data_1RPJ
# 
_entry.id   1RPJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RPJ         
RCSB  RCSB000451   
WWPDB D_1000000451 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RPJ 
_pdbx_database_status.recvd_initial_deposition_date   1999-02-04 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chaudhuri, B.' 1 
'Jones, T.A.'   2 
'Mowbray, S.L.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of D-allose binding protein from Escherichia coli bound to D-allose at 1.8 A resolution.' J.Mol.Biol.  286 1519 
1531 1999 JMOBAK UK 0022-2836 0070 ? 10064713 10.1006/jmbi.1999.2571 
1       'The D-Allose Operon of Escherichia Coli K-12'                                                       J.Bacteriol. 179 7631 
?    1997 JOBAAY US 0021-9193 0767 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chaudhuri, B.N.' 1 ? 
primary 'Ko, J.'          2 ? 
primary 'Park, C.'        3 ? 
primary 'Jones, T.A.'     4 ? 
primary 'Mowbray, S.L.'   5 ? 
1       'Kim, C.'         6 ? 
1       'Song, S.'        7 ? 
1       'Park, C.'        8 ? 
# 
_cell.entry_id           1RPJ 
_cell.length_a           33.380 
_cell.length_b           67.820 
_cell.length_c           53.590 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.71 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RPJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)' 30417.807 1   ? ? ? ? 
2 non-polymer syn 'ZINC ION'                                          65.409    1   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                       96.063    1   ? ? ? ? 
4 non-polymer syn beta-D-allopyranose                                 180.156   1   ? ? ? ? 
5 water       nat water                                               18.015    215 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ALBP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIFASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARA
WKKGIYLVNLDEKIDMDNLKKAGGNVEAFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATEAFK
KASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGKTGKVLVVGTDGIPEARKMVEAGQ
MTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPEFKLVDSILVTQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIFASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARA
WKKGIYLVNLDEKIDMDNLKKAGGNVEAFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATEAFK
KASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGKTGKVLVVGTDGIPEARKMVEAGQ
MTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPEFKLVDSILVTQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   GLU n 
1 4   TYR n 
1 5   ALA n 
1 6   VAL n 
1 7   VAL n 
1 8   LEU n 
1 9   LYS n 
1 10  THR n 
1 11  LEU n 
1 12  SER n 
1 13  ASN n 
1 14  PRO n 
1 15  PHE n 
1 16  TRP n 
1 17  VAL n 
1 18  ASP n 
1 19  MET n 
1 20  LYS n 
1 21  LYS n 
1 22  GLY n 
1 23  ILE n 
1 24  GLU n 
1 25  ASP n 
1 26  GLU n 
1 27  ALA n 
1 28  LYS n 
1 29  THR n 
1 30  LEU n 
1 31  GLY n 
1 32  VAL n 
1 33  SER n 
1 34  VAL n 
1 35  ASP n 
1 36  ILE n 
1 37  PHE n 
1 38  ALA n 
1 39  SER n 
1 40  PRO n 
1 41  SER n 
1 42  GLU n 
1 43  GLY n 
1 44  ASP n 
1 45  PHE n 
1 46  GLN n 
1 47  SER n 
1 48  GLN n 
1 49  LEU n 
1 50  GLN n 
1 51  LEU n 
1 52  PHE n 
1 53  GLU n 
1 54  ASP n 
1 55  LEU n 
1 56  SER n 
1 57  ASN n 
1 58  LYS n 
1 59  ASN n 
1 60  TYR n 
1 61  LYS n 
1 62  GLY n 
1 63  ILE n 
1 64  ALA n 
1 65  PHE n 
1 66  ALA n 
1 67  PRO n 
1 68  LEU n 
1 69  SER n 
1 70  SER n 
1 71  VAL n 
1 72  ASN n 
1 73  LEU n 
1 74  VAL n 
1 75  MET n 
1 76  PRO n 
1 77  VAL n 
1 78  ALA n 
1 79  ARG n 
1 80  ALA n 
1 81  TRP n 
1 82  LYS n 
1 83  LYS n 
1 84  GLY n 
1 85  ILE n 
1 86  TYR n 
1 87  LEU n 
1 88  VAL n 
1 89  ASN n 
1 90  LEU n 
1 91  ASP n 
1 92  GLU n 
1 93  LYS n 
1 94  ILE n 
1 95  ASP n 
1 96  MET n 
1 97  ASP n 
1 98  ASN n 
1 99  LEU n 
1 100 LYS n 
1 101 LYS n 
1 102 ALA n 
1 103 GLY n 
1 104 GLY n 
1 105 ASN n 
1 106 VAL n 
1 107 GLU n 
1 108 ALA n 
1 109 PHE n 
1 110 VAL n 
1 111 THR n 
1 112 THR n 
1 113 ASP n 
1 114 ASN n 
1 115 VAL n 
1 116 ALA n 
1 117 VAL n 
1 118 GLY n 
1 119 ALA n 
1 120 LYS n 
1 121 GLY n 
1 122 ALA n 
1 123 SER n 
1 124 PHE n 
1 125 ILE n 
1 126 ILE n 
1 127 ASP n 
1 128 LYS n 
1 129 LEU n 
1 130 GLY n 
1 131 ALA n 
1 132 GLU n 
1 133 GLY n 
1 134 GLY n 
1 135 GLU n 
1 136 VAL n 
1 137 ALA n 
1 138 ILE n 
1 139 ILE n 
1 140 GLU n 
1 141 GLY n 
1 142 LYS n 
1 143 ALA n 
1 144 GLY n 
1 145 ASN n 
1 146 ALA n 
1 147 SER n 
1 148 GLY n 
1 149 GLU n 
1 150 ALA n 
1 151 ARG n 
1 152 ARG n 
1 153 ASN n 
1 154 GLY n 
1 155 ALA n 
1 156 THR n 
1 157 GLU n 
1 158 ALA n 
1 159 PHE n 
1 160 LYS n 
1 161 LYS n 
1 162 ALA n 
1 163 SER n 
1 164 GLN n 
1 165 ILE n 
1 166 LYS n 
1 167 LEU n 
1 168 VAL n 
1 169 ALA n 
1 170 SER n 
1 171 GLN n 
1 172 PRO n 
1 173 ALA n 
1 174 ASP n 
1 175 TRP n 
1 176 ASP n 
1 177 ARG n 
1 178 ILE n 
1 179 LYS n 
1 180 ALA n 
1 181 LEU n 
1 182 ASP n 
1 183 VAL n 
1 184 ALA n 
1 185 THR n 
1 186 ASN n 
1 187 VAL n 
1 188 LEU n 
1 189 GLN n 
1 190 ARG n 
1 191 ASN n 
1 192 PRO n 
1 193 ASN n 
1 194 ILE n 
1 195 LYS n 
1 196 ALA n 
1 197 ILE n 
1 198 TYR n 
1 199 CYS n 
1 200 ALA n 
1 201 ASN n 
1 202 ASP n 
1 203 THR n 
1 204 MET n 
1 205 ALA n 
1 206 MET n 
1 207 GLY n 
1 208 VAL n 
1 209 ALA n 
1 210 GLN n 
1 211 ALA n 
1 212 VAL n 
1 213 ALA n 
1 214 ASN n 
1 215 ALA n 
1 216 GLY n 
1 217 LYS n 
1 218 THR n 
1 219 GLY n 
1 220 LYS n 
1 221 VAL n 
1 222 LEU n 
1 223 VAL n 
1 224 VAL n 
1 225 GLY n 
1 226 THR n 
1 227 ASP n 
1 228 GLY n 
1 229 ILE n 
1 230 PRO n 
1 231 GLU n 
1 232 ALA n 
1 233 ARG n 
1 234 LYS n 
1 235 MET n 
1 236 VAL n 
1 237 GLU n 
1 238 ALA n 
1 239 GLY n 
1 240 GLN n 
1 241 MET n 
1 242 THR n 
1 243 ALA n 
1 244 THR n 
1 245 VAL n 
1 246 ALA n 
1 247 GLN n 
1 248 ASN n 
1 249 PRO n 
1 250 ALA n 
1 251 ASP n 
1 252 ILE n 
1 253 GLY n 
1 254 ALA n 
1 255 THR n 
1 256 GLY n 
1 257 LEU n 
1 258 LYS n 
1 259 LEU n 
1 260 MET n 
1 261 VAL n 
1 262 ASP n 
1 263 ALA n 
1 264 GLU n 
1 265 LYS n 
1 266 SER n 
1 267 GLY n 
1 268 LYS n 
1 269 VAL n 
1 270 ILE n 
1 271 PRO n 
1 272 LEU n 
1 273 ASP n 
1 274 LYS n 
1 275 ALA n 
1 276 PRO n 
1 277 GLU n 
1 278 PHE n 
1 279 LYS n 
1 280 LEU n 
1 281 VAL n 
1 282 ASP n 
1 283 SER n 
1 284 ILE n 
1 285 LEU n 
1 286 VAL n 
1 287 THR n 
1 288 GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli K12' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      83333 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    'Escherichia coli' 
_entity_src_nat.strain                     K-12 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     PERIPLASM 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ALSB_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P39265 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RPJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 288 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P39265 
_struct_ref_seq.db_align_beg                  24 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  311 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       288 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE             ? 'C3 H7 N O2'     89.093  
ALL 'D-saccharide, beta linking' . beta-D-allopyranose ? 'C6 H12 O6'      180.156 
ARG 'L-peptide linking'          y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE             ? 'C2 H5 N O2'     75.067  
HOH non-polymer                  . WATER               ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'          y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE              ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'       ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE              ? 'C5 H11 N O2'    117.146 
ZN  non-polymer                  . 'ZINC ION'          ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1RPJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.98 
_exptl_crystal.density_percent_sol   41 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 550'    ? ? ? 
1 2 1 ZnSO4        ? ? ? 
1 3 1 'MES BUFFER' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RPJ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.787 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   21163 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.0450000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.4 
_reflns.B_iso_Wilson_estimate        17.07 
_reflns.pdbx_redundancy              2.8 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.85 
_reflns_shell.percent_possible_all   93.6 
_reflns_shell.Rmerge_I_obs           0.1500000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.0 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RPJ 
_refine.ls_number_reflns_obs                     22055 
_refine.ls_number_reflns_all                     22055 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1940000 
_refine.ls_R_factor_R_free                       0.2450000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.1 
_refine.ls_number_reflns_R_free                  1295 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               11.18 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'CNS WAS USED BEFORE REFMAC FOR REFINEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2DRI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2133 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             215 
_refine_hist.number_atoms_total               2366 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        29.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.01  0.02 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.026 0.04 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.03  0.05 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.024 0.03 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       .173  0.3  ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.252 0.3  ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.162 0.3  ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        4.2   7.0  ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     15.8  15.0 ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    22.6  20.0 ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       0.0   15.0 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RPJ 
_struct.title                     'CRYSTAL STRUCTURE OF D-ALLOSE BINDING PROTEIN FROM ESCHERICHIA COLI' 
_struct.pdbx_descriptor           PRECURSOR 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RPJ 
_struct_keywords.pdbx_keywords   'PERIPLASMIC SUGAR RECEPTOR' 
_struct_keywords.text            'PERIPLASMIC SUGAR RECEPTOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 14  ? LEU A 30  ? PRO A 14  LEU A 30  1 ? 17 
HELX_P HELX_P2  2  PHE A 45  ? ASN A 57  ? PHE A 45  ASN A 57  1 ? 13 
HELX_P HELX_P3  3  VAL A 74  ? LYS A 83  ? VAL A 74  LYS A 83  1 ? 10 
HELX_P HELX_P4  4  MET A 96  ? LYS A 101 ? MET A 96  LYS A 101 1 ? 6  
HELX_P HELX_P5  5  ASN A 114 ? LEU A 129 ? ASN A 114 LEU A 129 1 ? 16 
HELX_P HELX_P6  6  ALA A 146 ? LYS A 161 ? ALA A 146 LYS A 161 1 ? 16 
HELX_P HELX_P7  7  ARG A 177 ? ARG A 190 ? ARG A 177 ARG A 190 1 ? 14 
HELX_P HELX_P8  8  ASP A 202 ? ASN A 214 ? ASP A 202 ASN A 214 1 ? 13 
HELX_P HELX_P9  9  PRO A 230 ? ALA A 238 ? PRO A 230 ALA A 238 1 ? 9  
HELX_P HELX_P10 10 PRO A 249 ? SER A 266 ? PRO A 249 SER A 266 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A ALA 1 N  ? ? ? 1_555 B ZN  . ZN ? ? A ALA 1   A ZN  289 1_555 ? ? ? ? ? ? ? 2.209 ? ? 
metalc2 metalc ? ? A ALA 1 O  ? ? ? 1_555 B ZN  . ZN ? ? A ALA 1   A ZN  289 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc3 metalc ? ? B ZN  . ZN ? ? ? 1_555 E HOH . O  ? ? A ZN  289 A HOH 499 1_555 ? ? ? ? ? ? ? 2.059 ? ? 
metalc4 metalc ? ? B ZN  . ZN ? ? ? 1_555 E HOH . O  ? ? A ZN  289 A HOH 500 1_555 ? ? ? ? ? ? ? 2.348 ? ? 
metalc5 metalc ? ? B ZN  . ZN ? ? ? 1_555 E HOH . O  ? ? A ZN  289 A HOH 501 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc6 metalc ? ? B ZN  . ZN ? ? ? 1_555 E HOH . O  ? ? A ZN  289 A HOH 502 1_555 ? ? ? ? ? ? ? 1.942 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 277 ? VAL A 281 ? GLU A 277 VAL A 281 
A 2 ALA A 108 ? THR A 112 ? ALA A 108 THR A 112 
A 3 TYR A 86  ? LEU A 90  ? TYR A 86  LEU A 90  
A 4 GLY A 62  ? PHE A 65  ? GLY A 62  PHE A 65  
A 5 TYR A 4   ? THR A 10  ? TYR A 4   THR A 10  
A 6 VAL A 34  ? SER A 39  ? VAL A 34  SER A 39  
B 1 ILE A 284 ? THR A 287 ? ILE A 284 THR A 287 
B 2 ALA A 243 ? ALA A 246 ? ALA A 243 ALA A 246 
B 3 LEU A 222 ? ASP A 227 ? LEU A 222 ASP A 227 
B 4 ILE A 194 ? CYS A 199 ? ILE A 194 CYS A 199 
B 5 GLY A 134 ? GLU A 140 ? GLY A 134 GLU A 140 
B 6 ILE A 165 ? PRO A 172 ? ILE A 165 PRO A 172 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 277 ? O GLU A 277 N PHE A 109 ? N PHE A 109 
A 2 3 O ALA A 108 ? O ALA A 108 N ASN A 89  ? N ASN A 89  
A 3 4 O TYR A 86  ? O TYR A 86  N ILE A 63  ? N ILE A 63  
A 4 5 O GLY A 62  ? O GLY A 62  N ALA A 5   ? N ALA A 5   
A 5 6 O TYR A 4   ? O TYR A 4   N ASP A 35  ? N ASP A 35  
B 1 2 O ILE A 284 ? O ILE A 284 N ALA A 246 ? N ALA A 246 
B 2 3 O ALA A 243 ? O ALA A 243 N GLY A 225 ? N GLY A 225 
B 3 4 O LEU A 222 ? O LEU A 222 N ILE A 197 ? N ILE A 197 
B 4 5 O LYS A 195 ? O LYS A 195 N GLU A 135 ? N GLU A 135 
B 5 6 O GLY A 134 ? O GLY A 134 N LYS A 166 ? N LYS A 166 
# 
_struct_site.id                   ALL 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'THE SUGAR BINDING CLEFT IS FORMED AT THE DOMAIN INTERFACE IN THE CLOSED-FORM OF THE PROTEIN.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ALL 12 LYS A 9   ? LYS A 9   . ? 1_555 ? 
2  ALL 12 SER A 147 ? SER A 147 . ? 1_555 ? 
3  ALL 12 ASP A 91  ? ASP A 91  . ? 1_555 ? 
4  ALL 12 ARG A 151 ? ARG A 151 . ? 1_555 ? 
5  ALL 12 GLN A 247 ? GLN A 247 . ? 1_555 ? 
6  ALL 12 ASP A 227 ? ASP A 227 . ? 1_555 ? 
7  ALL 12 ASN A 201 ? ASN A 201 . ? 1_555 ? 
8  ALL 12 ASN A 13  ? ASN A 13  . ? 1_555 ? 
9  ALL 12 GLU A 42  ? GLU A 42  . ? 1_555 ? 
10 ALL 12 TRP A 16  ? TRP A 16  . ? 1_555 ? 
11 ALL 12 PHE A 15  ? PHE A 15  . ? 1_555 ? 
12 ALL 12 TRP A 175 ? TRP A 175 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RPJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RPJ 
_atom_sites.fract_transf_matrix[1][1]   0.029958 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003524 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018789 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? -8.965  24.127  -8.599  1.00 19.28 ? 1   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? -8.217  23.727  -7.390  1.00 17.78 ? 1   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? -7.077  24.686  -7.076  1.00 18.54 ? 1   ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? -6.618  25.475  -7.920  1.00 16.74 ? 1   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? -7.629  22.324  -7.571  1.00 17.58 ? 1   ALA A CB  1 
ATOM   6    N  N   . ALA A 1 2   ? -6.649  24.621  -5.811  1.00 18.79 ? 2   ALA A N   1 
ATOM   7    C  CA  . ALA A 1 2   ? -5.512  25.435  -5.382  1.00 17.04 ? 2   ALA A CA  1 
ATOM   8    C  C   . ALA A 1 2   ? -4.289  24.946  -6.130  1.00 15.33 ? 2   ALA A C   1 
ATOM   9    O  O   . ALA A 1 2   ? -4.414  24.094  -7.032  1.00 16.19 ? 2   ALA A O   1 
ATOM   10   C  CB  . ALA A 1 2   ? -5.356  25.398  -3.874  1.00 18.45 ? 2   ALA A CB  1 
ATOM   11   N  N   . GLU A 1 3   ? -3.110  25.498  -5.825  1.00 11.96 ? 3   GLU A N   1 
ATOM   12   C  CA  . GLU A 1 3   ? -1.937  25.092  -6.569  1.00 12.25 ? 3   GLU A CA  1 
ATOM   13   C  C   . GLU A 1 3   ? -1.465  23.722  -6.125  1.00 10.58 ? 3   GLU A C   1 
ATOM   14   O  O   . GLU A 1 3   ? -0.928  23.004  -6.947  1.00 10.00 ? 3   GLU A O   1 
ATOM   15   C  CB  . GLU A 1 3   ? -0.743  26.047  -6.436  1.00 12.99 ? 3   GLU A CB  1 
ATOM   16   C  CG  . GLU A 1 3   ? -1.055  27.416  -7.030  1.00 13.23 ? 3   GLU A CG  1 
ATOM   17   C  CD  . GLU A 1 3   ? -0.005  28.446  -6.659  1.00 14.67 ? 3   GLU A CD  1 
ATOM   18   O  OE1 . GLU A 1 3   ? 0.125   28.730  -5.451  1.00 15.93 ? 3   GLU A OE1 1 
ATOM   19   O  OE2 . GLU A 1 3   ? 0.668   28.960  -7.556  1.00 15.44 ? 3   GLU A OE2 1 
ATOM   20   N  N   . TYR A 1 4   ? -1.492  23.515  -4.807  1.00 10.00 ? 4   TYR A N   1 
ATOM   21   C  CA  . TYR A 1 4   ? -0.979  22.232  -4.277  1.00 9.81  ? 4   TYR A CA  1 
ATOM   22   C  C   . TYR A 1 4   ? -1.975  21.582  -3.335  1.00 9.31  ? 4   TYR A C   1 
ATOM   23   O  O   . TYR A 1 4   ? -2.835  22.170  -2.698  1.00 7.22  ? 4   TYR A O   1 
ATOM   24   C  CB  . TYR A 1 4   ? 0.365   22.412  -3.538  1.00 9.49  ? 4   TYR A CB  1 
ATOM   25   C  CG  . TYR A 1 4   ? 1.405   23.011  -4.449  1.00 9.97  ? 4   TYR A CG  1 
ATOM   26   C  CD1 . TYR A 1 4   ? 2.108   22.224  -5.343  1.00 9.55  ? 4   TYR A CD1 1 
ATOM   27   C  CD2 . TYR A 1 4   ? 1.611   24.400  -4.493  1.00 8.85  ? 4   TYR A CD2 1 
ATOM   28   C  CE1 . TYR A 1 4   ? 3.009   22.756  -6.228  1.00 10.10 ? 4   TYR A CE1 1 
ATOM   29   C  CE2 . TYR A 1 4   ? 2.497   24.947  -5.393  1.00 8.20  ? 4   TYR A CE2 1 
ATOM   30   C  CZ  . TYR A 1 4   ? 3.193   24.141  -6.264  1.00 9.56  ? 4   TYR A CZ  1 
ATOM   31   O  OH  . TYR A 1 4   ? 4.112   24.625  -7.149  1.00 10.62 ? 4   TYR A OH  1 
ATOM   32   N  N   . ALA A 1 5   ? -1.870  20.233  -3.284  1.00 8.83  ? 5   ALA A N   1 
ATOM   33   C  CA  . ALA A 1 5   ? -2.717  19.439  -2.438  1.00 8.71  ? 5   ALA A CA  1 
ATOM   34   C  C   . ALA A 1 5   ? -1.750  18.603  -1.563  1.00 6.82  ? 5   ALA A C   1 
ATOM   35   O  O   . ALA A 1 5   ? -0.643  18.374  -2.025  1.00 6.85  ? 5   ALA A O   1 
ATOM   36   C  CB  . ALA A 1 5   ? -3.609  18.420  -3.140  1.00 9.22  ? 5   ALA A CB  1 
ATOM   37   N  N   . VAL A 1 6   ? -2.276  18.334  -0.375  1.00 8.02  ? 6   VAL A N   1 
ATOM   38   C  CA  . VAL A 1 6   ? -1.451  17.497  0.540   1.00 8.62  ? 6   VAL A CA  1 
ATOM   39   C  C   . VAL A 1 6   ? -2.349  16.397  1.057   1.00 5.79  ? 6   VAL A C   1 
ATOM   40   O  O   . VAL A 1 6   ? -3.519  16.606  1.396   1.00 7.91  ? 6   VAL A O   1 
ATOM   41   C  CB  . VAL A 1 6   ? -0.858  18.290  1.708   1.00 9.13  ? 6   VAL A CB  1 
ATOM   42   C  CG1 . VAL A 1 6   ? -0.117  17.354  2.677   1.00 9.36  ? 6   VAL A CG1 1 
ATOM   43   C  CG2 . VAL A 1 6   ? 0.115   19.346  1.206   1.00 9.17  ? 6   VAL A CG2 1 
ATOM   44   N  N   . VAL A 1 7   ? -1.812  15.178  1.107   1.00 7.80  ? 7   VAL A N   1 
ATOM   45   C  CA  . VAL A 1 7   ? -2.566  14.031  1.611   1.00 8.16  ? 7   VAL A CA  1 
ATOM   46   C  C   . VAL A 1 7   ? -1.820  13.500  2.852   1.00 7.85  ? 7   VAL A C   1 
ATOM   47   O  O   . VAL A 1 7   ? -0.686  13.056  2.675   1.00 10.15 ? 7   VAL A O   1 
ATOM   48   C  CB  . VAL A 1 7   ? -2.755  12.944  0.551   1.00 10.20 ? 7   VAL A CB  1 
ATOM   49   C  CG1 . VAL A 1 7   ? -3.315  11.676  1.200   1.00 10.99 ? 7   VAL A CG1 1 
ATOM   50   C  CG2 . VAL A 1 7   ? -3.781  13.393  -0.505  1.00 11.38 ? 7   VAL A CG2 1 
ATOM   51   N  N   . LEU A 1 8   ? -2.336  13.726  4.030   1.00 6.75  ? 8   LEU A N   1 
ATOM   52   C  CA  . LEU A 1 8   ? -1.653  13.290  5.268   1.00 8.21  ? 8   LEU A CA  1 
ATOM   53   C  C   . LEU A 1 8   ? -2.300  11.998  5.725   1.00 9.22  ? 8   LEU A C   1 
ATOM   54   O  O   . LEU A 1 8   ? -3.373  11.682  5.194   1.00 10.08 ? 8   LEU A O   1 
ATOM   55   C  CB  . LEU A 1 8   ? -1.711  14.363  6.352   1.00 6.86  ? 8   LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 8   ? -1.074  15.711  5.994   1.00 8.29  ? 8   LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 8   ? -1.217  16.680  7.177   1.00 8.22  ? 8   LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 8   ? 0.370   15.560  5.556   1.00 8.93  ? 8   LEU A CD2 1 
ATOM   59   N  N   . LYS A 1 9   ? -1.691  11.248  6.663   1.00 7.76  ? 9   LYS A N   1 
ATOM   60   C  CA  . LYS A 1 9   ? -2.346  10.013  7.049   1.00 8.16  ? 9   LYS A CA  1 
ATOM   61   C  C   . LYS A 1 9   ? -3.647  10.235  7.770   1.00 7.81  ? 9   LYS A C   1 
ATOM   62   O  O   . LYS A 1 9   ? -4.689  9.805   7.255   1.00 7.74  ? 9   LYS A O   1 
ATOM   63   C  CB  . LYS A 1 9   ? -1.379  9.141   7.888   1.00 6.49  ? 9   LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 9   ? -0.195  8.646   7.057   1.00 4.89  ? 9   LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 9   ? 0.414   7.467   7.868   1.00 5.08  ? 9   LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 9   ? 1.751   7.041   7.255   1.00 5.17  ? 9   LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 9   ? 2.423   6.042   8.163   1.00 4.11  ? 9   LYS A NZ  1 
ATOM   68   N  N   . THR A 1 10  ? -3.653  10.765  9.001   1.00 7.45  ? 10  THR A N   1 
ATOM   69   C  CA  . THR A 1 10  ? -4.894  10.952  9.743   1.00 7.35  ? 10  THR A CA  1 
ATOM   70   C  C   . THR A 1 10  ? -4.662  12.054  10.777  1.00 8.36  ? 10  THR A C   1 
ATOM   71   O  O   . THR A 1 10  ? -3.662  12.089  11.502  1.00 8.74  ? 10  THR A O   1 
ATOM   72   C  CB  . THR A 1 10  ? -5.382  9.664   10.431  1.00 8.74  ? 10  THR A CB  1 
ATOM   73   O  OG1 . THR A 1 10  ? -6.369  9.930   11.446  1.00 9.38  ? 10  THR A OG1 1 
ATOM   74   C  CG2 . THR A 1 10  ? -4.178  8.988   11.074  1.00 9.49  ? 10  THR A CG2 1 
ATOM   75   N  N   . LEU A 1 11  ? -5.640  12.958  10.889  1.00 8.17  ? 11  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 11  ? -5.502  14.042  11.857  1.00 10.13 ? 11  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 11  ? -5.859  13.590  13.246  1.00 9.95  ? 11  LEU A C   1 
ATOM   78   O  O   . LEU A 1 11  ? -5.835  14.415  14.172  1.00 9.88  ? 11  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 11  ? -6.302  15.262  11.360  1.00 11.25 ? 11  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 11  ? -5.707  15.870  10.088  1.00 12.49 ? 11  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 11  ? -6.597  16.989  9.538   1.00 13.44 ? 11  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 11  ? -4.325  16.477  10.358  1.00 11.61 ? 11  LEU A CD2 1 
ATOM   83   N  N   . SER A 1 12  ? -6.214  12.310  13.445  1.00 9.93  ? 12  SER A N   1 
ATOM   84   C  CA  . SER A 1 12  ? -6.470  11.772  14.768  1.00 10.97 ? 12  SER A CA  1 
ATOM   85   C  C   . SER A 1 12  ? -5.172  11.493  15.537  1.00 10.95 ? 12  SER A C   1 
ATOM   86   O  O   . SER A 1 12  ? -5.217  11.031  16.665  1.00 11.67 ? 12  SER A O   1 
ATOM   87   C  CB  . SER A 1 12  ? -7.313  10.489  14.632  1.00 13.19 ? 12  SER A CB  1 
ATOM   88   O  OG  . SER A 1 12  ? -6.561  9.396   14.123  1.00 15.21 ? 12  SER A OG  1 
ATOM   89   N  N   . ASN A 1 13  ? -4.030  11.672  14.916  1.00 8.50  ? 13  ASN A N   1 
ATOM   90   C  CA  . ASN A 1 13  ? -2.681  11.533  15.471  1.00 8.07  ? 13  ASN A CA  1 
ATOM   91   C  C   . ASN A 1 13  ? -2.010  12.887  15.421  1.00 7.18  ? 13  ASN A C   1 
ATOM   92   O  O   . ASN A 1 13  ? -1.808  13.493  14.369  1.00 6.94  ? 13  ASN A O   1 
ATOM   93   C  CB  . ASN A 1 13  ? -1.949  10.469  14.639  1.00 8.41  ? 13  ASN A CB  1 
ATOM   94   C  CG  . ASN A 1 13  ? -0.494  10.207  14.948  1.00 8.60  ? 13  ASN A CG  1 
ATOM   95   O  OD1 . ASN A 1 13  ? 0.090   10.940  15.743  1.00 7.34  ? 13  ASN A OD1 1 
ATOM   96   N  ND2 . ASN A 1 13  ? 0.087   9.192   14.289  1.00 7.34  ? 13  ASN A ND2 1 
ATOM   97   N  N   . PRO A 1 14  ? -1.566  13.419  16.571  1.00 6.63  ? 14  PRO A N   1 
ATOM   98   C  CA  . PRO A 1 14  ? -0.882  14.694  16.687  1.00 7.17  ? 14  PRO A CA  1 
ATOM   99   C  C   . PRO A 1 14  ? 0.288   14.894  15.770  1.00 7.59  ? 14  PRO A C   1 
ATOM   100  O  O   . PRO A 1 14  ? 0.546   16.038  15.327  1.00 7.79  ? 14  PRO A O   1 
ATOM   101  C  CB  . PRO A 1 14  ? -0.450  14.733  18.163  1.00 7.61  ? 14  PRO A CB  1 
ATOM   102  C  CG  . PRO A 1 14  ? -1.533  13.950  18.846  1.00 8.24  ? 14  PRO A CG  1 
ATOM   103  C  CD  . PRO A 1 14  ? -1.769  12.772  17.907  1.00 6.90  ? 14  PRO A CD  1 
ATOM   104  N  N   . PHE A 1 15  ? 1.034   13.841  15.403  1.00 4.56  ? 15  PHE A N   1 
ATOM   105  C  CA  . PHE A 1 15  ? 2.117   13.924  14.468  1.00 6.15  ? 15  PHE A CA  1 
ATOM   106  C  C   . PHE A 1 15  ? 1.641   14.552  13.144  1.00 5.99  ? 15  PHE A C   1 
ATOM   107  O  O   . PHE A 1 15  ? 2.337   15.374  12.568  1.00 6.25  ? 15  PHE A O   1 
ATOM   108  C  CB  . PHE A 1 15  ? 2.641   12.493  14.194  1.00 6.20  ? 15  PHE A CB  1 
ATOM   109  C  CG  . PHE A 1 15  ? 3.729   12.430  13.174  1.00 6.82  ? 15  PHE A CG  1 
ATOM   110  C  CD1 . PHE A 1 15  ? 5.061   12.609  13.557  1.00 4.55  ? 15  PHE A CD1 1 
ATOM   111  C  CD2 . PHE A 1 15  ? 3.454   12.170  11.839  1.00 4.59  ? 15  PHE A CD2 1 
ATOM   112  C  CE1 . PHE A 1 15  ? 6.082   12.531  12.662  1.00 4.75  ? 15  PHE A CE1 1 
ATOM   113  C  CE2 . PHE A 1 15  ? 4.500   12.112  10.940  1.00 6.06  ? 15  PHE A CE2 1 
ATOM   114  C  CZ  . PHE A 1 15  ? 5.830   12.246  11.319  1.00 5.72  ? 15  PHE A CZ  1 
ATOM   115  N  N   . TRP A 1 16  ? 0.521   14.076  12.632  1.00 7.40  ? 16  TRP A N   1 
ATOM   116  C  CA  . TRP A 1 16  ? -0.035  14.566  11.368  1.00 8.47  ? 16  TRP A CA  1 
ATOM   117  C  C   . TRP A 1 16  ? -0.631  15.960  11.571  1.00 7.84  ? 16  TRP A C   1 
ATOM   118  O  O   . TRP A 1 16  ? -0.543  16.768  10.662  1.00 8.30  ? 16  TRP A O   1 
ATOM   119  C  CB  . TRP A 1 16  ? -1.066  13.587  10.756  1.00 7.46  ? 16  TRP A CB  1 
ATOM   120  C  CG  . TRP A 1 16  ? -0.328  12.289  10.488  1.00 6.35  ? 16  TRP A CG  1 
ATOM   121  C  CD1 . TRP A 1 16  ? -0.414  11.155  11.207  1.00 4.70  ? 16  TRP A CD1 1 
ATOM   122  C  CD2 . TRP A 1 16  ? 0.638   12.053  9.471   1.00 5.35  ? 16  TRP A CD2 1 
ATOM   123  N  NE1 . TRP A 1 16  ? 0.458   10.224  10.696  1.00 5.03  ? 16  TRP A NE1 1 
ATOM   124  C  CE2 . TRP A 1 16  ? 1.111   10.740  9.638   1.00 4.69  ? 16  TRP A CE2 1 
ATOM   125  C  CE3 . TRP A 1 16  ? 1.185   12.831  8.440   1.00 6.68  ? 16  TRP A CE3 1 
ATOM   126  C  CZ2 . TRP A 1 16  ? 2.080   10.207  8.804   1.00 3.76  ? 16  TRP A CZ2 1 
ATOM   127  C  CZ3 . TRP A 1 16  ? 2.133   12.291  7.622   1.00 5.18  ? 16  TRP A CZ3 1 
ATOM   128  C  CH2 . TRP A 1 16  ? 2.590   10.976  7.804   1.00 5.49  ? 16  TRP A CH2 1 
ATOM   129  N  N   . VAL A 1 17  ? -1.177  16.241  12.736  1.00 7.82  ? 17  VAL A N   1 
ATOM   130  C  CA  . VAL A 1 17  ? -1.738  17.561  13.056  1.00 9.47  ? 17  VAL A CA  1 
ATOM   131  C  C   . VAL A 1 17  ? -0.616  18.596  13.001  1.00 9.44  ? 17  VAL A C   1 
ATOM   132  O  O   . VAL A 1 17  ? -0.718  19.677  12.406  1.00 8.38  ? 17  VAL A O   1 
ATOM   133  C  CB  . VAL A 1 17  ? -2.395  17.572  14.431  1.00 10.38 ? 17  VAL A CB  1 
ATOM   134  C  CG1 . VAL A 1 17  ? -2.752  18.972  14.941  1.00 10.74 ? 17  VAL A CG1 1 
ATOM   135  C  CG2 . VAL A 1 17  ? -3.686  16.743  14.472  1.00 10.21 ? 17  VAL A CG2 1 
ATOM   136  N  N   . ASP A 1 18  ? 0.563   18.248  13.542  1.00 7.76  ? 18  ASP A N   1 
ATOM   137  C  CA  . ASP A 1 18  ? 1.692   19.178  13.518  1.00 6.31  ? 18  ASP A CA  1 
ATOM   138  C  C   . ASP A 1 18  ? 2.286   19.297  12.134  1.00 8.31  ? 18  ASP A C   1 
ATOM   139  O  O   . ASP A 1 18  ? 2.768   20.369  11.727  1.00 7.00  ? 18  ASP A O   1 
ATOM   140  C  CB  . ASP A 1 18  ? 2.763   18.684  14.504  1.00 7.62  ? 18  ASP A CB  1 
ATOM   141  C  CG  . ASP A 1 18  ? 2.294   18.765  15.932  1.00 7.55  ? 18  ASP A CG  1 
ATOM   142  O  OD1 . ASP A 1 18  ? 1.233   19.369  16.192  1.00 8.49  ? 18  ASP A OD1 1 
ATOM   143  O  OD2 . ASP A 1 18  ? 3.047   18.193  16.777  1.00 9.37  ? 18  ASP A OD2 1 
ATOM   144  N  N   . MET A 1 19  ? 2.238   18.204  11.361  1.00 6.79  ? 19  MET A N   1 
ATOM   145  C  CA  . MET A 1 19  ? 2.723   18.286  9.981   1.00 6.56  ? 19  MET A CA  1 
ATOM   146  C  C   . MET A 1 19  ? 1.822   19.244  9.181   1.00 7.20  ? 19  MET A C   1 
ATOM   147  O  O   . MET A 1 19  ? 2.352   20.083  8.467   1.00 7.87  ? 19  MET A O   1 
ATOM   148  C  CB  . MET A 1 19  ? 2.820   16.936  9.282   1.00 6.20  ? 19  MET A CB  1 
ATOM   149  C  CG  . MET A 1 19  ? 3.591   17.034  7.970   1.00 4.65  ? 19  MET A CG  1 
ATOM   150  S  SD  . MET A 1 19  ? 3.834   15.484  7.094   1.00 6.32  ? 19  MET A SD  1 
ATOM   151  C  CE  . MET A 1 19  ? 4.793   14.562  8.336   1.00 6.27  ? 19  MET A CE  1 
ATOM   152  N  N   . LYS A 1 20  ? 0.523   19.239  9.387   1.00 8.96  ? 20  LYS A N   1 
ATOM   153  C  CA  . LYS A 1 20  ? -0.392  20.162  8.687   1.00 9.47  ? 20  LYS A CA  1 
ATOM   154  C  C   . LYS A 1 20  ? -0.088  21.636  8.948   1.00 10.53 ? 20  LYS A C   1 
ATOM   155  O  O   . LYS A 1 20  ? 0.041   22.486  8.065   1.00 8.09  ? 20  LYS A O   1 
ATOM   156  C  CB  . LYS A 1 20  ? -1.808  19.784  9.150   1.00 10.34 ? 20  LYS A CB  1 
ATOM   157  C  CG  . LYS A 1 20  ? -2.897  20.751  8.647   1.00 11.82 ? 20  LYS A CG  1 
ATOM   158  C  CD  . LYS A 1 20  ? -4.260  20.068  8.764   1.00 12.10 ? 20  LYS A CD  1 
ATOM   159  C  CE  . LYS A 1 20  ? -5.408  20.995  8.351   1.00 14.85 ? 20  LYS A CE  1 
ATOM   160  N  NZ  . LYS A 1 20  ? -5.343  22.206  9.228   1.00 16.15 ? 20  LYS A NZ  1 
ATOM   161  N  N   . LYS A 1 21  ? 0.096   21.964  10.225  1.00 10.27 ? 21  LYS A N   1 
ATOM   162  C  CA  . LYS A 1 21  ? 0.530   23.281  10.682  1.00 11.53 ? 21  LYS A CA  1 
ATOM   163  C  C   . LYS A 1 21  ? 1.845   23.702  10.043  1.00 10.53 ? 21  LYS A C   1 
ATOM   164  O  O   . LYS A 1 21  ? 1.973   24.834  9.548   1.00 8.86  ? 21  LYS A O   1 
ATOM   165  C  CB  . LYS A 1 21  ? 0.592   23.268  12.217  1.00 14.55 ? 21  LYS A CB  1 
ATOM   166  C  CG  . LYS A 1 21  ? 1.070   24.579  12.832  1.00 14.86 ? 21  LYS A CG  1 
ATOM   167  C  CD  . LYS A 1 21  ? -0.043  25.494  13.233  1.00 19.03 ? 21  LYS A CD  1 
ATOM   168  C  CE  . LYS A 1 21  ? -1.368  24.937  13.689  1.00 20.70 ? 21  LYS A CE  1 
ATOM   169  N  NZ  . LYS A 1 21  ? -1.756  25.448  15.058  1.00 21.31 ? 21  LYS A NZ  1 
ATOM   170  N  N   . GLY A 1 22  ? 2.863   22.831  9.966   1.00 8.89  ? 22  GLY A N   1 
ATOM   171  C  CA  . GLY A 1 22  ? 4.125   23.154  9.335   1.00 7.02  ? 22  GLY A CA  1 
ATOM   172  C  C   . GLY A 1 22  ? 3.964   23.525  7.867   1.00 9.22  ? 22  GLY A C   1 
ATOM   173  O  O   . GLY A 1 22  ? 4.570   24.458  7.330   1.00 7.15  ? 22  GLY A O   1 
ATOM   174  N  N   . ILE A 1 23  ? 3.134   22.710  7.194   1.00 7.69  ? 23  ILE A N   1 
ATOM   175  C  CA  . ILE A 1 23  ? 2.833   22.951  5.783   1.00 7.19  ? 23  ILE A CA  1 
ATOM   176  C  C   . ILE A 1 23  ? 2.097   24.281  5.636   1.00 7.02  ? 23  ILE A C   1 
ATOM   177  O  O   . ILE A 1 23  ? 2.473   25.113  4.809   1.00 8.01  ? 23  ILE A O   1 
ATOM   178  C  CB  . ILE A 1 23  ? 1.975   21.809  5.230   1.00 7.60  ? 23  ILE A CB  1 
ATOM   179  C  CG1 . ILE A 1 23  ? 2.818   20.529  5.141   1.00 7.02  ? 23  ILE A CG1 1 
ATOM   180  C  CG2 . ILE A 1 23  ? 1.502   22.195  3.812   1.00 8.00  ? 23  ILE A CG2 1 
ATOM   181  C  CD1 . ILE A 1 23  ? 1.989   19.293  4.802   1.00 9.43  ? 23  ILE A CD1 1 
ATOM   182  N  N   . GLU A 1 24  ? 1.131   24.530  6.504   1.00 8.55  ? 24  GLU A N   1 
ATOM   183  C  CA  . GLU A 1 24  ? 0.370   25.798  6.435   1.00 9.93  ? 24  GLU A CA  1 
ATOM   184  C  C   . GLU A 1 24  ? 1.314   26.987  6.601   1.00 11.63 ? 24  GLU A C   1 
ATOM   185  O  O   . GLU A 1 24  ? 1.225   27.999  5.878   1.00 10.67 ? 24  GLU A O   1 
ATOM   186  C  CB  . GLU A 1 24  ? -0.752  25.822  7.452   1.00 9.95  ? 24  GLU A CB  1 
ATOM   187  C  CG  . GLU A 1 24  ? -1.871  24.816  7.139   1.00 10.15 ? 24  GLU A CG  1 
ATOM   188  C  CD  . GLU A 1 24  ? -2.856  24.628  8.260   1.00 11.42 ? 24  GLU A CD  1 
ATOM   189  O  OE1 . GLU A 1 24  ? -2.598  25.008  9.413   1.00 9.35  ? 24  GLU A OE1 1 
ATOM   190  O  OE2 . GLU A 1 24  ? -3.946  24.044  8.044   1.00 14.04 ? 24  GLU A OE2 1 
ATOM   191  N  N   . ASP A 1 25  ? 2.215   26.855  7.580   1.00 10.84 ? 25  ASP A N   1 
ATOM   192  C  CA  . ASP A 1 25  ? 3.157   27.956  7.814   1.00 12.01 ? 25  ASP A CA  1 
ATOM   193  C  C   . ASP A 1 25  ? 4.076   28.171  6.632   1.00 10.85 ? 25  ASP A C   1 
ATOM   194  O  O   . ASP A 1 25  ? 4.300   29.299  6.209   1.00 10.74 ? 25  ASP A O   1 
ATOM   195  C  CB  . ASP A 1 25  ? 3.969   27.710  9.087   1.00 13.04 ? 25  ASP A CB  1 
ATOM   196  C  CG  . ASP A 1 25  ? 3.154   27.883  10.341  1.00 15.05 ? 25  ASP A CG  1 
ATOM   197  O  OD1 . ASP A 1 25  ? 2.062   28.499  10.346  1.00 15.25 ? 25  ASP A OD1 1 
ATOM   198  O  OD2 . ASP A 1 25  ? 3.628   27.376  11.387  1.00 16.20 ? 25  ASP A OD2 1 
ATOM   199  N  N   . GLU A 1 26  ? 4.604   27.091  6.054   1.00 9.22  ? 26  GLU A N   1 
ATOM   200  C  CA  . GLU A 1 26  ? 5.473   27.142  4.912   1.00 8.21  ? 26  GLU A CA  1 
ATOM   201  C  C   . GLU A 1 26  ? 4.727   27.688  3.685   1.00 6.54  ? 26  GLU A C   1 
ATOM   202  O  O   . GLU A 1 26  ? 5.327   28.415  2.907   1.00 7.54  ? 26  GLU A O   1 
ATOM   203  C  CB  . GLU A 1 26  ? 6.067   25.758  4.628   1.00 7.25  ? 26  GLU A CB  1 
ATOM   204  C  CG  . GLU A 1 26  ? 7.124   25.741  3.541   1.00 8.32  ? 26  GLU A CG  1 
ATOM   205  C  CD  . GLU A 1 26  ? 8.411   26.484  3.829   1.00 11.83 ? 26  GLU A CD  1 
ATOM   206  O  OE1 . GLU A 1 26  ? 8.733   26.822  4.978   1.00 10.62 ? 26  GLU A OE1 1 
ATOM   207  O  OE2 . GLU A 1 26  ? 9.138   26.706  2.838   1.00 13.10 ? 26  GLU A OE2 1 
ATOM   208  N  N   . ALA A 1 27  ? 3.448   27.389  3.545   1.00 7.91  ? 27  ALA A N   1 
ATOM   209  C  CA  . ALA A 1 27  ? 2.686   27.845  2.382   1.00 8.53  ? 27  ALA A CA  1 
ATOM   210  C  C   . ALA A 1 27  ? 2.624   29.376  2.361   1.00 9.01  ? 27  ALA A C   1 
ATOM   211  O  O   . ALA A 1 27  ? 2.817   30.028  1.332   1.00 9.60  ? 27  ALA A O   1 
ATOM   212  C  CB  . ALA A 1 27  ? 1.267   27.286  2.446   1.00 8.53  ? 27  ALA A CB  1 
ATOM   213  N  N   . LYS A 1 28  ? 2.416   29.932  3.550   1.00 11.47 ? 28  LYS A N   1 
ATOM   214  C  CA  . LYS A 1 28  ? 2.414   31.406  3.681   1.00 12.37 ? 28  LYS A CA  1 
ATOM   215  C  C   . LYS A 1 28  ? 3.791   31.923  3.337   1.00 11.73 ? 28  LYS A C   1 
ATOM   216  O  O   . LYS A 1 28  ? 3.900   32.876  2.572   1.00 12.48 ? 28  LYS A O   1 
ATOM   217  C  CB  . LYS A 1 28  ? 2.044   31.775  5.107   1.00 12.07 ? 28  LYS A CB  1 
ATOM   218  C  CG  . LYS A 1 28  ? 0.579   31.578  5.472   1.00 14.97 ? 28  LYS A CG  1 
ATOM   219  C  CD  . LYS A 1 28  ? 0.503   31.350  6.984   1.00 16.54 ? 28  LYS A CD  1 
ATOM   220  C  CE  . LYS A 1 28  ? -0.864  31.679  7.523   1.00 18.83 ? 28  LYS A CE  1 
ATOM   221  N  NZ  . LYS A 1 28  ? -0.865  31.590  9.027   1.00 20.90 ? 28  LYS A NZ  1 
ATOM   222  N  N   . THR A 1 29  ? 4.893   31.279  3.782   1.00 11.19 ? 29  THR A N   1 
ATOM   223  C  CA  . THR A 1 29  ? 6.229   31.795  3.441   1.00 12.14 ? 29  THR A CA  1 
ATOM   224  C  C   . THR A 1 29  ? 6.506   31.777  1.957   1.00 12.12 ? 29  THR A C   1 
ATOM   225  O  O   . THR A 1 29  ? 7.118   32.685  1.364   1.00 13.12 ? 29  THR A O   1 
ATOM   226  C  CB  . THR A 1 29  ? 7.255   30.977  4.272   1.00 13.38 ? 29  THR A CB  1 
ATOM   227  O  OG1 . THR A 1 29  ? 6.901   31.233  5.639   1.00 11.41 ? 29  THR A OG1 1 
ATOM   228  C  CG2 . THR A 1 29  ? 8.709   31.310  4.061   1.00 14.90 ? 29  THR A CG2 1 
ATOM   229  N  N   . LEU A 1 30  ? 6.043   30.736  1.273   1.00 9.62  ? 30  LEU A N   1 
ATOM   230  C  CA  . LEU A 1 30  ? 6.281   30.558  -0.141  1.00 10.59 ? 30  LEU A CA  1 
ATOM   231  C  C   . LEU A 1 30  ? 5.257   31.283  -1.005  1.00 10.86 ? 30  LEU A C   1 
ATOM   232  O  O   . LEU A 1 30  ? 5.586   31.452  -2.187  1.00 10.23 ? 30  LEU A O   1 
ATOM   233  C  CB  . LEU A 1 30  ? 6.278   29.057  -0.479  1.00 10.76 ? 30  LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 30  ? 7.414   28.267  0.224   1.00 11.44 ? 30  LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 30  ? 7.309   26.807  -0.183  1.00 11.31 ? 30  LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 30  ? 8.785   28.843  -0.093  1.00 10.75 ? 30  LEU A CD2 1 
ATOM   237  N  N   . GLY A 1 31  ? 4.115   31.652  -0.454  1.00 10.83 ? 31  GLY A N   1 
ATOM   238  C  CA  . GLY A 1 31  ? 3.111   32.380  -1.254  1.00 12.03 ? 31  GLY A CA  1 
ATOM   239  C  C   . GLY A 1 31  ? 2.231   31.406  -2.026  1.00 14.46 ? 31  GLY A C   1 
ATOM   240  O  O   . GLY A 1 31  ? 1.799   31.765  -3.125  1.00 15.33 ? 31  GLY A O   1 
ATOM   241  N  N   . VAL A 1 32  ? 2.065   30.162  -1.565  1.00 11.68 ? 32  VAL A N   1 
ATOM   242  C  CA  . VAL A 1 32  ? 1.361   29.193  -2.401  1.00 11.37 ? 32  VAL A CA  1 
ATOM   243  C  C   . VAL A 1 32  ? 0.049   28.771  -1.777  1.00 11.41 ? 32  VAL A C   1 
ATOM   244  O  O   . VAL A 1 32  ? -0.081  28.743  -0.554  1.00 11.04 ? 32  VAL A O   1 
ATOM   245  C  CB  . VAL A 1 32  ? 2.218   27.955  -2.764  1.00 11.22 ? 32  VAL A CB  1 
ATOM   246  C  CG1 . VAL A 1 32  ? 3.418   28.314  -3.636  1.00 9.66  ? 32  VAL A CG1 1 
ATOM   247  C  CG2 . VAL A 1 32  ? 2.678   27.219  -1.515  1.00 6.67  ? 32  VAL A CG2 1 
ATOM   248  N  N   . SER A 1 33  ? -0.928  28.426  -2.638  1.00 9.95  ? 33  SER A N   1 
ATOM   249  C  CA  . SER A 1 33  ? -2.218  27.987  -2.122  1.00 9.30  ? 33  SER A CA  1 
ATOM   250  C  C   . SER A 1 33  ? -2.148  26.473  -1.939  1.00 10.33 ? 33  SER A C   1 
ATOM   251  O  O   . SER A 1 33  ? -1.729  25.742  -2.845  1.00 11.20 ? 33  SER A O   1 
ATOM   252  C  CB  . SER A 1 33  ? -3.375  28.376  -3.069  1.00 8.60  ? 33  SER A CB  1 
ATOM   253  O  OG  . SER A 1 33  ? -3.030  28.019  -4.388  1.00 10.87 ? 33  SER A OG  1 
ATOM   254  N  N   . VAL A 1 34  ? -2.482  25.992  -0.760  1.00 10.12 ? 34  VAL A N   1 
ATOM   255  C  CA  . VAL A 1 34  ? -2.388  24.559  -0.468  1.00 10.56 ? 34  VAL A CA  1 
ATOM   256  C  C   . VAL A 1 34  ? -3.692  24.078  0.165   1.00 11.00 ? 34  VAL A C   1 
ATOM   257  O  O   . VAL A 1 34  ? -4.189  24.719  1.084   1.00 10.72 ? 34  VAL A O   1 
ATOM   258  C  CB  . VAL A 1 34  ? -1.246  24.180  0.495   1.00 10.66 ? 34  VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 34  ? -1.054  22.670  0.590   1.00 10.45 ? 34  VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 34  ? 0.117   24.733  0.086   1.00 13.13 ? 34  VAL A CG2 1 
ATOM   261  N  N   . ASP A 1 35  ? -4.186  22.939  -0.346  1.00 9.15  ? 35  ASP A N   1 
ATOM   262  C  CA  . ASP A 1 35  ? -5.350  22.316  0.264   1.00 8.82  ? 35  ASP A CA  1 
ATOM   263  C  C   . ASP A 1 35  ? -4.796  21.054  0.985   1.00 8.55  ? 35  ASP A C   1 
ATOM   264  O  O   . ASP A 1 35  ? -4.046  20.334  0.360   1.00 9.16  ? 35  ASP A O   1 
ATOM   265  C  CB  . ASP A 1 35  ? -6.409  21.851  -0.717  1.00 11.43 ? 35  ASP A CB  1 
ATOM   266  C  CG  . ASP A 1 35  ? -7.040  23.040  -1.447  1.00 12.77 ? 35  ASP A CG  1 
ATOM   267  O  OD1 . ASP A 1 35  ? -7.208  24.089  -0.817  1.00 10.88 ? 35  ASP A OD1 1 
ATOM   268  O  OD2 . ASP A 1 35  ? -7.304  22.795  -2.637  1.00 16.21 ? 35  ASP A OD2 1 
ATOM   269  N  N   . ILE A 1 36  ? -5.125  20.924  2.253   1.00 10.05 ? 36  ILE A N   1 
ATOM   270  C  CA  . ILE A 1 36  ? -4.561  19.800  3.021   1.00 11.47 ? 36  ILE A CA  1 
ATOM   271  C  C   . ILE A 1 36  ? -5.665  18.861  3.484   1.00 10.54 ? 36  ILE A C   1 
ATOM   272  O  O   . ILE A 1 36  ? -6.662  19.292  4.069   1.00 11.11 ? 36  ILE A O   1 
ATOM   273  C  CB  . ILE A 1 36  ? -3.828  20.356  4.245   1.00 11.36 ? 36  ILE A CB  1 
ATOM   274  C  CG1 . ILE A 1 36  ? -2.697  21.305  3.857   1.00 10.21 ? 36  ILE A CG1 1 
ATOM   275  C  CG2 . ILE A 1 36  ? -3.300  19.189  5.099   1.00 10.13 ? 36  ILE A CG2 1 
ATOM   276  C  CD1 . ILE A 1 36  ? -2.027  22.021  5.014   1.00 10.11 ? 36  ILE A CD1 1 
ATOM   277  N  N   . PHE A 1 37  ? -5.488  17.578  3.170   1.00 10.80 ? 37  PHE A N   1 
ATOM   278  C  CA  . PHE A 1 37  ? -6.485  16.564  3.467   1.00 11.29 ? 37  PHE A CA  1 
ATOM   279  C  C   . PHE A 1 37  ? -5.770  15.402  4.184   1.00 10.77 ? 37  PHE A C   1 
ATOM   280  O  O   . PHE A 1 37  ? -4.545  15.365  4.201   1.00 10.33 ? 37  PHE A O   1 
ATOM   281  C  CB  . PHE A 1 37  ? -7.116  15.931  2.210   1.00 11.97 ? 37  PHE A CB  1 
ATOM   282  C  CG  . PHE A 1 37  ? -7.692  16.999  1.300   1.00 13.92 ? 37  PHE A CG  1 
ATOM   283  C  CD1 . PHE A 1 37  ? -6.901  17.587  0.337   1.00 14.48 ? 37  PHE A CD1 1 
ATOM   284  C  CD2 . PHE A 1 37  ? -9.004  17.396  1.473   1.00 16.22 ? 37  PHE A CD2 1 
ATOM   285  C  CE1 . PHE A 1 37  ? -7.440  18.570  -0.483  1.00 16.16 ? 37  PHE A CE1 1 
ATOM   286  C  CE2 . PHE A 1 37  ? -9.541  18.384  0.645   1.00 17.51 ? 37  PHE A CE2 1 
ATOM   287  C  CZ  . PHE A 1 37  ? -8.749  18.958  -0.324  1.00 14.81 ? 37  PHE A CZ  1 
ATOM   288  N  N   . ALA A 1 38  ? -6.623  14.587  4.762   1.00 11.49 ? 38  ALA A N   1 
ATOM   289  C  CA  . ALA A 1 38  ? -6.133  13.416  5.489   1.00 11.99 ? 38  ALA A CA  1 
ATOM   290  C  C   . ALA A 1 38  ? -7.228  12.367  5.444   1.00 14.40 ? 38  ALA A C   1 
ATOM   291  O  O   . ALA A 1 38  ? -8.396  12.760  5.332   1.00 13.15 ? 38  ALA A O   1 
ATOM   292  C  CB  . ALA A 1 38  ? -5.870  13.777  6.939   1.00 12.01 ? 38  ALA A CB  1 
ATOM   293  N  N   . SER A 1 39  ? -6.831  11.096  5.584   1.00 14.88 ? 39  SER A N   1 
ATOM   294  C  CA  . SER A 1 39  ? -7.890  10.084  5.668   1.00 16.47 ? 39  SER A CA  1 
ATOM   295  C  C   . SER A 1 39  ? -8.425  10.149  7.093   1.00 16.32 ? 39  SER A C   1 
ATOM   296  O  O   . SER A 1 39  ? -7.735  10.570  8.007   1.00 16.96 ? 39  SER A O   1 
ATOM   297  C  CB  . SER A 1 39  ? -7.377  8.679   5.419   1.00 15.65 ? 39  SER A CB  1 
ATOM   298  O  OG  . SER A 1 39  ? -6.257  8.640   4.583   1.00 21.02 ? 39  SER A OG  1 
ATOM   299  N  N   . PRO A 1 40  ? -9.623  9.617   7.315   1.00 18.40 ? 40  PRO A N   1 
ATOM   300  C  CA  . PRO A 1 40  ? -10.209 9.560   8.629   1.00 17.97 ? 40  PRO A CA  1 
ATOM   301  C  C   . PRO A 1 40  ? -9.444  8.672   9.590   1.00 18.64 ? 40  PRO A C   1 
ATOM   302  O  O   . PRO A 1 40  ? -9.352  9.021   10.774  1.00 21.70 ? 40  PRO A O   1 
ATOM   303  C  CB  . PRO A 1 40  ? -11.628 9.073   8.395   1.00 19.84 ? 40  PRO A CB  1 
ATOM   304  C  CG  . PRO A 1 40  ? -11.736 8.649   6.988   1.00 18.45 ? 40  PRO A CG  1 
ATOM   305  C  CD  . PRO A 1 40  ? -10.489 9.027   6.271   1.00 18.26 ? 40  PRO A CD  1 
ATOM   306  N  N   . SER A 1 41  ? -8.873  7.549   9.166   1.00 16.19 ? 41  SER A N   1 
ATOM   307  C  CA  . SER A 1 41  ? -8.203  6.671   10.132  1.00 13.44 ? 41  SER A CA  1 
ATOM   308  C  C   . SER A 1 41  ? -7.019  5.946   9.528   1.00 10.98 ? 41  SER A C   1 
ATOM   309  O  O   . SER A 1 41  ? -6.916  5.808   8.306   1.00 12.47 ? 41  SER A O   1 
ATOM   310  C  CB  . SER A 1 41  ? -9.175  5.576   10.624  1.00 14.29 ? 41  SER A CB  1 
ATOM   311  O  OG  . SER A 1 41  ? -10.067 6.199   11.530  1.00 18.93 ? 41  SER A OG  1 
ATOM   312  N  N   . GLU A 1 42  ? -6.205  5.339   10.409  1.00 8.69  ? 42  GLU A N   1 
ATOM   313  C  CA  . GLU A 1 42  ? -5.090  4.539   9.905   1.00 8.61  ? 42  GLU A CA  1 
ATOM   314  C  C   . GLU A 1 42  ? -5.543  3.390   9.006   1.00 10.00 ? 42  GLU A C   1 
ATOM   315  O  O   . GLU A 1 42  ? -4.778  3.047   8.086   1.00 11.52 ? 42  GLU A O   1 
ATOM   316  C  CB  . GLU A 1 42  ? -4.250  3.911   11.029  1.00 8.60  ? 42  GLU A CB  1 
ATOM   317  C  CG  . GLU A 1 42  ? -3.177  4.815   11.584  1.00 9.28  ? 42  GLU A CG  1 
ATOM   318  C  CD  . GLU A 1 42  ? -2.059  5.165   10.675  1.00 7.80  ? 42  GLU A CD  1 
ATOM   319  O  OE1 . GLU A 1 42  ? -1.671  4.427   9.743   1.00 6.66  ? 42  GLU A OE1 1 
ATOM   320  O  OE2 . GLU A 1 42  ? -1.524  6.287   10.844  1.00 10.37 ? 42  GLU A OE2 1 
ATOM   321  N  N   . GLY A 1 43  ? -6.683  2.768   9.255   1.00 10.69 ? 43  GLY A N   1 
ATOM   322  C  CA  . GLY A 1 43  ? -7.054  1.656   8.357   1.00 13.62 ? 43  GLY A CA  1 
ATOM   323  C  C   . GLY A 1 43  ? -7.777  2.023   7.075   1.00 14.46 ? 43  GLY A C   1 
ATOM   324  O  O   . GLY A 1 43  ? -8.303  1.158   6.371   1.00 13.09 ? 43  GLY A O   1 
ATOM   325  N  N   . ASP A 1 44  ? -7.788  3.264   6.625   1.00 13.62 ? 44  ASP A N   1 
ATOM   326  C  CA  . ASP A 1 44  ? -8.558  3.719   5.485   1.00 14.96 ? 44  ASP A CA  1 
ATOM   327  C  C   . ASP A 1 44  ? -7.786  3.694   4.183   1.00 14.12 ? 44  ASP A C   1 
ATOM   328  O  O   . ASP A 1 44  ? -7.727  4.709   3.484   1.00 12.76 ? 44  ASP A O   1 
ATOM   329  C  CB  . ASP A 1 44  ? -9.020  5.159   5.760   1.00 17.24 ? 44  ASP A CB  1 
ATOM   330  C  CG  . ASP A 1 44  ? -10.236 5.165   6.659   1.00 19.76 ? 44  ASP A CG  1 
ATOM   331  O  OD1 . ASP A 1 44  ? -11.014 4.180   6.565   1.00 22.56 ? 44  ASP A OD1 1 
ATOM   332  O  OD2 . ASP A 1 44  ? -10.407 6.102   7.450   1.00 20.56 ? 44  ASP A OD2 1 
ATOM   333  N  N   . PHE A 1 45  ? -7.115  2.582   3.874   1.00 11.85 ? 45  PHE A N   1 
ATOM   334  C  CA  . PHE A 1 45  ? -6.291  2.489   2.689   1.00 12.94 ? 45  PHE A CA  1 
ATOM   335  C  C   . PHE A 1 45  ? -7.094  2.818   1.433   1.00 12.35 ? 45  PHE A C   1 
ATOM   336  O  O   . PHE A 1 45  ? -6.633  3.548   0.568   1.00 10.79 ? 45  PHE A O   1 
ATOM   337  C  CB  . PHE A 1 45  ? -5.637  1.095   2.529   1.00 12.46 ? 45  PHE A CB  1 
ATOM   338  C  CG  . PHE A 1 45  ? -4.990  0.678   3.819   1.00 13.20 ? 45  PHE A CG  1 
ATOM   339  C  CD1 . PHE A 1 45  ? -3.788  1.276   4.206   1.00 14.20 ? 45  PHE A CD1 1 
ATOM   340  C  CD2 . PHE A 1 45  ? -5.590  -0.252  4.639   1.00 12.89 ? 45  PHE A CD2 1 
ATOM   341  C  CE1 . PHE A 1 45  ? -3.201  0.924   5.401   1.00 12.64 ? 45  PHE A CE1 1 
ATOM   342  C  CE2 . PHE A 1 45  ? -5.004  -0.585  5.852   1.00 13.39 ? 45  PHE A CE2 1 
ATOM   343  C  CZ  . PHE A 1 45  ? -3.817  0.013   6.225   1.00 13.02 ? 45  PHE A CZ  1 
ATOM   344  N  N   . GLN A 1 46  ? -8.264  2.202   1.353   1.00 13.55 ? 46  GLN A N   1 
ATOM   345  C  CA  . GLN A 1 46  ? -9.104  2.348   0.166   1.00 16.76 ? 46  GLN A CA  1 
ATOM   346  C  C   . GLN A 1 46  ? -9.615  3.762   -0.009  1.00 15.78 ? 46  GLN A C   1 
ATOM   347  O  O   . GLN A 1 46  ? -9.450  4.327   -1.087  1.00 16.57 ? 46  GLN A O   1 
ATOM   348  C  CB  . GLN A 1 46  ? -10.214 1.293   0.226   1.00 19.21 ? 46  GLN A CB  1 
ATOM   349  C  CG  . GLN A 1 46  ? -9.565  -0.109  0.164   1.00 22.72 ? 46  GLN A CG  1 
ATOM   350  C  CD  . GLN A 1 46  ? -10.623 -1.199  0.177   1.00 25.79 ? 46  GLN A CD  1 
ATOM   351  O  OE1 . GLN A 1 46  ? -10.928 -1.776  1.220   1.00 27.68 ? 46  GLN A OE1 1 
ATOM   352  N  NE2 . GLN A 1 46  ? -11.200 -1.473  -0.990  1.00 26.92 ? 46  GLN A NE2 1 
ATOM   353  N  N   . SER A 1 47  ? -10.121 4.371   1.043   1.00 16.73 ? 47  SER A N   1 
ATOM   354  C  CA  . SER A 1 47  ? -10.608 5.744   0.969   1.00 16.42 ? 47  SER A CA  1 
ATOM   355  C  C   . SER A 1 47  ? -9.462  6.719   0.780   1.00 15.23 ? 47  SER A C   1 
ATOM   356  O  O   . SER A 1 47  ? -9.687  7.747   0.128   1.00 13.84 ? 47  SER A O   1 
ATOM   357  C  CB  . SER A 1 47  ? -11.487 6.053   2.177   1.00 17.98 ? 47  SER A CB  1 
ATOM   358  O  OG  . SER A 1 47  ? -10.665 6.133   3.326   1.00 19.95 ? 47  SER A OG  1 
ATOM   359  N  N   . GLN A 1 48  ? -8.222  6.404   1.192   1.00 11.61 ? 48  GLN A N   1 
ATOM   360  C  CA  . GLN A 1 48  ? -7.112  7.298   0.875   1.00 10.46 ? 48  GLN A CA  1 
ATOM   361  C  C   . GLN A 1 48  ? -6.753  7.237   -0.599  1.00 10.28 ? 48  GLN A C   1 
ATOM   362  O  O   . GLN A 1 48  ? -6.383  8.234   -1.253  1.00 11.28 ? 48  GLN A O   1 
ATOM   363  C  CB  . GLN A 1 48  ? -5.847  6.975   1.698   1.00 9.93  ? 48  GLN A CB  1 
ATOM   364  C  CG  . GLN A 1 48  ? -4.866  8.175   1.641   1.00 8.57  ? 48  GLN A CG  1 
ATOM   365  C  CD  . GLN A 1 48  ? -3.520  7.739   2.215   1.00 9.23  ? 48  GLN A CD  1 
ATOM   366  O  OE1 . GLN A 1 48  ? -3.005  6.655   1.938   1.00 8.56  ? 48  GLN A OE1 1 
ATOM   367  N  NE2 . GLN A 1 48  ? -2.885  8.601   2.999   1.00 9.25  ? 48  GLN A NE2 1 
ATOM   368  N  N   . LEU A 1 49  ? -6.891  6.035   -1.173  1.00 13.21 ? 49  LEU A N   1 
ATOM   369  C  CA  . LEU A 1 49  ? -6.667  5.929   -2.616  1.00 15.42 ? 49  LEU A CA  1 
ATOM   370  C  C   . LEU A 1 49  ? -7.739  6.803   -3.290  1.00 15.08 ? 49  LEU A C   1 
ATOM   371  O  O   . LEU A 1 49  ? -7.392  7.594   -4.165  1.00 13.45 ? 49  LEU A O   1 
ATOM   372  C  CB  . LEU A 1 49  ? -6.680  4.506   -3.166  1.00 17.66 ? 49  LEU A CB  1 
ATOM   373  C  CG  . LEU A 1 49  ? -6.717  4.436   -4.706  1.00 18.41 ? 49  LEU A CG  1 
ATOM   374  C  CD1 . LEU A 1 49  ? -5.618  3.532   -5.238  1.00 19.36 ? 49  LEU A CD1 1 
ATOM   375  C  CD2 . LEU A 1 49  ? -8.084  3.938   -5.157  1.00 19.17 ? 49  LEU A CD2 1 
ATOM   376  N  N   . GLN A 1 50  ? -8.996  6.695   -2.871  1.00 16.50 ? 50  GLN A N   1 
ATOM   377  C  CA  . GLN A 1 50  ? -10.054 7.495   -3.486  1.00 17.66 ? 50  GLN A CA  1 
ATOM   378  C  C   . GLN A 1 50  ? -9.794  8.991   -3.307  1.00 17.23 ? 50  GLN A C   1 
ATOM   379  O  O   . GLN A 1 50  ? -10.073 9.808   -4.183  1.00 15.08 ? 50  GLN A O   1 
ATOM   380  C  CB  . GLN A 1 50  ? -11.454 7.219   -2.952  1.00 20.51 ? 50  GLN A CB  1 
ATOM   381  C  CG  . GLN A 1 50  ? -11.812 5.841   -2.476  1.00 25.00 ? 50  GLN A CG  1 
ATOM   382  C  CD  . GLN A 1 50  ? -11.753 4.717   -3.466  1.00 27.06 ? 50  GLN A CD  1 
ATOM   383  O  OE1 . GLN A 1 50  ? -11.258 4.838   -4.593  1.00 29.26 ? 50  GLN A OE1 1 
ATOM   384  N  NE2 . GLN A 1 50  ? -12.286 3.574   -3.038  1.00 27.82 ? 50  GLN A NE2 1 
ATOM   385  N  N   . LEU A 1 51  ? -9.361  9.377   -2.095  1.00 15.96 ? 51  LEU A N   1 
ATOM   386  C  CA  . LEU A 1 51  ? -9.048  10.783  -1.823  1.00 15.87 ? 51  LEU A CA  1 
ATOM   387  C  C   . LEU A 1 51  ? -7.975  11.269  -2.783  1.00 16.46 ? 51  LEU A C   1 
ATOM   388  O  O   . LEU A 1 51  ? -8.116  12.277  -3.487  1.00 15.52 ? 51  LEU A O   1 
ATOM   389  C  CB  . LEU A 1 51  ? -8.623  10.958  -0.368  1.00 17.02 ? 51  LEU A CB  1 
ATOM   390  C  CG  . LEU A 1 51  ? -7.939  12.273  0.022   1.00 18.39 ? 51  LEU A CG  1 
ATOM   391  C  CD1 . LEU A 1 51  ? -8.793  13.476  -0.319  1.00 18.68 ? 51  LEU A CD1 1 
ATOM   392  C  CD2 . LEU A 1 51  ? -7.562  12.213  1.506   1.00 17.89 ? 51  LEU A CD2 1 
ATOM   393  N  N   . PHE A 1 52  ? -6.889  10.503  -2.915  1.00 15.99 ? 52  PHE A N   1 
ATOM   394  C  CA  . PHE A 1 52  ? -5.799  10.835  -3.811  1.00 15.82 ? 52  PHE A CA  1 
ATOM   395  C  C   . PHE A 1 52  ? -6.319  10.938  -5.249  1.00 16.89 ? 52  PHE A C   1 
ATOM   396  O  O   . PHE A 1 52  ? -5.936  11.868  -5.977  1.00 16.05 ? 52  PHE A O   1 
ATOM   397  C  CB  . PHE A 1 52  ? -4.680  9.789   -3.759  1.00 15.51 ? 52  PHE A CB  1 
ATOM   398  C  CG  . PHE A 1 52  ? -3.399  10.285  -4.390  1.00 15.46 ? 52  PHE A CG  1 
ATOM   399  C  CD1 . PHE A 1 52  ? -3.201  10.252  -5.752  1.00 13.25 ? 52  PHE A CD1 1 
ATOM   400  C  CD2 . PHE A 1 52  ? -2.373  10.754  -3.561  1.00 14.92 ? 52  PHE A CD2 1 
ATOM   401  C  CE1 . PHE A 1 52  ? -2.036  10.711  -6.315  1.00 14.08 ? 52  PHE A CE1 1 
ATOM   402  C  CE2 . PHE A 1 52  ? -1.206  11.214  -4.132  1.00 14.50 ? 52  PHE A CE2 1 
ATOM   403  C  CZ  . PHE A 1 52  ? -1.028  11.206  -5.490  1.00 14.09 ? 52  PHE A CZ  1 
ATOM   404  N  N   . GLU A 1 53  ? -7.163  9.967   -5.632  1.00 16.50 ? 53  GLU A N   1 
ATOM   405  C  CA  . GLU A 1 53  ? -7.691  10.020  -7.003  1.00 18.36 ? 53  GLU A CA  1 
ATOM   406  C  C   . GLU A 1 53  ? -8.529  11.265  -7.203  1.00 17.55 ? 53  GLU A C   1 
ATOM   407  O  O   . GLU A 1 53  ? -8.354  11.912  -8.244  1.00 17.12 ? 53  GLU A O   1 
ATOM   408  C  CB  . GLU A 1 53  ? -8.474  8.761   -7.374  1.00 20.77 ? 53  GLU A CB  1 
ATOM   409  C  CG  . GLU A 1 53  ? -7.583  7.526   -7.367  1.00 24.76 ? 53  GLU A CG  1 
ATOM   410  C  CD  . GLU A 1 53  ? -6.969  7.200   -8.705  1.00 28.46 ? 53  GLU A CD  1 
ATOM   411  O  OE1 . GLU A 1 53  ? -6.734  8.111   -9.523  1.00 29.70 ? 53  GLU A OE1 1 
ATOM   412  O  OE2 . GLU A 1 53  ? -6.701  5.994   -8.953  1.00 30.25 ? 53  GLU A OE2 1 
ATOM   413  N  N   . ASP A 1 54  ? -9.391  11.621  -6.261  1.00 18.39 ? 54  ASP A N   1 
ATOM   414  C  CA  . ASP A 1 54  ? -10.197 12.832  -6.394  1.00 19.89 ? 54  ASP A CA  1 
ATOM   415  C  C   . ASP A 1 54  ? -9.335  14.087  -6.530  1.00 20.13 ? 54  ASP A C   1 
ATOM   416  O  O   . ASP A 1 54  ? -9.699  14.991  -7.277  1.00 17.78 ? 54  ASP A O   1 
ATOM   417  C  CB  . ASP A 1 54  ? -11.149 13.032  -5.218  1.00 23.35 ? 54  ASP A CB  1 
ATOM   418  C  CG  . ASP A 1 54  ? -12.033 14.260  -5.364  1.00 26.92 ? 54  ASP A CG  1 
ATOM   419  O  OD1 . ASP A 1 54  ? -12.939 14.290  -6.240  1.00 28.41 ? 54  ASP A OD1 1 
ATOM   420  O  OD2 . ASP A 1 54  ? -11.824 15.240  -4.610  1.00 28.97 ? 54  ASP A OD2 1 
ATOM   421  N  N   . LEU A 1 55  ? -8.215  14.182  -5.798  1.00 17.52 ? 55  LEU A N   1 
ATOM   422  C  CA  . LEU A 1 55  ? -7.379  15.372  -5.890  1.00 16.99 ? 55  LEU A CA  1 
ATOM   423  C  C   . LEU A 1 55  ? -6.568  15.362  -7.176  1.00 15.99 ? 55  LEU A C   1 
ATOM   424  O  O   . LEU A 1 55  ? -6.391  16.379  -7.839  1.00 15.20 ? 55  LEU A O   1 
ATOM   425  C  CB  . LEU A 1 55  ? -6.402  15.476  -4.708  1.00 15.86 ? 55  LEU A CB  1 
ATOM   426  C  CG  . LEU A 1 55  ? -7.023  15.262  -3.322  1.00 17.12 ? 55  LEU A CG  1 
ATOM   427  C  CD1 . LEU A 1 55  ? -5.939  15.154  -2.259  1.00 13.12 ? 55  LEU A CD1 1 
ATOM   428  C  CD2 . LEU A 1 55  ? -7.996  16.381  -3.009  1.00 16.90 ? 55  LEU A CD2 1 
ATOM   429  N  N   . SER A 1 56  ? -6.091  14.181  -7.564  1.00 14.52 ? 56  SER A N   1 
ATOM   430  C  CA  . SER A 1 56  ? -5.344  14.005  -8.793  1.00 16.69 ? 56  SER A CA  1 
ATOM   431  C  C   . SER A 1 56  ? -6.247  14.347  -9.997  1.00 18.54 ? 56  SER A C   1 
ATOM   432  O  O   . SER A 1 56  ? -5.727  14.831  -11.003 1.00 20.91 ? 56  SER A O   1 
ATOM   433  C  CB  . SER A 1 56  ? -4.866  12.573  -8.965  1.00 16.16 ? 56  SER A CB  1 
ATOM   434  O  OG  . SER A 1 56  ? -4.129  12.431  -10.172 1.00 18.05 ? 56  SER A OG  1 
ATOM   435  N  N   . ASN A 1 57  ? -7.540  14.112  -9.863  1.00 19.05 ? 57  ASN A N   1 
ATOM   436  C  CA  . ASN A 1 57  ? -8.494  14.422  -10.921 1.00 21.42 ? 57  ASN A CA  1 
ATOM   437  C  C   . ASN A 1 57  ? -8.809  15.907  -10.994 1.00 21.57 ? 57  ASN A C   1 
ATOM   438  O  O   . ASN A 1 57  ? -9.346  16.407  -11.994 1.00 23.01 ? 57  ASN A O   1 
ATOM   439  C  CB  . ASN A 1 57  ? -9.759  13.568  -10.739 1.00 20.69 ? 57  ASN A CB  1 
ATOM   440  C  CG  . ASN A 1 57  ? -9.504  12.143  -11.212 1.00 20.51 ? 57  ASN A CG  1 
ATOM   441  O  OD1 . ASN A 1 57  ? -8.671  11.908  -12.079 1.00 20.39 ? 57  ASN A OD1 1 
ATOM   442  N  ND2 . ASN A 1 57  ? -10.242 11.183  -10.652 1.00 20.19 ? 57  ASN A ND2 1 
ATOM   443  N  N   . LYS A 1 58  ? -8.517  16.663  -9.948  1.00 22.30 ? 58  LYS A N   1 
ATOM   444  C  CA  . LYS A 1 58  ? -8.668  18.130  -10.000 1.00 22.51 ? 58  LYS A CA  1 
ATOM   445  C  C   . LYS A 1 58  ? -7.398  18.625  -10.665 1.00 22.52 ? 58  LYS A C   1 
ATOM   446  O  O   . LYS A 1 58  ? -6.553  17.766  -10.978 1.00 25.00 ? 58  LYS A O   1 
ATOM   447  C  CB  . LYS A 1 58  ? -8.993  18.665  -8.622  1.00 23.85 ? 58  LYS A CB  1 
ATOM   448  C  CG  . LYS A 1 58  ? -10.110 17.930  -7.904  1.00 25.09 ? 58  LYS A CG  1 
ATOM   449  C  CD  . LYS A 1 58  ? -10.877 18.743  -6.895  1.00 26.80 ? 58  LYS A CD  1 
ATOM   450  C  CE  . LYS A 1 58  ? -12.022 17.977  -6.269  1.00 28.23 ? 58  LYS A CE  1 
ATOM   451  N  NZ  . LYS A 1 58  ? -12.667 18.705  -5.140  1.00 30.58 ? 58  LYS A NZ  1 
ATOM   452  N  N   . ASN A 1 59  ? -7.149  19.899  -10.965 1.00 22.69 ? 59  ASN A N   1 
ATOM   453  C  CA  . ASN A 1 59  ? -5.880  20.195  -11.643 1.00 19.74 ? 59  ASN A CA  1 
ATOM   454  C  C   . ASN A 1 59  ? -4.830  20.758  -10.695 1.00 18.16 ? 59  ASN A C   1 
ATOM   455  O  O   . ASN A 1 59  ? -4.170  21.739  -11.030 1.00 16.53 ? 59  ASN A O   1 
ATOM   456  C  CB  . ASN A 1 59  ? -6.091  21.128  -12.843 1.00 21.25 ? 59  ASN A CB  1 
ATOM   457  C  CG  . ASN A 1 59  ? -6.515  22.528  -12.471 1.00 22.56 ? 59  ASN A CG  1 
ATOM   458  O  OD1 . ASN A 1 59  ? -6.449  23.434  -13.311 1.00 23.70 ? 59  ASN A OD1 1 
ATOM   459  N  ND2 . ASN A 1 59  ? -6.920  22.721  -11.220 1.00 19.77 ? 59  ASN A ND2 1 
ATOM   460  N  N   . TYR A 1 60  ? -4.612  20.149  -9.517  1.00 15.21 ? 60  TYR A N   1 
ATOM   461  C  CA  . TYR A 1 60  ? -3.541  20.720  -8.677  1.00 14.84 ? 60  TYR A CA  1 
ATOM   462  C  C   . TYR A 1 60  ? -2.232  20.630  -9.433  1.00 13.82 ? 60  TYR A C   1 
ATOM   463  O  O   . TYR A 1 60  ? -2.105  19.606  -10.132 1.00 14.48 ? 60  TYR A O   1 
ATOM   464  C  CB  . TYR A 1 60  ? -3.313  19.871  -7.420  1.00 12.01 ? 60  TYR A CB  1 
ATOM   465  C  CG  . TYR A 1 60  ? -4.459  20.063  -6.459  1.00 11.08 ? 60  TYR A CG  1 
ATOM   466  C  CD1 . TYR A 1 60  ? -4.495  21.163  -5.631  1.00 11.88 ? 60  TYR A CD1 1 
ATOM   467  C  CD2 . TYR A 1 60  ? -5.516  19.172  -6.416  1.00 9.86  ? 60  TYR A CD2 1 
ATOM   468  C  CE1 . TYR A 1 60  ? -5.527  21.375  -4.755  1.00 10.34 ? 60  TYR A CE1 1 
ATOM   469  C  CE2 . TYR A 1 60  ? -6.558  19.363  -5.532  1.00 10.75 ? 60  TYR A CE2 1 
ATOM   470  C  CZ  . TYR A 1 60  ? -6.551  20.462  -4.703  1.00 10.35 ? 60  TYR A CZ  1 
ATOM   471  O  OH  . TYR A 1 60  ? -7.565  20.671  -3.811  1.00 13.29 ? 60  TYR A OH  1 
ATOM   472  N  N   . LYS A 1 61  ? -1.299  21.537  -9.212  1.00 11.52 ? 61  LYS A N   1 
ATOM   473  C  CA  . LYS A 1 61  ? -0.004  21.457  -9.837  1.00 10.70 ? 61  LYS A CA  1 
ATOM   474  C  C   . LYS A 1 61  ? 0.872   20.356  -9.173  1.00 11.26 ? 61  LYS A C   1 
ATOM   475  O  O   . LYS A 1 61  ? 1.703   19.756  -9.838  1.00 10.72 ? 61  LYS A O   1 
ATOM   476  C  CB  . LYS A 1 61  ? 0.850   22.708  -9.613  1.00 13.20 ? 61  LYS A CB  1 
ATOM   477  C  CG  . LYS A 1 61  ? 0.409   23.959  -10.350 1.00 15.64 ? 61  LYS A CG  1 
ATOM   478  C  CD  . LYS A 1 61  ? 1.567   24.947  -10.480 1.00 14.70 ? 61  LYS A CD  1 
ATOM   479  C  CE  . LYS A 1 61  ? 1.075   26.178  -11.258 1.00 15.38 ? 61  LYS A CE  1 
ATOM   480  N  NZ  . LYS A 1 61  ? 2.059   27.288  -11.177 1.00 14.52 ? 61  LYS A NZ  1 
ATOM   481  N  N   . GLY A 1 62  ? 0.692   20.225  -7.866  1.00 9.42  ? 62  GLY A N   1 
ATOM   482  C  CA  . GLY A 1 62  ? 1.536   19.238  -7.141  1.00 9.48  ? 62  GLY A CA  1 
ATOM   483  C  C   . GLY A 1 62  ? 0.709   18.622  -6.025  1.00 8.25  ? 62  GLY A C   1 
ATOM   484  O  O   . GLY A 1 62  ? -0.268  19.168  -5.517  1.00 7.35  ? 62  GLY A O   1 
ATOM   485  N  N   . ILE A 1 63  ? 1.099   17.377  -5.665  1.00 8.29  ? 63  ILE A N   1 
ATOM   486  C  CA  . ILE A 1 63  ? 0.425   16.675  -4.591  1.00 9.91  ? 63  ILE A CA  1 
ATOM   487  C  C   . ILE A 1 63  ? 1.533   16.094  -3.683  1.00 8.81  ? 63  ILE A C   1 
ATOM   488  O  O   . ILE A 1 63  ? 2.470   15.456  -4.160  1.00 9.22  ? 63  ILE A O   1 
ATOM   489  C  CB  . ILE A 1 63  ? -0.534  15.550  -5.011  1.00 11.13 ? 63  ILE A CB  1 
ATOM   490  C  CG1 . ILE A 1 63  ? -1.717  16.012  -5.869  1.00 11.11 ? 63  ILE A CG1 1 
ATOM   491  C  CG2 . ILE A 1 63  ? -1.150  14.966  -3.718  1.00 11.23 ? 63  ILE A CG2 1 
ATOM   492  C  CD1 . ILE A 1 63  ? -2.473  14.889  -6.577  1.00 12.14 ? 63  ILE A CD1 1 
ATOM   493  N  N   . ALA A 1 64  ? 1.505   16.466  -2.413  1.00 9.33  ? 64  ALA A N   1 
ATOM   494  C  CA  . ALA A 1 64  ? 2.534   15.925  -1.491  1.00 7.03  ? 64  ALA A CA  1 
ATOM   495  C  C   . ALA A 1 64  ? 1.723   14.928  -0.688  1.00 5.65  ? 64  ALA A C   1 
ATOM   496  O  O   . ALA A 1 64  ? 0.614   15.235  -0.268  1.00 6.23  ? 64  ALA A O   1 
ATOM   497  C  CB  . ALA A 1 64  ? 3.187   16.963  -0.604  1.00 7.52  ? 64  ALA A CB  1 
ATOM   498  N  N   . PHE A 1 65  ? 2.292   13.734  -0.439  1.00 8.33  ? 65  PHE A N   1 
ATOM   499  C  CA  . PHE A 1 65  ? 1.478   12.740  0.250   1.00 7.58  ? 65  PHE A CA  1 
ATOM   500  C  C   . PHE A 1 65  ? 2.332   11.806  1.134   1.00 6.79  ? 65  PHE A C   1 
ATOM   501  O  O   . PHE A 1 65  ? 3.481   11.549  0.850   1.00 6.63  ? 65  PHE A O   1 
ATOM   502  C  CB  . PHE A 1 65  ? 0.780   11.851  -0.837  1.00 7.05  ? 65  PHE A CB  1 
ATOM   503  C  CG  . PHE A 1 65  ? 1.784   11.086  -1.658  1.00 7.74  ? 65  PHE A CG  1 
ATOM   504  C  CD1 . PHE A 1 65  ? 2.483   11.660  -2.726  1.00 7.83  ? 65  PHE A CD1 1 
ATOM   505  C  CD2 . PHE A 1 65  ? 2.052   9.748   -1.356  1.00 6.75  ? 65  PHE A CD2 1 
ATOM   506  C  CE1 . PHE A 1 65  ? 3.410   10.961  -3.453  1.00 6.40  ? 65  PHE A CE1 1 
ATOM   507  C  CE2 . PHE A 1 65  ? 2.984   9.036   -2.074  1.00 5.33  ? 65  PHE A CE2 1 
ATOM   508  C  CZ  . PHE A 1 65  ? 3.675   9.622   -3.116  1.00 7.01  ? 65  PHE A CZ  1 
ATOM   509  N  N   . ALA A 1 66  ? 1.639   11.349  2.141   1.00 7.06  ? 66  ALA A N   1 
ATOM   510  C  CA  . ALA A 1 66  ? 2.041   10.308  3.087   1.00 7.19  ? 66  ALA A CA  1 
ATOM   511  C  C   . ALA A 1 66  ? 1.032   9.173   2.947   1.00 5.05  ? 66  ALA A C   1 
ATOM   512  O  O   . ALA A 1 66  ? -0.082  9.250   3.461   1.00 6.86  ? 66  ALA A O   1 
ATOM   513  C  CB  . ALA A 1 66  ? 2.012   10.838  4.492   1.00 5.88  ? 66  ALA A CB  1 
ATOM   514  N  N   . PRO A 1 67  ? 1.455   8.074   2.311   1.00 6.90  ? 67  PRO A N   1 
ATOM   515  C  CA  . PRO A 1 67  ? 0.539   6.967   2.059   1.00 5.85  ? 67  PRO A CA  1 
ATOM   516  C  C   . PRO A 1 67  ? 0.313   6.214   3.357   1.00 7.27  ? 67  PRO A C   1 
ATOM   517  O  O   . PRO A 1 67  ? 1.284   6.088   4.123   1.00 7.21  ? 67  PRO A O   1 
ATOM   518  C  CB  . PRO A 1 67  ? 1.317   6.064   1.091   1.00 8.21  ? 67  PRO A CB  1 
ATOM   519  C  CG  . PRO A 1 67  ? 2.765   6.389   1.278   1.00 6.76  ? 67  PRO A CG  1 
ATOM   520  C  CD  . PRO A 1 67  ? 2.761   7.856   1.697   1.00 5.68  ? 67  PRO A CD  1 
ATOM   521  N  N   . LEU A 1 68  ? -0.867  5.681   3.559   1.00 6.96  ? 68  LEU A N   1 
ATOM   522  C  CA  . LEU A 1 68  ? -1.107  4.879   4.759   1.00 7.75  ? 68  LEU A CA  1 
ATOM   523  C  C   . LEU A 1 68  ? -0.322  3.569   4.721   1.00 8.89  ? 68  LEU A C   1 
ATOM   524  O  O   . LEU A 1 68  ? 0.090   3.080   5.775   1.00 8.03  ? 68  LEU A O   1 
ATOM   525  C  CB  . LEU A 1 68  ? -2.586  4.504   4.869   1.00 7.28  ? 68  LEU A CB  1 
ATOM   526  C  CG  . LEU A 1 68  ? -3.430  5.717   5.308   1.00 7.96  ? 68  LEU A CG  1 
ATOM   527  C  CD1 . LEU A 1 68  ? -4.885  5.299   5.171   1.00 7.86  ? 68  LEU A CD1 1 
ATOM   528  C  CD2 . LEU A 1 68  ? -3.133  6.135   6.746   1.00 8.34  ? 68  LEU A CD2 1 
ATOM   529  N  N   . SER A 1 69  ? -0.131  3.031   3.524   1.00 10.06 ? 69  SER A N   1 
ATOM   530  C  CA  . SER A 1 69  ? 0.675   1.793   3.430   1.00 11.21 ? 69  SER A CA  1 
ATOM   531  C  C   . SER A 1 69  ? 1.697   1.990   2.339   1.00 10.42 ? 69  SER A C   1 
ATOM   532  O  O   . SER A 1 69  ? 1.658   2.963   1.554   1.00 11.32 ? 69  SER A O   1 
ATOM   533  C  CB  . SER A 1 69  ? -0.209  0.578   3.172   1.00 13.04 ? 69  SER A CB  1 
ATOM   534  O  OG  . SER A 1 69  ? -0.201  0.306   1.775   1.00 13.61 ? 69  SER A OG  1 
ATOM   535  N  N   . SER A 1 70  ? 2.679   1.096   2.233   1.00 8.89  ? 70  SER A N   1 
ATOM   536  C  CA  . SER A 1 70  ? 3.710   1.237   1.230   1.00 8.77  ? 70  SER A CA  1 
ATOM   537  C  C   . SER A 1 70  ? 3.117   1.101   -0.175  1.00 7.99  ? 70  SER A C   1 
ATOM   538  O  O   . SER A 1 70  ? 3.723   1.628   -1.084  1.00 6.32  ? 70  SER A O   1 
ATOM   539  C  CB  . SER A 1 70  ? 4.848   0.200   1.373   1.00 10.94 ? 70  SER A CB  1 
ATOM   540  O  OG  . SER A 1 70  ? 4.270   -1.095  1.214   1.00 11.00 ? 70  SER A OG  1 
ATOM   541  N  N   . VAL A 1 71  ? 2.043   0.347   -0.317  1.00 8.74  ? 71  VAL A N   1 
ATOM   542  C  CA  . VAL A 1 71  ? 1.516   0.072   -1.664  1.00 8.89  ? 71  VAL A CA  1 
ATOM   543  C  C   . VAL A 1 71  ? 0.163   0.658   -1.975  1.00 10.04 ? 71  VAL A C   1 
ATOM   544  O  O   . VAL A 1 71  ? -0.231  0.571   -3.159  1.00 10.92 ? 71  VAL A O   1 
ATOM   545  C  CB  . VAL A 1 71  ? 1.386   -1.484  -1.845  1.00 9.10  ? 71  VAL A CB  1 
ATOM   546  C  CG1 . VAL A 1 71  ? 2.773   -2.110  -1.796  1.00 10.54 ? 71  VAL A CG1 1 
ATOM   547  C  CG2 . VAL A 1 71  ? 0.431   -1.998  -0.800  1.00 7.93  ? 71  VAL A CG2 1 
ATOM   548  N  N   . ASN A 1 72  ? -0.602  1.196   -1.039  1.00 10.29 ? 72  ASN A N   1 
ATOM   549  C  CA  . ASN A 1 72  ? -1.961  1.638   -1.340  1.00 8.76  ? 72  ASN A CA  1 
ATOM   550  C  C   . ASN A 1 72  ? -2.023  2.817   -2.298  1.00 10.38 ? 72  ASN A C   1 
ATOM   551  O  O   . ASN A 1 72  ? -3.078  2.925   -2.923  1.00 10.14 ? 72  ASN A O   1 
ATOM   552  C  CB  . ASN A 1 72  ? -2.801  1.930   -0.102  1.00 9.18  ? 72  ASN A CB  1 
ATOM   553  C  CG  . ASN A 1 72  ? -2.456  3.253   0.557   1.00 8.07  ? 72  ASN A CG  1 
ATOM   554  O  OD1 . ASN A 1 72  ? -1.276  3.474   0.819   1.00 5.76  ? 72  ASN A OD1 1 
ATOM   555  N  ND2 . ASN A 1 72  ? -3.496  4.063   0.740   1.00 6.75  ? 72  ASN A ND2 1 
ATOM   556  N  N   . LEU A 1 73  ? -0.949  3.598   -2.455  1.00 8.22  ? 73  LEU A N   1 
ATOM   557  C  CA  . LEU A 1 73  ? -1.097  4.705   -3.414  1.00 9.39  ? 73  LEU A CA  1 
ATOM   558  C  C   . LEU A 1 73  ? -0.208  4.553   -4.624  1.00 9.05  ? 73  LEU A C   1 
ATOM   559  O  O   . LEU A 1 73  ? -0.167  5.454   -5.458  1.00 9.67  ? 73  LEU A O   1 
ATOM   560  C  CB  . LEU A 1 73  ? -0.841  6.007   -2.681  1.00 7.80  ? 73  LEU A CB  1 
ATOM   561  C  CG  . LEU A 1 73  ? -1.796  6.398   -1.577  1.00 8.25  ? 73  LEU A CG  1 
ATOM   562  C  CD1 . LEU A 1 73  ? -1.357  7.787   -1.070  1.00 8.42  ? 73  LEU A CD1 1 
ATOM   563  C  CD2 . LEU A 1 73  ? -3.273  6.397   -1.949  1.00 7.88  ? 73  LEU A CD2 1 
ATOM   564  N  N   . VAL A 1 74  ? 0.380   3.370   -4.842  1.00 8.99  ? 74  VAL A N   1 
ATOM   565  C  CA  . VAL A 1 74  ? 1.232   3.153   -5.993  1.00 8.33  ? 74  VAL A CA  1 
ATOM   566  C  C   . VAL A 1 74  ? 0.505   3.509   -7.307  1.00 9.11  ? 74  VAL A C   1 
ATOM   567  O  O   . VAL A 1 74  ? 1.096   4.242   -8.121  1.00 8.39  ? 74  VAL A O   1 
ATOM   568  C  CB  . VAL A 1 74  ? 1.739   1.697   -6.064  1.00 7.19  ? 74  VAL A CB  1 
ATOM   569  C  CG1 . VAL A 1 74  ? 2.424   1.349   -7.385  1.00 6.77  ? 74  VAL A CG1 1 
ATOM   570  C  CG2 . VAL A 1 74  ? 2.811   1.504   -4.944  1.00 5.84  ? 74  VAL A CG2 1 
ATOM   571  N  N   . MET A 1 75  ? -0.712  2.996   -7.445  1.00 9.98  ? 75  MET A N   1 
ATOM   572  C  CA  . MET A 1 75  ? -1.386  3.191   -8.739  1.00 11.85 ? 75  MET A CA  1 
ATOM   573  C  C   . MET A 1 75  ? -1.734  4.648   -9.010  1.00 10.39 ? 75  MET A C   1 
ATOM   574  O  O   . MET A 1 75  ? -1.343  5.169   -10.070 1.00 9.02  ? 75  MET A O   1 
ATOM   575  C  CB  . MET A 1 75  ? -2.528  2.204   -8.942  1.00 13.65 ? 75  MET A CB  1 
ATOM   576  C  CG  . MET A 1 75  ? -2.082  0.741   -8.957  1.00 14.94 ? 75  MET A CG  1 
ATOM   577  S  SD  . MET A 1 75  ? -0.704  0.376   -10.068 1.00 18.26 ? 75  MET A SD  1 
ATOM   578  C  CE  . MET A 1 75  ? -1.604  0.427   -11.629 1.00 18.76 ? 75  MET A CE  1 
ATOM   579  N  N   . PRO A 1 76  ? -2.397  5.330   -8.097  1.00 9.11  ? 76  PRO A N   1 
ATOM   580  C  CA  . PRO A 1 76  ? -2.746  6.737   -8.306  1.00 10.06 ? 76  PRO A CA  1 
ATOM   581  C  C   . PRO A 1 76  ? -1.526  7.598   -8.406  1.00 10.40 ? 76  PRO A C   1 
ATOM   582  O  O   . PRO A 1 76  ? -1.493  8.533   -9.240  1.00 11.60 ? 76  PRO A O   1 
ATOM   583  C  CB  . PRO A 1 76  ? -3.696  7.095   -7.188  1.00 9.87  ? 76  PRO A CB  1 
ATOM   584  C  CG  . PRO A 1 76  ? -3.476  6.058   -6.141  1.00 11.30 ? 76  PRO A CG  1 
ATOM   585  C  CD  . PRO A 1 76  ? -2.970  4.828   -6.849  1.00 10.24 ? 76  PRO A CD  1 
ATOM   586  N  N   . VAL A 1 77  ? -0.449  7.348   -7.640  1.00 8.78  ? 77  VAL A N   1 
ATOM   587  C  CA  . VAL A 1 77  ? 0.756   8.172   -7.773  1.00 8.96  ? 77  VAL A CA  1 
ATOM   588  C  C   . VAL A 1 77  ? 1.397   8.043   -9.131  1.00 9.07  ? 77  VAL A C   1 
ATOM   589  O  O   . VAL A 1 77  ? 1.791   9.027   -9.774  1.00 10.14 ? 77  VAL A O   1 
ATOM   590  C  CB  . VAL A 1 77  ? 1.777   7.859   -6.633  1.00 8.92  ? 77  VAL A CB  1 
ATOM   591  C  CG1 . VAL A 1 77  ? 3.150   8.443   -6.880  1.00 9.23  ? 77  VAL A CG1 1 
ATOM   592  C  CG2 . VAL A 1 77  ? 1.141   8.403   -5.366  1.00 8.97  ? 77  VAL A CG2 1 
ATOM   593  N  N   . ALA A 1 78  ? 1.416   6.812   -9.657  1.00 9.78  ? 78  ALA A N   1 
ATOM   594  C  CA  . ALA A 1 78  ? 1.986   6.558   -10.976 1.00 10.08 ? 78  ALA A CA  1 
ATOM   595  C  C   . ALA A 1 78  ? 1.182   7.347   -12.013 1.00 10.61 ? 78  ALA A C   1 
ATOM   596  O  O   . ALA A 1 78  ? 1.729   8.058   -12.833 1.00 10.60 ? 78  ALA A O   1 
ATOM   597  C  CB  . ALA A 1 78  ? 1.935   5.065   -11.263 1.00 10.72 ? 78  ALA A CB  1 
ATOM   598  N  N   . ARG A 1 79  ? -0.138  7.257   -11.886 1.00 11.54 ? 79  ARG A N   1 
ATOM   599  C  CA  . ARG A 1 79  ? -1.091  7.969   -12.744 1.00 12.21 ? 79  ARG A CA  1 
ATOM   600  C  C   . ARG A 1 79  ? -0.809  9.461   -12.717 1.00 12.24 ? 79  ARG A C   1 
ATOM   601  O  O   . ARG A 1 79  ? -0.701  10.104  -13.776 1.00 10.52 ? 79  ARG A O   1 
ATOM   602  C  CB  . ARG A 1 79  ? -2.491  7.704   -12.187 1.00 15.75 ? 79  ARG A CB  1 
ATOM   603  C  CG  . ARG A 1 79  ? -3.733  8.045   -12.947 1.00 19.48 ? 79  ARG A CG  1 
ATOM   604  C  CD  . ARG A 1 79  ? -4.937  7.196   -12.638 1.00 21.56 ? 79  ARG A CD  1 
ATOM   605  N  NE  . ARG A 1 79  ? -5.048  6.280   -11.545 1.00 23.05 ? 79  ARG A NE  1 
ATOM   606  C  CZ  . ARG A 1 79  ? -4.805  5.027   -11.242 1.00 22.66 ? 79  ARG A CZ  1 
ATOM   607  N  NH1 . ARG A 1 79  ? -4.217  4.142   -12.057 1.00 22.09 ? 79  ARG A NH1 1 
ATOM   608  N  NH2 . ARG A 1 79  ? -5.140  4.565   -10.023 1.00 22.59 ? 79  ARG A NH2 1 
ATOM   609  N  N   . ALA A 1 80  ? -0.676  10.009  -11.498 1.00 10.18 ? 80  ALA A N   1 
ATOM   610  C  CA  . ALA A 1 80  ? -0.418  11.448  -11.333 1.00 9.24  ? 80  ALA A CA  1 
ATOM   611  C  C   . ALA A 1 80  ? 0.909   11.881  -11.914 1.00 9.95  ? 80  ALA A C   1 
ATOM   612  O  O   . ALA A 1 80  ? 1.041   12.958  -12.541 1.00 10.54 ? 80  ALA A O   1 
ATOM   613  C  CB  . ALA A 1 80  ? -0.485  11.839  -9.861  1.00 11.13 ? 80  ALA A CB  1 
ATOM   614  N  N   . TRP A 1 81  ? 1.958   11.063  -11.772 1.00 9.99  ? 81  TRP A N   1 
ATOM   615  C  CA  . TRP A 1 81  ? 3.257   11.370  -12.337 1.00 10.06 ? 81  TRP A CA  1 
ATOM   616  C  C   . TRP A 1 81  ? 3.127   11.418  -13.860 1.00 11.79 ? 81  TRP A C   1 
ATOM   617  O  O   . TRP A 1 81  ? 3.696   12.293  -14.524 1.00 13.99 ? 81  TRP A O   1 
ATOM   618  C  CB  . TRP A 1 81  ? 4.347   10.355  -11.937 1.00 10.97 ? 81  TRP A CB  1 
ATOM   619  C  CG  . TRP A 1 81  ? 5.658   10.636  -12.601 1.00 9.95  ? 81  TRP A CG  1 
ATOM   620  C  CD1 . TRP A 1 81  ? 6.696   11.392  -12.105 1.00 10.56 ? 81  TRP A CD1 1 
ATOM   621  C  CD2 . TRP A 1 81  ? 6.087   10.210  -13.899 1.00 10.69 ? 81  TRP A CD2 1 
ATOM   622  N  NE1 . TRP A 1 81  ? 7.712   11.443  -12.996 1.00 9.79  ? 81  TRP A NE1 1 
ATOM   623  C  CE2 . TRP A 1 81  ? 7.361   10.731  -14.121 1.00 9.39  ? 81  TRP A CE2 1 
ATOM   624  C  CE3 . TRP A 1 81  ? 5.458   9.428   -14.903 1.00 9.42  ? 81  TRP A CE3 1 
ATOM   625  C  CZ2 . TRP A 1 81  ? 8.096   10.519  -15.292 1.00 8.69  ? 81  TRP A CZ2 1 
ATOM   626  C  CZ3 . TRP A 1 81  ? 6.190   9.226   -16.052 1.00 9.79  ? 81  TRP A CZ3 1 
ATOM   627  C  CH2 . TRP A 1 81  ? 7.474   9.747   -16.242 1.00 9.84  ? 81  TRP A CH2 1 
ATOM   628  N  N   . LYS A 1 82  ? 2.367   10.479  -14.431 1.00 10.18 ? 82  LYS A N   1 
ATOM   629  C  CA  . LYS A 1 82  ? 2.129   10.448  -15.879 1.00 12.15 ? 82  LYS A CA  1 
ATOM   630  C  C   . LYS A 1 82  ? 1.385   11.689  -16.373 1.00 13.41 ? 82  LYS A C   1 
ATOM   631  O  O   . LYS A 1 82  ? 1.585   12.185  -17.502 1.00 15.48 ? 82  LYS A O   1 
ATOM   632  C  CB  . LYS A 1 82  ? 1.327   9.163   -16.171 1.00 12.13 ? 82  LYS A CB  1 
ATOM   633  C  CG  . LYS A 1 82  ? 2.281   7.950   -16.279 1.00 12.97 ? 82  LYS A CG  1 
ATOM   634  C  CD  . LYS A 1 82  ? 1.433   6.698   -16.389 1.00 14.90 ? 82  LYS A CD  1 
ATOM   635  C  CE  . LYS A 1 82  ? 2.257   5.441   -16.101 1.00 17.07 ? 82  LYS A CE  1 
ATOM   636  N  NZ  . LYS A 1 82  ? 1.342   4.263   -16.101 1.00 17.78 ? 82  LYS A NZ  1 
ATOM   637  N  N   . LYS A 1 83  ? 0.532   12.291  -15.549 1.00 14.16 ? 83  LYS A N   1 
ATOM   638  C  CA  . LYS A 1 83  ? -0.213  13.498  -15.868 1.00 15.20 ? 83  LYS A CA  1 
ATOM   639  C  C   . LYS A 1 83  ? 0.652   14.749  -15.731 1.00 15.26 ? 83  LYS A C   1 
ATOM   640  O  O   . LYS A 1 83  ? 0.314   15.861  -16.174 1.00 15.90 ? 83  LYS A O   1 
ATOM   641  C  CB  . LYS A 1 83  ? -1.455  13.666  -14.995 1.00 16.04 ? 83  LYS A CB  1 
ATOM   642  C  CG  . LYS A 1 83  ? -2.402  12.501  -14.969 1.00 19.80 ? 83  LYS A CG  1 
ATOM   643  C  CD  . LYS A 1 83  ? -3.830  12.846  -14.636 1.00 22.88 ? 83  LYS A CD  1 
ATOM   644  C  CE  . LYS A 1 83  ? -4.050  13.610  -13.349 1.00 24.81 ? 83  LYS A CE  1 
ATOM   645  N  NZ  . LYS A 1 83  ? -4.080  15.091  -13.615 1.00 26.11 ? 83  LYS A NZ  1 
ATOM   646  N  N   . GLY A 1 84  ? 1.837   14.607  -15.154 1.00 12.52 ? 84  GLY A N   1 
ATOM   647  C  CA  . GLY A 1 84  ? 2.782   15.683  -15.021 1.00 12.27 ? 84  GLY A CA  1 
ATOM   648  C  C   . GLY A 1 84  ? 2.558   16.452  -13.710 1.00 12.41 ? 84  GLY A C   1 
ATOM   649  O  O   . GLY A 1 84  ? 3.003   17.600  -13.628 1.00 12.58 ? 84  GLY A O   1 
ATOM   650  N  N   . ILE A 1 85  ? 2.024   15.761  -12.727 1.00 12.07 ? 85  ILE A N   1 
ATOM   651  C  CA  . ILE A 1 85  ? 1.801   16.356  -11.406 1.00 12.33 ? 85  ILE A CA  1 
ATOM   652  C  C   . ILE A 1 85  ? 3.112   16.241  -10.624 1.00 11.91 ? 85  ILE A C   1 
ATOM   653  O  O   . ILE A 1 85  ? 3.727   15.176  -10.696 1.00 12.28 ? 85  ILE A O   1 
ATOM   654  C  CB  . ILE A 1 85  ? 0.652   15.655  -10.675 1.00 12.62 ? 85  ILE A CB  1 
ATOM   655  C  CG1 . ILE A 1 85  ? -0.699  16.053  -11.300 1.00 11.24 ? 85  ILE A CG1 1 
ATOM   656  C  CG2 . ILE A 1 85  ? 0.642   15.983  -9.183  1.00 14.30 ? 85  ILE A CG2 1 
ATOM   657  C  CD1 . ILE A 1 85  ? -1.902  15.276  -10.841 1.00 11.58 ? 85  ILE A CD1 1 
ATOM   658  N  N   . TYR A 1 86  ? 3.527   17.324  -9.982  1.00 8.70  ? 86  TYR A N   1 
ATOM   659  C  CA  . TYR A 1 86  ? 4.747   17.317  -9.188  1.00 9.22  ? 86  TYR A CA  1 
ATOM   660  C  C   . TYR A 1 86  ? 4.394   16.678  -7.846  1.00 8.12  ? 86  TYR A C   1 
ATOM   661  O  O   . TYR A 1 86  ? 3.642   17.253  -7.078  1.00 7.38  ? 86  TYR A O   1 
ATOM   662  C  CB  . TYR A 1 86  ? 5.190   18.760  -8.933  1.00 8.62  ? 86  TYR A CB  1 
ATOM   663  C  CG  . TYR A 1 86  ? 5.579   19.363  -10.277 1.00 10.02 ? 86  TYR A CG  1 
ATOM   664  C  CD1 . TYR A 1 86  ? 6.852   19.120  -10.738 1.00 10.02 ? 86  TYR A CD1 1 
ATOM   665  C  CD2 . TYR A 1 86  ? 4.690   20.147  -10.993 1.00 9.30  ? 86  TYR A CD2 1 
ATOM   666  C  CE1 . TYR A 1 86  ? 7.261   19.649  -11.960 1.00 10.91 ? 86  TYR A CE1 1 
ATOM   667  C  CE2 . TYR A 1 86  ? 5.093   20.661  -12.215 1.00 10.71 ? 86  TYR A CE2 1 
ATOM   668  C  CZ  . TYR A 1 86  ? 6.351   20.406  -12.667 1.00 10.93 ? 86  TYR A CZ  1 
ATOM   669  O  OH  . TYR A 1 86  ? 6.776   20.928  -13.862 1.00 13.81 ? 86  TYR A OH  1 
ATOM   670  N  N   . LEU A 1 87  ? 4.973   15.515  -7.608  1.00 8.95  ? 87  LEU A N   1 
ATOM   671  C  CA  . LEU A 1 87  ? 4.674   14.711  -6.443  1.00 7.81  ? 87  LEU A CA  1 
ATOM   672  C  C   . LEU A 1 87  ? 5.834   14.658  -5.449  1.00 6.99  ? 87  LEU A C   1 
ATOM   673  O  O   . LEU A 1 87  ? 6.973   14.501  -5.863  1.00 7.14  ? 87  LEU A O   1 
ATOM   674  C  CB  . LEU A 1 87  ? 4.486   13.250  -6.914  1.00 8.59  ? 87  LEU A CB  1 
ATOM   675  C  CG  . LEU A 1 87  ? 3.264   13.030  -7.832  1.00 6.87  ? 87  LEU A CG  1 
ATOM   676  C  CD1 . LEU A 1 87  ? 3.520   11.820  -8.721  1.00 8.88  ? 87  LEU A CD1 1 
ATOM   677  C  CD2 . LEU A 1 87  ? 1.990   12.857  -7.049  1.00 10.08 ? 87  LEU A CD2 1 
ATOM   678  N  N   . VAL A 1 88  ? 5.471   14.826  -4.188  1.00 7.46  ? 88  VAL A N   1 
ATOM   679  C  CA  . VAL A 1 88  ? 6.458   14.722  -3.107  1.00 7.79  ? 88  VAL A CA  1 
ATOM   680  C  C   . VAL A 1 88  ? 5.915   13.741  -2.058  1.00 6.42  ? 88  VAL A C   1 
ATOM   681  O  O   . VAL A 1 88  ? 4.833   13.895  -1.539  1.00 7.06  ? 88  VAL A O   1 
ATOM   682  C  CB  . VAL A 1 88  ? 6.795   16.083  -2.477  1.00 8.54  ? 88  VAL A CB  1 
ATOM   683  C  CG1 . VAL A 1 88  ? 7.630   15.907  -1.207  1.00 10.73 ? 88  VAL A CG1 1 
ATOM   684  C  CG2 . VAL A 1 88  ? 7.616   16.902  -3.469  1.00 7.80  ? 88  VAL A CG2 1 
ATOM   685  N  N   . ASN A 1 89  ? 6.720   12.748  -1.722  1.00 5.86  ? 89  ASN A N   1 
ATOM   686  C  CA  . ASN A 1 89  ? 6.378   11.716  -0.738  1.00 5.88  ? 89  ASN A CA  1 
ATOM   687  C  C   . ASN A 1 89  ? 6.862   12.224  0.636   1.00 4.53  ? 89  ASN A C   1 
ATOM   688  O  O   . ASN A 1 89  ? 8.039   12.509  0.783   1.00 7.15  ? 89  ASN A O   1 
ATOM   689  C  CB  . ASN A 1 89  ? 7.134   10.455  -1.141  1.00 5.37  ? 89  ASN A CB  1 
ATOM   690  C  CG  . ASN A 1 89  ? 6.840   9.199   -0.333  1.00 5.07  ? 89  ASN A CG  1 
ATOM   691  O  OD1 . ASN A 1 89  ? 7.511   8.199   -0.540  1.00 6.68  ? 89  ASN A OD1 1 
ATOM   692  N  ND2 . ASN A 1 89  ? 5.884   9.216   0.564   1.00 5.51  ? 89  ASN A ND2 1 
ATOM   693  N  N   . LEU A 1 90  ? 5.936   12.409  1.531   1.00 5.10  ? 90  LEU A N   1 
ATOM   694  C  CA  . LEU A 1 90  ? 6.201   12.876  2.886   1.00 5.50  ? 90  LEU A CA  1 
ATOM   695  C  C   . LEU A 1 90  ? 6.218   11.674  3.843   1.00 5.52  ? 90  LEU A C   1 
ATOM   696  O  O   . LEU A 1 90  ? 5.247   10.917  3.881   1.00 5.65  ? 90  LEU A O   1 
ATOM   697  C  CB  . LEU A 1 90  ? 5.036   13.731  3.365   1.00 5.14  ? 90  LEU A CB  1 
ATOM   698  C  CG  . LEU A 1 90  ? 4.812   15.051  2.582   1.00 5.29  ? 90  LEU A CG  1 
ATOM   699  C  CD1 . LEU A 1 90  ? 3.547   15.684  3.098   1.00 6.11  ? 90  LEU A CD1 1 
ATOM   700  C  CD2 . LEU A 1 90  ? 6.019   15.987  2.659   1.00 6.78  ? 90  LEU A CD2 1 
ATOM   701  N  N   . ASP A 1 91  ? 7.287   11.543  4.597   1.00 5.75  ? 91  ASP A N   1 
ATOM   702  C  CA  . ASP A 1 91  ? 7.358   10.660  5.747   1.00 6.19  ? 91  ASP A CA  1 
ATOM   703  C  C   . ASP A 1 91  ? 7.466   9.170   5.472   1.00 7.66  ? 91  ASP A C   1 
ATOM   704  O  O   . ASP A 1 91  ? 8.440   8.539   5.906   1.00 6.55  ? 91  ASP A O   1 
ATOM   705  C  CB  . ASP A 1 91  ? 6.190   10.961  6.700   1.00 6.83  ? 91  ASP A CB  1 
ATOM   706  C  CG  . ASP A 1 91  ? 6.146   9.986   7.897   1.00 8.03  ? 91  ASP A CG  1 
ATOM   707  O  OD1 . ASP A 1 91  ? 6.987   10.060  8.801   1.00 6.91  ? 91  ASP A OD1 1 
ATOM   708  O  OD2 . ASP A 1 91  ? 5.260   9.106   7.896   1.00 7.07  ? 91  ASP A OD2 1 
ATOM   709  N  N   . GLU A 1 92  ? 6.454   8.592   4.878   1.00 5.79  ? 92  GLU A N   1 
ATOM   710  C  CA  . GLU A 1 92  ? 6.218   7.174   4.725   1.00 7.85  ? 92  GLU A CA  1 
ATOM   711  C  C   . GLU A 1 92  ? 6.542   6.785   3.275   1.00 7.55  ? 92  GLU A C   1 
ATOM   712  O  O   . GLU A 1 92  ? 5.710   7.090   2.424   1.00 8.91  ? 92  GLU A O   1 
ATOM   713  C  CB  . GLU A 1 92  ? 4.738   6.885   5.034   1.00 6.69  ? 92  GLU A CB  1 
ATOM   714  C  CG  . GLU A 1 92  ? 4.350   5.405   4.938   1.00 5.18  ? 92  GLU A CG  1 
ATOM   715  C  CD  . GLU A 1 92  ? 5.035   4.575   6.035   1.00 5.20  ? 92  GLU A CD  1 
ATOM   716  O  OE1 . GLU A 1 92  ? 4.498   4.523   7.155   1.00 7.04  ? 92  GLU A OE1 1 
ATOM   717  O  OE2 . GLU A 1 92  ? 6.074   3.992   5.724   1.00 5.90  ? 92  GLU A OE2 1 
ATOM   718  N  N   . LYS A 1 93  ? 7.647   6.113   3.075   1.00 6.47  ? 93  LYS A N   1 
ATOM   719  C  CA  . LYS A 1 93  ? 8.172   5.783   1.769   1.00 9.01  ? 93  LYS A CA  1 
ATOM   720  C  C   . LYS A 1 93  ? 7.234   4.935   0.930   1.00 9.19  ? 93  LYS A C   1 
ATOM   721  O  O   . LYS A 1 93  ? 6.871   3.819   1.321   1.00 9.84  ? 93  LYS A O   1 
ATOM   722  C  CB  . LYS A 1 93  ? 9.557   5.123   1.821   1.00 10.44 ? 93  LYS A CB  1 
ATOM   723  C  CG  . LYS A 1 93  ? 10.331  5.292   0.495   1.00 13.65 ? 93  LYS A CG  1 
ATOM   724  C  CD  . LYS A 1 93  ? 11.789  4.872   0.706   1.00 15.19 ? 93  LYS A CD  1 
ATOM   725  C  CE  . LYS A 1 93  ? 12.618  4.944   -0.560  1.00 16.56 ? 93  LYS A CE  1 
ATOM   726  N  NZ  . LYS A 1 93  ? 13.666  3.868   -0.568  1.00 16.93 ? 93  LYS A NZ  1 
ATOM   727  N  N   . ILE A 1 94  ? 6.809   5.514   -0.197  1.00 8.29  ? 94  ILE A N   1 
ATOM   728  C  CA  . ILE A 1 94  ? 5.946   4.682   -1.076  1.00 7.66  ? 94  ILE A CA  1 
ATOM   729  C  C   . ILE A 1 94  ? 6.846   3.584   -1.588  1.00 6.55  ? 94  ILE A C   1 
ATOM   730  O  O   . ILE A 1 94  ? 8.060   3.796   -1.733  1.00 7.28  ? 94  ILE A O   1 
ATOM   731  C  CB  . ILE A 1 94  ? 5.361   5.537   -2.214  1.00 7.84  ? 94  ILE A CB  1 
ATOM   732  C  CG1 . ILE A 1 94  ? 4.424   4.730   -3.114  1.00 8.53  ? 94  ILE A CG1 1 
ATOM   733  C  CG2 . ILE A 1 94  ? 6.489   6.171   -3.013  1.00 7.37  ? 94  ILE A CG2 1 
ATOM   734  C  CD1 . ILE A 1 94  ? 3.465   5.614   -3.918  1.00 9.41  ? 94  ILE A CD1 1 
ATOM   735  N  N   . ASP A 1 95  ? 6.328   2.432   -1.979  1.00 7.11  ? 95  ASP A N   1 
ATOM   736  C  CA  . ASP A 1 95  ? 7.204   1.345   -2.459  1.00 8.79  ? 95  ASP A CA  1 
ATOM   737  C  C   . ASP A 1 95  ? 7.741   1.753   -3.832  1.00 9.50  ? 95  ASP A C   1 
ATOM   738  O  O   . ASP A 1 95  ? 6.973   1.793   -4.803  1.00 9.48  ? 95  ASP A O   1 
ATOM   739  C  CB  . ASP A 1 95  ? 6.406   0.068   -2.522  1.00 10.29 ? 95  ASP A CB  1 
ATOM   740  C  CG  . ASP A 1 95  ? 7.152   -1.124  -3.081  1.00 10.50 ? 95  ASP A CG  1 
ATOM   741  O  OD1 . ASP A 1 95  ? 8.035   -1.104  -3.941  1.00 10.68 ? 95  ASP A OD1 1 
ATOM   742  O  OD2 . ASP A 1 95  ? 6.758   -2.180  -2.548  1.00 14.21 ? 95  ASP A OD2 1 
ATOM   743  N  N   . MET A 1 96  ? 9.019   2.060   -3.894  1.00 9.61  ? 96  MET A N   1 
ATOM   744  C  CA  . MET A 1 96  ? 9.559   2.646   -5.130  1.00 11.06 ? 96  MET A CA  1 
ATOM   745  C  C   . MET A 1 96  ? 9.748   1.625   -6.224  1.00 12.10 ? 96  MET A C   1 
ATOM   746  O  O   . MET A 1 96  ? 9.619   1.998   -7.390  1.00 14.32 ? 96  MET A O   1 
ATOM   747  C  CB  . MET A 1 96  ? 10.842  3.425   -4.851  1.00 12.93 ? 96  MET A CB  1 
ATOM   748  C  CG  . MET A 1 96  ? 10.613  4.643   -3.948  1.00 12.08 ? 96  MET A CG  1 
ATOM   749  S  SD  . MET A 1 96  ? 9.585   5.931   -4.744  1.00 13.71 ? 96  MET A SD  1 
ATOM   750  C  CE  . MET A 1 96  ? 10.620  6.331   -6.136  1.00 13.46 ? 96  MET A CE  1 
ATOM   751  N  N   . ASP A 1 97  ? 9.981   0.363   -5.894  1.00 12.21 ? 97  ASP A N   1 
ATOM   752  C  CA  . ASP A 1 97  ? 10.086  -0.657  -6.957  1.00 13.52 ? 97  ASP A CA  1 
ATOM   753  C  C   . ASP A 1 97  ? 8.725   -0.837  -7.614  1.00 13.47 ? 97  ASP A C   1 
ATOM   754  O  O   . ASP A 1 97  ? 8.597   -0.893  -8.862  1.00 12.27 ? 97  ASP A O   1 
ATOM   755  C  CB  . ASP A 1 97  ? 10.561  -1.971  -6.318  1.00 16.77 ? 97  ASP A CB  1 
ATOM   756  C  CG  . ASP A 1 97  ? 12.004  -1.897  -5.859  1.00 19.40 ? 97  ASP A CG  1 
ATOM   757  O  OD1 . ASP A 1 97  ? 12.785  -1.080  -6.369  1.00 21.14 ? 97  ASP A OD1 1 
ATOM   758  O  OD2 . ASP A 1 97  ? 12.394  -2.698  -4.976  1.00 22.74 ? 97  ASP A OD2 1 
ATOM   759  N  N   . ASN A 1 98  ? 7.702   -0.893  -6.765  1.00 10.96 ? 98  ASN A N   1 
ATOM   760  C  CA  . ASN A 1 98  ? 6.318   -1.028  -7.228  1.00 14.24 ? 98  ASN A CA  1 
ATOM   761  C  C   . ASN A 1 98  ? 5.941   0.200   -8.073  1.00 13.83 ? 98  ASN A C   1 
ATOM   762  O  O   . ASN A 1 98  ? 5.272   0.105   -9.113  1.00 11.36 ? 98  ASN A O   1 
ATOM   763  C  CB  . ASN A 1 98  ? 5.313   -1.124  -6.091  1.00 16.41 ? 98  ASN A CB  1 
ATOM   764  C  CG  . ASN A 1 98  ? 4.881   -2.461  -5.566  1.00 21.17 ? 98  ASN A CG  1 
ATOM   765  O  OD1 . ASN A 1 98  ? 5.657   -3.305  -5.097  1.00 23.37 ? 98  ASN A OD1 1 
ATOM   766  N  ND2 . ASN A 1 98  ? 3.583   -2.744  -5.570  1.00 22.99 ? 98  ASN A ND2 1 
ATOM   767  N  N   . LEU A 1 99  ? 6.243   1.408   -7.549  1.00 12.27 ? 99  LEU A N   1 
ATOM   768  C  CA  . LEU A 1 99  ? 5.940   2.624   -8.317  1.00 10.81 ? 99  LEU A CA  1 
ATOM   769  C  C   . LEU A 1 99  ? 6.677   2.641   -9.645  1.00 11.33 ? 99  LEU A C   1 
ATOM   770  O  O   . LEU A 1 99  ? 6.090   3.068   -10.648 1.00 11.05 ? 99  LEU A O   1 
ATOM   771  C  CB  . LEU A 1 99  ? 6.350   3.881   -7.529  1.00 9.79  ? 99  LEU A CB  1 
ATOM   772  C  CG  . LEU A 1 99  ? 6.150   5.267   -8.163  1.00 10.07 ? 99  LEU A CG  1 
ATOM   773  C  CD1 . LEU A 1 99  ? 4.693   5.471   -8.536  1.00 10.31 ? 99  LEU A CD1 1 
ATOM   774  C  CD2 . LEU A 1 99  ? 6.541   6.393   -7.194  1.00 9.54  ? 99  LEU A CD2 1 
ATOM   775  N  N   . LYS A 1 100 ? 7.941   2.234   -9.696  1.00 9.95  ? 100 LYS A N   1 
ATOM   776  C  CA  . LYS A 1 100 ? 8.676   2.262   -10.972 1.00 13.63 ? 100 LYS A CA  1 
ATOM   777  C  C   . LYS A 1 100 ? 8.032   1.246   -11.917 1.00 14.29 ? 100 LYS A C   1 
ATOM   778  O  O   . LYS A 1 100 ? 7.764   1.539   -13.076 1.00 10.72 ? 100 LYS A O   1 
ATOM   779  C  CB  . LYS A 1 100 ? 10.157  2.078   -10.772 1.00 14.53 ? 100 LYS A CB  1 
ATOM   780  C  CG  . LYS A 1 100 ? 11.017  1.546   -11.877 1.00 18.28 ? 100 LYS A CG  1 
ATOM   781  C  CD  . LYS A 1 100 ? 12.454  1.292   -11.507 1.00 20.89 ? 100 LYS A CD  1 
ATOM   782  C  CE  . LYS A 1 100 ? 13.468  1.825   -12.492 1.00 23.08 ? 100 LYS A CE  1 
ATOM   783  N  NZ  . LYS A 1 100 ? 14.599  2.504   -11.793 1.00 25.68 ? 100 LYS A NZ  1 
ATOM   784  N  N   . LYS A 1 101 ? 7.617   0.096   -11.401 1.00 15.62 ? 101 LYS A N   1 
ATOM   785  C  CA  . LYS A 1 101 ? 6.912   -0.887  -12.239 1.00 17.30 ? 101 LYS A CA  1 
ATOM   786  C  C   . LYS A 1 101 ? 5.582   -0.358  -12.756 1.00 16.73 ? 101 LYS A C   1 
ATOM   787  O  O   . LYS A 1 101 ? 5.128   -0.778  -13.822 1.00 15.31 ? 101 LYS A O   1 
ATOM   788  C  CB  . LYS A 1 101 ? 6.723   -2.144  -11.382 1.00 20.84 ? 101 LYS A CB  1 
ATOM   789  C  CG  . LYS A 1 101 ? 5.846   -3.223  -11.980 1.00 22.79 ? 101 LYS A CG  1 
ATOM   790  C  CD  . LYS A 1 101 ? 5.779   -4.422  -11.024 1.00 25.54 ? 101 LYS A CD  1 
ATOM   791  C  CE  . LYS A 1 101 ? 5.393   -5.690  -11.760 1.00 27.12 ? 101 LYS A CE  1 
ATOM   792  N  NZ  . LYS A 1 101 ? 5.704   -6.895  -10.926 1.00 29.47 ? 101 LYS A NZ  1 
ATOM   793  N  N   . ALA A 1 102 ? 4.910   0.547   -12.040 1.00 14.40 ? 102 ALA A N   1 
ATOM   794  C  CA  . ALA A 1 102 ? 3.661   1.165   -12.436 1.00 13.12 ? 102 ALA A CA  1 
ATOM   795  C  C   . ALA A 1 102 ? 3.883   2.377   -13.335 1.00 12.51 ? 102 ALA A C   1 
ATOM   796  O  O   . ALA A 1 102 ? 2.906   2.979   -13.815 1.00 13.59 ? 102 ALA A O   1 
ATOM   797  C  CB  . ALA A 1 102 ? 2.842   1.567   -11.208 1.00 12.68 ? 102 ALA A CB  1 
ATOM   798  N  N   . GLY A 1 103 ? 5.134   2.716   -13.606 1.00 11.80 ? 103 GLY A N   1 
ATOM   799  C  CA  . GLY A 1 103 ? 5.480   3.784   -14.524 1.00 12.63 ? 103 GLY A CA  1 
ATOM   800  C  C   . GLY A 1 103 ? 5.485   5.185   -13.940 1.00 11.68 ? 103 GLY A C   1 
ATOM   801  O  O   . GLY A 1 103 ? 5.220   6.144   -14.693 1.00 10.57 ? 103 GLY A O   1 
ATOM   802  N  N   . GLY A 1 104 ? 5.773   5.311   -12.627 1.00 9.91  ? 104 GLY A N   1 
ATOM   803  C  CA  . GLY A 1 104 ? 5.795   6.672   -12.056 1.00 8.84  ? 104 GLY A CA  1 
ATOM   804  C  C   . GLY A 1 104 ? 7.077   6.868   -11.231 1.00 8.98  ? 104 GLY A C   1 
ATOM   805  O  O   . GLY A 1 104 ? 7.963   6.010   -11.145 1.00 8.76  ? 104 GLY A O   1 
ATOM   806  N  N   . ASN A 1 105 ? 7.117   8.041   -10.613 1.00 8.52  ? 105 ASN A N   1 
ATOM   807  C  CA  . ASN A 1 105 ? 8.257   8.448   -9.785  1.00 8.53  ? 105 ASN A CA  1 
ATOM   808  C  C   . ASN A 1 105 ? 7.725   9.586   -8.909  1.00 6.79  ? 105 ASN A C   1 
ATOM   809  O  O   . ASN A 1 105 ? 6.563   9.961   -9.041  1.00 7.58  ? 105 ASN A O   1 
ATOM   810  C  CB  . ASN A 1 105 ? 9.488   8.875   -10.548 1.00 8.74  ? 105 ASN A CB  1 
ATOM   811  C  CG  . ASN A 1 105 ? 10.791  8.727   -9.760  1.00 11.61 ? 105 ASN A CG  1 
ATOM   812  O  OD1 . ASN A 1 105 ? 10.760  8.278   -8.589  1.00 10.81 ? 105 ASN A OD1 1 
ATOM   813  N  ND2 . ASN A 1 105 ? 11.898  9.088   -10.371 1.00 10.59 ? 105 ASN A ND2 1 
ATOM   814  N  N   . VAL A 1 106 ? 8.520   10.080  -7.978  1.00 8.68  ? 106 VAL A N   1 
ATOM   815  C  CA  . VAL A 1 106 ? 8.158   11.204  -7.123  1.00 7.84  ? 106 VAL A CA  1 
ATOM   816  C  C   . VAL A 1 106 ? 9.355   12.145  -7.122  1.00 8.36  ? 106 VAL A C   1 
ATOM   817  O  O   . VAL A 1 106 ? 10.544  11.748  -7.159  1.00 8.71  ? 106 VAL A O   1 
ATOM   818  C  CB  . VAL A 1 106 ? 7.817   10.826  -5.663  1.00 8.30  ? 106 VAL A CB  1 
ATOM   819  C  CG1 . VAL A 1 106 ? 6.557   9.980   -5.602  1.00 9.17  ? 106 VAL A CG1 1 
ATOM   820  C  CG2 . VAL A 1 106 ? 9.006   10.126  -5.016  1.00 8.69  ? 106 VAL A CG2 1 
ATOM   821  N  N   . GLU A 1 107 ? 9.073   13.453  -7.122  1.00 7.16  ? 107 GLU A N   1 
ATOM   822  C  CA  . GLU A 1 107 ? 10.164  14.421  -7.185  1.00 7.80  ? 107 GLU A CA  1 
ATOM   823  C  C   . GLU A 1 107 ? 11.169  14.325  -6.041  1.00 7.88  ? 107 GLU A C   1 
ATOM   824  O  O   . GLU A 1 107 ? 12.361  14.647  -6.189  1.00 9.95  ? 107 GLU A O   1 
ATOM   825  C  CB  . GLU A 1 107 ? 9.579   15.847  -7.059  1.00 8.35  ? 107 GLU A CB  1 
ATOM   826  C  CG  . GLU A 1 107 ? 8.604   16.238  -8.163  1.00 10.03 ? 107 GLU A CG  1 
ATOM   827  C  CD  . GLU A 1 107 ? 9.344   16.204  -9.492  1.00 9.65  ? 107 GLU A CD  1 
ATOM   828  O  OE1 . GLU A 1 107 ? 10.525  16.533  -9.630  1.00 10.77 ? 107 GLU A OE1 1 
ATOM   829  O  OE2 . GLU A 1 107 ? 8.689   15.780  -10.454 1.00 12.71 ? 107 GLU A OE2 1 
ATOM   830  N  N   . ALA A 1 108 ? 10.621  14.030  -4.867  1.00 8.93  ? 108 ALA A N   1 
ATOM   831  C  CA  . ALA A 1 108 ? 11.380  14.049  -3.630  1.00 7.97  ? 108 ALA A CA  1 
ATOM   832  C  C   . ALA A 1 108 ? 10.686  13.190  -2.568  1.00 7.82  ? 108 ALA A C   1 
ATOM   833  O  O   . ALA A 1 108 ? 9.506   12.877  -2.642  1.00 7.40  ? 108 ALA A O   1 
ATOM   834  C  CB  . ALA A 1 108 ? 11.239  15.480  -3.077  1.00 8.27  ? 108 ALA A CB  1 
ATOM   835  N  N   . PHE A 1 109 ? 11.468  12.933  -1.542  1.00 7.93  ? 109 PHE A N   1 
ATOM   836  C  CA  . PHE A 1 109 ? 10.985  12.175  -0.381  1.00 7.41  ? 109 PHE A CA  1 
ATOM   837  C  C   . PHE A 1 109 ? 11.614  12.867  0.837   1.00 4.56  ? 109 PHE A C   1 
ATOM   838  O  O   . PHE A 1 109 ? 12.826  13.004  0.834   1.00 6.31  ? 109 PHE A O   1 
ATOM   839  C  CB  . PHE A 1 109 ? 11.479  10.740  -0.490  1.00 7.99  ? 109 PHE A CB  1 
ATOM   840  C  CG  . PHE A 1 109 ? 11.206  9.872   0.697   1.00 6.66  ? 109 PHE A CG  1 
ATOM   841  C  CD1 . PHE A 1 109 ? 10.018  9.887   1.372   1.00 6.53  ? 109 PHE A CD1 1 
ATOM   842  C  CD2 . PHE A 1 109 ? 12.211  8.994   1.125   1.00 8.89  ? 109 PHE A CD2 1 
ATOM   843  C  CE1 . PHE A 1 109 ? 9.766   9.071   2.462   1.00 7.51  ? 109 PHE A CE1 1 
ATOM   844  C  CE2 . PHE A 1 109 ? 11.956  8.192   2.237   1.00 6.96  ? 109 PHE A CE2 1 
ATOM   845  C  CZ  . PHE A 1 109 ? 10.769  8.204   2.899   1.00 6.88  ? 109 PHE A CZ  1 
ATOM   846  N  N   . VAL A 1 110 ? 10.767  13.279  1.755   1.00 5.65  ? 110 VAL A N   1 
ATOM   847  C  CA  . VAL A 1 110 ? 11.319  13.957  2.937   1.00 7.11  ? 110 VAL A CA  1 
ATOM   848  C  C   . VAL A 1 110 ? 10.883  13.106  4.119   1.00 6.48  ? 110 VAL A C   1 
ATOM   849  O  O   . VAL A 1 110 ? 9.718   12.781  4.261   1.00 5.07  ? 110 VAL A O   1 
ATOM   850  C  CB  . VAL A 1 110 ? 10.778  15.388  3.079   1.00 9.42  ? 110 VAL A CB  1 
ATOM   851  C  CG1 . VAL A 1 110 ? 11.385  16.022  4.351   1.00 9.57  ? 110 VAL A CG1 1 
ATOM   852  C  CG2 . VAL A 1 110 ? 11.204  16.216  1.883   1.00 8.57  ? 110 VAL A CG2 1 
ATOM   853  N  N   . THR A 1 111 ? 11.835  12.789  5.004   1.00 7.24  ? 111 THR A N   1 
ATOM   854  C  CA  . THR A 1 111 ? 11.420  11.878  6.085   1.00 6.73  ? 111 THR A CA  1 
ATOM   855  C  C   . THR A 1 111 ? 12.405  12.011  7.240   1.00 6.50  ? 111 THR A C   1 
ATOM   856  O  O   . THR A 1 111 ? 13.345  12.800  7.121   1.00 6.33  ? 111 THR A O   1 
ATOM   857  C  CB  . THR A 1 111 ? 11.469  10.429  5.526   1.00 7.90  ? 111 THR A CB  1 
ATOM   858  O  OG1 . THR A 1 111 ? 10.987  9.523   6.536   1.00 9.40  ? 111 THR A OG1 1 
ATOM   859  C  CG2 . THR A 1 111 ? 12.877  10.027  5.133   1.00 7.49  ? 111 THR A CG2 1 
ATOM   860  N  N   . THR A 1 112 ? 12.164  11.229  8.280   1.00 6.63  ? 112 THR A N   1 
ATOM   861  C  CA  . THR A 1 112 ? 13.200  11.215  9.354   1.00 6.59  ? 112 THR A CA  1 
ATOM   862  C  C   . THR A 1 112 ? 14.095  10.030  9.045   1.00 7.26  ? 112 THR A C   1 
ATOM   863  O  O   . THR A 1 112 ? 13.631  9.174   8.289   1.00 6.05  ? 112 THR A O   1 
ATOM   864  C  CB  . THR A 1 112 ? 12.524  11.008  10.698  1.00 6.01  ? 112 THR A CB  1 
ATOM   865  O  OG1 . THR A 1 112 ? 11.635  12.106  10.930  1.00 5.07  ? 112 THR A OG1 1 
ATOM   866  C  CG2 . THR A 1 112 ? 13.503  10.844  11.872  1.00 4.94  ? 112 THR A CG2 1 
ATOM   867  N  N   . ASP A 1 113 ? 15.365  9.998   9.461   1.00 5.88  ? 113 ASP A N   1 
ATOM   868  C  CA  . ASP A 1 113 ? 16.114  8.760   9.189   1.00 9.50  ? 113 ASP A CA  1 
ATOM   869  C  C   . ASP A 1 113 ? 15.554  7.758   10.222  1.00 9.86  ? 113 ASP A C   1 
ATOM   870  O  O   . ASP A 1 113 ? 15.911  7.802   11.389  1.00 8.36  ? 113 ASP A O   1 
ATOM   871  C  CB  . ASP A 1 113 ? 17.604  8.939   9.332   1.00 11.41 ? 113 ASP A CB  1 
ATOM   872  C  CG  . ASP A 1 113 ? 18.363  7.635   9.482   1.00 13.33 ? 113 ASP A CG  1 
ATOM   873  O  OD1 . ASP A 1 113 ? 17.890  6.504   9.423   1.00 15.30 ? 113 ASP A OD1 1 
ATOM   874  O  OD2 . ASP A 1 113 ? 19.575  7.713   9.726   1.00 15.93 ? 113 ASP A OD2 1 
ATOM   875  N  N   . ASN A 1 114 ? 14.694  6.863   9.734   1.00 8.82  ? 114 ASN A N   1 
ATOM   876  C  CA  . ASN A 1 114 ? 13.990  5.928   10.579  1.00 8.38  ? 114 ASN A CA  1 
ATOM   877  C  C   . ASN A 1 114 ? 14.819  4.778   11.115  1.00 7.20  ? 114 ASN A C   1 
ATOM   878  O  O   . ASN A 1 114 ? 14.521  4.239   12.165  1.00 6.41  ? 114 ASN A O   1 
ATOM   879  C  CB  . ASN A 1 114 ? 12.726  5.467   9.836   1.00 6.22  ? 114 ASN A CB  1 
ATOM   880  C  CG  . ASN A 1 114 ? 11.741  6.629   9.975   1.00 7.83  ? 114 ASN A CG  1 
ATOM   881  O  OD1 . ASN A 1 114 ? 11.537  7.128   11.085  1.00 5.71  ? 114 ASN A OD1 1 
ATOM   882  N  ND2 . ASN A 1 114 ? 11.177  7.058   8.832   1.00 6.69  ? 114 ASN A ND2 1 
ATOM   883  N  N   . VAL A 1 115 ? 15.921  4.438   10.450  1.00 8.97  ? 115 VAL A N   1 
ATOM   884  C  CA  . VAL A 1 115 ? 16.847  3.455   10.991  1.00 8.23  ? 115 VAL A CA  1 
ATOM   885  C  C   . VAL A 1 115 ? 17.509  4.088   12.232  1.00 8.24  ? 115 VAL A C   1 
ATOM   886  O  O   . VAL A 1 115 ? 17.542  3.440   13.265  1.00 8.51  ? 115 VAL A O   1 
ATOM   887  C  CB  . VAL A 1 115 ? 17.917  3.021   9.987   1.00 7.74  ? 115 VAL A CB  1 
ATOM   888  C  CG1 . VAL A 1 115 ? 18.987  2.137   10.636  1.00 8.60  ? 115 VAL A CG1 1 
ATOM   889  C  CG2 . VAL A 1 115 ? 17.203  2.303   8.825   1.00 8.67  ? 115 VAL A CG2 1 
ATOM   890  N  N   . ALA A 1 116 ? 17.940  5.330   12.185  1.00 6.37  ? 116 ALA A N   1 
ATOM   891  C  CA  . ALA A 1 116 ? 18.552  6.020   13.301  1.00 5.92  ? 116 ALA A CA  1 
ATOM   892  C  C   . ALA A 1 116 ? 17.560  6.169   14.447  1.00 7.15  ? 116 ALA A C   1 
ATOM   893  O  O   . ALA A 1 116 ? 17.935  6.012   15.606  1.00 6.49  ? 116 ALA A O   1 
ATOM   894  C  CB  . ALA A 1 116 ? 19.139  7.389   12.966  1.00 5.66  ? 116 ALA A CB  1 
ATOM   895  N  N   . VAL A 1 117 ? 16.273  6.456   14.152  1.00 5.93  ? 117 VAL A N   1 
ATOM   896  C  CA  . VAL A 1 117 ? 15.257  6.484   15.177  1.00 5.06  ? 117 VAL A CA  1 
ATOM   897  C  C   . VAL A 1 117 ? 15.252  5.156   15.936  1.00 6.08  ? 117 VAL A C   1 
ATOM   898  O  O   . VAL A 1 117 ? 15.219  5.089   17.158  1.00 5.37  ? 117 VAL A O   1 
ATOM   899  C  CB  . VAL A 1 117 ? 13.841  6.666   14.538  1.00 5.20  ? 117 VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 117 ? 12.753  6.326   15.517  1.00 6.42  ? 117 VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 117 ? 13.701  8.122   14.018  1.00 4.05  ? 117 VAL A CG2 1 
ATOM   902  N  N   . GLY A 1 118 ? 15.149  4.008   15.227  1.00 5.99  ? 118 GLY A N   1 
ATOM   903  C  CA  . GLY A 1 118 ? 15.046  2.724   15.958  1.00 7.96  ? 118 GLY A CA  1 
ATOM   904  C  C   . GLY A 1 118 ? 16.368  2.444   16.671  1.00 7.86  ? 118 GLY A C   1 
ATOM   905  O  O   . GLY A 1 118 ? 16.333  1.897   17.789  1.00 7.45  ? 118 GLY A O   1 
ATOM   906  N  N   . ALA A 1 119 ? 17.477  2.908   16.081  1.00 6.65  ? 119 ALA A N   1 
ATOM   907  C  CA  . ALA A 1 119 ? 18.764  2.685   16.779  1.00 7.22  ? 119 ALA A CA  1 
ATOM   908  C  C   . ALA A 1 119 ? 18.891  3.527   18.042  1.00 7.71  ? 119 ALA A C   1 
ATOM   909  O  O   . ALA A 1 119 ? 19.500  3.089   19.022  1.00 4.74  ? 119 ALA A O   1 
ATOM   910  C  CB  . ALA A 1 119 ? 19.916  2.949   15.830  1.00 7.06  ? 119 ALA A CB  1 
ATOM   911  N  N   . LYS A 1 120 ? 18.338  4.749   18.033  1.00 6.06  ? 120 LYS A N   1 
ATOM   912  C  CA  . LYS A 1 120 ? 18.347  5.602   19.200  1.00 5.73  ? 120 LYS A CA  1 
ATOM   913  C  C   . LYS A 1 120 ? 17.495  4.968   20.293  1.00 7.17  ? 120 LYS A C   1 
ATOM   914  O  O   . LYS A 1 120 ? 17.918  4.933   21.439  1.00 6.08  ? 120 LYS A O   1 
ATOM   915  C  CB  . LYS A 1 120 ? 17.757  7.014   18.922  1.00 6.25  ? 120 LYS A CB  1 
ATOM   916  C  CG  . LYS A 1 120 ? 18.633  7.783   17.944  1.00 8.90  ? 120 LYS A CG  1 
ATOM   917  C  CD  . LYS A 1 120 ? 18.017  9.216   17.843  1.00 8.49  ? 120 LYS A CD  1 
ATOM   918  C  CE  . LYS A 1 120 ? 18.891  9.924   16.812  1.00 10.71 ? 120 LYS A CE  1 
ATOM   919  N  NZ  . LYS A 1 120 ? 18.624  11.370  16.699  1.00 10.53 ? 120 LYS A NZ  1 
ATOM   920  N  N   . GLY A 1 121 ? 16.276  4.547   19.939  1.00 7.58  ? 121 GLY A N   1 
ATOM   921  C  CA  . GLY A 1 121 ? 15.422  3.938   20.953  1.00 8.40  ? 121 GLY A CA  1 
ATOM   922  C  C   . GLY A 1 121 ? 16.080  2.693   21.541  1.00 7.27  ? 121 GLY A C   1 
ATOM   923  O  O   . GLY A 1 121 ? 16.039  2.499   22.760  1.00 6.78  ? 121 GLY A O   1 
ATOM   924  N  N   . ALA A 1 122 ? 16.619  1.833   20.667  1.00 6.86  ? 122 ALA A N   1 
ATOM   925  C  CA  . ALA A 1 122 ? 17.230  0.597   21.175  1.00 8.04  ? 122 ALA A CA  1 
ATOM   926  C  C   . ALA A 1 122 ? 18.502  0.913   21.982  1.00 9.02  ? 122 ALA A C   1 
ATOM   927  O  O   . ALA A 1 122 ? 18.760  0.290   23.029  1.00 8.78  ? 122 ALA A O   1 
ATOM   928  C  CB  . ALA A 1 122 ? 17.621  -0.341  20.041  1.00 6.16  ? 122 ALA A CB  1 
ATOM   929  N  N   . SER A 1 123 ? 19.283  1.874   21.496  1.00 8.11  ? 123 SER A N   1 
ATOM   930  C  CA  . SER A 1 123 ? 20.542  2.212   22.189  1.00 9.30  ? 123 SER A CA  1 
ATOM   931  C  C   . SER A 1 123 ? 20.255  2.751   23.578  1.00 8.87  ? 123 SER A C   1 
ATOM   932  O  O   . SER A 1 123 ? 20.911  2.377   24.570  1.00 8.35  ? 123 SER A O   1 
ATOM   933  C  CB  . SER A 1 123 ? 21.338  3.195   21.319  1.00 10.98 ? 123 SER A CB  1 
ATOM   934  O  OG  . SER A 1 123 ? 22.496  3.608   22.048  1.00 15.44 ? 123 SER A OG  1 
ATOM   935  N  N   . PHE A 1 124 ? 19.233  3.600   23.692  1.00 7.51  ? 124 PHE A N   1 
ATOM   936  C  CA  . PHE A 1 124 ? 18.827  4.078   25.016  1.00 7.44  ? 124 PHE A CA  1 
ATOM   937  C  C   . PHE A 1 124 ? 18.407  2.904   25.901  1.00 8.86  ? 124 PHE A C   1 
ATOM   938  O  O   . PHE A 1 124 ? 18.753  2.851   27.091  1.00 6.21  ? 124 PHE A O   1 
ATOM   939  C  CB  . PHE A 1 124 ? 17.691  5.091   24.862  1.00 8.57  ? 124 PHE A CB  1 
ATOM   940  C  CG  . PHE A 1 124 ? 16.972  5.446   26.120  1.00 7.51  ? 124 PHE A CG  1 
ATOM   941  C  CD1 . PHE A 1 124 ? 17.537  6.387   26.994  1.00 8.95  ? 124 PHE A CD1 1 
ATOM   942  C  CD2 . PHE A 1 124 ? 15.794  4.826   26.476  1.00 9.39  ? 124 PHE A CD2 1 
ATOM   943  C  CE1 . PHE A 1 124 ? 16.833  6.709   28.150  1.00 8.35  ? 124 PHE A CE1 1 
ATOM   944  C  CE2 . PHE A 1 124 ? 15.133  5.130   27.667  1.00 10.06 ? 124 PHE A CE2 1 
ATOM   945  C  CZ  . PHE A 1 124 ? 15.653  6.095   28.507  1.00 7.50  ? 124 PHE A CZ  1 
ATOM   946  N  N   . ILE A 1 125 ? 17.530  2.018   25.386  1.00 6.96  ? 125 ILE A N   1 
ATOM   947  C  CA  . ILE A 1 125 ? 17.126  0.848   26.210  1.00 7.35  ? 125 ILE A CA  1 
ATOM   948  C  C   . ILE A 1 125 ? 18.367  0.055   26.647  1.00 7.35  ? 125 ILE A C   1 
ATOM   949  O  O   . ILE A 1 125 ? 18.514  -0.337  27.802  1.00 7.90  ? 125 ILE A O   1 
ATOM   950  C  CB  . ILE A 1 125 ? 16.212  -0.054  25.368  1.00 6.99  ? 125 ILE A CB  1 
ATOM   951  C  CG1 . ILE A 1 125 ? 14.793  0.552   25.294  1.00 6.23  ? 125 ILE A CG1 1 
ATOM   952  C  CG2 . ILE A 1 125 ? 16.162  -1.513  25.844  1.00 8.36  ? 125 ILE A CG2 1 
ATOM   953  C  CD1 . ILE A 1 125 ? 13.874  -0.161  24.312  1.00 4.72  ? 125 ILE A CD1 1 
ATOM   954  N  N   . ILE A 1 126 ? 19.265  -0.189  25.702  1.00 5.81  ? 126 ILE A N   1 
ATOM   955  C  CA  . ILE A 1 126 ? 20.464  -0.980  26.020  1.00 8.48  ? 126 ILE A CA  1 
ATOM   956  C  C   . ILE A 1 126 ? 21.197  -0.297  27.184  1.00 9.60  ? 126 ILE A C   1 
ATOM   957  O  O   . ILE A 1 126 ? 21.609  -0.989  28.119  1.00 9.25  ? 126 ILE A O   1 
ATOM   958  C  CB  . ILE A 1 126 ? 21.378  -1.151  24.833  1.00 8.27  ? 126 ILE A CB  1 
ATOM   959  C  CG1 . ILE A 1 126 ? 20.710  -2.131  23.827  1.00 7.39  ? 126 ILE A CG1 1 
ATOM   960  C  CG2 . ILE A 1 126 ? 22.764  -1.676  25.226  1.00 9.58  ? 126 ILE A CG2 1 
ATOM   961  C  CD1 . ILE A 1 126 ? 21.303  -1.899  22.433  1.00 7.53  ? 126 ILE A CD1 1 
ATOM   962  N  N   . ASP A 1 127 ? 21.367  0.996   27.070  1.00 7.97  ? 127 ASP A N   1 
ATOM   963  C  CA  . ASP A 1 127 ? 22.051  1.761   28.119  1.00 11.88 ? 127 ASP A CA  1 
ATOM   964  C  C   . ASP A 1 127 ? 21.333  1.616   29.449  1.00 12.48 ? 127 ASP A C   1 
ATOM   965  O  O   . ASP A 1 127 ? 21.982  1.342   30.466  1.00 14.82 ? 127 ASP A O   1 
ATOM   966  C  CB  . ASP A 1 127 ? 22.058  3.249   27.768  1.00 13.91 ? 127 ASP A CB  1 
ATOM   967  C  CG  . ASP A 1 127 ? 23.051  3.691   26.737  1.00 16.42 ? 127 ASP A CG  1 
ATOM   968  O  OD1 . ASP A 1 127 ? 23.821  2.871   26.221  1.00 17.00 ? 127 ASP A OD1 1 
ATOM   969  O  OD2 . ASP A 1 127 ? 23.044  4.908   26.416  1.00 18.59 ? 127 ASP A OD2 1 
ATOM   970  N  N   . LYS A 1 128 ? 20.031  1.853   29.478  1.00 11.84 ? 128 LYS A N   1 
ATOM   971  C  CA  . LYS A 1 128 ? 19.241  1.798   30.698  1.00 13.89 ? 128 LYS A CA  1 
ATOM   972  C  C   . LYS A 1 128 ? 19.232  0.422   31.351  1.00 14.03 ? 128 LYS A C   1 
ATOM   973  O  O   . LYS A 1 128 ? 19.163  0.312   32.584  1.00 14.95 ? 128 LYS A O   1 
ATOM   974  C  CB  . LYS A 1 128 ? 17.796  2.254   30.466  1.00 14.96 ? 128 LYS A CB  1 
ATOM   975  C  CG  . LYS A 1 128 ? 17.647  3.745   30.232  1.00 16.76 ? 128 LYS A CG  1 
ATOM   976  C  CD  . LYS A 1 128 ? 17.855  4.569   31.503  1.00 18.50 ? 128 LYS A CD  1 
ATOM   977  C  CE  . LYS A 1 128 ? 19.272  5.113   31.550  1.00 21.83 ? 128 LYS A CE  1 
ATOM   978  N  NZ  . LYS A 1 128 ? 19.302  6.571   31.863  1.00 21.83 ? 128 LYS A NZ  1 
ATOM   979  N  N   . LEU A 1 129 ? 19.321  -0.640  30.555  1.00 11.22 ? 129 LEU A N   1 
ATOM   980  C  CA  . LEU A 1 129 ? 19.324  -1.985  31.113  1.00 12.24 ? 129 LEU A CA  1 
ATOM   981  C  C   . LEU A 1 129 ? 20.705  -2.298  31.693  1.00 13.29 ? 129 LEU A C   1 
ATOM   982  O  O   . LEU A 1 129 ? 20.844  -3.247  32.462  1.00 15.95 ? 129 LEU A O   1 
ATOM   983  C  CB  . LEU A 1 129 ? 18.916  -3.024  30.079  1.00 10.72 ? 129 LEU A CB  1 
ATOM   984  C  CG  . LEU A 1 129 ? 17.429  -2.979  29.687  1.00 11.52 ? 129 LEU A CG  1 
ATOM   985  C  CD1 . LEU A 1 129 ? 17.099  -4.220  28.857  1.00 10.23 ? 129 LEU A CD1 1 
ATOM   986  C  CD2 . LEU A 1 129 ? 16.497  -2.862  30.874  1.00 10.67 ? 129 LEU A CD2 1 
ATOM   987  N  N   . GLY A 1 130 ? 21.709  -1.560  31.285  1.00 12.81 ? 130 GLY A N   1 
ATOM   988  C  CA  . GLY A 1 130 ? 23.053  -1.670  31.849  1.00 14.36 ? 130 GLY A CA  1 
ATOM   989  C  C   . GLY A 1 130 ? 23.721  -2.991  31.577  1.00 14.13 ? 130 GLY A C   1 
ATOM   990  O  O   . GLY A 1 130 ? 23.463  -3.689  30.582  1.00 14.35 ? 130 GLY A O   1 
ATOM   991  N  N   . ALA A 1 131 ? 24.666  -3.348  32.461  1.00 14.06 ? 131 ALA A N   1 
ATOM   992  C  CA  . ALA A 1 131 ? 25.450  -4.565  32.223  1.00 12.87 ? 131 ALA A CA  1 
ATOM   993  C  C   . ALA A 1 131 ? 24.659  -5.850  32.089  1.00 12.76 ? 131 ALA A C   1 
ATOM   994  O  O   . ALA A 1 131 ? 24.980  -6.663  31.206  1.00 11.87 ? 131 ALA A O   1 
ATOM   995  C  CB  . ALA A 1 131 ? 26.479  -4.689  33.342  1.00 12.57 ? 131 ALA A CB  1 
ATOM   996  N  N   . GLU A 1 132 ? 23.664  -6.095  32.930  1.00 12.76 ? 132 GLU A N   1 
ATOM   997  C  CA  . GLU A 1 132 ? 22.884  -7.323  32.914  1.00 13.31 ? 132 GLU A CA  1 
ATOM   998  C  C   . GLU A 1 132 ? 21.959  -7.503  31.705  1.00 12.71 ? 132 GLU A C   1 
ATOM   999  O  O   . GLU A 1 132 ? 21.631  -8.633  31.383  1.00 11.76 ? 132 GLU A O   1 
ATOM   1000 C  CB  . GLU A 1 132 ? 22.018  -7.397  34.186  1.00 17.48 ? 132 GLU A CB  1 
ATOM   1001 C  CG  . GLU A 1 132 ? 22.887  -8.035  35.282  1.00 22.67 ? 132 GLU A CG  1 
ATOM   1002 C  CD  . GLU A 1 132 ? 22.271  -8.087  36.658  1.00 24.80 ? 132 GLU A CD  1 
ATOM   1003 O  OE1 . GLU A 1 132 ? 21.033  -8.009  36.739  1.00 26.66 ? 132 GLU A OE1 1 
ATOM   1004 O  OE2 . GLU A 1 132 ? 23.050  -8.198  37.631  1.00 25.38 ? 132 GLU A OE2 1 
ATOM   1005 N  N   . GLY A 1 133 ? 21.590  -6.412  31.049  1.00 9.36  ? 133 GLY A N   1 
ATOM   1006 C  CA  . GLY A 1 133 ? 20.753  -6.561  29.871  1.00 10.70 ? 133 GLY A CA  1 
ATOM   1007 C  C   . GLY A 1 133 ? 19.431  -7.221  30.215  1.00 9.03  ? 133 GLY A C   1 
ATOM   1008 O  O   . GLY A 1 133 ? 18.833  -6.900  31.233  1.00 9.87  ? 133 GLY A O   1 
ATOM   1009 N  N   . GLY A 1 134 ? 18.968  -8.110  29.329  1.00 9.90  ? 134 GLY A N   1 
ATOM   1010 C  CA  . GLY A 1 134 ? 17.665  -8.710  29.565  1.00 8.70  ? 134 GLY A CA  1 
ATOM   1011 C  C   . GLY A 1 134 ? 16.870  -8.851  28.261  1.00 7.86  ? 134 GLY A C   1 
ATOM   1012 O  O   . GLY A 1 134 ? 17.400  -8.577  27.198  1.00 6.59  ? 134 GLY A O   1 
ATOM   1013 N  N   . GLU A 1 135 ? 15.673  -9.401  28.423  1.00 7.61  ? 135 GLU A N   1 
ATOM   1014 C  CA  . GLU A 1 135 ? 14.817  -9.669  27.252  1.00 7.78  ? 135 GLU A CA  1 
ATOM   1015 C  C   . GLU A 1 135 ? 14.115  -8.413  26.783  1.00 7.77  ? 135 GLU A C   1 
ATOM   1016 O  O   . GLU A 1 135 ? 13.703  -7.593  27.602  1.00 9.20  ? 135 GLU A O   1 
ATOM   1017 C  CB  . GLU A 1 135 ? 13.764  -10.721 27.662  1.00 7.39  ? 135 GLU A CB  1 
ATOM   1018 C  CG  . GLU A 1 135 ? 14.399  -12.094 27.900  1.00 10.81 ? 135 GLU A CG  1 
ATOM   1019 C  CD  . GLU A 1 135 ? 13.360  -13.147 28.264  1.00 12.62 ? 135 GLU A CD  1 
ATOM   1020 O  OE1 . GLU A 1 135 ? 12.152  -12.860 28.344  1.00 12.48 ? 135 GLU A OE1 1 
ATOM   1021 O  OE2 . GLU A 1 135 ? 13.753  -14.313 28.506  1.00 12.62 ? 135 GLU A OE2 1 
ATOM   1022 N  N   . VAL A 1 136 ? 14.047  -8.225  25.457  1.00 7.24  ? 136 VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 136 ? 13.400  -6.966  24.986  1.00 5.95  ? 136 VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 136 ? 12.474  -7.345  23.832  1.00 5.15  ? 136 VAL A C   1 
ATOM   1025 O  O   . VAL A 1 136 ? 12.634  -8.431  23.262  1.00 8.02  ? 136 VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 136 ? 14.381  -5.892  24.503  1.00 5.40  ? 136 VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 136 ? 15.395  -5.461  25.591  1.00 3.86  ? 136 VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 136 ? 15.136  -6.328  23.246  1.00 4.85  ? 136 VAL A CG2 1 
ATOM   1029 N  N   . ALA A 1 137 ? 11.572  -6.441  23.497  1.00 5.51  ? 137 ALA A N   1 
ATOM   1030 C  CA  . ALA A 1 137 ? 10.657  -6.732  22.380  1.00 5.04  ? 137 ALA A CA  1 
ATOM   1031 C  C   . ALA A 1 137 ? 10.490  -5.427  21.581  1.00 5.27  ? 137 ALA A C   1 
ATOM   1032 O  O   . ALA A 1 137 ? 10.768  -4.360  22.084  1.00 4.73  ? 137 ALA A O   1 
ATOM   1033 C  CB  . ALA A 1 137 ? 9.234   -7.147  22.760  1.00 5.31  ? 137 ALA A CB  1 
ATOM   1034 N  N   . ILE A 1 138 ? 10.058  -5.625  20.340  1.00 5.51  ? 138 ILE A N   1 
ATOM   1035 C  CA  . ILE A 1 138 ? 9.771   -4.514  19.460  1.00 4.47  ? 138 ILE A CA  1 
ATOM   1036 C  C   . ILE A 1 138 ? 8.304   -4.674  19.054  1.00 5.51  ? 138 ILE A C   1 
ATOM   1037 O  O   . ILE A 1 138 ? 7.878   -5.754  18.696  1.00 6.95  ? 138 ILE A O   1 
ATOM   1038 C  CB  . ILE A 1 138 ? 10.637  -4.494  18.213  1.00 5.25  ? 138 ILE A CB  1 
ATOM   1039 C  CG1 . ILE A 1 138 ? 12.104  -4.290  18.579  1.00 3.84  ? 138 ILE A CG1 1 
ATOM   1040 C  CG2 . ILE A 1 138 ? 10.125  -3.429  17.227  1.00 2.86  ? 138 ILE A CG2 1 
ATOM   1041 C  CD1 . ILE A 1 138 ? 13.044  -4.579  17.429  1.00 5.07  ? 138 ILE A CD1 1 
ATOM   1042 N  N   . ILE A 1 139 ? 7.593   -3.589  19.174  1.00 5.76  ? 139 ILE A N   1 
ATOM   1043 C  CA  . ILE A 1 139 ? 6.201   -3.495  18.750  1.00 8.60  ? 139 ILE A CA  1 
ATOM   1044 C  C   . ILE A 1 139 ? 6.274   -2.600  17.522  1.00 7.48  ? 139 ILE A C   1 
ATOM   1045 O  O   . ILE A 1 139 ? 6.618   -1.421  17.630  1.00 5.79  ? 139 ILE A O   1 
ATOM   1046 C  CB  . ILE A 1 139 ? 5.306   -2.927  19.853  1.00 7.91  ? 139 ILE A CB  1 
ATOM   1047 C  CG1 . ILE A 1 139 ? 5.291   -3.855  21.063  1.00 10.15 ? 139 ILE A CG1 1 
ATOM   1048 C  CG2 . ILE A 1 139 ? 3.863   -2.772  19.349  1.00 6.51  ? 139 ILE A CG2 1 
ATOM   1049 C  CD1 . ILE A 1 139 ? 4.700   -5.210  20.915  1.00 10.46 ? 139 ILE A CD1 1 
ATOM   1050 N  N   . GLU A 1 140 ? 6.130   -3.224  16.344  1.00 7.53  ? 140 GLU A N   1 
ATOM   1051 C  CA  . GLU A 1 140 ? 6.308   -2.556  15.086  1.00 7.57  ? 140 GLU A CA  1 
ATOM   1052 C  C   . GLU A 1 140 ? 5.049   -1.833  14.617  1.00 5.89  ? 140 GLU A C   1 
ATOM   1053 O  O   . GLU A 1 140 ? 4.000   -2.025  15.209  1.00 6.46  ? 140 GLU A O   1 
ATOM   1054 C  CB  . GLU A 1 140 ? 6.586   -3.650  13.996  1.00 9.46  ? 140 GLU A CB  1 
ATOM   1055 C  CG  . GLU A 1 140 ? 7.649   -4.639  14.411  1.00 12.86 ? 140 GLU A CG  1 
ATOM   1056 C  CD  . GLU A 1 140 ? 7.847   -5.813  13.470  1.00 15.64 ? 140 GLU A CD  1 
ATOM   1057 O  OE1 . GLU A 1 140 ? 7.285   -5.797  12.347  1.00 15.95 ? 140 GLU A OE1 1 
ATOM   1058 O  OE2 . GLU A 1 140 ? 8.611   -6.761  13.794  1.00 12.46 ? 140 GLU A OE2 1 
ATOM   1059 N  N   . GLY A 1 141 ? 5.156   -1.025  13.582  1.00 5.49  ? 141 GLY A N   1 
ATOM   1060 C  CA  . GLY A 1 141 ? 3.950   -0.426  12.996  1.00 5.32  ? 141 GLY A CA  1 
ATOM   1061 C  C   . GLY A 1 141 ? 3.338   -1.489  12.045  1.00 7.48  ? 141 GLY A C   1 
ATOM   1062 O  O   . GLY A 1 141 ? 3.516   -2.696  12.222  1.00 8.01  ? 141 GLY A O   1 
ATOM   1063 N  N   . LYS A 1 142 ? 2.685   -0.959  11.016  1.00 7.69  ? 142 LYS A N   1 
ATOM   1064 C  CA  . LYS A 1 142 ? 2.099   -1.895  10.028  1.00 7.18  ? 142 LYS A CA  1 
ATOM   1065 C  C   . LYS A 1 142 ? 3.249   -2.587  9.342   1.00 5.92  ? 142 LYS A C   1 
ATOM   1066 O  O   . LYS A 1 142 ? 4.163   -1.912  8.843   1.00 5.83  ? 142 LYS A O   1 
ATOM   1067 C  CB  . LYS A 1 142 ? 1.348   -0.999  9.018   1.00 8.54  ? 142 LYS A CB  1 
ATOM   1068 C  CG  . LYS A 1 142 ? 0.569   -1.866  7.998   1.00 9.71  ? 142 LYS A CG  1 
ATOM   1069 C  CD  . LYS A 1 142 ? -0.272  -0.891  7.129   1.00 8.24  ? 142 LYS A CD  1 
ATOM   1070 C  CE  . LYS A 1 142 ? -0.873  -1.724  5.959   1.00 8.97  ? 142 LYS A CE  1 
ATOM   1071 N  NZ  . LYS A 1 142 ? -1.859  -2.685  6.493   1.00 9.00  ? 142 LYS A NZ  1 
ATOM   1072 N  N   . ALA A 1 143 ? 3.305   -3.913  9.304   1.00 7.42  ? 143 ALA A N   1 
ATOM   1073 C  CA  . ALA A 1 143 ? 4.403   -4.625  8.650   1.00 6.89  ? 143 ALA A CA  1 
ATOM   1074 C  C   . ALA A 1 143 ? 4.440   -4.216  7.176   1.00 6.32  ? 143 ALA A C   1 
ATOM   1075 O  O   . ALA A 1 143 ? 3.406   -4.091  6.527   1.00 7.14  ? 143 ALA A O   1 
ATOM   1076 C  CB  . ALA A 1 143 ? 4.224   -6.138  8.764   1.00 6.05  ? 143 ALA A CB  1 
ATOM   1077 N  N   . GLY A 1 144 ? 5.638   -4.015  6.671   1.00 7.14  ? 144 GLY A N   1 
ATOM   1078 C  CA  . GLY A 1 144 ? 5.810   -3.593  5.271   1.00 7.66  ? 144 GLY A CA  1 
ATOM   1079 C  C   . GLY A 1 144 ? 5.889   -2.084  5.118   1.00 6.75  ? 144 GLY A C   1 
ATOM   1080 O  O   . GLY A 1 144 ? 6.381   -1.641  4.080   1.00 7.87  ? 144 GLY A O   1 
ATOM   1081 N  N   . ASN A 1 145 ? 5.389   -1.282  6.070   1.00 6.21  ? 145 ASN A N   1 
ATOM   1082 C  CA  . ASN A 1 145 ? 5.531   0.168   5.966   1.00 6.49  ? 145 ASN A CA  1 
ATOM   1083 C  C   . ASN A 1 145 ? 7.002   0.517   6.142   1.00 7.20  ? 145 ASN A C   1 
ATOM   1084 O  O   . ASN A 1 145 ? 7.585   0.175   7.162   1.00 6.53  ? 145 ASN A O   1 
ATOM   1085 C  CB  . ASN A 1 145 ? 4.718   0.934   7.020   1.00 7.80  ? 145 ASN A CB  1 
ATOM   1086 C  CG  . ASN A 1 145 ? 3.307   1.127   6.495   1.00 9.76  ? 145 ASN A CG  1 
ATOM   1087 O  OD1 . ASN A 1 145 ? 2.832   0.263   5.742   1.00 9.20  ? 145 ASN A OD1 1 
ATOM   1088 N  ND2 . ASN A 1 145 ? 2.654   2.199   6.894   1.00 8.50  ? 145 ASN A ND2 1 
ATOM   1089 N  N   . ALA A 1 146 ? 7.577   1.271   5.214   1.00 6.10  ? 146 ALA A N   1 
ATOM   1090 C  CA  . ALA A 1 146 ? 8.964   1.631   5.301   1.00 7.99  ? 146 ALA A CA  1 
ATOM   1091 C  C   . ALA A 1 146 ? 9.332   2.332   6.617   1.00 6.18  ? 146 ALA A C   1 
ATOM   1092 O  O   . ALA A 1 146 ? 10.453  2.100   7.078   1.00 8.16  ? 146 ALA A O   1 
ATOM   1093 C  CB  . ALA A 1 146 ? 9.397   2.574   4.175   1.00 6.99  ? 146 ALA A CB  1 
ATOM   1094 N  N   . SER A 1 147 ? 8.449   3.166   7.133   1.00 5.40  ? 147 SER A N   1 
ATOM   1095 C  CA  . SER A 1 147 ? 8.828   3.922   8.349   1.00 6.73  ? 147 SER A CA  1 
ATOM   1096 C  C   . SER A 1 147 ? 9.068   2.961   9.519   1.00 6.90  ? 147 SER A C   1 
ATOM   1097 O  O   . SER A 1 147 ? 10.122  2.995   10.156  1.00 6.25  ? 147 SER A O   1 
ATOM   1098 C  CB  . SER A 1 147 ? 7.719   4.903   8.691   1.00 4.96  ? 147 SER A CB  1 
ATOM   1099 O  OG  . SER A 1 147 ? 6.504   4.222   8.896   1.00 4.63  ? 147 SER A OG  1 
ATOM   1100 N  N   . GLY A 1 148 ? 8.072   2.109   9.723   1.00 7.14  ? 148 GLY A N   1 
ATOM   1101 C  CA  . GLY A 1 148 ? 8.149   1.146   10.841  1.00 8.59  ? 148 GLY A CA  1 
ATOM   1102 C  C   . GLY A 1 148 ? 9.267   0.131   10.582  1.00 9.05  ? 148 GLY A C   1 
ATOM   1103 O  O   . GLY A 1 148 ? 9.973   -0.303  11.534  1.00 8.98  ? 148 GLY A O   1 
ATOM   1104 N  N   . GLU A 1 149 ? 9.396   -0.318  9.329   1.00 8.53  ? 149 GLU A N   1 
ATOM   1105 C  CA  . GLU A 1 149 ? 10.401  -1.343  9.030   1.00 9.00  ? 149 GLU A CA  1 
ATOM   1106 C  C   . GLU A 1 149 ? 11.785  -0.779  9.365   1.00 8.49  ? 149 GLU A C   1 
ATOM   1107 O  O   . GLU A 1 149 ? 12.632  -1.515  9.888   1.00 8.22  ? 149 GLU A O   1 
ATOM   1108 C  CB  . GLU A 1 149 ? 10.437  -1.818  7.576   1.00 10.18 ? 149 GLU A CB  1 
ATOM   1109 C  CG  . GLU A 1 149 ? 9.208   -2.639  7.203   1.00 10.78 ? 149 GLU A CG  1 
ATOM   1110 C  CD  . GLU A 1 149 ? 9.137   -3.940  7.974   1.00 11.51 ? 149 GLU A CD  1 
ATOM   1111 O  OE1 . GLU A 1 149 ? 10.191  -4.440  8.463   1.00 9.88  ? 149 GLU A OE1 1 
ATOM   1112 O  OE2 . GLU A 1 149 ? 8.022   -4.459  8.138   1.00 11.76 ? 149 GLU A OE2 1 
ATOM   1113 N  N   . ALA A 1 150 ? 12.054  0.442   8.964   1.00 5.67  ? 150 ALA A N   1 
ATOM   1114 C  CA  . ALA A 1 150 ? 13.353  1.044   9.229   1.00 7.65  ? 150 ALA A CA  1 
ATOM   1115 C  C   . ALA A 1 150 ? 13.579  1.129   10.733  1.00 7.33  ? 150 ALA A C   1 
ATOM   1116 O  O   . ALA A 1 150 ? 14.649  0.724   11.188  1.00 7.57  ? 150 ALA A O   1 
ATOM   1117 C  CB  . ALA A 1 150 ? 13.419  2.421   8.571   1.00 7.69  ? 150 ALA A CB  1 
ATOM   1118 N  N   . ARG A 1 151 ? 12.592  1.602   11.491  1.00 6.76  ? 151 ARG A N   1 
ATOM   1119 C  CA  . ARG A 1 151 ? 12.735  1.671   12.950  1.00 7.73  ? 151 ARG A CA  1 
ATOM   1120 C  C   . ARG A 1 151 ? 13.007  0.273   13.502  1.00 8.27  ? 151 ARG A C   1 
ATOM   1121 O  O   . ARG A 1 151 ? 13.884  0.072   14.332  1.00 7.61  ? 151 ARG A O   1 
ATOM   1122 C  CB  . ARG A 1 151 ? 11.487  2.256   13.608  1.00 6.64  ? 151 ARG A CB  1 
ATOM   1123 C  CG  . ARG A 1 151 ? 11.336  3.714   13.139  1.00 5.76  ? 151 ARG A CG  1 
ATOM   1124 C  CD  . ARG A 1 151 ? 9.996   4.269   13.657  1.00 6.25  ? 151 ARG A CD  1 
ATOM   1125 N  NE  . ARG A 1 151 ? 9.837   5.533   12.911  1.00 5.63  ? 151 ARG A NE  1 
ATOM   1126 C  CZ  . ARG A 1 151 ? 8.666   6.116   12.661  1.00 4.71  ? 151 ARG A CZ  1 
ATOM   1127 N  NH1 . ARG A 1 151 ? 7.540   5.698   13.227  1.00 5.35  ? 151 ARG A NH1 1 
ATOM   1128 N  NH2 . ARG A 1 151 ? 8.695   7.188   11.899  1.00 5.15  ? 151 ARG A NH2 1 
ATOM   1129 N  N   . ARG A 1 152 ? 12.241  -0.711  12.994  1.00 7.13  ? 152 ARG A N   1 
ATOM   1130 C  CA  . ARG A 1 152 ? 12.470  -2.095  13.419  1.00 7.30  ? 152 ARG A CA  1 
ATOM   1131 C  C   . ARG A 1 152 ? 13.876  -2.568  13.104  1.00 7.04  ? 152 ARG A C   1 
ATOM   1132 O  O   . ARG A 1 152 ? 14.538  -3.228  13.949  1.00 8.53  ? 152 ARG A O   1 
ATOM   1133 C  CB  . ARG A 1 152 ? 11.471  -3.027  12.735  1.00 7.32  ? 152 ARG A CB  1 
ATOM   1134 C  CG  . ARG A 1 152 ? 11.657  -4.481  13.188  1.00 9.35  ? 152 ARG A CG  1 
ATOM   1135 C  CD  . ARG A 1 152 ? 10.877  -5.398  12.246  1.00 10.65 ? 152 ARG A CD  1 
ATOM   1136 N  NE  . ARG A 1 152 ? 11.506  -5.468  10.941  1.00 14.00 ? 152 ARG A NE  1 
ATOM   1137 C  CZ  . ARG A 1 152 ? 12.541  -6.232  10.636  1.00 17.46 ? 152 ARG A CZ  1 
ATOM   1138 N  NH1 . ARG A 1 152 ? 13.113  -6.965  11.586  1.00 17.35 ? 152 ARG A NH1 1 
ATOM   1139 N  NH2 . ARG A 1 152 ? 13.035  -6.259  9.403   1.00 18.22 ? 152 ARG A NH2 1 
ATOM   1140 N  N   . ASN A 1 153 ? 14.361  -2.285  11.897  1.00 5.29  ? 153 ASN A N   1 
ATOM   1141 C  CA  . ASN A 1 153 ? 15.698  -2.731  11.520  1.00 7.57  ? 153 ASN A CA  1 
ATOM   1142 C  C   . ASN A 1 153 ? 16.758  -2.032  12.374  1.00 7.95  ? 153 ASN A C   1 
ATOM   1143 O  O   . ASN A 1 153 ? 17.663  -2.680  12.870  1.00 7.46  ? 153 ASN A O   1 
ATOM   1144 C  CB  . ASN A 1 153 ? 15.910  -2.455  10.047  1.00 11.13 ? 153 ASN A CB  1 
ATOM   1145 C  CG  . ASN A 1 153 ? 15.159  -3.454  9.189   1.00 14.70 ? 153 ASN A CG  1 
ATOM   1146 O  OD1 . ASN A 1 153 ? 14.810  -4.548  9.641   1.00 19.42 ? 153 ASN A OD1 1 
ATOM   1147 N  ND2 . ASN A 1 153 ? 14.923  -3.104  7.940   1.00 16.79 ? 153 ASN A ND2 1 
ATOM   1148 N  N   . GLY A 1 154 ? 16.613  -0.717  12.505  1.00 5.78  ? 154 GLY A N   1 
ATOM   1149 C  CA  . GLY A 1 154 ? 17.556  0.036   13.349  1.00 6.24  ? 154 GLY A CA  1 
ATOM   1150 C  C   . GLY A 1 154 ? 17.579  -0.515  14.767  1.00 6.60  ? 154 GLY A C   1 
ATOM   1151 O  O   . GLY A 1 154 ? 18.662  -0.590  15.387  1.00 7.95  ? 154 GLY A O   1 
ATOM   1152 N  N   . ALA A 1 155 ? 16.413  -0.756  15.367  1.00 6.13  ? 155 ALA A N   1 
ATOM   1153 C  CA  . ALA A 1 155 ? 16.407  -1.263  16.744  1.00 7.72  ? 155 ALA A CA  1 
ATOM   1154 C  C   . ALA A 1 155 ? 16.928  -2.689  16.816  1.00 8.50  ? 155 ALA A C   1 
ATOM   1155 O  O   . ALA A 1 155 ? 17.692  -3.038  17.729  1.00 7.94  ? 155 ALA A O   1 
ATOM   1156 C  CB  . ALA A 1 155 ? 15.013  -1.157  17.346  1.00 5.47  ? 155 ALA A CB  1 
ATOM   1157 N  N   . THR A 1 156 ? 16.514  -3.546  15.875  1.00 5.74  ? 156 THR A N   1 
ATOM   1158 C  CA  . THR A 1 156 ? 16.930  -4.947  15.885  1.00 6.81  ? 156 THR A CA  1 
ATOM   1159 C  C   . THR A 1 156 ? 18.435  -5.085  15.733  1.00 7.36  ? 156 THR A C   1 
ATOM   1160 O  O   . THR A 1 156 ? 19.103  -5.844  16.453  1.00 6.29  ? 156 THR A O   1 
ATOM   1161 C  CB  . THR A 1 156 ? 16.212  -5.709  14.739  1.00 5.72  ? 156 THR A CB  1 
ATOM   1162 O  OG1 . THR A 1 156 ? 14.810  -5.594  14.994  1.00 7.19  ? 156 THR A OG1 1 
ATOM   1163 C  CG2 . THR A 1 156 ? 16.557  -7.198  14.745  1.00 7.03  ? 156 THR A CG2 1 
ATOM   1164 N  N   . GLU A 1 157 ? 19.014  -4.364  14.761  1.00 6.01  ? 157 GLU A N   1 
ATOM   1165 C  CA  . GLU A 1 157 ? 20.441  -4.376  14.529  1.00 7.74  ? 157 GLU A CA  1 
ATOM   1166 C  C   . GLU A 1 157 ? 21.222  -3.857  15.736  1.00 7.07  ? 157 GLU A C   1 
ATOM   1167 O  O   . GLU A 1 157 ? 22.316  -4.372  15.990  1.00 8.81  ? 157 GLU A O   1 
ATOM   1168 C  CB  . GLU A 1 157 ? 20.816  -3.553  13.279  1.00 8.47  ? 157 GLU A CB  1 
ATOM   1169 C  CG  . GLU A 1 157 ? 20.379  -4.408  12.055  1.00 11.32 ? 157 GLU A CG  1 
ATOM   1170 C  CD  . GLU A 1 157 ? 20.577  -3.719  10.715  1.00 14.93 ? 157 GLU A CD  1 
ATOM   1171 O  OE1 . GLU A 1 157 ? 21.245  -2.677  10.606  1.00 16.26 ? 157 GLU A OE1 1 
ATOM   1172 O  OE2 . GLU A 1 157 ? 20.073  -4.278  9.711   1.00 13.25 ? 157 GLU A OE2 1 
ATOM   1173 N  N   . ALA A 1 158 ? 20.681  -2.851  16.417  1.00 6.72  ? 158 ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 158 ? 21.373  -2.368  17.628  1.00 5.39  ? 158 ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 158 ? 21.303  -3.464  18.685  1.00 6.67  ? 158 ALA A C   1 
ATOM   1176 O  O   . ALA A 1 158 ? 22.324  -3.832  19.274  1.00 6.37  ? 158 ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 158 ? 20.659  -1.122  18.134  1.00 6.91  ? 158 ALA A CB  1 
ATOM   1178 N  N   . PHE A 1 159 ? 20.097  -4.001  18.941  1.00 6.26  ? 159 PHE A N   1 
ATOM   1179 C  CA  . PHE A 1 159 ? 19.973  -5.037  19.965  1.00 6.95  ? 159 PHE A CA  1 
ATOM   1180 C  C   . PHE A 1 159 ? 20.826  -6.266  19.617  1.00 8.47  ? 159 PHE A C   1 
ATOM   1181 O  O   . PHE A 1 159 ? 21.420  -6.848  20.532  1.00 6.86  ? 159 PHE A O   1 
ATOM   1182 C  CB  . PHE A 1 159 ? 18.533  -5.566  20.097  1.00 6.36  ? 159 PHE A CB  1 
ATOM   1183 C  CG  . PHE A 1 159 ? 17.561  -4.612  20.729  1.00 6.55  ? 159 PHE A CG  1 
ATOM   1184 C  CD1 . PHE A 1 159 ? 17.905  -3.811  21.809  1.00 6.71  ? 159 PHE A CD1 1 
ATOM   1185 C  CD2 . PHE A 1 159 ? 16.263  -4.553  20.243  1.00 6.32  ? 159 PHE A CD2 1 
ATOM   1186 C  CE1 . PHE A 1 159 ? 16.970  -2.949  22.379  1.00 7.52  ? 159 PHE A CE1 1 
ATOM   1187 C  CE2 . PHE A 1 159 ? 15.328  -3.712  20.822  1.00 5.69  ? 159 PHE A CE2 1 
ATOM   1188 C  CZ  . PHE A 1 159 ? 15.680  -2.898  21.907  1.00 6.49  ? 159 PHE A CZ  1 
ATOM   1189 N  N   . LYS A 1 160 ? 20.904  -6.616  18.325  1.00 7.15  ? 160 LYS A N   1 
ATOM   1190 C  CA  . LYS A 1 160 ? 21.746  -7.810  18.033  1.00 9.24  ? 160 LYS A CA  1 
ATOM   1191 C  C   . LYS A 1 160 ? 23.221  -7.635  18.343  1.00 8.97  ? 160 LYS A C   1 
ATOM   1192 O  O   . LYS A 1 160 ? 23.955  -8.614  18.579  1.00 6.75  ? 160 LYS A O   1 
ATOM   1193 C  CB  . LYS A 1 160 ? 21.432  -8.294  16.631  1.00 10.40 ? 160 LYS A CB  1 
ATOM   1194 C  CG  . LYS A 1 160 ? 20.030  -8.919  16.544  1.00 13.26 ? 160 LYS A CG  1 
ATOM   1195 C  CD  . LYS A 1 160 ? 19.696  -9.943  17.628  1.00 12.48 ? 160 LYS A CD  1 
ATOM   1196 C  CE  . LYS A 1 160 ? 18.309  -10.556 17.420  1.00 14.07 ? 160 LYS A CE  1 
ATOM   1197 N  NZ  . LYS A 1 160 ? 18.102  -11.063 16.038  1.00 12.57 ? 160 LYS A NZ  1 
ATOM   1198 N  N   . LYS A 1 161 ? 23.746  -6.413  18.336  1.00 5.44  ? 161 LYS A N   1 
ATOM   1199 C  CA  . LYS A 1 161 ? 25.129  -6.162  18.694  1.00 8.33  ? 161 LYS A CA  1 
ATOM   1200 C  C   . LYS A 1 161 ? 25.372  -6.296  20.199  1.00 8.72  ? 161 LYS A C   1 
ATOM   1201 O  O   . LYS A 1 161 ? 26.548  -6.413  20.559  1.00 9.15  ? 161 LYS A O   1 
ATOM   1202 C  CB  . LYS A 1 161 ? 25.550  -4.723  18.336  1.00 7.41  ? 161 LYS A CB  1 
ATOM   1203 C  CG  . LYS A 1 161 ? 25.576  -4.502  16.851  1.00 9.24  ? 161 LYS A CG  1 
ATOM   1204 C  CD  . LYS A 1 161 ? 25.657  -3.026  16.514  1.00 10.23 ? 161 LYS A CD  1 
ATOM   1205 C  CE  . LYS A 1 161 ? 25.097  -2.584  15.194  1.00 12.21 ? 161 LYS A CE  1 
ATOM   1206 N  NZ  . LYS A 1 161 ? 25.143  -1.067  15.106  1.00 13.75 ? 161 LYS A NZ  1 
ATOM   1207 N  N   . ALA A 1 162 ? 24.348  -6.203  20.999  1.00 7.26  ? 162 ALA A N   1 
ATOM   1208 C  CA  . ALA A 1 162 ? 24.520  -6.292  22.460  1.00 7.95  ? 162 ALA A CA  1 
ATOM   1209 C  C   . ALA A 1 162 ? 24.137  -7.671  22.929  1.00 8.94  ? 162 ALA A C   1 
ATOM   1210 O  O   . ALA A 1 162 ? 22.955  -7.942  23.101  1.00 9.64  ? 162 ALA A O   1 
ATOM   1211 C  CB  . ALA A 1 162 ? 23.667  -5.214  23.112  1.00 7.29  ? 162 ALA A CB  1 
ATOM   1212 N  N   . SER A 1 163 ? 25.106  -8.549  23.167  1.00 10.61 ? 163 SER A N   1 
ATOM   1213 C  CA  . SER A 1 163 ? 24.884  -9.928  23.575  1.00 11.99 ? 163 SER A CA  1 
ATOM   1214 C  C   . SER A 1 163 ? 24.092  -10.117 24.835  1.00 10.56 ? 163 SER A C   1 
ATOM   1215 O  O   . SER A 1 163 ? 23.539  -11.205 25.039  1.00 13.55 ? 163 SER A O   1 
ATOM   1216 C  CB  . SER A 1 163 ? 26.244  -10.655 23.883  1.00 10.86 ? 163 SER A CB  1 
ATOM   1217 O  OG  . SER A 1 163 ? 26.722  -10.985 22.586  1.00 17.00 ? 163 SER A OG  1 
ATOM   1218 N  N   . GLN A 1 164 ? 24.043  -9.145  25.730  1.00 10.90 ? 164 GLN A N   1 
ATOM   1219 C  CA  . GLN A 1 164 ? 23.329  -9.244  26.989  1.00 10.51 ? 164 GLN A CA  1 
ATOM   1220 C  C   . GLN A 1 164 ? 21.837  -8.980  26.747  1.00 8.84  ? 164 GLN A C   1 
ATOM   1221 O  O   . GLN A 1 164 ? 21.022  -9.073  27.650  1.00 10.32 ? 164 GLN A O   1 
ATOM   1222 C  CB  . GLN A 1 164 ? 23.867  -8.183  27.963  1.00 9.80  ? 164 GLN A CB  1 
ATOM   1223 C  CG  . GLN A 1 164 ? 23.367  -6.785  27.635  1.00 10.00 ? 164 GLN A CG  1 
ATOM   1224 C  CD  . GLN A 1 164 ? 24.291  -6.061  26.675  1.00 9.46  ? 164 GLN A CD  1 
ATOM   1225 O  OE1 . GLN A 1 164 ? 25.083  -6.658  25.938  1.00 10.23 ? 164 GLN A OE1 1 
ATOM   1226 N  NE2 . GLN A 1 164 ? 24.165  -4.742  26.659  1.00 11.08 ? 164 GLN A NE2 1 
ATOM   1227 N  N   . ILE A 1 165 ? 21.526  -8.629  25.492  1.00 7.35  ? 165 ILE A N   1 
ATOM   1228 C  CA  . ILE A 1 165 ? 20.135  -8.415  25.130  1.00 6.16  ? 165 ILE A CA  1 
ATOM   1229 C  C   . ILE A 1 165 ? 19.568  -9.616  24.391  1.00 6.97  ? 165 ILE A C   1 
ATOM   1230 O  O   . ILE A 1 165 ? 20.217  -10.157 23.484  1.00 8.34  ? 165 ILE A O   1 
ATOM   1231 C  CB  . ILE A 1 165 ? 20.060  -7.174  24.190  1.00 6.02  ? 165 ILE A CB  1 
ATOM   1232 C  CG1 . ILE A 1 165 ? 20.472  -5.928  24.952  1.00 5.26  ? 165 ILE A CG1 1 
ATOM   1233 C  CG2 . ILE A 1 165 ? 18.654  -7.066  23.588  1.00 4.92  ? 165 ILE A CG2 1 
ATOM   1234 C  CD1 . ILE A 1 165 ? 19.500  -5.456  26.024  1.00 6.28  ? 165 ILE A CD1 1 
ATOM   1235 N  N   . LYS A 1 166 ? 18.320  -9.945  24.736  1.00 6.99  ? 166 LYS A N   1 
ATOM   1236 C  CA  . LYS A 1 166 ? 17.689  -11.075 24.002  1.00 7.79  ? 166 LYS A CA  1 
ATOM   1237 C  C   . LYS A 1 166 ? 16.386  -10.553 23.386  1.00 6.41  ? 166 LYS A C   1 
ATOM   1238 O  O   . LYS A 1 166 ? 15.442  -10.265 24.103  1.00 6.94  ? 166 LYS A O   1 
ATOM   1239 C  CB  . LYS A 1 166 ? 17.410  -12.248 24.936  1.00 8.28  ? 166 LYS A CB  1 
ATOM   1240 C  CG  . LYS A 1 166 ? 16.897  -13.477 24.163  1.00 11.25 ? 166 LYS A CG  1 
ATOM   1241 C  CD  . LYS A 1 166 ? 16.494  -14.575 25.138  1.00 12.67 ? 166 LYS A CD  1 
ATOM   1242 C  CE  . LYS A 1 166 ? 16.344  -15.905 24.384  1.00 14.07 ? 166 LYS A CE  1 
ATOM   1243 N  NZ  . LYS A 1 166 ? 15.751  -16.899 25.352  1.00 16.09 ? 166 LYS A NZ  1 
ATOM   1244 N  N   . LEU A 1 167 ? 16.360  -10.411 22.067  1.00 7.74  ? 167 LEU A N   1 
ATOM   1245 C  CA  . LEU A 1 167 ? 15.120  -9.887  21.457  1.00 7.45  ? 167 LEU A CA  1 
ATOM   1246 C  C   . LEU A 1 167 ? 14.172  -11.085 21.408  1.00 7.14  ? 167 LEU A C   1 
ATOM   1247 O  O   . LEU A 1 167 ? 14.439  -12.011 20.632  1.00 6.77  ? 167 LEU A O   1 
ATOM   1248 C  CB  . LEU A 1 167 ? 15.446  -9.290  20.098  1.00 7.61  ? 167 LEU A CB  1 
ATOM   1249 C  CG  . LEU A 1 167 ? 14.208  -8.833  19.282  1.00 10.76 ? 167 LEU A CG  1 
ATOM   1250 C  CD1 . LEU A 1 167 ? 13.576  -7.633  19.985  1.00 9.40  ? 167 LEU A CD1 1 
ATOM   1251 C  CD2 . LEU A 1 167 ? 14.623  -8.500  17.862  1.00 9.18  ? 167 LEU A CD2 1 
ATOM   1252 N  N   . VAL A 1 168 ? 13.105  -11.070 22.175  1.00 6.30  ? 168 VAL A N   1 
ATOM   1253 C  CA  . VAL A 1 168 ? 12.206  -12.216 22.242  1.00 7.87  ? 168 VAL A CA  1 
ATOM   1254 C  C   . VAL A 1 168 ? 10.947  -12.073 21.428  1.00 9.30  ? 168 VAL A C   1 
ATOM   1255 O  O   . VAL A 1 168 ? 10.209  -13.051 21.292  1.00 7.45  ? 168 VAL A O   1 
ATOM   1256 C  CB  . VAL A 1 168 ? 11.832  -12.505 23.713  1.00 7.78  ? 168 VAL A CB  1 
ATOM   1257 C  CG1 . VAL A 1 168 ? 13.124  -12.826 24.471  1.00 10.20 ? 168 VAL A CG1 1 
ATOM   1258 C  CG2 . VAL A 1 168 ? 11.041  -11.391 24.350  1.00 10.51 ? 168 VAL A CG2 1 
ATOM   1259 N  N   . ALA A 1 169 ? 10.669  -10.845 20.980  1.00 7.84  ? 169 ALA A N   1 
ATOM   1260 C  CA  . ALA A 1 169 ? 9.445   -10.649 20.180  1.00 8.23  ? 169 ALA A CA  1 
ATOM   1261 C  C   . ALA A 1 169 ? 9.616   -9.393  19.334  1.00 8.59  ? 169 ALA A C   1 
ATOM   1262 O  O   . ALA A 1 169 ? 10.240  -8.413  19.765  1.00 7.31  ? 169 ALA A O   1 
ATOM   1263 C  CB  . ALA A 1 169 ? 8.215   -10.487 21.058  1.00 8.03  ? 169 ALA A CB  1 
ATOM   1264 N  N   . SER A 1 170 ? 9.107   -9.509  18.134  1.00 9.86  ? 170 SER A N   1 
ATOM   1265 C  CA  . SER A 1 170 ? 9.096   -8.398  17.187  1.00 10.04 ? 170 SER A CA  1 
ATOM   1266 C  C   . SER A 1 170 ? 7.758   -8.527  16.440  1.00 10.32 ? 170 SER A C   1 
ATOM   1267 O  O   . SER A 1 170 ? 7.612   -9.449  15.625  1.00 9.10  ? 170 SER A O   1 
ATOM   1268 C  CB  . SER A 1 170 ? 10.239  -8.433  16.196  1.00 9.01  ? 170 SER A CB  1 
ATOM   1269 O  OG  . SER A 1 170 ? 10.290  -7.119  15.630  1.00 9.16  ? 170 SER A OG  1 
ATOM   1270 N  N   . GLN A 1 171 ? 6.762   -7.762  16.892  1.00 9.48  ? 171 GLN A N   1 
ATOM   1271 C  CA  . GLN A 1 171 ? 5.430   -7.922  16.259  1.00 10.73 ? 171 GLN A CA  1 
ATOM   1272 C  C   . GLN A 1 171 ? 4.798   -6.598  15.841  1.00 11.02 ? 171 GLN A C   1 
ATOM   1273 O  O   . GLN A 1 171 ? 4.809   -5.640  16.607  1.00 8.24  ? 171 GLN A O   1 
ATOM   1274 C  CB  . GLN A 1 171 ? 4.470   -8.500  17.295  1.00 11.63 ? 171 GLN A CB  1 
ATOM   1275 C  CG  . GLN A 1 171 ? 4.799   -9.920  17.735  1.00 13.20 ? 171 GLN A CG  1 
ATOM   1276 C  CD  . GLN A 1 171 ? 4.495   -10.917 16.623  1.00 13.65 ? 171 GLN A CD  1 
ATOM   1277 O  OE1 . GLN A 1 171 ? 3.455   -10.838 15.974  1.00 15.88 ? 171 GLN A OE1 1 
ATOM   1278 N  NE2 . GLN A 1 171 ? 5.422   -11.832 16.442  1.00 13.75 ? 171 GLN A NE2 1 
ATOM   1279 N  N   . PRO A 1 172 ? 4.060   -6.612  14.738  1.00 10.82 ? 172 PRO A N   1 
ATOM   1280 C  CA  . PRO A 1 172 ? 3.315   -5.448  14.296  1.00 10.28 ? 172 PRO A CA  1 
ATOM   1281 C  C   . PRO A 1 172 ? 2.091   -5.177  15.156  1.00 7.96  ? 172 PRO A C   1 
ATOM   1282 O  O   . PRO A 1 172 ? 1.336   -6.047  15.621  1.00 6.00  ? 172 PRO A O   1 
ATOM   1283 C  CB  . PRO A 1 172 ? 2.903   -5.797  12.864  1.00 9.00  ? 172 PRO A CB  1 
ATOM   1284 C  CG  . PRO A 1 172 ? 2.744   -7.291  12.928  1.00 11.71 ? 172 PRO A CG  1 
ATOM   1285 C  CD  . PRO A 1 172 ? 3.933   -7.761  13.784  1.00 10.85 ? 172 PRO A CD  1 
ATOM   1286 N  N   . ALA A 1 173 ? 1.862   -3.861  15.370  1.00 4.46  ? 173 ALA A N   1 
ATOM   1287 C  CA  . ALA A 1 173 ? 0.679   -3.450  16.108  1.00 4.89  ? 173 ALA A CA  1 
ATOM   1288 C  C   . ALA A 1 173 ? -0.039  -2.367  15.292  1.00 5.85  ? 173 ALA A C   1 
ATOM   1289 O  O   . ALA A 1 173 ? -0.921  -1.676  15.783  1.00 4.51  ? 173 ALA A O   1 
ATOM   1290 C  CB  . ALA A 1 173 ? 0.965   -3.047  17.545  1.00 7.85  ? 173 ALA A CB  1 
ATOM   1291 N  N   . ASP A 1 174 ? 0.386   -2.264  14.018  1.00 5.42  ? 174 ASP A N   1 
ATOM   1292 C  CA  . ASP A 1 174 ? -0.302  -1.457  13.009  1.00 7.38  ? 174 ASP A CA  1 
ATOM   1293 C  C   . ASP A 1 174 ? -0.598  -0.034  13.362  1.00 7.46  ? 174 ASP A C   1 
ATOM   1294 O  O   . ASP A 1 174 ? -1.588  0.562   12.918  1.00 7.11  ? 174 ASP A O   1 
ATOM   1295 C  CB  . ASP A 1 174 ? -1.620  -2.208  12.698  1.00 7.11  ? 174 ASP A CB  1 
ATOM   1296 C  CG  . ASP A 1 174 ? -1.335  -3.682  12.369  1.00 8.79  ? 174 ASP A CG  1 
ATOM   1297 O  OD1 . ASP A 1 174 ? -0.293  -3.888  11.750  1.00 10.32 ? 174 ASP A OD1 1 
ATOM   1298 O  OD2 . ASP A 1 174 ? -2.111  -4.581  12.767  1.00 10.38 ? 174 ASP A OD2 1 
ATOM   1299 N  N   . TRP A 1 175 ? 0.285   0.632   14.122  1.00 7.27  ? 175 TRP A N   1 
ATOM   1300 C  CA  . TRP A 1 175 ? 0.076   2.008   14.535  1.00 6.68  ? 175 TRP A CA  1 
ATOM   1301 C  C   . TRP A 1 175 ? -1.201  2.202   15.329  1.00 7.41  ? 175 TRP A C   1 
ATOM   1302 O  O   . TRP A 1 175 ? -1.779  3.311   15.386  1.00 8.18  ? 175 TRP A O   1 
ATOM   1303 C  CB  . TRP A 1 175 ? -0.016  2.913   13.294  1.00 6.26  ? 175 TRP A CB  1 
ATOM   1304 C  CG  . TRP A 1 175 ? 1.012   2.756   12.219  1.00 4.29  ? 175 TRP A CG  1 
ATOM   1305 C  CD1 . TRP A 1 175 ? 0.770   2.450   10.910  1.00 5.44  ? 175 TRP A CD1 1 
ATOM   1306 C  CD2 . TRP A 1 175 ? 2.424   2.886   12.322  1.00 5.44  ? 175 TRP A CD2 1 
ATOM   1307 N  NE1 . TRP A 1 175 ? 1.926   2.363   10.187  1.00 5.41  ? 175 TRP A NE1 1 
ATOM   1308 C  CE2 . TRP A 1 175 ? 2.979   2.636   11.052  1.00 4.94  ? 175 TRP A CE2 1 
ATOM   1309 C  CE3 . TRP A 1 175 ? 3.286   3.142   13.404  1.00 4.88  ? 175 TRP A CE3 1 
ATOM   1310 C  CZ2 . TRP A 1 175 ? 4.336   2.719   10.798  1.00 6.04  ? 175 TRP A CZ2 1 
ATOM   1311 C  CZ3 . TRP A 1 175 ? 4.624   3.217   13.138  1.00 3.57  ? 175 TRP A CZ3 1 
ATOM   1312 C  CH2 . TRP A 1 175 ? 5.169   2.985   11.865  1.00 3.39  ? 175 TRP A CH2 1 
ATOM   1313 N  N   . ASP A 1 176 ? -1.738  1.172   15.956  1.00 6.52  ? 176 ASP A N   1 
ATOM   1314 C  CA  . ASP A 1 176 ? -3.008  1.218   16.642  1.00 6.56  ? 176 ASP A CA  1 
ATOM   1315 C  C   . ASP A 1 176 ? -2.836  1.026   18.140  1.00 6.93  ? 176 ASP A C   1 
ATOM   1316 O  O   . ASP A 1 176 ? -2.223  0.044   18.530  1.00 5.67  ? 176 ASP A O   1 
ATOM   1317 C  CB  . ASP A 1 176 ? -3.905  0.145   15.997  1.00 6.99  ? 176 ASP A CB  1 
ATOM   1318 C  CG  . ASP A 1 176 ? -5.299  0.214   16.600  1.00 9.40  ? 176 ASP A CG  1 
ATOM   1319 O  OD1 . ASP A 1 176 ? -5.528  -0.317  17.700  1.00 8.18  ? 176 ASP A OD1 1 
ATOM   1320 O  OD2 . ASP A 1 176 ? -6.132  0.882   15.952  1.00 8.00  ? 176 ASP A OD2 1 
ATOM   1321 N  N   . ARG A 1 177 ? -3.455  1.902   18.925  1.00 6.94  ? 177 ARG A N   1 
ATOM   1322 C  CA  . ARG A 1 177 ? -3.335  1.856   20.377  1.00 8.72  ? 177 ARG A CA  1 
ATOM   1323 C  C   . ARG A 1 177 ? -3.918  0.589   20.984  1.00 9.91  ? 177 ARG A C   1 
ATOM   1324 O  O   . ARG A 1 177 ? -3.322  -0.022  21.894  1.00 9.07  ? 177 ARG A O   1 
ATOM   1325 C  CB  . ARG A 1 177 ? -4.043  3.095   20.977  1.00 7.64  ? 177 ARG A CB  1 
ATOM   1326 C  CG  . ARG A 1 177 ? -3.576  3.398   22.418  1.00 9.65  ? 177 ARG A CG  1 
ATOM   1327 C  CD  . ARG A 1 177 ? -3.995  4.839   22.758  1.00 11.03 ? 177 ARG A CD  1 
ATOM   1328 N  NE  . ARG A 1 177 ? -3.749  5.152   24.192  1.00 10.57 ? 177 ARG A NE  1 
ATOM   1329 C  CZ  . ARG A 1 177 ? -3.663  6.432   24.584  1.00 12.45 ? 177 ARG A CZ  1 
ATOM   1330 N  NH1 . ARG A 1 177 ? -3.836  7.503   23.792  1.00 11.34 ? 177 ARG A NH1 1 
ATOM   1331 N  NH2 . ARG A 1 177 ? -3.420  6.696   25.864  1.00 9.51  ? 177 ARG A NH2 1 
ATOM   1332 N  N   . ILE A 1 178 ? -5.100  0.200   20.473  1.00 8.57  ? 178 ILE A N   1 
ATOM   1333 C  CA  . ILE A 1 178 ? -5.768  -0.990  21.038  1.00 8.09  ? 178 ILE A CA  1 
ATOM   1334 C  C   . ILE A 1 178 ? -4.945  -2.219  20.693  1.00 6.60  ? 178 ILE A C   1 
ATOM   1335 O  O   . ILE A 1 178 ? -4.710  -3.069  21.547  1.00 6.41  ? 178 ILE A O   1 
ATOM   1336 C  CB  . ILE A 1 178 ? -7.206  -1.133  20.480  1.00 8.67  ? 178 ILE A CB  1 
ATOM   1337 C  CG1 . ILE A 1 178 ? -7.996  0.097   20.948  1.00 10.41 ? 178 ILE A CG1 1 
ATOM   1338 C  CG2 . ILE A 1 178 ? -7.910  -2.421  20.944  1.00 7.71  ? 178 ILE A CG2 1 
ATOM   1339 C  CD1 . ILE A 1 178 ? -9.424  0.216   20.459  1.00 10.55 ? 178 ILE A CD1 1 
ATOM   1340 N  N   . LYS A 1 179 ? -4.577  -2.327  19.421  1.00 6.57  ? 179 LYS A N   1 
ATOM   1341 C  CA  . LYS A 1 179 ? -3.818  -3.482  18.966  1.00 5.66  ? 179 LYS A CA  1 
ATOM   1342 C  C   . LYS A 1 179 ? -2.474  -3.565  19.703  1.00 7.01  ? 179 LYS A C   1 
ATOM   1343 O  O   . LYS A 1 179 ? -2.076  -4.634  20.121  1.00 4.48  ? 179 LYS A O   1 
ATOM   1344 C  CB  . LYS A 1 179 ? -3.516  -3.342  17.467  1.00 7.92  ? 179 LYS A CB  1 
ATOM   1345 C  CG  . LYS A 1 179 ? -2.665  -4.477  16.912  1.00 8.29  ? 179 LYS A CG  1 
ATOM   1346 C  CD  . LYS A 1 179 ? -3.429  -5.799  16.973  1.00 10.29 ? 179 LYS A CD  1 
ATOM   1347 C  CE  . LYS A 1 179 ? -2.661  -6.833  16.123  1.00 9.57  ? 179 LYS A CE  1 
ATOM   1348 N  NZ  . LYS A 1 179 ? -3.332  -8.159  16.219  1.00 10.75 ? 179 LYS A NZ  1 
ATOM   1349 N  N   . ALA A 1 180 ? -1.827  -2.405  19.890  1.00 6.27  ? 180 ALA A N   1 
ATOM   1350 C  CA  . ALA A 1 180 ? -0.546  -2.450  20.628  1.00 6.45  ? 180 ALA A CA  1 
ATOM   1351 C  C   . ALA A 1 180 ? -0.730  -2.956  22.050  1.00 6.43  ? 180 ALA A C   1 
ATOM   1352 O  O   . ALA A 1 180 ? 0.148   -3.739  22.505  1.00 6.12  ? 180 ALA A O   1 
ATOM   1353 C  CB  . ALA A 1 180 ? 0.103   -1.073  20.635  1.00 5.21  ? 180 ALA A CB  1 
ATOM   1354 N  N   . LEU A 1 181 ? -1.821  -2.601  22.718  1.00 4.65  ? 181 LEU A N   1 
ATOM   1355 C  CA  . LEU A 1 181 ? -2.060  -3.025  24.094  1.00 6.05  ? 181 LEU A CA  1 
ATOM   1356 C  C   . LEU A 1 181 ? -2.189  -4.550  24.111  1.00 6.42  ? 181 LEU A C   1 
ATOM   1357 O  O   . LEU A 1 181 ? -1.609  -5.288  24.900  1.00 7.21  ? 181 LEU A O   1 
ATOM   1358 C  CB  . LEU A 1 181 ? -3.304  -2.318  24.653  1.00 7.40  ? 181 LEU A CB  1 
ATOM   1359 C  CG  . LEU A 1 181 ? -3.553  -2.412  26.164  1.00 9.00  ? 181 LEU A CG  1 
ATOM   1360 C  CD1 . LEU A 1 181 ? -4.507  -1.288  26.595  1.00 9.20  ? 181 LEU A CD1 1 
ATOM   1361 C  CD2 . LEU A 1 181 ? -4.185  -3.754  26.550  1.00 8.04  ? 181 LEU A CD2 1 
ATOM   1362 N  N   . ASP A 1 182 ? -2.960  -5.047  23.150  1.00 6.50  ? 182 ASP A N   1 
ATOM   1363 C  CA  . ASP A 1 182 ? -3.172  -6.489  22.984  1.00 6.51  ? 182 ASP A CA  1 
ATOM   1364 C  C   . ASP A 1 182 ? -1.873  -7.177  22.646  1.00 6.01  ? 182 ASP A C   1 
ATOM   1365 O  O   . ASP A 1 182 ? -1.577  -8.210  23.271  1.00 7.60  ? 182 ASP A O   1 
ATOM   1366 C  CB  . ASP A 1 182 ? -4.235  -6.732  21.889  1.00 5.74  ? 182 ASP A CB  1 
ATOM   1367 C  CG  . ASP A 1 182 ? -4.857  -8.117  22.031  1.00 8.29  ? 182 ASP A CG  1 
ATOM   1368 O  OD1 . ASP A 1 182 ? -5.375  -8.410  23.148  1.00 9.14  ? 182 ASP A OD1 1 
ATOM   1369 O  OD2 . ASP A 1 182 ? -4.820  -8.927  21.099  1.00 6.82  ? 182 ASP A OD2 1 
ATOM   1370 N  N   . VAL A 1 183 ? -1.109  -6.660  21.682  1.00 5.54  ? 183 VAL A N   1 
ATOM   1371 C  CA  . VAL A 1 183 ? 0.163   -7.315  21.321  1.00 7.89  ? 183 VAL A CA  1 
ATOM   1372 C  C   . VAL A 1 183 ? 1.112   -7.320  22.512  1.00 8.19  ? 183 VAL A C   1 
ATOM   1373 O  O   . VAL A 1 183 ? 1.695   -8.361  22.801  1.00 8.10  ? 183 VAL A O   1 
ATOM   1374 C  CB  . VAL A 1 183 ? 0.819   -6.638  20.105  1.00 6.50  ? 183 VAL A CB  1 
ATOM   1375 C  CG1 . VAL A 1 183 ? 2.203   -7.185  19.816  1.00 6.16  ? 183 VAL A CG1 1 
ATOM   1376 C  CG2 . VAL A 1 183 ? -0.082  -6.896  18.895  1.00 7.06  ? 183 VAL A CG2 1 
ATOM   1377 N  N   . ALA A 1 184 ? 1.237   -6.196  23.228  1.00 8.52  ? 184 ALA A N   1 
ATOM   1378 C  CA  . ALA A 1 184 ? 2.115   -6.175  24.399  1.00 7.52  ? 184 ALA A CA  1 
ATOM   1379 C  C   . ALA A 1 184 ? 1.635   -7.135  25.475  1.00 7.66  ? 184 ALA A C   1 
ATOM   1380 O  O   . ALA A 1 184 ? 2.478   -7.848  26.029  1.00 8.19  ? 184 ALA A O   1 
ATOM   1381 C  CB  . ALA A 1 184 ? 2.272   -4.772  24.964  1.00 8.69  ? 184 ALA A CB  1 
ATOM   1382 N  N   . THR A 1 185 ? 0.323   -7.232  25.711  1.00 6.41  ? 185 THR A N   1 
ATOM   1383 C  CA  . THR A 1 185 ? -0.189  -8.200  26.669  1.00 8.41  ? 185 THR A CA  1 
ATOM   1384 C  C   . THR A 1 185 ? 0.306   -9.597  26.342  1.00 8.83  ? 185 THR A C   1 
ATOM   1385 O  O   . THR A 1 185 ? 0.732   -10.315 27.242  1.00 8.87  ? 185 THR A O   1 
ATOM   1386 C  CB  . THR A 1 185 ? -1.722  -8.181  26.730  1.00 8.49  ? 185 THR A CB  1 
ATOM   1387 O  OG1 . THR A 1 185 ? -2.075  -6.819  27.113  1.00 8.50  ? 185 THR A OG1 1 
ATOM   1388 C  CG2 . THR A 1 185 ? -2.309  -9.144  27.751  1.00 7.53  ? 185 THR A CG2 1 
ATOM   1389 N  N   . ASN A 1 186 ? 0.172   -10.024 25.089  1.00 9.78  ? 186 ASN A N   1 
ATOM   1390 C  CA  . ASN A 1 186 ? 0.593   -11.360 24.667  1.00 10.38 ? 186 ASN A CA  1 
ATOM   1391 C  C   . ASN A 1 186 ? 2.106   -11.530 24.855  1.00 11.58 ? 186 ASN A C   1 
ATOM   1392 O  O   . ASN A 1 186 ? 2.600   -12.555 25.341  1.00 10.31 ? 186 ASN A O   1 
ATOM   1393 C  CB  . ASN A 1 186 ? 0.234   -11.608 23.201  1.00 11.80 ? 186 ASN A CB  1 
ATOM   1394 C  CG  . ASN A 1 186 ? -1.270  -11.679 22.997  1.00 13.80 ? 186 ASN A CG  1 
ATOM   1395 O  OD1 . ASN A 1 186 ? -2.018  -11.988 23.929  1.00 16.37 ? 186 ASN A OD1 1 
ATOM   1396 N  ND2 . ASN A 1 186 ? -1.715  -11.347 21.788  1.00 14.38 ? 186 ASN A ND2 1 
ATOM   1397 N  N   . VAL A 1 187 ? 2.873   -10.535 24.409  1.00 10.13 ? 187 VAL A N   1 
ATOM   1398 C  CA  . VAL A 1 187 ? 4.321   -10.583 24.560  1.00 12.25 ? 187 VAL A CA  1 
ATOM   1399 C  C   . VAL A 1 187 ? 4.705   -10.704 26.030  1.00 12.39 ? 187 VAL A C   1 
ATOM   1400 O  O   . VAL A 1 187 ? 5.564   -11.513 26.431  1.00 12.68 ? 187 VAL A O   1 
ATOM   1401 C  CB  . VAL A 1 187 ? 4.936   -9.317  23.915  1.00 12.11 ? 187 VAL A CB  1 
ATOM   1402 C  CG1 . VAL A 1 187 ? 6.402   -9.112  24.288  1.00 11.81 ? 187 VAL A CG1 1 
ATOM   1403 C  CG2 . VAL A 1 187 ? 4.769   -9.417  22.404  1.00 12.52 ? 187 VAL A CG2 1 
ATOM   1404 N  N   . LEU A 1 188 ? 4.064   -9.930  26.900  1.00 12.03 ? 188 LEU A N   1 
ATOM   1405 C  CA  . LEU A 1 188 ? 4.349   -9.929  28.323  1.00 12.36 ? 188 LEU A CA  1 
ATOM   1406 C  C   . LEU A 1 188 ? 3.962   -11.281 28.948  1.00 13.90 ? 188 LEU A C   1 
ATOM   1407 O  O   . LEU A 1 188 ? 4.635   -11.743 29.890  1.00 12.55 ? 188 LEU A O   1 
ATOM   1408 C  CB  . LEU A 1 188 ? 3.642   -8.806  29.051  1.00 12.52 ? 188 LEU A CB  1 
ATOM   1409 C  CG  . LEU A 1 188 ? 4.104   -7.364  28.796  1.00 14.22 ? 188 LEU A CG  1 
ATOM   1410 C  CD1 . LEU A 1 188 ? 3.022   -6.371  29.201  1.00 13.51 ? 188 LEU A CD1 1 
ATOM   1411 C  CD2 . LEU A 1 188 ? 5.387   -7.073  29.548  1.00 17.41 ? 188 LEU A CD2 1 
ATOM   1412 N  N   . GLN A 1 189 ? 2.898   -11.872 28.425  1.00 12.48 ? 189 GLN A N   1 
ATOM   1413 C  CA  . GLN A 1 189 ? 2.439   -13.180 28.838  1.00 15.44 ? 189 GLN A CA  1 
ATOM   1414 C  C   . GLN A 1 189 ? 3.447   -14.265 28.457  1.00 13.88 ? 189 GLN A C   1 
ATOM   1415 O  O   . GLN A 1 189 ? 3.764   -15.118 29.290  1.00 13.37 ? 189 GLN A O   1 
ATOM   1416 C  CB  . GLN A 1 189 ? 1.110   -13.533 28.126  1.00 16.89 ? 189 GLN A CB  1 
ATOM   1417 C  CG  . GLN A 1 189 ? -0.049  -13.712 29.093  1.00 22.45 ? 189 GLN A CG  1 
ATOM   1418 C  CD  . GLN A 1 189 ? -0.543  -12.388 29.634  1.00 24.94 ? 189 GLN A CD  1 
ATOM   1419 O  OE1 . GLN A 1 189 ? 0.292   -11.537 29.949  1.00 27.27 ? 189 GLN A OE1 1 
ATOM   1420 N  NE2 . GLN A 1 189 ? -1.849  -12.167 29.770  1.00 24.20 ? 189 GLN A NE2 1 
ATOM   1421 N  N   . ARG A 1 190 ? 3.928   -14.241 27.232  1.00 12.92 ? 190 ARG A N   1 
ATOM   1422 C  CA  . ARG A 1 190 ? 4.845   -15.265 26.737  1.00 14.93 ? 190 ARG A CA  1 
ATOM   1423 C  C   . ARG A 1 190 ? 6.261   -15.115 27.275  1.00 13.96 ? 190 ARG A C   1 
ATOM   1424 O  O   . ARG A 1 190 ? 7.023   -16.072 27.369  1.00 13.64 ? 190 ARG A O   1 
ATOM   1425 C  CB  . ARG A 1 190 ? 4.932   -15.231 25.207  1.00 18.60 ? 190 ARG A CB  1 
ATOM   1426 C  CG  . ARG A 1 190 ? 3.607   -15.136 24.484  1.00 23.28 ? 190 ARG A CG  1 
ATOM   1427 C  CD  . ARG A 1 190 ? 2.989   -16.417 23.981  1.00 27.37 ? 190 ARG A CD  1 
ATOM   1428 N  NE  . ARG A 1 190 ? 1.586   -16.192 23.648  1.00 30.95 ? 190 ARG A NE  1 
ATOM   1429 C  CZ  . ARG A 1 190 ? 0.577   -17.049 23.622  1.00 33.58 ? 190 ARG A CZ  1 
ATOM   1430 N  NH1 . ARG A 1 190 ? 0.718   -18.339 23.906  1.00 33.95 ? 190 ARG A NH1 1 
ATOM   1431 N  NH2 . ARG A 1 190 ? -0.638  -16.594 23.281  1.00 35.00 ? 190 ARG A NH2 1 
ATOM   1432 N  N   . ASN A 1 191 ? 6.644   -13.887 27.608  1.00 11.52 ? 191 ASN A N   1 
ATOM   1433 C  CA  . ASN A 1 191 ? 7.988   -13.601 28.121  1.00 12.78 ? 191 ASN A CA  1 
ATOM   1434 C  C   . ASN A 1 191 ? 7.826   -12.651 29.284  1.00 11.57 ? 191 ASN A C   1 
ATOM   1435 O  O   . ASN A 1 191 ? 8.083   -11.453 29.170  1.00 14.39 ? 191 ASN A O   1 
ATOM   1436 C  CB  . ASN A 1 191 ? 8.800   -12.999 26.970  1.00 13.90 ? 191 ASN A CB  1 
ATOM   1437 C  CG  . ASN A 1 191 ? 9.448   -14.013 26.051  1.00 14.78 ? 191 ASN A CG  1 
ATOM   1438 O  OD1 . ASN A 1 191 ? 8.977   -14.318 24.957  1.00 13.96 ? 191 ASN A OD1 1 
ATOM   1439 N  ND2 . ASN A 1 191 ? 10.602  -14.595 26.428  1.00 18.30 ? 191 ASN A ND2 1 
ATOM   1440 N  N   . PRO A 1 192 ? 7.411   -13.144 30.449  1.00 11.56 ? 192 PRO A N   1 
ATOM   1441 C  CA  . PRO A 1 192 ? 7.177   -12.313 31.608  1.00 12.07 ? 192 PRO A CA  1 
ATOM   1442 C  C   . PRO A 1 192 ? 8.408   -11.655 32.203  1.00 11.77 ? 192 PRO A C   1 
ATOM   1443 O  O   . PRO A 1 192 ? 8.154   -10.708 32.954  1.00 13.80 ? 192 PRO A O   1 
ATOM   1444 C  CB  . PRO A 1 192 ? 6.509   -13.234 32.638  1.00 12.78 ? 192 PRO A CB  1 
ATOM   1445 C  CG  . PRO A 1 192 ? 7.052   -14.577 32.265  1.00 12.41 ? 192 PRO A CG  1 
ATOM   1446 C  CD  . PRO A 1 192 ? 7.154   -14.564 30.766  1.00 11.87 ? 192 PRO A CD  1 
ATOM   1447 N  N   . ASN A 1 193 ? 9.622   -12.053 31.868  1.00 8.59  ? 193 ASN A N   1 
ATOM   1448 C  CA  . ASN A 1 193 ? 10.810  -11.404 32.372  1.00 10.22 ? 193 ASN A CA  1 
ATOM   1449 C  C   . ASN A 1 193 ? 11.286  -10.282 31.442  1.00 10.62 ? 193 ASN A C   1 
ATOM   1450 O  O   . ASN A 1 193 ? 12.373  -9.747  31.635  1.00 11.77 ? 193 ASN A O   1 
ATOM   1451 C  CB  . ASN A 1 193 ? 11.961  -12.407 32.578  1.00 11.40 ? 193 ASN A CB  1 
ATOM   1452 C  CG  . ASN A 1 193 ? 11.645  -13.345 33.723  1.00 13.28 ? 193 ASN A CG  1 
ATOM   1453 O  OD1 . ASN A 1 193 ? 11.037  -12.943 34.715  1.00 16.75 ? 193 ASN A OD1 1 
ATOM   1454 N  ND2 . ASN A 1 193 ? 11.987  -14.613 33.613  1.00 13.54 ? 193 ASN A ND2 1 
ATOM   1455 N  N   . ILE A 1 194 ? 10.540  -9.946  30.403  1.00 9.73  ? 194 ILE A N   1 
ATOM   1456 C  CA  . ILE A 1 194 ? 10.903  -8.858  29.498  1.00 8.12  ? 194 ILE A CA  1 
ATOM   1457 C  C   . ILE A 1 194 ? 11.186  -7.590  30.305  1.00 7.75  ? 194 ILE A C   1 
ATOM   1458 O  O   . ILE A 1 194 ? 10.458  -7.294  31.257  1.00 6.59  ? 194 ILE A O   1 
ATOM   1459 C  CB  . ILE A 1 194 ? 9.742   -8.635  28.502  1.00 10.69 ? 194 ILE A CB  1 
ATOM   1460 C  CG1 . ILE A 1 194 ? 9.915   -7.445  27.573  1.00 12.74 ? 194 ILE A CG1 1 
ATOM   1461 C  CG2 . ILE A 1 194 ? 8.465   -8.412  29.317  1.00 12.60 ? 194 ILE A CG2 1 
ATOM   1462 C  CD1 . ILE A 1 194 ? 9.572   -7.732  26.120  1.00 16.10 ? 194 ILE A CD1 1 
ATOM   1463 N  N   . LYS A 1 195 ? 12.269  -6.893  29.911  1.00 8.74  ? 195 LYS A N   1 
ATOM   1464 C  CA  . LYS A 1 195 ? 12.641  -5.661  30.586  1.00 8.79  ? 195 LYS A CA  1 
ATOM   1465 C  C   . LYS A 1 195 ? 12.470  -4.366  29.786  1.00 8.90  ? 195 LYS A C   1 
ATOM   1466 O  O   . LYS A 1 195 ? 12.616  -3.285  30.389  1.00 8.69  ? 195 LYS A O   1 
ATOM   1467 C  CB  . LYS A 1 195 ? 14.116  -5.753  31.024  1.00 11.74 ? 195 LYS A CB  1 
ATOM   1468 C  CG  . LYS A 1 195 ? 14.217  -6.332  32.438  1.00 15.30 ? 195 LYS A CG  1 
ATOM   1469 C  CD  . LYS A 1 195 ? 14.332  -7.806  32.483  1.00 20.30 ? 195 LYS A CD  1 
ATOM   1470 C  CE  . LYS A 1 195 ? 14.384  -8.386  33.910  1.00 21.55 ? 195 LYS A CE  1 
ATOM   1471 N  NZ  . LYS A 1 195 ? 13.145  -9.141  34.240  1.00 21.52 ? 195 LYS A NZ  1 
ATOM   1472 N  N   . ALA A 1 196 ? 12.113  -4.432  28.514  1.00 8.24  ? 196 ALA A N   1 
ATOM   1473 C  CA  . ALA A 1 196 ? 11.968  -3.195  27.742  1.00 7.94  ? 196 ALA A CA  1 
ATOM   1474 C  C   . ALA A 1 196 ? 11.294  -3.513  26.411  1.00 8.48  ? 196 ALA A C   1 
ATOM   1475 O  O   . ALA A 1 196 ? 11.425  -4.589  25.833  1.00 8.57  ? 196 ALA A O   1 
ATOM   1476 C  CB  . ALA A 1 196 ? 13.331  -2.582  27.458  1.00 9.37  ? 196 ALA A CB  1 
ATOM   1477 N  N   . ILE A 1 197 ? 10.574  -2.515  25.899  1.00 7.42  ? 197 ILE A N   1 
ATOM   1478 C  CA  . ILE A 1 197 ? 9.854   -2.690  24.632  1.00 6.03  ? 197 ILE A CA  1 
ATOM   1479 C  C   . ILE A 1 197 ? 10.012  -1.391  23.839  1.00 6.43  ? 197 ILE A C   1 
ATOM   1480 O  O   . ILE A 1 197 ? 9.671   -0.336  24.410  1.00 6.18  ? 197 ILE A O   1 
ATOM   1481 C  CB  . ILE A 1 197 ? 8.359   -2.910  24.896  1.00 6.23  ? 197 ILE A CB  1 
ATOM   1482 C  CG1 . ILE A 1 197 ? 8.139   -4.182  25.748  1.00 5.38  ? 197 ILE A CG1 1 
ATOM   1483 C  CG2 . ILE A 1 197 ? 7.573   -3.089  23.594  1.00 6.45  ? 197 ILE A CG2 1 
ATOM   1484 C  CD1 . ILE A 1 197 ? 6.711   -4.483  26.136  1.00 6.67  ? 197 ILE A CD1 1 
ATOM   1485 N  N   . TYR A 1 198 ? 10.569  -1.512  22.649  1.00 5.70  ? 198 TYR A N   1 
ATOM   1486 C  CA  . TYR A 1 198 ? 10.695  -0.341  21.776  1.00 5.56  ? 198 TYR A CA  1 
ATOM   1487 C  C   . TYR A 1 198 ? 9.419   -0.341  20.915  1.00 7.33  ? 198 TYR A C   1 
ATOM   1488 O  O   . TYR A 1 198 ? 9.073   -1.405  20.413  1.00 8.07  ? 198 TYR A O   1 
ATOM   1489 C  CB  . TYR A 1 198 ? 11.962  -0.419  20.914  1.00 7.21  ? 198 TYR A CB  1 
ATOM   1490 C  CG  . TYR A 1 198 ? 11.798  0.641   19.817  1.00 6.18  ? 198 TYR A CG  1 
ATOM   1491 C  CD1 . TYR A 1 198 ? 11.801  1.982   20.156  1.00 6.80  ? 198 TYR A CD1 1 
ATOM   1492 C  CD2 . TYR A 1 198 ? 11.565  0.265   18.511  1.00 6.12  ? 198 TYR A CD2 1 
ATOM   1493 C  CE1 . TYR A 1 198 ? 11.605  2.964   19.204  1.00 5.63  ? 198 TYR A CE1 1 
ATOM   1494 C  CE2 . TYR A 1 198 ? 11.359  1.242   17.543  1.00 5.24  ? 198 TYR A CE2 1 
ATOM   1495 C  CZ  . TYR A 1 198 ? 11.349  2.569   17.909  1.00 5.73  ? 198 TYR A CZ  1 
ATOM   1496 O  OH  . TYR A 1 198 ? 11.128  3.513   16.935  1.00 5.24  ? 198 TYR A OH  1 
ATOM   1497 N  N   . CYS A 1 199 ? 8.744   0.799   20.783  1.00 5.22  ? 199 CYS A N   1 
ATOM   1498 C  CA  . CYS A 1 199 ? 7.510   0.867   20.025  1.00 5.28  ? 199 CYS A CA  1 
ATOM   1499 C  C   . CYS A 1 199 ? 7.767   1.810   18.863  1.00 6.17  ? 199 CYS A C   1 
ATOM   1500 O  O   . CYS A 1 199 ? 8.246   2.922   19.100  1.00 4.73  ? 199 CYS A O   1 
ATOM   1501 C  CB  . CYS A 1 199 ? 6.356   1.405   20.884  1.00 5.82  ? 199 CYS A CB  1 
ATOM   1502 S  SG  . CYS A 1 199 ? 6.181   0.424   22.408  1.00 7.18  ? 199 CYS A SG  1 
ATOM   1503 N  N   . ALA A 1 200 ? 7.357   1.408   17.657  1.00 3.14  ? 200 ALA A N   1 
ATOM   1504 C  CA  . ALA A 1 200 ? 7.629   2.195   16.463  1.00 5.29  ? 200 ALA A CA  1 
ATOM   1505 C  C   . ALA A 1 200 ? 6.870   3.514   16.400  1.00 4.28  ? 200 ALA A C   1 
ATOM   1506 O  O   . ALA A 1 200 ? 7.254   4.384   15.596  1.00 6.84  ? 200 ALA A O   1 
ATOM   1507 C  CB  . ALA A 1 200 ? 7.391   1.351   15.196  1.00 4.85  ? 200 ALA A CB  1 
ATOM   1508 N  N   . ASN A 1 201 ? 5.910   3.759   17.273  1.00 4.44  ? 201 ASN A N   1 
ATOM   1509 C  CA  . ASN A 1 201 ? 5.313   5.076   17.414  1.00 5.37  ? 201 ASN A CA  1 
ATOM   1510 C  C   . ASN A 1 201 ? 4.612   5.212   18.763  1.00 5.86  ? 201 ASN A C   1 
ATOM   1511 O  O   . ASN A 1 201 ? 4.407   4.272   19.496  1.00 5.46  ? 201 ASN A O   1 
ATOM   1512 C  CB  . ASN A 1 201 ? 4.422   5.559   16.276  1.00 3.87  ? 201 ASN A CB  1 
ATOM   1513 C  CG  . ASN A 1 201 ? 2.994   5.118   16.325  1.00 6.19  ? 201 ASN A CG  1 
ATOM   1514 O  OD1 . ASN A 1 201 ? 2.576   4.238   17.067  1.00 5.02  ? 201 ASN A OD1 1 
ATOM   1515 N  ND2 . ASN A 1 201 ? 2.194   5.792   15.471  1.00 4.42  ? 201 ASN A ND2 1 
ATOM   1516 N  N   . ASP A 1 202 ? 4.263   6.465   19.055  1.00 5.00  ? 202 ASP A N   1 
ATOM   1517 C  CA  . ASP A 1 202 ? 3.678   6.844   20.336  1.00 4.60  ? 202 ASP A CA  1 
ATOM   1518 C  C   . ASP A 1 202 ? 2.270   6.317   20.511  1.00 4.66  ? 202 ASP A C   1 
ATOM   1519 O  O   . ASP A 1 202 ? 1.852   5.941   21.621  1.00 5.00  ? 202 ASP A O   1 
ATOM   1520 C  CB  . ASP A 1 202 ? 3.727   8.355   20.511  1.00 5.08  ? 202 ASP A CB  1 
ATOM   1521 C  CG  . ASP A 1 202 ? 5.127   8.858   20.829  1.00 5.73  ? 202 ASP A CG  1 
ATOM   1522 O  OD1 . ASP A 1 202 ? 6.031   8.071   21.201  1.00 5.15  ? 202 ASP A OD1 1 
ATOM   1523 O  OD2 . ASP A 1 202 ? 5.330   10.092  20.717  1.00 4.90  ? 202 ASP A OD2 1 
ATOM   1524 N  N   . THR A 1 203 ? 1.480   6.379   19.420  1.00 4.35  ? 203 THR A N   1 
ATOM   1525 C  CA  . THR A 1 203 ? 0.143   5.806   19.550  1.00 4.94  ? 203 THR A CA  1 
ATOM   1526 C  C   . THR A 1 203 ? 0.228   4.386   20.142  1.00 3.36  ? 203 THR A C   1 
ATOM   1527 O  O   . THR A 1 203 ? -0.545  4.075   21.038  1.00 4.76  ? 203 THR A O   1 
ATOM   1528 C  CB  . THR A 1 203 ? -0.514  5.705   18.169  1.00 6.64  ? 203 THR A CB  1 
ATOM   1529 O  OG1 . THR A 1 203 ? -0.446  7.023   17.590  1.00 5.23  ? 203 THR A OG1 1 
ATOM   1530 C  CG2 . THR A 1 203 ? -1.941  5.227   18.330  1.00 6.48  ? 203 THR A CG2 1 
ATOM   1531 N  N   . MET A 1 204 ? 1.112   3.589   19.569  1.00 5.25  ? 204 MET A N   1 
ATOM   1532 C  CA  . MET A 1 204 ? 1.303   2.216   20.063  1.00 5.80  ? 204 MET A CA  1 
ATOM   1533 C  C   . MET A 1 204 ? 1.980   2.196   21.433  1.00 6.01  ? 204 MET A C   1 
ATOM   1534 O  O   . MET A 1 204 ? 1.508   1.508   22.342  1.00 5.58  ? 204 MET A O   1 
ATOM   1535 C  CB  . MET A 1 204 ? 2.185   1.454   19.073  1.00 5.33  ? 204 MET A CB  1 
ATOM   1536 C  CG  . MET A 1 204 ? 1.390   1.148   17.798  1.00 5.49  ? 204 MET A CG  1 
ATOM   1537 S  SD  . MET A 1 204 ? 2.315   0.110   16.668  1.00 6.22  ? 204 MET A SD  1 
ATOM   1538 C  CE  . MET A 1 204 ? 3.872   1.000   16.493  1.00 6.59  ? 204 MET A CE  1 
ATOM   1539 N  N   . ALA A 1 205 ? 3.033   2.992   21.580  1.00 5.32  ? 205 ALA A N   1 
ATOM   1540 C  CA  . ALA A 1 205 ? 3.684   3.034   22.911  1.00 7.01  ? 205 ALA A CA  1 
ATOM   1541 C  C   . ALA A 1 205 ? 2.715   3.288   24.061  1.00 5.27  ? 205 ALA A C   1 
ATOM   1542 O  O   . ALA A 1 205 ? 2.861   2.741   25.174  1.00 6.08  ? 205 ALA A O   1 
ATOM   1543 C  CB  . ALA A 1 205 ? 4.776   4.107   22.864  1.00 6.71  ? 205 ALA A CB  1 
ATOM   1544 N  N   . MET A 1 206 ? 1.700   4.149   23.936  1.00 5.17  ? 206 MET A N   1 
ATOM   1545 C  CA  . MET A 1 206 ? 0.739   4.454   24.962  1.00 4.65  ? 206 MET A CA  1 
ATOM   1546 C  C   . MET A 1 206 ? -0.063  3.228   25.391  1.00 5.37  ? 206 MET A C   1 
ATOM   1547 O  O   . MET A 1 206 ? -0.325  2.958   26.576  1.00 6.71  ? 206 MET A O   1 
ATOM   1548 C  CB  . MET A 1 206 ? -0.169  5.639   24.559  1.00 6.93  ? 206 MET A CB  1 
ATOM   1549 C  CG  . MET A 1 206 ? 0.724   6.903   24.452  1.00 9.27  ? 206 MET A CG  1 
ATOM   1550 S  SD  . MET A 1 206 ? -0.254  8.387   24.207  1.00 9.92  ? 206 MET A SD  1 
ATOM   1551 C  CE  . MET A 1 206 ? -0.800  8.156   22.510  1.00 8.92  ? 206 MET A CE  1 
ATOM   1552 N  N   . GLY A 1 207 ? -0.462  2.416   24.416  1.00 5.63  ? 207 GLY A N   1 
ATOM   1553 C  CA  . GLY A 1 207 ? -1.210  1.196   24.673  1.00 4.22  ? 207 GLY A CA  1 
ATOM   1554 C  C   . GLY A 1 207 ? -0.265  0.166   25.319  1.00 5.83  ? 207 GLY A C   1 
ATOM   1555 O  O   . GLY A 1 207 ? -0.682  -0.528  26.246  1.00 6.46  ? 207 GLY A O   1 
ATOM   1556 N  N   . VAL A 1 208 ? 0.970   0.116   24.849  1.00 5.06  ? 208 VAL A N   1 
ATOM   1557 C  CA  . VAL A 1 208 ? 1.964   -0.787  25.466  1.00 5.43  ? 208 VAL A CA  1 
ATOM   1558 C  C   . VAL A 1 208 ? 2.132   -0.393  26.924  1.00 6.58  ? 208 VAL A C   1 
ATOM   1559 O  O   . VAL A 1 208 ? 2.129   -1.276  27.815  1.00 6.70  ? 208 VAL A O   1 
ATOM   1560 C  CB  . VAL A 1 208 ? 3.282   -0.734  24.688  1.00 6.58  ? 208 VAL A CB  1 
ATOM   1561 C  CG1 . VAL A 1 208 ? 4.386   -1.566  25.371  1.00 6.29  ? 208 VAL A CG1 1 
ATOM   1562 C  CG2 . VAL A 1 208 ? 3.089   -1.199  23.249  1.00 5.81  ? 208 VAL A CG2 1 
ATOM   1563 N  N   . ALA A 1 209 ? 2.206   0.923   27.182  1.00 6.00  ? 209 ALA A N   1 
ATOM   1564 C  CA  . ALA A 1 209 ? 2.297   1.313   28.618  1.00 7.90  ? 209 ALA A CA  1 
ATOM   1565 C  C   . ALA A 1 209 ? 1.134   0.805   29.438  1.00 8.22  ? 209 ALA A C   1 
ATOM   1566 O  O   . ALA A 1 209 ? 1.275   0.355   30.586  1.00 6.49  ? 209 ALA A O   1 
ATOM   1567 C  CB  . ALA A 1 209 ? 2.434   2.819   28.798  1.00 6.68  ? 209 ALA A CB  1 
ATOM   1568 N  N   . GLN A 1 210 ? -0.090  0.849   28.957  1.00 7.46  ? 210 GLN A N   1 
ATOM   1569 C  CA  . GLN A 1 210 ? -1.269  0.348   29.645  1.00 9.14  ? 210 GLN A CA  1 
ATOM   1570 C  C   . GLN A 1 210 ? -1.175  -1.161  29.852  1.00 9.27  ? 210 GLN A C   1 
ATOM   1571 O  O   . GLN A 1 210 ? -1.494  -1.671  30.925  1.00 10.22 ? 210 GLN A O   1 
ATOM   1572 C  CB  . GLN A 1 210 ? -2.546  0.699   28.892  1.00 11.85 ? 210 GLN A CB  1 
ATOM   1573 C  CG  . GLN A 1 210 ? -3.728  0.903   29.828  1.00 15.85 ? 210 GLN A CG  1 
ATOM   1574 C  CD  . GLN A 1 210 ? -4.908  1.501   29.082  1.00 18.65 ? 210 GLN A CD  1 
ATOM   1575 O  OE1 . GLN A 1 210 ? -6.014  0.959   29.211  1.00 20.27 ? 210 GLN A OE1 1 
ATOM   1576 N  NE2 . GLN A 1 210 ? -4.644  2.599   28.367  1.00 17.80 ? 210 GLN A NE2 1 
ATOM   1577 N  N   . ALA A 1 211 ? -0.655  -1.900  28.873  1.00 7.50  ? 211 ALA A N   1 
ATOM   1578 C  CA  . ALA A 1 211 ? -0.461  -3.341  29.052  1.00 7.81  ? 211 ALA A CA  1 
ATOM   1579 C  C   . ALA A 1 211 ? 0.511   -3.618  30.207  1.00 7.98  ? 211 ALA A C   1 
ATOM   1580 O  O   . ALA A 1 211 ? 0.351   -4.526  31.027  1.00 8.39  ? 211 ALA A O   1 
ATOM   1581 C  CB  . ALA A 1 211 ? 0.060   -3.949  27.756  1.00 7.37  ? 211 ALA A CB  1 
ATOM   1582 N  N   . VAL A 1 212 ? 1.613   -2.874  30.203  1.00 8.34  ? 212 VAL A N   1 
ATOM   1583 C  CA  . VAL A 1 212 ? 2.629   -2.980  31.248  1.00 9.53  ? 212 VAL A CA  1 
ATOM   1584 C  C   . VAL A 1 212 ? 2.010   -2.672  32.613  1.00 10.28 ? 212 VAL A C   1 
ATOM   1585 O  O   . VAL A 1 212 ? 2.313   -3.358  33.604  1.00 10.28 ? 212 VAL A O   1 
ATOM   1586 C  CB  . VAL A 1 212 ? 3.808   -2.065  30.902  1.00 9.16  ? 212 VAL A CB  1 
ATOM   1587 C  CG1 . VAL A 1 212 ? 4.709   -1.817  32.104  1.00 8.79  ? 212 VAL A CG1 1 
ATOM   1588 C  CG2 . VAL A 1 212 ? 4.608   -2.646  29.738  1.00 7.58  ? 212 VAL A CG2 1 
ATOM   1589 N  N   . ALA A 1 213 ? 1.218   -1.623  32.692  1.00 10.63 ? 213 ALA A N   1 
ATOM   1590 C  CA  . ALA A 1 213 ? 0.506   -1.253  33.914  1.00 14.11 ? 213 ALA A CA  1 
ATOM   1591 C  C   . ALA A 1 213 ? -0.437  -2.368  34.383  1.00 15.69 ? 213 ALA A C   1 
ATOM   1592 O  O   . ALA A 1 213 ? -0.459  -2.749  35.545  1.00 16.82 ? 213 ALA A O   1 
ATOM   1593 C  CB  . ALA A 1 213 ? -0.328  -0.008  33.635  1.00 13.20 ? 213 ALA A CB  1 
ATOM   1594 N  N   . ASN A 1 214 ? -1.219  -2.935  33.459  1.00 16.36 ? 214 ASN A N   1 
ATOM   1595 C  CA  . ASN A 1 214 ? -2.109  -4.061  33.780  1.00 16.56 ? 214 ASN A CA  1 
ATOM   1596 C  C   . ASN A 1 214 ? -1.316  -5.216  34.361  1.00 16.59 ? 214 ASN A C   1 
ATOM   1597 O  O   . ASN A 1 214 ? -1.754  -5.845  35.327  1.00 19.05 ? 214 ASN A O   1 
ATOM   1598 C  CB  . ASN A 1 214 ? -2.857  -4.564  32.538  1.00 16.86 ? 214 ASN A CB  1 
ATOM   1599 C  CG  . ASN A 1 214 ? -3.804  -3.540  31.957  1.00 17.80 ? 214 ASN A CG  1 
ATOM   1600 O  OD1 . ASN A 1 214 ? -4.228  -2.580  32.604  1.00 18.46 ? 214 ASN A OD1 1 
ATOM   1601 N  ND2 . ASN A 1 214 ? -4.181  -3.697  30.689  1.00 16.58 ? 214 ASN A ND2 1 
ATOM   1602 N  N   . ALA A 1 215 ? -0.125  -5.499  33.868  1.00 15.89 ? 215 ALA A N   1 
ATOM   1603 C  CA  . ALA A 1 215 ? 0.750   -6.548  34.358  1.00 16.92 ? 215 ALA A CA  1 
ATOM   1604 C  C   . ALA A 1 215 ? 1.449   -6.242  35.675  1.00 16.99 ? 215 ALA A C   1 
ATOM   1605 O  O   . ALA A 1 215 ? 2.256   -7.018  36.223  1.00 18.39 ? 215 ALA A O   1 
ATOM   1606 C  CB  . ALA A 1 215 ? 1.741   -6.815  33.217  1.00 14.50 ? 215 ALA A CB  1 
ATOM   1607 N  N   . GLY A 1 216 ? 1.257   -5.064  36.239  1.00 17.56 ? 216 GLY A N   1 
ATOM   1608 C  CA  . GLY A 1 216 ? 1.858   -4.579  37.470  1.00 15.98 ? 216 GLY A CA  1 
ATOM   1609 C  C   . GLY A 1 216 ? 3.347   -4.338  37.317  1.00 17.43 ? 216 GLY A C   1 
ATOM   1610 O  O   . GLY A 1 216 ? 4.137   -4.483  38.251  1.00 17.00 ? 216 GLY A O   1 
ATOM   1611 N  N   . LYS A 1 217 ? 3.776   -3.938  36.109  1.00 14.38 ? 217 LYS A N   1 
ATOM   1612 C  CA  . LYS A 1 217 ? 5.160   -3.784  35.773  1.00 14.17 ? 217 LYS A CA  1 
ATOM   1613 C  C   . LYS A 1 217 ? 5.629   -2.408  35.335  1.00 13.82 ? 217 LYS A C   1 
ATOM   1614 O  O   . LYS A 1 217 ? 6.702   -2.295  34.703  1.00 14.23 ? 217 LYS A O   1 
ATOM   1615 C  CB  . LYS A 1 217 ? 5.489   -4.885  34.749  1.00 14.21 ? 217 LYS A CB  1 
ATOM   1616 C  CG  . LYS A 1 217 ? 5.781   -6.202  35.482  1.00 14.88 ? 217 LYS A CG  1 
ATOM   1617 C  CD  . LYS A 1 217 ? 5.832   -7.396  34.551  1.00 14.83 ? 217 LYS A CD  1 
ATOM   1618 C  CE  . LYS A 1 217 ? 5.945   -8.692  35.373  1.00 14.15 ? 217 LYS A CE  1 
ATOM   1619 N  NZ  . LYS A 1 217 ? 6.093   -9.856  34.436  1.00 14.59 ? 217 LYS A NZ  1 
ATOM   1620 N  N   . THR A 1 218 ? 4.872   -1.379  35.637  1.00 12.28 ? 218 THR A N   1 
ATOM   1621 C  CA  . THR A 1 218 ? 5.285   -0.006  35.301  1.00 14.66 ? 218 THR A CA  1 
ATOM   1622 C  C   . THR A 1 218 ? 6.625   0.338   35.965  1.00 15.44 ? 218 THR A C   1 
ATOM   1623 O  O   . THR A 1 218 ? 6.835   0.123   37.170  1.00 14.29 ? 218 THR A O   1 
ATOM   1624 C  CB  . THR A 1 218 ? 4.250   1.035   35.708  1.00 15.29 ? 218 THR A CB  1 
ATOM   1625 O  OG1 . THR A 1 218 ? 3.004   0.742   35.062  1.00 18.65 ? 218 THR A OG1 1 
ATOM   1626 C  CG2 . THR A 1 218 ? 4.667   2.448   35.300  1.00 15.59 ? 218 THR A CG2 1 
ATOM   1627 N  N   . GLY A 1 219 ? 7.579   0.765   35.163  1.00 13.89 ? 219 GLY A N   1 
ATOM   1628 C  CA  . GLY A 1 219 ? 8.921   1.046   35.655  1.00 16.98 ? 219 GLY A CA  1 
ATOM   1629 C  C   . GLY A 1 219 ? 9.863   -0.143  35.585  1.00 16.92 ? 219 GLY A C   1 
ATOM   1630 O  O   . GLY A 1 219 ? 11.061  0.027   35.318  1.00 17.09 ? 219 GLY A O   1 
ATOM   1631 N  N   . LYS A 1 220 ? 9.367   -1.361  35.769  1.00 16.40 ? 220 LYS A N   1 
ATOM   1632 C  CA  . LYS A 1 220 ? 10.114  -2.589  35.627  1.00 16.35 ? 220 LYS A CA  1 
ATOM   1633 C  C   . LYS A 1 220 ? 10.256  -2.954  34.145  1.00 13.31 ? 220 LYS A C   1 
ATOM   1634 O  O   . LYS A 1 220 ? 11.192  -3.635  33.762  1.00 11.84 ? 220 LYS A O   1 
ATOM   1635 C  CB  . LYS A 1 220 ? 9.457   -3.790  36.310  1.00 19.17 ? 220 LYS A CB  1 
ATOM   1636 C  CG  . LYS A 1 220 ? 8.840   -3.599  37.668  1.00 23.08 ? 220 LYS A CG  1 
ATOM   1637 C  CD  . LYS A 1 220 ? 9.712   -2.767  38.604  1.00 24.86 ? 220 LYS A CD  1 
ATOM   1638 C  CE  . LYS A 1 220 ? 9.319   -3.060  40.055  1.00 26.27 ? 220 LYS A CE  1 
ATOM   1639 N  NZ  . LYS A 1 220 ? 8.197   -2.214  40.528  1.00 27.08 ? 220 LYS A NZ  1 
ATOM   1640 N  N   . VAL A 1 221 ? 9.290   -2.550  33.312  1.00 11.20 ? 221 VAL A N   1 
ATOM   1641 C  CA  . VAL A 1 221 ? 9.425   -2.794  31.878  1.00 9.98  ? 221 VAL A CA  1 
ATOM   1642 C  C   . VAL A 1 221 ? 9.580   -1.421  31.204  1.00 9.68  ? 221 VAL A C   1 
ATOM   1643 O  O   . VAL A 1 221 ? 8.643   -0.635  31.321  1.00 9.45  ? 221 VAL A O   1 
ATOM   1644 C  CB  . VAL A 1 221 ? 8.207   -3.560  31.322  1.00 9.80  ? 221 VAL A CB  1 
ATOM   1645 C  CG1 . VAL A 1 221 ? 8.246   -3.646  29.792  1.00 8.47  ? 221 VAL A CG1 1 
ATOM   1646 C  CG2 . VAL A 1 221 ? 8.162   -4.983  31.882  1.00 8.37  ? 221 VAL A CG2 1 
ATOM   1647 N  N   . LEU A 1 222 ? 10.718  -1.137  30.572  1.00 6.69  ? 222 LEU A N   1 
ATOM   1648 C  CA  . LEU A 1 222 ? 10.854  0.174   29.923  1.00 6.89  ? 222 LEU A CA  1 
ATOM   1649 C  C   . LEU A 1 222 ? 9.962   0.183   28.663  1.00 6.86  ? 222 LEU A C   1 
ATOM   1650 O  O   . LEU A 1 222 ? 9.831   -0.856  28.057  1.00 5.98  ? 222 LEU A O   1 
ATOM   1651 C  CB  . LEU A 1 222 ? 12.274  0.392   29.455  1.00 7.35  ? 222 LEU A CB  1 
ATOM   1652 C  CG  . LEU A 1 222 ? 13.372  0.107   30.529  1.00 9.27  ? 222 LEU A CG  1 
ATOM   1653 C  CD1 . LEU A 1 222 ? 14.725  0.408   29.920  1.00 10.80 ? 222 LEU A CD1 1 
ATOM   1654 C  CD2 . LEU A 1 222 ? 13.065  0.922   31.763  1.00 10.43 ? 222 LEU A CD2 1 
ATOM   1655 N  N   . VAL A 1 223 ? 9.417   1.355   28.371  1.00 6.97  ? 223 VAL A N   1 
ATOM   1656 C  CA  . VAL A 1 223 ? 8.591   1.531   27.182  1.00 6.30  ? 223 VAL A CA  1 
ATOM   1657 C  C   . VAL A 1 223 ? 9.137   2.758   26.463  1.00 5.22  ? 223 VAL A C   1 
ATOM   1658 O  O   . VAL A 1 223 ? 9.147   3.840   27.035  1.00 5.95  ? 223 VAL A O   1 
ATOM   1659 C  CB  . VAL A 1 223 ? 7.117   1.673   27.552  1.00 6.20  ? 223 VAL A CB  1 
ATOM   1660 C  CG1 . VAL A 1 223 ? 6.270   1.998   26.300  1.00 5.13  ? 223 VAL A CG1 1 
ATOM   1661 C  CG2 . VAL A 1 223 ? 6.563   0.426   28.245  1.00 6.16  ? 223 VAL A CG2 1 
ATOM   1662 N  N   . VAL A 1 224 ? 9.558   2.581   25.209  1.00 6.55  ? 224 VAL A N   1 
ATOM   1663 C  CA  . VAL A 1 224 ? 10.080  3.727   24.455  1.00 5.48  ? 224 VAL A CA  1 
ATOM   1664 C  C   . VAL A 1 224 ? 9.190   3.885   23.209  1.00 7.54  ? 224 VAL A C   1 
ATOM   1665 O  O   . VAL A 1 224 ? 8.936   2.906   22.524  1.00 6.64  ? 224 VAL A O   1 
ATOM   1666 C  CB  . VAL A 1 224 ? 11.534  3.528   24.051  1.00 6.51  ? 224 VAL A CB  1 
ATOM   1667 C  CG1 . VAL A 1 224 ? 12.056  4.655   23.162  1.00 5.08  ? 224 VAL A CG1 1 
ATOM   1668 C  CG2 . VAL A 1 224 ? 12.424  3.360   25.304  1.00 6.59  ? 224 VAL A CG2 1 
ATOM   1669 N  N   . GLY A 1 225 ? 8.735   5.119   22.985  1.00 6.28  ? 225 GLY A N   1 
ATOM   1670 C  CA  . GLY A 1 225 ? 7.897   5.371   21.808  1.00 5.99  ? 225 GLY A CA  1 
ATOM   1671 C  C   . GLY A 1 225 ? 8.700   6.041   20.701  1.00 5.58  ? 225 GLY A C   1 
ATOM   1672 O  O   . GLY A 1 225 ? 9.936   6.073   20.648  1.00 4.13  ? 225 GLY A O   1 
ATOM   1673 N  N   . THR A 1 226 ? 7.937   6.625   19.752  1.00 3.96  ? 226 THR A N   1 
ATOM   1674 C  CA  . THR A 1 226 ? 8.573   7.427   18.685  1.00 4.53  ? 226 THR A CA  1 
ATOM   1675 C  C   . THR A 1 226 ? 7.520   8.418   18.187  1.00 6.07  ? 226 THR A C   1 
ATOM   1676 O  O   . THR A 1 226 ? 6.357   8.004   18.055  1.00 4.15  ? 226 THR A O   1 
ATOM   1677 C  CB  . THR A 1 226 ? 9.072   6.532   17.555  1.00 5.08  ? 226 THR A CB  1 
ATOM   1678 O  OG1 . THR A 1 226 ? 10.323  5.940   17.914  1.00 4.61  ? 226 THR A OG1 1 
ATOM   1679 C  CG2 . THR A 1 226 ? 9.328   7.315   16.251  1.00 4.03  ? 226 THR A CG2 1 
ATOM   1680 N  N   . ASP A 1 227 ? 7.837   9.645   17.900  1.00 5.01  ? 227 ASP A N   1 
ATOM   1681 C  CA  . ASP A 1 227 ? 7.090   10.756  17.357  1.00 5.80  ? 227 ASP A CA  1 
ATOM   1682 C  C   . ASP A 1 227 ? 7.239   12.001  18.255  1.00 5.25  ? 227 ASP A C   1 
ATOM   1683 O  O   . ASP A 1 227 ? 7.458   13.110  17.762  1.00 5.68  ? 227 ASP A O   1 
ATOM   1684 C  CB  . ASP A 1 227 ? 5.580   10.626  17.091  1.00 5.77  ? 227 ASP A CB  1 
ATOM   1685 C  CG  . ASP A 1 227 ? 5.237   9.586   16.003  1.00 5.74  ? 227 ASP A CG  1 
ATOM   1686 O  OD1 . ASP A 1 227 ? 6.247   9.196   15.365  1.00 6.93  ? 227 ASP A OD1 1 
ATOM   1687 O  OD2 . ASP A 1 227 ? 4.051   9.239   15.896  1.00 5.59  ? 227 ASP A OD2 1 
ATOM   1688 N  N   . GLY A 1 228 ? 6.961   11.854  19.526  1.00 7.13  ? 228 GLY A N   1 
ATOM   1689 C  CA  . GLY A 1 228 ? 7.015   12.958  20.498  1.00 7.73  ? 228 GLY A CA  1 
ATOM   1690 C  C   . GLY A 1 228 ? 5.687   13.704  20.572  1.00 8.40  ? 228 GLY A C   1 
ATOM   1691 O  O   . GLY A 1 228 ? 5.633   14.943  20.766  1.00 8.49  ? 228 GLY A O   1 
ATOM   1692 N  N   . ILE A 1 229 ? 4.582   12.963  20.433  1.00 7.32  ? 229 ILE A N   1 
ATOM   1693 C  CA  . ILE A 1 229 ? 3.262   13.549  20.467  1.00 6.48  ? 229 ILE A CA  1 
ATOM   1694 C  C   . ILE A 1 229 ? 3.025   13.969  21.911  1.00 7.11  ? 229 ILE A C   1 
ATOM   1695 O  O   . ILE A 1 229 ? 3.649   13.418  22.849  1.00 7.32  ? 229 ILE A O   1 
ATOM   1696 C  CB  . ILE A 1 229 ? 2.120   12.668  19.917  1.00 7.01  ? 229 ILE A CB  1 
ATOM   1697 C  CG1 . ILE A 1 229 ? 1.835   11.474  20.846  1.00 8.28  ? 229 ILE A CG1 1 
ATOM   1698 C  CG2 . ILE A 1 229 ? 2.534   12.173  18.534  1.00 5.01  ? 229 ILE A CG2 1 
ATOM   1699 C  CD1 . ILE A 1 229 ? 0.700   10.574  20.391  1.00 8.15  ? 229 ILE A CD1 1 
ATOM   1700 N  N   . PRO A 1 230 ? 2.196   14.985  22.112  1.00 6.48  ? 230 PRO A N   1 
ATOM   1701 C  CA  . PRO A 1 230 ? 1.971   15.588  23.406  1.00 7.20  ? 230 PRO A CA  1 
ATOM   1702 C  C   . PRO A 1 230 ? 1.665   14.646  24.544  1.00 7.95  ? 230 PRO A C   1 
ATOM   1703 O  O   . PRO A 1 230 ? 2.326   14.718  25.587  1.00 7.03  ? 230 PRO A O   1 
ATOM   1704 C  CB  . PRO A 1 230 ? 0.815   16.571  23.152  1.00 7.78  ? 230 PRO A CB  1 
ATOM   1705 C  CG  . PRO A 1 230 ? 1.190   17.076  21.780  1.00 6.48  ? 230 PRO A CG  1 
ATOM   1706 C  CD  . PRO A 1 230 ? 1.512   15.775  21.043  1.00 7.29  ? 230 PRO A CD  1 
ATOM   1707 N  N   . GLU A 1 231 ? 0.679   13.769  24.398  1.00 9.40  ? 231 GLU A N   1 
ATOM   1708 C  CA  . GLU A 1 231 ? 0.336   12.804  25.438  1.00 9.54  ? 231 GLU A CA  1 
ATOM   1709 C  C   . GLU A 1 231 ? 1.556   11.930  25.759  1.00 8.53  ? 231 GLU A C   1 
ATOM   1710 O  O   . GLU A 1 231 ? 1.747   11.562  26.926  1.00 9.62  ? 231 GLU A O   1 
ATOM   1711 C  CB  . GLU A 1 231 ? -0.829  11.901  25.014  1.00 10.72 ? 231 GLU A CB  1 
ATOM   1712 C  CG  . GLU A 1 231 ? -1.530  11.147  26.131  1.00 11.84 ? 231 GLU A CG  1 
ATOM   1713 C  CD  . GLU A 1 231 ? -2.632  10.199  25.707  1.00 13.37 ? 231 GLU A CD  1 
ATOM   1714 O  OE1 . GLU A 1 231 ? -3.027  10.245  24.517  1.00 12.03 ? 231 GLU A OE1 1 
ATOM   1715 O  OE2 . GLU A 1 231 ? -3.095  9.406   26.556  1.00 10.91 ? 231 GLU A OE2 1 
ATOM   1716 N  N   . ALA A 1 232 ? 2.328   11.523  24.756  1.00 7.79  ? 232 ALA A N   1 
ATOM   1717 C  CA  . ALA A 1 232 ? 3.489   10.659  25.022  1.00 7.99  ? 232 ALA A CA  1 
ATOM   1718 C  C   . ALA A 1 232 ? 4.559   11.457  25.756  1.00 8.68  ? 232 ALA A C   1 
ATOM   1719 O  O   . ALA A 1 232 ? 5.178   10.935  26.695  1.00 7.23  ? 232 ALA A O   1 
ATOM   1720 C  CB  . ALA A 1 232 ? 4.078   10.039  23.764  1.00 5.40  ? 232 ALA A CB  1 
ATOM   1721 N  N   . ARG A 1 233 ? 4.747   12.727  25.365  1.00 7.25  ? 233 ARG A N   1 
ATOM   1722 C  CA  . ARG A 1 233 ? 5.740   13.513  26.149  1.00 9.80  ? 233 ARG A CA  1 
ATOM   1723 C  C   . ARG A 1 233 ? 5.350   13.622  27.602  1.00 8.05  ? 233 ARG A C   1 
ATOM   1724 O  O   . ARG A 1 233 ? 6.194   13.569  28.522  1.00 8.85  ? 233 ARG A O   1 
ATOM   1725 C  CB  . ARG A 1 233 ? 5.881   14.895  25.500  1.00 9.13  ? 233 ARG A CB  1 
ATOM   1726 C  CG  . ARG A 1 233 ? 6.837   14.849  24.303  1.00 8.68  ? 233 ARG A CG  1 
ATOM   1727 C  CD  . ARG A 1 233 ? 6.656   16.167  23.538  1.00 10.13 ? 233 ARG A CD  1 
ATOM   1728 N  NE  . ARG A 1 233 ? 7.478   16.261  22.344  1.00 10.14 ? 233 ARG A NE  1 
ATOM   1729 C  CZ  . ARG A 1 233 ? 8.739   16.699  22.369  1.00 11.32 ? 233 ARG A CZ  1 
ATOM   1730 N  NH1 . ARG A 1 233 ? 9.375   17.012  23.516  1.00 10.59 ? 233 ARG A NH1 1 
ATOM   1731 N  NH2 . ARG A 1 233 ? 9.394   16.785  21.224  1.00 8.85  ? 233 ARG A NH2 1 
ATOM   1732 N  N   . LYS A 1 234 ? 4.056   13.777  27.869  1.00 9.74  ? 234 LYS A N   1 
ATOM   1733 C  CA  . LYS A 1 234 ? 3.528   13.818  29.216  1.00 10.62 ? 234 LYS A CA  1 
ATOM   1734 C  C   . LYS A 1 234 ? 3.780   12.496  29.932  1.00 10.72 ? 234 LYS A C   1 
ATOM   1735 O  O   . LYS A 1 234 ? 4.196   12.530  31.091  1.00 9.78  ? 234 LYS A O   1 
ATOM   1736 C  CB  . LYS A 1 234 ? 2.033   14.128  29.266  1.00 13.05 ? 234 LYS A CB  1 
ATOM   1737 C  CG  . LYS A 1 234 ? 1.740   15.559  28.813  1.00 16.31 ? 234 LYS A CG  1 
ATOM   1738 C  CD  . LYS A 1 234 ? 0.278   15.853  29.176  1.00 19.46 ? 234 LYS A CD  1 
ATOM   1739 C  CE  . LYS A 1 234 ? -0.186  17.119  28.473  1.00 21.37 ? 234 LYS A CE  1 
ATOM   1740 N  NZ  . LYS A 1 234 ? -1.644  17.014  28.151  1.00 23.11 ? 234 LYS A NZ  1 
ATOM   1741 N  N   . MET A 1 235 ? 3.498   11.364  29.283  1.00 9.24  ? 235 MET A N   1 
ATOM   1742 C  CA  . MET A 1 235 ? 3.748   10.080  29.906  1.00 10.25 ? 235 MET A CA  1 
ATOM   1743 C  C   . MET A 1 235 ? 5.231   9.915   30.241  1.00 8.99  ? 235 MET A C   1 
ATOM   1744 O  O   . MET A 1 235 ? 5.577   9.397   31.312  1.00 9.34  ? 235 MET A O   1 
ATOM   1745 C  CB  . MET A 1 235 ? 3.311   8.952   28.956  1.00 11.24 ? 235 MET A CB  1 
ATOM   1746 C  CG  . MET A 1 235 ? 1.779   8.898   28.793  1.00 11.10 ? 235 MET A CG  1 
ATOM   1747 S  SD  . MET A 1 235 ? 1.385   7.252   28.098  1.00 15.33 ? 235 MET A SD  1 
ATOM   1748 C  CE  . MET A 1 235 ? -0.398  7.307   28.080  1.00 16.43 ? 235 MET A CE  1 
ATOM   1749 N  N   . VAL A 1 236 ? 6.106   10.387  29.364  1.00 7.81  ? 236 VAL A N   1 
ATOM   1750 C  CA  . VAL A 1 236 ? 7.541   10.290  29.604  1.00 7.48  ? 236 VAL A CA  1 
ATOM   1751 C  C   . VAL A 1 236 ? 7.890   11.150  30.822  1.00 9.57  ? 236 VAL A C   1 
ATOM   1752 O  O   . VAL A 1 236 ? 8.732   10.756  31.651  1.00 9.32  ? 236 VAL A O   1 
ATOM   1753 C  CB  . VAL A 1 236 ? 8.345   10.769  28.392  1.00 8.55  ? 236 VAL A CB  1 
ATOM   1754 C  CG1 . VAL A 1 236 ? 9.809   11.050  28.701  1.00 9.30  ? 236 VAL A CG1 1 
ATOM   1755 C  CG2 . VAL A 1 236 ? 8.212   9.695   27.285  1.00 6.78  ? 236 VAL A CG2 1 
ATOM   1756 N  N   . GLU A 1 237 ? 7.301   12.337  30.900  1.00 9.35  ? 237 GLU A N   1 
ATOM   1757 C  CA  . GLU A 1 237 ? 7.590   13.154  32.087  1.00 11.96 ? 237 GLU A CA  1 
ATOM   1758 C  C   . GLU A 1 237 ? 7.051   12.438  33.313  1.00 10.80 ? 237 GLU A C   1 
ATOM   1759 O  O   . GLU A 1 237 ? 7.692   12.488  34.362  1.00 12.05 ? 237 GLU A O   1 
ATOM   1760 C  CB  . GLU A 1 237 ? 6.908   14.523  32.001  1.00 13.82 ? 237 GLU A CB  1 
ATOM   1761 C  CG  . GLU A 1 237 ? 7.413   15.392  30.881  1.00 17.52 ? 237 GLU A CG  1 
ATOM   1762 C  CD  . GLU A 1 237 ? 6.691   16.716  30.718  1.00 20.41 ? 237 GLU A CD  1 
ATOM   1763 O  OE1 . GLU A 1 237 ? 5.444   16.731  30.746  1.00 21.34 ? 237 GLU A OE1 1 
ATOM   1764 O  OE2 . GLU A 1 237 ? 7.459   17.710  30.592  1.00 22.15 ? 237 GLU A OE2 1 
ATOM   1765 N  N   . ALA A 1 238 ? 5.908   11.768  33.224  1.00 9.78  ? 238 ALA A N   1 
ATOM   1766 C  CA  . ALA A 1 238 ? 5.287   11.177  34.422  1.00 9.71  ? 238 ALA A CA  1 
ATOM   1767 C  C   . ALA A 1 238 ? 5.704   9.774   34.767  1.00 10.68 ? 238 ALA A C   1 
ATOM   1768 O  O   . ALA A 1 238 ? 5.189   9.204   35.759  1.00 13.52 ? 238 ALA A O   1 
ATOM   1769 C  CB  . ALA A 1 238 ? 3.780   11.248  34.228  1.00 10.20 ? 238 ALA A CB  1 
ATOM   1770 N  N   . GLY A 1 239 ? 6.640   9.198   34.040  1.00 9.31  ? 239 GLY A N   1 
ATOM   1771 C  CA  . GLY A 1 239 ? 7.128   7.860   34.254  1.00 9.99  ? 239 GLY A CA  1 
ATOM   1772 C  C   . GLY A 1 239 ? 6.192   6.774   33.729  1.00 11.28 ? 239 GLY A C   1 
ATOM   1773 O  O   . GLY A 1 239 ? 6.366   5.615   34.151  1.00 10.79 ? 239 GLY A O   1 
ATOM   1774 N  N   . GLN A 1 240 ? 5.202   7.139   32.905  1.00 9.19  ? 240 GLN A N   1 
ATOM   1775 C  CA  . GLN A 1 240 ? 4.323   6.105   32.328  1.00 10.46 ? 240 GLN A CA  1 
ATOM   1776 C  C   . GLN A 1 240 ? 4.975   5.532   31.082  1.00 9.56  ? 240 GLN A C   1 
ATOM   1777 O  O   . GLN A 1 240 ? 4.732   4.401   30.640  1.00 9.58  ? 240 GLN A O   1 
ATOM   1778 C  CB  . GLN A 1 240 ? 2.928   6.658   32.081  1.00 10.77 ? 240 GLN A CB  1 
ATOM   1779 C  CG  . GLN A 1 240 ? 2.268   7.131   33.376  1.00 13.16 ? 240 GLN A CG  1 
ATOM   1780 C  CD  . GLN A 1 240 ? 1.236   8.217   33.111  1.00 14.51 ? 240 GLN A CD  1 
ATOM   1781 O  OE1 . GLN A 1 240 ? 1.467   9.114   32.294  1.00 15.32 ? 240 GLN A OE1 1 
ATOM   1782 N  NE2 . GLN A 1 240 ? 0.122   8.131   33.831  1.00 14.98 ? 240 GLN A NE2 1 
ATOM   1783 N  N   . MET A 1 241 ? 5.869   6.337   30.472  1.00 9.81  ? 241 MET A N   1 
ATOM   1784 C  CA  . MET A 1 241 ? 6.693   5.873   29.367  1.00 9.41  ? 241 MET A CA  1 
ATOM   1785 C  C   . MET A 1 241 ? 8.139   6.219   29.758  1.00 10.20 ? 241 MET A C   1 
ATOM   1786 O  O   . MET A 1 241 ? 8.293   7.146   30.546  1.00 11.31 ? 241 MET A O   1 
ATOM   1787 C  CB  . MET A 1 241 ? 6.351   6.458   28.002  1.00 9.44  ? 241 MET A CB  1 
ATOM   1788 C  CG  . MET A 1 241 ? 5.105   5.804   27.427  1.00 10.36 ? 241 MET A CG  1 
ATOM   1789 S  SD  . MET A 1 241 ? 4.548   6.654   25.924  1.00 10.33 ? 241 MET A SD  1 
ATOM   1790 C  CE  . MET A 1 241 ? 6.086   6.804   25.086  1.00 3.71  ? 241 MET A CE  1 
ATOM   1791 N  N   . THR A 1 242 ? 9.125   5.496   29.265  1.00 8.60  ? 242 THR A N   1 
ATOM   1792 C  CA  . THR A 1 242 ? 10.507  5.754   29.639  1.00 7.83  ? 242 THR A CA  1 
ATOM   1793 C  C   . THR A 1 242 ? 11.078  6.870   28.764  1.00 7.83  ? 242 THR A C   1 
ATOM   1794 O  O   . THR A 1 242 ? 11.838  7.715   29.215  1.00 7.36  ? 242 THR A O   1 
ATOM   1795 C  CB  . THR A 1 242 ? 11.338  4.473   29.492  1.00 8.26  ? 242 THR A CB  1 
ATOM   1796 O  OG1 . THR A 1 242 ? 10.640  3.392   30.151  1.00 6.82  ? 242 THR A OG1 1 
ATOM   1797 C  CG2 . THR A 1 242 ? 12.721  4.717   30.108  1.00 7.48  ? 242 THR A CG2 1 
ATOM   1798 N  N   . ALA A 1 243 ? 10.725  6.833   27.486  1.00 6.04  ? 243 ALA A N   1 
ATOM   1799 C  CA  . ALA A 1 243 ? 11.279  7.848   26.565  1.00 6.75  ? 243 ALA A CA  1 
ATOM   1800 C  C   . ALA A 1 243 ? 10.520  7.775   25.232  1.00 6.83  ? 243 ALA A C   1 
ATOM   1801 O  O   . ALA A 1 243 ? 9.683   6.891   25.106  1.00 5.73  ? 243 ALA A O   1 
ATOM   1802 C  CB  . ALA A 1 243 ? 12.740  7.553   26.260  1.00 6.71  ? 243 ALA A CB  1 
ATOM   1803 N  N   . THR A 1 244 ? 10.778  8.792   24.406  1.00 5.81  ? 244 THR A N   1 
ATOM   1804 C  CA  . THR A 1 244 ? 10.208  8.736   23.074  1.00 7.94  ? 244 THR A CA  1 
ATOM   1805 C  C   . THR A 1 244 ? 11.225  9.350   22.114  1.00 6.80  ? 244 THR A C   1 
ATOM   1806 O  O   . THR A 1 244 ? 11.957  10.287  22.508  1.00 8.01  ? 244 THR A O   1 
ATOM   1807 C  CB  . THR A 1 244 ? 8.814   9.334   22.893  1.00 7.53  ? 244 THR A CB  1 
ATOM   1808 O  OG1 . THR A 1 244 ? 8.391   9.069   21.541  1.00 6.43  ? 244 THR A OG1 1 
ATOM   1809 C  CG2 . THR A 1 244 ? 8.796   10.850  23.070  1.00 7.09  ? 244 THR A CG2 1 
ATOM   1810 N  N   . VAL A 1 245 ? 11.338  8.782   20.915  1.00 4.52  ? 245 VAL A N   1 
ATOM   1811 C  CA  . VAL A 1 245 ? 12.271  9.372   19.953  1.00 4.59  ? 245 VAL A CA  1 
ATOM   1812 C  C   . VAL A 1 245 ? 11.400  10.393  19.167  1.00 7.50  ? 245 VAL A C   1 
ATOM   1813 O  O   . VAL A 1 245 ? 10.565  9.938   18.403  1.00 5.37  ? 245 VAL A O   1 
ATOM   1814 C  CB  . VAL A 1 245 ? 12.883  8.428   18.921  1.00 5.05  ? 245 VAL A CB  1 
ATOM   1815 C  CG1 . VAL A 1 245 ? 13.903  9.203   18.085  1.00 4.17  ? 245 VAL A CG1 1 
ATOM   1816 C  CG2 . VAL A 1 245 ? 13.595  7.231   19.593  1.00 5.03  ? 245 VAL A CG2 1 
ATOM   1817 N  N   . ALA A 1 246 ? 11.611  11.669  19.441  1.00 6.24  ? 246 ALA A N   1 
ATOM   1818 C  CA  . ALA A 1 246 ? 10.725  12.690  18.895  1.00 6.77  ? 246 ALA A CA  1 
ATOM   1819 C  C   . ALA A 1 246 ? 11.064  13.003  17.457  1.00 6.78  ? 246 ALA A C   1 
ATOM   1820 O  O   . ALA A 1 246 ? 12.225  12.942  17.067  1.00 5.52  ? 246 ALA A O   1 
ATOM   1821 C  CB  . ALA A 1 246 ? 10.869  13.980  19.704  1.00 6.95  ? 246 ALA A CB  1 
ATOM   1822 N  N   . GLN A 1 247 ? 10.015  13.255  16.651  1.00 6.79  ? 247 GLN A N   1 
ATOM   1823 C  CA  . GLN A 1 247 ? 10.290  13.633  15.264  1.00 6.36  ? 247 GLN A CA  1 
ATOM   1824 C  C   . GLN A 1 247 ? 9.856   15.116  15.161  1.00 7.26  ? 247 GLN A C   1 
ATOM   1825 O  O   . GLN A 1 247 ? 9.233   15.606  16.075  1.00 5.53  ? 247 GLN A O   1 
ATOM   1826 C  CB  . GLN A 1 247 ? 9.477   12.836  14.247  1.00 7.01  ? 247 GLN A CB  1 
ATOM   1827 C  CG  . GLN A 1 247 ? 9.760   11.331  14.257  1.00 6.94  ? 247 GLN A CG  1 
ATOM   1828 C  CD  . GLN A 1 247 ? 9.088   10.650  13.067  1.00 7.05  ? 247 GLN A CD  1 
ATOM   1829 O  OE1 . GLN A 1 247 ? 9.552   10.807  11.947  1.00 8.93  ? 247 GLN A OE1 1 
ATOM   1830 N  NE2 . GLN A 1 247 ? 8.002   9.926   13.305  1.00 7.02  ? 247 GLN A NE2 1 
ATOM   1831 N  N   . ASN A 1 248 ? 10.092  15.717  14.003  1.00 6.36  ? 248 ASN A N   1 
ATOM   1832 C  CA  . ASN A 1 248 ? 9.657   17.076  13.713  1.00 5.85  ? 248 ASN A CA  1 
ATOM   1833 C  C   . ASN A 1 248 ? 8.787   17.050  12.452  1.00 4.13  ? 248 ASN A C   1 
ATOM   1834 O  O   . ASN A 1 248 ? 9.286   17.404  11.399  1.00 6.71  ? 248 ASN A O   1 
ATOM   1835 C  CB  . ASN A 1 248 ? 10.870  17.976  13.485  1.00 8.15  ? 248 ASN A CB  1 
ATOM   1836 C  CG  . ASN A 1 248 ? 10.524  19.457  13.450  1.00 9.82  ? 248 ASN A CG  1 
ATOM   1837 O  OD1 . ASN A 1 248 ? 9.388   19.813  13.186  1.00 9.03  ? 248 ASN A OD1 1 
ATOM   1838 N  ND2 . ASN A 1 248 ? 11.504  20.327  13.686  1.00 11.09 ? 248 ASN A ND2 1 
ATOM   1839 N  N   . PRO A 1 249 ? 7.543   16.602  12.574  1.00 4.91  ? 249 PRO A N   1 
ATOM   1840 C  CA  . PRO A 1 249 ? 6.661   16.526  11.427  1.00 4.89  ? 249 PRO A CA  1 
ATOM   1841 C  C   . PRO A 1 249 ? 6.427   17.909  10.794  1.00 5.77  ? 249 PRO A C   1 
ATOM   1842 O  O   . PRO A 1 249 ? 6.248   17.996  9.575   1.00 6.37  ? 249 PRO A O   1 
ATOM   1843 C  CB  . PRO A 1 249 ? 5.350   15.983  11.966  1.00 3.80  ? 249 PRO A CB  1 
ATOM   1844 C  CG  . PRO A 1 249 ? 5.383   16.185  13.459  1.00 4.93  ? 249 PRO A CG  1 
ATOM   1845 C  CD  . PRO A 1 249 ? 6.870   16.112  13.792  1.00 3.51  ? 249 PRO A CD  1 
ATOM   1846 N  N   . ALA A 1 250 ? 6.444   18.972  11.597  1.00 6.59  ? 250 ALA A N   1 
ATOM   1847 C  CA  . ALA A 1 250 ? 6.273   20.309  11.007  1.00 8.06  ? 250 ALA A CA  1 
ATOM   1848 C  C   . ALA A 1 250 ? 7.327   20.550  9.956   1.00 8.49  ? 250 ALA A C   1 
ATOM   1849 O  O   . ALA A 1 250 ? 7.031   21.034  8.861   1.00 8.94  ? 250 ALA A O   1 
ATOM   1850 C  CB  . ALA A 1 250 ? 6.292   21.423  12.060  1.00 7.72  ? 250 ALA A CB  1 
ATOM   1851 N  N   . ASP A 1 251 ? 8.607   20.222  10.266  1.00 8.17  ? 251 ASP A N   1 
ATOM   1852 C  CA  . ASP A 1 251 ? 9.667   20.438  9.286   1.00 9.00  ? 251 ASP A CA  1 
ATOM   1853 C  C   . ASP A 1 251 ? 9.606   19.415  8.171   1.00 7.64  ? 251 ASP A C   1 
ATOM   1854 O  O   . ASP A 1 251 ? 9.950   19.738  7.045   1.00 5.97  ? 251 ASP A O   1 
ATOM   1855 C  CB  . ASP A 1 251 ? 11.045  20.410  9.978   1.00 11.53 ? 251 ASP A CB  1 
ATOM   1856 C  CG  . ASP A 1 251 ? 12.190  20.912  9.145   1.00 15.84 ? 251 ASP A CG  1 
ATOM   1857 O  OD1 . ASP A 1 251 ? 11.983  21.830  8.310   1.00 18.04 ? 251 ASP A OD1 1 
ATOM   1858 O  OD2 . ASP A 1 251 ? 13.336  20.419  9.307   1.00 17.83 ? 251 ASP A OD2 1 
ATOM   1859 N  N   . ILE A 1 252 ? 9.162   18.179  8.421   1.00 7.36  ? 252 ILE A N   1 
ATOM   1860 C  CA  . ILE A 1 252 ? 9.017   17.238  7.294   1.00 6.74  ? 252 ILE A CA  1 
ATOM   1861 C  C   . ILE A 1 252 ? 8.044   17.851  6.271   1.00 7.44  ? 252 ILE A C   1 
ATOM   1862 O  O   . ILE A 1 252 ? 8.286   17.887  5.076   1.00 6.68  ? 252 ILE A O   1 
ATOM   1863 C  CB  . ILE A 1 252 ? 8.454   15.889  7.785   1.00 7.92  ? 252 ILE A CB  1 
ATOM   1864 C  CG1 . ILE A 1 252 ? 9.590   15.199  8.563   1.00 8.01  ? 252 ILE A CG1 1 
ATOM   1865 C  CG2 . ILE A 1 252 ? 7.957   15.049  6.609   1.00 6.93  ? 252 ILE A CG2 1 
ATOM   1866 C  CD1 . ILE A 1 252 ? 9.133   14.015  9.400   1.00 9.09  ? 252 ILE A CD1 1 
ATOM   1867 N  N   . GLY A 1 253 ? 6.922   18.304  6.781   1.00 7.98  ? 253 GLY A N   1 
ATOM   1868 C  CA  . GLY A 1 253 ? 5.858   18.927  5.991   1.00 9.08  ? 253 GLY A CA  1 
ATOM   1869 C  C   . GLY A 1 253 ? 6.321   20.197  5.298   1.00 9.23  ? 253 GLY A C   1 
ATOM   1870 O  O   . GLY A 1 253 ? 6.158   20.301  4.074   1.00 8.54  ? 253 GLY A O   1 
ATOM   1871 N  N   . ALA A 1 254 ? 6.938   21.146  6.007   1.00 7.13  ? 254 ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 254 ? 7.402   22.385  5.396   1.00 7.88  ? 254 ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 254 ? 8.424   22.138  4.302   1.00 8.18  ? 254 ALA A C   1 
ATOM   1874 O  O   . ALA A 1 254 ? 8.449   22.744  3.221   1.00 9.51  ? 254 ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 254 ? 8.046   23.281  6.480   1.00 7.10  ? 254 ALA A CB  1 
ATOM   1876 N  N   . THR A 1 255 ? 9.365   21.204  4.609   1.00 7.00  ? 255 THR A N   1 
ATOM   1877 C  CA  . THR A 1 255 ? 10.437  20.881  3.696   1.00 8.64  ? 255 THR A CA  1 
ATOM   1878 C  C   . THR A 1 255 ? 9.867   20.175  2.470   1.00 7.38  ? 255 THR A C   1 
ATOM   1879 O  O   . THR A 1 255 ? 10.328  20.451  1.365   1.00 7.55  ? 255 THR A O   1 
ATOM   1880 C  CB  . THR A 1 255 ? 11.514  20.002  4.381   1.00 10.21 ? 255 THR A CB  1 
ATOM   1881 O  OG1 . THR A 1 255 ? 12.033  20.778  5.464   1.00 11.76 ? 255 THR A OG1 1 
ATOM   1882 C  CG2 . THR A 1 255 ? 12.635  19.631  3.414   1.00 10.01 ? 255 THR A CG2 1 
ATOM   1883 N  N   . GLY A 1 256 ? 8.877   19.308  2.700   1.00 6.51  ? 256 GLY A N   1 
ATOM   1884 C  CA  . GLY A 1 256 ? 8.293   18.632  1.519   1.00 7.18  ? 256 GLY A CA  1 
ATOM   1885 C  C   . GLY A 1 256 ? 7.590   19.682  0.623   1.00 7.10  ? 256 GLY A C   1 
ATOM   1886 O  O   . GLY A 1 256 ? 7.691   19.591  -0.597  1.00 7.35  ? 256 GLY A O   1 
ATOM   1887 N  N   . LEU A 1 257 ? 6.848   20.610  1.221   1.00 7.38  ? 257 LEU A N   1 
ATOM   1888 C  CA  . LEU A 1 257 ? 6.148   21.614  0.394   1.00 8.53  ? 257 LEU A CA  1 
ATOM   1889 C  C   . LEU A 1 257 ? 7.146   22.427  -0.422  1.00 8.43  ? 257 LEU A C   1 
ATOM   1890 O  O   . LEU A 1 257 ? 6.996   22.649  -1.626  1.00 8.52  ? 257 LEU A O   1 
ATOM   1891 C  CB  . LEU A 1 257 ? 5.262   22.519  1.249   1.00 8.05  ? 257 LEU A CB  1 
ATOM   1892 C  CG  . LEU A 1 257 ? 4.596   23.684  0.480   1.00 7.01  ? 257 LEU A CG  1 
ATOM   1893 C  CD1 . LEU A 1 257 ? 3.590   23.150  -0.540  1.00 7.25  ? 257 LEU A CD1 1 
ATOM   1894 C  CD2 . LEU A 1 257 ? 3.891   24.606  1.492   1.00 8.17  ? 257 LEU A CD2 1 
ATOM   1895 N  N   . LYS A 1 258 ? 8.232   22.895  0.190   1.00 7.10  ? 258 LYS A N   1 
ATOM   1896 C  CA  . LYS A 1 258 ? 9.276   23.655  -0.443  1.00 9.40  ? 258 LYS A CA  1 
ATOM   1897 C  C   . LYS A 1 258 ? 9.920   22.857  -1.575  1.00 9.44  ? 258 LYS A C   1 
ATOM   1898 O  O   . LYS A 1 258 ? 10.156  23.426  -2.627  1.00 10.56 ? 258 LYS A O   1 
ATOM   1899 C  CB  . LYS A 1 258 ? 10.392  24.097  0.498   1.00 11.73 ? 258 LYS A CB  1 
ATOM   1900 C  CG  . LYS A 1 258 ? 11.483  24.918  -0.205  1.00 16.72 ? 258 LYS A CG  1 
ATOM   1901 C  CD  . LYS A 1 258 ? 11.006  26.342  -0.436  1.00 19.54 ? 258 LYS A CD  1 
ATOM   1902 C  CE  . LYS A 1 258 ? 12.160  27.348  -0.332  1.00 21.42 ? 258 LYS A CE  1 
ATOM   1903 N  NZ  . LYS A 1 258 ? 11.996  28.380  -1.401  1.00 22.33 ? 258 LYS A NZ  1 
ATOM   1904 N  N   . LEU A 1 259 ? 10.149  21.555  -1.371  1.00 7.48  ? 259 LEU A N   1 
ATOM   1905 C  CA  . LEU A 1 259 ? 10.688  20.747  -2.445  1.00 8.92  ? 259 LEU A CA  1 
ATOM   1906 C  C   . LEU A 1 259 ? 9.697   20.631  -3.616  1.00 6.78  ? 259 LEU A C   1 
ATOM   1907 O  O   . LEU A 1 259 ? 10.136  20.615  -4.783  1.00 8.32  ? 259 LEU A O   1 
ATOM   1908 C  CB  . LEU A 1 259 ? 11.040  19.364  -1.891  1.00 11.04 ? 259 LEU A CB  1 
ATOM   1909 C  CG  . LEU A 1 259 ? 12.249  19.355  -0.917  1.00 13.50 ? 259 LEU A CG  1 
ATOM   1910 C  CD1 . LEU A 1 259 ? 12.671  17.896  -0.696  1.00 12.84 ? 259 LEU A CD1 1 
ATOM   1911 C  CD2 . LEU A 1 259 ? 13.432  20.137  -1.431  1.00 14.73 ? 259 LEU A CD2 1 
ATOM   1912 N  N   . MET A 1 260 ? 8.429   20.527  -3.292  1.00 7.90  ? 260 MET A N   1 
ATOM   1913 C  CA  . MET A 1 260 ? 7.404   20.420  -4.352  1.00 8.07  ? 260 MET A CA  1 
ATOM   1914 C  C   . MET A 1 260 ? 7.350   21.701  -5.201  1.00 7.77  ? 260 MET A C   1 
ATOM   1915 O  O   . MET A 1 260 ? 7.456   21.710  -6.435  1.00 6.75  ? 260 MET A O   1 
ATOM   1916 C  CB  . MET A 1 260 ? 6.074   20.123  -3.697  1.00 8.29  ? 260 MET A CB  1 
ATOM   1917 C  CG  . MET A 1 260 ? 4.958   19.859  -4.725  1.00 8.89  ? 260 MET A CG  1 
ATOM   1918 S  SD  . MET A 1 260 ? 3.587   18.982  -3.983  1.00 7.57  ? 260 MET A SD  1 
ATOM   1919 C  CE  . MET A 1 260 ? 3.159   20.078  -2.628  1.00 7.71  ? 260 MET A CE  1 
ATOM   1920 N  N   . VAL A 1 261 ? 7.305   22.842  -4.508  1.00 8.97  ? 261 VAL A N   1 
ATOM   1921 C  CA  . VAL A 1 261 ? 7.282   24.147  -5.223  1.00 9.00  ? 261 VAL A CA  1 
ATOM   1922 C  C   . VAL A 1 261 ? 8.528   24.344  -6.062  1.00 10.62 ? 261 VAL A C   1 
ATOM   1923 O  O   . VAL A 1 261 ? 8.535   24.828  -7.199  1.00 10.61 ? 261 VAL A O   1 
ATOM   1924 C  CB  . VAL A 1 261 ? 7.145   25.272  -4.181  1.00 8.88  ? 261 VAL A CB  1 
ATOM   1925 C  CG1 . VAL A 1 261 ? 7.334   26.649  -4.797  1.00 10.56 ? 261 VAL A CG1 1 
ATOM   1926 C  CG2 . VAL A 1 261 ? 5.777   25.121  -3.501  1.00 8.88  ? 261 VAL A CG2 1 
ATOM   1927 N  N   . ASP A 1 262 ? 9.687   23.993  -5.470  1.00 11.80 ? 262 ASP A N   1 
ATOM   1928 C  CA  . ASP A 1 262 ? 10.948  24.070  -6.180  1.00 13.25 ? 262 ASP A CA  1 
ATOM   1929 C  C   . ASP A 1 262 ? 10.929  23.213  -7.441  1.00 11.87 ? 262 ASP A C   1 
ATOM   1930 O  O   . ASP A 1 262 ? 11.434  23.634  -8.487  1.00 12.01 ? 262 ASP A O   1 
ATOM   1931 C  CB  . ASP A 1 262 ? 12.110  23.658  -5.274  1.00 13.67 ? 262 ASP A CB  1 
ATOM   1932 C  CG  . ASP A 1 262 ? 12.468  24.796  -4.330  1.00 16.46 ? 262 ASP A CG  1 
ATOM   1933 O  OD1 . ASP A 1 262 ? 11.979  25.937  -4.509  1.00 15.23 ? 262 ASP A OD1 1 
ATOM   1934 O  OD2 . ASP A 1 262 ? 13.254  24.552  -3.391  1.00 17.30 ? 262 ASP A OD2 1 
ATOM   1935 N  N   . ALA A 1 263 ? 10.402  21.997  -7.312  1.00 11.84 ? 263 ALA A N   1 
ATOM   1936 C  CA  . ALA A 1 263 ? 10.359  21.098  -8.473  1.00 12.39 ? 263 ALA A CA  1 
ATOM   1937 C  C   . ALA A 1 263 ? 9.512   21.697  -9.582  1.00 11.66 ? 263 ALA A C   1 
ATOM   1938 O  O   . ALA A 1 263 ? 9.877   21.584  -10.766 1.00 13.15 ? 263 ALA A O   1 
ATOM   1939 C  CB  . ALA A 1 263 ? 9.797   19.732  -8.103  1.00 14.51 ? 263 ALA A CB  1 
ATOM   1940 N  N   . GLU A 1 264 ? 8.375   22.286  -9.237  1.00 10.77 ? 264 GLU A N   1 
ATOM   1941 C  CA  . GLU A 1 264 ? 7.478   22.879  -10.224 1.00 10.20 ? 264 GLU A CA  1 
ATOM   1942 C  C   . GLU A 1 264 ? 8.162   23.939  -11.057 1.00 9.05  ? 264 GLU A C   1 
ATOM   1943 O  O   . GLU A 1 264 ? 7.915   24.042  -12.265 1.00 9.27  ? 264 GLU A O   1 
ATOM   1944 C  CB  . GLU A 1 264 ? 6.224   23.457  -9.563  1.00 9.46  ? 264 GLU A CB  1 
ATOM   1945 C  CG  . GLU A 1 264 ? 5.144   23.873  -10.547 1.00 12.40 ? 264 GLU A CG  1 
ATOM   1946 C  CD  . GLU A 1 264 ? 5.220   25.274  -11.109 1.00 13.80 ? 264 GLU A CD  1 
ATOM   1947 O  OE1 . GLU A 1 264 ? 6.029   26.070  -10.592 1.00 12.88 ? 264 GLU A OE1 1 
ATOM   1948 O  OE2 . GLU A 1 264 ? 4.467   25.589  -12.073 1.00 14.88 ? 264 GLU A OE2 1 
ATOM   1949 N  N   . LYS A 1 265 ? 9.092   24.717  -10.522 1.00 11.02 ? 265 LYS A N   1 
ATOM   1950 C  CA  . LYS A 1 265 ? 9.859   25.689  -11.266 1.00 12.92 ? 265 LYS A CA  1 
ATOM   1951 C  C   . LYS A 1 265 ? 10.704  25.084  -12.389 1.00 15.27 ? 265 LYS A C   1 
ATOM   1952 O  O   . LYS A 1 265 ? 11.184  25.847  -13.224 1.00 13.11 ? 265 LYS A O   1 
ATOM   1953 C  CB  . LYS A 1 265 ? 10.857  26.388  -10.311 1.00 15.33 ? 265 LYS A CB  1 
ATOM   1954 C  CG  . LYS A 1 265 ? 10.146  27.142  -9.199  1.00 17.55 ? 265 LYS A CG  1 
ATOM   1955 C  CD  . LYS A 1 265 ? 11.164  27.636  -8.184  1.00 20.34 ? 265 LYS A CD  1 
ATOM   1956 C  CE  . LYS A 1 265 ? 10.557  28.357  -6.997  1.00 23.50 ? 265 LYS A CE  1 
ATOM   1957 N  NZ  . LYS A 1 265 ? 11.501  29.401  -6.469  1.00 24.61 ? 265 LYS A NZ  1 
ATOM   1958 N  N   . SER A 1 266 ? 10.952  23.768  -12.397 1.00 15.15 ? 266 SER A N   1 
ATOM   1959 C  CA  . SER A 1 266 ? 11.735  23.120  -13.424 1.00 15.99 ? 266 SER A CA  1 
ATOM   1960 C  C   . SER A 1 266 ? 10.873  22.875  -14.678 1.00 16.27 ? 266 SER A C   1 
ATOM   1961 O  O   . SER A 1 266 ? 11.427  22.646  -15.750 1.00 16.03 ? 266 SER A O   1 
ATOM   1962 C  CB  . SER A 1 266 ? 12.275  21.776  -12.950 1.00 18.04 ? 266 SER A CB  1 
ATOM   1963 O  OG  . SER A 1 266 ? 11.351  20.723  -13.239 1.00 17.52 ? 266 SER A OG  1 
ATOM   1964 N  N   . GLY A 1 267 ? 9.560   22.844  -14.529 1.00 16.29 ? 267 GLY A N   1 
ATOM   1965 C  CA  . GLY A 1 267 ? 8.661   22.724  -15.672 1.00 15.14 ? 267 GLY A CA  1 
ATOM   1966 C  C   . GLY A 1 267 ? 8.487   21.350  -16.278 1.00 15.67 ? 267 GLY A C   1 
ATOM   1967 O  O   . GLY A 1 267 ? 7.660   21.172  -17.188 1.00 13.74 ? 267 GLY A O   1 
ATOM   1968 N  N   . LYS A 1 268 ? 9.110   20.313  -15.720 1.00 15.21 ? 268 LYS A N   1 
ATOM   1969 C  CA  . LYS A 1 268 ? 8.857   18.925  -16.148 1.00 14.96 ? 268 LYS A CA  1 
ATOM   1970 C  C   . LYS A 1 268 ? 8.941   18.043  -14.898 1.00 14.36 ? 268 LYS A C   1 
ATOM   1971 O  O   . LYS A 1 268 ? 9.655   18.442  -13.985 1.00 13.16 ? 268 LYS A O   1 
ATOM   1972 C  CB  . LYS A 1 268 ? 9.878   18.423  -17.141 1.00 16.13 ? 268 LYS A CB  1 
ATOM   1973 C  CG  . LYS A 1 268 ? 9.939   19.106  -18.485 1.00 17.36 ? 268 LYS A CG  1 
ATOM   1974 C  CD  . LYS A 1 268 ? 10.916  18.412  -19.420 1.00 18.50 ? 268 LYS A CD  1 
ATOM   1975 C  CE  . LYS A 1 268 ? 11.286  19.401  -20.526 1.00 21.24 ? 268 LYS A CE  1 
ATOM   1976 N  NZ  . LYS A 1 268 ? 10.041  20.057  -21.034 1.00 23.25 ? 268 LYS A NZ  1 
ATOM   1977 N  N   . VAL A 1 269 ? 8.222   16.941  -14.826 1.00 14.95 ? 269 VAL A N   1 
ATOM   1978 C  CA  . VAL A 1 269 ? 8.328   16.084  -13.624 1.00 13.70 ? 269 VAL A CA  1 
ATOM   1979 C  C   . VAL A 1 269 ? 9.626   15.299  -13.669 1.00 11.96 ? 269 VAL A C   1 
ATOM   1980 O  O   . VAL A 1 269 ? 10.285  15.210  -14.699 1.00 12.05 ? 269 VAL A O   1 
ATOM   1981 C  CB  . VAL A 1 269 ? 7.153   15.113  -13.493 1.00 12.86 ? 269 VAL A CB  1 
ATOM   1982 C  CG1 . VAL A 1 269 ? 5.901   15.921  -13.171 1.00 14.23 ? 269 VAL A CG1 1 
ATOM   1983 C  CG2 . VAL A 1 269 ? 6.944   14.297  -14.762 1.00 13.30 ? 269 VAL A CG2 1 
ATOM   1984 N  N   . ILE A 1 270 ? 10.005  14.719  -12.504 1.00 9.95  ? 270 ILE A N   1 
ATOM   1985 C  CA  . ILE A 1 270 ? 11.261  13.983  -12.459 1.00 7.93  ? 270 ILE A CA  1 
ATOM   1986 C  C   . ILE A 1 270 ? 11.253  12.823  -13.448 1.00 7.41  ? 270 ILE A C   1 
ATOM   1987 O  O   . ILE A 1 270 ? 10.219  12.173  -13.531 1.00 10.24 ? 270 ILE A O   1 
ATOM   1988 C  CB  . ILE A 1 270 ? 11.434  13.463  -11.014 1.00 7.24  ? 270 ILE A CB  1 
ATOM   1989 C  CG1 . ILE A 1 270 ? 12.833  12.864  -10.808 1.00 9.38  ? 270 ILE A CG1 1 
ATOM   1990 C  CG2 . ILE A 1 270 ? 10.356  12.455  -10.638 1.00 8.24  ? 270 ILE A CG2 1 
ATOM   1991 C  CD1 . ILE A 1 270 ? 13.134  12.708  -9.333  1.00 8.24  ? 270 ILE A CD1 1 
ATOM   1992 N  N   . PRO A 1 271 ? 12.331  12.517  -14.110 1.00 9.04  ? 271 PRO A N   1 
ATOM   1993 C  CA  . PRO A 1 271 ? 12.400  11.346  -14.987 1.00 10.29 ? 271 PRO A CA  1 
ATOM   1994 C  C   . PRO A 1 271 ? 12.263  10.061  -14.190 1.00 11.69 ? 271 PRO A C   1 
ATOM   1995 O  O   . PRO A 1 271 ? 12.640  9.965   -13.003 1.00 9.97  ? 271 PRO A O   1 
ATOM   1996 C  CB  . PRO A 1 271 ? 13.726  11.466  -15.716 1.00 10.33 ? 271 PRO A CB  1 
ATOM   1997 C  CG  . PRO A 1 271 ? 14.176  12.888  -15.490 1.00 11.64 ? 271 PRO A CG  1 
ATOM   1998 C  CD  . PRO A 1 271 ? 13.640  13.203  -14.104 1.00 10.87 ? 271 PRO A CD  1 
ATOM   1999 N  N   . LEU A 1 272 ? 11.738  8.993   -14.820 1.00 9.51  ? 272 LEU A N   1 
ATOM   2000 C  CA  . LEU A 1 272 ? 11.577  7.718   -14.132 1.00 10.09 ? 272 LEU A CA  1 
ATOM   2001 C  C   . LEU A 1 272 ? 12.857  7.124   -13.551 1.00 11.13 ? 272 LEU A C   1 
ATOM   2002 O  O   . LEU A 1 272 ? 12.783  6.417   -12.528 1.00 12.05 ? 272 LEU A O   1 
ATOM   2003 C  CB  . LEU A 1 272 ? 11.014  6.641   -15.088 1.00 9.33  ? 272 LEU A CB  1 
ATOM   2004 C  CG  . LEU A 1 272 ? 9.614   6.954   -15.609 1.00 9.32  ? 272 LEU A CG  1 
ATOM   2005 C  CD1 . LEU A 1 272 ? 9.171   5.817   -16.551 1.00 8.18  ? 272 LEU A CD1 1 
ATOM   2006 C  CD2 . LEU A 1 272 ? 8.649   7.145   -14.467 1.00 7.88  ? 272 LEU A CD2 1 
ATOM   2007 N  N   . ASP A 1 273 ? 13.991  7.413   -14.167 1.00 11.68 ? 273 ASP A N   1 
ATOM   2008 C  CA  . ASP A 1 273 ? 15.221  6.807   -13.697 1.00 13.07 ? 273 ASP A CA  1 
ATOM   2009 C  C   . ASP A 1 273 ? 16.084  7.778   -12.895 1.00 13.38 ? 273 ASP A C   1 
ATOM   2010 O  O   . ASP A 1 273 ? 17.267  7.523   -12.736 1.00 12.50 ? 273 ASP A O   1 
ATOM   2011 C  CB  . ASP A 1 273 ? 15.952  6.169   -14.860 1.00 14.22 ? 273 ASP A CB  1 
ATOM   2012 C  CG  . ASP A 1 273 ? 16.224  7.071   -16.041 1.00 15.12 ? 273 ASP A CG  1 
ATOM   2013 O  OD1 . ASP A 1 273 ? 15.857  8.265   -16.005 1.00 14.25 ? 273 ASP A OD1 1 
ATOM   2014 O  OD2 . ASP A 1 273 ? 16.837  6.482   -16.955 1.00 16.83 ? 273 ASP A OD2 1 
ATOM   2015 N  N   . LYS A 1 274 ? 15.503  8.872   -12.438 1.00 13.53 ? 274 LYS A N   1 
ATOM   2016 C  CA  . LYS A 1 274 ? 16.282  9.812   -11.600 1.00 14.98 ? 274 LYS A CA  1 
ATOM   2017 C  C   . LYS A 1 274 ? 15.891  9.557   -10.151 1.00 13.35 ? 274 LYS A C   1 
ATOM   2018 O  O   . LYS A 1 274 ? 14.721  9.355   -9.785  1.00 13.14 ? 274 LYS A O   1 
ATOM   2019 C  CB  . LYS A 1 274 ? 16.069  11.250  -12.062 1.00 16.25 ? 274 LYS A CB  1 
ATOM   2020 C  CG  . LYS A 1 274 ? 16.951  12.299  -11.358 1.00 19.93 ? 274 LYS A CG  1 
ATOM   2021 C  CD  . LYS A 1 274 ? 16.757  13.655  -12.029 1.00 22.04 ? 274 LYS A CD  1 
ATOM   2022 C  CE  . LYS A 1 274 ? 17.290  14.820  -11.215 1.00 23.22 ? 274 LYS A CE  1 
ATOM   2023 N  NZ  . LYS A 1 274 ? 18.681  14.615  -10.740 1.00 23.92 ? 274 LYS A NZ  1 
ATOM   2024 N  N   . ALA A 1 275 ? 16.880  9.548   -9.254  1.00 13.84 ? 275 ALA A N   1 
ATOM   2025 C  CA  . ALA A 1 275 ? 16.560  9.364   -7.833  1.00 13.31 ? 275 ALA A CA  1 
ATOM   2026 C  C   . ALA A 1 275 ? 15.847  10.609  -7.318  1.00 9.40  ? 275 ALA A C   1 
ATOM   2027 O  O   . ALA A 1 275 ? 16.319  11.710  -7.537  1.00 11.38 ? 275 ALA A O   1 
ATOM   2028 C  CB  . ALA A 1 275 ? 17.847  9.136   -7.021  1.00 11.13 ? 275 ALA A CB  1 
ATOM   2029 N  N   . PRO A 1 276 ? 14.747  10.476  -6.599  1.00 10.31 ? 276 PRO A N   1 
ATOM   2030 C  CA  . PRO A 1 276 ? 14.037  11.626  -6.052  1.00 10.49 ? 276 PRO A CA  1 
ATOM   2031 C  C   . PRO A 1 276 ? 14.936  12.473  -5.141  1.00 12.96 ? 276 PRO A C   1 
ATOM   2032 O  O   . PRO A 1 276 ? 15.865  11.903  -4.546  1.00 13.42 ? 276 PRO A O   1 
ATOM   2033 C  CB  . PRO A 1 276 ? 12.911  10.998  -5.240  1.00 9.81  ? 276 PRO A CB  1 
ATOM   2034 C  CG  . PRO A 1 276 ? 12.682  9.665   -5.881  1.00 10.14 ? 276 PRO A CG  1 
ATOM   2035 C  CD  . PRO A 1 276 ? 14.042  9.201   -6.352  1.00 10.31 ? 276 PRO A CD  1 
ATOM   2036 N  N   . GLU A 1 277 ? 14.750  13.781  -5.070  1.00 12.12 ? 277 GLU A N   1 
ATOM   2037 C  CA  . GLU A 1 277 ? 15.448  14.604  -4.091  1.00 13.43 ? 277 GLU A CA  1 
ATOM   2038 C  C   . GLU A 1 277 ? 15.197  13.978  -2.711  1.00 13.35 ? 277 GLU A C   1 
ATOM   2039 O  O   . GLU A 1 277 ? 14.084  13.587  -2.408  1.00 10.54 ? 277 GLU A O   1 
ATOM   2040 C  CB  . GLU A 1 277 ? 14.867  16.022  -4.087  1.00 14.83 ? 277 GLU A CB  1 
ATOM   2041 C  CG  . GLU A 1 277 ? 15.254  16.843  -5.318  1.00 16.59 ? 277 GLU A CG  1 
ATOM   2042 C  CD  . GLU A 1 277 ? 16.763  16.888  -5.466  1.00 18.00 ? 277 GLU A CD  1 
ATOM   2043 O  OE1 . GLU A 1 277 ? 17.447  17.389  -4.550  1.00 19.05 ? 277 GLU A OE1 1 
ATOM   2044 O  OE2 . GLU A 1 277 ? 17.288  16.383  -6.474  1.00 18.36 ? 277 GLU A OE2 1 
ATOM   2045 N  N   . PHE A 1 278 ? 16.226  13.892  -1.872  1.00 13.65 ? 278 PHE A N   1 
ATOM   2046 C  CA  . PHE A 1 278 ? 16.014  13.196  -0.583  1.00 13.68 ? 278 PHE A CA  1 
ATOM   2047 C  C   . PHE A 1 278 ? 16.419  14.133  0.542   1.00 13.20 ? 278 PHE A C   1 
ATOM   2048 O  O   . PHE A 1 278 ? 17.479  14.734  0.352   1.00 11.73 ? 278 PHE A O   1 
ATOM   2049 C  CB  . PHE A 1 278 ? 16.909  11.963  -0.632  1.00 14.73 ? 278 PHE A CB  1 
ATOM   2050 C  CG  . PHE A 1 278 ? 16.868  11.098  0.596   1.00 17.64 ? 278 PHE A CG  1 
ATOM   2051 C  CD1 . PHE A 1 278 ? 15.694  10.534  1.058   1.00 17.00 ? 278 PHE A CD1 1 
ATOM   2052 C  CD2 . PHE A 1 278 ? 18.052  10.870  1.298   1.00 19.01 ? 278 PHE A CD2 1 
ATOM   2053 C  CE1 . PHE A 1 278 ? 15.680  9.752   2.195   1.00 17.85 ? 278 PHE A CE1 1 
ATOM   2054 C  CE2 . PHE A 1 278 ? 18.043  10.071  2.432   1.00 18.76 ? 278 PHE A CE2 1 
ATOM   2055 C  CZ  . PHE A 1 278 ? 16.865  9.520   2.878   1.00 18.79 ? 278 PHE A CZ  1 
ATOM   2056 N  N   . LYS A 1 279 ? 15.602  14.267  1.566   1.00 13.15 ? 279 LYS A N   1 
ATOM   2057 C  CA  . LYS A 1 279 ? 15.937  15.157  2.666   1.00 12.48 ? 279 LYS A CA  1 
ATOM   2058 C  C   . LYS A 1 279 ? 15.530  14.528  4.004   1.00 11.13 ? 279 LYS A C   1 
ATOM   2059 O  O   . LYS A 1 279 ? 14.408  14.044  4.158   1.00 9.17  ? 279 LYS A O   1 
ATOM   2060 C  CB  . LYS A 1 279 ? 15.313  16.549  2.586   1.00 14.52 ? 279 LYS A CB  1 
ATOM   2061 C  CG  . LYS A 1 279 ? 16.171  17.555  1.819   1.00 17.60 ? 279 LYS A CG  1 
ATOM   2062 C  CD  . LYS A 1 279 ? 15.459  18.906  1.751   1.00 20.46 ? 279 LYS A CD  1 
ATOM   2063 C  CE  . LYS A 1 279 ? 16.201  19.848  0.797   1.00 21.80 ? 279 LYS A CE  1 
ATOM   2064 N  NZ  . LYS A 1 279 ? 16.346  21.193  1.439   1.00 22.60 ? 279 LYS A NZ  1 
ATOM   2065 N  N   . LEU A 1 280 ? 16.503  14.575  4.934   1.00 9.28  ? 280 LEU A N   1 
ATOM   2066 C  CA  . LEU A 1 280 ? 16.224  13.978  6.240   1.00 9.43  ? 280 LEU A CA  1 
ATOM   2067 C  C   . LEU A 1 280 ? 16.038  15.081  7.274   1.00 9.56  ? 280 LEU A C   1 
ATOM   2068 O  O   . LEU A 1 280 ? 16.673  16.140  7.229   1.00 12.06 ? 280 LEU A O   1 
ATOM   2069 C  CB  . LEU A 1 280 ? 17.367  13.048  6.664   1.00 10.74 ? 280 LEU A CB  1 
ATOM   2070 C  CG  . LEU A 1 280 ? 17.519  11.762  5.844   1.00 12.22 ? 280 LEU A CG  1 
ATOM   2071 C  CD1 . LEU A 1 280 ? 18.843  11.072  6.169   1.00 11.60 ? 280 LEU A CD1 1 
ATOM   2072 C  CD2 . LEU A 1 280 ? 16.334  10.840  6.113   1.00 11.66 ? 280 LEU A CD2 1 
ATOM   2073 N  N   . VAL A 1 281 ? 15.109  14.849  8.155   1.00 7.34  ? 281 VAL A N   1 
ATOM   2074 C  CA  . VAL A 1 281 ? 14.785  15.745  9.242   1.00 7.12  ? 281 VAL A CA  1 
ATOM   2075 C  C   . VAL A 1 281 ? 15.263  15.037  10.516  1.00 8.25  ? 281 VAL A C   1 
ATOM   2076 O  O   . VAL A 1 281 ? 15.008  13.863  10.717  1.00 5.88  ? 281 VAL A O   1 
ATOM   2077 C  CB  . VAL A 1 281 ? 13.302  16.068  9.238   1.00 7.37  ? 281 VAL A CB  1 
ATOM   2078 C  CG1 . VAL A 1 281 ? 12.875  16.863  10.454  1.00 8.09  ? 281 VAL A CG1 1 
ATOM   2079 C  CG2 . VAL A 1 281 ? 12.906  16.834  7.958   1.00 8.37  ? 281 VAL A CG2 1 
ATOM   2080 N  N   . ASP A 1 282 ? 16.011  15.788  11.324  1.00 7.64  ? 282 ASP A N   1 
ATOM   2081 C  CA  . ASP A 1 282 ? 16.490  15.182  12.574  1.00 8.29  ? 282 ASP A CA  1 
ATOM   2082 C  C   . ASP A 1 282 ? 15.436  14.704  13.534  1.00 7.63  ? 282 ASP A C   1 
ATOM   2083 O  O   . ASP A 1 282 ? 14.315  15.188  13.690  1.00 8.81  ? 282 ASP A O   1 
ATOM   2084 C  CB  . ASP A 1 282 ? 17.294  16.289  13.339  1.00 9.84  ? 282 ASP A CB  1 
ATOM   2085 C  CG  . ASP A 1 282 ? 18.614  16.608  12.714  1.00 15.33 ? 282 ASP A CG  1 
ATOM   2086 O  OD1 . ASP A 1 282 ? 19.009  15.981  11.704  1.00 14.71 ? 282 ASP A OD1 1 
ATOM   2087 O  OD2 . ASP A 1 282 ? 19.336  17.517  13.247  1.00 17.73 ? 282 ASP A OD2 1 
ATOM   2088 N  N   . SER A 1 283 ? 15.838  13.708  14.377  1.00 5.52  ? 283 SER A N   1 
ATOM   2089 C  CA  . SER A 1 283 ? 15.005  13.224  15.454  1.00 5.60  ? 283 SER A CA  1 
ATOM   2090 C  C   . SER A 1 283 ? 15.789  13.516  16.765  1.00 5.96  ? 283 SER A C   1 
ATOM   2091 O  O   . SER A 1 283 ? 16.964  13.852  16.632  1.00 6.88  ? 283 SER A O   1 
ATOM   2092 C  CB  . SER A 1 283 ? 14.773  11.702  15.436  1.00 6.20  ? 283 SER A CB  1 
ATOM   2093 O  OG  . SER A 1 283 ? 16.006  11.024  15.257  1.00 6.55  ? 283 SER A OG  1 
ATOM   2094 N  N   . ILE A 1 284 ? 15.119  13.358  17.879  1.00 7.58  ? 284 ILE A N   1 
ATOM   2095 C  CA  . ILE A 1 284 ? 15.913  13.539  19.126  1.00 7.28  ? 284 ILE A CA  1 
ATOM   2096 C  C   . ILE A 1 284 ? 15.263  12.732  20.240  1.00 6.47  ? 284 ILE A C   1 
ATOM   2097 O  O   . ILE A 1 284 ? 14.043  12.726  20.394  1.00 6.55  ? 284 ILE A O   1 
ATOM   2098 C  CB  . ILE A 1 284 ? 16.040  15.022  19.489  1.00 8.35  ? 284 ILE A CB  1 
ATOM   2099 C  CG1 . ILE A 1 284 ? 17.048  15.177  20.645  1.00 9.86  ? 284 ILE A CG1 1 
ATOM   2100 C  CG2 . ILE A 1 284 ? 14.701  15.637  19.813  1.00 6.69  ? 284 ILE A CG2 1 
ATOM   2101 C  CD1 . ILE A 1 284 ? 17.366  16.656  20.901  1.00 10.75 ? 284 ILE A CD1 1 
ATOM   2102 N  N   . LEU A 1 285 ? 16.099  12.022  20.992  1.00 6.40  ? 285 LEU A N   1 
ATOM   2103 C  CA  . LEU A 1 285 ? 15.545  11.243  22.099  1.00 6.63  ? 285 LEU A CA  1 
ATOM   2104 C  C   . LEU A 1 285 ? 15.006  12.154  23.187  1.00 7.79  ? 285 LEU A C   1 
ATOM   2105 O  O   . LEU A 1 285 ? 15.680  13.153  23.559  1.00 6.66  ? 285 LEU A O   1 
ATOM   2106 C  CB  . LEU A 1 285 ? 16.647  10.334  22.661  1.00 7.23  ? 285 LEU A CB  1 
ATOM   2107 C  CG  . LEU A 1 285 ? 16.244  9.450   23.826  1.00 8.62  ? 285 LEU A CG  1 
ATOM   2108 C  CD1 . LEU A 1 285 ? 15.306  8.335   23.390  1.00 11.62 ? 285 LEU A CD1 1 
ATOM   2109 C  CD2 . LEU A 1 285 ? 17.550  8.844   24.399  1.00 10.50 ? 285 LEU A CD2 1 
ATOM   2110 N  N   . VAL A 1 286 ? 13.820  11.880  23.690  1.00 5.72  ? 286 VAL A N   1 
ATOM   2111 C  CA  . VAL A 1 286 ? 13.252  12.676  24.779  1.00 8.86  ? 286 VAL A CA  1 
ATOM   2112 C  C   . VAL A 1 286 ? 13.110  11.744  25.985  1.00 9.96  ? 286 VAL A C   1 
ATOM   2113 O  O   . VAL A 1 286 ? 12.377  10.746  25.909  1.00 9.61  ? 286 VAL A O   1 
ATOM   2114 C  CB  . VAL A 1 286 ? 11.887  13.290  24.455  1.00 9.06  ? 286 VAL A CB  1 
ATOM   2115 C  CG1 . VAL A 1 286 ? 11.235  14.051  25.614  1.00 6.69  ? 286 VAL A CG1 1 
ATOM   2116 C  CG2 . VAL A 1 286 ? 12.003  14.207  23.230  1.00 8.57  ? 286 VAL A CG2 1 
ATOM   2117 N  N   . THR A 1 287 ? 13.836  12.094  27.066  1.00 9.70  ? 287 THR A N   1 
ATOM   2118 C  CA  . THR A 1 287 ? 13.738  11.183  28.217  1.00 11.68 ? 287 THR A CA  1 
ATOM   2119 C  C   . THR A 1 287 ? 13.155  11.947  29.396  1.00 13.12 ? 287 THR A C   1 
ATOM   2120 O  O   . THR A 1 287 ? 12.827  13.114  29.227  1.00 12.47 ? 287 THR A O   1 
ATOM   2121 C  CB  . THR A 1 287 ? 15.101  10.632  28.636  1.00 10.35 ? 287 THR A CB  1 
ATOM   2122 O  OG1 . THR A 1 287 ? 15.861  11.786  29.063  1.00 10.49 ? 287 THR A OG1 1 
ATOM   2123 C  CG2 . THR A 1 287 ? 15.841  9.980   27.490  1.00 9.80  ? 287 THR A CG2 1 
ATOM   2124 N  N   . GLN A 1 288 ? 12.989  11.263  30.524  1.00 14.73 ? 288 GLN A N   1 
ATOM   2125 C  CA  . GLN A 1 288 ? 12.437  12.003  31.674  1.00 21.29 ? 288 GLN A CA  1 
ATOM   2126 C  C   . GLN A 1 288 ? 13.279  13.235  32.002  1.00 23.48 ? 288 GLN A C   1 
ATOM   2127 O  O   . GLN A 1 288 ? 13.724  13.373  33.172  1.00 27.28 ? 288 GLN A O   1 
ATOM   2128 C  CB  . GLN A 1 288 ? 12.276  11.048  32.861  1.00 19.52 ? 288 GLN A CB  1 
ATOM   2129 C  CG  . GLN A 1 288 ? 11.398  11.582  33.977  1.00 20.40 ? 288 GLN A CG  1 
ATOM   2130 C  CD  . GLN A 1 288 ? 11.172  10.543  35.042  1.00 21.48 ? 288 GLN A CD  1 
ATOM   2131 O  OE1 . GLN A 1 288 ? 12.105  10.245  35.796  1.00 23.22 ? 288 GLN A OE1 1 
ATOM   2132 N  NE2 . GLN A 1 288 ? 9.979   9.962   35.129  1.00 20.47 ? 288 GLN A NE2 1 
ATOM   2133 O  OXT . GLN A 1 288 ? 12.929  14.358  31.516  1.00 26.93 ? 288 GLN A OXT 1 
HETATM 2134 ZN ZN  . ZN  B 2 .   ? -8.000  25.767  -9.721  1.00 27.35 ? 289 ZN  A ZN  1 
HETATM 2135 S  S   . SO4 C 3 .   ? -0.628  -10.744 17.972  1.00 24.04 ? 290 SO4 A S   1 
HETATM 2136 O  O1  . SO4 C 3 .   ? 0.640   -11.486 17.659  1.00 25.01 ? 290 SO4 A O1  1 
HETATM 2137 O  O2  . SO4 C 3 .   ? -0.803  -9.655  16.952  1.00 24.60 ? 290 SO4 A O2  1 
HETATM 2138 O  O3  . SO4 C 3 .   ? -0.610  -10.236 19.377  1.00 24.63 ? 290 SO4 A O3  1 
HETATM 2139 O  O4  . SO4 C 3 .   ? -1.775  -11.720 17.839  1.00 25.53 ? 290 SO4 A O4  1 
HETATM 2140 C  C1  . ALL D 4 .   ? 4.859   7.133   10.458  1.00 6.01  ? 291 ALL A C1  1 
HETATM 2141 C  C2  . ALL D 4 .   ? 5.190   8.536   11.023  1.00 5.26  ? 291 ALL A C2  1 
HETATM 2142 C  C3  . ALL D 4 .   ? 4.750   8.629   12.481  1.00 6.70  ? 291 ALL A C3  1 
HETATM 2143 C  C4  . ALL D 4 .   ? 3.247   8.334   12.570  1.00 4.41  ? 291 ALL A C4  1 
HETATM 2144 C  C5  . ALL D 4 .   ? 2.995   6.960   11.933  1.00 3.84  ? 291 ALL A C5  1 
HETATM 2145 C  C6  . ALL D 4 .   ? 1.590   6.455   12.004  1.00 5.58  ? 291 ALL A C6  1 
HETATM 2146 O  O1  . ALL D 4 .   ? 5.242   7.006   9.107   1.00 3.59  ? 291 ALL A O1  1 
HETATM 2147 O  O2  . ALL D 4 .   ? 6.585   8.761   10.925  1.00 5.46  ? 291 ALL A O2  1 
HETATM 2148 O  O3  . ALL D 4 .   ? 5.473   7.595   13.234  1.00 5.78  ? 291 ALL A O3  1 
HETATM 2149 O  O4  . ALL D 4 .   ? 2.787   8.270   13.925  1.00 5.51  ? 291 ALL A O4  1 
HETATM 2150 O  O5  . ALL D 4 .   ? 3.467   6.921   10.592  1.00 5.40  ? 291 ALL A O5  1 
HETATM 2151 O  O6  . ALL D 4 .   ? 0.684   7.345   11.299  1.00 3.34  ? 291 ALL A O6  1 
HETATM 2152 O  O   . HOH E 5 .   ? 5.385   14.677  16.590  1.00 10.26 ? 292 HOH A O   1 
HETATM 2153 O  O   . HOH E 5 .   ? 0.485   4.132   8.212   1.00 5.14  ? 293 HOH A O   1 
HETATM 2154 O  O   . HOH E 5 .   ? 6.165   14.190  -9.748  1.00 8.59  ? 294 HOH A O   1 
HETATM 2155 O  O   . HOH E 5 .   ? 9.341   5.919   5.471   1.00 3.81  ? 295 HOH A O   1 
HETATM 2156 O  O   . HOH E 5 .   ? 16.721  11.983  11.060  1.00 10.57 ? 296 HOH A O   1 
HETATM 2157 O  O   . HOH E 5 .   ? 5.248   12.493  -17.214 1.00 13.66 ? 297 HOH A O   1 
HETATM 2158 O  O   . HOH E 5 .   ? -4.556  -11.560 20.815  1.00 13.44 ? 298 HOH A O   1 
HETATM 2159 O  O   . HOH E 5 .   ? 0.897   -5.200  9.973   1.00 9.49  ? 299 HOH A O   1 
HETATM 2160 O  O   . HOH E 5 .   ? 5.995   2.502   3.352   1.00 5.92  ? 300 HOH A O   1 
HETATM 2161 O  O   . HOH E 5 .   ? -0.781  5.917   15.115  1.00 7.80  ? 301 HOH A O   1 
HETATM 2162 O  O   . HOH E 5 .   ? -1.988  7.401   13.293  1.00 6.67  ? 302 HOH A O   1 
HETATM 2163 O  O   . HOH E 5 .   ? 11.419  17.690  -11.674 1.00 8.53  ? 303 HOH A O   1 
HETATM 2164 O  O   . HOH E 5 .   ? 0.386   11.495  31.815  1.00 15.15 ? 304 HOH A O   1 
HETATM 2165 O  O   . HOH E 5 .   ? 11.799  17.794  20.675  1.00 18.48 ? 305 HOH A O   1 
HETATM 2166 O  O   . HOH E 5 .   ? -10.233 20.353  -3.629  1.00 28.68 ? 306 HOH A O   1 
HETATM 2167 O  O   . HOH E 5 .   ? 21.965  -3.653  28.361  1.00 9.07  ? 307 HOH A O   1 
HETATM 2168 O  O   . HOH E 5 .   ? 9.791   28.002  -14.131 1.00 9.15  ? 308 HOH A O   1 
HETATM 2169 O  O   . HOH E 5 .   ? 6.152   -1.100  10.463  1.00 15.47 ? 309 HOH A O   1 
HETATM 2170 O  O   . HOH E 5 .   ? 9.502   9.667   9.443   1.00 9.27  ? 310 HOH A O   1 
HETATM 2171 O  O   . HOH E 5 .   ? 26.297  -9.552  19.291  1.00 12.19 ? 311 HOH A O   1 
HETATM 2172 O  O   . HOH E 5 .   ? 12.957  6.739   -8.281  1.00 23.20 ? 312 HOH A O   1 
HETATM 2173 O  O   . HOH E 5 .   ? -2.032  28.080  1.384   1.00 15.93 ? 313 HOH A O   1 
HETATM 2174 O  O   . HOH E 5 .   ? 20.712  10.265  10.957  1.00 20.80 ? 314 HOH A O   1 
HETATM 2175 O  O   . HOH E 5 .   ? -6.253  -4.086  23.679  1.00 8.00  ? 315 HOH A O   1 
HETATM 2176 O  O   . HOH E 5 .   ? 16.730  10.210  13.006  1.00 9.58  ? 316 HOH A O   1 
HETATM 2177 O  O   . HOH E 5 .   ? 5.230   26.887  -14.257 1.00 16.05 ? 317 HOH A O   1 
HETATM 2178 O  O   . HOH E 5 .   ? -6.082  -8.905  16.528  1.00 14.23 ? 318 HOH A O   1 
HETATM 2179 O  O   . HOH E 5 .   ? -2.384  1.517   -5.561  1.00 16.84 ? 319 HOH A O   1 
HETATM 2180 O  O   . HOH E 5 .   ? 7.719   26.026  -14.689 1.00 15.63 ? 320 HOH A O   1 
HETATM 2181 O  O   . HOH E 5 .   ? 12.874  -15.912 30.561  1.00 17.64 ? 321 HOH A O   1 
HETATM 2182 O  O   . HOH E 5 .   ? -0.931  13.636  22.244  1.00 8.06  ? 322 HOH A O   1 
HETATM 2183 O  O   . HOH E 5 .   ? 5.537   6.047   -17.354 1.00 11.03 ? 323 HOH A O   1 
HETATM 2184 O  O   . HOH E 5 .   ? -3.340  -6.102  29.555  1.00 14.64 ? 324 HOH A O   1 
HETATM 2185 O  O   . HOH E 5 .   ? 2.127   8.639   17.581  1.00 5.20  ? 325 HOH A O   1 
HETATM 2186 O  O   . HOH E 5 .   ? -6.557  6.429   13.038  1.00 23.34 ? 326 HOH A O   1 
HETATM 2187 O  O   . HOH E 5 .   ? -9.421  20.232  3.135   1.00 39.52 ? 327 HOH A O   1 
HETATM 2188 O  O   . HOH E 5 .   ? -6.808  18.444  6.498   1.00 15.57 ? 328 HOH A O   1 
HETATM 2189 O  O   . HOH E 5 .   ? 23.765  1.527   23.844  1.00 12.74 ? 329 HOH A O   1 
HETATM 2190 O  O   . HOH E 5 .   ? 1.462   3.695   -1.217  1.00 8.34  ? 330 HOH A O   1 
HETATM 2191 O  O   . HOH E 5 .   ? 6.112   28.639  -11.167 1.00 14.03 ? 331 HOH A O   1 
HETATM 2192 O  O   . HOH E 5 .   ? 21.166  0.175   14.400  1.00 7.12  ? 332 HOH A O   1 
HETATM 2193 O  O   . HOH E 5 .   ? 11.712  2.663   34.498  1.00 19.46 ? 333 HOH A O   1 
HETATM 2194 O  O   . HOH E 5 .   ? 12.066  14.123  12.550  1.00 4.96  ? 334 HOH A O   1 
HETATM 2195 O  O   . HOH E 5 .   ? 6.790   26.732  -8.231  1.00 10.48 ? 335 HOH A O   1 
HETATM 2196 O  O   . HOH E 5 .   ? 10.171  13.335  -16.709 1.00 14.99 ? 336 HOH A O   1 
HETATM 2197 O  O   . HOH E 5 .   ? 2.503   28.358  -9.010  1.00 20.17 ? 337 HOH A O   1 
HETATM 2198 O  O   . HOH E 5 .   ? 5.879   -2.916  -0.180  1.00 12.52 ? 338 HOH A O   1 
HETATM 2199 O  O   . HOH E 5 .   ? 4.661   -5.157  -0.729  1.00 16.37 ? 339 HOH A O   1 
HETATM 2200 O  O   . HOH E 5 .   ? -2.739  11.642  22.217  1.00 9.29  ? 340 HOH A O   1 
HETATM 2201 O  O   . HOH E 5 .   ? 14.496  20.400  6.420   1.00 24.41 ? 341 HOH A O   1 
HETATM 2202 O  O   . HOH E 5 .   ? 15.003  -10.228 30.968  1.00 7.87  ? 342 HOH A O   1 
HETATM 2203 O  O   . HOH E 5 .   ? 10.485  -14.011 29.924  1.00 9.11  ? 343 HOH A O   1 
HETATM 2204 O  O   . HOH E 5 .   ? -5.781  -6.428  24.938  1.00 8.44  ? 344 HOH A O   1 
HETATM 2205 O  O   . HOH E 5 .   ? 21.159  -9.512  21.182  1.00 8.37  ? 345 HOH A O   1 
HETATM 2206 O  O   . HOH E 5 .   ? -5.067  4.045   17.683  1.00 8.63  ? 346 HOH A O   1 
HETATM 2207 O  O   . HOH E 5 .   ? 25.797  -2.735  25.472  1.00 8.20  ? 347 HOH A O   1 
HETATM 2208 O  O   . HOH E 5 .   ? -2.350  2.245   8.668   1.00 6.58  ? 348 HOH A O   1 
HETATM 2209 O  O   . HOH E 5 .   ? 4.492   17.408  20.711  1.00 10.48 ? 349 HOH A O   1 
HETATM 2210 O  O   . HOH E 5 .   ? -3.009  -2.201  9.083   1.00 13.88 ? 350 HOH A O   1 
HETATM 2211 O  O   . HOH E 5 .   ? 8.713   16.790  26.171  1.00 11.63 ? 351 HOH A O   1 
HETATM 2212 O  O   . HOH E 5 .   ? -2.234  9.202   17.827  1.00 10.51 ? 352 HOH A O   1 
HETATM 2213 O  O   . HOH E 5 .   ? 12.769  -7.435  14.342  1.00 6.37  ? 353 HOH A O   1 
HETATM 2214 O  O   . HOH E 5 .   ? -4.636  7.782   21.065  1.00 10.72 ? 354 HOH A O   1 
HETATM 2215 O  O   . HOH E 5 .   ? 6.746   19.234  14.611  1.00 11.04 ? 355 HOH A O   1 
HETATM 2216 O  O   . HOH E 5 .   ? 7.826   -12.081 17.537  1.00 20.29 ? 356 HOH A O   1 
HETATM 2217 O  O   . HOH E 5 .   ? 8.663   14.682  27.811  1.00 13.18 ? 357 HOH A O   1 
HETATM 2218 O  O   . HOH E 5 .   ? 9.954   8.517   32.014  1.00 10.26 ? 358 HOH A O   1 
HETATM 2219 O  O   . HOH E 5 .   ? 25.711  -0.022  25.041  1.00 11.19 ? 359 HOH A O   1 
HETATM 2220 O  O   . HOH E 5 .   ? -4.446  7.190   14.404  1.00 16.10 ? 360 HOH A O   1 
HETATM 2221 O  O   . HOH E 5 .   ? 8.349   16.176  18.698  1.00 9.97  ? 361 HOH A O   1 
HETATM 2222 O  O   . HOH E 5 .   ? 12.231  0.696   5.412   1.00 12.21 ? 362 HOH A O   1 
HETATM 2223 O  O   . HOH E 5 .   ? -5.434  1.050   23.999  1.00 18.82 ? 363 HOH A O   1 
HETATM 2224 O  O   . HOH E 5 .   ? 3.357   15.482  32.412  1.00 11.93 ? 364 HOH A O   1 
HETATM 2225 O  O   . HOH E 5 .   ? 7.865   -2.974  10.773  1.00 13.35 ? 365 HOH A O   1 
HETATM 2226 O  O   . HOH E 5 .   ? 18.907  -4.988  33.223  1.00 9.70  ? 366 HOH A O   1 
HETATM 2227 O  O   . HOH E 5 .   ? 14.366  6.509   6.961   1.00 19.52 ? 367 HOH A O   1 
HETATM 2228 O  O   . HOH E 5 .   ? 5.679   17.740  16.444  1.00 9.85  ? 368 HOH A O   1 
HETATM 2229 O  O   . HOH E 5 .   ? -4.330  4.310   15.137  1.00 11.54 ? 369 HOH A O   1 
HETATM 2230 O  O   . HOH E 5 .   ? 3.071   18.991  19.301  1.00 7.94  ? 370 HOH A O   1 
HETATM 2231 O  O   . HOH E 5 .   ? -4.606  -4.224  13.549  1.00 15.09 ? 371 HOH A O   1 
HETATM 2232 O  O   . HOH E 5 .   ? -8.084  12.779  9.732   1.00 12.03 ? 372 HOH A O   1 
HETATM 2233 O  O   . HOH E 5 .   ? 10.021  7.997   -2.230  1.00 12.48 ? 373 HOH A O   1 
HETATM 2234 O  O   . HOH E 5 .   ? 4.343   27.093  -7.347  1.00 15.27 ? 374 HOH A O   1 
HETATM 2235 O  O   . HOH E 5 .   ? 8.185   21.871  -19.809 1.00 13.73 ? 375 HOH A O   1 
HETATM 2236 O  O   . HOH E 5 .   ? 3.005   15.536  17.724  1.00 10.24 ? 376 HOH A O   1 
HETATM 2237 O  O   . HOH E 5 .   ? 10.467  3.958   32.710  1.00 16.67 ? 377 HOH A O   1 
HETATM 2238 O  O   . HOH E 5 .   ? 16.458  18.368  10.757  1.00 15.37 ? 378 HOH A O   1 
HETATM 2239 O  O   . HOH E 5 .   ? -0.374  19.147  18.177  1.00 17.77 ? 379 HOH A O   1 
HETATM 2240 O  O   . HOH E 5 .   ? 24.398  -0.822  29.019  1.00 11.39 ? 380 HOH A O   1 
HETATM 2241 O  O   . HOH E 5 .   ? 2.807   1.488   32.560  1.00 14.51 ? 381 HOH A O   1 
HETATM 2242 O  O   . HOH E 5 .   ? 3.459   22.155  13.606  1.00 21.37 ? 382 HOH A O   1 
HETATM 2243 O  O   . HOH E 5 .   ? 7.402   13.601  -17.699 1.00 14.49 ? 383 HOH A O   1 
HETATM 2244 O  O   . HOH E 5 .   ? 3.238   24.234  -13.913 1.00 17.91 ? 384 HOH A O   1 
HETATM 2245 O  O   . HOH E 5 .   ? 12.772  18.996  -14.607 1.00 17.46 ? 385 HOH A O   1 
HETATM 2246 O  O   . HOH E 5 .   ? 25.557  0.962   27.450  1.00 16.65 ? 386 HOH A O   1 
HETATM 2247 O  O   . HOH E 5 .   ? 6.279   3.438   -18.079 1.00 19.44 ? 387 HOH A O   1 
HETATM 2248 O  O   . HOH E 5 .   ? -2.593  9.863   29.207  1.00 13.70 ? 388 HOH A O   1 
HETATM 2249 O  O   . HOH E 5 .   ? -4.721  0.424   -6.415  1.00 17.94 ? 389 HOH A O   1 
HETATM 2250 O  O   . HOH E 5 .   ? -0.919  4.943   -14.661 1.00 24.01 ? 390 HOH A O   1 
HETATM 2251 O  O   . HOH E 5 .   ? 18.580  -10.054 13.525  1.00 15.64 ? 391 HOH A O   1 
HETATM 2252 O  O   . HOH E 5 .   ? 13.680  16.963  15.933  1.00 23.55 ? 392 HOH A O   1 
HETATM 2253 O  O   . HOH E 5 .   ? 19.765  6.847   22.093  1.00 11.44 ? 393 HOH A O   1 
HETATM 2254 O  O   . HOH E 5 .   ? 7.753   4.282   36.097  1.00 19.40 ? 394 HOH A O   1 
HETATM 2255 O  O   . HOH E 5 .   ? -0.054  28.919  9.057   1.00 21.19 ? 395 HOH A O   1 
HETATM 2256 O  O   . HOH E 5 .   ? 4.428   31.623  7.686   1.00 22.60 ? 396 HOH A O   1 
HETATM 2257 O  O   . HOH E 5 .   ? 18.958  11.921  20.316  1.00 15.02 ? 397 HOH A O   1 
HETATM 2258 O  O   . HOH E 5 .   ? -0.677  -7.069  30.502  1.00 13.11 ? 398 HOH A O   1 
HETATM 2259 O  O   . HOH E 5 .   ? -2.794  21.393  12.565  1.00 14.64 ? 399 HOH A O   1 
HETATM 2260 O  O   . HOH E 5 .   ? 7.346   -12.557 24.228  1.00 18.02 ? 400 HOH A O   1 
HETATM 2261 O  O   . HOH E 5 .   ? 22.661  5.393   23.840  1.00 21.63 ? 401 HOH A O   1 
HETATM 2262 O  O   . HOH E 5 .   ? 5.825   30.610  -9.125  1.00 15.10 ? 402 HOH A O   1 
HETATM 2263 O  O   . HOH E 5 .   ? 12.437  16.506  -15.409 1.00 12.43 ? 403 HOH A O   1 
HETATM 2264 O  O   . HOH E 5 .   ? 26.228  -5.628  29.032  1.00 13.74 ? 404 HOH A O   1 
HETATM 2265 O  O   . HOH E 5 .   ? 5.309   21.872  -18.203 1.00 16.98 ? 405 HOH A O   1 
HETATM 2266 O  O   . HOH E 5 .   ? -1.965  27.377  10.287  1.00 19.05 ? 406 HOH A O   1 
HETATM 2267 O  O   . HOH E 5 .   ? 19.148  15.333  4.092   1.00 16.12 ? 407 HOH A O   1 
HETATM 2268 O  O   . HOH E 5 .   ? 5.031   22.467  -15.259 1.00 12.41 ? 408 HOH A O   1 
HETATM 2269 O  O   . HOH E 5 .   ? -6.543  22.875  3.709   1.00 14.64 ? 409 HOH A O   1 
HETATM 2270 O  O   . HOH E 5 .   ? 15.436  15.697  24.223  1.00 16.16 ? 410 HOH A O   1 
HETATM 2271 O  O   . HOH E 5 .   ? 13.801  16.252  -12.239 1.00 16.76 ? 411 HOH A O   1 
HETATM 2272 O  O   . HOH E 5 .   ? -12.080 9.267   0.189   1.00 15.88 ? 412 HOH A O   1 
HETATM 2273 O  O   . HOH E 5 .   ? -5.727  2.068   13.862  1.00 16.64 ? 413 HOH A O   1 
HETATM 2274 O  O   . HOH E 5 .   ? 10.718  1.637   -1.671  1.00 18.72 ? 414 HOH A O   1 
HETATM 2275 O  O   . HOH E 5 .   ? -7.087  2.265   18.211  1.00 17.29 ? 415 HOH A O   1 
HETATM 2276 O  O   . HOH E 5 .   ? 12.101  6.862   6.267   1.00 22.97 ? 416 HOH A O   1 
HETATM 2277 O  O   . HOH E 5 .   ? 8.778   1.660   0.472   1.00 11.86 ? 417 HOH A O   1 
HETATM 2278 O  O   . HOH E 5 .   ? -5.303  -7.225  27.570  1.00 14.85 ? 418 HOH A O   1 
HETATM 2279 O  O   . HOH E 5 .   ? 28.216  -13.718 22.374  1.00 19.71 ? 419 HOH A O   1 
HETATM 2280 O  O   . HOH E 5 .   ? 7.721   3.871   32.197  1.00 17.02 ? 420 HOH A O   1 
HETATM 2281 O  O   . HOH E 5 .   ? 3.083   -1.267  37.811  1.00 17.97 ? 421 HOH A O   1 
HETATM 2282 O  O   . HOH E 5 .   ? 12.887  19.778  -10.645 1.00 11.60 ? 422 HOH A O   1 
HETATM 2283 O  O   . HOH E 5 .   ? -3.126  -8.715  18.999  1.00 14.87 ? 423 HOH A O   1 
HETATM 2284 O  O   . HOH E 5 .   ? -5.497  6.409   18.981  1.00 10.00 ? 424 HOH A O   1 
HETATM 2285 O  O   . HOH E 5 .   ? -2.225  17.682  19.323  1.00 15.61 ? 425 HOH A O   1 
HETATM 2286 O  O   . HOH E 5 .   ? -9.263  12.261  11.860  1.00 25.64 ? 426 HOH A O   1 
HETATM 2287 O  O   . HOH E 5 .   ? 1.233   13.586  32.817  1.00 17.43 ? 427 HOH A O   1 
HETATM 2288 O  O   . HOH E 5 .   ? -7.083  -1.450  9.937   1.00 19.07 ? 428 HOH A O   1 
HETATM 2289 O  O   . HOH E 5 .   ? 1.470   22.293  -13.523 1.00 16.96 ? 429 HOH A O   1 
HETATM 2290 O  O   . HOH E 5 .   ? -2.648  0.171   10.151  1.00 16.08 ? 430 HOH A O   1 
HETATM 2291 O  O   . HOH E 5 .   ? 18.645  13.038  13.885  1.00 15.03 ? 431 HOH A O   1 
HETATM 2292 O  O   . HOH E 5 .   ? 0.253   2.195   -13.839 1.00 21.45 ? 432 HOH A O   1 
HETATM 2293 O  O   . HOH E 5 .   ? -3.309  31.971  9.695   1.00 21.69 ? 433 HOH A O   1 
HETATM 2294 O  O   . HOH E 5 .   ? -1.450  3.721   -12.383 1.00 17.49 ? 434 HOH A O   1 
HETATM 2295 O  O   . HOH E 5 .   ? 26.075  -2.992  28.191  1.00 17.38 ? 435 HOH A O   1 
HETATM 2296 O  O   . HOH E 5 .   ? 8.711   -0.617  2.460   1.00 18.12 ? 436 HOH A O   1 
HETATM 2297 O  O   . HOH E 5 .   ? -9.465  14.792  8.510   1.00 19.26 ? 437 HOH A O   1 
HETATM 2298 O  O   . HOH E 5 .   ? 6.744   25.366  8.850   1.00 12.65 ? 438 HOH A O   1 
HETATM 2299 O  O   . HOH E 5 .   ? -4.768  14.538  16.855  1.00 14.39 ? 439 HOH A O   1 
HETATM 2300 O  O   . HOH E 5 .   ? 5.197   21.278  15.411  1.00 19.41 ? 440 HOH A O   1 
HETATM 2301 O  O   . HOH E 5 .   ? 20.889  6.506   15.937  1.00 14.19 ? 441 HOH A O   1 
HETATM 2302 O  O   . HOH E 5 .   ? -3.501  10.152  20.168  1.00 9.93  ? 442 HOH A O   1 
HETATM 2303 O  O   . HOH E 5 .   ? 7.169   1.375   32.489  1.00 13.28 ? 443 HOH A O   1 
HETATM 2304 O  O   . HOH E 5 .   ? 18.562  -10.946 20.665  1.00 19.04 ? 444 HOH A O   1 
HETATM 2305 O  O   . HOH E 5 .   ? 5.040   1.841   30.919  1.00 10.88 ? 445 HOH A O   1 
HETATM 2306 O  O   . HOH E 5 .   ? -3.916  9.937   -9.935  1.00 16.75 ? 446 HOH A O   1 
HETATM 2307 O  O   . HOH E 5 .   ? 24.767  1.705   30.896  1.00 23.16 ? 447 HOH A O   1 
HETATM 2308 O  O   . HOH E 5 .   ? 14.317  -0.778  6.551   1.00 20.58 ? 448 HOH A O   1 
HETATM 2309 O  O   . HOH E 5 .   ? 22.079  -1.997  8.273   1.00 19.66 ? 449 HOH A O   1 
HETATM 2310 O  O   . HOH E 5 .   ? 1.257   3.756   32.848  1.00 19.47 ? 450 HOH A O   1 
HETATM 2311 O  O   . HOH E 5 .   ? 16.557  3.775   -17.182 1.00 26.33 ? 451 HOH A O   1 
HETATM 2312 O  O   . HOH E 5 .   ? 1.146   -8.900  15.696  1.00 15.91 ? 452 HOH A O   1 
HETATM 2313 O  O   . HOH E 5 .   ? -4.360  8.340   16.906  1.00 14.90 ? 453 HOH A O   1 
HETATM 2314 O  O   . HOH E 5 .   ? -4.936  24.360  5.191   1.00 15.20 ? 454 HOH A O   1 
HETATM 2315 O  O   . HOH E 5 .   ? -4.109  24.396  -10.031 1.00 17.36 ? 455 HOH A O   1 
HETATM 2316 O  O   . HOH E 5 .   ? 21.859  5.216   18.048  1.00 18.08 ? 456 HOH A O   1 
HETATM 2317 O  O   . HOH E 5 .   ? 10.511  5.419   -11.068 1.00 27.48 ? 457 HOH A O   1 
HETATM 2318 O  O   . HOH E 5 .   ? 23.199  0.190   15.761  1.00 19.00 ? 458 HOH A O   1 
HETATM 2319 O  O   . HOH E 5 .   ? 21.019  5.675   9.974   1.00 15.58 ? 459 HOH A O   1 
HETATM 2320 O  O   . HOH E 5 .   ? -5.249  1.322   -3.079  1.00 27.99 ? 460 HOH A O   1 
HETATM 2321 O  O   . HOH E 5 .   ? 14.741  16.154  -9.736  1.00 21.54 ? 461 HOH A O   1 
HETATM 2322 O  O   . HOH E 5 .   ? 22.748  -4.350  34.850  1.00 26.80 ? 462 HOH A O   1 
HETATM 2323 O  O   . HOH E 5 .   ? 7.497   19.523  -21.433 1.00 18.76 ? 463 HOH A O   1 
HETATM 2324 O  O   . HOH E 5 .   ? -2.332  15.946  21.768  1.00 14.37 ? 464 HOH A O   1 
HETATM 2325 O  O   . HOH E 5 .   ? -4.023  2.864   25.647  1.00 18.80 ? 465 HOH A O   1 
HETATM 2326 O  O   . HOH E 5 .   ? 6.802   -0.945  -15.832 1.00 22.96 ? 466 HOH A O   1 
HETATM 2327 O  O   . HOH E 5 .   ? 21.277  9.884   3.160   1.00 25.56 ? 467 HOH A O   1 
HETATM 2328 O  O   . HOH E 5 .   ? 27.882  -1.588  13.588  1.00 14.89 ? 468 HOH A O   1 
HETATM 2329 O  O   . HOH E 5 .   ? 15.477  -11.819 15.771  1.00 29.06 ? 469 HOH A O   1 
HETATM 2330 O  O   . HOH E 5 .   ? -7.201  3.255   23.181  1.00 22.93 ? 470 HOH A O   1 
HETATM 2331 O  O   . HOH E 5 .   ? 3.008   -15.470 31.896  1.00 28.62 ? 471 HOH A O   1 
HETATM 2332 O  O   . HOH E 5 .   ? -7.364  16.548  14.432  1.00 25.09 ? 472 HOH A O   1 
HETATM 2333 O  O   . HOH E 5 .   ? 7.128   16.378  -17.435 1.00 17.43 ? 473 HOH A O   1 
HETATM 2334 O  O   . HOH E 5 .   ? -13.119 3.761   7.596   1.00 30.25 ? 474 HOH A O   1 
HETATM 2335 O  O   . HOH E 5 .   ? 6.520   18.147  19.108  1.00 22.87 ? 475 HOH A O   1 
HETATM 2336 O  O   . HOH E 5 .   ? 11.092  -0.951  3.855   1.00 14.35 ? 476 HOH A O   1 
HETATM 2337 O  O   . HOH E 5 .   ? 1.563   19.864  -12.532 1.00 20.63 ? 477 HOH A O   1 
HETATM 2338 O  O   . HOH E 5 .   ? 20.790  7.101   24.332  1.00 22.29 ? 478 HOH A O   1 
HETATM 2339 O  O   . HOH E 5 .   ? -4.360  17.013  17.971  1.00 19.66 ? 479 HOH A O   1 
HETATM 2340 O  O   . HOH E 5 .   ? 12.656  16.396  -8.258  1.00 17.06 ? 480 HOH A O   1 
HETATM 2341 O  O   . HOH E 5 .   ? -3.205  25.134  3.594   1.00 27.33 ? 481 HOH A O   1 
HETATM 2342 O  O   . HOH E 5 .   ? -7.156  18.013  -14.191 1.00 36.21 ? 482 HOH A O   1 
HETATM 2343 O  O   . HOH E 5 .   ? 1.263   1.644   36.849  1.00 24.82 ? 483 HOH A O   1 
HETATM 2344 O  O   . HOH E 5 .   ? 18.680  14.332  -2.744  1.00 25.58 ? 484 HOH A O   1 
HETATM 2345 O  O   . HOH E 5 .   ? -3.624  23.546  11.213  1.00 23.02 ? 485 HOH A O   1 
HETATM 2346 O  O   . HOH E 5 .   ? 13.959  26.320  -12.981 1.00 15.60 ? 486 HOH A O   1 
HETATM 2347 O  O   . HOH E 5 .   ? -1.817  15.586  25.857  1.00 18.97 ? 487 HOH A O   1 
HETATM 2348 O  O   . HOH E 5 .   ? 7.727   -13.849 19.617  1.00 33.57 ? 488 HOH A O   1 
HETATM 2349 O  O   . HOH E 5 .   ? 7.093   16.174  35.407  1.00 16.21 ? 489 HOH A O   1 
HETATM 2350 O  O   . HOH E 5 .   ? 11.510  14.906  -18.521 1.00 16.36 ? 490 HOH A O   1 
HETATM 2351 O  O   . HOH E 5 .   ? 15.736  14.234  -18.238 1.00 27.08 ? 491 HOH A O   1 
HETATM 2352 O  O   . HOH E 5 .   ? -1.158  23.421  -13.498 1.00 20.72 ? 492 HOH A O   1 
HETATM 2353 O  O   . HOH E 5 .   ? 13.498  8.427   31.003  1.00 15.67 ? 493 HOH A O   1 
HETATM 2354 O  O   . HOH E 5 .   ? -1.850  22.557  15.195  1.00 19.27 ? 494 HOH A O   1 
HETATM 2355 O  O   . HOH E 5 .   ? 7.472   17.224  -19.864 1.00 14.51 ? 495 HOH A O   1 
HETATM 2356 O  O   . HOH E 5 .   ? 4.561   19.253  -15.682 1.00 18.54 ? 496 HOH A O   1 
HETATM 2357 O  O   . HOH E 5 .   ? -2.184  9.675   -16.202 1.00 19.71 ? 497 HOH A O   1 
HETATM 2358 O  O   . HOH E 5 .   ? 2.230   -9.592  36.011  1.00 23.99 ? 498 HOH A O   1 
HETATM 2359 O  O   . HOH E 5 .   ? -6.421  25.224  -10.926 1.00 29.18 ? 499 HOH A O   1 
HETATM 2360 O  O   . HOH E 5 .   ? -9.263  25.819  -11.700 1.00 16.88 ? 500 HOH A O   1 
HETATM 2361 O  O   . HOH E 5 .   ? -8.718  27.185  -7.877  1.00 29.99 ? 501 HOH A O   1 
HETATM 2362 O  O   . HOH E 5 .   ? -7.703  27.660  -10.035 1.00 22.14 ? 502 HOH A O   1 
HETATM 2363 O  O   . HOH E 5 .   ? 15.098  14.585  27.005  1.00 20.50 ? 503 HOH A O   1 
HETATM 2364 O  O   . HOH E 5 .   ? 7.799   35.002  2.723   1.00 14.13 ? 504 HOH A O   1 
HETATM 2365 O  O   . HOH E 5 .   ? 0.932   21.946  15.702  1.00 13.19 ? 505 HOH A O   1 
HETATM 2366 O  O   . HOH E 5 .   ? 10.900  6.462   33.884  1.00 10.97 ? 506 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  TRP 16  16  16  TRP TRP A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  MET 19  19  19  MET MET A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  TRP 81  81  81  TRP TRP A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 TRP 175 175 175 TRP TRP A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 LYS 179 179 179 LYS LYS A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 GLN 189 189 189 GLN GLN A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 MET 204 204 204 MET MET A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 MET 206 206 206 MET MET A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 VAL 221 221 221 VAL VAL A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 ILE 229 229 229 ILE ILE A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 GLN 240 240 240 GLN GLN A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 THR 255 255 255 THR THR A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 MET 260 260 260 MET MET A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 ASP 262 262 262 ASP ASP A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 LYS 274 274 274 LYS LYS A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 ASP 282 282 282 ASP ASP A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   289 1   ZN  ZN  A . 
C 3 SO4 1   290 2   SO4 SO4 A . 
D 4 ALL 1   291 1   ALL ALL A . 
E 5 HOH 1   292 1   HOH HOH A . 
E 5 HOH 2   293 2   HOH HOH A . 
E 5 HOH 3   294 3   HOH HOH A . 
E 5 HOH 4   295 4   HOH HOH A . 
E 5 HOH 5   296 5   HOH HOH A . 
E 5 HOH 6   297 6   HOH HOH A . 
E 5 HOH 7   298 7   HOH HOH A . 
E 5 HOH 8   299 8   HOH HOH A . 
E 5 HOH 9   300 9   HOH HOH A . 
E 5 HOH 10  301 10  HOH HOH A . 
E 5 HOH 11  302 11  HOH HOH A . 
E 5 HOH 12  303 12  HOH HOH A . 
E 5 HOH 13  304 13  HOH HOH A . 
E 5 HOH 14  305 14  HOH HOH A . 
E 5 HOH 15  306 15  HOH HOH A . 
E 5 HOH 16  307 16  HOH HOH A . 
E 5 HOH 17  308 17  HOH HOH A . 
E 5 HOH 18  309 18  HOH HOH A . 
E 5 HOH 19  310 19  HOH HOH A . 
E 5 HOH 20  311 20  HOH HOH A . 
E 5 HOH 21  312 21  HOH HOH A . 
E 5 HOH 22  313 22  HOH HOH A . 
E 5 HOH 23  314 23  HOH HOH A . 
E 5 HOH 24  315 24  HOH HOH A . 
E 5 HOH 25  316 25  HOH HOH A . 
E 5 HOH 26  317 26  HOH HOH A . 
E 5 HOH 27  318 27  HOH HOH A . 
E 5 HOH 28  319 28  HOH HOH A . 
E 5 HOH 29  320 29  HOH HOH A . 
E 5 HOH 30  321 30  HOH HOH A . 
E 5 HOH 31  322 31  HOH HOH A . 
E 5 HOH 32  323 32  HOH HOH A . 
E 5 HOH 33  324 33  HOH HOH A . 
E 5 HOH 34  325 34  HOH HOH A . 
E 5 HOH 35  326 35  HOH HOH A . 
E 5 HOH 36  327 36  HOH HOH A . 
E 5 HOH 37  328 37  HOH HOH A . 
E 5 HOH 38  329 38  HOH HOH A . 
E 5 HOH 39  330 39  HOH HOH A . 
E 5 HOH 40  331 40  HOH HOH A . 
E 5 HOH 41  332 41  HOH HOH A . 
E 5 HOH 42  333 42  HOH HOH A . 
E 5 HOH 43  334 43  HOH HOH A . 
E 5 HOH 44  335 44  HOH HOH A . 
E 5 HOH 45  336 45  HOH HOH A . 
E 5 HOH 46  337 46  HOH HOH A . 
E 5 HOH 47  338 47  HOH HOH A . 
E 5 HOH 48  339 48  HOH HOH A . 
E 5 HOH 49  340 49  HOH HOH A . 
E 5 HOH 50  341 50  HOH HOH A . 
E 5 HOH 51  342 51  HOH HOH A . 
E 5 HOH 52  343 52  HOH HOH A . 
E 5 HOH 53  344 53  HOH HOH A . 
E 5 HOH 54  345 54  HOH HOH A . 
E 5 HOH 55  346 55  HOH HOH A . 
E 5 HOH 56  347 56  HOH HOH A . 
E 5 HOH 57  348 57  HOH HOH A . 
E 5 HOH 58  349 58  HOH HOH A . 
E 5 HOH 59  350 59  HOH HOH A . 
E 5 HOH 60  351 60  HOH HOH A . 
E 5 HOH 61  352 61  HOH HOH A . 
E 5 HOH 62  353 62  HOH HOH A . 
E 5 HOH 63  354 63  HOH HOH A . 
E 5 HOH 64  355 64  HOH HOH A . 
E 5 HOH 65  356 65  HOH HOH A . 
E 5 HOH 66  357 66  HOH HOH A . 
E 5 HOH 67  358 67  HOH HOH A . 
E 5 HOH 68  359 68  HOH HOH A . 
E 5 HOH 69  360 69  HOH HOH A . 
E 5 HOH 70  361 70  HOH HOH A . 
E 5 HOH 71  362 71  HOH HOH A . 
E 5 HOH 72  363 72  HOH HOH A . 
E 5 HOH 73  364 73  HOH HOH A . 
E 5 HOH 74  365 74  HOH HOH A . 
E 5 HOH 75  366 75  HOH HOH A . 
E 5 HOH 76  367 76  HOH HOH A . 
E 5 HOH 77  368 77  HOH HOH A . 
E 5 HOH 78  369 78  HOH HOH A . 
E 5 HOH 79  370 79  HOH HOH A . 
E 5 HOH 80  371 80  HOH HOH A . 
E 5 HOH 81  372 81  HOH HOH A . 
E 5 HOH 82  373 82  HOH HOH A . 
E 5 HOH 83  374 83  HOH HOH A . 
E 5 HOH 84  375 84  HOH HOH A . 
E 5 HOH 85  376 85  HOH HOH A . 
E 5 HOH 86  377 86  HOH HOH A . 
E 5 HOH 87  378 87  HOH HOH A . 
E 5 HOH 88  379 88  HOH HOH A . 
E 5 HOH 89  380 89  HOH HOH A . 
E 5 HOH 90  381 90  HOH HOH A . 
E 5 HOH 91  382 91  HOH HOH A . 
E 5 HOH 92  383 92  HOH HOH A . 
E 5 HOH 93  384 93  HOH HOH A . 
E 5 HOH 94  385 94  HOH HOH A . 
E 5 HOH 95  386 95  HOH HOH A . 
E 5 HOH 96  387 96  HOH HOH A . 
E 5 HOH 97  388 97  HOH HOH A . 
E 5 HOH 98  389 98  HOH HOH A . 
E 5 HOH 99  390 99  HOH HOH A . 
E 5 HOH 100 391 100 HOH HOH A . 
E 5 HOH 101 392 101 HOH HOH A . 
E 5 HOH 102 393 102 HOH HOH A . 
E 5 HOH 103 394 103 HOH HOH A . 
E 5 HOH 104 395 104 HOH HOH A . 
E 5 HOH 105 396 105 HOH HOH A . 
E 5 HOH 106 397 106 HOH HOH A . 
E 5 HOH 107 398 107 HOH HOH A . 
E 5 HOH 108 399 108 HOH HOH A . 
E 5 HOH 109 400 109 HOH HOH A . 
E 5 HOH 110 401 110 HOH HOH A . 
E 5 HOH 111 402 111 HOH HOH A . 
E 5 HOH 112 403 112 HOH HOH A . 
E 5 HOH 113 404 113 HOH HOH A . 
E 5 HOH 114 405 114 HOH HOH A . 
E 5 HOH 115 406 115 HOH HOH A . 
E 5 HOH 116 407 116 HOH HOH A . 
E 5 HOH 117 408 117 HOH HOH A . 
E 5 HOH 118 409 118 HOH HOH A . 
E 5 HOH 119 410 119 HOH HOH A . 
E 5 HOH 120 411 120 HOH HOH A . 
E 5 HOH 121 412 121 HOH HOH A . 
E 5 HOH 122 413 122 HOH HOH A . 
E 5 HOH 123 414 123 HOH HOH A . 
E 5 HOH 124 415 124 HOH HOH A . 
E 5 HOH 125 416 125 HOH HOH A . 
E 5 HOH 126 417 126 HOH HOH A . 
E 5 HOH 127 418 127 HOH HOH A . 
E 5 HOH 128 419 128 HOH HOH A . 
E 5 HOH 129 420 129 HOH HOH A . 
E 5 HOH 130 421 130 HOH HOH A . 
E 5 HOH 131 422 131 HOH HOH A . 
E 5 HOH 132 423 132 HOH HOH A . 
E 5 HOH 133 424 133 HOH HOH A . 
E 5 HOH 134 425 134 HOH HOH A . 
E 5 HOH 135 426 135 HOH HOH A . 
E 5 HOH 136 427 136 HOH HOH A . 
E 5 HOH 137 428 137 HOH HOH A . 
E 5 HOH 138 429 138 HOH HOH A . 
E 5 HOH 139 430 139 HOH HOH A . 
E 5 HOH 140 431 140 HOH HOH A . 
E 5 HOH 141 432 141 HOH HOH A . 
E 5 HOH 142 433 142 HOH HOH A . 
E 5 HOH 143 434 143 HOH HOH A . 
E 5 HOH 144 435 144 HOH HOH A . 
E 5 HOH 145 436 145 HOH HOH A . 
E 5 HOH 146 437 146 HOH HOH A . 
E 5 HOH 147 438 147 HOH HOH A . 
E 5 HOH 148 439 148 HOH HOH A . 
E 5 HOH 149 440 149 HOH HOH A . 
E 5 HOH 150 441 150 HOH HOH A . 
E 5 HOH 151 442 151 HOH HOH A . 
E 5 HOH 152 443 152 HOH HOH A . 
E 5 HOH 153 444 153 HOH HOH A . 
E 5 HOH 154 445 154 HOH HOH A . 
E 5 HOH 155 446 155 HOH HOH A . 
E 5 HOH 156 447 156 HOH HOH A . 
E 5 HOH 157 448 157 HOH HOH A . 
E 5 HOH 158 449 158 HOH HOH A . 
E 5 HOH 159 450 159 HOH HOH A . 
E 5 HOH 160 451 160 HOH HOH A . 
E 5 HOH 161 452 161 HOH HOH A . 
E 5 HOH 162 453 162 HOH HOH A . 
E 5 HOH 163 454 163 HOH HOH A . 
E 5 HOH 164 455 164 HOH HOH A . 
E 5 HOH 165 456 165 HOH HOH A . 
E 5 HOH 166 457 166 HOH HOH A . 
E 5 HOH 167 458 167 HOH HOH A . 
E 5 HOH 168 459 168 HOH HOH A . 
E 5 HOH 169 460 169 HOH HOH A . 
E 5 HOH 170 461 170 HOH HOH A . 
E 5 HOH 171 462 171 HOH HOH A . 
E 5 HOH 172 463 172 HOH HOH A . 
E 5 HOH 173 464 173 HOH HOH A . 
E 5 HOH 174 465 174 HOH HOH A . 
E 5 HOH 175 466 175 HOH HOH A . 
E 5 HOH 176 467 176 HOH HOH A . 
E 5 HOH 177 468 177 HOH HOH A . 
E 5 HOH 178 469 178 HOH HOH A . 
E 5 HOH 179 470 179 HOH HOH A . 
E 5 HOH 180 471 180 HOH HOH A . 
E 5 HOH 181 472 181 HOH HOH A . 
E 5 HOH 182 473 182 HOH HOH A . 
E 5 HOH 183 474 183 HOH HOH A . 
E 5 HOH 184 475 184 HOH HOH A . 
E 5 HOH 185 476 185 HOH HOH A . 
E 5 HOH 186 477 186 HOH HOH A . 
E 5 HOH 187 478 187 HOH HOH A . 
E 5 HOH 188 479 188 HOH HOH A . 
E 5 HOH 189 480 189 HOH HOH A . 
E 5 HOH 190 481 190 HOH HOH A . 
E 5 HOH 191 482 191 HOH HOH A . 
E 5 HOH 192 483 192 HOH HOH A . 
E 5 HOH 193 484 193 HOH HOH A . 
E 5 HOH 194 485 194 HOH HOH A . 
E 5 HOH 195 486 195 HOH HOH A . 
E 5 HOH 196 487 196 HOH HOH A . 
E 5 HOH 197 488 197 HOH HOH A . 
E 5 HOH 198 489 198 HOH HOH A . 
E 5 HOH 199 490 200 HOH HOH A . 
E 5 HOH 200 491 201 HOH HOH A . 
E 5 HOH 201 492 202 HOH HOH A . 
E 5 HOH 202 493 203 HOH HOH A . 
E 5 HOH 203 494 204 HOH HOH A . 
E 5 HOH 204 495 205 HOH HOH A . 
E 5 HOH 205 496 206 HOH HOH A . 
E 5 HOH 206 497 207 HOH HOH A . 
E 5 HOH 207 498 208 HOH HOH A . 
E 5 HOH 208 499 209 HOH HOH A . 
E 5 HOH 209 500 210 HOH HOH A . 
E 5 HOH 210 501 211 HOH HOH A . 
E 5 HOH 211 502 212 HOH HOH A . 
E 5 HOH 212 503 213 HOH HOH A . 
E 5 HOH 213 504 214 HOH HOH A . 
E 5 HOH 214 505 215 HOH HOH A . 
E 5 HOH 215 506 216 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  N ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? A ALA 1 ? A ALA 1   ? 1_555 76.7  ? 
2  N ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 499 ? 1_555 115.9 ? 
3  O ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 499 ? 1_555 87.9  ? 
4  N ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 500 ? 1_555 102.1 ? 
5  O ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 500 ? 1_555 172.2 ? 
6  O ? E HOH . ? A HOH 499 ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 500 ? 1_555 85.7  ? 
7  N ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 85.3  ? 
8  O ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 69.9  ? 
9  O ? E HOH . ? A HOH 499 ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 145.4 ? 
10 O ? E HOH . ? A HOH 500 ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 117.8 ? 
11 N ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 502 ? 1_555 150.8 ? 
12 O ? A ALA 1 ? A ALA 1   ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 502 ? 1_555 99.2  ? 
13 O ? E HOH . ? A HOH 499 ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 502 ? 1_555 92.6  ? 
14 O ? E HOH . ? A HOH 500 ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 502 ? 1_555 85.7  ? 
15 O ? E HOH . ? A HOH 501 ? 1_555 ZN ? B ZN . ? A ZN 289 ? 1_555 O ? E HOH . ? A HOH 502 ? 1_555 66.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-02-16 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2017-11-15 
5 'Structure model' 2 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' atom_site                 
2 5 'Structure model' chem_comp                 
3 5 'Structure model' entity                    
4 5 'Structure model' pdbx_chem_comp_identifier 
5 5 'Structure model' pdbx_entity_nonpoly       
6 5 'Structure model' pdbx_struct_conn_angle    
7 5 'Structure model' struct_conn               
8 5 'Structure model' struct_site               
9 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                 
2  4 'Structure model' '_atom_site.Cartn_x'                        
3  4 'Structure model' '_atom_site.Cartn_y'                        
4  4 'Structure model' '_atom_site.Cartn_z'                        
5  4 'Structure model' '_atom_site.auth_atom_id'                   
6  4 'Structure model' '_atom_site.label_atom_id'                  
7  5 'Structure model' '_chem_comp.name'                           
8  5 'Structure model' '_chem_comp.type'                           
9  5 'Structure model' '_entity.pdbx_description'                  
10 5 'Structure model' '_pdbx_entity_nonpoly.name'                 
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 
13 5 'Structure model' '_pdbx_struct_conn_angle.value'             
14 5 'Structure model' '_struct_conn.pdbx_dist_value'              
15 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE  phasing          .         ? 1 
REFMAC refinement       .         ? 2 
DENZO  'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
_pdbx_entry_details.entry_id                 1RPJ 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;ZINC SULFATE WAS ESSENTIAL FOR CRYSTALLIZATION AND BOTH
ZINC AND SULFATE IONS COULD BE MODELLED IN THE DENSITY. THE
ZINC ION IS OBSERVED IN OCTAHEDRAL COORDINATION WOTH BOTH
AMINO AND CARBONYL GROUPS OF THE N-TERMINAL RESIDUE AND
FOUR WATER MOLECULES. THESE WATER MOLECULES MEDIATE
INTERACTIONS WITH THE SIDE CHAINS OF A SYMMETRY RELATED
MOLECULE.
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG A ARG 79  ? ? CD A ARG 79  ? ? NE  A ARG 79  ? ? 125.46 111.80 13.66 2.10 N 
2  1 CD A ARG 79  ? ? NE A ARG 79  ? ? CZ  A ARG 79  ? ? 140.70 123.60 17.10 1.40 N 
3  1 NE A ARG 79  ? ? CZ A ARG 79  ? ? NH1 A ARG 79  ? ? 124.89 120.30 4.59  0.50 N 
4  1 CB A ASP 95  ? ? CG A ASP 95  ? ? OD1 A ASP 95  ? ? 126.73 118.30 8.43  0.90 N 
5  1 CB A ASP 95  ? ? CG A ASP 95  ? ? OD2 A ASP 95  ? ? 110.70 118.30 -7.60 0.90 N 
6  1 CB A ASP 113 ? ? CG A ASP 113 ? ? OD1 A ASP 113 ? ? 126.50 118.30 8.20  0.90 N 
7  1 NE A ARG 151 ? ? CZ A ARG 151 ? ? NH2 A ARG 151 ? ? 116.49 120.30 -3.81 0.50 N 
8  1 NE A ARG 177 ? ? CZ A ARG 177 ? ? NH1 A ARG 177 ? ? 125.47 120.30 5.17  0.50 N 
9  1 CB A ASP 227 ? ? CG A ASP 227 ? ? OD1 A ASP 227 ? ? 112.85 118.30 -5.45 0.90 N 
10 1 CB A ASP 273 ? ? CG A ASP 273 ? ? OD2 A ASP 273 ? ? 112.28 118.30 -6.02 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 2   ? ? -65.35  -175.76 
2 1 ASP A 44  ? ? -93.50  48.67   
3 1 ASN A 59  ? ? -101.72 47.56   
4 1 ASP A 91  ? ? 74.19   -64.56  
5 1 ASP A 227 ? ? 127.57  -53.06  
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
ALL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DAllpb           
ALL 'COMMON NAME'                         GMML     1.0 b-D-allopyranose 
ALL 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Allp         
ALL 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 All              
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'          ZN  
3 'SULFATE ION'       SO4 
4 beta-D-allopyranose ALL 
5 water               HOH 
#