ASP A N   1 
ATOM   1511 C  CA  . ASP A 1 196 ? 11.932  33.058  7.688   1.00 21.16 ? 195  ASP A CA  1 
ATOM   1512 C  C   . ASP A 1 196 ? 11.637  33.423  9.114   1.00 19.52 ? 195  ASP A C   1 
ATOM   1513 O  O   . ASP A 1 196 ? 10.646  34.079  9.369   1.00 19.69 ? 195  ASP A O   1 
ATOM   1514 C  CB  . ASP A 1 196 ? 10.852  32.080  7.212   1.00 21.75 ? 195  ASP A CB  1 
ATOM   1515 C  CG  . ASP A 1 196 ? 10.824  31.922  5.713   1.00 24.99 ? 195  ASP A CG  1 
ATOM   1516 O  OD1 . ASP A 1 196 ? 11.092  32.906  5.007   1.00 22.26 ? 195  ASP A OD1 1 
ATOM   1517 O  OD2 . ASP A 1 196 ? 10.512  30.807  5.234   1.00 23.70 ? 195  ASP A OD2 1 
ATOM   1518 N  N   . ALA A 1 197 ? 12.418  32.913  10.059  1.00 22.85 ? 196  ALA A N   1 
ATOM   1519 C  CA  . ALA A 1 197 ? 12.169  33.221  11.483  1.00 21.52 ? 196  ALA A CA  1 
ATOM   1520 C  C   . ALA A 1 197 ? 13.412  32.950  12.282  1.00 22.67 ? 196  ALA A C   1 
ATOM   1521 O  O   . ALA A 1 197 ? 14.309  32.317  11.765  1.00 24.07 ? 196  ALA A O   1 
ATOM   1522 C  CB  . ALA A 1 197 ? 11.028  32.393  12.018  1.00 20.83 ? 196  ALA A CB  1 
ATOM   1523 N  N   . ASP A 1 198 ? 13.491  33.448  13.526  1.00 23.99 ? 197  ASP A N   1 
ATOM   1524 C  CA  . ASP A 1 198 ? 14.676  33.217  14.366  1.00 25.05 ? 197  ASP A CA  1 
ATOM   1525 C  C   . ASP A 1 198 ? 14.850  31.716  14.671  1.00 25.52 ? 197  ASP A C   1 
ATOM   1526 O  O   . ASP A 1 198 ? 15.974  31.220  14.833  1.00 27.83 ? 197  ASP A O   1 
ATOM   1527 C  CB  . ASP A 1 198 ? 14.622  33.986  15.703  1.00 26.00 ? 197  ASP A CB  1 
ATOM   1528 C  CG  . ASP A 1 198 ? 14.496  35.494  15.540  1.00 27.63 ? 197  ASP A CG  1 
ATOM   1529 O  OD1 . ASP A 1 198 ? 14.741  36.022  14.446  1.00 29.64 ? 197  ASP A OD1 1 
ATOM   1530 O  OD2 . ASP A 1 198 ? 14.134  36.182  16.522  1.00 29.54 ? 197  ASP A OD2 1 
ATOM   1531 N  N   . PHE A 1 199 ? 13.741  30.985  14.712  1.00 25.89 ? 198  PHE A N   1 
ATOM   1532 C  CA  . PHE A 1 199 ? 13.773  29.543  14.969  1.00 24.45 ? 198  PHE A CA  1 
ATOM   1533 C  C   . PHE A 1 199 ? 12.696  28.869  14.141  1.00 22.90 ? 198  PHE A C   1 
ATOM   1534 O  O   . PHE A 1 199 ? 11.524  29.201  14.222  1.00 22.56 ? 198  PHE A O   1 
ATOM   1535 C  CB  . PHE A 1 199 ? 13.581  29.246  16.480  1.00 24.44 ? 198  PHE A CB  1 
ATOM   1536 C  CG  . PHE A 1 199 ? 13.516  27.760  16.806  1.00 23.80 ? 198  PHE A CG  1 
ATOM   1537 C  CD1 . PHE A 1 199 ? 14.565  26.918  16.499  1.00 24.90 ? 198  PHE A CD1 1 
ATOM   1538 C  CD2 . PHE A 1 199 ? 12.373  27.207  17.360  1.00 23.63 ? 198  PHE A CD2 1 
ATOM   1539 C  CE1 . PHE A 1 199 ? 14.474  25.537  16.734  1.00 26.12 ? 198  PHE A CE1 1 
ATOM   1540 C  CE2 . PHE A 1 199 ? 12.272  25.860  17.590  1.00 24.12 ? 198  PHE A CE2 1 
ATOM   1541 C  CZ  . PHE A 1 199 ? 13.342  25.023  17.268  1.00 23.50 ? 198  PHE A CZ  1 
ATOM   1542 N  N   . VAL A 1 200 ? 13.128  27.983  13.265  1.00 23.65 ? 199  VAL A N   1 
ATOM   1543 C  CA  . VAL A 1 200 ? 12.224  27.253  12.421  1.00 21.96 ? 199  VAL A CA  1 
ATOM   1544 C  C   . VAL A 1 200 ? 12.435  25.764  12.737  1.00 22.09 ? 199  VAL A C   1 
ATOM   1545 O  O   . VAL A 1 200 ? 13.558  25.271  12.645  1.00 22.19 ? 199  VAL A O   1 
ATOM   1546 C  CB  . VAL A 1 200 ? 12.526  27.538  10.908  1.00 20.78 ? 199  VAL A CB  1 
ATOM   1547 C  CG1 . VAL A 1 200 ? 11.793  26.513  10.009  1.00 20.02 ? 199  VAL A CG1 1 
ATOM   1548 C  CG2 . VAL A 1 200 ? 12.061  28.955  10.556  1.00 20.93 ? 199  VAL A CG2 1 
ATOM   1549 N  N   . ASP A 1 201 ? 11.404  25.105  13.254  1.00 23.26 ? 200  ASP A N   1 
ATOM   1550 C  CA  . ASP A 1 201 ? 11.506  23.673  13.544  1.00 23.22 ? 200  ASP A CA  1 
ATOM   1551 C  C   . ASP A 1 201 ? 10.513  22.980  12.610  1.00 23.54 ? 200  ASP A C   1 
ATOM   1552 O  O   . ASP A 1 201 ? 9.413   23.513  12.364  1.00 20.04 ? 200  ASP A O   1 
ATOM   1553 C  CB  . ASP A 1 201 ? 11.273  23.359  15.030  1.00 24.22 ? 200  ASP A CB  1 
ATOM   1554 C  CG  . ASP A 1 201 ? 9.923   23.822  15.537  1.00 24.97 ? 200  ASP A CG  1 
ATOM   1555 O  OD1 . ASP A 1 201 ? 9.518   24.986  15.286  1.00 25.92 ? 200  ASP A OD1 1 
ATOM   1556 O  OD2 . ASP A 1 201 ? 9.273   23.043  16.252  1.00 27.26 ? 200  ASP A OD2 1 
ATOM   1557 N  N   . VAL A 1 202 ? 10.943  21.855  12.020  1.00 21.31 ? 201  VAL A N   1 
ATOM   1558 C  CA  . VAL A 1 202 ? 10.118  21.132  11.041  1.00 21.29 ? 201  VAL A CA  1 
ATOM   1559 C  C   . VAL A 1 202 ? 9.942   19.606  11.273  1.00 22.89 ? 201  VAL A C   1 
ATOM   1560 O  O   . VAL A 1 202 ? 10.927  18.872  11.513  1.00 21.83 ? 201  VAL A O   1 
ATOM   1561 C  CB  . VAL A 1 202 ? 10.690  21.372  9.617   1.00 23.17 ? 201  VAL A CB  1 
ATOM   1562 C  CG1 . VAL A 1 202 ? 9.827   20.671  8.553   1.00 20.25 ? 201  VAL A CG1 1 
ATOM   1563 C  CG2 . VAL A 1 202 ? 10.763  22.892  9.335   1.00 21.89 ? 201  VAL A CG2 1 
ATOM   1564 N  N   . ILE A 1 203 ? 8.679   19.179  11.242  1.00 22.48 ? 202  ILE A N   1 
ATOM   1565 C  CA  . ILE A 1 203 ? 8.282   17.772  11.417  1.00 24.57 ? 202  ILE A CA  1 
ATOM   1566 C  C   . ILE A 1 203 ? 7.874   17.181  10.073  1.00 25.85 ? 202  ILE A C   1 
ATOM   1567 O  O   . ILE A 1 203 ? 6.964   17.686  9.415   1.00 25.58 ? 202  ILE A O   1 
ATOM   1568 C  CB  . ILE A 1 203 ? 7.109   17.626  12.399  1.00 23.61 ? 202  ILE A CB  1 
ATOM   1569 C  CG1 . ILE A 1 203 ? 7.567   18.065  13.790  1.00 23.19 ? 202  ILE A CG1 1 
ATOM   1570 C  CG2 . ILE A 1 203 ? 6.552   16.155  12.395  1.00 20.57 ? 202  ILE A CG2 1 
ATOM   1571 C  CD1 . ILE A 1 203 ? 6.453   18.140  14.797  1.00 23.53 ? 202  ILE A CD1 1 
ATOM   1572 N  N   . HIS A 1 204 ? 8.558   16.101  9.667   1.00 24.61 ? 203  HIS A N   1 
ATOM   1573 C  CA  . HIS A 1 204 ? 8.284   15.445  8.407   1.00 24.65 ? 203  HIS A CA  1 
ATOM   1574 C  C   . HIS A 1 204 ? 7.566   14.118  8.654   1.00 25.78 ? 203  HIS A C   1 
ATOM   1575 O  O   . HIS A 1 204 ? 8.074   13.268  9.370   1.00 24.72 ? 203  HIS A O   1 
ATOM   1576 C  CB  . HIS A 1 204 ? 9.589   15.187  7.646   1.00 24.62 ? 203  HIS A CB  1 
ATOM   1577 C  CG  . HIS A 1 204 ? 10.437  16.411  7.438   1.00 23.93 ? 203  HIS A CG  1 
ATOM   1578 N  ND1 . HIS A 1 204 ? 10.672  16.942  6.186   1.00 26.13 ? 203  HIS A ND1 1 
ATOM   1579 C  CD2 . HIS A 1 204 ? 11.211  17.112  8.294   1.00 21.35 ? 203  HIS A CD2 1 
ATOM   1580 C  CE1 . HIS A 1 204 ? 11.573  17.905  6.273   1.00 23.73 ? 203  HIS A CE1 1 
ATOM   1581 N  NE2 . HIS A 1 204 ? 11.913  18.027  7.542   1.00 23.36 ? 203  HIS A NE2 1 
ATOM   1582 N  N   . THR A 1 205 ? 6.422   13.920  8.007   1.00 25.80 ? 204  THR A N   1 
ATOM   1583 C  CA  . THR A 1 205 ? 5.650   12.698  8.197   1.00 24.96 ? 204  THR A CA  1 
ATOM   1584 C  C   . THR A 1 205 ? 5.168   11.971  6.955   1.00 26.18 ? 204  THR A C   1 
ATOM   1585 O  O   . THR A 1 205 ? 4.715   10.820  7.050   1.00 25.85 ? 204  THR A O   1 
ATOM   1586 C  CB  . THR A 1 205 ? 4.436   12.914  9.145   1.00 25.39 ? 204  THR A CB  1 
ATOM   1587 O  OG1 . THR A 1 205 ? 3.640   14.015  8.715   1.00 23.16 ? 204  THR A OG1 1 
ATOM   1588 C  CG2 . THR A 1 205 ? 4.877   13.119  10.566  1.00 21.90 ? 204  THR A CG2 1 
ATOM   1589 N  N   . ASP A 1 206 ? 5.258   12.617  5.786   1.00 23.56 ? 205  ASP A N   1 
ATOM   1590 C  CA  . ASP A 1 206 ? 4.801   11.993  4.553   1.00 24.08 ? 205  ASP A CA  1 
ATOM   1591 C  C   . ASP A 1 206 ? 5.791   12.316  3.441   1.00 25.27 ? 205  ASP A C   1 
ATOM   1592 O  O   . ASP A 1 206 ? 5.377   12.636  2.346   1.00 23.74 ? 205  ASP A O   1 
ATOM   1593 C  CB  . ASP A 1 206 ? 3.433   12.563  4.197   1.00 26.09 ? 205  ASP A CB  1 
ATOM   1594 C  CG  . ASP A 1 206 ? 2.683   11.741  3.160   1.00 27.36 ? 205  ASP A CG  1 
ATOM   1595 O  OD1 . ASP A 1 206 ? 3.014   10.560  2.939   1.00 30.17 ? 205  ASP A OD1 1 
ATOM   1596 O  OD2 . ASP A 1 206 ? 1.732   12.278  2.572   1.00 28.05 ? 205  ASP A OD2 1 
ATOM   1597 N  N   . ALA A 1 207 ? 7.083   12.201  3.729   1.00 25.31 ? 206  ALA A N   1 
ATOM   1598 C  CA  . ALA A 1 207 ? 8.159   12.533  2.792   1.00 27.33 ? 206  ALA A CA  1 
ATOM   1599 C  C   . ALA A 1 207 ? 8.555   11.558  1.679   1.00 31.45 ? 206  ALA A C   1 
ATOM   1600 O  O   . ALA A 1 207 ? 9.587   11.773  1.038   1.00 32.03 ? 206  ALA A O   1 
ATOM   1601 C  CB  . ALA A 1 207 ? 9.400   12.947  3.575   1.00 25.93 ? 206  ALA A CB  1 
ATOM   1602 N  N   . ALA A 1 208 ? 7.801   10.476  1.450   1.00 33.44 ? 207  ALA A N   1 
ATOM   1603 C  CA  . ALA A 1 208 ? 8.151   9.567   0.352   1.00 34.56 ? 207  ALA A CA  1 
ATOM   1604 C  C   . ALA A 1 208 ? 7.838   10.317  -0.936  1.00 35.85 ? 207  ALA A C   1 
ATOM   1605 O  O   . ALA A 1 208 ? 6.913   11.121  -0.963  1.00 36.19 ? 207  ALA A O   1 
ATOM   1606 C  CB  . ALA A 1 208 ? 7.320   8.279   0.424   1.00 34.14 ? 207  ALA A CB  1 
ATOM   1607 N  N   . PRO A 1 209 ? 8.604   10.071  -2.017  1.00 37.84 ? 208  PRO A N   1 
ATOM   1608 C  CA  . PRO A 1 209 ? 8.393   10.733  -3.311  1.00 38.23 ? 208  PRO A CA  1 
ATOM   1609 C  C   . PRO A 1 209 ? 6.930   10.711  -3.733  1.00 38.67 ? 208  PRO A C   1 
ATOM   1610 O  O   . PRO A 1 209 ? 6.227   9.714   -3.512  1.00 39.53 ? 208  PRO A O   1 
ATOM   1611 C  CB  . PRO A 1 209 ? 9.286   9.923   -4.251  1.00 38.90 ? 208  PRO A CB  1 
ATOM   1612 C  CG  . PRO A 1 209 ? 10.468  9.664   -3.383  1.00 38.14 ? 208  PRO A CG  1 
ATOM   1613 C  CD  . PRO A 1 209 ? 9.792   9.200   -2.080  1.00 38.18 ? 208  PRO A CD  1 
ATOM   1614 N  N   . LEU A 1 210 ? 6.478   11.829  -4.300  1.00 36.93 ? 209  LEU A N   1 
ATOM   1615 C  CA  . LEU A 1 210 ? 5.102   11.980  -4.745  1.00 36.65 ? 209  LEU A CA  1 
ATOM   1616 C  C   . LEU A 1 210 ? 4.783   10.900  -5.773  1.00 37.98 ? 209  LEU A C   1 
ATOM   1617 O  O   . LEU A 1 210 ? 3.675   10.346  -5.785  1.00 37.97 ? 209  LEU A O   1 
ATOM   1618 C  CB  . LEU A 1 210 ? 4.884   13.383  -5.345  1.00 34.00 ? 209  LEU A CB  1 
ATOM   1619 C  CG  . LEU A 1 210 ? 3.529   13.678  -6.009  1.00 32.19 ? 209  LEU A CG  1 
ATOM   1620 C  CD1 . LEU A 1 210 ? 2.449   13.809  -4.983  1.00 27.88 ? 209  LEU A CD1 1 
ATOM   1621 C  CD2 . LEU A 1 210 ? 3.609   14.922  -6.849  1.00 31.84 ? 209  LEU A CD2 1 
ATOM   1622 N  N   . ILE A 1 211 ? 5.740   10.657  -6.667  1.00 39.25 ? 210  ILE A N   1 
ATOM   1623 C  CA  . ILE A 1 211 ? 5.612   9.631   -7.702  1.00 40.73 ? 210  ILE A CA  1 
ATOM   1624 C  C   . ILE A 1 211 ? 6.671   8.570   -7.380  1.00 39.96 ? 210  ILE A C   1 
ATOM   1625 O  O   . ILE A 1 211 ? 7.882   8.840   -7.453  1.00 40.64 ? 210  ILE A O   1 
ATOM   1626 C  CB  . ILE A 1 211 ? 5.916   10.163  -9.114  1.00 42.44 ? 210  ILE A CB  1 
ATOM   1627 C  CG1 . ILE A 1 211 ? 5.091   11.399  -9.434  1.00 42.03 ? 210  ILE A CG1 1 
ATOM   1628 C  CG2 . ILE A 1 211 ? 5.595   9.079   -10.162 1.00 42.92 ? 210  ILE A CG2 1 
ATOM   1629 C  CD1 . ILE A 1 211 ? 5.552   12.064  -10.711 1.00 44.10 ? 210  ILE A CD1 1 
ATOM   1630 N  N   . PRO A 1 212 ? 6.236   7.320   -7.185  1.00 39.15 ? 211  PRO A N   1 
ATOM   1631 C  CA  . PRO A 1 212 ? 4.831   6.914   -7.270  1.00 38.20 ? 211  PRO A CA  1 
ATOM   1632 C  C   . PRO A 1 212 ? 4.091   6.667   -5.969  1.00 36.87 ? 211  PRO A C   1 
ATOM   1633 O  O   . PRO A 1 212 ? 2.960   6.175   -6.004  1.00 37.47 ? 211  PRO A O   1 
ATOM   1634 C  CB  . PRO A 1 212 ? 4.943   5.611   -8.029  1.00 38.16 ? 211  PRO A CB  1 
ATOM   1635 C  CG  . PRO A 1 212 ? 6.128   4.967   -7.301  1.00 37.92 ? 211  PRO A CG  1 
ATOM   1636 C  CD  . PRO A 1 212 ? 7.114   6.135   -7.122  1.00 39.60 ? 211  PRO A CD  1 
ATOM   1637 N  N   . PHE A 1 213 ? 4.691   7.011   -4.830  1.00 37.76 ? 212  PHE A N   1 
ATOM   1638 C  CA  . PHE A 1 213 ? 4.059   6.736   -3.531  1.00 36.50 ? 212  PHE A CA  1 
ATOM   1639 C  C   . PHE A 1 213 ? 3.013   7.722   -3.054  1.00 36.50 ? 212  PHE A C   1 
ATOM   1640 O  O   . PHE A 1 213 ? 2.428   7.531   -1.995  1.00 34.53 ? 212  PHE A O   1 
ATOM   1641 C  CB  . PHE A 1 213 ? 5.109   6.595   -2.434  1.00 37.27 ? 212  PHE A CB  1 
ATOM   1642 C  CG  . PHE A 1 213 ? 6.314   5.812   -2.850  1.00 38.53 ? 212  PHE A CG  1 
ATOM   1643 C  CD1 . PHE A 1 213 ? 6.298   4.419   -2.831  1.00 38.18 ? 212  PHE A CD1 1 
ATOM   1644 C  CD2 . PHE A 1 213 ? 7.467   6.469   -3.274  1.00 37.24 ? 212  PHE A CD2 1 
ATOM   1645 C  CE1 . PHE A 1 213 ? 7.422   3.696   -3.235  1.00 38.54 ? 212  PHE A CE1 1 
ATOM   1646 C  CE2 . PHE A 1 213 ? 8.589   5.757   -3.678  1.00 38.20 ? 212  PHE A CE2 1 
ATOM   1647 C  CZ  . PHE A 1 213 ? 8.570   4.361   -3.660  1.00 38.80 ? 212  PHE A CZ  1 
ATOM   1648 N  N   . LEU A 1 214 ? 2.790   8.788   -3.814  1.00 37.47 ? 213  LEU A N   1 
ATOM   1649 C  CA  . LEU A 1 214 ? 1.813   9.803   -3.427  1.00 37.02 ? 213  LEU A CA  1 
ATOM   1650 C  C   . LEU A 1 214 ? 2.118   10.467  -2.074  1.00 34.38 ? 213  LEU A C   1 
ATOM   1651 O  O   . LEU A 1 214 ? 1.216   10.789  -1.307  1.00 35.54 ? 213  LEU A O   1 
ATOM   1652 C  CB  . LEU A 1 214 ? 0.377   9.243   -3.484  1.00 37.05 ? 213  LEU A CB  1 
ATOM   1653 C  CG  . LEU A 1 214 ? -0.440  9.928   -4.589  1.00 37.90 ? 213  LEU A CG  1 
ATOM   1654 C  CD1 . LEU A 1 214 ? -1.769  9.258   -4.851  1.00 36.61 ? 213  LEU A CD1 1 
ATOM   1655 C  CD2 . LEU A 1 214 ? -0.653  11.403  -4.175  1.00 38.89 ? 213  LEU A CD2 1 
ATOM   1656 N  N   . GLY A 1 215 ? 3.402   10.651  -1.779  1.00 33.39 ? 214  GLY A N   1 
ATOM   1657 C  CA  . GLY A 1 215 ? 3.789   11.316  -0.545  1.00 31.71 ? 214  GLY A CA  1 
ATOM   1658 C  C   . GLY A 1 215 ? 3.685   12.835  -0.765  1.00 30.94 ? 214  GLY A C   1 
ATOM   1659 O  O   . GLY A 1 215 ? 4.241   13.361  -1.723  1.00 30.28 ? 214  GLY A O   1 
ATOM   1660 N  N   . PHE A 1 216 ? 2.913   13.513  0.080   1.00 31.61 ? 215  PHE A N   1 
ATOM   1661 C  CA  . PHE A 1 216 ? 2.705   14.969  0.004   1.00 31.41 ? 215  PHE A CA  1 
ATOM   1662 C  C   . PHE A 1 216 ? 3.814   15.811  0.661   1.00 31.62 ? 215  PHE A C   1 
ATOM   1663 O  O   . PHE A 1 216 ? 4.022   16.963  0.282   1.00 31.13 ? 215  PHE A O   1 
ATOM   1664 C  CB  . PHE A 1 216 ? 1.361   15.342  0.646   1.00 29.74 ? 215  PHE A CB  1 
ATOM   1665 C  CG  . PHE A 1 216 ? 0.201   15.339  -0.324  1.00 30.42 ? 215  PHE A CG  1 
ATOM   1666 C  CD1 . PHE A 1 216 ? 0.241   14.588  -1.501  1.00 28.05 ? 215  PHE A CD1 1 
ATOM   1667 C  CD2 . PHE A 1 216 ? -0.931  16.093  -0.064  1.00 29.54 ? 215  PHE A CD2 1 
ATOM   1668 C  CE1 . PHE A 1 216 ? -0.823  14.601  -2.387  1.00 29.00 ? 215  PHE A CE1 1 
ATOM   1669 C  CE2 . PHE A 1 216 ? -2.013  16.108  -0.959  1.00 30.47 ? 215  PHE A CE2 1 
ATOM   1670 C  CZ  . PHE A 1 216 ? -1.950  15.359  -2.122  1.00 28.31 ? 215  PHE A CZ  1 
ATOM   1671 N  N   . GLY A 1 217 ? 4.525   15.224  1.621   1.00 28.56 ? 216  GLY A N   1 
ATOM   1672 C  CA  . GLY A 1 217 ? 5.561   15.940  2.333   1.00 26.46 ? 216  GLY A CA  1 
ATOM   1673 C  C   . GLY A 1 217 ? 6.905   16.013  1.669   1.00 26.32 ? 216  GLY A C   1 
ATOM   1674 O  O   . GLY A 1 217 ? 7.082   15.541  0.560   1.00 27.85 ? 216  GLY A O   1 
ATOM   1675 N  N   . THR A 1 218 ? 7.872   16.611  2.360   1.00 29.05 ? 217  THR A N   1 
ATOM   1676 C  CA  . THR A 1 218 ? 9.224   16.733  1.820   1.00 32.27 ? 217  THR A CA  1 
ATOM   1677 C  C   . THR A 1 218 ? 10.285  16.017  2.667   1.00 31.28 ? 217  THR A C   1 
ATOM   1678 O  O   . THR A 1 218 ? 10.149  15.887  3.885   1.00 32.54 ? 217  THR A O   1 
ATOM   1679 C  CB  . THR A 1 218 ? 9.630   18.219  1.636   1.00 33.62 ? 217  THR A CB  1 
ATOM   1680 O  OG1 . THR A 1 218 ? 10.795  18.298  0.808   1.00 36.15 ? 217  THR A OG1 1 
ATOM   1681 C  CG2 . THR A 1 218 ? 9.937   18.864  2.960   1.00 33.09 ? 217  THR A CG2 1 
ATOM   1682 N  N   . SER A 1 219 ? 11.330  15.554  2.003   1.00 30.96 ? 218  SER A N   1 
ATOM   1683 C  CA  . SER A 1 219 ? 12.452  14.857  2.631   1.00 31.06 ? 218  SER A CA  1 
ATOM   1684 C  C   . SER A 1 219 ? 13.525  15.881  2.994   1.00 30.71 ? 218  SER A C   1 
ATOM   1685 O  O   . SER A 1 219 ? 14.235  15.747  3.992   1.00 29.77 ? 218  SER A O   1 
ATOM   1686 C  CB  . SER A 1 219 ? 13.020  13.848  1.627   1.00 31.74 ? 218  SER A CB  1 
ATOM   1687 O  OG  . SER A 1 219 ? 14.168  13.209  2.135   1.00 31.38 ? 218  SER A OG  1 
ATOM   1688 N  N   . GLN A 1 220 ? 13.588  16.942  2.193   1.00 31.75 ? 219  GLN A N   1 
ATOM   1689 C  CA  . GLN A 1 220 ? 14.563  18.043  2.358   1.00 31.90 ? 219  GLN A CA  1 
ATOM   1690 C  C   . GLN A 1 220 ? 14.524  18.742  3.726   1.00 29.29 ? 219  GLN A C   1 
ATOM   1691 O  O   . GLN A 1 220 ? 13.457  19.056  4.229   1.00 27.39 ? 219  GLN A O   1 
ATOM   1692 C  CB  . GLN A 1 220 ? 14.297  19.073  1.247   1.00 34.14 ? 219  GLN A CB  1 
ATOM   1693 C  CG  . GLN A 1 220 ? 15.147  20.353  1.253   1.00 36.77 ? 219  GLN A CG  1 
ATOM   1694 C  CD  . GLN A 1 220 ? 14.642  21.386  0.223   1.00 39.22 ? 219  GLN A CD  1 
ATOM   1695 O  OE1 . GLN A 1 220 ? 13.762  21.098  -0.606  1.00 40.89 ? 219  GLN A OE1 1 
ATOM   1696 N  NE2 . GLN A 1 220 ? 15.169  22.595  0.298   1.00 40.00 ? 219  GLN A NE2 1 
ATOM   1697 N  N   . GLN A 1 221 ? 15.690  18.969  4.331   1.00 28.92 ? 220  GLN A N   1 
ATOM   1698 C  CA  . GLN A 1 221 ? 15.749  19.685  5.593   1.00 29.05 ? 220  GLN A CA  1 
ATOM   1699 C  C   . GLN A 1 221 ? 15.352  21.142  5.318   1.00 28.24 ? 220  GLN A C   1 
ATOM   1700 O  O   . GLN A 1 221 ? 15.831  21.752  4.374   1.00 25.27 ? 220  GLN A O   1 
ATOM   1701 C  CB  . GLN A 1 221 ? 17.126  19.571  6.215   1.00 31.83 ? 220  GLN A CB  1 
ATOM   1702 C  CG  . GLN A 1 221 ? 17.400  18.133  6.702   1.00 33.85 ? 220  GLN A CG  1 
ATOM   1703 C  CD  . GLN A 1 221 ? 18.822  17.910  7.167   1.00 36.00 ? 220  GLN A CD  1 
ATOM   1704 O  OE1 . GLN A 1 221 ? 19.616  17.244  6.490   1.00 35.99 ? 220  GLN A OE1 1 
ATOM   1705 N  NE2 . GLN A 1 221 ? 19.151  18.453  8.337   1.00 36.25 ? 220  GLN A NE2 1 
ATOM   1706 N  N   . MET A 1 222 ? 14.410  21.649  6.096   1.00 29.04 ? 221  MET A N   1 
ATOM   1707 C  CA  . MET A 1 222 ? 13.903  22.997  5.894   1.00 29.27 ? 221  MET A CA  1 
ATOM   1708 C  C   . MET A 1 222 ? 14.017  23.949  7.077   1.00 28.58 ? 221  MET A C   1 
ATOM   1709 O  O   . MET A 1 222 ? 13.624  25.118  6.958   1.00 26.04 ? 221  MET A O   1 
ATOM   1710 C  CB  . MET A 1 222 ? 12.435  22.937  5.463   1.00 28.09 ? 221  MET A CB  1 
ATOM   1711 C  CG  . MET A 1 222 ? 12.133  21.976  4.333   1.00 29.84 ? 221  MET A CG  1 
ATOM   1712 S  SD  . MET A 1 222 ? 10.388  21.879  4.060   1.00 33.87 ? 221  MET A SD  1 
ATOM   1713 C  CE  . MET A 1 222 ? 10.066  23.508  3.413   1.00 33.70 ? 221  MET A CE  1 
ATOM   1714 N  N   . GLY A 1 223 ? 14.566  23.490  8.204   1.00 27.30 ? 222  GLY A N   1 
ATOM   1715 C  CA  . GLY A 1 223 ? 14.649  24.387  9.352   1.00 28.06 ? 222  GLY A CA  1 
ATOM   1716 C  C   . GLY A 1 223 ? 15.964  24.341  10.085  1.00 27.45 ? 222  GLY A C   1 
ATOM   1717 O  O   . GLY A 1 223 ? 16.972  23.910  9.524   1.00 28.03 ? 222  GLY A O   1 
ATOM   1718 N  N   . HIS A 1 224 ? 15.972  24.929  11.286  1.00 27.18 ? 223  HIS A N   1 
ATOM   1719 C  CA  . HIS A 1 224 ? 17.128  24.923  12.177  1.00 26.01 ? 223  HIS A CA  1 
ATOM   1720 C  C   . HIS A 1 224 ? 17.180  23.538  12.830  1.00 27.63 ? 223  HIS A C   1 
ATOM   1721 O  O   . HIS A 1 224 ? 18.262  23.036  13.169  1.00 27.15 ? 223  HIS A O   1 
ATOM   1722 C  CB  . HIS A 1 224 ? 16.969  26.010  13.249  1.00 25.94 ? 223  HIS A CB  1 
ATOM   1723 C  CG  . HIS A 1 224 ? 17.132  27.397  12.704  1.00 26.57 ? 223  HIS A CG  1 
ATOM   1724 N  ND1 . HIS A 1 224 ? 16.079  28.263  12.517  1.00 25.49 ? 223  HIS A ND1 1 
ATOM   1725 C  CD2 . HIS A 1 224 ? 18.219  28.012  12.174  1.00 26.10 ? 223  HIS A CD2 1 
ATOM   1726 C  CE1 . HIS A 1 224 ? 16.501  29.340  11.883  1.00 25.58 ? 223  HIS A CE1 1 
ATOM   1727 N  NE2 . HIS A 1 224 ? 17.791  29.212  11.663  1.00 26.07 ? 223  HIS A NE2 1 
ATOM   1728 N  N   . LEU A 1 225 ? 16.004  22.915  12.939  1.00 25.30 ? 224  LEU A N   1 
ATOM   1729 C  CA  . LEU A 1 225 ? 15.818  21.589  13.517  1.00 26.88 ? 224  LEU A CA  1 
ATOM   1730 C  C   . LEU A 1 225 ? 14.758  20.881  12.681  1.00 26.07 ? 224  LEU A C   1 
ATOM   1731 O  O   . LEU A 1 225 ? 13.660  21.409  12.504  1.00 26.05 ? 224  LEU A O   1 
ATOM   1732 C  CB  . LEU A 1 225 ? 15.335  21.688  14.970  1.00 26.41 ? 224  LEU A CB  1 
ATOM   1733 C  CG  . LEU A 1 225 ? 16.364  22.137  15.991  1.00 26.46 ? 224  LEU A CG  1 
ATOM   1734 C  CD1 . LEU A 1 225 ? 15.739  22.070  17.380  1.00 28.41 ? 224  LEU A CD1 1 
ATOM   1735 C  CD2 . LEU A 1 225 ? 17.654  21.300  15.903  1.00 26.96 ? 224  LEU A CD2 1 
ATOM   1736 N  N   . ASP A 1 226 ? 15.110  19.708  12.159  1.00 25.38 ? 225  ASP A N   1 
ATOM   1737 C  CA  . ASP A 1 226 ? 14.231  18.884  11.318  1.00 25.71 ? 225  ASP A CA  1 
ATOM   1738 C  C   . ASP A 1 226 ? 14.115  17.504  11.957  1.00 26.84 ? 225  ASP A C   1 
ATOM   1739 O  O   . ASP A 1 226 ? 15.129  16.827  12.175  1.00 27.44 ? 225  ASP A O   1 
ATOM   1740 C  CB  . ASP A 1 226 ? 14.798  18.721  9.912   1.00 24.82 ? 225  ASP A CB  1 
ATOM   1741 C  CG  . ASP A 1 226 ? 14.621  19.953  9.071   1.00 26.48 ? 225  ASP A CG  1 
ATOM   1742 O  OD1 . ASP A 1 226 ? 15.452  20.878  9.190   1.00 25.88 ? 225  ASP A OD1 1 
ATOM   1743 O  OD2 . ASP A 1 226 ? 13.655  20.009  8.291   1.00 24.70 ? 225  ASP A OD2 1 
ATOM   1744 N  N   . PHE A 1 227 ? 12.871  17.070  12.134  1.00 26.38 ? 226  PHE A N   1 
ATOM   1745 C  CA  . PHE A 1 227 ? 12.514  15.821  12.787  1.00 25.77 ? 226  PHE A CA  1 
ATOM   1746 C  C   . PHE A 1 227 ? 11.831  14.890  11.828  1.00 26.31 ? 226  PHE A C   1 
ATOM   1747 O  O   . PHE A 1 227 ? 10.921  15.300  11.079  1.00 23.31 ? 226  PHE A O   1 
ATOM   1748 C  CB  . PHE A 1 227 ? 11.564  16.098  13.958  1.00 24.67 ? 226  PHE A CB  1 
ATOM   1749 C  CG  . PHE A 1 227 ? 12.135  17.001  14.990  1.00 26.23 ? 226  PHE A CG  1 
ATOM   1750 C  CD1 . PHE A 1 227 ? 12.014  18.386  14.853  1.00 26.81 ? 226  PHE A CD1 1 
ATOM   1751 C  CD2 . PHE A 1 227 ? 12.837  16.479  16.091  1.00 23.99 ? 226  PHE A CD2 1 
ATOM   1752 C  CE1 . PHE A 1 227 ? 12.594  19.247  15.794  1.00 26.03 ? 226  PHE A CE1 1 
ATOM   1753 C  CE2 . PHE A 1 227 ? 13.417  17.340  17.032  1.00 24.69 ? 226  PHE A CE2 1 
ATOM   1754 C  CZ  . PHE A 1 227 ? 13.298  18.723  16.879  1.00 26.85 ? 226  PHE A CZ  1 
ATOM   1755 N  N   . PHE A 1 228 ? 12.243  13.627  11.894  1.00 25.37 ? 227  PHE A N   1 
ATOM   1756 C  CA  . PHE A 1 228 ? 11.704  12.585  11.033  1.00 25.32 ? 227  PHE A CA  1 
ATOM   1757 C  C   . PHE A 1 228 ? 11.195  11.426  11.892  1.00 24.61 ? 227  PHE A C   1 
ATOM   1758 O  O   . PHE A 1 228 ? 11.817  10.359  11.979  1.00 26.20 ? 227  PHE A O   1 
ATOM   1759 C  CB  . PHE A 1 228 ? 12.800  12.117  10.080  1.00 23.44 ? 227  PHE A CB  1 
ATOM   1760 C  CG  . PHE A 1 228 ? 13.404  13.242  9.259   1.00 24.92 ? 227  PHE A CG  1 
ATOM   1761 C  CD1 . PHE A 1 228 ? 14.370  14.081  9.815   1.00 21.66 ? 227  PHE A CD1 1 
ATOM   1762 C  CD2 . PHE A 1 228 ? 12.987  13.472  7.950   1.00 23.92 ? 227  PHE A CD2 1 
ATOM   1763 C  CE1 . PHE A 1 228 ? 14.894  15.116  9.085   1.00 22.68 ? 227  PHE A CE1 1 
ATOM   1764 C  CE2 . PHE A 1 228 ? 13.518  14.516  7.209   1.00 24.30 ? 227  PHE A CE2 1 
ATOM   1765 C  CZ  . PHE A 1 228 ? 14.475  15.339  7.785   1.00 23.34 ? 227  PHE A CZ  1 
ATOM   1766 N  N   . PRO A 1 229 ? 10.063  11.628  12.552  1.00 25.45 ? 228  PRO A N   1 
ATOM   1767 C  CA  . PRO A 1 229 ? 9.520   10.558  13.394  1.00 25.41 ? 228  PRO A CA  1 
ATOM   1768 C  C   . PRO A 1 229 ? 9.170   9.337   12.529  1.00 26.01 ? 228  PRO A C   1 
ATOM   1769 O  O   . PRO A 1 229 ? 8.617   9.464   11.434  1.00 23.94 ? 228  PRO A O   1 
ATOM   1770 C  CB  . PRO A 1 229 ? 8.276   11.203  14.007  1.00 24.21 ? 228  PRO A CB  1 
ATOM   1771 C  CG  . PRO A 1 229 ? 7.843   12.189  12.947  1.00 22.10 ? 228  PRO A CG  1 
ATOM   1772 C  CD  . PRO A 1 229 ? 9.135   12.771  12.462  1.00 25.58 ? 228  PRO A CD  1 
ATOM   1773 N  N   . ASN A 1 230 ? 9.612   8.168   12.999  1.00 27.84 ? 229  ASN A N   1 
ATOM   1774 C  CA  . ASN A 1 230 ? 9.374   6.901   12.322  1.00 26.23 ? 229  ASN A CA  1 
ATOM   1775 C  C   . ASN A 1 230 ? 10.007  6.912   10.944  1.00 24.80 ? 229  ASN A C   1 
ATOM   1776 O  O   . ASN A 1 230 ? 9.575   6.207   10.036  1.00 27.98 ? 229  ASN A O   1 
ATOM   1777 C  CB  . ASN A 1 230 ? 7.887   6.613   12.240  1.00 26.94 ? 229  ASN A CB  1 
ATOM   1778 C  CG  . ASN A 1 230 ? 7.179   6.831   13.562  1.00 27.87 ? 229  ASN A CG  1 
ATOM   1779 O  OD1 . ASN A 1 230 ? 7.533   6.227   14.579  1.00 26.99 ? 229  ASN A OD1 1 
ATOM   1780 N  ND2 . ASN A 1 230 ? 6.185   7.726   13.569  1.00 26.36 ? 229  ASN A ND2 1 
ATOM   1781 N  N   . GLY A 1 231 ? 11.049  7.713   10.794  1.00 23.68 ? 230  GLY A N   1 
ATOM   1782 C  CA  . GLY A 1 231 ? 11.743  7.801   9.511   1.00 24.38 ? 230  GLY A CA  1 
ATOM   1783 C  C   . GLY A 1 231 ? 11.294  8.913   8.581   1.00 24.18 ? 230  GLY A C   1 
ATOM   1784 O  O   . GLY A 1 231 ? 12.016  9.258   7.637   1.00 23.59 ? 230  GLY A O   1 
ATOM   1785 N  N   . GLY A 1 232 ? 10.100  9.445   8.833   1.00 25.94 ? 231  GLY A N   1 
ATOM   1786 C  CA  . GLY A 1 232 ? 9.538   10.519  8.031   1.00 25.80 ? 231  GLY A CA  1 
ATOM   1787 C  C   . GLY A 1 232 ? 8.709   10.189  6.791   1.00 29.04 ? 231  GLY A C   1 
ATOM   1788 O  O   . GLY A 1 232 ? 8.132   11.109  6.198   1.00 29.96 ? 231  GLY A O   1 
ATOM   1789 N  N   . GLU A 1 233 ? 8.599   8.912   6.419   1.00 28.66 ? 232  GLU A N   1 
ATOM   1790 C  CA  . GLU A 1 233 ? 7.857   8.526   5.201   1.00 30.02 ? 232  GLU A CA  1 
ATOM   1791 C  C   . GLU A 1 233 ? 6.557   7.776   5.389   1.00 29.14 ? 232  GLU A C   1 
ATOM   1792 O  O   . GLU A 1 233 ? 5.607   8.010   4.631   1.00 27.33 ? 232  GLU A O   1 
ATOM   1793 C  CB  . GLU A 1 233 ? 8.752   7.747   4.229   1.00 30.46 ? 232  GLU A CB  1 
ATOM   1794 C  CG  . GLU A 1 233 ? 10.142  8.308   4.113   1.00 34.32 ? 232  GLU A CG  1 
ATOM   1795 C  CD  . GLU A 1 233 ? 10.959  7.656   3.013   1.00 36.87 ? 232  GLU A CD  1 
ATOM   1796 O  OE1 . GLU A 1 233 ? 10.562  6.585   2.518   1.00 40.79 ? 232  GLU A OE1 1 
ATOM   1797 O  OE2 . GLU A 1 233 ? 11.988  8.230   2.624   1.00 38.78 ? 232  GLU A OE2 1 
ATOM   1798 N  N   . GLU A 1 234 ? 6.535   6.842   6.342   1.00 28.09 ? 233  GLU A N   1 
ATOM   1799 C  CA  . GLU A 1 234 ? 5.344   6.031   6.630   1.00 30.81 ? 233  GLU A CA  1 
ATOM   1800 C  C   . GLU A 1 234 ? 5.136   6.039   8.135   1.00 27.28 ? 233  GLU A C   1 
ATOM   1801 O  O   . GLU A 1 234 ? 6.030   5.691   8.891   1.00 26.17 ? 233  GLU A O   1 
ATOM   1802 C  CB  . GLU A 1 234 ? 5.521   4.557   6.172   1.00 33.96 ? 233  GLU A CB  1 
ATOM   1803 C  CG  . GLU A 1 234 ? 6.399   4.341   4.971   1.00 38.61 ? 233  GLU A CG  1 
ATOM   1804 C  CD  . GLU A 1 234 ? 6.564   2.864   4.604   1.00 42.40 ? 233  GLU A CD  1 
ATOM   1805 O  OE1 . GLU A 1 234 ? 5.642   2.284   3.988   1.00 43.67 ? 233  GLU A OE1 1 
ATOM   1806 O  OE2 . GLU A 1 234 ? 7.624   2.288   4.915   1.00 44.49 ? 233  GLU A OE2 1 
ATOM   1807 N  N   . MET A 1 235 ? 3.958   6.422   8.583   1.00 27.86 ? 234  MET A N   1 
ATOM   1808 C  CA  . MET A 1 235 ? 3.715   6.491   10.007  1.00 27.38 ? 234  MET A CA  1 
ATOM   1809 C  C   . MET A 1 235 ? 2.965   5.249   10.472  1.00 29.42 ? 234  MET A C   1 
ATOM   1810 O  O   . MET A 1 235 ? 2.066   4.765   9.787   1.00 30.53 ? 234  MET A O   1 
ATOM   1811 C  CB  . MET A 1 235 ? 2.908   7.764   10.359  1.00 27.95 ? 234  MET A CB  1 
ATOM   1812 C  CG  . MET A 1 235 ? 3.589   9.107   9.958   1.00 26.19 ? 234  MET A CG  1 
ATOM   1813 S  SD  . MET A 1 235 ? 5.202   9.408   10.755  1.00 25.39 ? 234  MET A SD  1 
ATOM   1814 C  CE  . MET A 1 235 ? 6.303   9.096   9.478   1.00 21.87 ? 234  MET A CE  1 
ATOM   1815 N  N   . PRO A 1 236 ? 3.364   4.678   11.621  1.00 31.38 ? 235  PRO A N   1 
ATOM   1816 C  CA  . PRO A 1 236 ? 2.666   3.490   12.126  1.00 32.37 ? 235  PRO A CA  1 
ATOM   1817 C  C   . PRO A 1 236 ? 1.203   3.852   12.408  1.00 33.54 ? 235  PRO A C   1 
ATOM   1818 O  O   . PRO A 1 236 ? 0.919   4.939   12.938  1.00 34.55 ? 235  PRO A O   1 
ATOM   1819 C  CB  . PRO A 1 236 ? 3.435   3.168   13.423  1.00 32.48 ? 235  PRO A CB  1 
ATOM   1820 C  CG  . PRO A 1 236 ? 4.031   4.466   13.835  1.00 32.10 ? 235  PRO A CG  1 
ATOM   1821 C  CD  . PRO A 1 236 ? 4.486   5.033   12.507  1.00 30.49 ? 235  PRO A CD  1 
ATOM   1822 N  N   . GLY A 1 237 ? 0.290   2.958   12.008  1.00 33.79 ? 236  GLY A N   1 
ATOM   1823 C  CA  . GLY A 1 237 ? -1.134  3.187   12.203  1.00 34.46 ? 236  GLY A CA  1 
ATOM   1824 C  C   . GLY A 1 237 ? -1.806  3.928   11.047  1.00 36.06 ? 236  GLY A C   1 
ATOM   1825 O  O   . GLY A 1 237 ? -2.978  4.286   11.130  1.00 38.69 ? 236  GLY A O   1 
ATOM   1826 N  N   . CYS A 1 238 ? -1.048  4.217   10.002  1.00 37.09 ? 237  CYS A N   1 
ATOM   1827 C  CA  . CYS A 1 238 ? -1.575  4.911   8.842   1.00 36.29 ? 237  CYS A CA  1 
ATOM   1828 C  C   . CYS A 1 238 ? -1.584  4.006   7.622   1.00 37.98 ? 237  CYS A C   1 
ATOM   1829 O  O   . CYS A 1 238 ? -0.614  3.289   7.364   1.00 38.07 ? 237  CYS A O   1 
ATOM   1830 C  CB  . CYS A 1 238 ? -0.713  6.143   8.499   1.00 34.50 ? 237  CYS A CB  1 
ATOM   1831 S  SG  . CYS A 1 238 ? -1.056  7.663   9.457   1.00 28.01 ? 237  CYS A SG  1 
ATOM   1832 N  N   . LYS A 1 239 ? -2.692  4.011   6.890   1.00 39.84 ? 238  LYS A N   1 
ATOM   1833 C  CA  . LYS A 1 239 ? -2.782  3.242   5.653   1.00 41.70 ? 238  LYS A CA  1 
ATOM   1834 C  C   . LYS A 1 239 ? -2.025  4.107   4.645   1.00 42.88 ? 238  LYS A C   1 
ATOM   1835 O  O   . LYS A 1 239 ? -1.789  5.296   4.889   1.00 43.30 ? 238  LYS A O   1 
ATOM   1836 C  CB  . LYS A 1 239 ? -4.239  3.053   5.229   1.00 42.04 ? 238  LYS A CB  1 
ATOM   1837 C  CG  . LYS A 1 239 ? -5.066  2.245   6.221   1.00 43.49 ? 238  LYS A CG  1 
ATOM   1838 C  CD  . LYS A 1 239 ? -6.500  2.078   5.723   1.00 46.17 ? 238  LYS A CD  1 
ATOM   1839 C  CE  . LYS A 1 239 ? -7.380  1.291   6.711   1.00 46.89 ? 238  LYS A CE  1 
ATOM   1840 N  NZ  . LYS A 1 239 ? -8.787  1.179   6.194   1.00 47.26 ? 238  LYS A NZ  1 
ATOM   1841 N  N   . LYS A 1 240 ? -1.629  3.523   3.521   1.00 41.77 ? 239  LYS A N   1 
ATOM   1842 C  CA  . LYS A 1 240 ? -0.871  4.240   2.508   1.00 41.90 ? 239  LYS A CA  1 
ATOM   1843 C  C   . LYS A 1 240 ? -1.684  4.395   1.228   1.00 40.71 ? 239  LYS A C   1 
ATOM   1844 O  O   . LYS A 1 240 ? -2.763  3.818   1.086   1.00 42.02 ? 239  LYS A O   1 
ATOM   1845 C  CB  . LYS A 1 240 ? 0.419   3.482   2.184   1.00 42.51 ? 239  LYS A CB  1 
ATOM   1846 C  CG  . LYS A 1 240 ? 1.252   3.092   3.382   1.00 44.66 ? 239  LYS A CG  1 
ATOM   1847 C  CD  . LYS A 1 240 ? 2.728   3.109   3.025   1.00 46.64 ? 239  LYS A CD  1 
ATOM   1848 C  CE  . LYS A 1 240 ? 3.183   4.542   2.727   1.00 47.46 ? 239  LYS A CE  1 
ATOM   1849 N  NZ  . LYS A 1 240 ? 4.642   4.652   2.406   1.00 48.00 ? 239  LYS A NZ  1 
ATOM   1850 N  N   . ASN A 1 241 ? -1.179  5.201   0.304   1.00 39.84 ? 240  ASN A N   1 
ATOM   1851 C  CA  . ASN A 1 241 ? -1.861  5.398   -0.974  1.00 38.15 ? 240  ASN A CA  1 
ATOM   1852 C  C   . ASN A 1 241 ? -1.361  4.355   -1.977  1.00 38.18 ? 240  ASN A C   1 
ATOM   1853 O  O   . ASN A 1 241 ? -0.188  3.955   -1.920  1.00 35.19 ? 240  ASN A O   1 
ATOM   1854 C  CB  . ASN A 1 241 ? -1.552  6.789   -1.545  1.00 37.95 ? 240  ASN A CB  1 
ATOM   1855 C  CG  . ASN A 1 241 ? -2.249  7.890   -0.801  1.00 36.57 ? 240  ASN A CG  1 
ATOM   1856 O  OD1 . ASN A 1 241 ? -3.408  8.196   -1.074  1.00 36.06 ? 240  ASN A OD1 1 
ATOM   1857 N  ND2 . ASN A 1 241 ? -1.561  8.485   0.156   1.00 36.00 ? 240  ASN A ND2 1 
ATOM   1858 N  N   . ALA A 1 242 ? -2.229  3.939   -2.899  1.00 39.09 ? 241  ALA A N   1 
ATOM   1859 C  CA  . ALA A 1 242 ? -1.850  2.987   -3.947  1.00 41.63 ? 241  ALA A CA  1 
ATOM   1860 C  C   . ALA A 1 242 ? -0.861  3.701   -4.867  1.00 42.29 ? 241  ALA A C   1 
ATOM   1861 O  O   . ALA A 1 242 ? -1.093  4.853   -5.272  1.00 43.78 ? 241  ALA A O   1 
ATOM   1862 C  CB  . ALA A 1 242 ? -3.087  2.543   -4.746  1.00 41.62 ? 241  ALA A CB  1 
ATOM   1863 N  N   . LEU A 1 243 ? 0.243   3.042   -5.192  1.00 41.89 ? 242  LEU A N   1 
ATOM   1864 C  CA  . LEU A 1 243 ? 1.239   3.664   -6.052  1.00 42.64 ? 242  LEU A CA  1 
ATOM   1865 C  C   . LEU A 1 243 ? 0.642   4.040   -7.403  1.00 43.41 ? 242  LEU A C   1 
ATOM   1866 O  O   . LEU A 1 243 ? -0.453  3.594   -7.764  1.00 43.65 ? 242  LEU A O   1 
ATOM   1867 C  CB  . LEU A 1 243 ? 2.431   2.731   -6.269  1.00 43.87 ? 242  LEU A CB  1 
ATOM   1868 C  CG  . LEU A 1 243 ? 2.888   1.813   -5.128  1.00 44.00 ? 242  LEU A CG  1 
ATOM   1869 C  CD1 . LEU A 1 243 ? 4.058   0.934   -5.609  1.00 43.14 ? 242  LEU A CD1 1 
ATOM   1870 C  CD2 . LEU A 1 243 ? 3.275   2.613   -3.915  1.00 44.16 ? 242  LEU A CD2 1 
ATOM   1871 N  N   . SER A 1 244 ? 1.347   4.902   -8.123  1.00 44.36 ? 243  SER A N   1 
ATOM   1872 C  CA  . SER A 1 244 ? 0.921   5.328   -9.438  1.00 44.34 ? 243  SER A CA  1 
ATOM   1873 C  C   . SER A 1 244 ? 1.917   6.290   -10.039 1.00 45.26 ? 243  SER A C   1 
ATOM   1874 O  O   . SER A 1 244 ? 2.440   7.179   -9.358  1.00 45.02 ? 243  SER A O   1 
ATOM   1875 C  CB  . SER A 1 244 ? -0.458  5.986   -9.405  1.00 44.66 ? 243  SER A CB  1 
ATOM   1876 O  OG  . SER A 1 244 ? -0.851  6.329   -10.730 1.00 46.06 ? 243  SER A OG  1 
ATOM   1877 N  N   . GLN A 1 245 ? 2.177   6.100   -11.327 1.00 46.11 ? 244  GLN A N   1 
ATOM   1878 C  CA  . GLN A 1 245 ? 3.101   6.945   -12.071 1.00 47.02 ? 244  GLN A CA  1 
ATOM   1879 C  C   . GLN A 1 245 ? 2.416   8.245   -12.467 1.00 46.13 ? 244  GLN A C   1 
ATOM   1880 O  O   . GLN A 1 245 ? 3.065   9.172   -12.932 1.00 47.81 ? 244  GLN A O   1 
ATOM   1881 C  CB  . GLN A 1 245 ? 3.581   6.216   -13.326 1.00 46.94 ? 244  GLN A CB  1 
ATOM   1882 C  CG  . GLN A 1 245 ? 4.401   4.976   -13.031 1.00 49.29 ? 244  GLN A CG  1 
ATOM   1883 C  CD  . GLN A 1 245 ? 5.757   5.304   -12.433 1.00 49.71 ? 244  GLN A CD  1 
ATOM   1884 O  OE1 . GLN A 1 245 ? 6.481   6.175   -12.930 1.00 50.60 ? 244  GLN A OE1 1 
ATOM   1885 N  NE2 . GLN A 1 245 ? 6.122   4.592   -11.373 1.00 49.45 ? 244  GLN A NE2 1 
ATOM   1886 N  N   . ILE A 1 246 ? 1.095   8.276   -12.333 1.00 47.35 ? 245  ILE A N   1 
ATOM   1887 C  CA  . ILE A 1 246 ? 0.317   9.458   -12.663 1.00 46.93 ? 245  ILE A CA  1 
ATOM   1888 C  C   . ILE A 1 246 ? -0.543  9.871   -11.473 1.00 47.42 ? 245  ILE A C   1 
ATOM   1889 O  O   . ILE A 1 246 ? -1.489  9.164   -11.079 1.00 48.53 ? 245  ILE A O   1 
ATOM   1890 C  CB  . ILE A 1 246 ? -0.581  9.235   -13.922 1.00 46.98 ? 245  ILE A CB  1 
ATOM   1891 C  CG1 . ILE A 1 246 ? -1.462  10.463  -14.175 0.00 46.42 ? 245  ILE A CG1 1 
ATOM   1892 C  CG2 . ILE A 1 246 ? -1.409  7.958   -13.785 0.00 46.59 ? 245  ILE A CG2 1 
ATOM   1893 C  CD1 . ILE A 1 246 ? -2.312  10.369  -15.427 0.00 46.17 ? 245  ILE A CD1 1 
ATOM   1894 N  N   . VAL A 1 247 ? -0.201  11.010  -10.878 1.00 46.61 ? 246  VAL A N   1 
ATOM   1895 C  CA  . VAL A 1 247 ? -0.965  11.515  -9.743  1.00 44.19 ? 246  VAL A CA  1 
ATOM   1896 C  C   . VAL A 1 247 ? -1.750  12.777  -10.139 1.00 42.68 ? 246  VAL A C   1 
ATOM   1897 O  O   . VAL A 1 247 ? -1.254  13.655  -10.859 1.00 42.23 ? 246  VAL A O   1 
ATOM   1898 C  CB  . VAL A 1 247 ? -0.074  11.724  -8.462  1.00 44.05 ? 246  VAL A CB  1 
ATOM   1899 C  CG1 . VAL A 1 247 ? 1.398   11.412  -8.740  1.00 43.44 ? 246  VAL A CG1 1 
ATOM   1900 C  CG2 . VAL A 1 247 ? -0.241  13.125  -7.910  1.00 44.30 ? 246  VAL A CG2 1 
ATOM   1901 N  N   . ASP A 1 248 ? -2.996  12.831  -9.706  1.00 42.00 ? 247  ASP A N   1 
ATOM   1902 C  CA  . ASP A 1 248 ? -3.875  13.950  -10.020 1.00 40.96 ? 247  ASP A CA  1 
ATOM   1903 C  C   . ASP A 1 248 ? -3.863  14.895  -8.839  1.00 39.36 ? 247  ASP A C   1 
ATOM   1904 O  O   . ASP A 1 248 ? -4.726  14.779  -7.970  1.00 39.85 ? 247  ASP A O   1 
ATOM   1905 C  CB  . ASP A 1 248 ? -5.301  13.431  -10.231 1.00 41.37 ? 247  ASP A CB  1 
ATOM   1906 C  CG  . ASP A 1 248 ? -6.246  14.488  -10.765 1.00 41.55 ? 247  ASP A CG  1 
ATOM   1907 O  OD1 . ASP A 1 248 ? -5.778  15.562  -11.222 1.00 44.16 ? 247  ASP A OD1 1 
ATOM   1908 O  OD2 . ASP A 1 248 ? -7.475  14.234  -10.748 1.00 40.79 ? 247  ASP A OD2 1 
ATOM   1909 N  N   . LEU A 1 249 ? -2.863  15.785  -8.771  1.00 36.65 ? 248  LEU A N   1 
ATOM   1910 C  CA  . LEU A 1 249 ? -2.797  16.744  -7.666  1.00 35.65 ? 248  LEU A CA  1 
ATOM   1911 C  C   . LEU A 1 249 ? -4.038  17.633  -7.637  1.00 34.32 ? 248  LEU A C   1 
ATOM   1912 O  O   . LEU A 1 249 ? -4.702  17.721  -6.604  1.00 35.88 ? 248  LEU A O   1 
ATOM   1913 C  CB  . LEU A 1 249 ? -1.510  17.596  -7.707  1.00 35.04 ? 248  LEU A CB  1 
ATOM   1914 C  CG  . LEU A 1 249 ? -0.332  17.000  -6.928  1.00 35.56 ? 248  LEU A CG  1 
ATOM   1915 C  CD1 . LEU A 1 249 ? 0.965   17.803  -7.077  1.00 36.67 ? 248  LEU A CD1 1 
ATOM   1916 C  CD2 . LEU A 1 249 ? -0.720  16.838  -5.488  1.00 36.01 ? 248  LEU A CD2 1 
ATOM   1917 N  N   . ASP A 1 250 ? -4.421  18.181  -8.800  1.00 34.59 ? 249  ASP A N   1 
ATOM   1918 C  CA  . ASP A 1 250 ? -5.592  19.066  -8.892  1.00 33.77 ? 249  ASP A CA  1 
ATOM   1919 C  C   . ASP A 1 250 ? -6.827  18.405  -8.343  1.00 34.87 ? 249  ASP A C   1 
ATOM   1920 O  O   . ASP A 1 250 ? -7.519  18.983  -7.501  1.00 35.70 ? 249  ASP A O   1 
ATOM   1921 C  CB  . ASP A 1 250 ? -5.842  19.570  -10.332 1.00 33.56 ? 249  ASP A CB  1 
ATOM   1922 C  CG  . ASP A 1 250 ? -4.690  20.391  -10.878 1.00 31.79 ? 249  ASP A CG  1 
ATOM   1923 O  OD1 . ASP A 1 250 ? -3.834  20.798  -10.071 1.00 31.73 ? 249  ASP A OD1 1 
ATOM   1924 O  OD2 . ASP A 1 250 ? -4.587  20.595  -12.128 1.00 32.11 ? 249  ASP A OD2 1 
ATOM   1925 N  N   . GLY A 1 251 ? -7.076  17.173  -8.781  1.00 36.12 ? 250  GLY A N   1 
ATOM   1926 C  CA  . GLY A 1 251 ? -8.235  16.429  -8.320  1.00 31.82 ? 250  GLY A CA  1 
ATOM   1927 C  C   . GLY A 1 251 ? -8.232  16.219  -6.813  1.00 31.78 ? 250  GLY A C   1 
ATOM   1928 O  O   . GLY A 1 251 ? -9.282  16.330  -6.178  1.00 30.56 ? 250  GLY A O   1 
ATOM   1929 N  N   . ILE A 1 252 ? -7.081  15.885  -6.226  1.00 30.92 ? 251  ILE A N   1 
ATOM   1930 C  CA  . ILE A 1 252 ? -7.019  15.698  -4.769  1.00 31.24 ? 251  ILE A CA  1 
ATOM   1931 C  C   . ILE A 1 252 ? -7.299  17.000  -3.983  1.00 31.76 ? 251  ILE A C   1 
ATOM   1932 O  O   . ILE A 1 252 ? -8.035  16.986  -2.985  1.00 29.49 ? 251  ILE A O   1 
ATOM   1933 C  CB  . ILE A 1 252 ? -5.644  15.135  -4.295  1.00 31.92 ? 251  ILE A CB  1 
ATOM   1934 C  CG1 . ILE A 1 252 ? -5.437  13.695  -4.785  1.00 31.22 ? 251  ILE A CG1 1 
ATOM   1935 C  CG2 . ILE A 1 252 ? -5.570  15.152  -2.773  1.00 30.67 ? 251  ILE A CG2 1 
ATOM   1936 C  CD1 . ILE A 1 252 ? -3.997  13.203  -4.688  1.00 29.28 ? 251  ILE A CD1 1 
ATOM   1937 N  N   . TRP A 1 253 ? -6.716  18.114  -4.422  1.00 31.99 ? 252  TRP A N   1 
ATOM   1938 C  CA  . TRP A 1 253 ? -6.915  19.387  -3.726  1.00 32.03 ? 252  TRP A CA  1 
ATOM   1939 C  C   . TRP A 1 253 ? -8.300  20.008  -3.928  1.00 33.03 ? 252  TRP A C   1 
ATOM   1940 O  O   . TRP A 1 253 ? -8.817  20.687  -3.037  1.00 33.24 ? 252  TRP A O   1 
ATOM   1941 C  CB  . TRP A 1 253 ? -5.776  20.359  -4.072  1.00 31.24 ? 252  TRP A CB  1 
ATOM   1942 C  CG  . TRP A 1 253 ? -4.511  19.982  -3.366  1.00 31.77 ? 252  TRP A CG  1 
ATOM   1943 C  CD1 . TRP A 1 253 ? -3.556  19.104  -3.796  1.00 31.69 ? 252  TRP A CD1 1 
ATOM   1944 C  CD2 . TRP A 1 253 ? -4.101  20.408  -2.059  1.00 30.55 ? 252  TRP A CD2 1 
ATOM   1945 N  NE1 . TRP A 1 253 ? -2.572  18.957  -2.833  1.00 31.68 ? 252  TRP A NE1 1 
ATOM   1946 C  CE2 . TRP A 1 253 ? -2.888  19.750  -1.756  1.00 30.83 ? 252  TRP A CE2 1 
ATOM   1947 C  CE3 . TRP A 1 253 ? -4.638  21.293  -1.113  1.00 31.29 ? 252  TRP A CE3 1 
ATOM   1948 C  CZ2 . TRP A 1 253 ? -2.207  19.948  -0.561  1.00 31.00 ? 252  TRP A CZ2 1 
ATOM   1949 C  CZ3 . TRP A 1 253 ? -3.957  21.493  0.077   1.00 29.31 ? 252  TRP A CZ3 1 
ATOM   1950 C  CH2 . TRP A 1 253 ? -2.755  20.822  0.338   1.00 30.76 ? 252  TRP A CH2 1 
ATOM   1951 N  N   . GLU A 1 254 ? -8.922  19.775  -5.081  1.00 34.25 ? 253  GLU A N   1 
ATOM   1952 C  CA  . GLU A 1 254 ? -10.271 20.305  -5.268  1.00 37.07 ? 253  GLU A CA  1 
ATOM   1953 C  C   . GLU A 1 254 ? -11.284 19.362  -4.602  1.00 36.61 ? 253  GLU A C   1 
ATOM   1954 O  O   . GLU A 1 254 ? -12.475 19.665  -4.502  1.00 34.61 ? 253  GLU A O   1 
ATOM   1955 C  CB  . GLU A 1 254 ? -10.593 20.633  -6.741  1.00 39.20 ? 253  GLU A CB  1 
ATOM   1956 C  CG  . GLU A 1 254 ? -10.325 19.556  -7.771  1.00 42.05 ? 253  GLU A CG  1 
ATOM   1957 C  CD  . GLU A 1 254 ? -9.949  20.125  -9.148  1.00 44.41 ? 253  GLU A CD  1 
ATOM   1958 O  OE1 . GLU A 1 254 ? -9.229  21.152  -9.221  1.00 44.66 ? 253  GLU A OE1 1 
ATOM   1959 O  OE2 . GLU A 1 254 ? -10.345 19.514  -10.161 1.00 45.64 ? 253  GLU A OE2 1 
ATOM   1960 N  N   . GLY A 1 255 ? -10.767 18.264  -4.047  1.00 37.28 ? 254  GLY A N   1 
ATOM   1961 C  CA  . GLY A 1 255 ? -11.605 17.313  -3.340  1.00 38.01 ? 254  GLY A CA  1 
ATOM   1962 C  C   . GLY A 1 255 ? -12.416 16.334  -4.169  1.00 40.18 ? 254  GLY A C   1 
ATOM   1963 O  O   . GLY A 1 255 ? -13.442 15.845  -3.707  1.00 39.54 ? 254  GLY A O   1 
ATOM   1964 N  N   . THR A 1 256 ? -11.984 16.051  -5.391  1.00 40.73 ? 255  THR A N   1 
ATOM   1965 C  CA  . THR A 1 256 ? -12.718 15.102  -6.214  1.00 43.16 ? 255  THR A CA  1 
ATOM   1966 C  C   . THR A 1 256 ? -12.016 13.739  -6.239  1.00 44.46 ? 255  THR A C   1 
ATOM   1967 O  O   . THR A 1 256 ? -12.651 12.706  -6.449  1.00 44.13 ? 255  THR A O   1 
ATOM   1968 C  CB  . THR A 1 256 ? -12.928 15.612  -7.660  1.00 42.46 ? 255  THR A CB  1 
ATOM   1969 O  OG1 . THR A 1 256 ? -11.777 16.340  -8.104  1.00 43.80 ? 255  THR A OG1 1 
ATOM   1970 C  CG2 . THR A 1 256 ? -14.154 16.487  -7.754  1.00 43.39 ? 255  THR A CG2 1 
ATOM   1971 N  N   . ARG A 1 257 ? -10.713 13.731  -5.989  1.00 45.08 ? 256  ARG A N   1 
ATOM   1972 C  CA  . ARG A 1 257 ? -9.970  12.488  -6.003  1.00 46.13 ? 256  ARG A CA  1 
ATOM   1973 C  C   . ARG A 1 257 ? -9.640  11.942  -4.627  1.00 46.57 ? 256  ARG A C   1 
ATOM   1974 O  O   . ARG A 1 257 ? -9.400  12.706  -3.691  1.00 46.20 ? 256  ARG A O   1 
ATOM   1975 C  CB  . ARG A 1 257 ? -8.702  12.621  -6.846  1.00 47.16 ? 256  ARG A CB  1 
ATOM   1976 C  CG  . ARG A 1 257 ? -8.974  12.525  -8.329  1.00 48.44 ? 256  ARG A CG  1 
ATOM   1977 C  CD  . ARG A 1 257 ? -9.815  11.286  -8.609  1.00 49.74 ? 256  ARG A CD  1 
ATOM   1978 N  NE  . ARG A 1 257 ? -10.101 11.096  -10.029 1.00 51.89 ? 256  ARG A NE  1 
ATOM   1979 C  CZ  . ARG A 1 257 ? -9.207  10.669  -10.917 1.00 53.15 ? 256  ARG A CZ  1 
ATOM   1980 N  NH1 . ARG A 1 257 ? -7.961  10.404  -10.533 1.00 53.25 ? 256  ARG A NH1 1 
ATOM   1981 N  NH2 . ARG A 1 257 ? -9.581  10.425  -12.170 1.00 53.64 ? 256  ARG A NH2 1 
ATOM   1982 N  N   . ASP A 1 258 ? -9.643  10.615  -4.511  1.00 46.35 ? 257  ASP A N   1 
ATOM   1983 C  CA  . ASP A 1 258 ? -9.333  9.945   -3.252  1.00 46.07 ? 257  ASP A CA  1 
ATOM   1984 C  C   . ASP A 1 258 ? -7.879  10.174  -2.878  1.00 43.39 ? 257  ASP A C   1 
ATOM   1985 O  O   . ASP A 1 258 ? -7.005  10.209  -3.749  1.00 44.63 ? 257  ASP A O   1 
ATOM   1986 C  CB  . ASP A 1 258 ? -9.589  8.434   -3.372  1.00 47.98 ? 257  ASP A CB  1 
ATOM   1987 C  CG  . ASP A 1 258 ? -11.067 8.079   -3.343  1.00 49.64 ? 257  ASP A CG  1 
ATOM   1988 O  OD1 . ASP A 1 258 ? -11.876 8.856   -2.779  1.00 50.91 ? 257  ASP A OD1 1 
ATOM   1989 O  OD2 . ASP A 1 258 ? -11.413 7.002   -3.858  1.00 50.62 ? 257  ASP A OD2 1 
ATOM   1990 N  N   . PHE A 1 259 ? -7.624  10.279  -1.583  1.00 40.62 ? 258  PHE A N   1 
ATOM   1991 C  CA  . PHE A 1 259 ? -6.275  10.478  -1.074  1.00 38.50 ? 258  PHE A CA  1 
ATOM   1992 C  C   . PHE A 1 259 ? -6.209  10.043  0.378   1.00 36.51 ? 258  PHE A C   1 
ATOM   1993 O  O   . PHE A 1 259 ? -7.024  10.461  1.198   1.00 37.89 ? 258  PHE A O   1 
ATOM   1994 C  CB  . PHE A 1 259 ? -5.863  11.960  -1.182  1.00 35.81 ? 258  PHE A CB  1 
ATOM   1995 C  CG  . PHE A 1 259 ? -4.507  12.241  -0.618  1.00 33.93 ? 258  PHE A CG  1 
ATOM   1996 C  CD1 . PHE A 1 259 ? -3.375  11.648  -1.178  1.00 33.49 ? 258  PHE A CD1 1 
ATOM   1997 C  CD2 . PHE A 1 259 ? -4.361  13.066  0.491   1.00 31.63 ? 258  PHE A CD2 1 
ATOM   1998 C  CE1 . PHE A 1 259 ? -2.118  11.875  -0.633  1.00 33.10 ? 258  PHE A CE1 1 
ATOM   1999 C  CE2 . PHE A 1 259 ? -3.106  13.301  1.043   1.00 32.33 ? 258  PHE A CE2 1 
ATOM   2000 C  CZ  . PHE A 1 259 ? -1.983  12.707  0.486   1.00 31.40 ? 258  PHE A CZ  1 
ATOM   2001 N  N   . VAL A 1 260 ? -5.220  9.230   0.720   1.00 35.06 ? 259  VAL A N   1 
ATOM   2002 C  CA  . VAL A 1 260 ? -5.077  8.773   2.105   1.00 34.50 ? 259  VAL A CA  1 
ATOM   2003 C  C   . VAL A 1 260 ? -4.171  9.779   2.796   1.00 33.43 ? 259  VAL A C   1 
ATOM   2004 O  O   . VAL A 1 260 ? -2.942  9.687   2.727   1.00 31.87 ? 259  VAL A O   1 
ATOM   2005 C  CB  . VAL A 1 260 ? -4.459  7.333   2.212   1.00 34.81 ? 259  VAL A CB  1 
ATOM   2006 C  CG1 . VAL A 1 260 ? -4.500  6.860   3.663   1.00 33.68 ? 259  VAL A CG1 1 
ATOM   2007 C  CG2 . VAL A 1 260 ? -5.232  6.361   1.334   1.00 35.18 ? 259  VAL A CG2 1 
ATOM   2008 N  N   . ALA A 1 261 ? -4.802  10.725  3.476   1.00 34.42 ? 260  ALA A N   1 
ATOM   2009 C  CA  . ALA A 1 261 ? -4.107  11.801  4.144   1.00 32.71 ? 260  ALA A CA  1 
ATOM   2010 C  C   . ALA A 1 261 ? -3.473  11.492  5.500   1.00 31.72 ? 260  ALA A C   1 
ATOM   2011 O  O   . ALA A 1 261 ? -2.704  12.312  6.019   1.00 29.01 ? 260  ALA A O   1 
ATOM   2012 C  CB  . ALA A 1 261 ? -5.045  13.018  4.256   1.00 34.37 ? 260  ALA A CB  1 
ATOM   2013 N  N   . CYS A 1 262 ? -3.701  10.294  6.026   1.00 29.22 ? 261  CYS A N   1 
ATOM   2014 C  CA  . CYS A 1 262 ? -3.163  9.913   7.335   1.00 28.83 ? 261  CYS A CA  1 
ATOM   2015 C  C   . CYS A 1 262 ? -1.722  10.332  7.603   1.00 27.65 ? 261  CYS A C   1 
ATOM   2016 O  O   . CYS A 1 262 ? -1.472  11.009  8.589   1.00 24.87 ? 261  CYS A O   1 
ATOM   2017 C  CB  . CYS A 1 262 ? -3.322  8.395   7.584   1.00 30.65 ? 261  CYS A CB  1 
ATOM   2018 S  SG  . CYS A 1 262 ? -3.061  7.877   9.309   1.00 34.21 ? 261  CYS A SG  1 
ATOM   2019 N  N   . ASN A 1 263 ? -0.783  9.927   6.748   1.00 28.03 ? 262  ASN A N   1 
ATOM   2020 C  CA  . ASN A 1 263 ? 0.634   10.271  6.930   1.00 28.63 ? 262  ASN A CA  1 
ATOM   2021 C  C   . ASN A 1 263 ? 0.855   11.814  6.952   1.00 28.09 ? 262  ASN A C   1 
ATOM   2022 O  O   . ASN A 1 263 ? 1.593   12.351  7.782   1.00 25.81 ? 262  ASN A O   1 
ATOM   2023 C  CB  . ASN A 1 263 ? 1.487   9.657   5.834   1.00 29.55 ? 262  ASN A CB  1 
ATOM   2024 C  CG  . ASN A 1 263 ? 1.792   8.175   6.054   1.00 30.69 ? 262  ASN A CG  1 
ATOM   2025 O  OD1 . ASN A 1 263 ? 1.954   7.719   7.175   1.00 30.59 ? 262  ASN A OD1 1 
ATOM   2026 N  ND2 . ASN A 1 263 ? 1.962   7.447   4.959   1.00 32.36 ? 262  ASN A ND2 1 
ATOM   2027 N  N   . HIS A 1 264 ? 0.238   12.504  6.005   1.00 27.31 ? 263  HIS A N   1 
ATOM   2028 C  CA  . HIS A 1 264 ? 0.330   13.953  5.901   1.00 28.35 ? 263  HIS A CA  1 
ATOM   2029 C  C   . HIS A 1 264 ? -0.206  14.637  7.181   1.00 26.94 ? 263  HIS A C   1 
ATOM   2030 O  O   . HIS A 1 264 ? 0.405   15.599  7.660   1.00 27.93 ? 263  HIS A O   1 
ATOM   2031 C  CB  . HIS A 1 264 ? -0.436  14.407  4.659   1.00 27.98 ? 263  HIS A CB  1 
ATOM   2032 C  CG  . HIS A 1 264 ? -0.220  15.845  4.291   1.00 29.22 ? 263  HIS A CG  1 
ATOM   2033 N  ND1 . HIS A 1 264 ? 1.021   16.446  4.280   1.00 29.79 ? 263  HIS A ND1 1 
ATOM   2034 C  CD2 . HIS A 1 264 ? -1.087  16.777  3.824   1.00 28.78 ? 263  HIS A CD2 1 
ATOM   2035 C  CE1 . HIS A 1 264 ? 0.919   17.672  3.811   1.00 28.37 ? 263  HIS A CE1 1 
ATOM   2036 N  NE2 . HIS A 1 264 ? -0.355  17.900  3.521   1.00 26.31 ? 263  HIS A NE2 1 
ATOM   2037 N  N   . LEU A 1 265 ? -1.308  14.144  7.748   1.00 26.81 ? 264  LEU A N   1 
ATOM   2038 C  CA  . LEU A 1 265 ? -1.871  14.742  8.971   1.00 27.08 ? 264  LEU A CA  1 
ATOM   2039 C  C   . LEU A 1 265 ? -1.196  14.378  10.275  1.00 27.56 ? 264  LEU A C   1 
ATOM   2040 O  O   . LEU A 1 265 ? -1.396  15.091  11.290  1.00 28.52 ? 264  LEU A O   1 
ATOM   2041 C  CB  . LEU A 1 265 ? -3.355  14.441  9.146   1.00 29.23 ? 264  LEU A CB  1 
ATOM   2042 C  CG  . LEU A 1 265 ? -4.337  14.420  7.989   1.00 28.80 ? 264  LEU A CG  1 
ATOM   2043 C  CD1 . LEU A 1 265 ? -5.698  14.136  8.583   1.00 29.77 ? 264  LEU A CD1 1 
ATOM   2044 C  CD2 . LEU A 1 265 ? -4.329  15.712  7.175   1.00 30.04 ? 264  LEU A CD2 1 
ATOM   2045 N  N   . ARG A 1 266 ? -0.429  13.278  10.293  1.00 23.53 ? 265  ARG A N   1 
ATOM   2046 C  CA  . ARG A 1 266 ? 0.265   12.890  11.519  1.00 25.41 ? 265  ARG A CA  1 
ATOM   2047 C  C   . ARG A 1 266 ? 1.112   14.021  12.110  1.00 24.13 ? 265  ARG A C   1 
ATOM   2048 O  O   . ARG A 1 266 ? 1.197   14.163  13.326  1.00 25.69 ? 265  ARG A O   1 
ATOM   2049 C  CB  . ARG A 1 266 ? 1.134   11.630  11.312  1.00 26.25 ? 265  ARG A CB  1 
ATOM   2050 C  CG  . ARG A 1 266 ? 0.360   10.300  11.335  1.00 31.05 ? 265  ARG A CG  1 
ATOM   2051 C  CD  . ARG A 1 266 ? -0.287  9.982   12.697  1.00 33.01 ? 265  ARG A CD  1 
ATOM   2052 N  NE  . ARG A 1 266 ? -1.340  8.966   12.570  1.00 39.05 ? 265  ARG A NE  1 
ATOM   2053 C  CZ  . ARG A 1 266 ? -1.432  7.884   13.338  1.00 39.55 ? 265  ARG A CZ  1 
ATOM   2054 N  NH1 . ARG A 1 266 ? -0.561  7.692   14.307  1.00 42.44 ? 265  ARG A NH1 1 
ATOM   2055 N  NH2 . ARG A 1 266 ? -2.405  7.004   13.168  1.00 40.21 ? 265  ARG A NH2 1 
ATOM   2056 N  N   . SER A 1 267 ? 1.736   14.833  11.259  1.00 24.09 ? 266  SER A N   1 
ATOM   2057 C  CA  . SER A 1 267 ? 2.579   15.923  11.757  1.00 21.25 ? 266  SER A CA  1 
ATOM   2058 C  C   . SER A 1 267 ? 1.896   16.781  12.821  1.00 21.27 ? 266  SER A C   1 
ATOM   2059 O  O   . SER A 1 267 ? 2.487   17.079  13.858  1.00 19.79 ? 266  SER A O   1 
ATOM   2060 C  CB  . SER A 1 267 ? 3.109   16.793  10.611  1.00 21.69 ? 266  SER A CB  1 
ATOM   2061 O  OG  . SER A 1 267 ? 2.081   17.182  9.700   1.00 23.05 ? 266  SER A OG  1 
ATOM   2062 N  N   . TYR A 1 268 ? 0.631   17.131  12.611  1.00 23.76 ? 267  TYR A N   1 
ATOM   2063 C  CA  . TYR A 1 268 ? -0.069  17.941  13.600  1.00 23.67 ? 267  TYR A CA  1 
ATOM   2064 C  C   . TYR A 1 268 ? -0.652  17.127  14.751  1.00 26.39 ? 267  TYR A C   1 
ATOM   2065 O  O   . TYR A 1 268 ? -0.938  17.678  15.829  1.00 28.14 ? 267  TYR A O   1 
ATOM   2066 C  CB  . TYR A 1 268 ? -1.114  18.876  12.955  1.00 20.91 ? 267  TYR A CB  1 
ATOM   2067 C  CG  . TYR A 1 268 ? -2.328  18.256  12.296  1.00 20.02 ? 267  TYR A CG  1 
ATOM   2068 C  CD1 . TYR A 1 268 ? -3.351  17.676  13.052  1.00 20.89 ? 267  TYR A CD1 1 
ATOM   2069 C  CD2 . TYR A 1 268 ? -2.503  18.371  10.932  1.00 19.20 ? 267  TYR A CD2 1 
ATOM   2070 C  CE1 . TYR A 1 268 ? -4.534  17.224  12.434  1.00 24.09 ? 267  TYR A CE1 1 
ATOM   2071 C  CE2 . TYR A 1 268 ? -3.660  17.946  10.304  1.00 22.34 ? 267  TYR A CE2 1 
ATOM   2072 C  CZ  . TYR A 1 268 ? -4.680  17.371  11.052  1.00 24.50 ? 267  TYR A CZ  1 
ATOM   2073 O  OH  . TYR A 1 268 ? -5.854  17.024  10.411  1.00 23.56 ? 267  TYR A OH  1 
ATOM   2074 N  N   . LYS A 1 269 ? -0.848  15.823  14.532  1.00 27.71 ? 268  LYS A N   1 
ATOM   2075 C  CA  . LYS A 1 269 ? -1.364  14.945  15.577  1.00 26.77 ? 268  LYS A CA  1 
ATOM   2076 C  C   . LYS A 1 269 ? -0.234  14.836  16.596  1.00 24.83 ? 268  LYS A C   1 
ATOM   2077 O  O   . LYS A 1 269 ? -0.461  14.976  17.790  1.00 24.25 ? 268  LYS A O   1 
ATOM   2078 C  CB  . LYS A 1 269 ? -1.696  13.551  15.041  1.00 28.32 ? 268  LYS A CB  1 
ATOM   2079 C  CG  . LYS A 1 269 ? -2.681  13.493  13.878  1.00 29.67 ? 268  LYS A CG  1 
ATOM   2080 C  CD  . LYS A 1 269 ? -4.117  13.581  14.320  1.00 29.82 ? 268  LYS A CD  1 
ATOM   2081 C  CE  . LYS A 1 269 ? -5.013  13.367  13.119  1.00 30.37 ? 268  LYS A CE  1 
ATOM   2082 N  NZ  . LYS A 1 269 ? -6.437  13.307  13.501  1.00 32.78 ? 268  LYS A NZ  1 
ATOM   2083 N  N   . TYR A 1 270 ? 0.992   14.630  16.125  1.00 26.09 ? 269  TYR A N   1 
ATOM   2084 C  CA  . TYR A 1 270 ? 2.141   14.547  17.043  1.00 24.64 ? 269  TYR A CA  1 
ATOM   2085 C  C   . TYR A 1 270 ? 2.435   15.884  17.729  1.00 24.20 ? 269  TYR A C   1 
ATOM   2086 O  O   . TYR A 1 270 ? 2.814   15.913  18.900  1.00 24.26 ? 269  TYR A O   1 
ATOM   2087 C  CB  . TYR A 1 270 ? 3.416   14.115  16.313  1.00 25.27 ? 269  TYR A CB  1 
ATOM   2088 C  CG  . TYR A 1 270 ? 3.411   12.772  15.631  1.00 25.07 ? 269  TYR A CG  1 
ATOM   2089 C  CD1 . TYR A 1 270 ? 2.555   11.741  16.020  1.00 27.57 ? 269  TYR A CD1 1 
ATOM   2090 C  CD2 . TYR A 1 270 ? 4.260   12.548  14.550  1.00 27.02 ? 269  TYR A CD2 1 
ATOM   2091 C  CE1 . TYR A 1 270 ? 2.554   10.507  15.328  1.00 27.84 ? 269  TYR A CE1 1 
ATOM   2092 C  CE2 . TYR A 1 270 ? 4.263   11.334  13.861  1.00 27.47 ? 269  TYR A CE2 1 
ATOM   2093 C  CZ  . TYR A 1 270 ? 3.407   10.328  14.260  1.00 27.65 ? 269  TYR A CZ  1 
ATOM   2094 O  OH  . TYR A 1 270 ? 3.428   9.162   13.563  1.00 30.84 ? 269  TYR A OH  1 
ATOM   2095 N  N   . TYR A 1 271 ? 2.309   16.999  16.996  1.00 24.46 ? 270  TYR A N   1 
ATOM   2096 C  CA  . TYR A 1 271 ? 2.577   18.319  17.588  1.00 23.19 ? 270  TYR A CA  1 
ATOM   2097 C  C   . TYR A 1 271 ? 1.531   18.565  18.665  1.00 23.09 ? 270  TYR A C   1 
ATOM   2098 O  O   . TYR A 1 271 ? 1.871   18.888  19.795  1.00 24.48 ? 270  TYR A O   1 
ATOM   2099 C  CB  . TYR A 1 271 ? 2.585   19.461  16.529  1.00 21.82 ? 270  TYR A CB  1 
ATOM   2100 C  CG  . TYR A 1 271 ? 3.004   20.814  17.121  1.00 22.32 ? 270  TYR A CG  1 
ATOM   2101 C  CD1 . TYR A 1 271 ? 2.152   21.519  17.965  1.00 21.82 ? 270  TYR A CD1 1 
ATOM   2102 C  CD2 . TYR A 1 271 ? 4.285   21.333  16.907  1.00 21.79 ? 270  TYR A CD2 1 
ATOM   2103 C  CE1 . TYR A 1 271 ? 2.566   22.693  18.594  1.00 21.57 ? 270  TYR A CE1 1 
ATOM   2104 C  CE2 . TYR A 1 271 ? 4.711   22.511  17.530  1.00 21.25 ? 270  TYR A CE2 1 
ATOM   2105 C  CZ  . TYR A 1 271 ? 3.847   23.179  18.372  1.00 22.27 ? 270  TYR A CZ  1 
ATOM   2106 O  OH  . TYR A 1 271 ? 4.263   24.305  19.044  1.00 23.34 ? 270  TYR A OH  1 
ATOM   2107 N  N   . SER A 1 272 ? 0.255   18.374  18.337  1.00 22.90 ? 271  SER A N   1 
ATOM   2108 C  CA  . SER A 1 272 ? -0.791  18.583  19.324  1.00 24.90 ? 271  SER A CA  1 
ATOM   2109 C  C   . SER A 1 272 ? -0.537  17.777  20.602  1.00 26.51 ? 271  SER A C   1 
ATOM   2110 O  O   . SER A 1 272 ? -0.696  18.270  21.741  1.00 26.62 ? 271  SER A O   1 
ATOM   2111 C  CB  . SER A 1 272 ? -2.132  18.214  18.740  1.00 23.26 ? 271  SER A CB  1 
ATOM   2112 O  OG  . SER A 1 272 ? -3.156  18.674  19.597  1.00 27.71 ? 271  SER A OG  1 
ATOM   2113 N  N   . GLU A 1 273 ? -0.148  16.521  20.456  1.00 27.01 ? 272  GLU A N   1 
ATOM   2114 C  CA  . GLU A 1 273 ? 0.124   15.754  21.660  1.00 28.17 ? 272  GLU A CA  1 
ATOM   2115 C  C   . GLU A 1 273 ? 1.370   16.247  22.390  1.00 27.61 ? 272  GLU A C   1 
ATOM   2116 O  O   . GLU A 1 273 ? 1.385   16.301  23.619  1.00 29.54 ? 272  GLU A O   1 
ATOM   2117 C  CB  . GLU A 1 273 ? 0.279   14.270  21.370  1.00 28.91 ? 272  GLU A CB  1 
ATOM   2118 C  CG  . GLU A 1 273 ? 0.700   13.569  22.653  1.00 30.33 ? 272  GLU A CG  1 
ATOM   2119 C  CD  . GLU A 1 273 ? 0.698   12.088  22.545  1.00 30.50 ? 272  GLU A CD  1 
ATOM   2120 O  OE1 . GLU A 1 273 ? -0.122  11.562  21.765  1.00 29.13 ? 272  GLU A OE1 1 
ATOM   2121 O  OE2 . GLU A 1 273 ? 1.510   11.458  23.257  1.00 31.89 ? 272  GLU A OE2 1 
ATOM   2122 N  N   . SER A 1 274 ? 2.413   16.639  21.658  1.00 26.99 ? 273  SER A N   1 
ATOM   2123 C  CA  . SER A 1 274 ? 3.633   17.105  22.312  1.00 26.20 ? 273  SER A CA  1 
ATOM   2124 C  C   . SER A 1 274 ? 3.395   18.267  23.283  1.00 24.90 ? 273  SER A C   1 
ATOM   2125 O  O   . SER A 1 274 ? 4.105   18.426  24.271  1.00 25.85 ? 273  SER A O   1 
ATOM   2126 C  CB  . SER A 1 274 ? 4.704   17.473  21.274  1.00 29.52 ? 273  SER A CB  1 
ATOM   2127 O  OG  . SER A 1 274 ? 4.375   18.672  20.591  1.00 26.82 ? 273  SER A OG  1 
ATOM   2128 N  N   . ILE A 1 275 ? 2.382   19.085  23.005  1.00 25.12 ? 274  ILE A N   1 
ATOM   2129 C  CA  . ILE A 1 275 ? 2.061   20.218  23.861  1.00 24.45 ? 274  ILE A CA  1 
ATOM   2130 C  C   . ILE A 1 275 ? 1.775   19.684  25.267  1.00 26.08 ? 274  ILE A C   1 
ATOM   2131 O  O   . ILE A 1 275 ? 2.197   20.278  26.261  1.00 26.04 ? 274  ILE A O   1 
ATOM   2132 C  CB  . ILE A 1 275 ? 0.774   20.985  23.346  1.00 23.68 ? 274  ILE A CB  1 
ATOM   2133 C  CG1 . ILE A 1 275 ? 0.998   21.565  21.937  1.00 23.13 ? 274  ILE A CG1 1 
ATOM   2134 C  CG2 . ILE A 1 275 ? 0.405   22.142  24.270  1.00 23.33 ? 274  ILE A CG2 1 
ATOM   2135 C  CD1 . ILE A 1 275 ? -0.254  22.191  21.353  1.00 23.59 ? 274  ILE A CD1 1 
ATOM   2136 N  N   . LEU A 1 276 ? 1.059   18.556  25.337  1.00 30.24 ? 275  LEU A N   1 
ATOM   2137 C  CA  . LEU A 1 276 ? 0.672   17.924  26.611  1.00 32.55 ? 275  LEU A CA  1 
ATOM   2138 C  C   . LEU A 1 276 ? 1.723   16.993  27.212  1.00 33.84 ? 275  LEU A C   1 
ATOM   2139 O  O   . LEU A 1 276 ? 1.673   16.689  28.408  1.00 33.65 ? 275  LEU A O   1 
ATOM   2140 C  CB  . LEU A 1 276 ? -0.662  17.166  26.449  1.00 32.63 ? 275  LEU A CB  1 
ATOM   2141 C  CG  . LEU A 1 276 ? -1.870  17.988  25.976  1.00 33.46 ? 275  LEU A CG  1 
ATOM   2142 C  CD1 . LEU A 1 276 ? -3.129  17.150  26.007  1.00 32.85 ? 275  LEU A CD1 1 
ATOM   2143 C  CD2 . LEU A 1 276 ? -2.046  19.222  26.864  1.00 31.72 ? 275  LEU A CD2 1 
ATOM   2144 N  N   . ASN A 1 277 ? 2.673   16.544  26.389  1.00 33.98 ? 276  ASN A N   1 
ATOM   2145 C  CA  . ASN A 1 277 ? 3.738   15.646  26.846  1.00 34.79 ? 276  ASN A CA  1 
ATOM   2146 C  C   . ASN A 1 277 ? 5.104   16.263  26.580  1.00 33.06 ? 276  ASN A C   1 
ATOM   2147 O  O   . ASN A 1 277 ? 5.773   15.899  25.615  1.00 33.68 ? 276  ASN A O   1 
ATOM   2148 C  CB  . ASN A 1 277 ? 3.648   14.292  26.133  1.00 34.87 ? 276  ASN A CB  1 
ATOM   2149 C  CG  . ASN A 1 277 ? 2.983   13.229  26.976  1.00 36.70 ? 276  ASN A CG  1 
ATOM   2150 O  OD1 . ASN A 1 277 ? 1.839   12.838  26.721  1.00 36.53 ? 276  ASN A OD1 1 
ATOM   2151 N  ND2 . ASN A 1 277 ? 3.700   12.741  27.987  1.00 36.11 ? 276  ASN A ND2 1 
ATOM   2152 N  N   . PRO A 1 278 ? 5.579   17.128  27.487  1.00 30.08 ? 277  PRO A N   1 
ATOM   2153 C  CA  . PRO A 1 278 ? 6.875   17.783  27.321  1.00 30.22 ? 277  PRO A CA  1 
ATOM   2154 C  C   . PRO A 1 278 ? 8.134   16.913  27.205  1.00 29.59 ? 277  PRO A C   1 
ATOM   2155 O  O   . PRO A 1 278 ? 9.195   17.437  26.864  1.00 29.94 ? 277  PRO A O   1 
ATOM   2156 C  CB  . PRO A 1 278 ? 6.933   18.759  28.501  1.00 29.46 ? 277  PRO A CB  1 
ATOM   2157 C  CG  . PRO A 1 278 ? 5.981   18.187  29.493  1.00 31.65 ? 277  PRO A CG  1 
ATOM   2158 C  CD  . PRO A 1 278 ? 4.872   17.628  28.678  1.00 31.35 ? 277  PRO A CD  1 
ATOM   2159 N  N   . ASP A 1 279 ? 8.040   15.614  27.515  1.00 30.66 ? 278  ASP A N   1 
ATOM   2160 C  CA  . ASP A 1 279 ? 9.198   14.711  27.411  1.00 29.39 ? 278  ASP A CA  1 
ATOM   2161 C  C   . ASP A 1 279 ? 8.910   13.468  26.553  1.00 29.37 ? 278  ASP A C   1 
ATOM   2162 O  O   . ASP A 1 279 ? 9.773   12.620  26.351  1.00 30.30 ? 278  ASP A O   1 
ATOM   2163 C  CB  . ASP A 1 279 ? 9.706   14.311  28.796  1.00 30.70 ? 278  ASP A CB  1 
ATOM   2164 C  CG  . ASP A 1 279 ? 11.126  13.733  28.758  1.00 33.24 ? 278  ASP A CG  1 
ATOM   2165 O  OD1 . ASP A 1 279 ? 12.028  14.375  28.174  1.00 30.58 ? 278  ASP A OD1 1 
ATOM   2166 O  OD2 . ASP A 1 279 ? 11.351  12.643  29.317  1.00 33.27 ? 278  ASP A OD2 1 
ATOM   2167 N  N   . GLY A 1 280 ? 7.724   13.405  25.977  1.00 27.85 ? 279  GLY A N   1 
ATOM   2168 C  CA  . GLY A 1 280 ? 7.363   12.260  25.167  1.00 27.06 ? 279  GLY A CA  1 
ATOM   2169 C  C   . GLY A 1 280 ? 7.930   12.130  23.769  1.00 25.31 ? 279  GLY A C   1 
ATOM   2170 O  O   . GLY A 1 280 ? 7.563   11.174  23.093  1.00 23.46 ? 279  GLY A O   1 
ATOM   2171 N  N   . PHE A 1 281 ? 8.757   13.066  23.280  1.00 25.97 ? 280  PHE A N   1 
ATOM   2172 C  CA  . PHE A 1 281 ? 9.289   12.948  21.914  1.00 23.18 ? 280  PHE A CA  1 
ATOM   2173 C  C   . PHE A 1 281 ? 10.780  13.296  21.757  1.00 26.67 ? 280  PHE A C   1 
ATOM   2174 O  O   . PHE A 1 281 ? 11.154  14.045  20.841  1.00 24.84 ? 280  PHE A O   1 
ATOM   2175 C  CB  . PHE A 1 281 ? 8.459   13.805  20.935  1.00 22.82 ? 280  PHE A CB  1 
ATOM   2176 C  CG  . PHE A 1 281 ? 7.007   13.454  20.898  1.00 20.18 ? 280  PHE A CG  1 
ATOM   2177 C  CD1 . PHE A 1 281 ? 6.116   14.037  21.787  1.00 20.57 ? 280  PHE A CD1 1 
ATOM   2178 C  CD2 . PHE A 1 281 ? 6.537   12.506  20.015  1.00 18.44 ? 280  PHE A CD2 1 
ATOM   2179 C  CE1 . PHE A 1 281 ? 4.771   13.672  21.789  1.00 19.83 ? 280  PHE A CE1 1 
ATOM   2180 C  CE2 . PHE A 1 281 ? 5.213   12.137  20.010  1.00 19.36 ? 280  PHE A CE2 1 
ATOM   2181 C  CZ  . PHE A 1 281 ? 4.325   12.718  20.890  1.00 19.25 ? 280  PHE A CZ  1 
ATOM   2182 N  N   . ALA A 1 282 ? 11.637  12.766  22.638  1.00 26.25 ? 281  ALA A N   1 
ATOM   2183 C  CA  . ALA A 1 282 ? 13.074  13.012  22.551  1.00 27.16 ? 281  ALA A CA  1 
ATOM   2184 C  C   . ALA A 1 282 ? 13.548  12.506  21.203  1.00 27.42 ? 281  ALA A C   1 
ATOM   2185 O  O   . ALA A 1 282 ? 13.202  11.391  20.782  1.00 28.66 ? 281  ALA A O   1 
ATOM   2186 C  CB  . ALA A 1 282 ? 13.829  12.318  23.672  1.00 28.81 ? 281  ALA A CB  1 
ATOM   2187 N  N   . SER A 1 283 ? 14.375  13.322  20.556  1.00 28.51 ? 282  SER A N   1 
ATOM   2188 C  CA  . SER A 1 283 ? 14.863  13.037  19.222  1.00 25.11 ? 282  SER A CA  1 
ATOM   2189 C  C   . SER A 1 283 ? 16.358  12.919  19.221  1.00 24.97 ? 282  SER A C   1 
ATOM   2190 O  O   . SER A 1 283 ? 17.041  13.619  19.951  1.00 24.88 ? 282  SER A O   1 
ATOM   2191 C  CB  . SER A 1 283 ? 14.354  14.130  18.272  1.00 24.02 ? 282  SER A CB  1 
ATOM   2192 O  OG  . SER A 1 283 ? 12.937  14.204  18.374  1.00 25.95 ? 282  SER A OG  1 
ATOM   2193 N  N   . TYR A 1 284 ? 16.858  12.023  18.383  1.00 24.63 ? 283  TYR A N   1 
ATOM   2194 C  CA  . TYR A 1 284 ? 18.270  11.718  18.316  1.00 24.28 ? 283  TYR A CA  1 
ATOM   2195 C  C   . TYR A 1 284 ? 18.886  12.039  16.967  1.00 25.89 ? 283  TYR A C   1 
ATOM   2196 O  O   . TYR A 1 284 ? 18.401  11.571  15.934  1.00 29.28 ? 283  TYR A O   1 
ATOM   2197 C  CB  . TYR A 1 284 ? 18.467  10.214  18.606  1.00 23.10 ? 283  TYR A CB  1 
ATOM   2198 C  CG  . TYR A 1 284 ? 17.864  9.751   19.930  1.00 21.58 ? 283  TYR A CG  1 
ATOM   2199 C  CD1 . TYR A 1 284 ? 16.491  9.519   20.065  1.00 23.02 ? 283  TYR A CD1 1 
ATOM   2200 C  CD2 . TYR A 1 284 ? 18.669  9.599   21.052  1.00 19.44 ? 283  TYR A CD2 1 
ATOM   2201 C  CE1 . TYR A 1 284 ? 15.925  9.150   21.329  1.00 22.39 ? 283  TYR A CE1 1 
ATOM   2202 C  CE2 . TYR A 1 284 ? 18.132  9.242   22.295  1.00 19.86 ? 283  TYR A CE2 1 
ATOM   2203 C  CZ  . TYR A 1 284 ? 16.764  9.024   22.425  1.00 21.20 ? 283  TYR A CZ  1 
ATOM   2204 O  OH  . TYR A 1 284 ? 16.270  8.710   23.666  1.00 23.62 ? 283  TYR A OH  1 
ATOM   2205 N  N   . PRO A 1 285 ? 20.029  12.756  16.961  1.00 26.38 ? 284  PRO A N   1 
ATOM   2206 C  CA  . PRO A 1 285 ? 20.681  13.102  15.699  1.00 27.08 ? 284  PRO A CA  1 
ATOM   2207 C  C   . PRO A 1 285 ? 21.216  11.805  15.118  1.00 28.50 ? 284  PRO A C   1 
ATOM   2208 O  O   . PRO A 1 285 ? 21.767  10.988  15.842  1.00 28.66 ? 284  PRO A O   1 
ATOM   2209 C  CB  . PRO A 1 285 ? 21.794  14.060  16.139  1.00 26.54 ? 284  PRO A CB  1 
ATOM   2210 C  CG  . PRO A 1 285 ? 22.097  13.665  17.532  1.00 25.85 ? 284  PRO A CG  1 
ATOM   2211 C  CD  . PRO A 1 285 ? 20.758  13.312  18.117  1.00 25.52 ? 284  PRO A CD  1 
ATOM   2212 N  N   . CYS A 1 286 ? 21.042  11.583  13.826  1.00 28.70 ? 285  CYS A N   1 
ATOM   2213 C  CA  . CYS A 1 286 ? 21.530  10.336  13.275  1.00 30.15 ? 285  CYS A CA  1 
ATOM   2214 C  C   . CYS A 1 286 ? 21.700  10.507  11.792  1.00 29.19 ? 285  CYS A C   1 
ATOM   2215 O  O   . CYS A 1 286 ? 21.115  11.401  11.209  1.00 27.26 ? 285  CYS A O   1 
ATOM   2216 C  CB  . CYS A 1 286 ? 20.518  9.215   13.553  1.00 30.19 ? 285  CYS A CB  1 
ATOM   2217 S  SG  . CYS A 1 286 ? 21.197  7.529   13.412  1.00 29.58 ? 285  CYS A SG  1 
ATOM   2218 N  N   . ALA A 1 287 ? 22.512  9.648   11.190  1.00 30.41 ? 286  ALA A N   1 
ATOM   2219 C  CA  . ALA A 1 287 ? 22.766  9.680   9.756   1.00 29.87 ? 286  ALA A CA  1 
ATOM   2220 C  C   . ALA A 1 287 ? 21.536  9.294   8.951   1.00 31.20 ? 286  ALA A C   1 
ATOM   2221 O  O   . ALA A 1 287 ? 21.307  9.789   7.835   1.00 30.93 ? 286  ALA A O   1 
ATOM   2222 C  CB  . ALA A 1 287 ? 23.912  8.740   9.423   1.00 31.35 ? 286  ALA A CB  1 
ATOM   2223 N  N   . SER A 1 288 ? 20.736  8.392   9.500   1.00 29.71 ? 287  SER A N   1 
ATOM   2224 C  CA  . SER A 1 288 ? 19.562  7.926   8.783   1.00 29.42 ? 287  SER A CA  1 
ATOM   2225 C  C   . SER A 1 288 ? 18.664  7.193   9.746   1.00 28.25 ? 287  SER A C   1 
ATOM   2226 O  O   . SER A 1 288 ? 19.039  6.943   10.874  1.00 28.47 ? 287  SER A O   1 
ATOM   2227 C  CB  . SER A 1 288 ? 19.982  6.993   7.623   1.00 31.53 ? 287  SER A CB  1 
ATOM   2228 O  OG  . SER A 1 288 ? 20.617  5.795   8.078   1.00 29.47 ? 287  SER A OG  1 
ATOM   2229 N  N   . TYR A 1 289 ? 17.453  6.890   9.302   1.00 30.16 ? 288  TYR A N   1 
ATOM   2230 C  CA  . TYR A 1 289 ? 16.504  6.184   10.132  1.00 27.35 ? 288  TYR A CA  1 
ATOM   2231 C  C   . TYR A 1 289 ? 17.010  4.762   10.307  1.00 29.77 ? 288  TYR A C   1 
ATOM   2232 O  O   . TYR A 1 289 ? 16.782  4.137   11.331  1.00 29.75 ? 288  TYR A O   1 
ATOM   2233 C  CB  . TYR A 1 289 ? 15.147  6.179   9.474   1.00 25.91 ? 288  TYR A CB  1 
ATOM   2234 C  CG  . TYR A 1 289 ? 14.102  5.508   10.311  1.00 25.19 ? 288  TYR A CG  1 
ATOM   2235 C  CD1 . TYR A 1 289 ? 14.000  5.776   11.660  1.00 25.56 ? 288  TYR A CD1 1 
ATOM   2236 C  CD2 . TYR A 1 289 ? 13.209  4.623   9.754   1.00 23.73 ? 288  TYR A CD2 1 
ATOM   2237 C  CE1 . TYR A 1 289 ? 13.047  5.178   12.434  1.00 25.14 ? 288  TYR A CE1 1 
ATOM   2238 C  CE2 . TYR A 1 289 ? 12.244  4.017   10.521  1.00 25.86 ? 288  TYR A CE2 1 
ATOM   2239 C  CZ  . TYR A 1 289 ? 12.161  4.305   11.858  1.00 25.17 ? 288  TYR A CZ  1 
ATOM   2240 O  OH  . TYR A 1 289 ? 11.170  3.771   12.643  1.00 25.51 ? 288  TYR A OH  1 
ATOM   2241 N  N   . ARG A 1 290 ? 17.672  4.240   9.283   1.00 32.35 ? 289  ARG A N   1 
ATOM   2242 C  CA  . ARG A 1 290 ? 18.210  2.907   9.390   1.00 33.85 ? 289  ARG A CA  1 
ATOM   2243 C  C   . ARG A 1 290 ? 19.301  2.796   10.404  1.00 33.11 ? 289  ARG A C   1 
ATOM   2244 O  O   . ARG A 1 290 ? 19.286  1.866   11.216  1.00 34.25 ? 289  ARG A O   1 
ATOM   2245 C  CB  . ARG A 1 290 ? 18.557  2.347   8.031   1.00 35.75 ? 289  ARG A CB  1 
ATOM   2246 C  CG  . ARG A 1 290 ? 17.247  2.005   7.327   1.00 39.29 ? 289  ARG A CG  1 
ATOM   2247 C  CD  . ARG A 1 290 ? 16.226  1.476   8.379   1.00 40.48 ? 289  ARG A CD  1 
ATOM   2248 N  NE  . ARG A 1 290 ? 14.856  1.379   7.895   1.00 40.75 ? 289  ARG A NE  1 
ATOM   2249 C  CZ  . ARG A 1 290 ? 13.845  0.905   8.620   1.00 42.10 ? 289  ARG A CZ  1 
ATOM   2250 N  NH1 . ARG A 1 290 ? 14.046  0.485   9.871   1.00 41.92 ? 289  ARG A NH1 1 
ATOM   2251 N  NH2 . ARG A 1 290 ? 12.637  0.800   8.073   1.00 42.50 ? 289  ARG A NH2 1 
ATOM   2252 N  N   . ALA A 1 291 ? 20.187  3.789   10.454  1.00 31.87 ? 290  ALA A N   1 
ATOM   2253 C  CA  . ALA A 1 291 ? 21.229  3.760   11.476  1.00 32.02 ? 290  ALA A CA  1 
ATOM   2254 C  C   . ALA A 1 291 ? 20.567  3.846   12.877  1.00 30.28 ? 290  ALA A C   1 
ATOM   2255 O  O   . ALA A 1 291 ? 20.997  3.173   13.806  1.00 31.39 ? 290  ALA A O   1 
ATOM   2256 C  CB  . ALA A 1 291 ? 22.226  4.918   11.275  1.00 32.53 ? 290  ALA A CB  1 
ATOM   2257 N  N   . PHE A 1 292 ? 19.526  4.660   13.013  1.00 26.71 ? 291  PHE A N   1 
ATOM   2258 C  CA  . PHE A 1 292 ? 18.799  4.805   14.282  1.00 26.59 ? 291  PHE A CA  1 
ATOM   2259 C  C   . PHE A 1 292 ? 18.184  3.438   14.714  1.00 26.65 ? 291  PHE A C   1 
ATOM   2260 O  O   . PHE A 1 292 ? 18.375  2.987   15.845  1.00 28.72 ? 291  PHE A O   1 
ATOM   2261 C  CB  . PHE A 1 292 ? 17.682  5.857   14.102  1.00 24.40 ? 291  PHE A CB  1 
ATOM   2262 C  CG  . PHE A 1 292 ? 16.825  6.072   15.325  1.00 23.27 ? 291  PHE A CG  1 
ATOM   2263 C  CD1 . PHE A 1 292 ? 17.359  6.657   16.469  1.00 25.04 ? 291  PHE A CD1 1 
ATOM   2264 C  CD2 . PHE A 1 292 ? 15.494  5.692   15.336  1.00 22.18 ? 291  PHE A CD2 1 
ATOM   2265 C  CE1 . PHE A 1 292 ? 16.569  6.849   17.592  1.00 22.08 ? 291  PHE A CE1 1 
ATOM   2266 C  CE2 . PHE A 1 292 ? 14.700  5.878   16.458  1.00 23.82 ? 291  PHE A CE2 1 
ATOM   2267 C  CZ  . PHE A 1 292 ? 15.250  6.461   17.593  1.00 21.84 ? 291  PHE A CZ  1 
ATOM   2268 N  N   . GLU A 1 293 ? 17.479  2.797   13.788  1.00 26.64 ? 292  GLU A N   1 
ATOM   2269 C  CA  . GLU A 1 293 ? 16.842  1.502   13.997  1.00 28.55 ? 292  GLU A CA  1 
ATOM   2270 C  C   . GLU A 1 293 ? 17.842  0.359   14.195  1.00 29.22 ? 292  GLU A C   1 
ATOM   2271 O  O   . GLU A 1 293 ? 17.466  -0.718  14.661  1.00 32.06 ? 292  GLU A O   1 
ATOM   2272 C  CB  . GLU A 1 293 ? 15.927  1.166   12.828  1.00 27.07 ? 292  GLU A CB  1 
ATOM   2273 C  CG  . GLU A 1 293 ? 14.725  2.084   12.694  1.00 29.55 ? 292  GLU A CG  1 
ATOM   2274 C  CD  . GLU A 1 293 ? 13.557  1.628   13.523  1.00 32.01 ? 292  GLU A CD  1 
ATOM   2275 O  OE1 . GLU A 1 293 ? 12.820  0.745   13.039  1.00 33.65 ? 292  GLU A OE1 1 
ATOM   2276 O  OE2 . GLU A 1 293 ? 13.385  2.131   14.657  1.00 32.30 ? 292  GLU A OE2 1 
ATOM   2277 N  N   . SER A 1 294 ? 19.095  0.584   13.810  1.00 26.18 ? 293  SER A N   1 
ATOM   2278 C  CA  . SER A 1 294 ? 20.157  -0.394  13.958  1.00 26.32 ? 293  SER A CA  1 
ATOM   2279 C  C   . SER A 1 294 ? 20.906  -0.150  15.256  1.00 25.77 ? 293  SER A C   1 
ATOM   2280 O  O   . SER A 1 294 ? 22.013  -0.664  15.444  1.00 25.00 ? 293  SER A O   1 
ATOM   2281 C  CB  . SER A 1 294 ? 21.126  -0.318  12.788  1.00 26.10 ? 293  SER A CB  1 
ATOM   2282 O  OG  . SER A 1 294 ? 20.474  -0.677  11.590  1.00 28.99 ? 293  SER A OG  1 
ATOM   2283 N  N   . ASN A 1 295 ? 20.319  0.661   16.139  1.00 27.49 ? 294  ASN A N   1 
ATOM   2284 C  CA  . ASN A 1 295 ? 20.925  0.969   17.437  1.00 29.00 ? 294  ASN A CA  1 
ATOM   2285 C  C   . ASN A 1 295 ? 22.311  1.618   17.362  1.00 29.31 ? 294  ASN A C   1 
ATOM   2286 O  O   . ASN A 1 295 ? 23.210  1.296   18.150  1.00 29.73 ? 294  ASN A O   1 
ATOM   2287 C  CB  . ASN A 1 295 ? 20.963  -0.283  18.321  1.00 30.24 ? 294  ASN A CB  1 
ATOM   2288 C  CG  . ASN A 1 295 ? 19.586  -0.922  18.474  1.00 29.89 ? 294  ASN A CG  1 
ATOM   2289 O  OD1 . ASN A 1 295 ? 18.568  -0.271  18.269  1.00 28.40 ? 294  ASN A OD1 1 
ATOM   2290 N  ND2 . ASN A 1 295 ? 19.554  -2.204  18.797  1.00 29.76 ? 294  ASN A ND2 1 
ATOM   2291 N  N   . LYS A 1 296 ? 22.444  2.607   16.479  1.00 30.31 ? 295  LYS A N   1 
ATOM   2292 C  CA  . LYS A 1 296 ? 23.706  3.334   16.271  1.00 31.38 ? 295  LYS A CA  1 
ATOM   2293 C  C   . LYS A 1 296 ? 23.680  4.785   16.757  1.00 30.37 ? 295  LYS A C   1 
ATOM   2294 O  O   . LYS A 1 296 ? 24.717  5.437   16.808  1.00 30.79 ? 295  LYS A O   1 
ATOM   2295 C  CB  . LYS A 1 296 ? 24.034  3.394   14.767  1.00 33.19 ? 295  LYS A CB  1 
ATOM   2296 C  CG  . LYS A 1 296 ? 24.253  2.084   14.073  1.00 36.08 ? 295  LYS A CG  1 
ATOM   2297 C  CD  . LYS A 1 296 ? 25.392  1.369   14.722  1.00 38.68 ? 295  LYS A CD  1 
ATOM   2298 C  CE  . LYS A 1 296 ? 25.486  -0.064  14.252  1.00 40.65 ? 295  LYS A CE  1 
ATOM   2299 N  NZ  . LYS A 1 296 ? 26.356  -0.799  15.204  1.00 40.52 ? 295  LYS A NZ  1 
ATOM   2300 N  N   . CYS A 1 297 ? 22.522  5.286   17.157  1.00 30.76 ? 296  CYS A N   1 
ATOM   2301 C  CA  . CYS A 1 297 ? 22.425  6.697   17.537  1.00 28.60 ? 296  CYS A CA  1 
ATOM   2302 C  C   . CYS A 1 297 ? 21.742  6.955   18.866  1.00 29.44 ? 296  CYS A C   1 
ATOM   2303 O  O   . CYS A 1 297 ? 20.912  7.851   18.996  1.00 27.48 ? 296  CYS A O   1 
ATOM   2304 C  CB  . CYS A 1 297 ? 21.681  7.427   16.422  1.00 27.23 ? 296  CYS A CB  1 
ATOM   2305 S  SG  . CYS A 1 297 ? 22.614  7.439   14.870  1.00 29.10 ? 296  CYS A SG  1 
ATOM   2306 N  N   . PHE A 1 298 ? 22.156  6.215   19.880  1.00 29.51 ? 297  PHE A N   1 
ATOM   2307 C  CA  . PHE A 1 298 ? 21.558  6.302   21.202  1.00 26.21 ? 297  PHE A CA  1 
ATOM   2308 C  C   . PHE A 1 298 ? 22.664  5.961   22.179  1.00 27.79 ? 297  PHE A C   1 
ATOM   2309 O  O   . PHE A 1 298 ? 23.441  5.022   21.924  1.00 27.72 ? 297  PHE A O   1 
ATOM   2310 C  CB  . PHE A 1 298 ? 20.414  5.283   21.238  1.00 26.38 ? 297  PHE A CB  1 
ATOM   2311 C  CG  . PHE A 1 298 ? 19.851  5.026   22.605  1.00 24.90 ? 297  PHE A CG  1 
ATOM   2312 C  CD1 . PHE A 1 298 ? 20.528  4.228   23.511  1.00 24.53 ? 297  PHE A CD1 1 
ATOM   2313 C  CD2 . PHE A 1 298 ? 18.637  5.548   22.968  1.00 24.60 ? 297  PHE A CD2 1 
ATOM   2314 C  CE1 . PHE A 1 298 ? 20.002  3.963   24.731  1.00 23.54 ? 297  PHE A CE1 1 
ATOM   2315 C  CE2 . PHE A 1 298 ? 18.115  5.277   24.190  1.00 23.61 ? 297  PHE A CE2 1 
ATOM   2316 C  CZ  . PHE A 1 298 ? 18.807  4.479   25.075  1.00 21.93 ? 297  PHE A CZ  1 
ATOM   2317 N  N   . PRO A 1 299 ? 22.667  6.571   23.376  1.00 26.54 ? 298  PRO A N   1 
ATOM   2318 C  CA  . PRO A 1 299 ? 21.733  7.551   23.945  1.00 28.33 ? 298  PRO A CA  1 
ATOM   2319 C  C   . PRO A 1 299 ? 21.812  8.984   23.369  1.00 28.02 ? 298  PRO A C   1 
ATOM   2320 O  O   . PRO A 1 299 ? 22.351  9.210   22.268  1.00 29.30 ? 298  PRO A O   1 
ATOM   2321 C  CB  . PRO A 1 299 ? 22.077  7.510   25.430  1.00 27.20 ? 298  PRO A CB  1 
ATOM   2322 C  CG  . PRO A 1 299 ? 23.576  7.397   25.393  1.00 26.43 ? 298  PRO A CG  1 
ATOM   2323 C  CD  . PRO A 1 299 ? 23.803  6.355   24.294  1.00 27.63 ? 298  PRO A CD  1 
ATOM   2324 N  N   . CYS A 1 300 ? 21.213  9.923   24.086  1.00 28.42 ? 299  CYS A N   1 
ATOM   2325 C  CA  . CYS A 1 300 ? 21.216  11.323  23.675  1.00 29.88 ? 299  CYS A CA  1 
ATOM   2326 C  C   . CYS A 1 300 ? 22.620  11.855  23.814  1.00 31.17 ? 299  CYS A C   1 
ATOM   2327 O  O   . CYS A 1 300 ? 23.375  11.376  24.659  1.00 33.34 ? 299  CYS A O   1 
ATOM   2328 C  CB  . CYS A 1 300 ? 20.330  12.170  24.590  1.00 28.34 ? 299  CYS A CB  1 
ATOM   2329 S  SG  . CYS A 1 300 ? 18.543  11.889  24.452  1.00 29.80 ? 299  CYS A SG  1 
ATOM   2330 N  N   . PRO A 1 301 ? 22.986  12.864  22.996  1.00 33.53 ? 300  PRO A N   1 
ATOM   2331 C  CA  . PRO A 1 301 ? 24.312  13.498  23.020  1.00 34.75 ? 300  PRO A CA  1 
ATOM   2332 C  C   . PRO A 1 301 ? 24.464  14.151  24.375  1.00 34.79 ? 300  PRO A C   1 
ATOM   2333 O  O   . PRO A 1 301 ? 23.477  14.330  25.087  1.00 33.94 ? 300  PRO A O   1 
ATOM   2334 C  CB  . PRO A 1 301 ? 24.205  14.543  21.911  1.00 35.77 ? 300  PRO A CB  1 
ATOM   2335 C  CG  . PRO A 1 301 ? 23.291  13.878  20.948  1.00 35.63 ? 300  PRO A CG  1 
ATOM   2336 C  CD  . PRO A 1 301 ? 22.208  13.364  21.856  1.00 32.06 ? 300  PRO A CD  1 
ATOM   2337 N  N   . ASP A 1 302 ? 25.686  14.529  24.730  1.00 38.83 ? 301  ASP A N   1 
ATOM   2338 C  CA  . ASP A 1 302 ? 25.954  15.132  26.038  1.00 40.22 ? 301  ASP A CA  1 
ATOM   2339 C  C   . ASP A 1 302 ? 25.038  16.278  26.436  1.00 40.98 ? 301  ASP A C   1 
ATOM   2340 O  O   . ASP A 1 302 ? 24.568  16.351  27.587  1.00 40.25 ? 301  ASP A O   1 
ATOM   2341 C  CB  . ASP A 1 302 ? 27.406  15.602  26.107  1.00 43.64 ? 301  ASP A CB  1 
ATOM   2342 C  CG  . ASP A 1 302 ? 28.346  14.525  26.607  1.00 45.48 ? 301  ASP A CG  1 
ATOM   2343 O  OD1 . ASP A 1 302 ? 28.469  14.387  27.852  1.00 46.12 ? 301  ASP A OD1 1 
ATOM   2344 O  OD2 . ASP A 1 302 ? 28.967  13.836  25.763  1.00 46.21 ? 301  ASP A OD2 1 
ATOM   2345 N  N   . GLN A 1 303 ? 24.786  17.166  25.475  1.00 41.15 ? 302  GLN A N   1 
ATOM   2346 C  CA  . GLN A 1 303 ? 23.951  18.351  25.698  1.00 43.04 ? 302  GLN A CA  1 
ATOM   2347 C  C   . GLN A 1 303 ? 22.458  18.036  25.791  1.00 42.09 ? 302  GLN A C   1 
ATOM   2348 O  O   . GLN A 1 303 ? 21.661  18.899  26.187  1.00 43.18 ? 302  GLN A O   1 
ATOM   2349 C  CB  . GLN A 1 303 ? 24.219  19.436  24.630  1.00 44.36 ? 302  GLN A CB  1 
ATOM   2350 C  CG  . GLN A 1 303 ? 23.802  19.104  23.182  1.00 46.82 ? 302  GLN A CG  1 
ATOM   2351 C  CD  . GLN A 1 303 ? 24.802  18.216  22.442  1.00 48.88 ? 302  GLN A CD  1 
ATOM   2352 O  OE1 . GLN A 1 303 ? 25.747  17.677  23.039  1.00 51.22 ? 302  GLN A OE1 1 
ATOM   2353 N  NE2 . GLN A 1 303 ? 24.600  18.062  21.134  1.00 49.02 ? 302  GLN A NE2 1 
ATOM   2354 N  N   . GLY A 1 304 ? 22.082  16.816  25.423  1.00 39.02 ? 303  GLY A N   1 
ATOM   2355 C  CA  . GLY A 1 304 ? 20.690  16.429  25.505  1.00 34.46 ? 303  GLY A CA  1 
ATOM   2356 C  C   . GLY A 1 304 ? 20.094  16.246  24.134  1.00 31.91 ? 303  GLY A C   1 
ATOM   2357 O  O   . GLY A 1 304 ? 20.755  16.514  23.132  1.00 31.97 ? 303  GLY A O   1 
ATOM   2358 N  N   . CYS A 1 305 ? 18.884  15.710  24.106  1.00 30.26 ? 304  CYS A N   1 
ATOM   2359 C  CA  . CYS A 1 305 ? 18.129  15.469  22.885  1.00 29.21 ? 304  CYS A CA  1 
ATOM   2360 C  C   . CYS A 1 305 ? 17.080  16.548  22.814  1.00 28.51 ? 304  CYS A C   1 
ATOM   2361 O  O   . CYS A 1 305 ? 16.596  16.996  23.862  1.00 26.23 ? 304  CYS A O   1 
ATOM   2362 C  CB  . CYS A 1 305 ? 17.299  14.173  22.983  1.00 28.76 ? 304  CYS A CB  1 
ATOM   2363 S  SG  . CYS A 1 305 ? 18.040  12.573  22.592  1.00 29.37 ? 304  CYS A SG  1 
ATOM   2364 N  N   . PRO A 1 306 ? 16.780  17.046  21.599  1.00 27.72 ? 305  PRO A N   1 
ATOM   2365 C  CA  . PRO A 1 306 ? 15.740  18.076  21.485  1.00 27.41 ? 305  PRO A CA  1 
ATOM   2366 C  C   . PRO A 1 306 ? 14.379  17.350  21.451  1.00 27.28 ? 305  PRO A C   1 
ATOM   2367 O  O   . PRO A 1 306 ? 14.299  16.174  21.080  1.00 27.47 ? 305  PRO A O   1 
ATOM   2368 C  CB  . PRO A 1 306 ? 16.041  18.735  20.130  1.00 24.32 ? 305  PRO A CB  1 
ATOM   2369 C  CG  . PRO A 1 306 ? 16.761  17.646  19.343  1.00 28.75 ? 305  PRO A CG  1 
ATOM   2370 C  CD  . PRO A 1 306 ? 17.632  17.002  20.401  1.00 27.71 ? 305  PRO A CD  1 
ATOM   2371 N  N   . GLN A 1 307 ? 13.327  18.007  21.911  1.00 26.92 ? 306  GLN A N   1 
ATOM   2372 C  CA  . GLN A 1 307 ? 12.003  17.421  21.861  1.00 25.38 ? 306  GLN A CA  1 
ATOM   2373 C  C   . GLN A 1 307 ? 11.442  17.808  20.525  1.00 26.87 ? 306  GLN A C   1 
ATOM   2374 O  O   . GLN A 1 307 ? 11.646  18.936  20.083  1.00 25.98 ? 306  GLN A O   1 
ATOM   2375 C  CB  . GLN A 1 307 ? 11.089  18.028  22.929  1.00 25.97 ? 306  GLN A CB  1 
ATOM   2376 C  CG  . GLN A 1 307 ? 11.342  17.537  24.338  1.00 25.42 ? 306  GLN A CG  1 
ATOM   2377 C  CD  . GLN A 1 307 ? 11.004  16.061  24.488  1.00 25.39 ? 306  GLN A CD  1 
ATOM   2378 O  OE1 . GLN A 1 307 ? 9.865   15.661  24.269  1.00 23.89 ? 306  GLN A OE1 1 
ATOM   2379 N  NE2 . GLN A 1 307 ? 11.988  15.253  24.891  1.00 26.44 ? 306  GLN A NE2 1 
ATOM   2380 N  N   . MET A 1 308 ? 10.788  16.858  19.855  1.00 25.68 ? 307  MET A N   1 
ATOM   2381 C  CA  . MET A 1 308 ? 10.120  17.140  18.606  1.00 24.62 ? 307  MET A CA  1 
ATOM   2382 C  C   . MET A 1 308 ? 8.805   17.805  19.014  1.00 24.94 ? 307  MET A C   1 
ATOM   2383 O  O   . MET A 1 308 ? 8.203   17.420  20.015  1.00 23.02 ? 307  MET A O   1 
ATOM   2384 C  CB  . MET A 1 308 ? 9.781   15.847  17.856  1.00 24.86 ? 307  MET A CB  1 
ATOM   2385 C  CG  . MET A 1 308 ? 8.831   16.090  16.714  1.00 25.80 ? 307  MET A CG  1 
ATOM   2386 S  SD  . MET A 1 308 ? 8.415   14.705  15.689  1.00 26.72 ? 307  MET A SD  1 
ATOM   2387 C  CE  . MET A 1 308 ? 6.931   14.083  16.533  1.00 21.91 ? 307  MET A CE  1 
ATOM   2388 N  N   . GLY A 1 309 ? 8.357   18.810  18.263  1.00 23.52 ? 308  GLY A N   1 
ATOM   2389 C  CA  . GLY A 1 309 ? 7.090   19.414  18.604  1.00 21.75 ? 308  GLY A CA  1 
ATOM   2390 C  C   . GLY A 1 309 ? 7.178   20.714  19.371  1.00 23.48 ? 308  GLY A C   1 
ATOM   2391 O  O   . GLY A 1 309 ? 8.142   21.454  19.219  1.00 21.62 ? 308  GLY A O   1 
ATOM   2392 N  N   . HIS A 1 310 ? 6.182   20.958  20.218  1.00 23.18 ? 309  HIS A N   1 
ATOM   2393 C  CA  . HIS A 1 310 ? 6.068   22.197  20.979  1.00 26.58 ? 309  HIS A CA  1 
ATOM   2394 C  C   . HIS A 1 310 ? 7.276   22.718  21.755  1.00 27.25 ? 309  HIS A C   1 
ATOM   2395 O  O   . HIS A 1 310 ? 7.598   23.914  21.716  1.00 28.18 ? 309  HIS A O   1 
ATOM   2396 C  CB  . HIS A 1 310 ? 4.837   22.105  21.890  1.00 27.16 ? 309  HIS A CB  1 
ATOM   2397 C  CG  . HIS A 1 310 ? 4.327   23.432  22.375  1.00 30.94 ? 309  HIS A CG  1 
ATOM   2398 N  ND1 . HIS A 1 310 ? 3.499   24.235  21.612  1.00 29.53 ? 309  HIS A ND1 1 
ATOM   2399 C  CD2 . HIS A 1 310 ? 4.453   24.054  23.566  1.00 31.27 ? 309  HIS A CD2 1 
ATOM   2400 C  CE1 . HIS A 1 310 ? 3.138   25.286  22.318  1.00 29.50 ? 309  HIS A CE1 1 
ATOM   2401 N  NE2 . HIS A 1 310 ? 3.702   25.206  23.510  1.00 31.59 ? 309  HIS A NE2 1 
ATOM   2402 N  N   . TYR A 1 311 ? 7.985   21.835  22.427  1.00 26.25 ? 310  TYR A N   1 
ATOM   2403 C  CA  . TYR A 1 311 ? 9.103   22.252  23.238  1.00 25.39 ? 310  TYR A CA  1 
ATOM   2404 C  C   . TYR A 1 311 ? 10.443  22.209  22.558  1.00 25.48 ? 310  TYR A C   1 
ATOM   2405 O  O   . TYR A 1 311 ? 11.456  22.321  23.219  1.00 24.03 ? 310  TYR A O   1 
ATOM   2406 C  CB  . TYR A 1 311 ? 9.098   21.433  24.534  1.00 27.04 ? 310  TYR A CB  1 
ATOM   2407 C  CG  . TYR A 1 311 ? 7.780   21.574  25.273  1.00 24.78 ? 310  TYR A CG  1 
ATOM   2408 C  CD1 . TYR A 1 311 ? 7.570   22.605  26.192  1.00 26.04 ? 310  TYR A CD1 1 
ATOM   2409 C  CD2 . TYR A 1 311 ? 6.743   20.703  25.019  1.00 26.44 ? 310  TYR A CD2 1 
ATOM   2410 C  CE1 . TYR A 1 311 ? 6.336   22.759  26.836  1.00 26.37 ? 310  TYR A CE1 1 
ATOM   2411 C  CE2 . TYR A 1 311 ? 5.519   20.835  25.641  1.00 27.51 ? 310  TYR A CE2 1 
ATOM   2412 C  CZ  . TYR A 1 311 ? 5.317   21.869  26.546  1.00 28.46 ? 310  TYR A CZ  1 
ATOM   2413 O  OH  . TYR A 1 311 ? 4.066   21.997  27.093  1.00 28.68 ? 310  TYR A OH  1 
ATOM   2414 N  N   . ALA A 1 312 ? 10.452  22.101  21.235  1.00 27.31 ? 311  ALA A N   1 
ATOM   2415 C  CA  . ALA A 1 312 ? 11.706  22.045  20.499  1.00 28.47 ? 311  ALA A CA  1 
ATOM   2416 C  C   . ALA A 1 312 ? 12.496  23.326  20.684  1.00 30.51 ? 311  ALA A C   1 
ATOM   2417 O  O   . ALA A 1 312 ? 13.715  23.340  20.548  1.00 29.66 ? 311  ALA A O   1 
ATOM   2418 C  CB  . ALA A 1 312 ? 11.453  21.772  19.027  1.00 28.06 ? 311  ALA A CB  1 
ATOM   2419 N  N   . ASP A 1 313 ? 11.801  24.396  21.058  1.00 33.33 ? 312  ASP A N   1 
ATOM   2420 C  CA  . ASP A 1 313 ? 12.454  25.685  21.265  1.00 34.04 ? 312  ASP A CA  1 
ATOM   2421 C  C   . ASP A 1 313 ? 13.283  25.736  22.543  1.00 35.98 ? 312  ASP A C   1 
ATOM   2422 O  O   . ASP A 1 313 ? 14.047  26.671  22.752  1.00 34.23 ? 312  ASP A O   1 
ATOM   2423 C  CB  . ASP A 1 313 ? 11.433  26.841  21.212  1.00 33.72 ? 312  ASP A CB  1 
ATOM   2424 C  CG  . ASP A 1 313 ? 10.369  26.772  22.296  1.00 34.67 ? 312  ASP A CG  1 
ATOM   2425 O  OD1 . ASP A 1 313 ? 10.076  25.694  22.858  1.00 33.98 ? 312  ASP A OD1 1 
ATOM   2426 O  OD2 . ASP A 1 313 ? 9.775   27.830  22.570  1.00 34.12 ? 312  ASP A OD2 1 
ATOM   2427 N  N   . LYS A 1 314 ? 13.119  24.732  23.402  1.00 36.48 ? 313  LYS A N   1 
ATOM   2428 C  CA  . LYS A 1 314 ? 13.867  24.661  24.658  1.00 39.22 ? 313  LYS A CA  1 
ATOM   2429 C  C   . LYS A 1 314 ? 15.341  24.380  24.338  1.00 38.90 ? 313  LYS A C   1 
ATOM   2430 O  O   . LYS A 1 314 ? 16.243  24.794  25.060  1.00 40.47 ? 313  LYS A O   1 
ATOM   2431 C  CB  . LYS A 1 314 ? 13.322  23.510  25.515  1.00 40.71 ? 313  LYS A CB  1 
ATOM   2432 C  CG  . LYS A 1 314 ? 12.750  23.909  26.851  1.00 43.04 ? 313  LYS A CG  1 
ATOM   2433 C  CD  . LYS A 1 314 ? 11.428  24.629  26.719  1.00 44.34 ? 313  LYS A CD  1 
ATOM   2434 C  CE  . LYS A 1 314 ? 10.893  25.000  28.102  1.00 47.02 ? 313  LYS A CE  1 
ATOM   2435 N  NZ  . LYS A 1 314 ? 9.503   25.568  28.083  1.00 47.95 ? 313  LYS A NZ  1 
ATOM   2436 N  N   . PHE A 1 315 ? 15.556  23.699  23.226  1.00 40.15 ? 314  PHE A N   1 
ATOM   2437 C  CA  . PHE A 1 315 ? 16.871  23.285  22.746  1.00 41.43 ? 314  PHE A CA  1 
ATOM   2438 C  C   . PHE A 1 315 ? 17.785  24.423  22.267  1.00 40.73 ? 314  PHE A C   1 
ATOM   2439 O  O   . PHE A 1 315 ? 17.370  25.275  21.475  1.00 40.50 ? 314  PHE A O   1 
ATOM   2440 C  CB  . PHE A 1 315 ? 16.664  22.236  21.634  1.00 40.16 ? 314  PHE A CB  1 
ATOM   2441 C  CG  . PHE A 1 315 ? 17.917  21.502  21.222  1.00 41.92 ? 314  PHE A CG  1 
ATOM   2442 C  CD1 . PHE A 1 315 ? 18.496  20.557  22.061  1.00 41.63 ? 314  PHE A CD1 1 
ATOM   2443 C  CD2 . PHE A 1 315 ? 18.486  21.716  19.961  1.00 42.31 ? 314  PHE A CD2 1 
ATOM   2444 C  CE1 . PHE A 1 315 ? 19.626  19.828  21.646  1.00 43.11 ? 314  PHE A CE1 1 
ATOM   2445 C  CE2 . PHE A 1 315 ? 19.612  20.994  19.540  1.00 42.28 ? 314  PHE A CE2 1 
ATOM   2446 C  CZ  . PHE A 1 315 ? 20.178  20.051  20.384  1.00 42.05 ? 314  PHE A CZ  1 
ATOM   2447 N  N   . ALA A 1 316 ? 19.048  24.376  22.703  1.00 42.36 ? 315  ALA A N   1 
ATOM   2448 C  CA  . ALA A 1 316 ? 20.070  25.367  22.349  1.00 44.13 ? 315  ALA A CA  1 
ATOM   2449 C  C   . ALA A 1 316 ? 21.140  24.806  21.409  1.00 43.75 ? 315  ALA A C   1 
ATOM   2450 O  O   . ALA A 1 316 ? 20.761  24.235  20.362  1.00 44.72 ? 315  ALA A O   1 
ATOM   2451 C  CB  . ALA A 1 316 ? 20.732  25.926  23.622  1.00 45.38 ? 315  ALA A CB  1 
ATOM   2452 N  N   . GLN A 1 324 ? 22.329  17.311  12.797  1.00 40.36 ? 323  GLN A N   1 
ATOM   2453 C  CA  . GLN A 1 324 ? 21.505  17.629  11.588  1.00 38.84 ? 323  GLN A CA  1 
ATOM   2454 C  C   . GLN A 1 324 ? 20.161  16.920  11.636  1.00 35.99 ? 323  GLN A C   1 
ATOM   2455 O  O   . GLN A 1 324 ? 19.296  17.370  12.349  1.00 39.19 ? 323  GLN A O   1 
ATOM   2456 C  CB  . GLN A 1 324 ? 22.272  17.311  10.300  1.00 38.85 ? 323  GLN A CB  1 
ATOM   2457 C  CG  . GLN A 1 324 ? 22.941  18.522  9.662   1.00 37.44 ? 323  GLN A CG  1 
ATOM   2458 C  CD  . GLN A 1 324 ? 23.999  19.166  10.550  0.00 36.63 ? 323  GLN A CD  1 
ATOM   2459 O  OE1 . GLN A 1 324 ? 24.087  18.882  11.745  0.00 36.11 ? 323  GLN A OE1 1 
ATOM   2460 N  NE2 . GLN A 1 324 ? 24.806  20.040  9.965   0.00 35.87 ? 323  GLN A NE2 1 
ATOM   2461 N  N   . LYS A 1 325 ? 19.977  15.810  10.933  1.00 31.33 ? 324  LYS A N   1 
ATOM   2462 C  CA  . LYS A 1 325 ? 18.684  15.101  10.957  1.00 32.50 ? 324  LYS A CA  1 
ATOM   2463 C  C   . LYS A 1 325 ? 18.371  14.407  12.307  1.00 31.18 ? 324  LYS A C   1 
ATOM   2464 O  O   . LYS A 1 325 ? 19.227  13.690  12.846  1.00 30.44 ? 324  LYS A O   1 
ATOM   2465 C  CB  . LYS A 1 325 ? 18.643  14.057  9.847   1.00 33.08 ? 324  LYS A CB  1 
ATOM   2466 C  CG  . LYS A 1 325 ? 17.943  14.478  8.580   1.00 35.48 ? 324  LYS A CG  1 
ATOM   2467 C  CD  . LYS A 1 325 ? 18.295  13.523  7.464   1.00 36.91 ? 324  LYS A CD  1 
ATOM   2468 C  CE  . LYS A 1 325 ? 17.137  13.269  6.517   1.00 39.40 ? 324  LYS A CE  1 
ATOM   2469 N  NZ  . LYS A 1 325 ? 17.305  13.892  5.161   1.00 40.11 ? 324  LYS A NZ  1 
ATOM   2470 N  N   . TYR A 1 326 ? 17.155  14.579  12.828  1.00 27.20 ? 325  TYR A N   1 
ATOM   2471 C  CA  . TYR A 1 326 ? 16.785  13.955  14.099  1.00 26.63 ? 325  TYR A CA  1 
ATOM   2472 C  C   . TYR A 1 326 ? 15.728  12.864  13.939  1.00 26.49 ? 325  TYR A C   1 
ATOM   2473 O  O   . TYR A 1 326 ? 14.719  13.043  13.246  1.00 24.19 ? 325  TYR A O   1 
ATOM   2474 C  CB  . TYR A 1 326 ? 16.306  14.993  15.119  1.00 27.14 ? 325  TYR A CB  1 
ATOM   2475 C  CG  . TYR A 1 326 ? 17.410  15.897  15.578  1.00 28.82 ? 325  TYR A CG  1 
ATOM   2476 C  CD1 . TYR A 1 326 ? 17.803  16.984  14.813  1.00 28.62 ? 325  TYR A CD1 1 
ATOM   2477 C  CD2 . TYR A 1 326 ? 18.100  15.640  16.762  1.00 28.85 ? 325  TYR A CD2 1 
ATOM   2478 C  CE1 . TYR A 1 326 ? 18.844  17.792  15.208  1.00 29.82 ? 325  TYR A CE1 1 
ATOM   2479 C  CE2 . TYR A 1 326 ? 19.143  16.440  17.163  1.00 31.10 ? 325  TYR A CE2 1 
ATOM   2480 C  CZ  . TYR A 1 326 ? 19.509  17.515  16.375  1.00 30.20 ? 325  TYR A CZ  1 
ATOM   2481 O  OH  . TYR A 1 326 ? 20.561  18.286  16.754  1.00 29.84 ? 325  TYR A OH  1 
ATOM   2482 N  N   . PHE A 1 327 ? 15.961  11.735  14.603  1.00 24.13 ? 326  PHE A N   1 
ATOM   2483 C  CA  . PHE A 1 327 ? 15.025  10.629  14.529  1.00 22.35 ? 326  PHE A CA  1 
ATOM   2484 C  C   . PHE A 1 327 ? 14.491  10.241  15.874  1.00 23.25 ? 326  PHE A C   1 
ATOM   2485 O  O   . PHE A 1 327 ? 15.102  10.523  16.888  1.00 25.73 ? 326  PHE A O   1 
ATOM   2486 C  CB  . PHE A 1 327 ? 15.669  9.428   13.835  1.00 19.85 ? 326  PHE A CB  1 
ATOM   2487 C  CG  . PHE A 1 327 ? 16.045  9.698   12.417  1.00 17.56 ? 326  PHE A CG  1 
ATOM   2488 C  CD1 . PHE A 1 327 ? 17.259  10.284  12.103  1.00 19.38 ? 326  PHE A CD1 1 
ATOM   2489 C  CD2 . PHE A 1 327 ? 15.153  9.418   11.396  1.00 16.26 ? 326  PHE A CD2 1 
ATOM   2490 C  CE1 . PHE A 1 327 ? 17.590  10.609  10.783  1.00 19.77 ? 326  PHE A CE1 1 
ATOM   2491 C  CE2 . PHE A 1 327 ? 15.464  9.732   10.062  1.00 17.48 ? 326  PHE A CE2 1 
ATOM   2492 C  CZ  . PHE A 1 327 ? 16.687  10.334  9.764   1.00 20.77 ? 326  PHE A CZ  1 
ATOM   2493 N  N   . LEU A 1 328 ? 13.342  9.589   15.841  1.00 24.50 ? 327  LEU A N   1 
ATOM   2494 C  CA  . LEU A 1 328 ? 12.655  9.114   17.021  1.00 25.22 ? 327  LEU A CA  1 
ATOM   2495 C  C   . LEU A 1 328 ? 11.479  8.321   16.505  1.00 25.47 ? 327  LEU A C   1 
ATOM   2496 O  O   . LEU A 1 328 ? 11.151  8.409   15.329  1.00 25.05 ? 327  LEU A O   1 
ATOM   2497 C  CB  . LEU A 1 328 ? 12.156  10.292  17.877  1.00 26.71 ? 327  LEU A CB  1 
ATOM   2498 C  CG  . LEU A 1 328 ? 11.195  11.438  17.453  1.00 28.87 ? 327  LEU A CG  1 
ATOM   2499 C  CD1 . LEU A 1 328 ? 11.374  11.900  16.028  1.00 24.86 ? 327  LEU A CD1 1 
ATOM   2500 C  CD2 . LEU A 1 328 ? 9.784   11.122  17.743  1.00 27.77 ? 327  LEU A CD2 1 
ATOM   2501 N  N   . ASN A 1 329 ? 10.834  7.558   17.395  1.00 27.45 ? 328  ASN A N   1 
ATOM   2502 C  CA  . ASN A 1 329 ? 9.672   6.748   17.063  1.00 25.97 ? 328  ASN A CA  1 
ATOM   2503 C  C   . ASN A 1 329 ? 8.499   7.159   17.919  1.00 23.06 ? 328  ASN A C   1 
ATOM   2504 O  O   . ASN A 1 329 ? 8.677   7.652   19.043  1.00 23.51 ? 328  ASN A O   1 
ATOM   2505 C  CB  . ASN A 1 329 ? 9.955   5.258   17.278  1.00 28.14 ? 328  ASN A CB  1 
ATOM   2506 C  CG  . ASN A 1 329 ? 10.866  4.703   16.224  1.00 27.66 ? 328  ASN A CG  1 
ATOM   2507 O  OD1 . ASN A 1 329 ? 11.761  3.912   16.500  1.00 28.61 ? 328  ASN A OD1 1 
ATOM   2508 N  ND2 . ASN A 1 329 ? 10.677  5.156   15.010  1.00 27.68 ? 328  ASN A ND2 1 
ATOM   2509 N  N   . THR A 1 330 ? 7.305   6.939   17.395  1.00 20.03 ? 329  THR A N   1 
ATOM   2510 C  CA  . THR A 1 330 ? 6.079   7.273   18.104  1.00 22.91 ? 329  THR A CA  1 
ATOM   2511 C  C   . THR A 1 330 ? 5.180   6.035   18.136  1.00 24.66 ? 329  THR A C   1 
ATOM   2512 O  O   . THR A 1 330 ? 5.441   5.045   17.450  1.00 23.39 ? 329  THR A O   1 
ATOM   2513 C  CB  . THR A 1 330 ? 5.292   8.374   17.353  1.00 21.73 ? 329  THR A CB  1 
ATOM   2514 O  OG1 . THR A 1 330 ? 4.797   7.837   16.124  1.00 25.59 ? 329  THR A OG1 1 
ATOM   2515 C  CG2 . THR A 1 330 ? 6.176   9.597   17.022  1.00 22.52 ? 329  THR A CG2 1 
ATOM   2516 N  N   . GLY A 1 331 ? 4.096   6.122   18.890  1.00 23.69 ? 330  GLY A N   1 
ATOM   2517 C  CA  . GLY A 1 331 ? 3.148   5.036   18.915  1.00 27.84 ? 330  GLY A CA  1 
ATOM   2518 C  C   . GLY A 1 331 ? 2.384   5.076   17.604  1.00 30.21 ? 330  GLY A C   1 
ATOM   2519 O  O   . GLY A 1 331 ? 2.614   5.963   16.770  1.00 32.10 ? 330  GLY A O   1 
ATOM   2520 N  N   . ASP A 1 332 ? 1.514   4.093   17.389  1.00 30.88 ? 331  ASP A N   1 
ATOM   2521 C  CA  . ASP A 1 332 ? 0.720   4.061   16.167  1.00 31.77 ? 331  ASP A CA  1 
ATOM   2522 C  C   . ASP A 1 332 ? -0.658  4.652   16.370  1.00 32.36 ? 331  ASP A C   1 
ATOM   2523 O  O   . ASP A 1 332 ? -1.435  4.739   15.435  1.00 32.98 ? 331  ASP A O   1 
ATOM   2524 C  CB  . ASP A 1 332 ? 0.619   2.642   15.578  1.00 34.75 ? 331  ASP A CB  1 
ATOM   2525 C  CG  . ASP A 1 332 ? -0.097  1.643   16.493  1.00 37.71 ? 331  ASP A CG  1 
ATOM   2526 O  OD1 . ASP A 1 332 ? -0.452  1.965   17.656  1.00 39.74 ? 331  ASP A OD1 1 
ATOM   2527 O  OD2 . ASP A 1 332 ? -0.299  0.508   16.018  1.00 39.91 ? 331  ASP A OD2 1 
ATOM   2528 N  N   . SER A 1 333 ? -0.949  5.067   17.590  1.00 31.93 ? 332  SER A N   1 
ATOM   2529 C  CA  . SER A 1 333 ? -2.242  5.646   17.919  1.00 34.98 ? 332  SER A CA  1 
ATOM   2530 C  C   . SER A 1 333 ? -1.983  6.569   19.096  1.00 34.46 ? 332  SER A C   1 
ATOM   2531 O  O   . SER A 1 333 ? -0.893  6.532   19.661  1.00 33.95 ? 332  SER A O   1 
ATOM   2532 C  CB  . SER A 1 333 ? -3.248  4.558   18.312  1.00 36.72 ? 332  SER A CB  1 
ATOM   2533 O  OG  . SER A 1 333 ? -2.897  3.951   19.550  1.00 39.22 ? 332  SER A OG  1 
ATOM   2534 N  N   . SER A 1 334 ? -2.992  7.353   19.475  1.00 36.08 ? 333  SER A N   1 
ATOM   2535 C  CA  . SER A 1 334 ? -2.862  8.317   20.551  1.00 37.03 ? 333  SER A CA  1 
ATOM   2536 C  C   . SER A 1 334 ? -2.043  7.943   21.754  1.00 40.02 ? 333  SER A C   1 
ATOM   2537 O  O   . SER A 1 334 ? -2.292  6.942   22.429  1.00 41.16 ? 333  SER A O   1 
ATOM   2538 C  CB  . SER A 1 334 ? -4.189  8.919   20.973  1.00 37.77 ? 333  SER A CB  1 
ATOM   2539 O  OG  . SER A 1 334 ? -3.937  9.935   21.916  1.00 37.87 ? 333  SER A OG  1 
ATOM   2540 N  N   . ASN A 1 335 ? -1.323  8.981   22.163  1.00 41.40 ? 334  ASN A N   1 
ATOM   2541 C  CA  . ASN A 1 335 ? -0.316  8.966   23.188  1.00 37.05 ? 334  ASN A CA  1 
ATOM   2542 C  C   . ASN A 1 335 ? 0.744   8.227   22.408  1.00 37.16 ? 334  ASN A C   1 
ATOM   2543 O  O   . ASN A 1 335 ? 0.954   6.998   22.495  1.00 33.78 ? 334  ASN A O   1 
ATOM   2544 C  CB  . ASN A 1 335 ? -0.725  8.384   24.516  1.00 40.36 ? 334  ASN A CB  1 
ATOM   2545 C  CG  . ASN A 1 335 ? -0.873  9.471   25.562  1.00 41.15 ? 334  ASN A CG  1 
ATOM   2546 O  OD1 . ASN A 1 335 ? -1.944  10.050  25.716  1.00 42.03 ? 334  ASN A OD1 1 
ATOM   2547 N  ND2 . ASN A 1 335 ? 0.230   9.827   26.218  1.00 43.18 ? 334  ASN A ND2 1 
ATOM   2548 N  N   . PHE A 1 336 ? 1.112   8.993   21.384  1.00 28.26 ? 335  PHE A N   1 
ATOM   2549 C  CA  . PHE A 1 336 ? 2.108   8.668   20.410  1.00 28.05 ? 335  PHE A CA  1 
ATOM   2550 C  C   . PHE A 1 336 ? 3.441   8.779   21.112  1.00 27.17 ? 335  PHE A C   1 
ATOM   2551 O  O   . PHE A 1 336 ? 4.444   8.332   20.588  1.00 28.70 ? 335  PHE A O   1 
ATOM   2552 C  CB  . PHE A 1 336 ? 2.027   9.696   19.279  1.00 25.65 ? 335  PHE A CB  1 
ATOM   2553 C  CG  . PHE A 1 336 ? 0.755   9.629   18.487  1.00 27.00 ? 335  PHE A CG  1 
ATOM   2554 C  CD1 . PHE A 1 336 ? 0.535   8.590   17.614  1.00 27.69 ? 335  PHE A CD1 1 
ATOM   2555 C  CD2 . PHE A 1 336 ? -0.204  10.633  18.594  1.00 28.71 ? 335  PHE A CD2 1 
ATOM   2556 C  CE1 . PHE A 1 336 ? -0.631  8.547   16.849  1.00 29.57 ? 335  PHE A CE1 1 
ATOM   2557 C  CE2 . PHE A 1 336 ? -1.366  10.597  17.837  1.00 28.46 ? 335  PHE A CE2 1 
ATOM   2558 C  CZ  . PHE A 1 336 ? -1.586  9.559   16.966  1.00 29.64 ? 335  PHE A CZ  1 
ATOM   2559 N  N   . ALA A 1 337 ? 3.445   9.459   22.258  1.00 25.00 ? 336  ALA A N   1 
ATOM   2560 C  CA  . ALA A 1 337 ? 4.648   9.647   23.073  1.00 26.51 ? 336  ALA A CA  1 
ATOM   2561 C  C   . ALA A 1 337 ? 5.328   8.294   23.400  1.00 26.97 ? 336  ALA A C   1 
ATOM   2562 O  O   . ALA A 1 337 ? 4.640   7.311   23.693  1.00 26.29 ? 336  ALA A O   1 
ATOM   2563 C  CB  . ALA A 1 337 ? 4.275   10.354  24.357  1.00 23.59 ? 336  ALA A CB  1 
ATOM   2564 N  N   . ARG A 1 338 ? 6.652   8.263   23.313  1.00 26.83 ? 337  ARG A N   1 
ATOM   2565 C  CA  . ARG A 1 338 ? 7.476   7.081   23.580  1.00 24.27 ? 337  ARG A CA  1 
ATOM   2566 C  C   . ARG A 1 338 ? 8.793   7.535   24.205  1.00 25.84 ? 337  ARG A C   1 
ATOM   2567 O  O   . ARG A 1 338 ? 9.276   8.644   23.939  1.00 24.47 ? 337  ARG A O   1 
ATOM   2568 C  CB  . ARG A 1 338 ? 7.811   6.304   22.288  1.00 24.64 ? 337  ARG A CB  1 
ATOM   2569 C  CG  . ARG A 1 338 ? 6.631   5.577   21.598  1.00 24.78 ? 337  ARG A CG  1 
ATOM   2570 C  CD  . ARG A 1 338 ? 6.091   4.386   22.454  1.00 27.01 ? 337  ARG A CD  1 
ATOM   2571 N  NE  . ARG A 1 338 ? 5.070   3.577   21.794  1.00 25.93 ? 337  ARG A NE  1 
ATOM   2572 C  CZ  . ARG A 1 338 ? 3.766   3.847   21.782  1.00 26.10 ? 337  ARG A CZ  1 
ATOM   2573 N  NH1 . ARG A 1 338 ? 3.285   4.908   22.401  1.00 27.54 ? 337  ARG A NH1 1 
ATOM   2574 N  NH2 . ARG A 1 338 ? 2.941   3.088   21.071  1.00 26.54 ? 337  ARG A NH2 1 
ATOM   2575 N  N   . TRP A 1 339 ? 9.379   6.650   25.018  1.00 26.32 ? 338  TRP A N   1 
ATOM   2576 C  CA  . TRP A 1 339 ? 10.664  6.868   25.673  1.00 25.75 ? 338  TRP A CA  1 
ATOM   2577 C  C   . TRP A 1 339 ? 11.555  5.651   25.298  1.00 26.77 ? 338  TRP A C   1 
ATOM   2578 O  O   . TRP A 1 339 ? 11.143  4.502   25.444  1.00 25.42 ? 338  TRP A O   1 
ATOM   2579 C  CB  . TRP A 1 339 ? 10.472  6.942   27.178  1.00 25.92 ? 338  TRP A CB  1 
ATOM   2580 C  CG  . TRP A 1 339 ? 9.891   8.268   27.703  1.00 25.86 ? 338  TRP A CG  1 
ATOM   2581 C  CD1 . TRP A 1 339 ? 10.578  9.270   28.326  1.00 25.15 ? 338  TRP A CD1 1 
ATOM   2582 C  CD2 . TRP A 1 339 ? 8.517   8.715   27.641  1.00 24.59 ? 338  TRP A CD2 1 
ATOM   2583 N  NE1 . TRP A 1 339 ? 9.738   10.299  28.648  1.00 22.42 ? 338  TRP A NE1 1 
ATOM   2584 C  CE2 . TRP A 1 339 ? 8.466   9.994   28.235  1.00 24.78 ? 338  TRP A CE2 1 
ATOM   2585 C  CE3 . TRP A 1 339 ? 7.324   8.154   27.138  1.00 22.37 ? 338  TRP A CE3 1 
ATOM   2586 C  CZ2 . TRP A 1 339 ? 7.273   10.736  28.339  1.00 22.34 ? 338  TRP A CZ2 1 
ATOM   2587 C  CZ3 . TRP A 1 339 ? 6.146   8.884   27.246  1.00 23.48 ? 338  TRP A CZ3 1 
ATOM   2588 C  CH2 . TRP A 1 339 ? 6.135   10.166  27.843  1.00 21.98 ? 338  TRP A CH2 1 
ATOM   2589 N  N   . ARG A 1 340 ? 12.730  5.933   24.759  1.00 25.41 ? 339  ARG A N   1 
ATOM   2590 C  CA  . ARG A 1 340 ? 13.650  4.910   24.308  1.00 26.25 ? 339  ARG A CA  1 
ATOM   2591 C  C   . ARG A 1 340 ? 14.630  4.509   25.390  1.00 24.58 ? 339  ARG A C   1 
ATOM   2592 O  O   . ARG A 1 340 ? 15.119  5.345   26.151  1.00 25.72 ? 339  ARG A O   1 
ATOM   2593 C  CB  . ARG A 1 340 ? 14.373  5.366   23.019  1.00 27.57 ? 339  ARG A CB  1 
ATOM   2594 C  CG  . ARG A 1 340 ? 15.404  4.365   22.499  1.00 28.99 ? 339  ARG A CG  1 
ATOM   2595 C  CD  . ARG A 1 340 ? 15.911  4.649   21.092  1.00 28.76 ? 339  ARG A CD  1 
ATOM   2596 N  NE  . ARG A 1 340 ? 15.015  4.001   20.164  1.00 32.82 ? 339  ARG A NE  1 
ATOM   2597 C  CZ  . ARG A 1 340 ? 15.347  3.121   19.240  1.00 31.19 ? 339  ARG A CZ  1 
ATOM   2598 N  NH1 . ARG A 1 340 ? 16.598  2.763   19.016  1.00 31.94 ? 339  ARG A NH1 1 
ATOM   2599 N  NH2 . ARG A 1 340 ? 14.391  2.633   18.494  1.00 35.22 ? 339  ARG A NH2 1 
ATOM   2600 N  N   . TYR A 1 341 ? 14.834  3.207   25.501  1.00 25.79 ? 340  TYR A N   1 
ATOM   2601 C  CA  . TYR A 1 341 ? 15.736  2.615   26.483  1.00 23.27 ? 340  TYR A CA  1 
ATOM   2602 C  C   . TYR A 1 341 ? 16.657  1.628   25.749  1.00 24.88 ? 340  TYR A C   1 
ATOM   2603 O  O   . TYR A 1 341 ? 16.299  1.123   24.689  1.00 26.26 ? 340  TYR A O   1 
ATOM   2604 C  CB  . TYR A 1 341 ? 14.945  1.827   27.510  1.00 22.37 ? 340  TYR A CB  1 
ATOM   2605 C  CG  . TYR A 1 341 ? 14.020  2.635   28.381  1.00 21.57 ? 340  TYR A CG  1 
ATOM   2606 C  CD1 . TYR A 1 341 ? 12.740  2.941   27.951  1.00 22.90 ? 340  TYR A CD1 1 
ATOM   2607 C  CD2 . TYR A 1 341 ? 14.407  3.051   29.635  1.00 23.04 ? 340  TYR A CD2 1 
ATOM   2608 C  CE1 . TYR A 1 341 ? 11.867  3.616   28.742  1.00 22.38 ? 340  TYR A CE1 1 
ATOM   2609 C  CE2 . TYR A 1 341 ? 13.524  3.742   30.459  1.00 22.43 ? 340  TYR A CE2 1 
ATOM   2610 C  CZ  . TYR A 1 341 ? 12.260  4.017   30.003  1.00 22.87 ? 340  TYR A CZ  1 
ATOM   2611 O  OH  . TYR A 1 341 ? 11.353  4.673   30.822  1.00 23.41 ? 340  TYR A OH  1 
ATOM   2612 N  N   . GLY A 1 342 ? 17.833  1.393   26.314  1.00 21.71 ? 341  GLY A N   1 
ATOM   2613 C  CA  . GLY A 1 342 ? 18.785  0.456   25.740  1.00 23.94 ? 341  GLY A CA  1 
ATOM   2614 C  C   . GLY A 1 342 ? 19.036  -0.562  26.852  1.00 23.75 ? 341  GLY A C   1 
ATOM   2615 O  O   . GLY A 1 342 ? 19.022  -0.190  28.015  1.00 19.07 ? 341  GLY A O   1 
ATOM   2616 N  N   . VAL A 1 343 ? 19.177  -1.843  26.512  1.00 24.71 ? 342  VAL A N   1 
ATOM   2617 C  CA  . VAL A 1 343 ? 19.403  -2.898  27.516  1.00 24.37 ? 342  VAL A CA  1 
ATOM   2618 C  C   . VAL A 1 343 ? 20.371  -3.953  26.948  1.00 24.17 ? 342  VAL A C   1 
ATOM   2619 O  O   . VAL A 1 343 ? 20.378  -4.207  25.735  1.00 24.68 ? 342  VAL A O   1 
ATOM   2620 C  CB  . VAL A 1 343 ? 18.088  -3.670  27.916  1.00 23.37 ? 342  VAL A CB  1 
ATOM   2621 C  CG1 . VAL A 1 343 ? 17.087  -2.796  28.611  1.00 23.23 ? 342  VAL A CG1 1 
ATOM   2622 C  CG2 . VAL A 1 343 ? 17.443  -4.244  26.707  1.00 24.61 ? 342  VAL A CG2 1 
ATOM   2623 N  N   . SER A 1 344 ? 21.161  -4.543  27.849  1.00 23.78 ? 343  SER A N   1 
ATOM   2624 C  CA  . SER A 1 344 ? 22.131  -5.587  27.530  1.00 25.98 ? 343  SER A CA  1 
ATOM   2625 C  C   . SER A 1 344 ? 21.894  -6.714  28.508  1.00 26.63 ? 343  SER A C   1 
ATOM   2626 O  O   . SER A 1 344 ? 21.988  -6.521  29.725  1.00 27.73 ? 343  SER A O   1 
ATOM   2627 C  CB  . SER A 1 344 ? 23.571  -5.113  27.701  1.00 25.46 ? 343  SER A CB  1 
ATOM   2628 O  OG  . SER A 1 344 ? 23.851  -3.974  26.927  1.00 28.38 ? 343  SER A OG  1 
ATOM   2629 N  N   . ILE A 1 345 ? 21.567  -7.879  27.968  1.00 27.82 ? 344  ILE A N   1 
ATOM   2630 C  CA  . ILE A 1 345 ? 21.306  -9.078  28.761  1.00 24.71 ? 344  ILE A CA  1 
ATOM   2631 C  C   . ILE A 1 345 ? 22.456  -10.082 28.609  1.00 23.33 ? 344  ILE A C   1 
ATOM   2632 O  O   . ILE A 1 345 ? 22.837  -10.458 27.487  1.00 22.49 ? 344  ILE A O   1 
ATOM   2633 C  CB  . ILE A 1 345 ? 20.030  -9.758  28.295  1.00 25.30 ? 344  ILE A CB  1 
ATOM   2634 C  CG1 . ILE A 1 345 ? 18.864  -8.757  28.254  1.00 27.55 ? 344  ILE A CG1 1 
ATOM   2635 C  CG2 . ILE A 1 345 ? 19.670  -10.882 29.238  1.00 24.74 ? 344  ILE A CG2 1 
ATOM   2636 C  CD1 . ILE A 1 345 ? 17.606  -9.361  27.702  1.00 30.42 ? 344  ILE A CD1 1 
ATOM   2637 N  N   . THR A 1 346 ? 23.020  -10.480 29.732  1.00 23.39 ? 345  THR A N   1 
ATOM   2638 C  CA  . THR A 1 346 ? 24.080  -11.478 29.773  1.00 22.61 ? 345  THR A CA  1 
ATOM   2639 C  C   . THR A 1 346 ? 23.330  -12.694 30.279  1.00 21.90 ? 345  THR A C   1 
ATOM   2640 O  O   . THR A 1 346 ? 22.763  -12.667 31.370  1.00 21.35 ? 345  THR A O   1 
ATOM   2641 C  CB  . THR A 1 346 ? 25.193  -11.079 30.747  1.00 23.01 ? 345  THR A CB  1 
ATOM   2642 O  OG1 . THR A 1 346 ? 25.752  -9.826  30.304  1.00 21.54 ? 345  THR A OG1 1 
ATOM   2643 C  CG2 . THR A 1 346 ? 26.318  -12.177 30.734  1.00 22.02 ? 345  THR A CG2 1 
ATOM   2644 N  N   . LEU A 1 347 ? 23.220  -13.708 29.426  1.00 21.90 ? 346  LEU A N   1 
ATOM   2645 C  CA  . LEU A 1 347 ? 22.439  -14.905 29.763  1.00 22.61 ? 346  LEU A CA  1 
ATOM   2646 C  C   . LEU A 1 347 ? 23.101  -15.856 30.731  1.00 21.90 ? 346  LEU A C   1 
ATOM   2647 O  O   . LEU A 1 347 ? 24.323  -15.886 30.847  1.00 21.24 ? 346  LEU A O   1 
ATOM   2648 C  CB  . LEU A 1 347 ? 22.009  -15.646 28.470  1.00 19.82 ? 346  LEU A CB  1 
ATOM   2649 C  CG  . LEU A 1 347 ? 21.115  -14.806 27.553  1.00 19.36 ? 346  LEU A CG  1 
ATOM   2650 C  CD1 . LEU A 1 347 ? 21.006  -15.421 26.161  1.00 20.04 ? 346  LEU A CD1 1 
ATOM   2651 C  CD2 . LEU A 1 347 ? 19.766  -14.591 28.166  1.00 18.34 ? 346  LEU A CD2 1 
ATOM   2652 N  N   . SER A 1 348 ? 22.267  -16.627 31.429  1.00 24.41 ? 347  SER A N   1 
ATOM   2653 C  CA  . SER A 1 348 ? 22.704  -17.629 32.384  1.00 23.64 ? 347  SER A CA  1 
ATOM   2654 C  C   . SER A 1 348 ? 21.818  -18.891 32.207  1.00 26.33 ? 347  SER A C   1 
ATOM   2655 O  O   . SER A 1 348 ? 20.941  -18.924 31.341  1.00 27.85 ? 347  SER A O   1 
ATOM   2656 C  CB  . SER A 1 348 ? 22.559  -17.104 33.806  1.00 22.12 ? 347  SER A CB  1 
ATOM   2657 O  OG  . SER A 1 348 ? 21.191  -16.912 34.130  1.00 24.75 ? 347  SER A OG  1 
ATOM   2658 N  N   . GLY A 1 349 ? 22.043  -19.915 33.034  1.00 28.83 ? 348  GLY A N   1 
ATOM   2659 C  CA  . GLY A 1 349 ? 21.235  -21.122 32.960  1.00 29.84 ? 348  GLY A CA  1 
ATOM   2660 C  C   . GLY A 1 349 ? 21.754  -22.131 31.966  1.00 31.26 ? 348  GLY A C   1 
ATOM   2661 O  O   . GLY A 1 349 ? 22.956  -22.422 31.919  1.00 32.24 ? 348  GLY A O   1 
ATOM   2662 N  N   . LYS A 1 350 ? 20.865  -22.611 31.104  1.00 33.13 ? 349  LYS A N   1 
ATOM   2663 C  CA  . LYS A 1 350 ? 21.256  -23.609 30.126  1.00 34.01 ? 349  LYS A CA  1 
ATOM   2664 C  C   . LYS A 1 350 ? 20.919  -23.152 28.731  1.00 34.59 ? 349  LYS A C   1 
ATOM   2665 O  O   . LYS A 1 350 ? 20.101  -22.248 28.545  1.00 34.81 ? 349  LYS A O   1 
ATOM   2666 C  CB  . LYS A 1 350 ? 20.571  -24.955 30.436  1.00 34.29 ? 349  LYS A CB  1 
ATOM   2667 C  CG  . LYS A 1 350 ? 21.041  -25.614 31.728  0.00 32.92 ? 349  LYS A CG  1 
ATOM   2668 C  CD  . LYS A 1 350 ? 20.398  -26.976 31.910  0.00 32.24 ? 349  LYS A CD  1 
ATOM   2669 C  CE  . LYS A 1 350 ? 20.811  -27.633 33.219  0.00 31.75 ? 349  LYS A CE  1 
ATOM   2670 N  NZ  . LYS A 1 350 ? 20.456  -26.813 34.413  0.00 31.40 ? 349  LYS A NZ  1 
ATOM   2671 N  N   . ARG A 1 351 ? 21.587  -23.751 27.749  1.00 34.83 ? 350  ARG A N   1 
ATOM   2672 C  CA  . ARG A 1 351 ? 21.349  -23.420 26.355  1.00 35.00 ? 350  ARG A CA  1 
ATOM   2673 C  C   . ARG A 1 351 ? 19.915  -23.754 25.941  1.00 35.74 ? 350  ARG A C   1 
ATOM   2674 O  O   . ARG A 1 351 ? 19.351  -24.782 26.360  1.00 36.12 ? 350  ARG A O   1 
ATOM   2675 C  CB  . ARG A 1 351 ? 22.312  -24.172 25.442  1.00 36.30 ? 350  ARG A CB  1 
ATOM   2676 C  CG  . ARG A 1 351 ? 22.099  -23.856 23.957  1.00 36.94 ? 350  ARG A CG  1 
ATOM   2677 C  CD  . ARG A 1 351 ? 21.998  -25.120 23.126  1.00 40.40 ? 350  ARG A CD  1 
ATOM   2678 N  NE  . ARG A 1 351 ? 21.999  -24.852 21.687  1.00 41.23 ? 350  ARG A NE  1 
ATOM   2679 C  CZ  . ARG A 1 351 ? 23.091  -24.553 20.993  1.00 41.02 ? 350  ARG A CZ  1 
ATOM   2680 N  NH1 . ARG A 1 351 ? 24.273  -24.471 21.601  1.00 41.18 ? 350  ARG A NH1 1 
ATOM   2681 N  NH2 . ARG A 1 351 ? 23.015  -24.387 19.680  1.00 40.26 ? 350  ARG A NH2 1 
ATOM   2682 N  N   . ALA A 1 352 ? 19.336  -22.890 25.103  1.00 32.79 ? 351  ALA A N   1 
ATOM   2683 C  CA  . ALA A 1 352 ? 17.979  -23.068 24.608  1.00 32.31 ? 351  ALA A CA  1 
ATOM   2684 C  C   . ALA A 1 352 ? 17.783  -22.116 23.456  1.00 33.45 ? 351  ALA A C   1 
ATOM   2685 O  O   . ALA A 1 352 ? 18.626  -21.262 23.210  1.00 34.30 ? 351  ALA A O   1 
ATOM   2686 C  CB  . ALA A 1 352 ? 16.968  -22.797 25.708  1.00 33.25 ? 351  ALA A CB  1 
ATOM   2687 N  N   . THR A 1 353 ? 16.739  -22.324 22.672  1.00 35.27 ? 352  THR A N   1 
ATOM   2688 C  CA  . THR A 1 353 ? 16.460  -21.454 21.555  1.00 34.16 ? 352  THR A CA  1 
ATOM   2689 C  C   . THR A 1 353 ? 15.172  -20.743 21.920  1.00 33.23 ? 352  THR A C   1 
ATOM   2690 O  O   . THR A 1 353 ? 14.248  -21.352 22.461  1.00 31.77 ? 352  THR A O   1 
ATOM   2691 C  CB  . THR A 1 353 ? 16.295  -22.242 20.229  1.00 35.73 ? 352  THR A CB  1 
ATOM   2692 O  OG1 . THR A 1 353 ? 15.589  -23.462 20.485  1.00 40.93 ? 352  THR A OG1 1 
ATOM   2693 C  CG2 . THR A 1 353 ? 17.658  -22.584 19.628  1.00 36.33 ? 352  THR A CG2 1 
ATOM   2694 N  N   . GLY A 1 354 ? 15.110  -19.445 21.664  1.00 31.80 ? 353  GLY A N   1 
ATOM   2695 C  CA  . GLY A 1 354 ? 13.893  -18.736 21.999  1.00 31.25 ? 353  GLY A CA  1 
ATOM   2696 C  C   . GLY A 1 354 ? 14.026  -17.239 21.924  1.00 30.85 ? 353  GLY A C   1 
ATOM   2697 O  O   . GLY A 1 354 ? 15.032  -16.704 21.425  1.00 29.33 ? 353  GLY A O   1 
ATOM   2698 N  N   . GLN A 1 355 ? 12.991  -16.572 22.428  1.00 30.52 ? 354  GLN A N   1 
ATOM   2699 C  CA  . GLN A 1 355 ? 12.902  -15.121 22.454  1.00 28.60 ? 354  GLN A CA  1 
ATOM   2700 C  C   . GLN A 1 355 ? 13.074  -14.632 23.881  1.00 28.36 ? 354  GLN A C   1 
ATOM   2701 O  O   . GLN A 1 355 ? 12.254  -14.952 24.752  1.00 29.78 ? 354  GLN A O   1 
ATOM   2702 C  CB  . GLN A 1 355 ? 11.525  -14.679 21.937  1.00 28.28 ? 354  GLN A CB  1 
ATOM   2703 C  CG  . GLN A 1 355 ? 11.253  -13.188 22.057  1.00 28.73 ? 354  GLN A CG  1 
ATOM   2704 C  CD  . GLN A 1 355 ? 12.110  -12.355 21.138  1.00 26.52 ? 354  GLN A CD  1 
ATOM   2705 O  OE1 . GLN A 1 355 ? 11.839  -12.257 19.956  1.00 28.75 ? 354  GLN A OE1 1 
ATOM   2706 N  NE2 . GLN A 1 355 ? 13.173  -11.779 21.674  1.00 28.39 ? 354  GLN A NE2 1 
ATOM   2707 N  N   . ALA A 1 356 ? 14.165  -13.912 24.130  1.00 25.24 ? 355  ALA A N   1 
ATOM   2708 C  CA  . ALA A 1 356 ? 14.444  -13.324 25.435  1.00 23.65 ? 355  ALA A CA  1 
ATOM   2709 C  C   . ALA A 1 356 ? 13.765  -11.930 25.457  1.00 24.26 ? 355  ALA A C   1 
ATOM   2710 O  O   . ALA A 1 356 ? 13.885  -11.158 24.489  1.00 22.05 ? 355  ALA A O   1 
ATOM   2711 C  CB  . ALA A 1 356 ? 15.948  -13.202 25.647  1.00 24.62 ? 355  ALA A CB  1 
ATOM   2712 N  N   . LYS A 1 357 ? 13.088  -11.608 26.552  1.00 24.49 ? 356  LYS A N   1 
ATOM   2713 C  CA  . LYS A 1 357 ? 12.337  -10.365 26.725  1.00 25.67 ? 356  LYS A CA  1 
ATOM   2714 C  C   . LYS A 1 357 ? 12.705  -9.681  28.039  1.00 26.39 ? 356  LYS A C   1 
ATOM   2715 O  O   . LYS A 1 357 ? 13.240  -10.317 28.940  1.00 26.44 ? 356  LYS A O   1 
ATOM   2716 C  CB  . LYS A 1 357 ? 10.842  -10.670 26.742  1.00 26.80 ? 356  LYS A CB  1 
ATOM   2717 C  CG  . LYS A 1 357 ? 10.342  -11.413 25.508  1.00 28.65 ? 356  LYS A CG  1 
ATOM   2718 C  CD  . LYS A 1 357 ? 8.827   -11.588 25.547  1.00 32.34 ? 356  LYS A CD  1 
ATOM   2719 C  CE  . LYS A 1 357 ? 8.363   -12.575 24.466  1.00 34.13 ? 356  LYS A CE  1 
ATOM   2720 N  NZ  . LYS A 1 357 ? 8.002   -11.934 23.173  1.00 34.78 ? 356  LYS A NZ  1 
ATOM   2721 N  N   . VAL A 1 358 ? 12.393  -8.390  28.152  1.00 27.16 ? 357  VAL A N   1 
ATOM   2722 C  CA  . VAL A 1 358 ? 12.699  -7.623  29.359  1.00 27.16 ? 357  VAL A CA  1 
ATOM   2723 C  C   . VAL A 1 358 ? 11.646  -6.533  29.591  1.00 27.26 ? 357  VAL A C   1 
ATOM   2724 O  O   . VAL A 1 358 ? 11.048  -6.018  28.639  1.00 29.19 ? 357  VAL A O   1 
ATOM   2725 C  CB  . VAL A 1 358 ? 14.114  -6.965  29.262  1.00 30.64 ? 357  VAL A CB  1 
ATOM   2726 C  CG1 . VAL A 1 358 ? 14.046  -5.567  28.579  1.00 29.88 ? 357  VAL A CG1 1 
ATOM   2727 C  CG2 . VAL A 1 358 ? 14.743  -6.873  30.597  1.00 31.92 ? 357  VAL A CG2 1 
ATOM   2728 N  N   . ALA A 1 359 ? 11.325  -6.274  30.852  1.00 25.65 ? 358  ALA A N   1 
ATOM   2729 C  CA  . ALA A 1 359 ? 10.381  -5.206  31.207  1.00 24.24 ? 358  ALA A CA  1 
ATOM   2730 C  C   . ALA A 1 359 ? 11.058  -4.464  32.341  1.00 23.96 ? 358  ALA A C   1 
ATOM   2731 O  O   . ALA A 1 359 ? 11.725  -5.086  33.158  1.00 20.60 ? 358  ALA A O   1 
ATOM   2732 C  CB  . ALA A 1 359 ? 9.051   -5.762  31.655  1.00 21.56 ? 358  ALA A CB  1 
ATOM   2733 N  N   . LEU A 1 360 ? 10.940  -3.131  32.346  1.00 25.51 ? 359  LEU A N   1 
ATOM   2734 C  CA  . LEU A 1 360 ? 11.555  -2.308  33.370  1.00 27.32 ? 359  LEU A CA  1 
ATOM   2735 C  C   . LEU A 1 360 ? 10.504  -1.881  34.374  1.00 25.32 ? 359  LEU A C   1 
ATOM   2736 O  O   . LEU A 1 360 ? 9.355   -1.624  34.011  1.00 26.80 ? 359  LEU A O   1 
ATOM   2737 C  CB  . LEU A 1 360 ? 12.207  -1.042  32.778  1.00 28.93 ? 359  LEU A CB  1 
ATOM   2738 C  CG  . LEU A 1 360 ? 13.160  -0.988  31.588  1.00 30.88 ? 359  LEU A CG  1 
ATOM   2739 C  CD1 . LEU A 1 360 ? 14.232  -2.114  31.577  1.00 29.28 ? 359  LEU A CD1 1 
ATOM   2740 C  CD2 . LEU A 1 360 ? 12.318  -1.078  30.377  1.00 32.53 ? 359  LEU A CD2 1 
ATOM   2741 N  N   . PHE A 1 361 ? 10.882  -1.884  35.644  1.00 25.64 ? 360  PHE A N   1 
ATOM   2742 C  CA  . PHE A 1 361 ? 9.980   -1.483  36.703  1.00 25.80 ? 360  PHE A CA  1 
ATOM   2743 C  C   . PHE A 1 361 ? 10.694  -0.382  37.478  1.00 25.05 ? 360  PHE A C   1 
ATOM   2744 O  O   . PHE A 1 361 ? 11.734  -0.612  38.109  1.00 23.67 ? 360  PHE A O   1 
ATOM   2745 C  CB  . PHE A 1 361 ? 9.621   -2.673  37.630  1.00 24.32 ? 360  PHE A CB  1 
ATOM   2746 C  CG  . PHE A 1 361 ? 8.658   -3.673  37.004  1.00 23.62 ? 360  PHE A CG  1 
ATOM   2747 C  CD1 . PHE A 1 361 ? 9.029   -4.401  35.870  1.00 24.21 ? 360  PHE A CD1 1 
ATOM   2748 C  CD2 . PHE A 1 361 ? 7.377   -3.851  37.525  1.00 23.02 ? 360  PHE A CD2 1 
ATOM   2749 C  CE1 . PHE A 1 361 ? 8.130   -5.288  35.252  1.00 23.39 ? 360  PHE A CE1 1 
ATOM   2750 C  CE2 . PHE A 1 361 ? 6.473   -4.727  36.927  1.00 23.04 ? 360  PHE A CE2 1 
ATOM   2751 C  CZ  . PHE A 1 361 ? 6.856   -5.450  35.775  1.00 23.60 ? 360  PHE A CZ  1 
ATOM   2752 N  N   . GLY A 1 362 ? 10.120  0.816   37.426  1.00 27.63 ? 361  GLY A N   1 
ATOM   2753 C  CA  . GLY A 1 362 ? 10.699  1.947   38.134  1.00 26.46 ? 361  GLY A CA  1 
ATOM   2754 C  C   . GLY A 1 362 ? 9.739   2.672   39.061  1.00 28.09 ? 361  GLY A C   1 
ATOM   2755 O  O   . GLY A 1 362 ? 8.595   2.235   39.269  1.00 25.46 ? 361  GLY A O   1 
ATOM   2756 N  N   . SER A 1 363 ? 10.205  3.797   39.600  1.00 28.76 ? 362  SER A N   1 
ATOM   2757 C  CA  . SER A 1 363 ? 9.420   4.609   40.530  1.00 29.78 ? 362  SER A CA  1 
ATOM   2758 C  C   . SER A 1 363 ? 8.118   5.135   39.952  1.00 30.46 ? 362  SER A C   1 
ATOM   2759 O  O   . SER A 1 363 ? 7.140   5.268   40.675  1.00 32.42 ? 362  SER A O   1 
ATOM   2760 C  CB  . SER A 1 363 ? 10.252  5.790   41.044  1.00 31.56 ? 362  SER A CB  1 
ATOM   2761 O  OG  . SER A 1 363 ? 10.702  6.623   39.967  1.00 30.02 ? 362  SER A OG  1 
ATOM   2762 N  N   . LYS A 1 364 ? 8.104   5.488   38.667  1.00 30.95 ? 363  LYS A N   1 
ATOM   2763 C  CA  . LYS A 1 364 ? 6.894   6.022   38.040  1.00 32.05 ? 363  LYS A CA  1 
ATOM   2764 C  C   . LYS A 1 364 ? 5.983   5.000   37.357  1.00 32.90 ? 363  LYS A C   1 
ATOM   2765 O  O   . LYS A 1 364 ? 4.931   5.368   36.817  1.00 33.72 ? 363  LYS A O   1 
ATOM   2766 C  CB  . LYS A 1 364 ? 7.260   7.128   37.043  1.00 33.42 ? 363  LYS A CB  1 
ATOM   2767 C  CG  . LYS A 1 364 ? 7.905   8.351   37.684  1.00 34.96 ? 363  LYS A CG  1 
ATOM   2768 C  CD  . LYS A 1 364 ? 8.529   9.283   36.650  1.00 36.78 ? 363  LYS A CD  1 
ATOM   2769 C  CE  . LYS A 1 364 ? 8.988   10.584  37.310  1.00 38.70 ? 363  LYS A CE  1 
ATOM   2770 N  NZ  . LYS A 1 364 ? 9.463   11.552  36.285  1.00 40.52 ? 363  LYS A NZ  1 
ATOM   2771 N  N   . GLY A 1 365 ? 6.374   3.723   37.378  1.00 32.36 ? 364  GLY A N   1 
ATOM   2772 C  CA  . GLY A 1 365 ? 5.574   2.684   36.744  1.00 33.55 ? 364  GLY A CA  1 
ATOM   2773 C  C   . GLY A 1 365 ? 6.421   1.659   35.997  1.00 30.46 ? 364  GLY A C   1 
ATOM   2774 O  O   . GLY A 1 365 ? 7.643   1.640   36.117  1.00 31.52 ? 364  GLY A O   1 
ATOM   2775 N  N   . ASN A 1 366 ? 5.791   0.825   35.184  1.00 31.82 ? 365  ASN A N   1 
ATOM   2776 C  CA  . ASN A 1 366 ? 6.554   -0.193  34.461  1.00 30.08 ? 365  ASN A CA  1 
ATOM   2777 C  C   . ASN A 1 366 ? 6.162   -0.286  32.997  1.00 31.40 ? 365  ASN A C   1 
ATOM   2778 O  O   . ASN A 1 366 ? 5.078   0.143   32.601  1.00 32.28 ? 365  ASN A O   1 
ATOM   2779 C  CB  . ASN A 1 366 ? 6.394   -1.563  35.143  1.00 29.50 ? 365  ASN A CB  1 
ATOM   2780 C  CG  . ASN A 1 366 ? 4.981   -2.093  35.069  1.00 28.68 ? 365  ASN A CG  1 
ATOM   2781 O  OD1 . ASN A 1 366 ? 4.167   -1.810  35.941  1.00 29.46 ? 365  ASN A OD1 1 
ATOM   2782 N  ND2 . ASN A 1 366 ? 4.676   -2.852  34.030  1.00 28.92 ? 365  ASN A ND2 1 
ATOM   2783 N  N   . THR A 1 367 ? 7.067   -0.840  32.189  1.00 30.95 ? 366  THR A N   1 
ATOM   2784 C  CA  . THR A 1 367 ? 6.840   -1.008  30.762  1.00 30.07 ? 366  THR A CA  1 
ATOM   2785 C  C   . THR A 1 367 ? 6.259   -2.393  30.468  1.00 31.61 ? 366  THR A C   1 
ATOM   2786 O  O   . THR A 1 367 ? 6.116   -3.218  31.370  1.00 32.91 ? 366  THR A O   1 
ATOM   2787 C  CB  . THR A 1 367 ? 8.168   -0.927  30.004  1.00 29.22 ? 366  THR A CB  1 
ATOM   2788 O  OG1 . THR A 1 367 ? 8.965   -2.093  30.292  1.00 26.64 ? 366  THR A OG1 1 
ATOM   2789 C  CG2 . THR A 1 367 ? 8.930   0.322   30.419  1.00 25.63 ? 366  THR A CG2 1 
ATOM   2790 N  N   . HIS A 1 368 ? 5.925   -2.635  29.203  1.00 31.61 ? 367  HIS A N   1 
ATOM   2791 C  CA  . HIS A 1 368 ? 5.454   -3.947  28.785  1.00 33.44 ? 367  HIS A CA  1 
ATOM   2792 C  C   . HIS A 1 368 ? 6.719   -4.783  28.539  1.00 31.58 ? 367  HIS A C   1 
ATOM   2793 O  O   . HIS A 1 368 ? 7.835   -4.269  28.632  1.00 28.96 ? 367  HIS A O   1 
ATOM   2794 C  CB  . HIS A 1 368 ? 4.673   -3.855  27.480  1.00 35.05 ? 367  HIS A CB  1 
ATOM   2795 C  CG  . HIS A 1 368 ? 3.304   -3.266  27.631  1.00 38.63 ? 367  HIS A CG  1 
ATOM   2796 N  ND1 . HIS A 1 368 ? 2.434   -3.136  26.572  1.00 40.02 ? 367  HIS A ND1 1 
ATOM   2797 C  CD2 . HIS A 1 368 ? 2.671   -2.741  28.706  1.00 38.95 ? 367  HIS A CD2 1 
ATOM   2798 C  CE1 . HIS A 1 368 ? 1.324   -2.549  26.983  1.00 40.08 ? 367  HIS A CE1 1 
ATOM   2799 N  NE2 . HIS A 1 368 ? 1.441   -2.300  28.279  1.00 39.17 ? 367  HIS A NE2 1 
ATOM   2800 N  N   . GLN A 1 369 ? 6.549   -6.053  28.193  1.00 31.76 ? 368  GLN A N   1 
ATOM   2801 C  CA  . GLN A 1 369 ? 7.699   -6.913  27.913  1.00 32.20 ? 368  GLN A CA  1 
ATOM   2802 C  C   . GLN A 1 369 ? 8.174   -6.619  26.482  1.00 31.62 ? 368  GLN A C   1 
ATOM   2803 O  O   . GLN A 1 369 ? 7.373   -6.606  25.543  1.00 31.43 ? 368  GLN A O   1 
ATOM   2804 C  CB  . GLN A 1 369 ? 7.318   -8.385  28.104  1.00 32.85 ? 368  GLN A CB  1 
ATOM   2805 C  CG  . GLN A 1 369 ? 7.161   -8.809  29.572  1.00 33.59 ? 368  GLN A CG  1 
ATOM   2806 C  CD  . GLN A 1 369 ? 6.004   -9.802  29.835  1.00 37.56 ? 368  GLN A CD  1 
ATOM   2807 O  OE1 . GLN A 1 369 ? 4.936   -9.744  29.205  1.00 40.30 ? 368  GLN A OE1 1 
ATOM   2808 N  NE2 . GLN A 1 369 ? 6.197   -10.680 30.813  1.00 39.63 ? 368  GLN A NE2 1 
ATOM   2809 N  N   . PHE A 1 370 ? 9.468   -6.349  26.323  1.00 30.71 ? 369  PHE A N   1 
ATOM   2810 C  CA  . PHE A 1 370 ? 10.030  -6.046  25.009  1.00 29.63 ? 369  PHE A CA  1 
ATOM   2811 C  C   . PHE A 1 370 ? 11.030  -7.086  24.499  1.00 29.65 ? 369  PHE A C   1 
ATOM   2812 O  O   . PHE A 1 370 ? 11.925  -7.521  25.240  1.00 25.85 ? 369  PHE A O   1 
ATOM   2813 C  CB  . PHE A 1 370 ? 10.719  -4.681  25.045  1.00 30.37 ? 369  PHE A CB  1 
ATOM   2814 C  CG  . PHE A 1 370 ? 9.776   -3.516  24.958  1.00 30.20 ? 369  PHE A CG  1 
ATOM   2815 C  CD1 . PHE A 1 370 ? 9.430   -2.985  23.724  1.00 31.84 ? 369  PHE A CD1 1 
ATOM   2816 C  CD2 . PHE A 1 370 ? 9.285   -2.903  26.102  1.00 31.84 ? 369  PHE A CD2 1 
ATOM   2817 C  CE1 . PHE A 1 370 ? 8.619   -1.865  23.627  1.00 32.24 ? 369  PHE A CE1 1 
ATOM   2818 C  CE2 . PHE A 1 370 ? 8.460   -1.764  26.009  1.00 32.29 ? 369  PHE A CE2 1 
ATOM   2819 C  CZ  . PHE A 1 370 ? 8.137   -1.259  24.771  1.00 31.09 ? 369  PHE A CZ  1 
ATOM   2820 N  N   . ASN A 1 371 ? 10.862  -7.467  23.234  1.00 27.96 ? 370  ASN A N   1 
ATOM   2821 C  CA  . ASN A 1 371 ? 11.744  -8.410  22.549  1.00 28.80 ? 370  ASN A CA  1 
ATOM   2822 C  C   . ASN A 1 371 ? 13.171  -7.866  22.518  1.00 27.97 ? 370  ASN A C   1 
ATOM   2823 O  O   . ASN A 1 371 ? 13.416  -6.799  21.968  1.00 30.07 ? 370  ASN A O   1 
ATOM   2824 C  CB  . ASN A 1 371 ? 11.280  -8.642  21.093  1.00 26.50 ? 370  ASN A CB  1 
ATOM   2825 C  CG  . ASN A 1 371 ? 10.007  -9.486  20.994  1.00 30.59 ? 370  ASN A CG  1 
ATOM   2826 O  OD1 . ASN A 1 371 ? 9.604   -10.147 21.943  1.00 29.31 ? 370  ASN A OD1 1 
ATOM   2827 N  ND2 . ASN A 1 371 ? 9.376   -9.471  19.829  1.00 29.80 ? 370  ASN A ND2 1 
ATOM   2828 N  N   . ILE A 1 372 ? 14.111  -8.566  23.145  1.00 25.50 ? 371  ILE A N   1 
ATOM   2829 C  CA  . ILE A 1 372 ? 15.488  -8.132  23.120  1.00 25.75 ? 371  ILE A CA  1 
ATOM   2830 C  C   . ILE A 1 372 ? 16.344  -8.926  22.119  1.00 28.70 ? 371  ILE A C   1 
ATOM   2831 O  O   . ILE A 1 372 ? 17.091  -8.335  21.321  1.00 27.39 ? 371  ILE A O   1 
ATOM   2832 C  CB  . ILE A 1 372 ? 16.115  -8.203  24.517  1.00 27.21 ? 371  ILE A CB  1 
ATOM   2833 C  CG1 . ILE A 1 372 ? 15.388  -7.221  25.460  1.00 26.58 ? 371  ILE A CG1 1 
ATOM   2834 C  CG2 . ILE A 1 372 ? 17.608  -7.914  24.433  1.00 25.84 ? 371  ILE A CG2 1 
ATOM   2835 C  CD1 . ILE A 1 372 ? 15.260  -5.782  24.849  1.00 26.99 ? 371  ILE A CD1 1 
ATOM   2836 N  N   . PHE A 1 373 ? 16.264  -10.259 22.193  1.00 26.36 ? 372  PHE A N   1 
ATOM   2837 C  CA  . PHE A 1 373 ? 17.024  -11.130 21.307  1.00 27.91 ? 372  PHE A CA  1 
ATOM   2838 C  C   . PHE A 1 373 ? 16.325  -12.460 21.076  1.00 27.88 ? 372  PHE A C   1 
ATOM   2839 O  O   . PHE A 1 373 ? 15.788  -13.064 22.009  1.00 25.58 ? 372  PHE A O   1 
ATOM   2840 C  CB  . PHE A 1 373 ? 18.426  -11.382 21.860  1.00 27.58 ? 372  PHE A CB  1 
ATOM   2841 C  CG  . PHE A 1 373 ? 19.224  -12.348 21.046  1.00 28.50 ? 372  PHE A CG  1 
ATOM   2842 C  CD1 . PHE A 1 373 ? 19.828  -11.947 19.873  1.00 28.67 ? 372  PHE A CD1 1 
ATOM   2843 C  CD2 . PHE A 1 373 ? 19.353  -13.672 21.454  1.00 29.89 ? 372  PHE A CD2 1 
ATOM   2844 C  CE1 . PHE A 1 373 ? 20.561  -12.844 19.096  1.00 32.00 ? 372  PHE A CE1 1 
ATOM   2845 C  CE2 . PHE A 1 373 ? 20.081  -14.570 20.688  1.00 31.34 ? 372  PHE A CE2 1 
ATOM   2846 C  CZ  . PHE A 1 373 ? 20.687  -14.152 19.504  1.00 31.46 ? 372  PHE A CZ  1 
ATOM   2847 N  N   . LYS A 1 374 ? 16.320  -12.909 19.828  1.00 28.95 ? 373  LYS A N   1 
ATOM   2848 C  CA  . LYS A 1 374 ? 15.687  -14.169 19.476  1.00 28.77 ? 373  LYS A CA  1 
ATOM   2849 C  C   . LYS A 1 374 ? 16.693  -15.053 18.754  1.00 27.27 ? 373  LYS A C   1 
ATOM   2850 O  O   . LYS A 1 374 ? 17.393  -14.616 17.851  1.00 28.14 ? 373  LYS A O   1 
ATOM   2851 C  CB  . LYS A 1 374 ? 14.465  -13.950 18.585  1.00 29.46 ? 373  LYS A CB  1 
ATOM   2852 C  CG  . LYS A 1 374 ? 13.616  -15.216 18.385  1.00 33.34 ? 373  LYS A CG  1 
ATOM   2853 C  CD  . LYS A 1 374 ? 12.670  -15.059 17.213  1.00 35.91 ? 373  LYS A CD  1 
ATOM   2854 C  CE  . LYS A 1 374 ? 11.683  -16.225 17.106  1.00 38.18 ? 373  LYS A CE  1 
ATOM   2855 N  NZ  . LYS A 1 374 ? 10.590  -16.132 18.119  1.00 37.66 ? 373  LYS A NZ  1 
ATOM   2856 N  N   . GLY A 1 375 ? 16.815  -16.285 19.212  1.00 27.26 ? 374  GLY A N   1 
ATOM   2857 C  CA  . GLY A 1 375 ? 17.749  -17.186 18.576  1.00 26.86 ? 374  GLY A CA  1 
ATOM   2858 C  C   . GLY A 1 375 ? 18.222  -18.195 19.572  1.00 26.31 ? 374  GLY A C   1 
ATOM   2859 O  O   . GLY A 1 375 ? 17.443  -18.673 20.401  1.00 26.14 ? 374  GLY A O   1 
ATOM   2860 N  N   . ILE A 1 376 ? 19.494  -18.547 19.499  1.00 27.43 ? 375  ILE A N   1 
ATOM   2861 C  CA  . ILE A 1 376 ? 20.012  -19.523 20.452  1.00 29.20 ? 375  ILE A CA  1 
ATOM   2862 C  C   . ILE A 1 376 ? 20.457  -18.740 21.670  1.00 28.35 ? 375  ILE A C   1 
ATOM   2863 O  O   . ILE A 1 376 ? 21.237  -17.816 21.560  1.00 29.65 ? 375  ILE A O   1 
ATOM   2864 C  CB  . ILE A 1 376 ? 21.202  -20.360 19.864  1.00 31.74 ? 375  ILE A CB  1 
ATOM   2865 C  CG1 . ILE A 1 376 ? 20.691  -21.295 18.753  1.00 32.18 ? 375  ILE A CG1 1 
ATOM   2866 C  CG2 . ILE A 1 376 ? 21.848  -21.204 20.962  1.00 31.36 ? 375  ILE A CG2 1 
ATOM   2867 C  CD1 . ILE A 1 376 ? 21.772  -22.104 18.078  1.00 35.72 ? 375  ILE A CD1 1 
ATOM   2868 N  N   . LEU A 1 377 ? 19.856  -19.045 22.809  1.00 28.03 ? 376  LEU A N   1 
ATOM   2869 C  CA  . LEU A 1 377 ? 20.166  -18.410 24.065  1.00 28.33 ? 376  LEU A CA  1 
ATOM   2870 C  C   . LEU A 1 377 ? 21.235  -19.247 24.766  1.00 28.71 ? 376  LEU A C   1 
ATOM   2871 O  O   . LEU A 1 377 ? 20.922  -20.256 25.404  1.00 28.68 ? 376  LEU A O   1 
ATOM   2872 C  CB  . LEU A 1 377 ? 18.906  -18.312 24.932  1.00 26.55 ? 376  LEU A CB  1 
ATOM   2873 C  CG  . LEU A 1 377 ? 17.692  -17.675 24.278  1.00 27.11 ? 376  LEU A CG  1 
ATOM   2874 C  CD1 . LEU A 1 377 ? 16.494  -17.825 25.188  1.00 28.97 ? 376  LEU A CD1 1 
ATOM   2875 C  CD2 . LEU A 1 377 ? 17.953  -16.223 23.963  1.00 27.06 ? 376  LEU A CD2 1 
ATOM   2876 N  N   . LYS A 1 378 ? 22.496  -18.856 24.627  1.00 30.79 ? 377  LYS A N   1 
ATOM   2877 C  CA  . LYS A 1 378 ? 23.586  -19.597 25.254  1.00 31.91 ? 377  LYS A CA  1 
ATOM   2878 C  C   . LYS A 1 378 ? 24.077  -18.892 26.505  1.00 31.12 ? 377  LYS A C   1 
ATOM   2879 O  O   . LYS A 1 378 ? 24.325  -17.690 26.479  1.00 28.48 ? 377  LYS A O   1 
ATOM   2880 C  CB  . LYS A 1 378 ? 24.740  -19.862 24.263  1.00 35.04 ? 377  LYS A CB  1 
ATOM   2881 C  CG  . LYS A 1 378 ? 25.504  -18.643 23.781  1.00 41.30 ? 377  LYS A CG  1 
ATOM   2882 C  CD  . LYS A 1 378 ? 26.781  -19.021 22.995  1.00 43.62 ? 377  LYS A CD  1 
ATOM   2883 C  CE  . LYS A 1 378 ? 27.895  -19.548 23.911  1.00 46.33 ? 377  LYS A CE  1 
ATOM   2884 N  NZ  . LYS A 1 378 ? 28.475  -18.473 24.794  1.00 48.15 ? 377  LYS A NZ  1 
ATOM   2885 N  N   . PRO A 1 379 ? 24.246  -19.635 27.614  1.00 29.87 ? 378  PRO A N   1 
ATOM   2886 C  CA  . PRO A 1 379 ? 24.705  -19.052 28.877  1.00 27.34 ? 378  PRO A CA  1 
ATOM   2887 C  C   . PRO A 1 379 ? 26.051  -18.375 28.677  1.00 26.66 ? 378  PRO A C   1 
ATOM   2888 O  O   . PRO A 1 379 ? 26.901  -18.879 27.933  1.00 23.29 ? 378  PRO A O   1 
ATOM   2889 C  CB  . PRO A 1 379 ? 24.848  -20.273 29.793  1.00 29.81 ? 378  PRO A CB  1 
ATOM   2890 C  CG  . PRO A 1 379 ? 23.878  -21.266 29.191  1.00 31.37 ? 378  PRO A CG  1 
ATOM   2891 C  CD  . PRO A 1 379 ? 24.133  -21.099 27.725  1.00 30.41 ? 378  PRO A CD  1 
ATOM   2892 N  N   . GLY A 1 380 ? 26.235  -17.226 29.320  1.00 24.23 ? 379  GLY A N   1 
ATOM   2893 C  CA  . GLY A 1 380 ? 27.496  -16.531 29.205  1.00 22.94 ? 379  GLY A CA  1 
ATOM   2894 C  C   . GLY A 1 380 ? 27.594  -15.613 28.010  1.00 21.19 ? 379  GLY A C   1 
ATOM   2895 O  O   . GLY A 1 380 ? 28.646  -15.034 27.766  1.00 25.24 ? 379  GLY A O   1 
ATOM   2896 N  N   . SER A 1 381 ? 26.549  -15.515 27.217  1.00 20.24 ? 380  SER A N   1 
ATOM   2897 C  CA  . SER A 1 381 ? 26.572  -14.602 26.091  1.00 21.45 ? 380  SER A CA  1 
ATOM   2898 C  C   . SER A 1 381 ? 25.781  -13.317 26.465  1.00 23.25 ? 380  SER A C   1 
ATOM   2899 O  O   . SER A 1 381 ? 24.956  -13.339 27.376  1.00 24.74 ? 380  SER A O   1 
ATOM   2900 C  CB  . SER A 1 381 ? 25.958  -15.273 24.887  1.00 23.92 ? 380  SER A CB  1 
ATOM   2901 O  OG  . SER A 1 381 ? 24.550  -15.350 25.050  1.00 28.09 ? 380  SER A OG  1 
ATOM   2902 N  N   . THR A 1 382 ? 26.013  -12.222 25.742  1.00 22.55 ? 381  THR A N   1 
ATOM   2903 C  CA  . THR A 1 382 ? 25.349  -10.946 26.003  1.00 23.21 ? 381  THR A CA  1 
ATOM   2904 C  C   . THR A 1 382 ? 24.763  -10.401 24.694  1.00 20.59 ? 381  THR A C   1 
ATOM   2905 O  O   . THR A 1 382 ? 25.421  -10.450 23.653  1.00 21.67 ? 381  THR A O   1 
ATOM   2906 C  CB  . THR A 1 382 ? 26.373  -9.928  26.573  1.00 23.29 ? 381  THR A CB  1 
ATOM   2907 O  OG1 . THR A 1 382 ? 26.916  -10.460 27.781  1.00 21.66 ? 381  THR A OG1 1 
ATOM   2908 C  CG2 . THR A 1 382 ? 25.756  -8.560  26.836  1.00 22.21 ? 381  THR A CG2 1 
ATOM   2909 N  N   . HIS A 1 383 ? 23.530  -9.921  24.765  1.00 20.66 ? 382  HIS A N   1 
ATOM   2910 C  CA  . HIS A 1 383 ? 22.792  -9.373  23.628  1.00 23.38 ? 382  HIS A CA  1 
ATOM   2911 C  C   . HIS A 1 383 ? 22.120  -8.076  24.031  1.00 26.09 ? 382  HIS A C   1 
ATOM   2912 O  O   . HIS A 1 383 ? 21.545  -8.000  25.114  1.00 23.31 ? 382  HIS A O   1 
ATOM   2913 C  CB  . HIS A 1 383 ? 21.707  -10.347 23.152  1.00 25.55 ? 382  HIS A CB  1 
ATOM   2914 C  CG  . HIS A 1 383 ? 22.221  -11.732 22.878  1.00 25.43 ? 382  HIS A CG  1 
ATOM   2915 N  ND1 . HIS A 1 383 ? 22.819  -12.085 21.687  1.00 25.41 ? 382  HIS A ND1 1 
ATOM   2916 C  CD2 . HIS A 1 383 ? 22.264  -12.835 23.664  1.00 26.34 ? 382  HIS A CD2 1 
ATOM   2917 C  CE1 . HIS A 1 383 ? 23.216  -13.345 21.754  1.00 26.05 ? 382  HIS A CE1 1 
ATOM   2918 N  NE2 . HIS A 1 383 ? 22.889  -13.825 22.939  1.00 28.17 ? 382  HIS A NE2 1 
ATOM   2919 N  N   . SER A 1 384 ? 22.097  -7.106  23.111  1.00 26.16 ? 383  SER A N   1 
ATOM   2920 C  CA  . SER A 1 384 ? 21.513  -5.785  23.371  1.00 29.62 ? 383  SER A CA  1 
ATOM   2921 C  C   . SER A 1 384 ? 20.485  -5.361  22.353  1.00 27.30 ? 383  SER A C   1 
ATOM   2922 O  O   . SER A 1 384 ? 20.470  -5.856  21.240  1.00 27.78 ? 383  SER A O   1 
ATOM   2923 C  CB  . SER A 1 384 ? 22.604  -4.705  23.335  1.00 30.90 ? 383  SER A CB  1 
ATOM   2924 O  OG  . SER A 1 384 ? 23.652  -4.999  24.222  1.00 33.99 ? 383  SER A OG  1 
ATOM   2925 N  N   . ASN A 1 385 ? 19.692  -4.375  22.715  1.00 26.73 ? 384  ASN A N   1 
ATOM   2926 C  CA  . ASN A 1 385 ? 18.700  -3.845  21.803  1.00 25.28 ? 384  ASN A CA  1 
ATOM   2927 C  C   . ASN A 1 385 ? 18.155  -2.581  22.449  1.00 24.96 ? 384  ASN A C   1 
ATOM   2928 O  O   . ASN A 1 385 ? 18.408  -2.322  23.614  1.00 26.14 ? 384  ASN A O   1 
ATOM   2929 C  CB  . ASN A 1 385 ? 17.555  -4.850  21.569  1.00 23.80 ? 384  ASN A CB  1 
ATOM   2930 C  CG  . ASN A 1 385 ? 16.911  -4.698  20.212  1.00 25.14 ? 384  ASN A CG  1 
ATOM   2931 O  OD1 . ASN A 1 385 ? 17.305  -3.843  19.422  1.00 24.86 ? 384  ASN A OD1 1 
ATOM   2932 N  ND2 . ASN A 1 385 ? 15.927  -5.525  19.923  1.00 26.16 ? 384  ASN A ND2 1 
ATOM   2933 N  N   . GLU A 1 386 ? 17.412  -1.794  21.679  1.00 25.26 ? 385  GLU A N   1 
ATOM   2934 C  CA  . GLU A 1 386 ? 16.822  -0.583  22.171  1.00 23.42 ? 385  GLU A CA  1 
ATOM   2935 C  C   . GLU A 1 386 ? 15.371  -0.727  21.814  1.00 23.24 ? 385  GLU A C   1 
ATOM   2936 O  O   . GLU A 1 386 ? 15.026  -1.392  20.837  1.00 24.09 ? 385  GLU A O   1 
ATOM   2937 C  CB  . GLU A 1 386 ? 17.428  0.634   21.448  1.00 24.28 ? 385  GLU A CB  1 
ATOM   2938 C  CG  . GLU A 1 386 ? 18.925  0.860   21.789  1.00 25.21 ? 385  GLU A CG  1 
ATOM   2939 C  CD  . GLU A 1 386 ? 19.649  1.788   20.818  1.00 23.63 ? 385  GLU A CD  1 
ATOM   2940 O  OE1 . GLU A 1 386 ? 19.001  2.485   19.996  1.00 24.03 ? 385  GLU A OE1 1 
ATOM   2941 O  OE2 . GLU A 1 386 ? 20.884  1.816   20.886  1.00 24.99 ? 385  GLU A OE2 1 
ATOM   2942 N  N   . PHE A 1 387 ? 14.507  -0.196  22.653  1.00 23.24 ? 386  PHE A N   1 
ATOM   2943 C  CA  . PHE A 1 387 ? 13.085  -0.260  22.366  1.00 22.40 ? 386  PHE A CA  1 
ATOM   2944 C  C   . PHE A 1 387 ? 12.435  1.037   22.839  1.00 22.29 ? 386  PHE A C   1 
ATOM   2945 O  O   . PHE A 1 387 ? 12.994  1.744   23.694  1.00 20.92 ? 386  PHE A O   1 
ATOM   2946 C  CB  . PHE A 1 387 ? 12.450  -1.466  23.078  1.00 20.99 ? 386  PHE A CB  1 
ATOM   2947 C  CG  . PHE A 1 387 ? 12.722  -1.530  24.547  1.00 18.12 ? 386  PHE A CG  1 
ATOM   2948 C  CD1 . PHE A 1 387 ? 11.940  -0.808  25.443  1.00 20.69 ? 386  PHE A CD1 1 
ATOM   2949 C  CD2 . PHE A 1 387 ? 13.750  -2.323  25.036  1.00 21.15 ? 386  PHE A CD2 1 
ATOM   2950 C  CE1 . PHE A 1 387 ? 12.177  -0.869  26.789  1.00 21.51 ? 386  PHE A CE1 1 
ATOM   2951 C  CE2 . PHE A 1 387 ? 13.983  -2.390  26.400  1.00 20.52 ? 386  PHE A CE2 1 
ATOM   2952 C  CZ  . PHE A 1 387 ? 13.204  -1.668  27.276  1.00 21.38 ? 386  PHE A CZ  1 
ATOM   2953 N  N   . ASP A 1 388 ? 11.267  1.347   22.280  1.00 24.47 ? 387  ASP A N   1 
ATOM   2954 C  CA  . ASP A 1 388 ? 10.502  2.541   22.661  1.00 25.04 ? 387  ASP A CA  1 
ATOM   2955 C  C   . ASP A 1 388 ? 9.273   2.114   23.487  1.00 24.26 ? 387  ASP A C   1 
ATOM   2956 O  O   . ASP A 1 388 ? 8.367   1.440   22.995  1.00 24.97 ? 387  ASP A O   1 
ATOM   2957 C  CB  . ASP A 1 388 ? 10.072  3.339   21.406  1.00 24.72 ? 387  ASP A CB  1 
ATOM   2958 C  CG  . ASP A 1 388 ? 11.232  3.628   20.468  1.00 23.33 ? 387  ASP A CG  1 
ATOM   2959 O  OD1 . ASP A 1 388 ? 12.100  4.429   20.835  1.00 23.87 ? 387  ASP A OD1 1 
ATOM   2960 O  OD2 . ASP A 1 388 ? 11.306  3.051   19.370  1.00 23.92 ? 387  ASP A OD2 1 
ATOM   2961 N  N   . ALA A 1 389 ? 9.317   2.473   24.759  1.00 23.30 ? 388  ALA A N   1 
ATOM   2962 C  CA  . ALA A 1 389 ? 8.263   2.174   25.708  1.00 25.07 ? 388  ALA A CA  1 
ATOM   2963 C  C   . ALA A 1 389 ? 7.238   3.323   25.793  1.00 25.67 ? 388  ALA A C   1 
ATOM   2964 O  O   . ALA A 1 389 ? 7.469   4.426   25.272  1.00 23.95 ? 388  ALA A O   1 
ATOM   2965 C  CB  . ALA A 1 389 ? 8.857   1.871   27.087  1.00 22.55 ? 388  ALA A CB  1 
ATOM   2966 N  N   . LYS A 1 390 ? 6.128   3.051   26.459  1.00 25.14 ? 389  LYS A N   1 
ATOM   2967 C  CA  . LYS A 1 390 ? 5.028   4.013   26.575  1.00 27.45 ? 389  LYS A CA  1 
ATOM   2968 C  C   . LYS A 1 390 ? 5.103   5.024   27.688  1.00 27.40 ? 389  LYS A C   1 
ATOM   2969 O  O   . LYS A 1 390 ? 4.212   5.858   27.796  1.00 29.53 ? 389  LYS A O   1 
ATOM   2970 C  CB  . LYS A 1 390 ? 3.692   3.296   26.677  1.00 27.77 ? 389  LYS A CB  1 
ATOM   2971 C  CG  . LYS A 1 390 ? 3.234   2.643   25.391  1.00 30.46 ? 389  LYS A CG  1 
ATOM   2972 C  CD  . LYS A 1 390 ? 1.869   1.971   25.566  1.00 32.49 ? 389  LYS A CD  1 
ATOM   2973 C  CE  . LYS A 1 390 ? 1.349   1.420   24.251  1.00 34.66 ? 389  LYS A CE  1 
ATOM   2974 N  NZ  . LYS A 1 390 ? 0.047   0.710   24.425  1.00 35.76 ? 389  LYS A NZ  1 
ATOM   2975 N  N   . LEU A 1 391 ? 6.155   4.973   28.501  1.00 26.63 ? 390  LEU A N   1 
ATOM   2976 C  CA  . LEU A 1 391 ? 6.299   5.910   29.609  1.00 25.22 ? 390  LEU A CA  1 
ATOM   2977 C  C   . LEU A 1 391 ? 7.722   5.922   30.066  1.00 25.97 ? 390  LEU A C   1 
ATOM   2978 O  O   . LEU A 1 391 ? 8.518   5.074   29.628  1.00 25.21 ? 390  LEU A O   1 
ATOM   2979 C  CB  . LEU A 1 391 ? 5.430   5.495   30.805  1.00 27.99 ? 390  LEU A CB  1 
ATOM   2980 C  CG  . LEU A 1 391 ? 5.963   4.376   31.738  1.00 28.25 ? 390  LEU A CG  1 
ATOM   2981 C  CD1 . LEU A 1 391 ? 5.237   4.415   33.091  1.00 29.02 ? 390  LEU A CD1 1 
ATOM   2982 C  CD2 . LEU A 1 391 ? 5.856   3.009   31.078  1.00 28.08 ? 390  LEU A CD2 1 
ATOM   2983 N  N   . ASP A 1 392 ? 8.060   6.936   30.871  1.00 25.27 ? 391  ASP A N   1 
ATOM   2984 C  CA  . ASP A 1 392 ? 9.373   7.092   31.493  1.00 26.10 ? 391  ASP A CA  1 
ATOM   2985 C  C   . ASP A 1 392 ? 9.098   6.436   32.862  1.00 28.14 ? 391  ASP A C   1 
ATOM   2986 O  O   . ASP A 1 392 ? 8.213   6.892   33.599  1.00 24.92 ? 391  ASP A O   1 
ATOM   2987 C  CB  . ASP A 1 392 ? 9.669   8.586   31.697  1.00 28.94 ? 391  ASP A CB  1 
ATOM   2988 C  CG  . ASP A 1 392 ? 10.981  8.847   32.412  1.00 31.93 ? 391  ASP A CG  1 
ATOM   2989 O  OD1 . ASP A 1 392 ? 11.510  7.960   33.129  1.00 31.59 ? 391  ASP A OD1 1 
ATOM   2990 O  OD2 . ASP A 1 392 ? 11.489  9.985   32.303  1.00 33.84 ? 391  ASP A OD2 1 
ATOM   2991 N  N   . VAL A 1 393 ? 9.827   5.363   33.177  1.00 28.50 ? 392  VAL A N   1 
ATOM   2992 C  CA  . VAL A 1 393 ? 9.654   4.623   34.430  1.00 27.57 ? 392  VAL A CA  1 
ATOM   2993 C  C   . VAL A 1 393 ? 10.276  5.294   35.659  1.00 28.14 ? 392  VAL A C   1 
ATOM   2994 O  O   . VAL A 1 393 ? 10.140  4.802   36.782  1.00 30.17 ? 392  VAL A O   1 
ATOM   2995 C  CB  . VAL A 1 393 ? 10.165  3.153   34.298  1.00 27.45 ? 392  VAL A CB  1 
ATOM   2996 C  CG1 . VAL A 1 393 ? 9.420   2.423   33.147  1.00 24.11 ? 392  VAL A CG1 1 
ATOM   2997 C  CG2 . VAL A 1 393 ? 11.665  3.134   34.071  1.00 23.60 ? 392  VAL A CG2 1 
ATOM   2998 N  N   . GLY A 1 394 ? 10.914  6.438   35.463  1.00 28.26 ? 393  GLY A N   1 
ATOM   2999 C  CA  . GLY A 1 394 ? 11.525  7.172   36.570  1.00 27.80 ? 393  GLY A CA  1 
ATOM   3000 C  C   . GLY A 1 394 ? 12.798  6.469   36.988  1.00 28.19 ? 393  GLY A C   1 
ATOM   3001 O  O   . GLY A 1 394 ? 13.577  6.082   36.130  1.00 29.63 ? 393  GLY A O   1 
ATOM   3002 N  N   . THR A 1 395 ? 12.991  6.248   38.284  1.00 27.65 ? 394  THR A N   1 
ATOM   3003 C  CA  . THR A 1 395 ? 14.174  5.533   38.732  1.00 28.91 ? 394  THR A CA  1 
ATOM   3004 C  C   . THR A 1 395 ? 13.900  4.033   38.522  1.00 26.58 ? 394  THR A C   1 
ATOM   3005 O  O   . THR A 1 395 ? 12.868  3.523   38.949  1.00 25.17 ? 394  THR A O   1 
ATOM   3006 C  CB  . THR A 1 395 ? 14.494  5.810   40.200  1.00 28.51 ? 394  THR A CB  1 
ATOM   3007 O  OG1 . THR A 1 395 ? 14.700  7.218   40.376  1.00 29.61 ? 394  THR A OG1 1 
ATOM   3008 C  CG2 . THR A 1 395 ? 15.770  5.090   40.620  1.00 29.51 ? 394  THR A CG2 1 
ATOM   3009 N  N   . ILE A 1 396 ? 14.781  3.338   37.816  1.00 27.93 ? 395  ILE A N   1 
ATOM   3010 C  CA  . ILE A 1 396 ? 14.569  1.910   37.573  1.00 25.30 ? 395  ILE A CA  1 
ATOM   3011 C  C   . ILE A 1 396 ? 14.914  1.154   38.852  1.00 24.92 ? 395  ILE A C   1 
ATOM   3012 O  O   . ILE A 1 396 ? 16.025  1.228   39.349  1.00 25.15 ? 395  ILE A O   1 
ATOM   3013 C  CB  . ILE A 1 396 ? 15.372  1.428   36.359  1.00 27.45 ? 395  ILE A CB  1 
ATOM   3014 C  CG1 . ILE A 1 396 ? 14.986  2.279   35.137  1.00 27.20 ? 395  ILE A CG1 1 
ATOM   3015 C  CG2 . ILE A 1 396 ? 15.018  -0.036  36.059  1.00 26.63 ? 395  ILE A CG2 1 
ATOM   3016 C  CD1 . ILE A 1 396 ? 15.916  2.209   33.945  1.00 27.17 ? 395  ILE A CD1 1 
ATOM   3017 N  N   . GLU A 1 397 ? 13.918  0.480   39.420  1.00 26.46 ? 396  GLU A N   1 
ATOM   3018 C  CA  . GLU A 1 397 ? 14.083  -0.261  40.655  1.00 29.25 ? 396  GLU A CA  1 
ATOM   3019 C  C   . GLU A 1 397 ? 14.396  -1.744  40.501  1.00 28.89 ? 396  GLU A C   1 
ATOM   3020 O  O   . GLU A 1 397 ? 15.115  -2.300  41.319  1.00 28.84 ? 396  GLU A O   1 
ATOM   3021 C  CB  . GLU A 1 397 ? 12.866  -0.040  41.539  1.00 30.47 ? 396  GLU A CB  1 
ATOM   3022 C  CG  . GLU A 1 397 ? 12.688  1.456   41.899  1.00 32.93 ? 396  GLU A CG  1 
ATOM   3023 C  CD  . GLU A 1 397 ? 11.384  1.749   42.580  1.00 35.47 ? 396  GLU A CD  1 
ATOM   3024 O  OE1 . GLU A 1 397 ? 10.503  0.870   42.539  1.00 36.97 ? 396  GLU A OE1 1 
ATOM   3025 O  OE2 . GLU A 1 397 ? 11.222  2.869   43.136  1.00 37.60 ? 396  GLU A OE2 1 
ATOM   3026 N  N   . LYS A 1 398 ? 13.905  -2.355  39.429  1.00 30.04 ? 397  LYS A N   1 
ATOM   3027 C  CA  . LYS A 1 398 ? 14.134  -3.766  39.138  1.00 30.84 ? 397  LYS A CA  1 
ATOM   3028 C  C   . LYS A 1 398 ? 13.736  -3.991  37.701  1.00 30.40 ? 397  LYS A C   1 
ATOM   3029 O  O   . LYS A 1 398 ? 13.017  -3.192  37.110  1.00 29.45 ? 397  LYS A O   1 
ATOM   3030 C  CB  . LYS A 1 398 ? 13.303  -4.687  40.047  1.00 31.40 ? 397  LYS A CB  1 
ATOM   3031 C  CG  . LYS A 1 398 ? 11.803  -4.494  39.908  1.00 33.05 ? 397  LYS A CG  1 
ATOM   3032 C  CD  . LYS A 1 398 ? 11.029  -5.346  40.883  1.00 33.33 ? 397  LYS A CD  1 
ATOM   3033 C  CE  . LYS A 1 398 ? 9.545   -5.013  40.798  1.00 32.41 ? 397  LYS A CE  1 
ATOM   3034 N  NZ  . LYS A 1 398 ? 8.728   -5.722  41.846  1.00 36.35 ? 397  LYS A NZ  1 
ATOM   3035 N  N   . VAL A 1 399 ? 14.225  -5.097  37.151  1.00 29.71 ? 398  VAL A N   1 
ATOM   3036 C  CA  . VAL A 1 399 ? 13.963  -5.471  35.785  1.00 28.41 ? 398  VAL A CA  1 
ATOM   3037 C  C   . VAL A 1 399 ? 13.450  -6.909  35.764  1.00 28.49 ? 398  VAL A C   1 
ATOM   3038 O  O   . VAL A 1 399 ? 13.859  -7.744  36.580  1.00 26.17 ? 398  VAL A O   1 
ATOM   3039 C  CB  . VAL A 1 399 ? 15.274  -5.377  34.971  1.00 30.19 ? 398  VAL A CB  1 
ATOM   3040 C  CG1 . VAL A 1 399 ? 15.179  -6.170  33.714  1.00 30.37 ? 398  VAL A CG1 1 
ATOM   3041 C  CG2 . VAL A 1 399 ? 15.595  -3.927  34.647  1.00 30.47 ? 398  VAL A CG2 1 
ATOM   3042 N  N   . LYS A 1 400 ? 12.551  -7.208  34.836  1.00 25.11 ? 399  LYS A N   1 
ATOM   3043 C  CA  . LYS A 1 400 ? 12.034  -8.559  34.749  1.00 25.35 ? 399  LYS A CA  1 
ATOM   3044 C  C   . LYS A 1 400 ? 12.368  -9.214  33.412  1.00 24.17 ? 399  LYS A C   1 
ATOM   3045 O  O   . LYS A 1 400 ? 12.152  -8.629  32.338  1.00 24.42 ? 399  LYS A O   1 
ATOM   3046 C  CB  . LYS A 1 400 ? 10.544  -8.602  35.060  1.00 24.56 ? 399  LYS A CB  1 
ATOM   3047 C  CG  . LYS A 1 400 ? 10.244  -8.295  36.527  1.00 23.56 ? 399  LYS A CG  1 
ATOM   3048 C  CD  . LYS A 1 400 ? 8.759   -8.382  36.771  1.00 25.25 ? 399  LYS A CD  1 
ATOM   3049 C  CE  . LYS A 1 400 ? 8.415   -7.925  38.173  1.00 26.07 ? 399  LYS A CE  1 
ATOM   3050 N  NZ  . LYS A 1 400 ? 7.046   -8.409  38.552  1.00 24.08 ? 399  LYS A NZ  1 
ATOM   3051 N  N   . PHE A 1 401 ? 13.035  -10.355 33.505  1.00 22.08 ? 400  PHE A N   1 
ATOM   3052 C  CA  . PHE A 1 401 ? 13.450  -11.141 32.342  1.00 21.65 ? 400  PHE A CA  1 
ATOM   3053 C  C   . PHE A 1 401 ? 12.435  -12.251 32.030  1.00 22.92 ? 400  PHE A C   1 
ATOM   3054 O  O   . PHE A 1 401 ? 11.857  -12.846 32.941  1.00 22.67 ? 400  PHE A O   1 
ATOM   3055 C  CB  . PHE A 1 401 ? 14.831  -11.747 32.608  1.00 22.45 ? 400  PHE A CB  1 
ATOM   3056 C  CG  . PHE A 1 401 ? 15.262  -12.756 31.566  1.00 23.27 ? 400  PHE A CG  1 
ATOM   3057 C  CD1 . PHE A 1 401 ? 15.822  -12.334 30.372  1.00 22.51 ? 400  PHE A CD1 1 
ATOM   3058 C  CD2 . PHE A 1 401 ? 15.067  -14.116 31.768  1.00 21.97 ? 400  PHE A CD2 1 
ATOM   3059 C  CE1 . PHE A 1 401 ? 16.181  -13.248 29.384  1.00 22.77 ? 400  PHE A CE1 1 
ATOM   3060 C  CE2 . PHE A 1 401 ? 15.423  -15.047 30.790  1.00 22.06 ? 400  PHE A CE2 1 
ATOM   3061 C  CZ  . PHE A 1 401 ? 15.979  -14.607 29.600  1.00 21.61 ? 400  PHE A CZ  1 
ATOM   3062 N  N   . LEU A 1 402 ? 12.199  -12.523 30.756  1.00 26.01 ? 401  LEU A N   1 
ATOM   3063 C  CA  . LEU A 1 402 ? 11.255  -13.581 30.391  1.00 28.00 ? 401  LEU A CA  1 
ATOM   3064 C  C   . LEU A 1 402 ? 11.685  -14.124 29.048  1.00 29.29 ? 401  LEU A C   1 
ATOM   3065 O  O   . LEU A 1 402 ? 12.210  -13.373 28.219  1.00 29.37 ? 401  LEU A O   1 
ATOM   3066 C  CB  . LEU A 1 402 ? 9.836   -13.019 30.296  1.00 29.41 ? 401  LEU A CB  1 
ATOM   3067 C  CG  . LEU A 1 402 ? 8.652   -13.893 29.889  1.00 31.28 ? 401  LEU A CG  1 
ATOM   3068 C  CD1 . LEU A 1 402 ? 8.191   -14.676 31.061  1.00 31.30 ? 401  LEU A CD1 1 
ATOM   3069 C  CD2 . LEU A 1 402 ? 7.485   -13.034 29.419  1.00 33.29 ? 401  LEU A CD2 1 
ATOM   3070 N  N   . TRP A 1 403 ? 11.502  -15.423 28.835  1.00 29.10 ? 402  TRP A N   1 
ATOM   3071 C  CA  . TRP A 1 403 ? 11.869  -16.025 27.565  1.00 30.86 ? 402  TRP A CA  1 
ATOM   3072 C  C   . TRP A 1 403 ? 10.794  -17.012 27.152  1.00 31.95 ? 402  TRP A C   1 
ATOM   3073 O  O   . TRP A 1 403 ? 10.118  -17.604 27.991  1.00 32.10 ? 402  TRP A O   1 
ATOM   3074 C  CB  . TRP A 1 403 ? 13.248  -16.692 27.629  1.00 31.87 ? 402  TRP A CB  1 
ATOM   3075 C  CG  . TRP A 1 403 ? 13.301  -17.978 28.406  1.00 32.39 ? 402  TRP A CG  1 
ATOM   3076 C  CD1 . TRP A 1 403 ? 13.271  -18.127 29.764  1.00 32.53 ? 402  TRP A CD1 1 
ATOM   3077 C  CD2 . TRP A 1 403 ? 13.369  -19.298 27.856  1.00 32.46 ? 402  TRP A CD2 1 
ATOM   3078 N  NE1 . TRP A 1 403 ? 13.313  -19.462 30.093  1.00 32.68 ? 402  TRP A NE1 1 
ATOM   3079 C  CE2 . TRP A 1 403 ? 13.374  -20.207 28.938  1.00 33.28 ? 402  TRP A CE2 1 
ATOM   3080 C  CE3 . TRP A 1 403 ? 13.426  -19.805 26.549  1.00 32.62 ? 402  TRP A CE3 1 
ATOM   3081 C  CZ2 . TRP A 1 403 ? 13.430  -21.591 28.757  1.00 31.79 ? 402  TRP A CZ2 1 
ATOM   3082 C  CZ3 . TRP A 1 403 ? 13.480  -21.185 26.369  1.00 32.80 ? 402  TRP A CZ3 1 
ATOM   3083 C  CH2 . TRP A 1 403 ? 13.479  -22.059 27.470  1.00 32.52 ? 402  TRP A CH2 1 
ATOM   3084 N  N   . ASN A 1 404 ? 10.563  -17.086 25.858  1.00 35.00 ? 403  ASN A N   1 
ATOM   3085 C  CA  . ASN A 1 404 ? 9.571   -17.984 25.290  1.00 40.98 ? 403  ASN A CA  1 
ATOM   3086 C  C   . ASN A 1 404 ? 10.367  -18.862 24.379  1.00 42.60 ? 403  ASN A C   1 
ATOM   3087 O  O   . ASN A 1 404 ? 11.158  -18.369 23.571  1.00 42.57 ? 403  ASN A O   1 
ATOM   3088 C  CB  . ASN A 1 404 ? 8.536   -17.216 24.474  1.00 42.76 ? 403  ASN A CB  1 
ATOM   3089 C  CG  . ASN A 1 404 ? 7.601   -16.428 25.343  1.00 46.47 ? 403  ASN A CG  1 
ATOM   3090 O  OD1 . ASN A 1 404 ? 7.251   -16.856 26.450  1.00 48.72 ? 403  ASN A OD1 1 
ATOM   3091 N  ND2 . ASN A 1 404 ? 7.200   -15.258 24.869  1.00 47.74 ? 403  ASN A ND2 1 
ATOM   3092 N  N   . ASN A 1 405 ? 10.206  -20.166 24.545  1.00 46.15 ? 404  ASN A N   1 
ATOM   3093 C  CA  . ASN A 1 405 ? 10.948  -21.128 23.742  1.00 47.33 ? 404  ASN A CA  1 
ATOM   3094 C  C   . ASN A 1 405 ? 10.364  -21.320 22.363  1.00 48.07 ? 404  ASN A C   1 
ATOM   3095 O  O   . ASN A 1 405 ? 9.251   -20.875 22.071  1.00 49.07 ? 404  ASN A O   1 
ATOM   3096 C  CB  . ASN A 1 405 ? 11.099  -22.463 24.478  1.00 47.92 ? 404  ASN A CB  1 
ATOM   3097 C  CG  . ASN A 1 405 ? 9.785   -23.034 24.934  1.00 48.74 ? 404  ASN A CG  1 
ATOM   3098 O  OD1 . ASN A 1 405 ? 8.780   -22.325 25.034  1.00 49.61 ? 404  ASN A OD1 1 
ATOM   3099 N  ND2 . ASN A 1 405 ? 9.783   -24.329 25.232  1.00 48.59 ? 404  ASN A ND2 1 
ATOM   3100 N  N   . ASN A 1 406 ? 11.169  -21.915 21.496  1.00 48.62 ? 406  ASN A N   1 
ATOM   3101 C  CA  . ASN A 1 406 ? 10.782  -22.167 20.117  1.00 50.40 ? 406  ASN A CA  1 
ATOM   3102 C  C   . ASN A 1 406 ? 10.535  -23.651 19.831  1.00 51.69 ? 406  ASN A C   1 
ATOM   3103 O  O   . ASN A 1 406 ? 9.658   -23.936 18.966  1.00 50.94 ? 406  ASN A O   1 
ATOM   3104 C  CB  . ASN A 1 406 ? 11.856  -21.624 19.177  1.00 51.15 ? 406  ASN A CB  1 
ATOM   3105 C  CG  . ASN A 1 406 ? 11.890  -20.094 19.142  1.00 52.83 ? 406  ASN A CG  1 
ATOM   3106 O  OD1 . ASN A 1 406 ? 12.797  -19.498 18.554  1.00 53.26 ? 406  ASN A OD1 1 
ATOM   3107 N  ND2 . ASN A 1 406 ? 10.897  -19.450 19.768  1.00 53.45 ? 406  ASN A ND2 1 
ATOM   3108 N  N   . ASN A 1 409 ? 11.914  -28.760 24.648  1.00 50.05 ? 409  ASN A N   1 
ATOM   3109 C  CA  . ASN A 1 409 ? 13.153  -29.502 25.021  1.00 49.26 ? 409  ASN A CA  1 
ATOM   3110 C  C   . ASN A 1 409 ? 12.734  -30.462 26.146  1.00 49.94 ? 409  ASN A C   1 
ATOM   3111 O  O   . ASN A 1 409 ? 12.247  -30.020 27.192  1.00 48.95 ? 409  ASN A O   1 
ATOM   3112 C  CB  . ASN A 1 409 ? 14.216  -28.501 25.480  1.00 49.31 ? 409  ASN A CB  1 
ATOM   3113 C  CG  . ASN A 1 409 ? 15.587  -29.149 25.713  1.00 49.97 ? 409  ASN A CG  1 
ATOM   3114 O  OD1 . ASN A 1 409 ? 16.575  -28.770 25.089  1.00 51.69 ? 409  ASN A OD1 1 
ATOM   3115 N  ND2 . ASN A 1 409 ? 15.658  -30.052 26.674  1.00 48.65 ? 409  ASN A ND2 1 
ATOM   3116 N  N   . PRO A 1 410 ? 12.911  -31.789 25.948  1.00 50.47 ? 410  PRO A N   1 
ATOM   3117 C  CA  . PRO A 1 410 ? 12.529  -32.774 26.970  1.00 49.21 ? 410  PRO A CA  1 
ATOM   3118 C  C   . PRO A 1 410 ? 13.185  -32.591 28.333  1.00 48.53 ? 410  PRO A C   1 
ATOM   3119 O  O   . PRO A 1 410 ? 12.650  -33.065 29.342  1.00 48.39 ? 410  PRO A O   1 
ATOM   3120 C  CB  . PRO A 1 410 ? 12.916  -34.116 26.319  1.00 49.97 ? 410  PRO A CB  1 
ATOM   3121 C  CG  . PRO A 1 410 ? 14.075  -33.760 25.466  1.00 49.78 ? 410  PRO A CG  1 
ATOM   3122 C  CD  . PRO A 1 410 ? 13.619  -32.455 24.835  1.00 50.88 ? 410  PRO A CD  1 
ATOM   3123 N  N   . THR A 1 411 ? 14.315  -31.886 28.375  1.00 47.71 ? 411  THR A N   1 
ATOM   3124 C  CA  . THR A 1 411 ? 15.025  -31.665 29.634  1.00 47.89 ? 411  THR A CA  1 
ATOM   3125 C  C   . THR A 1 411 ? 14.563  -30.419 30.385  1.00 46.56 ? 411  THR A C   1 
ATOM   3126 O  O   . THR A 1 411 ? 15.083  -30.113 31.464  1.00 45.87 ? 411  THR A O   1 
ATOM   3127 C  CB  . THR A 1 411 ? 16.552  -31.592 29.424  1.00 48.55 ? 411  THR A CB  1 
ATOM   3128 O  OG1 . THR A 1 411 ? 16.895  -30.347 28.790  1.00 49.21 ? 411  THR A OG1 1 
ATOM   3129 C  CG2 . THR A 1 411 ? 17.031  -32.764 28.551  1.00 49.65 ? 411  THR A CG2 1 
ATOM   3130 N  N   . PHE A 1 412 ? 13.587  -29.716 29.809  1.00 45.72 ? 412  PHE A N   1 
ATOM   3131 C  CA  . PHE A 1 412 ? 13.012  -28.494 30.378  1.00 44.27 ? 412  PHE A CA  1 
ATOM   3132 C  C   . PHE A 1 412 ? 14.063  -27.504 30.872  1.00 42.40 ? 412  PHE A C   1 
ATOM   3133 O  O   . PHE A 1 412 ? 14.068  -27.128 32.042  1.00 41.64 ? 412  PHE A O   1 
ATOM   3134 C  CB  . PHE A 1 412 ? 12.038  -28.851 31.500  1.00 45.89 ? 412  PHE A CB  1 
ATOM   3135 C  CG  . PHE A 1 412 ? 11.030  -29.874 31.098  1.00 47.95 ? 412  PHE A CG  1 
ATOM   3136 C  CD1 . PHE A 1 412 ? 10.221  -29.659 29.986  1.00 48.76 ? 412  PHE A CD1 1 
ATOM   3137 C  CD2 . PHE A 1 412 ? 10.912  -31.069 31.797  1.00 48.72 ? 412  PHE A CD2 1 
ATOM   3138 C  CE1 . PHE A 1 412 ? 9.304   -30.626 29.564  1.00 48.97 ? 412  PHE A CE1 1 
ATOM   3139 C  CE2 . PHE A 1 412 ? 10.001  -32.046 31.387  1.00 49.14 ? 412  PHE A CE2 1 
ATOM   3140 C  CZ  . PHE A 1 412 ? 9.197   -31.821 30.269  1.00 49.33 ? 412  PHE A CZ  1 
ATOM   3141 N  N   . PRO A 1 413 ? 14.949  -27.041 29.964  1.00 41.23 ? 413  PRO A N   1 
ATOM   3142 C  CA  . PRO A 1 413 ? 16.010  -26.090 30.293  1.00 38.70 ? 413  PRO A CA  1 
ATOM   3143 C  C   . PRO A 1 413 ? 15.470  -24.854 30.995  1.00 36.59 ? 413  PRO A C   1 
ATOM   3144 O  O   . PRO A 1 413 ? 14.313  -24.482 30.843  1.00 34.82 ? 413  PRO A O   1 
ATOM   3145 C  CB  . PRO A 1 413 ? 16.601  -25.751 28.916  1.00 40.19 ? 413  PRO A CB  1 
ATOM   3146 C  CG  . PRO A 1 413 ? 15.450  -25.965 27.969  1.00 39.23 ? 413  PRO A CG  1 
ATOM   3147 C  CD  . PRO A 1 413 ? 14.894  -27.258 28.507  1.00 41.09 ? 413  PRO A CD  1 
ATOM   3148 N  N   . LYS A 1 414 ? 16.312  -24.266 31.828  1.00 35.12 ? 414  LYS A N   1 
ATOM   3149 C  CA  . LYS A 1 414 ? 15.955  -23.067 32.553  1.00 32.84 ? 414  LYS A CA  1 
ATOM   3150 C  C   . LYS A 1 414 ? 16.931  -22.018 32.067  1.00 32.42 ? 414  LYS A C   1 
ATOM   3151 O  O   . LYS A 1 414 ? 18.136  -22.266 32.036  1.00 32.95 ? 414  LYS A O   1 
ATOM   3152 C  CB  . LYS A 1 414 ? 16.110  -23.281 34.056  1.00 32.27 ? 414  LYS A CB  1 
ATOM   3153 C  CG  . LYS A 1 414 ? 14.969  -24.071 34.673  1.00 32.84 ? 414  LYS A CG  1 
ATOM   3154 C  CD  . LYS A 1 414 ? 15.158  -24.228 36.161  1.00 31.75 ? 414  LYS A CD  1 
ATOM   3155 C  CE  . LYS A 1 414 ? 13.920  -23.808 36.905  1.00 32.97 ? 414  LYS A CE  1 
ATOM   3156 N  NZ  . LYS A 1 414 ? 14.207  -23.699 38.372  1.00 34.20 ? 414  LYS A NZ  1 
ATOM   3157 N  N   . VAL A 1 415 ? 16.393  -20.887 31.610  1.00 30.36 ? 415  VAL A N   1 
ATOM   3158 C  CA  . VAL A 1 415 ? 17.186  -19.762 31.129  1.00 27.28 ? 415  VAL A CA  1 
ATOM   3159 C  C   . VAL A 1 415 ? 17.031  -18.574 32.119  1.00 27.03 ? 415  VAL A C   1 
ATOM   3160 O  O   . VAL A 1 415 ? 15.965  -18.337 32.682  1.00 27.26 ? 415  VAL A O   1 
ATOM   3161 C  CB  . VAL A 1 415 ? 16.717  -19.312 29.724  1.00 26.84 ? 415  VAL A CB  1 
ATOM   3162 C  CG1 . VAL A 1 415 ? 17.597  -18.179 29.215  1.00 26.52 ? 415  VAL A CG1 1 
ATOM   3163 C  CG2 . VAL A 1 415 ? 16.726  -20.488 28.731  1.00 26.60 ? 415  VAL A CG2 1 
ATOM   3164 N  N   . GLY A 1 416 ? 18.109  -17.851 32.355  1.00 25.40 ? 416  GLY A N   1 
ATOM   3165 C  CA  . GLY A 1 416 ? 18.044  -16.718 33.250  1.00 23.26 ? 416  GLY A CA  1 
ATOM   3166 C  C   . GLY A 1 416 ? 18.887  -15.590 32.675  1.00 23.43 ? 416  GLY A C   1 
ATOM   3167 O  O   . GLY A 1 416 ? 19.340  -15.664 31.529  1.00 18.58 ? 416  GLY A O   1 
ATOM   3168 N  N   . ALA A 1 417 ? 19.043  -14.517 33.448  1.00 22.51 ? 417  ALA A N   1 
ATOM   3169 C  CA  . ALA A 1 417 ? 19.905  -13.391 33.057  1.00 21.34 ? 417  ALA A CA  1 
ATOM   3170 C  C   . ALA A 1 417 ? 20.689  -13.108 34.326  1.00 18.55 ? 417  ALA A C   1 
ATOM   3171 O  O   . ALA A 1 417 ? 20.120  -12.868 35.379  1.00 16.83 ? 417  ALA A O   1 
ATOM   3172 C  CB  . ALA A 1 417 ? 19.075  -12.155 32.638  1.00 24.06 ? 417  ALA A CB  1 
ATOM   3173 N  N   . ALA A 1 418 ? 21.999  -13.266 34.245  1.00 19.43 ? 418  ALA A N   1 
ATOM   3174 C  CA  . ALA A 1 418 ? 22.851  -13.032 35.389  1.00 18.48 ? 418  ALA A CA  1 
ATOM   3175 C  C   . ALA A 1 418 ? 22.997  -11.520 35.628  1.00 21.45 ? 418  ALA A C   1 
ATOM   3176 O  O   . ALA A 1 418 ? 23.278  -11.094 36.741  1.00 21.39 ? 418  ALA A O   1 
ATOM   3177 C  CB  . ALA A 1 418 ? 24.203  -13.649 35.135  1.00 15.71 ? 418  ALA A CB  1 
ATOM   3178 N  N   . LYS A 1 419 ? 22.889  -10.737 34.556  1.00 21.94 ? 419  LYS A N   1 
ATOM   3179 C  CA  . LYS A 1 419 ? 23.021  -9.296  34.641  1.00 22.89 ? 419  LYS A CA  1 
ATOM   3180 C  C   . LYS A 1 419 ? 22.364  -8.602  33.460  1.00 22.87 ? 419  LYS A C   1 
ATOM   3181 O  O   . LYS A 1 419 ? 22.478  -9.066  32.321  1.00 23.35 ? 419  LYS A O   1 
ATOM   3182 C  CB  . LYS A 1 419 ? 24.507  -8.895  34.697  1.00 24.45 ? 419  LYS A CB  1 
ATOM   3183 C  CG  . LYS A 1 419 ? 24.787  -7.392  34.875  1.00 24.52 ? 419  LYS A CG  1 
ATOM   3184 C  CD  . LYS A 1 419 ? 26.229  -7.188  35.320  1.00 25.00 ? 419  LYS A CD  1 
ATOM   3185 C  CE  . LYS A 1 419 ? 26.488  -5.834  35.970  1.00 25.06 ? 419  LYS A CE  1 
ATOM   3186 N  NZ  . LYS A 1 419 ? 27.950  -5.580  36.168  1.00 25.04 ? 419  LYS A NZ  1 
ATOM   3187 N  N   . ILE A 1 420 ? 21.566  -7.579  33.758  1.00 21.19 ? 420  ILE A N   1 
ATOM   3188 C  CA  . ILE A 1 420 ? 20.950  -6.734  32.736  1.00 21.17 ? 420  ILE A CA  1 
ATOM   3189 C  C   . ILE A 1 420 ? 21.353  -5.264  33.031  1.00 22.20 ? 420  ILE A C   1 
ATOM   3190 O  O   . ILE A 1 420 ? 21.191  -4.804  34.164  1.00 21.36 ? 420  ILE A O   1 
ATOM   3191 C  CB  . ILE A 1 420 ? 19.397  -6.853  32.717  1.00 20.20 ? 420  ILE A CB  1 
ATOM   3192 C  CG1 . ILE A 1 420 ? 18.995  -8.274  32.316  1.00 17.69 ? 420  ILE A CG1 1 
ATOM   3193 C  CG2 . ILE A 1 420 ? 18.799  -5.847  31.717  1.00 20.96 ? 420  ILE A CG2 1 
ATOM   3194 C  CD1 . ILE A 1 420 ? 17.519  -8.522  32.356  1.00 18.14 ? 420  ILE A CD1 1 
ATOM   3195 N  N   . THR A 1 421 ? 21.996  -4.601  32.064  1.00 21.90 ? 421  THR A N   1 
ATOM   3196 C  CA  . THR A 1 421 ? 22.350  -3.184  32.213  1.00 22.49 ? 421  THR A CA  1 
ATOM   3197 C  C   . THR A 1 421 ? 21.305  -2.396  31.387  1.00 24.60 ? 421  THR A C   1 
ATOM   3198 O  O   . THR A 1 421 ? 20.872  -2.848  30.322  1.00 24.35 ? 421  THR A O   1 
ATOM   3199 C  CB  . THR A 1 421 ? 23.769  -2.812  31.725  1.00 21.43 ? 421  THR A CB  1 
ATOM   3200 O  OG1 . THR A 1 421 ? 23.931  -3.197  30.353  1.00 24.54 ? 421  THR A OG1 1 
ATOM   3201 C  CG2 . THR A 1 421 ? 24.839  -3.428  32.587  1.00 20.34 ? 421  THR A CG2 1 
ATOM   3202 N  N   . VAL A 1 422 ? 20.865  -1.259  31.928  1.00 23.38 ? 422  VAL A N   1 
ATOM   3203 C  CA  . VAL A 1 422 ? 19.826  -0.411  31.333  1.00 25.01 ? 422  VAL A CA  1 
ATOM   3204 C  C   . VAL A 1 422 ? 20.326  1.023   31.148  1.00 27.03 ? 422  VAL A C   1 
ATOM   3205 O  O   . VAL A 1 422 ? 20.962  1.594   32.028  1.00 25.94 ? 422  VAL A O   1 
ATOM   3206 C  CB  . VAL A 1 422 ? 18.588  -0.361  32.234  1.00 23.38 ? 422  VAL A CB  1 
ATOM   3207 C  CG1 . VAL A 1 422 ? 17.430  0.315   31.522  1.00 22.63 ? 422  VAL A CG1 1 
ATOM   3208 C  CG2 . VAL A 1 422 ? 18.188  -1.778  32.666  1.00 24.95 ? 422  VAL A CG2 1 
ATOM   3209 N  N   . GLN A 1 423 ? 19.988  1.610   30.010  1.00 28.95 ? 423  GLN A N   1 
ATOM   3210 C  CA  . GLN A 1 423 ? 20.397  2.978   29.691  1.00 28.39 ? 423  GLN A CA  1 
ATOM   3211 C  C   . GLN A 1 423 ? 19.187  3.779   29.206  1.00 26.68 ? 423  GLN A C   1 
ATOM   3212 O  O   . GLN A 1 423 ? 18.550  3.403   28.237  1.00 28.33 ? 423  GLN A O   1 
ATOM   3213 C  CB  . GLN A 1 423 ? 21.488  2.929   28.618  1.00 28.38 ? 423  GLN A CB  1 
ATOM   3214 C  CG  . GLN A 1 423 ? 21.776  4.230   27.885  1.00 28.56 ? 423  GLN A CG  1 
ATOM   3215 C  CD  . GLN A 1 423 ? 22.761  5.093   28.600  1.00 28.94 ? 423  GLN A CD  1 
ATOM   3216 O  OE1 . GLN A 1 423 ? 22.389  6.014   29.325  1.00 31.08 ? 423  GLN A OE1 1 
ATOM   3217 N  NE2 . GLN A 1 423 ? 24.036  4.797   28.411  1.00 26.78 ? 423  GLN A NE2 1 
ATOM   3218 N  N   . LYS A 1 424 ? 18.819  4.807   29.960  1.00 26.91 ? 424  LYS A N   1 
ATOM   3219 C  CA  . LYS A 1 424 ? 17.709  5.700   29.608  1.00 26.61 ? 424  LYS A CA  1 
ATOM   3220 C  C   . LYS A 1 424 ? 18.331  6.673   28.594  1.00 25.57 ? 424  LYS A C   1 
ATOM   3221 O  O   . LYS A 1 424 ? 19.474  7.092   28.756  1.00 24.13 ? 424  LYS A O   1 
ATOM   3222 C  CB  . LYS A 1 424 ? 17.198  6.467   30.837  1.00 26.35 ? 424  LYS A CB  1 
ATOM   3223 C  CG  . LYS A 1 424 ? 17.029  5.611   32.105  1.00 27.81 ? 424  LYS A CG  1 
ATOM   3224 C  CD  . LYS A 1 424 ? 15.625  5.704   32.696  1.00 28.68 ? 424  LYS A CD  1 
ATOM   3225 C  CE  . LYS A 1 424 ? 15.177  7.152   32.857  1.00 30.26 ? 424  LYS A CE  1 
ATOM   3226 N  NZ  . LYS A 1 424 ? 13.918  7.319   33.625  1.00 30.51 ? 424  LYS A NZ  1 
ATOM   3227 N  N   . GLY A 1 425 ? 17.606  6.998   27.531  1.00 27.55 ? 425  GLY A N   1 
ATOM   3228 C  CA  . GLY A 1 425 ? 18.169  7.868   26.501  1.00 28.66 ? 425  GLY A CA  1 
ATOM   3229 C  C   . GLY A 1 425 ? 18.655  9.232   26.948  1.00 28.64 ? 425  GLY A C   1 
ATOM   3230 O  O   . GLY A 1 425 ? 19.647  9.745   26.445  1.00 29.88 ? 425  GLY A O   1 
ATOM   3231 N  N   . GLU A 1 426 ? 17.987  9.792   27.942  1.00 31.27 ? 426  GLU A N   1 
ATOM   3232 C  CA  . GLU A 1 426 ? 18.321  11.109  28.430  1.00 34.59 ? 426  GLU A CA  1 
ATOM   3233 C  C   . GLU A 1 426 ? 19.252  11.150  29.625  1.00 36.22 ? 426  GLU A C   1 
ATOM   3234 O  O   . GLU A 1 426 ? 19.401  12.203  30.243  1.00 37.45 ? 426  GLU A O   1 
ATOM   3235 C  CB  . GLU A 1 426 ? 17.036  11.882  28.719  1.00 33.66 ? 426  GLU A CB  1 
ATOM   3236 C  CG  . GLU A 1 426 ? 16.041  11.721  27.606  1.00 36.38 ? 426  GLU A CG  1 
ATOM   3237 C  CD  . GLU A 1 426 ? 15.118  12.908  27.425  1.00 36.73 ? 426  GLU A CD  1 
ATOM   3238 O  OE1 . GLU A 1 426 ? 15.605  14.007  27.116  1.00 37.44 ? 426  GLU A OE1 1 
ATOM   3239 O  OE2 . GLU A 1 426 ? 13.900  12.720  27.513  1.00 36.97 ? 426  GLU A OE2 1 
ATOM   3240 N  N   . GLU A 1 427 ? 19.901  10.036  29.941  1.00 37.24 ? 427  GLU A N   1 
ATOM   3241 C  CA  . GLU A 1 427 ? 20.817  10.007  31.078  1.00 37.83 ? 427  GLU A CA  1 
ATOM   3242 C  C   . GLU A 1 427 ? 22.196  9.681   30.607  1.00 37.90 ? 427  GLU A C   1 
ATOM   3243 O  O   . GLU A 1 427 ? 22.371  9.094   29.537  1.00 37.10 ? 427  GLU A O   1 
ATOM   3244 C  CB  . GLU A 1 427 ? 20.408  8.961   32.106  1.00 38.27 ? 427  GLU A CB  1 
ATOM   3245 C  CG  . GLU A 1 427 ? 19.123  9.254   32.815  1.00 40.01 ? 427  GLU A CG  1 
ATOM   3246 C  CD  . GLU A 1 427 ? 18.964  8.392   34.045  1.00 41.77 ? 427  GLU A CD  1 
ATOM   3247 O  OE1 . GLU A 1 427 ? 19.765  7.451   34.234  1.00 40.53 ? 427  GLU A OE1 1 
ATOM   3248 O  OE2 . GLU A 1 427 ? 18.037  8.659   34.826  1.00 45.18 ? 427  GLU A OE2 1 
ATOM   3249 N  N   . LYS A 1 428 ? 23.188  10.028  31.419  1.00 38.95 ? 428  LYS A N   1 
ATOM   3250 C  CA  . LYS A 1 428 ? 24.570  9.752   31.053  1.00 41.18 ? 428  LYS A CA  1 
ATOM   3251 C  C   . LYS A 1 428 ? 25.053  8.417   31.629  1.00 40.92 ? 428  LYS A C   1 
ATOM   3252 O  O   . LYS A 1 428 ? 25.870  7.728   31.015  1.00 42.78 ? 428  LYS A O   1 
ATOM   3253 C  CB  . LYS A 1 428 ? 25.482  10.915  31.483  1.00 42.82 ? 428  LYS A CB  1 
ATOM   3254 C  CG  . LYS A 1 428 ? 26.812  10.942  30.741  1.00 45.32 ? 428  LYS A CG  1 
ATOM   3255 C  CD  . LYS A 1 428 ? 27.529  12.277  30.916  1.00 47.16 ? 428  LYS A CD  1 
ATOM   3256 C  CE  . LYS A 1 428 ? 28.912  12.254  30.251  1.00 48.21 ? 428  LYS A CE  1 
ATOM   3257 N  NZ  . LYS A 1 428 ? 29.636  13.563  30.383  1.00 49.10 ? 428  LYS A NZ  1 
ATOM   3258 N  N   . THR A 1 429 ? 24.501  8.012   32.768  1.00 38.79 ? 429  THR A N   1 
ATOM   3259 C  CA  . THR A 1 429 ? 24.929  6.753   33.366  1.00 39.45 ? 429  THR A CA  1 
ATOM   3260 C  C   . THR A 1 429 ? 24.150  5.505   32.894  1.00 36.94 ? 429  THR A C   1 
ATOM   3261 O  O   . THR A 1 429 ? 23.164  5.600   32.167  1.00 36.00 ? 429  THR A O   1 
ATOM   3262 C  CB  . THR A 1 429 ? 24.904  6.827   34.914  1.00 38.12 ? 429  THR A CB  1 
ATOM   3263 O  OG1 . THR A 1 429 ? 25.590  5.685   35.461  1.00 40.80 ? 429  THR A OG1 1 
ATOM   3264 C  CG2 . THR A 1 429 ? 23.467  6.862   35.420  1.00 37.81 ? 429  THR A CG2 1 
ATOM   3265 N  N   . VAL A 1 430 ? 24.585  4.351   33.397  1.00 37.14 ? 430  VAL A N   1 
ATOM   3266 C  CA  . VAL A 1 430 ? 24.012  3.037   33.129  1.00 34.40 ? 430  VAL A CA  1 
ATOM   3267 C  C   . VAL A 1 430 ? 23.591  2.396   34.472  1.00 33.59 ? 430  VAL A C   1 
ATOM   3268 O  O   . VAL A 1 430 ? 24.191  2.656   35.516  1.00 31.85 ? 430  VAL A O   1 
ATOM   3269 C  CB  . VAL A 1 430 ? 25.072  2.150   32.431  1.00 35.33 ? 430  VAL A CB  1 
ATOM   3270 C  CG1 . VAL A 1 430 ? 24.643  0.685   32.411  1.00 36.69 ? 430  VAL A CG1 1 
ATOM   3271 C  CG2 . VAL A 1 430 ? 25.320  2.653   31.026  1.00 35.82 ? 430  VAL A CG2 1 
ATOM   3272 N  N   . HIS A 1 431 ? 22.544  1.578   34.452  1.00 28.78 ? 701  HIS A N   1 
ATOM   3273 C  CA  . HIS A 1 431 ? 22.088  0.917   35.666  1.00 29.56 ? 701  HIS A CA  1 
ATOM   3274 C  C   . HIS A 1 431 ? 22.192  -0.610  35.505  1.00 28.14 ? 701  HIS A C   1 
ATOM   3275 O  O   . HIS A 1 431 ? 21.710  -1.161  34.523  1.00 24.50 ? 701  HIS A O   1 
ATOM   3276 C  CB  . HIS A 1 431 ? 20.646  1.341   35.966  1.00 30.84 ? 701  HIS A CB  1 
ATOM   3277 C  CG  . HIS A 1 431 ? 20.483  2.824   36.110  1.00 31.67 ? 701  HIS A CG  1 
ATOM   3278 N  ND1 . HIS A 1 431 ? 20.905  3.503   37.234  1.00 33.58 ? 701  HIS A ND1 1 
ATOM   3279 C  CD2 . HIS A 1 431 ? 20.011  3.757   35.257  1.00 32.50 ? 701  HIS A CD2 1 
ATOM   3280 C  CE1 . HIS A 1 431 ? 20.703  4.796   37.059  1.00 33.52 ? 701  HIS A CE1 1 
ATOM   3281 N  NE2 . HIS A 1 431 ? 20.162  4.980   35.872  1.00 33.34 ? 701  HIS A NE2 1 
ATOM   3282 N  N   . SER A 1 432 ? 22.782  -1.261  36.505  1.00 27.36 ? 431  SER A N   1 
ATOM   3283 C  CA  . SER A 1 432 ? 22.998  -2.706  36.535  1.00 25.57 ? 431  SER A CA  1 
ATOM   3284 C  C   . SER A 1 432 ? 22.074  -3.429  37.487  1.00 24.99 ? 431  SER A C   1 
ATOM   3285 O  O   . SER A 1 432 ? 21.910  -3.011  38.629  1.00 23.92 ? 431  SER A O   1 
ATOM   3286 C  CB  . SER A 1 432 ? 24.451  -3.007  36.943  1.00 25.79 ? 431  SER A CB  1 
ATOM   3287 O  OG  . SER A 1 432 ? 25.353  -2.509  35.985  1.00 29.15 ? 431  SER A OG  1 
ATOM   3288 N  N   . PHE A 1 433 ? 21.487  -4.533  37.015  1.00 26.39 ? 432  PHE A N   1 
ATOM   3289 C  CA  . PHE A 1 433 ? 20.583  -5.381  37.782  1.00 24.64 ? 432  PHE A CA  1 
ATOM   3290 C  C   . PHE A 1 433 ? 21.105  -6.820  37.601  1.00 25.31 ? 432  PHE A C   1 
ATOM   3291 O  O   . PHE A 1 433 ? 21.549  -7.176  36.513  1.00 21.78 ? 432  PHE A O   1 
ATOM   3292 C  CB  . PHE A 1 433 ? 19.166  -5.230  37.238  1.00 24.75 ? 432  PHE A CB  1 
ATOM   3293 C  CG  . PHE A 1 433 ? 18.636  -3.838  37.359  1.00 25.46 ? 432  PHE A CG  1 
ATOM   3294 C  CD1 . PHE A 1 433 ? 18.894  -2.882  36.368  1.00 26.19 ? 432  PHE A CD1 1 
ATOM   3295 C  CD2 . PHE A 1 433 ? 17.941  -3.454  38.495  1.00 25.49 ? 432  PHE A CD2 1 
ATOM   3296 C  CE1 . PHE A 1 433 ? 18.460  -1.551  36.518  1.00 25.13 ? 432  PHE A CE1 1 
ATOM   3297 C  CE2 . PHE A 1 433 ? 17.510  -2.143  38.650  1.00 26.26 ? 432  PHE A CE2 1 
ATOM   3298 C  CZ  . PHE A 1 433 ? 17.776  -1.185  37.647  1.00 26.93 ? 432  PHE A CZ  1 
ATOM   3299 N  N   . CYS A 1 434 ? 21.015  -7.643  38.644  1.00 25.41 ? 433  CYS A N   1 
ATOM   3300 C  CA  . CYS A 1 434 ? 21.552  -9.015  38.608  1.00 27.22 ? 433  CYS A CA  1 
ATOM   3301 C  C   . CYS A 1 434 ? 20.646  -10.093 39.218  1.00 27.27 ? 433  CYS A C   1 
ATOM   3302 O  O   . CYS A 1 434 ? 19.715  -9.794  39.965  1.00 27.69 ? 433  CYS A O   1 
ATOM   3303 C  CB  . CYS A 1 434 ? 22.885  -9.074  39.407  1.00 26.42 ? 433  CYS A CB  1 
ATOM   3304 S  SG  . CYS A 1 434 ? 24.295  -8.099  38.796  1.00 29.45 ? 433  CYS A SG  1 
ATOM   3305 N  N   . SER A 1 435 ? 21.012  -11.341 38.963  1.00 27.00 ? 434  SER A N   1 
ATOM   3306 C  CA  . SER A 1 435 ? 20.347  -12.526 39.494  1.00 26.26 ? 434  SER A CA  1 
ATOM   3307 C  C   . SER A 1 435 ? 21.224  -13.767 39.270  1.00 28.48 ? 434  SER A C   1 
ATOM   3308 O  O   . SER A 1 435 ? 22.062  -13.814 38.350  1.00 25.97 ? 434  SER A O   1 
ATOM   3309 C  CB  . SER A 1 435 ? 18.973  -12.768 38.849  1.00 26.61 ? 434  SER A CB  1 
ATOM   3310 O  OG  . SER A 1 435 ? 18.360  -13.942 39.408  1.00 25.74 ? 434  SER A OG  1 
ATOM   3311 N  N   . GLU A 1 436 ? 21.073  -14.722 40.176  1.00 28.70 ? 435  GLU A N   1 
ATOM   3312 C  CA  . GLU A 1 436 ? 21.776  -15.990 40.102  1.00 30.17 ? 435  GLU A CA  1 
ATOM   3313 C  C   . GLU A 1 436 ? 20.757  -17.109 39.794  1.00 28.97 ? 435  GLU A C   1 
ATOM   3314 O  O   . GLU A 1 436 ? 21.120  -18.279 39.665  1.00 28.43 ? 435  GLU A O   1 
ATOM   3315 C  CB  . GLU A 1 436 ? 22.513  -16.261 41.412  1.00 29.81 ? 435  GLU A CB  1 
ATOM   3316 C  CG  . GLU A 1 436 ? 23.762  -15.378 41.588  1.00 31.33 ? 435  GLU A CG  1 
ATOM   3317 C  CD  . GLU A 1 436 ? 24.517  -15.689 42.863  1.00 33.24 ? 435  GLU A CD  1 
ATOM   3318 O  OE1 . GLU A 1 436 ? 24.213  -16.710 43.509  1.00 34.80 ? 435  GLU A OE1 1 
ATOM   3319 O  OE2 . GLU A 1 436 ? 25.412  -14.919 43.228  1.00 34.04 ? 435  GLU A OE2 1 
ATOM   3320 N  N   . SER A 1 437 ? 19.500  -16.711 39.611  1.00 27.28 ? 436  SER A N   1 
ATOM   3321 C  CA  . SER A 1 437 ? 18.401  -17.625 39.344  1.00 26.72 ? 436  SER A CA  1 
ATOM   3322 C  C   . SER A 1 437 ? 18.087  -17.744 37.877  1.00 28.37 ? 436  SER A C   1 
ATOM   3323 O  O   . SER A 1 437 ? 18.505  -16.918 37.062  1.00 30.27 ? 436  SER A O   1 
ATOM   3324 C  CB  . SER A 1 437 ? 17.150  -17.197 40.108  1.00 27.19 ? 436  SER A CB  1 
ATOM   3325 O  OG  . SER A 1 437 ? 17.440  -16.980 41.476  1.00 28.18 ? 436  SER A OG  1 
ATOM   3326 N  N   . THR A 1 438 ? 17.347  -18.781 37.531  1.00 27.13 ? 437  THR A N   1 
ATOM   3327 C  CA  . THR A 1 438 ? 16.973  -19.035 36.146  1.00 27.39 ? 437  THR A CA  1 
ATOM   3328 C  C   . THR A 1 438 ? 15.525  -19.435 36.217  1.00 27.21 ? 437  THR A C   1 
ATOM   3329 O  O   . THR A 1 438 ? 15.051  -19.867 37.253  1.00 30.36 ? 437  THR A O   1 
ATOM   3330 C  CB  . THR A 1 438 ? 17.787  -20.217 35.551  1.00 27.74 ? 437  THR A CB  1 
ATOM   3331 O  OG1 . THR A 1 438 ? 17.422  -21.422 36.242  1.00 26.72 ? 437  THR A OG1 1 
ATOM   3332 C  CG2 . THR A 1 438 ? 19.282  -19.990 35.734  1.00 26.07 ? 437  THR A CG2 1 
ATOM   3333 N  N   . VAL A 1 439 ? 14.827  -19.363 35.105  1.00 26.10 ? 438  VAL A N   1 
ATOM   3334 C  CA  . VAL A 1 439 ? 13.425  -19.707 35.112  1.00 25.28 ? 438  VAL A CA  1 
ATOM   3335 C  C   . VAL A 1 439 ? 13.093  -20.505 33.861  1.00 26.53 ? 438  VAL A C   1 
ATOM   3336 O  O   . VAL A 1 439 ? 13.883  -20.557 32.915  1.00 23.65 ? 438  VAL A O   1 
ATOM   3337 C  CB  . VAL A 1 439 ? 12.547  -18.427 35.072  1.00 25.59 ? 438  VAL A CB  1 
ATOM   3338 C  CG1 . VAL A 1 439 ? 12.571  -17.701 36.436  1.00 25.48 ? 438  VAL A CG1 1 
ATOM   3339 C  CG2 . VAL A 1 439 ? 13.023  -17.514 33.928  1.00 24.95 ? 438  VAL A CG2 1 
ATOM   3340 N  N   . ARG A 1 440 ? 11.931  -21.143 33.869  1.00 28.05 ? 439  ARG A N   1 
ATOM   3341 C  CA  . ARG A 1 440 ? 11.482  -21.888 32.702  1.00 29.97 ? 439  ARG A CA  1 
ATOM   3342 C  C   . ARG A 1 440 ? 10.790  -20.915 31.780  1.00 30.13 ? 439  ARG A C   1 
ATOM   3343 O  O   . ARG A 1 440 ? 10.420  -19.824 32.187  1.00 27.86 ? 439  ARG A O   1 
ATOM   3344 C  CB  . ARG A 1 440 ? 10.509  -23.011 33.079  1.00 32.49 ? 439  ARG A CB  1 
ATOM   3345 C  CG  . ARG A 1 440 ? 11.217  -24.191 33.747  1.00 36.31 ? 439  ARG A CG  1 
ATOM   3346 C  CD  . ARG A 1 440 ? 10.401  -25.465 33.732  1.00 40.28 ? 439  ARG A CD  1 
ATOM   3347 N  NE  . ARG A 1 440 ? 10.206  -26.002 32.391  1.00 42.10 ? 439  ARG A NE  1 
ATOM   3348 C  CZ  . ARG A 1 440 ? 9.106   -26.647 32.008  1.00 43.08 ? 439  ARG A CZ  1 
ATOM   3349 N  NH1 . ARG A 1 440 ? 8.104   -26.822 32.861  1.00 42.42 ? 439  ARG A NH1 1 
ATOM   3350 N  NH2 . ARG A 1 440 ? 9.002   -27.104 30.766  1.00 43.85 ? 439  ARG A NH2 1 
ATOM   3351 N  N   . GLU A 1 441 ? 10.550  -21.356 30.559  1.00 30.07 ? 440  GLU A N   1 
ATOM   3352 C  CA  . GLU A 1 441 ? 9.878   -20.557 29.560  1.00 32.67 ? 440  GLU A CA  1 
ATOM   3353 C  C   . GLU A 1 441 ? 8.574   -19.977 30.093  1.00 33.46 ? 440  GLU A C   1 
ATOM   3354 O  O   . GLU A 1 441 ? 7.858   -20.610 30.862  1.00 34.28 ? 440  GLU A O   1 
ATOM   3355 C  CB  . GLU A 1 441 ? 9.640   -21.404 28.302  1.00 33.79 ? 440  GLU A CB  1 
ATOM   3356 C  CG  . GLU A 1 441 ? 8.581   -22.485 28.459  1.00 37.78 ? 440  GLU A CG  1 
ATOM   3357 C  CD  . GLU A 1 441 ? 9.066   -23.782 29.125  1.00 38.66 ? 440  GLU A CD  1 
ATOM   3358 O  OE1 . GLU A 1 441 ? 10.229  -23.866 29.620  1.00 36.84 ? 440  GLU A OE1 1 
ATOM   3359 O  OE2 . GLU A 1 441 ? 8.263   -24.750 29.114  1.00 41.64 ? 440  GLU A OE2 1 
ATOM   3360 N  N   . ASP A 1 442 ? 8.341   -18.717 29.765  1.00 34.85 ? 441  ASP A N   1 
ATOM   3361 C  CA  . ASP A 1 442 ? 7.139   -17.994 30.164  1.00 34.86 ? 441  ASP A CA  1 
ATOM   3362 C  C   . ASP A 1 442 ? 6.971   -17.709 31.654  1.00 34.32 ? 441  ASP A C   1 
ATOM   3363 O  O   . ASP A 1 442 ? 5.852   -17.490 32.118  1.00 32.05 ? 441  ASP A O   1 
ATOM   3364 C  CB  . ASP A 1 442 ? 5.885   -18.683 29.619  1.00 37.47 ? 441  ASP A CB  1 
ATOM   3365 C  CG  . ASP A 1 442 ? 4.837   -17.690 29.186  1.00 40.06 ? 441  ASP A CG  1 
ATOM   3366 O  OD1 . ASP A 1 442 ? 5.160   -16.833 28.331  1.00 39.83 ? 441  ASP A OD1 1 
ATOM   3367 O  OD2 . ASP A 1 442 ? 3.704   -17.752 29.712  1.00 42.40 ? 441  ASP A OD2 1 
ATOM   3368 N  N   . VAL A 1 443 ? 8.082   -17.687 32.389  1.00 31.66 ? 442  VAL A N   1 
ATOM   3369 C  CA  . VAL A 1 443 ? 8.080   -17.408 33.827  1.00 30.88 ? 442  VAL A CA  1 
ATOM   3370 C  C   . VAL A 1 443 ? 8.940   -16.149 34.009  1.00 31.99 ? 442  VAL A C   1 
ATOM   3371 O  O   . VAL A 1 443 ? 9.997   -16.030 33.383  1.00 33.69 ? 442  VAL A O   1 
ATOM   3372 C  CB  . VAL A 1 443 ? 8.672   -18.608 34.663  1.00 29.39 ? 442  VAL A CB  1 
ATOM   3373 C  CG1 . VAL A 1 443 ? 8.735   -18.252 36.142  1.00 26.31 ? 442  VAL A CG1 1 
ATOM   3374 C  CG2 . VAL A 1 443 ? 7.778   -19.826 34.526  1.00 28.14 ? 442  VAL A CG2 1 
ATOM   3375 N  N   . LEU A 1 444 ? 8.441   -15.185 34.783  1.00 31.20 ? 443  LEU A N   1 
ATOM   3376 C  CA  . LEU A 1 444 ? 9.141   -13.921 35.035  1.00 29.34 ? 443  LEU A CA  1 
ATOM   3377 C  C   . LEU A 1 444 ? 10.200  -14.034 36.101  1.00 28.92 ? 443  LEU A C   1 
ATOM   3378 O  O   . LEU A 1 444 ? 9.920   -14.496 37.214  1.00 28.27 ? 443  LEU A O   1 
ATOM   3379 C  CB  . LEU A 1 444 ? 8.132   -12.846 35.460  1.00 31.03 ? 443  LEU A CB  1 
ATOM   3380 C  CG  . LEU A 1 444 ? 7.196   -12.305 34.387  1.00 30.78 ? 443  LEU A CG  1 
ATOM   3381 C  CD1 . LEU A 1 444 ? 5.936   -11.717 35.016  1.00 33.20 ? 443  LEU A CD1 1 
ATOM   3382 C  CD2 . LEU A 1 444 ? 7.944   -11.270 33.578  1.00 33.27 ? 443  LEU A CD2 1 
ATOM   3383 N  N   . LEU A 1 445 ? 11.406  -13.590 35.766  1.00 26.16 ? 444  LEU A N   1 
ATOM   3384 C  CA  . LEU A 1 445 ? 12.547  -13.607 36.670  1.00 24.98 ? 444  LEU A CA  1 
ATOM   3385 C  C   . LEU A 1 445 ? 12.863  -12.149 37.009  1.00 26.16 ? 444  LEU A C   1 
ATOM   3386 O  O   . LEU A 1 445 ? 13.009  -11.289 36.116  1.00 25.88 ? 444  LEU A O   1 
ATOM   3387 C  CB  . LEU A 1 445 ? 13.758  -14.230 35.960  1.00 25.08 ? 444  LEU A CB  1 
ATOM   3388 C  CG  . LEU A 1 445 ? 15.037  -14.785 36.638  1.00 27.50 ? 444  LEU A CG  1 
ATOM   3389 C  CD1 . LEU A 1 445 ? 16.285  -14.252 35.948  1.00 27.25 ? 444  LEU A CD1 1 
ATOM   3390 C  CD2 . LEU A 1 445 ? 15.102  -14.585 38.107  1.00 26.82 ? 444  LEU A CD2 1 
ATOM   3391 N  N   . THR A 1 446 ? 12.970  -11.859 38.294  1.00 25.81 ? 445  THR A N   1 
ATOM   3392 C  CA  . THR A 1 446 ? 13.264  -10.508 38.719  1.00 25.09 ? 445  THR A CA  1 
ATOM   3393 C  C   . THR A 1 446 ? 14.726  -10.309 39.076  1.00 25.56 ? 445  THR A C   1 
ATOM   3394 O  O   . THR A 1 446 ? 15.300  -11.066 39.869  1.00 26.85 ? 445  THR A O   1 
ATOM   3395 C  CB  . THR A 1 446 ? 12.407  -10.144 39.924  1.00 26.66 ? 445  THR A CB  1 
ATOM   3396 O  OG1 . THR A 1 446 ? 11.042  -10.054 39.495  1.00 25.28 ? 445  THR A OG1 1 
ATOM   3397 C  CG2 . THR A 1 446 ? 12.869  -8.819  40.567  1.00 26.87 ? 445  THR A CG2 1 
ATOM   3398 N  N   . LEU A 1 447 ? 15.327  -9.300  38.470  1.00 24.46 ? 446  LEU A N   1 
ATOM   3399 C  CA  . LEU A 1 447 ? 16.706  -8.932  38.750  1.00 22.69 ? 446  LEU A CA  1 
ATOM   3400 C  C   . LEU A 1 447 ? 16.644  -7.653  39.599  1.00 24.83 ? 446  LEU A C   1 
ATOM   3401 O  O   . LEU A 1 447 ? 15.792  -6.781  39.368  1.00 23.09 ? 446  LEU A O   1 
ATOM   3402 C  CB  . LEU A 1 447 ? 17.501  -8.671  37.471  1.00 20.08 ? 446  LEU A CB  1 
ATOM   3403 C  CG  . LEU A 1 447 ? 17.972  -9.862  36.650  1.00 20.63 ? 446  LEU A CG  1 
ATOM   3404 C  CD1 . LEU A 1 447 ? 16.851  -10.354 35.724  1.00 18.15 ? 446  LEU A CD1 1 
ATOM   3405 C  CD2 . LEU A 1 447 ? 19.181  -9.474  35.839  1.00 19.11 ? 446  LEU A CD2 1 
ATOM   3406 N  N   . THR A 1 448 ? 17.555  -7.558  40.566  1.00 24.67 ? 447  THR A N   1 
ATOM   3407 C  CA  . THR A 1 448 ? 17.636  -6.450  41.497  1.00 27.03 ? 447  THR A CA  1 
ATOM   3408 C  C   . THR A 1 448 ? 18.979  -5.723  41.315  1.00 26.16 ? 447  THR A C   1 
ATOM   3409 O  O   . THR A 1 448 ? 19.911  -6.270  40.727  1.00 25.81 ? 447  THR A O   1 
ATOM   3410 C  CB  . THR A 1 448 ? 17.516  -6.987  42.957  1.00 27.74 ? 447  THR A CB  1 
ATOM   3411 O  OG1 . THR A 1 448 ? 18.400  -8.115  43.106  1.00 30.11 ? 447  THR A OG1 1 
ATOM   3412 C  CG2 . THR A 1 448 ? 16.080  -7.433  43.287  1.00 28.83 ? 447  THR A CG2 1 
ATOM   3413 N  N   . PRO A 1 449 ? 19.107  -4.496  41.849  1.00 26.95 ? 448  PRO A N   1 
ATOM   3414 C  CA  . PRO A 1 449 ? 20.334  -3.689  41.749  1.00 27.74 ? 448  PRO A CA  1 
ATOM   3415 C  C   . PRO A 1 449 ? 21.651  -4.387  42.093  1.00 29.13 ? 448  PRO A C   1 
ATOM   3416 O  O   . PRO A 1 449 ? 21.724  -5.135  43.081  1.00 28.65 ? 448  PRO A O   1 
ATOM   3417 C  CB  . PRO A 1 449 ? 20.068  -2.562  42.750  1.00 28.12 ? 448  PRO A CB  1 
ATOM   3418 C  CG  . PRO A 1 449 ? 18.594  -2.339  42.604  1.00 28.88 ? 448  PRO A CG  1 
ATOM   3419 C  CD  . PRO A 1 449 ? 18.062  -3.772  42.598  1.00 26.90 ? 448  PRO A CD  1 
ATOM   3420 N  N   . CYS A 1 450 ? 22.696  -4.117  41.306  1.00 28.68 ? 449  CYS A N   1 
ATOM   3421 C  CA  . CYS A 1 450 ? 24.022  -4.669  41.580  1.00 29.32 ? 449  CYS A CA  1 
ATOM   3422 C  C   . CYS A 1 450 ? 25.190  -3.809  41.057  1.00 30.31 ? 449  CYS A C   1 
ATOM   3423 O  O   . CYS A 1 450 ? 24.876  -2.663  40.660  1.00 32.44 ? 449  CYS A O   1 
ATOM   3424 C  CB  . CYS A 1 450 ? 24.147  -6.084  41.041  1.00 29.47 ? 449  CYS A CB  1 
ATOM   3425 S  SG  . CYS A 1 450 ? 23.827  -6.187  39.284  1.00 29.09 ? 449  CYS A SG  1 
HETATM 3426 C  C1  . NAG B 2 .   ? -2.116  52.237  13.297  1.00 44.45 ? 500  NAG A C1  1 
HETATM 3427 C  C2  . NAG B 2 .   ? -3.124  53.398  13.253  1.00 45.71 ? 500  NAG A C2  1 
HETATM 3428 C  C3  . NAG B 2 .   ? -3.047  54.133  11.917  1.00 46.14 ? 500  NAG A C3  1 
HETATM 3429 C  C4  . NAG B 2 .   ? -1.614  54.569  11.632  1.00 46.93 ? 500  NAG A C4  1 
HETATM 3430 C  C5  . NAG B 2 .   ? -0.690  53.339  11.702  1.00 46.97 ? 500  NAG A C5  1 
HETATM 3431 C  C6  . NAG B 2 .   ? 0.791   53.656  11.465  1.00 47.45 ? 500  NAG A C6  1 
HETATM 3432 C  C7  . NAG B 2 .   ? -5.287  53.466  14.294  1.00 44.82 ? 500  NAG A C7  1 
HETATM 3433 C  C8  . NAG B 2 .   ? -6.679  52.875  14.399  1.00 44.61 ? 500  NAG A C8  1 
HETATM 3434 N  N2  . NAG B 2 .   ? -4.470  52.895  13.417  1.00 43.75 ? 500  NAG A N2  1 
HETATM 3435 O  O3  . NAG B 2 .   ? -3.902  55.261  11.937  1.00 46.68 ? 500  NAG A O3  1 
HETATM 3436 O  O4  . NAG B 2 .   ? -1.553  55.159  10.333  1.00 48.30 ? 500  NAG A O4  1 
HETATM 3437 O  O5  . NAG B 2 .   ? -0.794  52.718  13.000  1.00 45.42 ? 500  NAG A O5  1 
HETATM 3438 O  O6  . NAG B 2 .   ? 1.348   54.436  12.517  1.00 49.27 ? 500  NAG A O6  1 
HETATM 3439 O  O7  . NAG B 2 .   ? -4.937  54.408  15.012  1.00 44.64 ? 500  NAG A O7  1 
HETATM 3440 CA CA  . CA  C 3 .   ? 11.215  31.526  2.893   1.00 21.46 ? 501  CA  A CA  1 
HETATM 3441 O  O   . HOH D 4 .   ? 9.724   37.731  -18.940 1.00 53.30 ? 702  HOH A O   1 
HETATM 3442 O  O   . HOH D 4 .   ? 12.605  31.073  -16.589 1.00 49.70 ? 703  HOH A O   1 
HETATM 3443 O  O   . HOH D 4 .   ? 7.739   21.315  -16.061 1.00 59.84 ? 704  HOH A O   1 
HETATM 3444 O  O   . HOH D 4 .   ? -6.038  32.712  -11.100 1.00 35.87 ? 705  HOH A O   1 
HETATM 3445 O  O   . HOH D 4 .   ? -9.429  37.905  3.112   1.00 38.34 ? 706  HOH A O   1 
HETATM 3446 O  O   . HOH D 4 .   ? -14.115 36.786  -7.251  1.00 36.88 ? 707  HOH A O   1 
HETATM 3447 O  O   . HOH D 4 .   ? -15.687 33.866  -5.420  1.00 47.37 ? 708  HOH A O   1 
HETATM 3448 O  O   . HOH D 4 .   ? -11.605 30.178  3.327   1.00 22.32 ? 709  HOH A O   1 
HETATM 3449 O  O   . HOH D 4 .   ? -16.103 24.552  3.773   1.00 56.21 ? 710  HOH A O   1 
HETATM 3450 O  O   . HOH D 4 .   ? -16.212 35.533  22.712  1.00 56.58 ? 711  HOH A O   1 
HETATM 3451 O  O   . HOH D 4 .   ? -15.629 30.450  24.573  1.00 26.69 ? 712  HOH A O   1 
HETATM 3452 O  O   . HOH D 4 .   ? -17.798 33.155  17.911  1.00 31.97 ? 713  HOH A O   1 
HETATM 3453 O  O   . HOH D 4 .   ? -12.859 40.910  17.726  1.00 30.89 ? 714  HOH A O   1 
HETATM 3454 O  O   . HOH D 4 .   ? -8.897  42.951  6.872   1.00 28.17 ? 715  HOH A O   1 
HETATM 3455 O  O   . HOH D 4 .   ? 8.083   31.811  19.799  1.00 34.17 ? 716  HOH A O   1 
HETATM 3456 O  O   . HOH D 4 .   ? -5.431  16.333  15.384  1.00 40.40 ? 717  HOH A O   1 
HETATM 3457 O  O   . HOH D 4 .   ? -5.418  18.747  16.419  1.00 22.57 ? 718  HOH A O   1 
HETATM 3458 O  O   . HOH D 4 .   ? -3.209  27.904  32.069  1.00 46.27 ? 719  HOH A O   1 
HETATM 3459 O  O   . HOH D 4 .   ? 3.640   26.278  25.974  1.00 31.28 ? 720  HOH A O   1 
HETATM 3460 O  O   . HOH D 4 .   ? 0.570   48.257  10.812  1.00 36.03 ? 721  HOH A O   1 
HETATM 3461 O  O   . HOH D 4 .   ? 9.289   32.344  2.029   1.00 22.86 ? 722  HOH A O   1 
HETATM 3462 O  O   . HOH D 4 .   ? 11.295  36.585  10.472  1.00 21.67 ? 723  HOH A O   1 
HETATM 3463 O  O   . HOH D 4 .   ? 17.645  29.122  3.874   1.00 31.01 ? 724  HOH A O   1 
HETATM 3464 O  O   . HOH D 4 .   ? 16.713  33.071  10.682  1.00 25.42 ? 725  HOH A O   1 
HETATM 3465 O  O   . HOH D 4 .   ? 22.958  25.483  16.575  1.00 50.95 ? 726  HOH A O   1 
HETATM 3466 O  O   . HOH D 4 .   ? 18.108  18.145  3.187   1.00 39.06 ? 727  HOH A O   1 
HETATM 3467 O  O   . HOH D 4 .   ? 17.933  20.668  9.681   1.00 29.93 ? 728  HOH A O   1 
HETATM 3468 O  O   . HOH D 4 .   ? -2.446  11.906  20.850  1.00 46.66 ? 729  HOH A O   1 
HETATM 3469 O  O   . HOH D 4 .   ? 24.719  8.154   12.647  1.00 25.56 ? 730  HOH A O   1 
HETATM 3470 O  O   . HOH D 4 .   ? 23.288  2.267   25.256  1.00 38.60 ? 731  HOH A O   1 
HETATM 3471 O  O   . HOH D 4 .   ? 12.087  9.199   21.770  1.00 27.65 ? 732  HOH A O   1 
HETATM 3472 O  O   . HOH D 4 .   ? 14.222  7.826   27.486  1.00 23.84 ? 733  HOH A O   1 
HETATM 3473 O  O   . HOH D 4 .   ? 23.749  -0.928  28.740  1.00 27.56 ? 734  HOH A O   1 
HETATM 3474 O  O   . HOH D 4 .   ? 20.824  -15.661 36.542  1.00 26.73 ? 735  HOH A O   1 
HETATM 3475 O  O   . HOH D 4 .   ? 24.979  -19.542 33.863  1.00 31.96 ? 736  HOH A O   1 
HETATM 3476 O  O   . HOH D 4 .   ? 19.268  -29.343 27.860  1.00 60.63 ? 737  HOH A O   1 
HETATM 3477 O  O   . HOH D 4 .   ? 3.810   -7.138  28.600  1.00 31.62 ? 738  HOH A O   1 
HETATM 3478 O  O   . HOH D 4 .   ? 23.150  -16.565 22.907  1.00 34.63 ? 739  HOH A O   1 
HETATM 3479 O  O   . HOH D 4 .   ? 6.665   -19.942 24.360  1.00 40.64 ? 740  HOH A O   1 
HETATM 3480 O  O   . HOH D 4 .   ? 17.649  -26.034 33.277  1.00 36.74 ? 741  HOH A O   1 
HETATM 3481 O  O   . HOH D 4 .   ? 24.144  0.240   38.364  1.00 38.58 ? 742  HOH A O   1 
HETATM 3482 O  O   . HOH D 4 .   ? 19.287  -14.806 42.497  1.00 31.95 ? 743  HOH A O   1 
HETATM 3483 O  O   . HOH D 4 .   ? 25.819  -12.563 42.240  1.00 19.77 ? 744  HOH A O   1 
HETATM 3484 O  O   . HOH D 4 .   ? 10.635  -21.181 36.487  1.00 35.13 ? 745  HOH A O   1 
HETATM 3485 O  O   . HOH D 4 .   ? 9.332   -12.396 39.015  1.00 36.97 ? 746  HOH A O   1 
HETATM 3486 O  O   . HOH D 4 .   ? 28.238  -1.964  41.808  1.00 37.41 ? 747  HOH A O   1 
HETATM 3487 O  O   . HOH D 4 .   ? -15.290 39.221  17.918  1.00 49.44 ? 748  HOH A O   1 
HETATM 3488 O  O   . HOH D 4 .   ? -17.432 30.305  17.620  1.00 44.98 ? 749  HOH A O   1 
HETATM 3489 O  O   . HOH D 4 .   ? 13.395  11.242  4.391   1.00 39.81 ? 750  HOH A O   1 
HETATM 3490 O  O   . HOH D 4 .   ? 20.953  22.852  10.384  1.00 51.63 ? 751  HOH A O   1 
HETATM 3491 O  O   . HOH D 4 .   ? 9.614   4.259   3.973   1.00 44.30 ? 752  HOH A O   1 
HETATM 3492 O  O   . HOH D 4 .   ? 9.915   1.048   18.273  1.00 29.05 ? 753  HOH A O   1 
HETATM 3493 O  O   . HOH D 4 .   ? 23.968  -25.281 27.763  1.00 31.46 ? 754  HOH A O   1 
HETATM 3494 O  O   . HOH D 4 .   ? 23.883  -7.482  21.083  1.00 27.80 ? 755  HOH A O   1 
HETATM 3495 O  O   . HOH D 4 .   ? 13.654  20.388  23.267  1.00 28.20 ? 756  HOH A O   1 
HETATM 3496 O  O   . HOH D 4 .   ? 24.658  24.306  12.583  1.00 45.66 ? 757  HOH A O   1 
HETATM 3497 O  O   . HOH D 4 .   ? -12.910 38.414  3.187   1.00 44.26 ? 758  HOH A O   1 
HETATM 3498 O  O   . HOH D 4 .   ? 5.939   38.910  -7.540  1.00 33.27 ? 759  HOH A O   1 
HETATM 3499 O  O   . HOH D 4 .   ? -2.648  13.891  19.016  1.00 42.49 ? 760  HOH A O   1 
HETATM 3500 O  O   . HOH D 4 .   ? -8.755  11.749  8.479   1.00 37.51 ? 761  HOH A O   1 
HETATM 3501 O  O   . HOH D 4 .   ? -12.792 21.770  19.036  1.00 25.79 ? 762  HOH A O   1 
HETATM 3502 O  O   . HOH D 4 .   ? 7.724   19.149  22.163  1.00 22.66 ? 763  HOH A O   1 
HETATM 3503 O  O   . HOH D 4 .   ? 5.097   31.062  -2.016  1.00 25.64 ? 764  HOH A O   1 
HETATM 3504 O  O   . HOH D 4 .   ? 7.806   17.775  -4.658  1.00 46.59 ? 765  HOH A O   1 
HETATM 3505 O  O   . HOH D 4 .   ? 6.155   2.450   16.510  1.00 41.47 ? 766  HOH A O   1 
HETATM 3506 O  O   . HOH D 4 .   ? 5.860   -15.396 35.743  1.00 31.30 ? 767  HOH A O   1 
HETATM 3507 O  O   . HOH D 4 .   ? 13.762  7.642   6.560   1.00 28.02 ? 768  HOH A O   1 
HETATM 3508 O  O   . HOH D 4 .   ? -4.839  6.865   -3.222  1.00 54.02 ? 769  HOH A O   1 
HETATM 3509 O  O   . HOH D 4 .   ? -9.054  21.472  -12.488 1.00 40.90 ? 770  HOH A O   1 
HETATM 3510 O  O   . HOH D 4 .   ? 17.167  4.684   36.966  1.00 31.79 ? 771  HOH A O   1 
HETATM 3511 O  O   . HOH D 4 .   ? 5.859   9.122   30.962  1.00 31.60 ? 772  HOH A O   1 
HETATM 3512 O  O   . HOH D 4 .   ? 2.846   0.986   34.819  1.00 34.34 ? 773  HOH A O   1 
HETATM 3513 O  O   . HOH D 4 .   ? -6.695  44.979  -7.438  1.00 41.92 ? 774  HOH A O   1 
HETATM 3514 O  O   . HOH D 4 .   ? 15.971  38.706  13.651  1.00 52.18 ? 775  HOH A O   1 
HETATM 3515 O  O   . HOH D 4 .   ? -14.092 24.819  13.327  1.00 46.17 ? 776  HOH A O   1 
HETATM 3516 O  O   . HOH D 4 .   ? -3.364  46.782  8.226   1.00 37.99 ? 777  HOH A O   1 
HETATM 3517 O  O   . HOH D 4 .   ? 6.774   44.165  11.627  1.00 46.29 ? 778  HOH A O   1 
HETATM 3518 O  O   . HOH D 4 .   ? 13.831  0.805   17.198  1.00 27.23 ? 779  HOH A O   1 
HETATM 3519 O  O   . HOH D 4 .   ? 23.547  -27.990 27.100  1.00 38.69 ? 780  HOH A O   1 
HETATM 3520 O  O   . HOH D 4 .   ? 18.247  -11.041 43.059  1.00 35.42 ? 781  HOH A O   1 
HETATM 3521 O  O   . HOH D 4 .   ? 11.004  -2.560  42.800  1.00 55.82 ? 782  HOH A O   1 
HETATM 3522 O  O   . HOH D 4 .   ? -8.017  39.095  -8.397  1.00 52.24 ? 783  HOH A O   1 
HETATM 3523 O  O   . HOH D 4 .   ? 5.312   37.617  -5.396  1.00 49.23 ? 784  HOH A O   1 
HETATM 3524 O  O   . HOH D 4 .   ? 1.777   42.149  3.996   1.00 27.54 ? 785  HOH A O   1 
HETATM 3525 O  O   . HOH D 4 .   ? 3.478   44.553  1.415   1.00 50.44 ? 786  HOH A O   1 
HETATM 3526 O  O   . HOH D 4 .   ? -6.376  43.175  1.362   1.00 28.51 ? 787  HOH A O   1 
HETATM 3527 O  O   . HOH D 4 .   ? -9.835  41.576  2.790   1.00 35.48 ? 788  HOH A O   1 
HETATM 3528 O  O   . HOH D 4 .   ? -7.598  44.081  -2.750  1.00 23.37 ? 789  HOH A O   1 
HETATM 3529 O  O   . HOH D 4 .   ? -1.053  34.751  -14.992 1.00 42.32 ? 790  HOH A O   1 
HETATM 3530 O  O   . HOH D 4 .   ? -5.025  37.388  -13.155 1.00 41.14 ? 791  HOH A O   1 
HETATM 3531 O  O   . HOH D 4 .   ? 3.140   39.905  -18.509 1.00 35.11 ? 792  HOH A O   1 
HETATM 3532 O  O   . HOH D 4 .   ? 9.911   38.162  -15.615 1.00 34.37 ? 793  HOH A O   1 
HETATM 3533 O  O   . HOH D 4 .   ? -4.158  33.163  -12.860 1.00 40.43 ? 794  HOH A O   1 
HETATM 3534 O  O   . HOH D 4 .   ? -7.866  43.171  -13.688 1.00 46.22 ? 795  HOH A O   1 
HETATM 3535 O  O   . HOH D 4 .   ? -7.632  47.085  -5.676  1.00 38.24 ? 796  HOH A O   1 
HETATM 3536 O  O   . HOH D 4 .   ? 5.423   42.776  3.900   1.00 43.15 ? 797  HOH A O   1 
HETATM 3537 O  O   . HOH D 4 .   ? 4.738   36.131  -2.896  1.00 25.80 ? 798  HOH A O   1 
HETATM 3538 O  O   . HOH D 4 .   ? 3.263   41.775  -2.137  1.00 23.93 ? 799  HOH A O   1 
HETATM 3539 O  O   . HOH D 4 .   ? 11.475  37.532  -8.942  1.00 39.98 ? 800  HOH A O   1 
HETATM 3540 O  O   . HOH D 4 .   ? 13.977  37.240  -8.391  1.00 28.17 ? 801  HOH A O   1 
HETATM 3541 O  O   . HOH D 4 .   ? 10.376  28.197  -9.530  1.00 26.99 ? 802  HOH A O   1 
HETATM 3542 O  O   . HOH D 4 .   ? 15.508  28.776  -7.797  1.00 34.42 ? 803  HOH A O   1 
HETATM 3543 O  O   . HOH D 4 .   ? 15.985  24.359  -2.295  1.00 36.38 ? 804  HOH A O   1 
HETATM 3544 O  O   . HOH D 4 .   ? 0.749   29.188  -18.026 1.00 44.63 ? 805  HOH A O   1 
HETATM 3545 O  O   . HOH D 4 .   ? -4.691  25.912  -12.264 1.00 36.28 ? 806  HOH A O   1 
HETATM 3546 O  O   . HOH D 4 .   ? 3.613   29.776  -4.008  1.00 26.81 ? 807  HOH A O   1 
HETATM 3547 O  O   . HOH D 4 .   ? -7.786  35.162  -15.471 1.00 43.72 ? 808  HOH A O   1 
HETATM 3548 O  O   . HOH D 4 .   ? -9.726  36.259  -7.094  1.00 38.64 ? 809  HOH A O   1 
HETATM 3549 O  O   . HOH D 4 .   ? -12.049 38.507  -6.485  1.00 33.67 ? 810  HOH A O   1 
HETATM 3550 O  O   . HOH D 4 .   ? -10.597 37.669  9.832   1.00 29.24 ? 811  HOH A O   1 
HETATM 3551 O  O   . HOH D 4 .   ? -13.344 39.986  6.582   1.00 35.94 ? 812  HOH A O   1 
HETATM 3552 O  O   . HOH D 4 .   ? -10.204 26.886  13.114  1.00 36.77 ? 813  HOH A O   1 
HETATM 3553 O  O   . HOH D 4 .   ? -14.743 28.143  12.089  1.00 33.23 ? 814  HOH A O   1 
HETATM 3554 O  O   . HOH D 4 .   ? -10.445 24.295  13.789  1.00 27.78 ? 815  HOH A O   1 
HETATM 3555 O  O   . HOH D 4 .   ? -6.165  34.377  28.562  1.00 37.93 ? 816  HOH A O   1 
HETATM 3556 O  O   . HOH D 4 .   ? 0.849   30.881  31.021  1.00 32.01 ? 817  HOH A O   1 
HETATM 3557 O  O   . HOH D 4 .   ? -7.257  28.030  30.598  1.00 31.06 ? 818  HOH A O   1 
HETATM 3558 O  O   . HOH D 4 .   ? 1.725   33.241  26.938  1.00 35.57 ? 819  HOH A O   1 
HETATM 3559 O  O   . HOH D 4 .   ? 7.524   28.872  20.921  1.00 22.17 ? 820  HOH A O   1 
HETATM 3560 O  O   . HOH D 4 .   ? 6.647   32.466  21.743  1.00 36.72 ? 821  HOH A O   1 
HETATM 3561 O  O   . HOH D 4 .   ? 8.076   25.371  24.781  1.00 32.32 ? 822  HOH A O   1 
HETATM 3562 O  O   . HOH D 4 .   ? -7.849  21.799  1.873   1.00 31.40 ? 823  HOH A O   1 
HETATM 3563 O  O   . HOH D 4 .   ? -10.876 25.433  7.487   1.00 29.59 ? 824  HOH A O   1 
HETATM 3564 O  O   . HOH D 4 .   ? -12.551 11.643  -1.330  1.00 42.04 ? 825  HOH A O   1 
HETATM 3565 O  O   . HOH D 4 .   ? -12.832 17.991  13.346  1.00 30.75 ? 826  HOH A O   1 
HETATM 3566 O  O   . HOH D 4 .   ? -12.533 17.532  17.888  1.00 28.84 ? 827  HOH A O   1 
HETATM 3567 O  O   . HOH D 4 .   ? -8.313  23.447  27.743  1.00 47.14 ? 828  HOH A O   1 
HETATM 3568 O  O   . HOH D 4 .   ? -3.893  18.056  30.028  1.00 44.30 ? 829  HOH A O   1 
HETATM 3569 O  O   . HOH D 4 .   ? 2.991   27.682  30.535  1.00 35.12 ? 830  HOH A O   1 
HETATM 3570 O  O   . HOH D 4 .   ? -14.983 23.883  -3.206  1.00 56.81 ? 831  HOH A O   1 
HETATM 3571 O  O   . HOH D 4 .   ? -0.711  21.348  -10.114 1.00 46.87 ? 832  HOH A O   1 
HETATM 3572 O  O   . HOH D 4 .   ? 8.552   35.105  0.739   1.00 44.37 ? 833  HOH A O   1 
HETATM 3573 O  O   . HOH D 4 .   ? 4.871   42.023  8.653   1.00 31.21 ? 834  HOH A O   1 
HETATM 3574 O  O   . HOH D 4 .   ? 1.076   46.038  6.388   1.00 45.43 ? 835  HOH A O   1 
HETATM 3575 O  O   . HOH D 4 .   ? 3.646   41.804  15.661  1.00 24.53 ? 836  HOH A O   1 
HETATM 3576 O  O   . HOH D 4 .   ? 27.571  -21.210 26.876  1.00 30.96 ? 837  HOH A O   1 
HETATM 3577 O  O   . HOH D 4 .   ? 4.583   47.457  25.052  1.00 37.45 ? 838  HOH A O   1 
HETATM 3578 O  O   . HOH D 4 .   ? 7.625   17.141  5.242   1.00 24.17 ? 839  HOH A O   1 
HETATM 3579 O  O   . HOH D 4 .   ? 7.442   17.765  -7.590  1.00 35.87 ? 840  HOH A O   1 
HETATM 3580 O  O   . HOH D 4 .   ? 17.055  25.069  -9.952  1.00 40.00 ? 841  HOH A O   1 
HETATM 3581 O  O   . HOH D 4 .   ? 13.439  25.230  2.421   1.00 25.27 ? 842  HOH A O   1 
HETATM 3582 O  O   . HOH D 4 .   ? 7.082   30.416  1.843   1.00 24.25 ? 843  HOH A O   1 
HETATM 3583 O  O   . HOH D 4 .   ? 8.949   40.010  0.221   1.00 43.51 ? 844  HOH A O   1 
HETATM 3584 O  O   . HOH D 4 .   ? 15.340  35.570  11.504  1.00 34.24 ? 845  HOH A O   1 
HETATM 3585 O  O   . HOH D 4 .   ? 12.624  32.307  18.488  1.00 30.87 ? 846  HOH A O   1 
HETATM 3586 O  O   . HOH D 4 .   ? 12.751  35.316  19.676  1.00 51.88 ? 847  HOH A O   1 
HETATM 3587 O  O   . HOH D 4 .   ? 9.324   20.195  16.021  1.00 23.03 ? 848  HOH A O   1 
HETATM 3588 O  O   . HOH D 4 .   ? 10.708  4.912   0.119   1.00 45.86 ? 849  HOH A O   1 
HETATM 3589 O  O   . HOH D 4 .   ? 0.986   9.723   1.178   1.00 46.51 ? 850  HOH A O   1 
HETATM 3590 O  O   . HOH D 4 .   ? -0.801  11.173  3.488   1.00 34.45 ? 851  HOH A O   1 
HETATM 3591 O  O   . HOH D 4 .   ? 5.331   9.382   2.413   1.00 25.15 ? 852  HOH A O   1 
HETATM 3592 O  O   . HOH D 4 .   ? 4.135   6.918   0.883   1.00 37.10 ? 853  HOH A O   1 
HETATM 3593 O  O   . HOH D 4 .   ? 2.101   4.925   -0.905  1.00 40.62 ? 854  HOH A O   1 
HETATM 3594 O  O   . HOH D 4 .   ? 17.189  29.297  16.292  1.00 29.54 ? 855  HOH A O   1 
HETATM 3595 O  O   . HOH D 4 .   ? 9.195   6.427   7.343   1.00 22.89 ? 856  HOH A O   1 
HETATM 3596 O  O   . HOH D 4 .   ? 1.904   4.354   6.883   1.00 33.69 ? 857  HOH A O   1 
HETATM 3597 O  O   . HOH D 4 .   ? 7.718   3.229   14.558  1.00 25.48 ? 858  HOH A O   1 
HETATM 3598 O  O   . HOH D 4 .   ? 1.775   7.236   14.168  1.00 22.24 ? 859  HOH A O   1 
HETATM 3599 O  O   . HOH D 4 .   ? 1.773   12.601  -12.215 1.00 40.76 ? 860  HOH A O   1 
HETATM 3600 O  O   . HOH D 4 .   ? -3.191  6.387   -6.202  1.00 39.42 ? 861  HOH A O   1 
HETATM 3601 O  O   . HOH D 4 .   ? -3.000  17.553  -11.221 1.00 47.54 ? 862  HOH A O   1 
HETATM 3602 O  O   . HOH D 4 .   ? -9.627  14.958  -2.456  1.00 27.85 ? 863  HOH A O   1 
HETATM 3603 O  O   . HOH D 4 .   ? -7.627  10.481  4.162   1.00 30.90 ? 864  HOH A O   1 
HETATM 3604 O  O   . HOH D 4 .   ? -2.848  11.158  11.239  1.00 30.61 ? 865  HOH A O   1 
HETATM 3605 O  O   . HOH D 4 .   ? -5.664  10.718  10.658  1.00 32.12 ? 866  HOH A O   1 
HETATM 3606 O  O   . HOH D 4 .   ? -5.182  7.743   17.713  1.00 31.40 ? 867  HOH A O   1 
HETATM 3607 O  O   . HOH D 4 .   ? -5.264  7.928   11.722  1.00 47.91 ? 868  HOH A O   1 
HETATM 3608 O  O   . HOH D 4 .   ? -4.928  10.324  16.891  1.00 38.72 ? 869  HOH A O   1 
HETATM 3609 O  O   . HOH D 4 .   ? -6.727  12.279  16.996  1.00 40.84 ? 870  HOH A O   1 
HETATM 3610 O  O   . HOH D 4 .   ? 7.568   16.954  23.825  1.00 22.96 ? 871  HOH A O   1 
HETATM 3611 O  O   . HOH D 4 .   ? 5.963   14.126  28.939  1.00 29.70 ? 872  HOH A O   1 
HETATM 3612 O  O   . HOH D 4 .   ? 8.386   11.911  32.012  1.00 43.42 ? 873  HOH A O   1 
HETATM 3613 O  O   . HOH D 4 .   ? 10.795  10.692  24.842  1.00 30.95 ? 874  HOH A O   1 
HETATM 3614 O  O   . HOH D 4 .   ? 13.025  10.101  26.359  1.00 26.10 ? 875  HOH A O   1 
HETATM 3615 O  O   . HOH D 4 .   ? 13.672  8.620   23.975  1.00 24.55 ? 876  HOH A O   1 
HETATM 3616 O  O   . HOH D 4 .   ? 9.485   9.673   20.941  1.00 26.88 ? 877  HOH A O   1 
HETATM 3617 O  O   . HOH D 4 .   ? 22.412  10.832  19.682  1.00 41.69 ? 878  HOH A O   1 
HETATM 3618 O  O   . HOH D 4 .   ? 24.579  12.536  12.806  1.00 32.09 ? 879  HOH A O   1 
HETATM 3619 O  O   . HOH D 4 .   ? 28.003  13.585  22.316  1.00 41.12 ? 880  HOH A O   1 
HETATM 3620 O  O   . HOH D 4 .   ? 17.284  5.249   6.511   1.00 28.63 ? 881  HOH A O   1 
HETATM 3621 O  O   . HOH D 4 .   ? 16.437  7.905   7.002   1.00 29.70 ? 882  HOH A O   1 
HETATM 3622 O  O   . HOH D 4 .   ? 24.000  -3.707  11.964  1.00 51.20 ? 883  HOH A O   1 
HETATM 3623 O  O   . HOH D 4 .   ? 23.086  3.240   19.901  1.00 28.03 ? 884  HOH A O   1 
HETATM 3624 O  O   . HOH D 4 .   ? 19.925  4.332   17.719  1.00 28.87 ? 885  HOH A O   1 
HETATM 3625 O  O   . HOH D 4 .   ? 25.927  7.983   19.654  1.00 48.25 ? 886  HOH A O   1 
HETATM 3626 O  O   . HOH D 4 .   ? 24.618  11.129  27.579  1.00 45.93 ? 887  HOH A O   1 
HETATM 3627 O  O   . HOH D 4 .   ? 2.486   1.561   18.778  1.00 25.28 ? 888  HOH A O   1 
HETATM 3628 O  O   . HOH D 4 .   ? 24.430  -7.527  30.605  1.00 19.04 ? 889  HOH A O   1 
HETATM 3629 O  O   . HOH D 4 .   ? 23.625  -20.762 35.803  1.00 36.27 ? 890  HOH A O   1 
HETATM 3630 O  O   . HOH D 4 .   ? 2.655   4.968   36.063  1.00 33.78 ? 891  HOH A O   1 
HETATM 3631 O  O   . HOH D 4 .   ? 5.960   -4.332  24.053  1.00 34.52 ? 892  HOH A O   1 
HETATM 3632 O  O   . HOH D 4 .   ? 5.542   -6.152  31.834  1.00 31.26 ? 893  HOH A O   1 
HETATM 3633 O  O   . HOH D 4 .   ? 6.492   -8.329  33.165  1.00 26.60 ? 894  HOH A O   1 
HETATM 3634 O  O   . HOH D 4 .   ? 11.755  -4.610  21.109  1.00 30.73 ? 895  HOH A O   1 
HETATM 3635 O  O   . HOH D 4 .   ? 20.118  -8.624  20.764  1.00 30.65 ? 896  HOH A O   1 
HETATM 3636 O  O   . HOH D 4 .   ? 22.442  -10.063 20.045  1.00 43.43 ? 897  HOH A O   1 
HETATM 3637 O  O   . HOH D 4 .   ? 29.137  -11.945 27.409  1.00 15.26 ? 898  HOH A O   1 
HETATM 3638 O  O   . HOH D 4 .   ? 30.609  -15.851 28.924  1.00 25.00 ? 899  HOH A O   1 
HETATM 3639 O  O   . HOH D 4 .   ? 13.683  5.641   44.165  1.00 56.62 ? 900  HOH A O   1 
HETATM 3640 O  O   . HOH D 4 .   ? 18.230  2.740   38.657  1.00 32.71 ? 901  HOH A O   1 
HETATM 3641 O  O   . HOH D 4 .   ? 10.564  -17.193 31.077  1.00 26.52 ? 902  HOH A O   1 
HETATM 3642 O  O   . HOH D 4 .   ? 6.649   -23.128 32.214  1.00 40.78 ? 903  HOH A O   1 
HETATM 3643 O  O   . HOH D 4 .   ? 16.992  -12.667 41.258  1.00 34.70 ? 904  HOH A O   1 
HETATM 3644 O  O   . HOH D 4 .   ? 21.862  -8.254  42.451  1.00 27.42 ? 905  HOH A O   1 
HETATM 3645 O  O   . HOH D 4 .   ? 12.940  -17.475 40.036  1.00 36.29 ? 906  HOH A O   1 
HETATM 3646 O  O   . HOH D 4 .   ? 4.101   -15.329 31.554  1.00 42.06 ? 907  HOH A O   1 
HETATM 3647 O  O   . HOH D 4 .   ? 1.517   -18.314 32.398  1.00 57.65 ? 908  HOH A O   1 
HETATM 3648 O  O   . HOH D 4 .   ? 9.167   -8.759  40.973  1.00 33.67 ? 909  HOH A O   1 
HETATM 3649 O  O   . HOH D 4 .   ? 20.651  -0.527  39.525  1.00 30.96 ? 910  HOH A O   1 
HETATM 3650 O  O   . HOH D 4 .   ? 4.419   47.642  11.607  1.00 38.59 ? 911  HOH A O   1 
HETATM 3651 O  O   . HOH D 4 .   ? 9.953   20.615  -6.685  1.00 43.97 ? 912  HOH A O   1 
HETATM 3652 O  O   . HOH D 4 .   ? 12.329  6.944   19.699  1.00 27.25 ? 913  HOH A O   1 
HETATM 3653 O  O   . HOH D 4 .   ? 15.279  9.190   29.691  1.00 41.50 ? 914  HOH A O   1 
HETATM 3654 O  O   . HOH D 4 .   ? -9.405  38.534  7.423   1.00 27.29 ? 915  HOH A O   1 
HETATM 3655 O  O   . HOH D 4 .   ? 9.249   31.356  -20.403 1.00 47.46 ? 916  HOH A O   1 
HETATM 3656 O  O   . HOH D 4 .   ? 7.024   28.150  -19.459 1.00 40.68 ? 917  HOH A O   1 
HETATM 3657 O  O   . HOH D 4 .   ? -6.089  35.980  -9.386  1.00 27.77 ? 918  HOH A O   1 
HETATM 3658 O  O   . HOH D 4 .   ? -9.845  48.839  5.378   1.00 40.40 ? 919  HOH A O   1 
HETATM 3659 O  O   . HOH D 4 .   ? 4.943   39.407  -3.398  1.00 34.99 ? 920  HOH A O   1 
HETATM 3660 O  O   . HOH D 4 .   ? 14.481  20.830  -12.027 1.00 43.19 ? 921  HOH A O   1 
HETATM 3661 O  O   . HOH D 4 .   ? 3.136   31.071  26.928  1.00 35.16 ? 922  HOH A O   1 
HETATM 3662 O  O   . HOH D 4 .   ? 27.014  -8.113  43.208  1.00 37.71 ? 923  HOH A O   1 
HETATM 3663 O  O   . HOH D 4 .   ? 28.184  -6.074  42.360  1.00 32.11 ? 924  HOH A O   1 
HETATM 3664 O  O   . HOH D 4 .   ? -11.016 30.784  31.821  1.00 53.09 ? 925  HOH A O   1 
HETATM 3665 O  O   . HOH D 4 .   ? 2.801   28.688  -10.398 1.00 28.81 ? 926  HOH A O   1 
HETATM 3666 O  O   . HOH D 4 .   ? -13.776 30.741  -5.933  1.00 42.66 ? 927  HOH A O   1 
HETATM 3667 O  O   . HOH D 4 .   ? -7.128  50.236  18.163  1.00 55.16 ? 928  HOH A O   1 
HETATM 3668 O  O   . HOH D 4 .   ? -4.313  21.197  7.383   1.00 24.74 ? 929  HOH A O   1 
HETATM 3669 O  O   . HOH D 4 .   ? -2.532  56.816  13.871  1.00 39.48 ? 930  HOH A O   1 
HETATM 3670 O  O   . HOH D 4 .   ? 11.483  30.228  20.633  1.00 34.04 ? 931  HOH A O   1 
HETATM 3671 O  O   . HOH D 4 .   ? 12.268  34.638  22.147  1.00 38.27 ? 932  HOH A O   1 
HETATM 3672 O  O   . HOH D 4 .   ? -4.351  15.010  17.561  1.00 43.32 ? 933  HOH A O   1 
HETATM 3673 O  O   . HOH D 4 .   ? -5.653  17.691  18.730  1.00 37.60 ? 934  HOH A O   1 
HETATM 3674 O  O   . HOH D 4 .   ? 6.881   27.398  24.098  1.00 34.39 ? 935  HOH A O   1 
HETATM 3675 O  O   . HOH D 4 .   ? 23.344  5.379   7.399   1.00 36.06 ? 936  HOH A O   1 
HETATM 3676 O  O   . HOH D 4 .   ? 25.608  5.848   12.068  1.00 30.31 ? 937  HOH A O   1 
HETATM 3677 O  O   . HOH D 4 .   ? 23.856  9.792   16.575  1.00 29.23 ? 938  HOH A O   1 
HETATM 3678 O  O   . HOH D 4 .   ? 25.669  13.668  16.934  1.00 41.97 ? 939  HOH A O   1 
HETATM 3679 O  O   . HOH D 4 .   ? 22.507  -1.300  26.656  1.00 25.41 ? 940  HOH A O   1 
HETATM 3680 O  O   . HOH D 4 .   ? 12.795  -13.833 40.516  1.00 33.60 ? 941  HOH A O   1 
HETATM 3681 O  O   . HOH D 4 .   ? 22.586  -23.958 35.836  1.00 36.33 ? 942  HOH A O   1 
HETATM 3682 O  O   . HOH D 4 .   ? 13.991  -10.934 43.744  1.00 37.36 ? 943  HOH A O   1 
HETATM 3683 O  O   . HOH D 4 .   ? 11.265  -7.487  43.970  1.00 44.11 ? 944  HOH A O   1 
HETATM 3684 O  O   . HOH D 4 .   ? 20.371  25.486  10.047  1.00 33.96 ? 945  HOH A O   1 
HETATM 3685 O  O   . HOH D 4 .   ? 6.532   1.298   20.487  1.00 35.45 ? 946  HOH A O   1 
HETATM 3686 O  O   . HOH D 4 .   ? 18.052  15.145  26.759  1.00 21.00 ? 947  HOH A O   1 
HETATM 3687 O  O   . HOH D 4 .   ? 20.580  27.817  9.058   1.00 39.00 ? 948  HOH A O   1 
HETATM 3688 O  O   . HOH D 4 .   ? 4.539   -19.162 33.629  1.00 50.40 ? 949  HOH A O   1 
HETATM 3689 O  O   . HOH D 4 .   ? 3.308   -20.968 32.133  1.00 58.48 ? 950  HOH A O   1 
HETATM 3690 O  O   . HOH D 4 .   ? 15.840  9.831   34.063  1.00 37.72 ? 951  HOH A O   1 
HETATM 3691 O  O   . HOH D 4 .   ? 2.114   6.719   31.316  1.00 36.66 ? 952  HOH A O   1 
HETATM 3692 O  O   . HOH D 4 .   ? 4.415   12.562  34.792  1.00 42.62 ? 953  HOH A O   1 
HETATM 3693 O  O   . HOH D 4 .   ? 15.140  -1.063  43.815  1.00 45.39 ? 954  HOH A O   1 
HETATM 3694 O  O   . HOH D 4 .   ? -12.446 26.674  -2.961  1.00 30.29 ? 955  HOH A O   1 
HETATM 3695 O  O   . HOH D 4 .   ? 3.535   17.629  -2.784  1.00 24.11 ? 956  HOH A O   1 
HETATM 3696 O  O   . HOH D 4 .   ? 0.580   17.961  -2.607  1.00 28.56 ? 957  HOH A O   1 
HETATM 3697 O  O   . HOH D 4 .   ? 1.032   15.121  -10.111 1.00 57.77 ? 958  HOH A O   1 
HETATM 3698 O  O   . HOH D 4 .   ? 3.492   14.290  -10.567 1.00 55.12 ? 959  HOH A O   1 
HETATM 3699 O  O   . HOH D 4 .   ? 14.414  -9.827  19.290  1.00 27.11 ? 960  HOH A O   1 
HETATM 3700 O  O   . HOH D 4 .   ? 16.909  -11.149 17.744  1.00 31.43 ? 961  HOH A O   1 
HETATM 3701 O  O   . HOH D 4 .   ? 6.927   -22.941 34.940  1.00 40.54 ? 962  HOH A O   1 
HETATM 3702 O  O   . HOH D 4 .   ? 17.053  34.025  2.467   1.00 26.76 ? 963  HOH A O   1 
HETATM 3703 O  O   . HOH D 4 .   ? -5.832  28.822  -11.565 1.00 40.14 ? 964  HOH A O   1 
HETATM 3704 O  O   . HOH D 4 .   ? -5.957  41.482  3.641   1.00 26.59 ? 965  HOH A O   1 
HETATM 3705 O  O   . HOH D 4 .   ? -10.405 40.638  5.958   1.00 33.83 ? 966  HOH A O   1 
HETATM 3706 O  O   . HOH D 4 .   ? -14.942 30.007  -3.081  1.00 44.33 ? 967  HOH A O   1 
HETATM 3707 O  O   . HOH D 4 .   ? -13.318 31.640  4.333   1.00 43.70 ? 968  HOH A O   1 
HETATM 3708 O  O   . HOH D 4 .   ? -15.084 32.727  -1.959  1.00 33.07 ? 969  HOH A O   1 
HETATM 3709 O  O   . HOH D 4 .   ? -14.674 25.315  28.392  1.00 40.10 ? 970  HOH A O   1 
HETATM 3710 O  O   . HOH D 4 .   ? -9.252  27.458  29.058  1.00 35.02 ? 971  HOH A O   1 
HETATM 3711 O  O   . HOH D 4 .   ? -7.492  33.143  31.213  1.00 32.24 ? 972  HOH A O   1 
HETATM 3712 O  O   . HOH D 4 .   ? -19.521 25.833  19.550  1.00 37.44 ? 973  HOH A O   1 
HETATM 3713 O  O   . HOH D 4 .   ? -15.636 35.430  11.214  1.00 31.60 ? 974  HOH A O   1 
HETATM 3714 O  O   . HOH D 4 .   ? -19.471 34.441  11.491  1.00 39.29 ? 975  HOH A O   1 
HETATM 3715 O  O   . HOH D 4 .   ? -13.918 47.153  9.567   1.00 46.83 ? 976  HOH A O   1 
HETATM 3716 O  O   . HOH D 4 .   ? -6.813  44.889  3.560   1.00 40.12 ? 977  HOH A O   1 
HETATM 3717 O  O   . HOH D 4 .   ? 9.766   33.930  22.432  1.00 42.90 ? 978  HOH A O   1 
HETATM 3718 O  O   . HOH D 4 .   ? 10.397  33.283  26.086  1.00 31.58 ? 979  HOH A O   1 
HETATM 3719 O  O   . HOH D 4 .   ? -12.158 18.953  22.249  1.00 39.62 ? 980  HOH A O   1 
HETATM 3720 O  O   . HOH D 4 .   ? 18.779  31.286  9.673   1.00 33.72 ? 981  HOH A O   1 
HETATM 3721 O  O   . HOH D 4 .   ? 17.990  19.432  12.383  1.00 26.30 ? 982  HOH A O   1 
HETATM 3722 O  O   . HOH D 4 .   ? 22.367  -2.642  20.756  1.00 37.16 ? 983  HOH A O   1 
HETATM 3723 O  O   . HOH D 4 .   ? 20.344  5.324   32.346  1.00 26.74 ? 984  HOH A O   1 
HETATM 3724 O  O   . HOH D 4 .   ? 13.338  11.008  30.285  1.00 28.53 ? 985  HOH A O   1 
HETATM 3725 O  O   . HOH D 4 .   ? 11.794  10.219  35.078  1.00 37.08 ? 986  HOH A O   1 
HETATM 3726 O  O   . HOH D 4 .   ? 5.545   0.085   27.623  1.00 16.76 ? 987  HOH A O   1 
HETATM 3727 O  O   . HOH D 4 .   ? 14.108  -28.187 34.604  1.00 34.79 ? 988  HOH A O   1 
HETATM 3728 O  O   . HOH D 4 .   ? 14.937  -14.264 42.101  1.00 34.47 ? 989  HOH A O   1 
HETATM 3729 O  O   . HOH D 4 .   ? 21.224  -11.169 42.918  1.00 35.91 ? 990  HOH A O   1 
HETATM 3730 O  O   . HOH D 4 .   ? -12.244 27.579  14.398  1.00 37.13 ? 991  HOH A O   1 
HETATM 3731 O  O   . HOH D 4 .   ? 4.587   -18.081 36.504  1.00 37.94 ? 992  HOH A O   1 
HETATM 3732 O  O   . HOH D 4 .   ? 12.197  -21.333 38.576  1.00 40.07 ? 993  HOH A O   1 
HETATM 3733 O  O   . HOH D 4 .   ? 18.878  24.908  18.534  1.00 51.37 ? 994  HOH A O   1 
HETATM 3734 O  O   . HOH D 4 .   ? 8.519   3.722   9.578   1.00 39.31 ? 995  HOH A O   1 
HETATM 3735 O  O   . HOH D 4 .   ? 10.412  0.821   15.323  1.00 37.07 ? 996  HOH A O   1 
HETATM 3736 O  O   . HOH D 4 .   ? -6.888  18.019  7.627   1.00 26.88 ? 997  HOH A O   1 
HETATM 3737 O  O   . HOH D 4 .   ? -9.234  9.160   2.459   1.00 32.00 ? 998  HOH A O   1 
HETATM 3738 O  O   . HOH D 4 .   ? -9.250  17.044  15.320  1.00 37.32 ? 999  HOH A O   1 
HETATM 3739 O  O   . HOH D 4 .   ? 2.751   -0.600  13.960  1.00 38.20 ? 1000 HOH A O   1 
HETATM 3740 O  O   . HOH D 4 .   ? -1.899  0.934   3.336   1.00 32.49 ? 1001 HOH A O   1 
HETATM 3741 O  O   . HOH D 4 .   ? -4.096  -0.240  2.694   1.00 38.73 ? 1002 HOH A O   1 
HETATM 3742 O  O   . HOH D 4 .   ? 3.840   7.917   29.620  1.00 42.90 ? 1003 HOH A O   1 
HETATM 3743 O  O   . HOH D 4 .   ? 4.535   -0.856  38.262  1.00 30.91 ? 1004 HOH A O   1 
HETATM 3744 O  O   . HOH D 4 .   ? 7.465   -0.393  38.815  1.00 27.34 ? 1005 HOH A O   1 
HETATM 3745 O  O   . HOH D 4 .   ? -3.564  44.900  -9.967  1.00 35.11 ? 1006 HOH A O   1 
HETATM 3746 O  O   . HOH D 4 .   ? 7.180   46.283  17.984  1.00 41.97 ? 1007 HOH A O   1 
HETATM 3747 O  O   . HOH D 4 .   ? 16.160  -0.532  17.395  1.00 38.87 ? 1008 HOH A O   1 
HETATM 3748 O  O   . HOH D 4 .   ? 13.068  -2.681  20.017  1.00 31.35 ? 1009 HOH A O   1 
HETATM 3749 O  O   . HOH D 4 .   ? 12.682  -25.461 28.881  1.00 36.13 ? 1010 HOH A O   1 
HETATM 3750 O  O   . HOH D 4 .   ? 23.748  -11.510 41.619  1.00 30.93 ? 1011 HOH A O   1 
HETATM 3751 O  O   . HOH D 4 .   ? 8.553   37.844  -2.007  1.00 31.07 ? 1012 HOH A O   1 
HETATM 3752 O  O   . HOH D 4 .   ? 4.591   44.631  -3.856  1.00 27.45 ? 1013 HOH A O   1 
HETATM 3753 O  O   . HOH D 4 .   ? 1.149   48.115  -3.643  1.00 34.20 ? 1014 HOH A O   1 
HETATM 3754 O  O   . HOH D 4 .   ? 3.921   34.988  28.454  1.00 31.31 ? 1015 HOH A O   1 
HETATM 3755 O  O   . HOH D 4 .   ? 14.779  16.197  25.579  1.00 28.52 ? 1016 HOH A O   1 
HETATM 3756 O  O   . HOH D 4 .   ? 16.974  20.375  25.058  1.00 41.49 ? 1017 HOH A O   1 
HETATM 3757 O  O   . HOH D 4 .   ? -8.460  16.951  29.249  1.00 44.37 ? 1018 HOH A O   1 
HETATM 3758 O  O   . HOH D 4 .   ? 1.070   23.987  32.382  1.00 46.16 ? 1019 HOH A O   1 
HETATM 3759 O  O   . HOH D 4 .   ? 5.977   42.555  22.494  1.00 33.66 ? 1020 HOH A O   1 
HETATM 3760 O  O   . HOH D 4 .   ? 1.203   6.498   1.198   1.00 39.40 ? 1021 HOH A O   1 
HETATM 3761 O  O   . HOH D 4 .   ? 14.970  3.785   5.523   1.00 44.41 ? 1022 HOH A O   1 
HETATM 3762 O  O   . HOH D 4 .   ? 1.100   0.408   10.348  1.00 37.59 ? 1023 HOH A O   1 
HETATM 3763 O  O   . HOH D 4 .   ? 13.788  -1.995  14.075  1.00 44.99 ? 1024 HOH A O   1 
HETATM 3764 O  O   . HOH D 4 .   ? -13.112 19.652  3.759   1.00 34.83 ? 1025 HOH A O   1 
HETATM 3765 O  O   . HOH D 4 .   ? 2.917   6.897   25.863  1.00 26.18 ? 1026 HOH A O   1 
HETATM 3766 O  O   . HOH D 4 .   ? 5.853   8.244   33.812  1.00 31.87 ? 1027 HOH A O   1 
HETATM 3767 O  O   . HOH D 4 .   ? 6.456   -4.576  21.552  1.00 32.41 ? 1028 HOH A O   1 
HETATM 3768 O  O   . HOH D 4 .   ? 8.041   -2.421  19.994  1.00 33.86 ? 1029 HOH A O   1 
HETATM 3769 O  O   . HOH D 4 .   ? 17.303  1.554   42.865  1.00 43.56 ? 1030 HOH A O   1 
HETATM 3770 O  O   . HOH D 4 .   ? -12.743 30.610  -11.823 1.00 20.00 ? 1031 HOH A O   1 
HETATM 3771 O  O   . HOH D 4 .   ? -11.533 26.221  -7.866  1.00 20.00 ? 1032 HOH A O   1 
HETATM 3772 O  O   . HOH D 4 .   ? -11.383 27.228  10.995  1.00 20.00 ? 1033 HOH A O   1 
HETATM 3773 O  O   . HOH D 4 .   ? -9.014  45.849  3.206   1.00 20.00 ? 1034 HOH A O   1 
HETATM 3774 O  O   . HOH D 4 .   ? -12.452 40.962  2.327   1.00 20.00 ? 1035 HOH A O   1 
HETATM 3775 O  O   . HOH D 4 .   ? -0.513  46.189  8.850   1.00 20.00 ? 1036 HOH A O   1 
HETATM 3776 O  O   . HOH D 4 .   ? 4.974   37.228  26.763  1.00 20.00 ? 1037 HOH A O   1 
HETATM 3777 O  O   . HOH D 4 .   ? 0.553   54.747  7.702   1.00 20.00 ? 1038 HOH A O   1 
HETATM 3778 O  O   . HOH D 4 .   ? 3.284   49.551  9.610   1.00 20.00 ? 1039 HOH A O   1 
HETATM 3779 O  O   . HOH D 4 .   ? 6.586   46.801  9.817   1.00 20.00 ? 1040 HOH A O   1 
HETATM 3780 O  O   . HOH D 4 .   ? 4.836   43.753  6.203   1.00 20.00 ? 1041 HOH A O   1 
HETATM 3781 O  O   . HOH D 4 .   ? 18.751  25.127  5.106   1.00 20.00 ? 1042 HOH A O   1 
HETATM 3782 O  O   . HOH D 4 .   ? 19.873  14.211  28.295  1.00 20.00 ? 1043 HOH A O   1 
HETATM 3783 O  O   . HOH D 4 .   ? 25.770  -22.980 25.777  1.00 20.00 ? 1044 HOH A O   1 
HETATM 3784 O  O   . HOH D 4 .   ? 23.084  -19.084 37.617  1.00 20.00 ? 1045 HOH A O   1 
HETATM 3785 O  O   . HOH D 4 .   ? 25.346  -16.705 21.591  1.00 20.00 ? 1046 HOH A O   1 
HETATM 3786 O  O   . HOH D 4 .   ? 17.292  7.341   36.877  1.00 20.00 ? 1047 HOH A O   1 
HETATM 3787 O  O   . HOH D 4 .   ? 20.366  -19.513 43.319  1.00 20.00 ? 1048 HOH A O   1 
HETATM 3788 O  O   . HOH D 4 .   ? 24.133  15.453  13.329  1.00 20.00 ? 1049 HOH A O   1 
HETATM 3789 O  O   . HOH D 4 .   ? -6.156  5.472   5.421   1.00 20.00 ? 1050 HOH A O   1 
HETATM 3790 O  O   . HOH D 4 .   ? -5.003  5.191   7.556   1.00 20.00 ? 1051 HOH A O   1 
HETATM 3791 O  O   . HOH D 4 .   ? 14.466  20.805  -8.615  1.00 20.00 ? 1052 HOH A O   1 
HETATM 3792 O  O   . HOH D 4 .   ? 9.192   43.216  11.974  1.00 20.00 ? 1053 HOH A O   1 
HETATM 3793 O  O   . HOH D 4 .   ? 2.886   30.486  29.744  1.00 20.00 ? 1054 HOH A O   1 
HETATM 3794 O  O   . HOH D 4 .   ? -4.700  36.204  27.729  1.00 20.00 ? 1055 HOH A O   1 
HETATM 3795 O  O   . HOH D 4 .   ? -8.366  12.927  1.581   1.00 20.00 ? 1056 HOH A O   1 
HETATM 3796 O  O   . HOH D 4 .   ? 26.378  7.422   27.739  1.00 20.00 ? 1057 HOH A O   1 
HETATM 3797 O  O   . HOH D 4 .   ? 10.402  -0.573  20.326  1.00 20.00 ? 1058 HOH A O   1 
HETATM 3798 O  O   . HOH D 4 .   ? 19.786  -6.157  44.937  1.00 20.00 ? 1059 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   CYS 4   4   4   CYS CYS A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  CYS 10  10  10  CYS CYS A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  TRP 17  17  17  TRP TRP A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  TRP 30  30  30  TRP TRP A . n 
A 1 31  SER 31  30  30  SER SER A A n 
A 1 32  PRO 32  31  31  PRO PRO A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  ARG 34  33  33  ARG ARG A . n 
A 1 35  ILE 35  34  34  ILE ILE A . n 
A 1 36  GLY 36  35  35  GLY GLY A . n 
A 1 37  THR 37  36  36  THR THR A . n 
A 1 38  ARG 38  37  37  ARG ARG A . n 
A 1 39  PHE 39  38  38  PHE PHE A . n 
A 1 40  LEU 40  39  39  LEU LEU A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  TYR 42  41  41  TYR TYR A . n 
A 1 43  THR 43  42  42  THR THR A . n 
A 1 44  ASN 44  43  43  ASN ASN A . n 
A 1 45  LYS 45  44  44  LYS LYS A . n 
A 1 46  ASN 46  45  45  ASN ASN A . n 
A 1 47  PRO 47  46  46  PRO PRO A . n 
A 1 48  ASN 48  47  47  ASN ASN A . n 
A 1 49  ASN 49  48  48  ASN ASN A . n 
A 1 50  PHE 50  49  49  PHE PHE A . n 
A 1 51  GLN 51  50  50  GLN GLN A . n 
A 1 52  THR 52  51  51  THR THR A . n 
A 1 53  LEU 53  52  52  LEU LEU A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  SER 56  700 700 SER SER A . n 
A 1 57  ASP 57  55  55  ASP ASP A . n 
A 1 58  PRO 58  56  56  PRO PRO A . n 
A 1 59  SER 59  57  57  SER SER A . n 
A 1 60  THR 60  58  58  THR THR A . n 
A 1 61  ILE 61  59  59  ILE ILE A . n 
A 1 62  GLY 62  60  60  GLY GLY A . n 
A 1 63  ALA 63  61  61  ALA ALA A . n 
A 1 64  SER 64  62  62  SER SER A . n 
A 1 65  ASN 65  63  63  ASN ASN A . n 
A 1 66  PHE 66  64  64  PHE PHE A . n 
A 1 67  GLN 67  65  65  GLN GLN A . n 
A 1 68  THR 68  66  66  THR THR A . n 
A 1 69  ASP 69  67  67  ASP ASP A . n 
A 1 70  LYS 70  68  68  LYS LYS A . n 
A 1 71  LYS 71  69  69  LYS LYS A . n 
A 1 72  THR 72  70  70  THR THR A . n 
A 1 73  ARG 73  71  71  ARG ARG A . n 
A 1 74  PHE 74  72  72  PHE PHE A . n 
A 1 75  ILE 75  73  73  ILE ILE A . n 
A 1 76  ILE 76  74  74  ILE ILE A . n 
A 1 77  HIS 77  75  75  HIS HIS A . n 
A 1 78  GLY 78  76  76  GLY GLY A . n 
A 1 79  PHE 79  77  77  PHE PHE A . n 
A 1 80  ILE 80  78  78  ILE ILE A . n 
A 1 81  ASP 81  79  79  ASP ASP A . n 
A 1 82  LYS 82  80  80  LYS LYS A . n 
A 1 83  GLY 83  81  81  GLY GLY A . n 
A 1 84  GLU 84  82  82  GLU GLU A . n 
A 1 85  GLU 85  83  83  GLU GLU A . n 
A 1 86  ASN 86  84  84  ASN ASN A . n 
A 1 87  TRP 87  85  85  TRP TRP A . n 
A 1 88  LEU 88  86  86  LEU LEU A . n 
A 1 89  LEU 89  87  87  LEU LEU A . n 
A 1 90  ASP 90  88  88  ASP ASP A . n 
A 1 91  MET 91  89  89  MET MET A . n 
A 1 92  CYS 92  90  90  CYS CYS A . n 
A 1 93  LYS 93  91  91  LYS LYS A . n 
A 1 94  ASN 94  92  92  ASN ASN A . n 
A 1 95  MET 95  93  93  MET MET A . n 
A 1 96  PHE 96  94  94  PHE PHE A . n 
A 1 97  LYS 97  95  95  LYS LYS A . n 
A 1 98  VAL 98  96  96  VAL VAL A . n 
A 1 99  GLU 99  97  97  GLU GLU A . n 
A 1 100 GLU 100 98  98  GLU GLU A . n 
A 1 101 VAL 101 99  99  VAL VAL A . n 
A 1 102 ASN 102 100 100 ASN ASN A . n 
A 1 103 CYS 103 101 101 CYS CYS A . n 
A 1 104 ILE 104 102 102 ILE ILE A . n 
A 1 105 CYS 105 103 103 CYS CYS A . n 
A 1 106 VAL 106 104 104 VAL VAL A . n 
A 1 107 ASP 107 105 105 ASP ASP A . n 
A 1 108 TRP 108 106 106 TRP TRP A . n 
A 1 109 LYS 109 107 107 LYS LYS A . n 
A 1 110 LYS 110 108 108 LYS LYS A . n 
A 1 111 GLY 111 109 109 GLY GLY A . n 
A 1 112 SER 112 110 110 SER SER A . n 
A 1 113 GLN 113 111 111 GLN GLN A . n 
A 1 114 THR 114 112 112 THR THR A . n 
A 1 115 SER 115 113 113 SER SER A . n 
A 1 116 TYR 116 114 114 TYR TYR A . n 
A 1 117 THR 117 115 115 THR THR A . n 
A 1 118 GLN 118 116 116 GLN GLN A . n 
A 1 119 ALA 119 117 117 ALA ALA A . n 
A 1 120 ALA 120 118 118 ALA ALA A . n 
A 1 121 ASN 121 119 119 ASN ASN A . n 
A 1 122 ASN 122 120 120 ASN ASN A . n 
A 1 123 VAL 123 121 121 VAL VAL A . n 
A 1 124 ARG 124 122 122 ARG ARG A . n 
A 1 125 VAL 125 123 123 VAL VAL A . n 
A 1 126 VAL 126 124 124 VAL VAL A . n 
A 1 127 GLY 127 125 125 GLY GLY A . n 
A 1 128 ALA 128 126 126 ALA ALA A . n 
A 1 129 GLN 129 127 127 GLN GLN A . n 
A 1 130 VAL 130 128 128 VAL VAL A . n 
A 1 131 ALA 131 129 129 ALA ALA A . n 
A 1 132 GLN 132 130 130 GLN GLN A . n 
A 1 133 MET 133 131 131 MET MET A . n 
A 1 134 LEU 134 132 132 LEU LEU A . n 
A 1 135 SER 135 133 133 SER SER A . n 
A 1 136 MET 136 134 134 MET MET A . n 
A 1 137 LEU 137 135 135 LEU LEU A . n 
A 1 138 SER 138 136 136 SER SER A . n 
A 1 139 ALA 139 137 137 ALA ALA A . n 
A 1 140 ASN 140 138 138 ASN ASN A . n 
A 1 141 TYR 141 139 139 TYR TYR A . n 
A 1 142 SER 142 140 140 SER SER A . n 
A 1 143 TYR 143 141 141 TYR TYR A . n 
A 1 144 SER 144 142 142 SER SER A . n 
A 1 145 PRO 145 143 143 PRO PRO A . n 
A 1 146 SER 146 144 144 SER SER A . n 
A 1 147 GLN 147 145 145 GLN GLN A . n 
A 1 148 VAL 148 146 146 VAL VAL A . n 
A 1 149 GLN 149 147 147 GLN GLN A . n 
A 1 150 LEU 150 148 148 LEU LEU A . n 
A 1 151 ILE 151 149 149 ILE ILE A . n 
A 1 152 GLY 152 150 150 GLY GLY A . n 
A 1 153 HIS 153 151 151 HIS HIS A . n 
A 1 154 SER 154 152 152 SER SER A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 GLY 156 154 154 GLY GLY A . n 
A 1 157 ALA 157 155 155 ALA ALA A . n 
A 1 158 HIS 158 156 156 HIS HIS A . n 
A 1 159 VAL 159 157 157 VAL VAL A . n 
A 1 160 ALA 160 158 158 ALA ALA A . n 
A 1 161 GLY 161 159 159 GLY GLY A . n 
A 1 162 GLU 162 160 160 GLU GLU A . n 
A 1 163 ALA 163 161 161 ALA ALA A . n 
A 1 164 GLY 164 162 162 GLY GLY A . n 
A 1 165 SER 165 163 163 SER SER A . n 
A 1 166 ARG 166 164 164 ARG ARG A . n 
A 1 167 THR 167 165 165 THR THR A . n 
A 1 168 PRO 168 166 166 PRO PRO A . n 
A 1 169 GLY 169 168 168 GLY GLY A . n 
A 1 170 LEU 170 169 169 LEU LEU A . n 
A 1 171 GLY 171 170 170 GLY GLY A . n 
A 1 172 ARG 172 171 171 ARG ARG A . n 
A 1 173 ILE 173 172 172 ILE ILE A . n 
A 1 174 THR 174 173 173 THR THR A . n 
A 1 175 GLY 175 174 174 GLY GLY A . n 
A 1 176 LEU 176 175 175 LEU LEU A . n 
A 1 177 ASP 177 176 176 ASP ASP A . n 
A 1 178 PRO 178 177 177 PRO PRO A . n 
A 1 179 VAL 179 178 178 VAL VAL A . n 
A 1 180 GLU 180 179 179 GLU GLU A . n 
A 1 181 ALA 181 180 180 ALA ALA A . n 
A 1 182 SER 182 181 181 SER SER A . n 
A 1 183 PHE 183 182 182 PHE PHE A . n 
A 1 184 GLN 184 183 183 GLN GLN A . n 
A 1 185 GLY 185 184 184 GLY GLY A . n 
A 1 186 THR 186 185 185 THR THR A . n 
A 1 187 PRO 187 186 186 PRO PRO A . n 
A 1 188 GLU 188 187 187 GLU GLU A . n 
A 1 189 GLU 189 188 188 GLU GLU A . n 
A 1 190 VAL 190 189 189 VAL VAL A . n 
A 1 191 ARG 191 190 190 ARG ARG A . n 
A 1 192 LEU 192 191 191 LEU LEU A . n 
A 1 193 ASP 193 192 192 ASP ASP A . n 
A 1 194 PRO 194 193 193 PRO PRO A . n 
A 1 195 THR 195 194 194 THR THR A . n 
A 1 196 ASP 196 195 195 ASP ASP A . n 
A 1 197 ALA 197 196 196 ALA ALA A . n 
A 1 198 ASP 198 197 197 ASP ASP A . n 
A 1 199 PHE 199 198 198 PHE PHE A . n 
A 1 200 VAL 200 199 199 VAL VAL A . n 
A 1 201 ASP 201 200 200 ASP ASP A . n 
A 1 202 VAL 202 201 201 VAL VAL A . n 
A 1 203 ILE 203 202 202 ILE ILE A . n 
A 1 204 HIS 204 203 203 HIS HIS A . n 
A 1 205 THR 205 204 204 THR THR A . n 
A 1 206 ASP 206 205 205 ASP ASP A . n 
A 1 207 ALA 207 206 206 ALA ALA A . n 
A 1 208 ALA 208 207 207 ALA ALA A . n 
A 1 209 PRO 209 208 208 PRO PRO A . n 
A 1 210 LEU 210 209 209 LEU LEU A . n 
A 1 211 ILE 211 210 210 ILE ILE A . n 
A 1 212 PRO 212 211 211 PRO PRO A . n 
A 1 213 PHE 213 212 212 PHE PHE A . n 
A 1 214 LEU 214 213 213 LEU LEU A . n 
A 1 215 GLY 215 214 214 GLY GLY A . n 
A 1 216 PHE 216 215 215 PHE PHE A . n 
A 1 217 GLY 217 216 216 GLY GLY A . n 
A 1 218 THR 218 217 217 THR THR A . n 
A 1 219 SER 219 218 218 SER SER A . n 
A 1 220 GLN 220 219 219 GLN GLN A . n 
A 1 221 GLN 221 220 220 GLN GLN A . n 
A 1 222 MET 222 221 221 MET MET A . n 
A 1 223 GLY 223 222 222 GLY GLY A . n 
A 1 224 HIS 224 223 223 HIS HIS A . n 
A 1 225 LEU 225 224 224 LEU LEU A . n 
A 1 226 ASP 226 225 225 ASP ASP A . n 
A 1 227 PHE 227 226 226 PHE PHE A . n 
A 1 228 PHE 228 227 227 PHE PHE A . n 
A 1 229 PRO 229 228 228 PRO PRO A . n 
A 1 230 ASN 230 229 229 ASN ASN A . n 
A 1 231 GLY 231 230 230 GLY GLY A . n 
A 1 232 GLY 232 231 231 GLY GLY A . n 
A 1 233 GLU 233 232 232 GLU GLU A . n 
A 1 234 GLU 234 233 233 GLU GLU A . n 
A 1 235 MET 235 234 234 MET MET A . n 
A 1 236 PRO 236 235 235 PRO PRO A . n 
A 1 237 GLY 237 236 236 GLY GLY A . n 
A 1 238 CYS 238 237 237 CYS CYS A . n 
A 1 239 LYS 239 238 238 LYS LYS A . n 
A 1 240 LYS 240 239 239 LYS LYS A . n 
A 1 241 ASN 241 240 240 ASN ASN A . n 
A 1 242 ALA 242 241 241 ALA ALA A . n 
A 1 243 LEU 243 242 242 LEU LEU A . n 
A 1 244 SER 244 243 243 SER SER A . n 
A 1 245 GLN 245 244 244 GLN GLN A . n 
A 1 246 ILE 246 245 245 ILE ILE A . n 
A 1 247 VAL 247 246 246 VAL VAL A . n 
A 1 248 ASP 248 247 247 ASP ASP A . n 
A 1 249 LEU 249 248 248 LEU LEU A . n 
A 1 250 ASP 250 249 249 ASP ASP A . n 
A 1 251 GLY 251 250 250 GLY GLY A . n 
A 1 252 ILE 252 251 251 ILE ILE A . n 
A 1 253 TRP 253 252 252 TRP TRP A . n 
A 1 254 GLU 254 253 253 GLU GLU A . n 
A 1 255 GLY 255 254 254 GLY GLY A . n 
A 1 256 THR 256 255 255 THR THR A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 ASP 258 257 257 ASP ASP A . n 
A 1 259 PHE 259 258 258 PHE PHE A . n 
A 1 260 VAL 260 259 259 VAL VAL A . n 
A 1 261 ALA 261 260 260 ALA ALA A . n 
A 1 262 CYS 262 261 261 CYS CYS A . n 
A 1 263 ASN 263 262 262 ASN ASN A . n 
A 1 264 HIS 264 263 263 HIS HIS A . n 
A 1 265 LEU 265 264 264 LEU LEU A . n 
A 1 266 ARG 266 265 265 ARG ARG A . n 
A 1 267 SER 267 266 266 SER SER A . n 
A 1 268 TYR 268 267 267 TYR TYR A . n 
A 1 269 LYS 269 268 268 LYS LYS A . n 
A 1 270 TYR 270 269 269 TYR TYR A . n 
A 1 271 TYR 271 270 270 TYR TYR A . n 
A 1 272 SER 272 271 271 SER SER A . n 
A 1 273 GLU 273 272 272 GLU GLU A . n 
A 1 274 SER 274 273 273 SER SER A . n 
A 1 275 ILE 275 274 274 ILE ILE A . n 
A 1 276 LEU 276 275 275 LEU LEU A . n 
A 1 277 ASN 277 276 276 ASN ASN A . n 
A 1 278 PRO 278 277 277 PRO PRO A . n 
A 1 279 ASP 279 278 278 ASP ASP A . n 
A 1 280 GLY 280 279 279 GLY GLY A . n 
A 1 281 PHE 281 280 280 PHE PHE A . n 
A 1 282 ALA 282 281 281 ALA ALA A . n 
A 1 283 SER 283 282 282 SER SER A . n 
A 1 284 TYR 284 283 283 TYR TYR A . n 
A 1 285 PRO 285 284 284 PRO PRO A . n 
A 1 286 CYS 286 285 285 CYS CYS A . n 
A 1 287 ALA 287 286 286 ALA ALA A . n 
A 1 288 SER 288 287 287 SER SER A . n 
A 1 289 TYR 289 288 288 TYR TYR A . n 
A 1 290 ARG 290 289 289 ARG ARG A . n 
A 1 291 ALA 291 290 290 ALA ALA A . n 
A 1 292 PHE 292 291 291 PHE PHE A . n 
A 1 293 GLU 293 292 292 GLU GLU A . n 
A 1 294 SER 294 293 293 SER SER A . n 
A 1 295 ASN 295 294 294 ASN ASN A . n 
A 1 296 LYS 296 295 295 LYS LYS A . n 
A 1 297 CYS 297 296 296 CYS CYS A . n 
A 1 298 PHE 298 297 297 PHE PHE A . n 
A 1 299 PRO 299 298 298 PRO PRO A . n 
A 1 300 CYS 300 299 299 CYS CYS A . n 
A 1 301 PRO 301 300 300 PRO PRO A . n 
A 1 302 ASP 302 301 301 ASP ASP A . n 
A 1 303 GLN 303 302 302 GLN GLN A . n 
A 1 304 GLY 304 303 303 GLY GLY A . n 
A 1 305 CYS 305 304 304 CYS CYS A . n 
A 1 306 PRO 306 305 305 PRO PRO A . n 
A 1 307 GLN 307 306 306 GLN GLN A . n 
A 1 308 MET 308 307 307 MET MET A . n 
A 1 309 GLY 309 308 308 GLY GLY A . n 
A 1 310 HIS 310 309 309 HIS HIS A . n 
A 1 311 TYR 311 310 310 TYR TYR A . n 
A 1 312 ALA 312 311 311 ALA ALA A . n 
A 1 313 ASP 313 312 312 ASP ASP A . n 
A 1 314 LYS 314 313 313 LYS LYS A . n 
A 1 315 PHE 315 314 314 PHE PHE A . n 
A 1 316 ALA 316 315 315 ALA ALA A . n 
A 1 317 VAL 317 316 ?   ?   ?   A . n 
A 1 318 LYS 318 317 ?   ?   ?   A . n 
A 1 319 THR 319 318 ?   ?   ?   A . n 
A 1 320 SER 320 319 ?   ?   ?   A . n 
A 1 321 ASP 321 320 ?   ?   ?   A . n 
A 1 322 GLU 322 321 ?   ?   ?   A . n 
A 1 323 THR 323 322 ?   ?   ?   A . n 
A 1 324 GLN 324 323 323 GLN GLN A . n 
A 1 325 LYS 325 324 324 LYS LYS A . n 
A 1 326 TYR 326 325 325 TYR TYR A . n 
A 1 327 PHE 327 326 326 PHE PHE A . n 
A 1 328 LEU 328 327 327 LEU LEU A . n 
A 1 329 ASN 329 328 328 ASN ASN A . n 
A 1 330 THR 330 329 329 THR THR A . n 
A 1 331 GLY 331 330 330 GLY GLY A . n 
A 1 332 ASP 332 331 331 ASP ASP A . n 
A 1 333 SER 333 332 332 SER SER A . n 
A 1 334 SER 334 333 333 SER SER A . n 
A 1 335 ASN 335 334 334 ASN ASN A . n 
A 1 336 PHE 336 335 335 PHE PHE A . n 
A 1 337 ALA 337 336 336 ALA ALA A . n 
A 1 338 ARG 338 337 337 ARG ARG A . n 
A 1 339 TRP 339 338 338 TRP TRP A . n 
A 1 340 ARG 340 339 339 ARG ARG A . n 
A 1 341 TYR 341 340 340 TYR TYR A . n 
A 1 342 GLY 342 341 341 GLY GLY A . n 
A 1 343 VAL 343 342 342 VAL VAL A . n 
A 1 344 SER 344 343 343 SER SER A . n 
A 1 345 ILE 345 344 344 ILE ILE A . n 
A 1 346 THR 346 345 345 THR THR A . n 
A 1 347 LEU 347 346 346 LEU LEU A . n 
A 1 348 SER 348 347 347 SER SER A . n 
A 1 349 GLY 349 348 348 GLY GLY A . n 
A 1 350 LYS 350 349 349 LYS LYS A . n 
A 1 351 ARG 351 350 350 ARG ARG A . n 
A 1 352 ALA 352 351 351 ALA ALA A . n 
A 1 353 THR 353 352 352 THR THR A . n 
A 1 354 GLY 354 353 353 GLY GLY A . n 
A 1 355 GLN 355 354 354 GLN GLN A . n 
A 1 356 ALA 356 355 355 ALA ALA A . n 
A 1 357 LYS 357 356 356 LYS LYS A . n 
A 1 358 VAL 358 357 357 VAL VAL A . n 
A 1 359 ALA 359 358 358 ALA ALA A . n 
A 1 360 LEU 360 359 359 LEU LEU A . n 
A 1 361 PHE 361 360 360 PHE PHE A . n 
A 1 362 GLY 362 361 361 GLY GLY A . n 
A 1 363 SER 363 362 362 SER SER A . n 
A 1 364 LYS 364 363 363 LYS LYS A . n 
A 1 365 GLY 365 364 364 GLY GLY A . n 
A 1 366 ASN 366 365 365 ASN ASN A . n 
A 1 367 THR 367 366 366 THR THR A . n 
A 1 368 HIS 368 367 367 HIS HIS A . n 
A 1 369 GLN 369 368 368 GLN GLN A . n 
A 1 370 PHE 370 369 369 PHE PHE A . n 
A 1 371 ASN 371 370 370 ASN ASN A . n 
A 1 372 ILE 372 371 371 ILE ILE A . n 
A 1 373 PHE 373 372 372 PHE PHE A . n 
A 1 374 LYS 374 373 373 LYS LYS A . n 
A 1 375 GLY 375 374 374 GLY GLY A . n 
A 1 376 ILE 376 375 375 ILE ILE A . n 
A 1 377 LEU 377 376 376 LEU LEU A . n 
A 1 378 LYS 378 377 377 LYS LYS A . n 
A 1 379 PRO 379 378 378 PRO PRO A . n 
A 1 380 GLY 380 379 379 GLY GLY A . n 
A 1 381 SER 381 380 380 SER SER A . n 
A 1 382 THR 382 381 381 THR THR A . n 
A 1 383 HIS 383 382 382 HIS HIS A . n 
A 1 384 SER 384 383 383 SER SER A . n 
A 1 385 ASN 385 384 384 ASN ASN A . n 
A 1 386 GLU 386 385 385 GLU GLU A . n 
A 1 387 PHE 387 386 386 PHE PHE A . n 
A 1 388 ASP 388 387 387 ASP ASP A . n 
A 1 389 ALA 389 388 388 ALA ALA A . n 
A 1 390 LYS 390 389 389 LYS LYS A . n 
A 1 391 LEU 391 390 390 LEU LEU A . n 
A 1 392 ASP 392 391 391 ASP ASP A . n 
A 1 393 VAL 393 392 392 VAL VAL A . n 
A 1 394 GLY 394 393 393 GLY GLY A . n 
A 1 395 THR 395 394 394 THR THR A . n 
A 1 396 ILE 396 395 395 ILE ILE A . n 
A 1 397 GLU 397 396 396 GLU GLU A . n 
A 1 398 LYS 398 397 397 LYS LYS A . n 
A 1 399 VAL 399 398 398 VAL VAL A . n 
A 1 400 LYS 400 399 399 LYS LYS A . n 
A 1 401 PHE 401 400 400 PHE PHE A . n 
A 1 402 LEU 402 401 401 LEU LEU A . n 
A 1 403 TRP 403 402 402 TRP TRP A . n 
A 1 404 ASN 404 403 403 ASN ASN A . n 
A 1 405 ASN 405 404 404 ASN ASN A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 ?   ?   ?   A . n 
A 1 408 VAL 408 408 ?   ?   ?   A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 PHE 412 412 412 PHE PHE A . n 
A 1 413 PRO 413 413 413 PRO PRO A . n 
A 1 414 LYS 414 414 414 LYS LYS A . n 
A 1 415 VAL 415 415 415 VAL VAL A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ALA 417 417 417 ALA ALA A . n 
A 1 418 ALA 418 418 418 ALA ALA A . n 
A 1 419 LYS 419 419 419 LYS LYS A . n 
A 1 420 ILE 420 420 420 ILE ILE A . n 
A 1 421 THR 421 421 421 THR THR A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 GLN 423 423 423 GLN GLN A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 GLY 425 425 425 GLY GLY A . n 
A 1 426 GLU 426 426 426 GLU GLU A . n 
A 1 427 GLU 427 427 427 GLU GLU A . n 
A 1 428 LYS 428 428 428 LYS LYS A . n 
A 1 429 THR 429 429 429 THR THR A . n 
A 1 430 VAL 430 430 430 VAL VAL A . n 
A 1 431 HIS 431 701 701 HIS HIS A . n 
A 1 432 SER 432 431 431 SER SER A . n 
A 1 433 PHE 433 432 432 PHE PHE A . n 
A 1 434 CYS 434 433 433 CYS CYS A . n 
A 1 435 SER 435 434 434 SER SER A . n 
A 1 436 GLU 436 435 435 GLU GLU A . n 
A 1 437 SER 437 436 436 SER SER A . n 
A 1 438 THR 438 437 437 THR THR A . n 
A 1 439 VAL 439 438 438 VAL VAL A . n 
A 1 440 ARG 440 439 439 ARG ARG A . n 
A 1 441 GLU 441 440 440 GLU GLU A . n 
A 1 442 ASP 442 441 441 ASP ASP A . n 
A 1 443 VAL 443 442 442 VAL VAL A . n 
A 1 444 LEU 444 443 443 LEU LEU A . n 
A 1 445 LEU 445 444 444 LEU LEU A . n 
A 1 446 THR 446 445 445 THR THR A . n 
A 1 447 LEU 447 446 446 LEU LEU A . n 
A 1 448 THR 448 447 447 THR THR A . n 
A 1 449 PRO 449 448 448 PRO PRO A . n 
A 1 450 CYS 450 449 449 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   500  500 NAG NAG A . 
C 3 CA  1   501  501 CA  CA  A . 
D 4 HOH 1   702  1   HOH HOH A . 
D 4 HOH 2   703  2   HOH HOH A . 
D 4 HOH 3   704  3   HOH HOH A . 
D 4 HOH 4   705  4   HOH HOH A . 
D 4 HOH 5   706  5   HOH HOH A . 
D 4 HOH 6   707  6   HOH HOH A . 
D 4 HOH 7   708  7   HOH HOH A . 
D 4 HOH 8   709  8   HOH HOH A . 
D 4 HOH 9   710  9   HOH HOH A . 
D 4 HOH 10  711  10  HOH HOH A . 
D 4 HOH 11  712  11  HOH HOH A . 
D 4 HOH 12  713  12  HOH HOH A . 
D 4 HOH 13  714  13  HOH HOH A . 
D 4 HOH 14  715  14  HOH HOH A . 
D 4 HOH 15  716  15  HOH HOH A . 
D 4 HOH 16  717  16  HOH HOH A . 
D 4 HOH 17  718  17  HOH HOH A . 
D 4 HOH 18  719  18  HOH HOH A . 
D 4 HOH 19  720  19  HOH HOH A . 
D 4 HOH 20  721  20  HOH HOH A . 
D 4 HOH 21  722  21  HOH HOH A . 
D 4 HOH 22  723  22  HOH HOH A . 
D 4 HOH 23  724  23  HOH HOH A . 
D 4 HOH 24  725  24  HOH HOH A . 
D 4 HOH 25  726  25  HOH HOH A . 
D 4 HOH 26  727  26  HOH HOH A . 
D 4 HOH 27  728  27  HOH HOH A . 
D 4 HOH 28  729  28  HOH HOH A . 
D 4 HOH 29  730  29  HOH HOH A . 
D 4 HOH 30  731  30  HOH HOH A . 
D 4 HOH 31  732  31  HOH HOH A . 
D 4 HOH 32  733  32  HOH HOH A . 
D 4 HOH 33  734  33  HOH HOH A . 
D 4 HOH 34  735  34  HOH HOH A . 
D 4 HOH 35  736  35  HOH HOH A . 
D 4 HOH 36  737  36  HOH HOH A . 
D 4 HOH 37  738  37  HOH HOH A . 
D 4 HOH 38  739  38  HOH HOH A . 
D 4 HOH 39  740  39  HOH HOH A . 
D 4 HOH 40  741  40  HOH HOH A . 
D 4 HOH 41  742  41  HOH HOH A . 
D 4 HOH 42  743  42  HOH HOH A . 
D 4 HOH 43  744  43  HOH HOH A . 
D 4 HOH 44  745  44  HOH HOH A . 
D 4 HOH 45  746  45  HOH HOH A . 
D 4 HOH 46  747  46  HOH HOH A . 
D 4 HOH 47  748  47  HOH HOH A . 
D 4 HOH 48  749  48  HOH HOH A . 
D 4 HOH 49  750  49  HOH HOH A . 
D 4 HOH 50  751  50  HOH HOH A . 
D 4 HOH 51  752  51  HOH HOH A . 
D 4 HOH 52  753  52  HOH HOH A . 
D 4 HOH 53  754  53  HOH HOH A . 
D 4 HOH 54  755  54  HOH HOH A . 
D 4 HOH 55  756  55  HOH HOH A . 
D 4 HOH 56  757  56  HOH HOH A . 
D 4 HOH 57  758  57  HOH HOH A . 
D 4 HOH 58  759  58  HOH HOH A . 
D 4 HOH 59  760  59  HOH HOH A . 
D 4 HOH 60  761  60  HOH HOH A . 
D 4 HOH 61  762  61  HOH HOH A . 
D 4 HOH 62  763  62  HOH HOH A . 
D 4 HOH 63  764  63  HOH HOH A . 
D 4 HOH 64  765  64  HOH HOH A . 
D 4 HOH 65  766  65  HOH HOH A . 
D 4 HOH 66  767  66  HOH HOH A . 
D 4 HOH 67  768  67  HOH HOH A . 
D 4 HOH 68  769  68  HOH HOH A . 
D 4 HOH 69  770  69  HOH HOH A . 
D 4 HOH 70  771  70  HOH HOH A . 
D 4 HOH 71  772  71  HOH HOH A . 
D 4 HOH 72  773  72  HOH HOH A . 
D 4 HOH 73  774  73  HOH HOH A . 
D 4 HOH 74  775  74  HOH HOH A . 
D 4 HOH 75  776  75  HOH HOH A . 
D 4 HOH 76  777  76  HOH HOH A . 
D 4 HOH 77  778  77  HOH HOH A . 
D 4 HOH 78  779  78  HOH HOH A . 
D 4 HOH 79  780  79  HOH HOH A . 
D 4 HOH 80  781  80  HOH HOH A . 
D 4 HOH 81  782  81  HOH HOH A . 
D 4 HOH 82  783  82  HOH HOH A . 
D 4 HOH 83  784  83  HOH HOH A . 
D 4 HOH 84  785  84  HOH HOH A . 
D 4 HOH 85  786  85  HOH HOH A . 
D 4 HOH 86  787  86  HOH HOH A . 
D 4 HOH 87  788  87  HOH HOH A . 
D 4 HOH 88  789  88  HOH HOH A . 
D 4 HOH 89  790  89  HOH HOH A . 
D 4 HOH 90  791  90  HOH HOH A . 
D 4 HOH 91  792  91  HOH HOH A . 
D 4 HOH 92  793  92  HOH HOH A . 
D 4 HOH 93  794  93  HOH HOH A . 
D 4 HOH 94  795  94  HOH HOH A . 
D 4 HOH 95  796  95  HOH HOH A . 
D 4 HOH 96  797  96  HOH HOH A . 
D 4 HOH 97  798  97  HOH HOH A . 
D 4 HOH 98  799  98  HOH HOH A . 
D 4 HOH 99  800  99  HOH HOH A . 
D 4 HOH 100 801  100 HOH HOH A . 
D 4 HOH 101 802  101 HOH HOH A . 
D 4 HOH 102 803  102 HOH HOH A . 
D 4 HOH 103 804  103 HOH HOH A . 
D 4 HOH 104 805  104 HOH HOH A . 
D 4 HOH 105 806  105 HOH HOH A . 
D 4 HOH 106 807  106 HOH HOH A . 
D 4 HOH 107 808  107 HOH HOH A . 
D 4 HOH 108 809  108 HOH HOH A . 
D 4 HOH 109 810  109 HOH HOH A . 
D 4 HOH 110 811  110 HOH HOH A . 
D 4 HOH 111 812  111 HOH HOH A . 
D 4 HOH 112 813  112 HOH HOH A . 
D 4 HOH 113 814  113 HOH HOH A . 
D 4 HOH 114 815  114 HOH HOH A . 
D 4 HOH 115 816  115 HOH HOH A . 
D 4 HOH 116 817  116 HOH HOH A . 
D 4 HOH 117 818  117 HOH HOH A . 
D 4 HOH 118 819  118 HOH HOH A . 
D 4 HOH 119 820  119 HOH HOH A . 
D 4 HOH 120 821  120 HOH HOH A . 
D 4 HOH 121 822  121 HOH HOH A . 
D 4 HOH 122 823  122 HOH HOH A . 
D 4 HOH 123 824  123 HOH HOH A . 
D 4 HOH 124 825  124 HOH HOH A . 
D 4 HOH 125 826  125 HOH HOH A . 
D 4 HOH 126 827  126 HOH HOH A . 
D 4 HOH 127 828  127 HOH HOH A . 
D 4 HOH 128 829  128 HOH HOH A . 
D 4 HOH 129 830  129 HOH HOH A . 
D 4 HOH 130 831  130 HOH HOH A . 
D 4 HOH 131 832  131 HOH HOH A . 
D 4 HOH 132 833  132 HOH HOH A . 
D 4 HOH 133 834  133 HOH HOH A . 
D 4 HOH 134 835  134 HOH HOH A . 
D 4 HOH 135 836  135 HOH HOH A . 
D 4 HOH 136 837  136 HOH HOH A . 
D 4 HOH 137 838  137 HOH HOH A . 
D 4 HOH 138 839  138 HOH HOH A . 
D 4 HOH 139 840  139 HOH HOH A . 
D 4 HOH 140 841  140 HOH HOH A . 
D 4 HOH 141 842  141 HOH HOH A . 
D 4 HOH 142 843  142 HOH HOH A . 
D 4 HOH 143 844  143 HOH HOH A . 
D 4 HOH 144 845  144 HOH HOH A . 
D 4 HOH 145 846  145 HOH HOH A . 
D 4 HOH 146 847  146 HOH HOH A . 
D 4 HOH 147 848  147 HOH HOH A . 
D 4 HOH 148 849  148 HOH HOH A . 
D 4 HOH 149 850  149 HOH HOH A . 
D 4 HOH 150 851  150 HOH HOH A . 
D 4 HOH 151 852  151 HOH HOH A . 
D 4 HOH 152 853  152 HOH HOH A . 
D 4 HOH 153 854  153 HOH HOH A . 
D 4 HOH 154 855  154 HOH HOH A . 
D 4 HOH 155 856  155 HOH HOH A . 
D 4 HOH 156 857  156 HOH HOH A . 
D 4 HOH 157 858  157 HOH HOH A . 
D 4 HOH 158 859  158 HOH HOH A . 
D 4 HOH 159 860  159 HOH HOH A . 
D 4 HOH 160 861  160 HOH HOH A . 
D 4 HOH 161 862  161 HOH HOH A . 
D 4 HOH 162 863  162 HOH HOH A . 
D 4 HOH 163 864  163 HOH HOH A . 
D 4 HOH 164 865  164 HOH HOH A . 
D 4 HOH 165 866  165 HOH HOH A . 
D 4 HOH 166 867  166 HOH HOH A . 
D 4 HOH 167 868  167 HOH HOH A . 
D 4 HOH 168 869  168 HOH HOH A . 
D 4 HOH 169 870  169 HOH HOH A . 
D 4 HOH 170 871  170 HOH HOH A . 
D 4 HOH 171 872  171 HOH HOH A . 
D 4 HOH 172 873  172 HOH HOH A . 
D 4 HOH 173 874  173 HOH HOH A . 
D 4 HOH 174 875  174 HOH HOH A . 
D 4 HOH 175 876  175 HOH HOH A . 
D 4 HOH 176 877  176 HOH HOH A . 
D 4 HOH 177 878  177 HOH HOH A . 
D 4 HOH 178 879  178 HOH HOH A . 
D 4 HOH 179 880  179 HOH HOH A . 
D 4 HOH 180 881  180 HOH HOH A . 
D 4 HOH 181 882  181 HOH HOH A . 
D 4 HOH 182 883  182 HOH HOH A . 
D 4 HOH 183 884  183 HOH HOH A . 
D 4 HOH 184 885  184 HOH HOH A . 
D 4 HOH 185 886  185 HOH HOH A . 
D 4 HOH 186 887  186 HOH HOH A . 
D 4 HOH 187 888  187 HOH HOH A . 
D 4 HOH 188 889  188 HOH HOH A . 
D 4 HOH 189 890  189 HOH HOH A . 
D 4 HOH 190 891  190 HOH HOH A . 
D 4 HOH 191 892  191 HOH HOH A . 
D 4 HOH 192 893  192 HOH HOH A . 
D 4 HOH 193 894  193 HOH HOH A . 
D 4 HOH 194 895  194 HOH HOH A . 
D 4 HOH 195 896  195 HOH HOH A . 
D 4 HOH 196 897  196 HOH HOH A . 
D 4 HOH 197 898  197 HOH HOH A . 
D 4 HOH 198 899  198 HOH HOH A . 
D 4 HOH 199 900  199 HOH HOH A . 
D 4 HOH 200 901  200 HOH HOH A . 
D 4 HOH 201 902  201 HOH HOH A . 
D 4 HOH 202 903  202 HOH HOH A . 
D 4 HOH 203 904  203 HOH HOH A . 
D 4 HOH 204 905  204 HOH HOH A . 
D 4 HOH 205 906  205 HOH HOH A . 
D 4 HOH 206 907  206 HOH HOH A . 
D 4 HOH 207 908  207 HOH HOH A . 
D 4 HOH 208 909  208 HOH HOH A . 
D 4 HOH 209 910  209 HOH HOH A . 
D 4 HOH 210 911  210 HOH HOH A . 
D 4 HOH 211 912  211 HOH HOH A . 
D 4 HOH 212 913  212 HOH HOH A . 
D 4 HOH 213 914  213 HOH HOH A . 
D 4 HOH 214 915  214 HOH HOH A . 
D 4 HOH 215 916  215 HOH HOH A . 
D 4 HOH 216 917  216 HOH HOH A . 
D 4 HOH 217 918  217 HOH HOH A . 
D 4 HOH 218 919  218 HOH HOH A . 
D 4 HOH 219 920  219 HOH HOH A . 
D 4 HOH 220 921  220 HOH HOH A . 
D 4 HOH 221 922  221 HOH HOH A . 
D 4 HOH 222 923  222 HOH HOH A . 
D 4 HOH 223 924  223 HOH HOH A . 
D 4 HOH 224 925  224 HOH HOH A . 
D 4 HOH 225 926  225 HOH HOH A . 
D 4 HOH 226 927  226 HOH HOH A . 
D 4 HOH 227 928  227 HOH HOH A . 
D 4 HOH 228 929  228 HOH HOH A . 
D 4 HOH 229 930  229 HOH HOH A . 
D 4 HOH 230 931  230 HOH HOH A . 
D 4 HOH 231 932  231 HOH HOH A . 
D 4 HOH 232 933  232 HOH HOH A . 
D 4 HOH 233 934  233 HOH HOH A . 
D 4 HOH 234 935  234 HOH HOH A . 
D 4 HOH 235 936  235 HOH HOH A . 
D 4 HOH 236 937  236 HOH HOH A . 
D 4 HOH 237 938  237 HOH HOH A . 
D 4 HOH 238 939  238 HOH HOH A . 
D 4 HOH 239 940  239 HOH HOH A . 
D 4 HOH 240 941  240 HOH HOH A . 
D 4 HOH 241 942  241 HOH HOH A . 
D 4 HOH 242 943  242 HOH HOH A . 
D 4 HOH 243 944  243 HOH HOH A . 
D 4 HOH 244 945  244 HOH HOH A . 
D 4 HOH 245 946  245 HOH HOH A . 
D 4 HOH 246 947  246 HOH HOH A . 
D 4 HOH 247 948  247 HOH HOH A . 
D 4 HOH 248 949  248 HOH HOH A . 
D 4 HOH 249 950  249 HOH HOH A . 
D 4 HOH 250 951  250 HOH HOH A . 
D 4 HOH 251 952  251 HOH HOH A . 
D 4 HOH 252 953  252 HOH HOH A . 
D 4 HOH 253 954  253 HOH HOH A . 
D 4 HOH 254 955  254 HOH HOH A . 
D 4 HOH 255 956  255 HOH HOH A . 
D 4 HOH 256 957  256 HOH HOH A . 
D 4 HOH 257 958  257 HOH HOH A . 
D 4 HOH 258 959  258 HOH HOH A . 
D 4 HOH 259 960  259 HOH HOH A . 
D 4 HOH 260 961  260 HOH HOH A . 
D 4 HOH 261 962  261 HOH HOH A . 
D 4 HOH 262 963  262 HOH HOH A . 
D 4 HOH 263 964  263 HOH HOH A . 
D 4 HOH 264 965  264 HOH HOH A . 
D 4 HOH 265 966  265 HOH HOH A . 
D 4 HOH 266 967  266 HOH HOH A . 
D 4 HOH 267 968  267 HOH HOH A . 
D 4 HOH 268 969  268 HOH HOH A . 
D 4 HOH 269 970  269 HOH HOH A . 
D 4 HOH 270 971  270 HOH HOH A . 
D 4 HOH 271 972  271 HOH HOH A . 
D 4 HOH 272 973  272 HOH HOH A . 
D 4 HOH 273 974  273 HOH HOH A . 
D 4 HOH 274 975  274 HOH HOH A . 
D 4 HOH 275 976  275 HOH HOH A . 
D 4 HOH 276 977  276 HOH HOH A . 
D 4 HOH 277 978  277 HOH HOH A . 
D 4 HOH 278 979  278 HOH HOH A . 
D 4 HOH 279 980  279 HOH HOH A . 
D 4 HOH 280 981  280 HOH HOH A . 
D 4 HOH 281 982  281 HOH HOH A . 
D 4 HOH 282 983  282 HOH HOH A . 
D 4 HOH 283 984  283 HOH HOH A . 
D 4 HOH 284 985  284 HOH HOH A . 
D 4 HOH 285 986  285 HOH HOH A . 
D 4 HOH 286 987  286 HOH HOH A . 
D 4 HOH 287 988  287 HOH HOH A . 
D 4 HOH 288 989  288 HOH HOH A . 
D 4 HOH 289 990  289 HOH HOH A . 
D 4 HOH 290 991  290 HOH HOH A . 
D 4 HOH 291 992  291 HOH HOH A . 
D 4 HOH 292 993  292 HOH HOH A . 
D 4 HOH 293 994  293 HOH HOH A . 
D 4 HOH 294 995  294 HOH HOH A . 
D 4 HOH 295 996  295 HOH HOH A . 
D 4 HOH 296 997  296 HOH HOH A . 
D 4 HOH 297 998  297 HOH HOH A . 
D 4 HOH 298 999  298 HOH HOH A . 
D 4 HOH 299 1000 299 HOH HOH A . 
D 4 HOH 300 1001 300 HOH HOH A . 
D 4 HOH 301 1002 301 HOH HOH A . 
D 4 HOH 302 1003 302 HOH HOH A . 
D 4 HOH 303 1004 303 HOH HOH A . 
D 4 HOH 304 1005 304 HOH HOH A . 
D 4 HOH 305 1006 305 HOH HOH A . 
D 4 HOH 306 1007 306 HOH HOH A . 
D 4 HOH 307 1008 307 HOH HOH A . 
D 4 HOH 308 1009 308 HOH HOH A . 
D 4 HOH 309 1010 309 HOH HOH A . 
D 4 HOH 310 1011 310 HOH HOH A . 
D 4 HOH 311 1012 311 HOH HOH A . 
D 4 HOH 312 1013 312 HOH HOH A . 
D 4 HOH 313 1014 313 HOH HOH A . 
D 4 HOH 314 1015 314 HOH HOH A . 
D 4 HOH 315 1016 315 HOH HOH A . 
D 4 HOH 316 1017 316 HOH HOH A . 
D 4 HOH 317 1018 317 HOH HOH A . 
D 4 HOH 318 1019 318 HOH HOH A . 
D 4 HOH 319 1020 319 HOH HOH A . 
D 4 HOH 320 1021 320 HOH HOH A . 
D 4 HOH 321 1022 321 HOH HOH A . 
D 4 HOH 322 1023 322 HOH HOH A . 
D 4 HOH 323 1024 323 HOH HOH A . 
D 4 HOH 324 1025 324 HOH HOH A . 
D 4 HOH 325 1026 325 HOH HOH A . 
D 4 HOH 326 1027 326 HOH HOH A . 
D 4 HOH 327 1028 327 HOH HOH A . 
D 4 HOH 328 1029 328 HOH HOH A . 
D 4 HOH 329 1030 329 HOH HOH A . 
D 4 HOH 330 1031 330 HOH HOH A . 
D 4 HOH 331 1032 331 HOH HOH A . 
D 4 HOH 332 1033 332 HOH HOH A . 
D 4 HOH 333 1034 333 HOH HOH A . 
D 4 HOH 334 1035 334 HOH HOH A . 
D 4 HOH 335 1036 335 HOH HOH A . 
D 4 HOH 336 1037 336 HOH HOH A . 
D 4 HOH 337 1038 337 HOH HOH A . 
D 4 HOH 338 1039 338 HOH HOH A . 
D 4 HOH 339 1040 339 HOH HOH A . 
D 4 HOH 340 1041 340 HOH HOH A . 
D 4 HOH 341 1042 341 HOH HOH A . 
D 4 HOH 342 1043 342 HOH HOH A . 
D 4 HOH 343 1044 344 HOH HOH A . 
D 4 HOH 344 1045 345 HOH HOH A . 
D 4 HOH 345 1046 346 HOH HOH A . 
D 4 HOH 346 1047 347 HOH HOH A . 
D 4 HOH 347 1048 348 HOH HOH A . 
D 4 HOH 348 1049 349 HOH HOH A . 
D 4 HOH 349 1050 350 HOH HOH A . 
D 4 HOH 350 1051 351 HOH HOH A . 
D 4 HOH 351 1052 352 HOH HOH A . 
D 4 HOH 352 1053 353 HOH HOH A . 
D 4 HOH 353 1054 354 HOH HOH A . 
D 4 HOH 354 1055 355 HOH HOH A . 
D 4 HOH 355 1056 356 HOH HOH A . 
D 4 HOH 356 1057 357 HOH HOH A . 
D 4 HOH 357 1058 358 HOH HOH A . 
D 4 HOH 358 1059 359 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     140 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      138 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 33  ? A GLU 32  ? 8_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? A GLU 188 ? A GLU 187 ? 1_555 73.0  ? 
2  OE1 ? A GLU 33  ? A GLU 32  ? 8_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? A ARG 191 ? A ARG 190 ? 1_555 148.9 ? 
3  O   ? A GLU 188 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? A ARG 191 ? A ARG 190 ? 1_555 76.0  ? 
4  OE1 ? A GLU 33  ? A GLU 32  ? 8_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 193 ? A ASP 192 ? 1_555 89.1  ? 
5  O   ? A GLU 188 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 193 ? A ASP 192 ? 1_555 83.6  ? 
6  O   ? A ARG 191 ? A ARG 190 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 193 ? A ASP 192 ? 1_555 89.6  ? 
7  OE1 ? A GLU 33  ? A GLU 32  ? 8_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 196 ? A ASP 195 ? 1_555 73.4  ? 
8  O   ? A GLU 188 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 196 ? A ASP 195 ? 1_555 146.3 ? 
9  O   ? A ARG 191 ? A ARG 190 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 196 ? A ASP 195 ? 1_555 137.7 ? 
10 OD1 ? A ASP 193 ? A ASP 192 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 196 ? A ASP 195 ? 1_555 93.8  ? 
11 OE1 ? A GLU 33  ? A GLU 32  ? 8_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 196 ? A ASP 195 ? 1_555 123.6 ? 
12 O   ? A GLU 188 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 196 ? A ASP 195 ? 1_555 160.1 ? 
13 O   ? A ARG 191 ? A ARG 190 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 196 ? A ASP 195 ? 1_555 87.3  ? 
14 OD1 ? A ASP 193 ? A ASP 192 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 196 ? A ASP 195 ? 1_555 85.8  ? 
15 OD1 ? A ASP 196 ? A ASP 195 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 196 ? A ASP 195 ? 1_555 51.1  ? 
16 OE1 ? A GLU 33  ? A GLU 32  ? 8_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? D HOH .   ? A HOH 722 ? 1_555 89.6  ? 
17 O   ? A GLU 188 ? A GLU 187 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? D HOH .   ? A HOH 722 ? 1_555 87.2  ? 
18 O   ? A ARG 191 ? A ARG 190 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? D HOH .   ? A HOH 722 ? 1_555 86.7  ? 
19 OD1 ? A ASP 193 ? A ASP 192 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? D HOH .   ? A HOH 722 ? 1_555 170.7 ? 
20 OD1 ? A ASP 196 ? A ASP 195 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? D HOH .   ? A HOH 722 ? 1_555 94.6  ? 
21 OD2 ? A ASP 196 ? A ASP 195 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? D HOH .   ? A HOH 722 ? 1_555 102.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-06-17 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Database references'       
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' chem_comp                    
2  4 'Structure model' entity                       
3  4 'Structure model' pdbx_chem_comp_identifier    
4  4 'Structure model' pdbx_entity_nonpoly          
5  4 'Structure model' pdbx_struct_conn_angle       
6  4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
7  4 'Structure model' struct_conn                  
8  4 'Structure model' struct_ref_seq_dif           
9  4 'Structure model' struct_site                  
10 4 'Structure model' struct_site_gen              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                             
2  4 'Structure model' '_chem_comp.type'                             
3  4 'Structure model' '_entity.pdbx_description'                    
4  4 'Structure model' '_pdbx_entity_nonpoly.name'                   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry'      
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry'      
19 4 'Structure model' '_pdbx_struct_conn_angle.value'               
20 4 'Structure model' '_struct_conn.pdbx_dist_value'                
21 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
22 4 'Structure model' '_struct_conn.pdbx_role'                      
23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
27 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
28 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
29 4 'Structure model' '_struct_conn.ptnr1_symmetry'                 
30 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
34 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
35 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
36 4 'Structure model' '_struct_conn.ptnr2_symmetry'                 
37 4 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
AMoRE     phasing          .     ? 3 
X-PLOR    refinement       3.843 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 7   ? ? 62.01   -14.88  
2 1 SER A 152 ? ? 64.46   -130.46 
3 1 SER A 243 ? ? -179.06 138.24  
4 1 PRO A 298 ? ? -73.30  -164.47 
5 1 SER A 333 ? ? -37.89  139.95  
6 1 ASN A 334 ? ? 72.74   64.83   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A VAL 316 ? A VAL 317 
2 1 Y 1 A LYS 317 ? A LYS 318 
3 1 Y 1 A THR 318 ? A THR 319 
4 1 Y 1 A SER 319 ? A SER 320 
5 1 Y 1 A ASP 320 ? A ASP 321 
6 1 Y 1 A GLU 321 ? A GLU 322 
7 1 Y 1 A THR 322 ? A THR 323 
8 1 Y 1 A VAL 407 ? A VAL 407 
9 1 Y 1 A VAL 408 ? A VAL 408 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'CALCIUM ION'                            CA  
4 water                                    HOH 
#