data_1RPU
# 
_entry.id   1RPU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RPU         
NDB   PR0109       
RCSB  RCSB020934   
WWPDB D_1000020934 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RPU 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vargason, J.M.' 1 
'Szittya, G.'    2 
'Burgyan, J.'    3 
'Hall, T.M.T.'   4 
# 
_citation.id                        primary 
_citation.title                     'Size selective recognition of siRNA by an RNA silencing suppressor' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            115 
_citation.page_first                799 
_citation.page_last                 811 
_citation.year                      2003 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14697199 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(03)00984-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vargason, J.M.' 1 
primary 'Szittya, G.'    2 
primary 'Burgyan, J.'    3 
primary 'Hall, T.M.T.'   4 
# 
_cell.entry_id           1RPU 
_cell.length_a           115.400 
_cell.length_b           115.400 
_cell.length_c           128.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RPU 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'" 6680.997  2   ? ? ? ? 
2 polymer man '19 kDa protein'                                                           19358.373 2   ? ? ? ? 
3 water   nat water                                                                      18.015    111 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no CGUACGCGUCACGCGUACGUU CGUACGCGUCACGCGUACGUU C,D ? 
2 'polypeptide(L)'   no no 
;MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
;
;MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   C   n 
1 2   G   n 
1 3   U   n 
1 4   A   n 
1 5   C   n 
1 6   G   n 
1 7   C   n 
1 8   G   n 
1 9   U   n 
1 10  C   n 
1 11  A   n 
1 12  C   n 
1 13  G   n 
1 14  C   n 
1 15  G   n 
1 16  U   n 
1 17  A   n 
1 18  C   n 
1 19  G   n 
1 20  U   n 
1 21  U   n 
2 1   MET n 
2 2   GLU n 
2 3   ARG n 
2 4   ALA n 
2 5   ILE n 
2 6   GLN n 
2 7   GLY n 
2 8   ASN n 
2 9   ASP n 
2 10  THR n 
2 11  ARG n 
2 12  GLU n 
2 13  GLN n 
2 14  ALA n 
2 15  ASN n 
2 16  GLY n 
2 17  GLU n 
2 18  ARG n 
2 19  TRP n 
2 20  ASP n 
2 21  GLY n 
2 22  GLY n 
2 23  SER n 
2 24  GLY n 
2 25  GLY n 
2 26  ILE n 
2 27  THR n 
2 28  SER n 
2 29  PRO n 
2 30  PHE n 
2 31  LYS n 
2 32  LEU n 
2 33  PRO n 
2 34  ASP n 
2 35  GLU n 
2 36  SER n 
2 37  PRO n 
2 38  SER n 
2 39  TRP n 
2 40  THR n 
2 41  GLU n 
2 42  TRP n 
2 43  ARG n 
2 44  LEU n 
2 45  TYR n 
2 46  ASN n 
2 47  ASP n 
2 48  GLU n 
2 49  THR n 
2 50  ASN n 
2 51  SER n 
2 52  ASN n 
2 53  GLN n 
2 54  ASP n 
2 55  ASN n 
2 56  PRO n 
2 57  LEU n 
2 58  GLY n 
2 59  PHE n 
2 60  LYS n 
2 61  GLU n 
2 62  SER n 
2 63  TRP n 
2 64  GLY n 
2 65  PHE n 
2 66  GLY n 
2 67  LYS n 
2 68  VAL n 
2 69  VAL n 
2 70  PHE n 
2 71  LYS n 
2 72  ARG n 
2 73  TYR n 
2 74  LEU n 
2 75  ARG n 
2 76  TYR n 
2 77  ASP n 
2 78  ARG n 
2 79  THR n 
2 80  GLU n 
2 81  ALA n 
2 82  SER n 
2 83  LEU n 
2 84  HIS n 
2 85  ARG n 
2 86  VAL n 
2 87  LEU n 
2 88  GLY n 
2 89  SER n 
2 90  TRP n 
2 91  THR n 
2 92  GLY n 
2 93  ASP n 
2 94  SER n 
2 95  VAL n 
2 96  ASN n 
2 97  TYR n 
2 98  ALA n 
2 99  ALA n 
2 100 SER n 
2 101 ARG n 
2 102 PHE n 
2 103 LEU n 
2 104 GLY n 
2 105 ALA n 
2 106 ASN n 
2 107 GLN n 
2 108 VAL n 
2 109 GLY n 
2 110 CYS n 
2 111 THR n 
2 112 TYR n 
2 113 SER n 
2 114 ILE n 
2 115 ARG n 
2 116 PHE n 
2 117 ARG n 
2 118 GLY n 
2 119 VAL n 
2 120 SER n 
2 121 VAL n 
2 122 THR n 
2 123 ILE n 
2 124 SER n 
2 125 GLY n 
2 126 GLY n 
2 127 SER n 
2 128 ARG n 
2 129 THR n 
2 130 LEU n 
2 131 GLN n 
2 132 HIS n 
2 133 LEU n 
2 134 CYS n 
2 135 GLU n 
2 136 MET n 
2 137 ALA n 
2 138 ILE n 
2 139 ARG n 
2 140 SER n 
2 141 LYS n 
2 142 GLN n 
2 143 GLU n 
2 144 LEU n 
2 145 LEU n 
2 146 GLN n 
2 147 LEU n 
2 148 THR n 
2 149 PRO n 
2 150 VAL n 
2 151 GLU n 
2 152 VAL n 
2 153 GLU n 
2 154 SER n 
2 155 ASN n 
2 156 VAL n 
2 157 SER n 
2 158 ARG n 
2 159 GLY n 
2 160 CYS n 
2 161 PRO n 
2 162 GLU n 
2 163 GLY n 
2 164 ILE n 
2 165 GLU n 
2 166 THR n 
2 167 PHE n 
2 168 LYS n 
2 169 LYS n 
2 170 GLU n 
2 171 SER n 
2 172 GLU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Tombusvirus 
_entity_src_gen.pdbx_gene_src_gene                 p19 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Carnation Italian ringspot virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     39443 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthesized by Dharmacon' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VP19_CIRV Q66104 2 
;MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
;
1 ? 
2 PDB 1RPU      1RPU   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RPU A 1 ? 172 ? Q66104 1 ? 172 ? 1 172 
2 1 1RPU B 1 ? 172 ? Q66104 1 ? 172 ? 1 172 
3 2 1RPU C 1 ? 21  ? 1RPU   1 ? 21  ? 1 21  
4 2 1RPU D 1 ? 21  ? 1RPU   1 ? 21  ? 1 21  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RPU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.00 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      2.37 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'PEG MME 2000, ammonium sulfate, sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG MME 2000'     ? ? ? 
1 2 1 'ammonium sulfate' ? ? ? 
1 3 1 'sodium acetate'   ? ? ? 
1 4 1 H2O                ? ? ? 
1 5 2 'PEG MME 2000'     ? ? ? 
1 6 2 'ammonium sulfate' ? ? ? 
1 7 2 'sodium acetate'   ? ? ? 
1 8 2 H2O                ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-04-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     1RPU 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   17767 
_reflns.number_obs                   17767 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.087 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.381 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RPU 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     17767 
_refine.ls_number_reflns_obs                     17767 
_refine.ls_number_reflns_R_free                  862 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.24 
_refine.ls_R_factor_obs                          0.24 
_refine.ls_R_factor_R_work                       0.224 
_refine.ls_R_factor_R_free                       0.289 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2164 
_refine_hist.pdbx_number_atoms_nucleic_acid   1780 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               4055 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.18  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RPU 
_struct.title                     'Crystal Structure of CIRV p19 bound to siRNA' 
_struct.pdbx_descriptor           'PROTEIN/RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RPU 
_struct_keywords.pdbx_keywords   'RNA Binding Protein/RNA' 
_struct_keywords.text            
'RNAi, PROTEIN-RNA COMPLEX, RNA DOUBLE HELIX, RNA LENGTH RECOGNITION, RNA Binding Protein-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 9   ? ARG C 18  ? ASP A 9   ARG A 18  1 ? 10 
HELX_P HELX_P2  2  SER C 38  ? ASN C 46  ? SER A 38  ASN A 46  1 ? 9  
HELX_P HELX_P3  3  THR C 79  ? LEU C 87  ? THR A 79  LEU A 87  1 ? 9  
HELX_P HELX_P4  4  GLY C 88  ? TRP C 90  ? GLY A 88  TRP A 90  5 ? 3  
HELX_P HELX_P5  5  THR C 91  ? ARG C 101 ? THR A 91  ARG A 101 1 ? 11 
HELX_P HELX_P6  6  THR C 129 ? GLN C 146 ? THR A 129 GLN A 146 1 ? 18 
HELX_P HELX_P7  7  ASN D 8   ? ARG D 18  ? ASN B 8   ARG B 18  1 ? 11 
HELX_P HELX_P8  8  SER D 38  ? ASN D 46  ? SER B 38  ASN B 46  1 ? 9  
HELX_P HELX_P9  9  THR D 79  ? LEU D 87  ? THR B 79  LEU B 87  1 ? 9  
HELX_P HELX_P10 10 THR D 91  ? ARG D 101 ? THR B 91  ARG B 101 1 ? 11 
HELX_P HELX_P11 11 THR D 129 ? LEU D 145 ? THR B 129 LEU B 145 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A C 1  N3 A ? ? 1_555 B G 19 N1 A ? C C 1  D G 19 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog2  hydrog ? ? A C 1  N4 A ? ? 1_555 B G 19 O6 A ? C C 1  D G 19 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog3  hydrog ? ? A C 1  O2 A ? ? 1_555 B G 19 N2 A ? C C 1  D G 19 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog4  hydrog ? ? A G 2  N1 A ? ? 1_555 B C 18 N3 A ? C G 2  D C 18 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog5  hydrog ? ? A G 2  N2 A ? ? 1_555 B C 18 O2 A ? C G 2  D C 18 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog6  hydrog ? ? A G 2  O6 A ? ? 1_555 B C 18 N4 A ? C G 2  D C 18 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog7  hydrog ? ? A U 3  N3 A ? ? 1_555 B A 17 N1 A ? C U 3  D A 17 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog8  hydrog ? ? A U 3  O4 A ? ? 1_555 B A 17 N6 A ? C U 3  D A 17 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog9  hydrog ? ? A A 4  N1 A ? ? 1_555 B U 16 N3 A ? C A 4  D U 16 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog10 hydrog ? ? A A 4  N6 A ? ? 1_555 B U 16 O4 A ? C A 4  D U 16 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog11 hydrog ? ? A C 5  N3 A ? ? 1_555 B G 15 N1 A ? C C 5  D G 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog12 hydrog ? ? A C 5  N4 A ? ? 1_555 B G 15 O6 A ? C C 5  D G 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog13 hydrog ? ? A C 5  O2 A ? ? 1_555 B G 15 N2 A ? C C 5  D G 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog14 hydrog ? ? A G 6  N1 A ? ? 1_555 B C 14 N3 A ? C G 6  D C 14 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog15 hydrog ? ? A G 6  N2 A ? ? 1_555 B C 14 O2 A ? C G 6  D C 14 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog16 hydrog ? ? A G 6  O6 A ? ? 1_555 B C 14 N4 A ? C G 6  D C 14 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog17 hydrog ? ? A C 7  N3 A ? ? 1_555 B G 13 N1 A ? C C 7  D G 13 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog18 hydrog ? ? A C 7  N4 A ? ? 1_555 B G 13 O6 A ? C C 7  D G 13 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog19 hydrog ? ? A C 7  O2 A ? ? 1_555 B G 13 N2 A ? C C 7  D G 13 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog20 hydrog ? ? A G 8  N1 A ? ? 1_555 B C 12 N3 A ? C G 8  D C 12 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog21 hydrog ? ? A G 8  N2 A ? ? 1_555 B C 12 O2 A ? C G 8  D C 12 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog22 hydrog ? ? A G 8  O6 A ? ? 1_555 B C 12 N4 A ? C G 8  D C 12 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog23 hydrog ? ? A U 9  N3 A ? ? 1_555 B A 11 N1 A ? C U 9  D A 11 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog24 hydrog ? ? A U 9  O4 A ? ? 1_555 B A 11 N6 A ? C U 9  D A 11 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog25 hydrog ? ? A C 10 N3 A ? ? 1_555 B C 10 N4 A ? C C 10 D C 10 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
hydrog26 hydrog ? ? A A 11 N1 A ? ? 1_555 B U 9  N3 A ? C A 11 D U 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog27 hydrog ? ? A A 11 N6 A ? ? 1_555 B U 9  O4 A ? C A 11 D U 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog28 hydrog ? ? A C 12 N3 A ? ? 1_555 B G 8  N1 A ? C C 12 D G 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog29 hydrog ? ? A C 12 N4 A ? ? 1_555 B G 8  O6 A ? C C 12 D G 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog30 hydrog ? ? A C 12 O2 A ? ? 1_555 B G 8  N2 A ? C C 12 D G 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog31 hydrog ? ? A G 13 N1 A ? ? 1_555 B C 7  N3 A ? C G 13 D C 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog32 hydrog ? ? A G 13 N2 A ? ? 1_555 B C 7  O2 A ? C G 13 D C 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog33 hydrog ? ? A G 13 O6 A ? ? 1_555 B C 7  N4 A ? C G 13 D C 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog34 hydrog ? ? A C 14 N3 A ? ? 1_555 B G 6  N1 A ? C C 14 D G 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog35 hydrog ? ? A C 14 N4 A ? ? 1_555 B G 6  O6 A ? C C 14 D G 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog36 hydrog ? ? A C 14 O2 A ? ? 1_555 B G 6  N2 A ? C C 14 D G 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog37 hydrog ? ? A G 15 N1 A ? ? 1_555 B C 5  N3 A ? C G 15 D C 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog38 hydrog ? ? A G 15 N2 A ? ? 1_555 B C 5  O2 A ? C G 15 D C 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog39 hydrog ? ? A G 15 O6 A ? ? 1_555 B C 5  N4 A ? C G 15 D C 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog40 hydrog ? ? A U 16 N3 A ? ? 1_555 B A 4  N1 A ? C U 16 D A 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog41 hydrog ? ? A U 16 O4 A ? ? 1_555 B A 4  N6 A ? C U 16 D A 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog42 hydrog ? ? A A 17 N1 A ? ? 1_555 B U 3  N3 A ? C A 17 D U 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog43 hydrog ? ? A A 17 N6 A ? ? 1_555 B U 3  O4 A ? C A 17 D U 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog44 hydrog ? ? A C 18 N3 A ? ? 1_555 B G 2  N1 A ? C C 18 D G 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog45 hydrog ? ? A C 18 N4 A ? ? 1_555 B G 2  O6 A ? C C 18 D G 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog46 hydrog ? ? A C 18 O2 A ? ? 1_555 B G 2  N2 A ? C C 18 D G 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog47 hydrog ? ? A G 19 N1 A ? ? 1_555 B C 1  N3 A ? C G 19 D C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog48 hydrog ? ? A G 19 N2 A ? ? 1_555 B C 1  O2 A ? C G 19 D C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog49 hydrog ? ? A G 19 O6 A ? ? 1_555 B C 1  N4 A ? C G 19 D C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL C 68  ? ARG C 75  ? VAL A 68  ARG A 75  
A 2 GLY C 58  ? PHE C 65  ? GLY A 58  PHE A 65  
A 3 GLY C 109 ? PHE C 116 ? GLY A 109 PHE A 116 
A 4 VAL C 119 ? GLY C 126 ? VAL A 119 GLY A 126 
A 5 VAL D 119 ? GLY D 126 ? VAL B 119 GLY B 126 
A 6 GLY D 109 ? PHE D 116 ? GLY B 109 PHE B 116 
A 7 GLY D 58  ? PHE D 65  ? GLY B 58  PHE B 65  
A 8 VAL D 68  ? ARG D 75  ? VAL B 68  ARG B 75  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE C 70  ? O PHE A 70  N TRP C 63  ? N TRP A 63  
A 2 3 N GLY C 64  ? N GLY A 64  O THR C 111 ? O THR A 111 
A 3 4 N TYR C 112 ? N TYR A 112 O ILE C 123 ? O ILE A 123 
A 4 5 N SER C 124 ? N SER A 124 O SER D 120 ? O SER B 120 
A 5 6 O ILE D 123 ? O ILE B 123 N TYR D 112 ? N TYR B 112 
A 6 7 O THR D 111 ? O THR B 111 N GLY D 64  ? N GLY B 64  
A 7 8 N TRP D 63  ? N TRP B 63  O PHE D 70  ? O PHE B 70  
# 
_database_PDB_matrix.entry_id          1RPU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RPU 
_atom_sites.fract_transf_matrix[1][1]   0.008666 
_atom_sites.fract_transf_matrix[1][2]   0.005003 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010006 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007800 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O OP3   A C   A 1 1   ? -7.005  37.688 50.581  0.60 29.09 ? 1   C   C OP3   1 
ATOM   2    O OP3   B C   A 1 1   ? -6.653  36.261 51.094  0.40 28.26 ? 1   C   C OP3   1 
ATOM   3    P P     A C   A 1 1   ? -8.284  38.506 50.584  0.60 27.34 ? 1   C   C P     1 
ATOM   4    P P     B C   A 1 1   ? -8.150  36.411 51.318  0.40 28.35 ? 1   C   C P     1 
ATOM   5    O OP1   A C   A 1 1   ? -8.747  38.916 51.969  0.60 27.60 ? 1   C   C OP1   1 
ATOM   6    O OP1   B C   A 1 1   ? -8.852  35.063 51.303  0.40 26.74 ? 1   C   C OP1   1 
ATOM   7    O OP2   A C   A 1 1   ? -8.241  39.648 49.584  0.60 28.40 ? 1   C   C OP2   1 
ATOM   8    O OP2   B C   A 1 1   ? -8.501  37.259 52.531  0.40 26.84 ? 1   C   C OP2   1 
ATOM   9    O "O5'" A C   A 1 1   ? -9.442  37.507 50.040  0.60 28.29 ? 1   C   C "O5'" 1 
ATOM   10   O "O5'" B C   A 1 1   ? -8.699  37.238 50.023  0.40 29.96 ? 1   C   C "O5'" 1 
ATOM   11   C "C5'" A C   A 1 1   ? -10.772 37.987 49.811  0.60 27.10 ? 1   C   C "C5'" 1 
ATOM   12   C "C5'" B C   A 1 1   ? -9.979  37.901 50.046  0.40 31.80 ? 1   C   C "C5'" 1 
ATOM   13   C "C4'" A C   A 1 1   ? -11.569 36.954 49.054  0.60 27.21 ? 1   C   C "C4'" 1 
ATOM   14   C "C4'" B C   A 1 1   ? -10.944 37.225 49.092  0.40 33.63 ? 1   C   C "C4'" 1 
ATOM   15   O "O4'" A C   A 1 1   ? -10.990 36.754 47.731  0.60 26.72 ? 1   C   C "O4'" 1 
ATOM   16   O "O4'" B C   A 1 1   ? -10.335 37.092 47.774  0.40 33.19 ? 1   C   C "O4'" 1 
ATOM   17   C "C3'" A C   A 1 1   ? -11.568 35.553 49.638  0.60 25.32 ? 1   C   C "C3'" 1 
ATOM   18   C "C3'" B C   A 1 1   ? -11.347 35.804 49.449  0.40 33.81 ? 1   C   C "C3'" 1 
ATOM   19   O "O3'" A C   A 1 1   ? -12.452 35.415 50.742  0.60 24.18 ? 1   C   C "O3'" 1 
ATOM   20   O "O3'" B C   A 1 1   ? -12.387 35.765 50.413  0.40 34.82 ? 1   C   C "O3'" 1 
ATOM   21   C "C2'" A C   A 1 1   ? -12.013 34.731 48.438  0.60 26.05 ? 1   C   C "C2'" 1 
ATOM   22   C "C2'" B C   A 1 1   ? -11.803 35.268 48.101  0.40 34.15 ? 1   C   C "C2'" 1 
ATOM   23   O "O2'" A C   A 1 1   ? -13.402 34.799 48.205  0.60 23.64 ? 1   C   C "O2'" 1 
ATOM   24   O "O2'" B C   A 1 1   ? -13.086 35.727 47.727  0.40 33.35 ? 1   C   C "O2'" 1 
ATOM   25   C "C1'" A C   A 1 1   ? -11.267 35.433 47.300  0.60 27.49 ? 1   C   C "C1'" 1 
ATOM   26   C "C1'" B C   A 1 1   ? -10.738 35.866 47.182  0.40 33.95 ? 1   C   C "C1'" 1 
ATOM   27   N N1    A C   A 1 1   ? -10.004 34.751 46.999  0.60 29.96 ? 1   C   C N1    1 
ATOM   28   N N1    B C   A 1 1   ? -9.564  34.988 47.123  0.40 35.57 ? 1   C   C N1    1 
ATOM   29   C C2    A C   A 1 1   ? -10.046 33.598 46.210  0.60 30.35 ? 1   C   C C2    1 
ATOM   30   C C2    B C   A 1 1   ? -9.639  33.790 46.398  0.40 35.81 ? 1   C   C C2    1 
ATOM   31   O O2    A C   A 1 1   ? -11.136 33.219 45.766  0.60 31.68 ? 1   C   C O2    1 
ATOM   32   O O2    B C   A 1 1   ? -10.681 33.520 45.783  0.40 35.85 ? 1   C   C O2    1 
ATOM   33   N N3    A C   A 1 1   ? -8.906  32.928 45.949  0.60 31.24 ? 1   C   C N3    1 
ATOM   34   N N3    B C   A 1 1   ? -8.573  32.961 46.385  0.40 36.26 ? 1   C   C N3    1 
ATOM   35   C C4    A C   A 1 1   ? -7.749  33.370 46.437  0.60 31.00 ? 1   C   C C4    1 
ATOM   36   C C4    B C   A 1 1   ? -7.466  33.290 47.049  0.40 36.02 ? 1   C   C C4    1 
ATOM   37   N N4    A C   A 1 1   ? -6.653  32.668 46.152  0.60 30.75 ? 1   C   C N4    1 
ATOM   38   N N4    B C   A 1 1   ? -6.448  32.435 47.021  0.40 37.10 ? 1   C   C N4    1 
ATOM   39   C C5    A C   A 1 1   ? -7.669  34.552 47.237  0.60 31.43 ? 1   C   C C5    1 
ATOM   40   C C5    B C   A 1 1   ? -7.355  34.510 47.775  0.40 36.53 ? 1   C   C C5    1 
ATOM   41   C C6    A C   A 1 1   ? -8.812  35.209 47.488  0.60 30.43 ? 1   C   C C6    1 
ATOM   42   C C6    B C   A 1 1   ? -8.416  35.322 47.784  0.40 35.55 ? 1   C   C C6    1 
ATOM   43   P P     A G   A 1 2   ? -12.365 34.103 51.674  0.60 26.80 ? 2   G   C P     1 
ATOM   44   P P     B G   A 1 2   ? -12.496 34.506 51.402  0.40 36.95 ? 2   G   C P     1 
ATOM   45   O OP1   A G   A 1 2   ? -13.383 34.231 52.747  0.60 27.58 ? 2   G   C OP1   1 
ATOM   46   O OP1   B G   A 1 2   ? -13.715 34.685 52.227  0.40 38.83 ? 2   G   C OP1   1 
ATOM   47   O OP2   A G   A 1 2   ? -10.953 33.831 52.043  0.60 27.56 ? 2   G   C OP2   1 
ATOM   48   O OP2   B G   A 1 2   ? -11.187 34.312 52.070  0.40 38.24 ? 2   G   C OP2   1 
ATOM   49   O "O5'" A G   A 1 2   ? -12.818 32.931 50.702  0.60 27.22 ? 2   G   C "O5'" 1 
ATOM   50   O "O5'" B G   A 1 2   ? -12.726 33.272 50.423  0.40 37.79 ? 2   G   C "O5'" 1 
ATOM   51   C "C5'" A G   A 1 2   ? -14.113 32.913 50.118  0.60 27.50 ? 2   G   C "C5'" 1 
ATOM   52   C "C5'" B G   A 1 2   ? -13.967 33.084 49.753  0.40 38.56 ? 2   G   C "C5'" 1 
ATOM   53   C "C4'" A G   A 1 2   ? -14.343 31.588 49.446  0.60 29.33 ? 2   G   C "C4'" 1 
ATOM   54   C "C4'" B G   A 1 2   ? -13.990 31.736 49.074  0.40 39.70 ? 2   G   C "C4'" 1 
ATOM   55   O "O4'" A G   A 1 2   ? -13.488 31.462 48.278  0.60 30.91 ? 2   G   C "O4'" 1 
ATOM   56   O "O4'" B G   A 1 2   ? -13.019 31.715 47.990  0.40 39.83 ? 2   G   C "O4'" 1 
ATOM   57   C "C3'" A G   A 1 2   ? -13.948 30.412 50.311  0.60 31.13 ? 2   G   C "C3'" 1 
ATOM   58   C "C3'" B G   A 1 2   ? -13.570 30.574 49.953  0.40 40.64 ? 2   G   C "C3'" 1 
ATOM   59   O "O3'" A G   A 1 2   ? -14.982 30.102 51.230  0.60 34.72 ? 2   G   C "O3'" 1 
ATOM   60   O "O3'" B G   A 1 2   ? -14.635 30.114 50.774  0.40 43.91 ? 2   G   C "O3'" 1 
ATOM   61   C "C2'" A G   A 1 2   ? -13.708 29.325 49.278  0.60 32.90 ? 2   G   C "C2'" 1 
ATOM   62   C "C2'" B G   A 1 2   ? -13.139 29.540 48.923  0.40 40.67 ? 2   G   C "C2'" 1 
ATOM   63   O "O2'" A G   A 1 2   ? -14.913 28.739 48.807  0.60 36.28 ? 2   G   C "O2'" 1 
ATOM   64   O "O2'" B G   A 1 2   ? -14.232 28.881 48.315  0.40 43.18 ? 2   G   C "O2'" 1 
ATOM   65   C "C1'" A G   A 1 2   ? -13.026 30.126 48.166  0.60 32.12 ? 2   G   C "C1'" 1 
ATOM   66   C "C1'" B G   A 1 2   ? -12.440 30.423 47.890  0.40 39.73 ? 2   G   C "C1'" 1 
ATOM   67   N N9    A G   A 1 2   ? -11.569 30.134 48.277  0.60 33.44 ? 2   G   C N9    1 
ATOM   68   N N9    B G   A 1 2   ? -11.002 30.539 48.119  0.40 39.27 ? 2   G   C N9    1 
ATOM   69   C C8    A G   A 1 2   ? -10.776 31.147 48.758  0.60 34.54 ? 2   G   C C8    1 
ATOM   70   C C8    B G   A 1 2   ? -10.349 31.520 48.828  0.40 39.42 ? 2   G   C C8    1 
ATOM   71   N N7    A G   A 1 2   ? -9.503  30.858 48.735  0.60 34.56 ? 2   G   C N7    1 
ATOM   72   N N7    B G   A 1 2   ? -9.053  31.362 48.847  0.40 38.98 ? 2   G   C N7    1 
ATOM   73   C C5    A G   A 1 2   ? -9.452  29.578 48.201  0.60 34.96 ? 2   G   C C5    1 
ATOM   74   C C5    B G   A 1 2   ? -8.836  30.207 48.109  0.40 39.05 ? 2   G   C C5    1 
ATOM   75   C C6    A G   A 1 2   ? -8.337  28.730 47.924  0.60 36.47 ? 2   G   C C6    1 
ATOM   76   C C6    B G   A 1 2   ? -7.621  29.534 47.773  0.40 39.25 ? 2   G   C C6    1 
ATOM   77   O O6    A G   A 1 2   ? -7.122  28.956 48.088  0.60 35.85 ? 2   G   C O6    1 
ATOM   78   O O6    B G   A 1 2   ? -6.450  29.840 48.068  0.40 38.23 ? 2   G   C O6    1 
ATOM   79   N N1    A G   A 1 2   ? -8.745  27.509 47.399  0.60 37.40 ? 2   G   C N1    1 
ATOM   80   N N1    B G   A 1 2   ? -7.865  28.395 47.012  0.40 39.32 ? 2   G   C N1    1 
ATOM   81   C C2    A G   A 1 2   ? -10.045 27.148 47.159  0.60 37.77 ? 2   G   C C2    1 
ATOM   82   C C2    B G   A 1 2   ? -9.107  27.956 46.620  0.40 38.87 ? 2   G   C C2    1 
ATOM   83   N N2    A G   A 1 2   ? -10.236 25.921 46.660  0.60 38.76 ? 2   G   C N2    1 
ATOM   84   N N2    B G   A 1 2   ? -9.134  26.832 45.892  0.40 38.00 ? 2   G   C N2    1 
ATOM   85   N N3    A G   A 1 2   ? -11.086 27.929 47.396  0.60 37.81 ? 2   G   C N3    1 
ATOM   86   N N3    B G   A 1 2   ? -10.239 28.574 46.919  0.40 38.89 ? 2   G   C N3    1 
ATOM   87   C C4    A G   A 1 2   ? -10.720 29.118 47.916  0.60 34.77 ? 2   G   C C4    1 
ATOM   88   C C4    B G   A 1 2   ? -10.031 29.682 47.659  0.40 38.71 ? 2   G   C C4    1 
ATOM   89   P P     A U   A 1 3   ? -14.690 29.075 52.422  0.60 34.46 ? 3   U   C P     1 
ATOM   90   P P     B U   A 1 3   ? -14.304 29.184 52.040  0.40 45.70 ? 3   U   C P     1 
ATOM   91   O OP1   A U   A 1 3   ? -15.869 29.037 53.319  0.60 35.51 ? 3   U   C OP1   1 
ATOM   92   O OP1   B U   A 1 3   ? -15.566 28.550 52.499  0.40 46.34 ? 3   U   C OP1   1 
ATOM   93   O OP2   A U   A 1 3   ? -13.358 29.396 52.986  0.60 35.39 ? 3   U   C OP2   1 
ATOM   94   O OP2   B U   A 1 3   ? -13.488 29.964 53.005  0.40 45.84 ? 3   U   C OP2   1 
ATOM   95   O "O5'" A U   A 1 3   ? -14.605 27.688 51.649  0.60 36.23 ? 3   U   C "O5'" 1 
ATOM   96   O "O5'" B U   A 1 3   ? -13.392 28.053 51.396  0.40 47.97 ? 3   U   C "O5'" 1 
ATOM   97   C "C5'" A U   A 1 3   ? -14.118 26.539 52.305  0.60 39.71 ? 3   U   C "C5'" 1 
ATOM   98   C "C5'" B U   A 1 3   ? -12.451 27.329 52.174  0.40 51.95 ? 3   U   C "C5'" 1 
ATOM   99   C "C4'" A U   A 1 3   ? -13.977 25.387 51.345  0.60 39.49 ? 3   U   C "C4'" 1 
ATOM   100  C "C4'" B U   A 1 3   ? -11.709 26.354 51.296  0.40 54.55 ? 3   U   C "C4'" 1 
ATOM   101  O "O4'" A U   A 1 3   ? -13.282 25.794 50.140  0.60 39.09 ? 3   U   C "O4'" 1 
ATOM   102  O "O4'" B U   A 1 3   ? -10.949 27.085 50.298  0.40 55.10 ? 3   U   C "O4'" 1 
ATOM   103  C "C3'" A U   A 1 3   ? -13.108 24.317 51.962  0.60 41.35 ? 3   U   C "C3'" 1 
ATOM   104  C "C3'" B U   A 1 3   ? -10.662 25.514 51.998  0.40 56.68 ? 3   U   C "C3'" 1 
ATOM   105  O "O3'" A U   A 1 3   ? -13.897 23.474 52.772  0.60 45.53 ? 3   U   C "O3'" 1 
ATOM   106  O "O3'" B U   A 1 3   ? -11.276 24.405 52.641  0.40 59.98 ? 3   U   C "O3'" 1 
ATOM   107  C "C2'" A U   A 1 3   ? -12.443 23.671 50.762  0.60 39.73 ? 3   U   C "C2'" 1 
ATOM   108  C "C2'" B U   A 1 3   ? -9.769  25.100 50.837  0.40 55.91 ? 3   U   C "C2'" 1 
ATOM   109  O "O2'" A U   A 1 3   ? -13.264 22.726 50.112  0.60 41.03 ? 3   U   C "O2'" 1 
ATOM   110  O "O2'" B U   A 1 3   ? -10.319 24.046 50.077  0.40 56.67 ? 3   U   C "O2'" 1 
ATOM   111  C "C1'" A U   A 1 3   ? -12.211 24.898 49.878  0.60 39.38 ? 3   U   C "C1'" 1 
ATOM   112  C "C1'" B U   A 1 3   ? -9.757  26.379 49.999  0.40 55.74 ? 3   U   C "C1'" 1 
ATOM   113  N N1    A U   A 1 3   ? -10.961 25.616 50.178  0.60 38.24 ? 3   U   C N1    1 
ATOM   114  N N1    B U   A 1 3   ? -8.611  27.243 50.312  0.40 56.45 ? 3   U   C N1    1 
ATOM   115  C C2    A U   A 1 3   ? -9.767  25.091 49.723  0.60 37.51 ? 3   U   C C2    1 
ATOM   116  C C2    B U   A 1 3   ? -7.392  26.897 49.767  0.40 57.18 ? 3   U   C C2    1 
ATOM   117  O O2    A U   A 1 3   ? -9.694  24.053 49.091  0.60 38.81 ? 3   U   C O2    1 
ATOM   118  O O2    B U   A 1 3   ? -7.249  25.932 49.030  0.40 57.04 ? 3   U   C O2    1 
ATOM   119  N N3    A U   A 1 3   ? -8.656  25.833 50.030  0.60 36.52 ? 3   U   C N3    1 
ATOM   120  N N3    B U   A 1 3   ? -6.348  27.722 50.113  0.40 56.91 ? 3   U   C N3    1 
ATOM   121  C C4    A U   A 1 3   ? -8.619  27.024 50.724  0.60 36.64 ? 3   U   C C4    1 
ATOM   122  C C4    B U   A 1 3   ? -6.399  28.834 50.928  0.40 56.78 ? 3   U   C C4    1 
ATOM   123  O O4    A U   A 1 3   ? -7.542  27.608 50.878  0.60 35.94 ? 3   U   C O4    1 
ATOM   124  O O4    B U   A 1 3   ? -5.360  29.450 51.179  0.40 57.22 ? 3   U   C O4    1 
ATOM   125  C C5    A U   A 1 3   ? -9.891  27.494 51.163  0.60 37.22 ? 3   U   C C5    1 
ATOM   126  C C5    B U   A 1 3   ? -7.701  29.135 51.441  0.40 56.64 ? 3   U   C C5    1 
ATOM   127  C C6    A U   A 1 3   ? -10.989 26.792 50.886  0.60 37.07 ? 3   U   C C6    1 
ATOM   128  C C6    B U   A 1 3   ? -8.737  28.349 51.122  0.40 56.53 ? 3   U   C C6    1 
ATOM   129  P P     A A   A 1 4   ? -13.559 23.372 54.333  0.60 50.06 ? 4   A   C P     1 
ATOM   130  P P     B A   A 1 4   ? -10.966 24.117 54.191  0.40 61.68 ? 4   A   C P     1 
ATOM   131  O OP1   A A   A 1 4   ? -14.680 22.661 55.008  0.60 49.66 ? 4   A   C OP1   1 
ATOM   132  O OP1   B A   A 1 4   ? -12.223 23.635 54.812  0.40 61.60 ? 4   A   C OP1   1 
ATOM   133  O OP2   A A   A 1 4   ? -13.156 24.723 54.807  0.60 49.23 ? 4   A   C OP2   1 
ATOM   134  O OP2   B A   A 1 4   ? -10.271 25.300 54.760  0.40 61.64 ? 4   A   C OP2   1 
ATOM   135  O "O5'" A A   A 1 4   ? -12.280 22.429 54.331  0.60 48.52 ? 4   A   C "O5'" 1 
ATOM   136  O "O5'" B A   A 1 4   ? -9.939  22.904 54.146  0.40 63.66 ? 4   A   C "O5'" 1 
ATOM   137  C "C5'" A A   A 1 4   ? -12.354 21.142 53.735  0.60 48.70 ? 4   A   C "C5'" 1 
ATOM   138  C "C5'" B A   A 1 4   ? -10.309 21.667 53.551  0.40 67.80 ? 4   A   C "C5'" 1 
ATOM   139  C "C4'" A A   A 1 4   ? -10.977 20.557 53.566  0.60 49.19 ? 4   A   C "C4'" 1 
ATOM   140  C "C4'" B A   A 1 4   ? -9.085  20.956 53.037  0.40 70.28 ? 4   A   C "C4'" 1 
ATOM   141  O "O4'" A A   A 1 4   ? -10.242 21.300 52.555  0.60 49.37 ? 4   A   C "O4'" 1 
ATOM   142  O "O4'" B A   A 1 4   ? -8.512  21.711 51.932  0.40 70.70 ? 4   A   C "O4'" 1 
ATOM   143  C "C3'" A A   A 1 4   ? -10.048 20.631 54.763  0.60 48.56 ? 4   A   C "C3'" 1 
ATOM   144  C "C3'" B A   A 1 4   ? -7.949  20.853 54.038  0.40 71.63 ? 4   A   C "C3'" 1 
ATOM   145  O "O3'" A A   A 1 4   ? -10.339 19.664 55.756  0.60 47.97 ? 4   A   C "O3'" 1 
ATOM   146  O "O3'" B A   A 1 4   ? -8.135  19.769 54.939  0.40 73.82 ? 4   A   C "O3'" 1 
ATOM   147  C "C2'" A A   A 1 4   ? -8.711  20.362 54.097  0.60 48.85 ? 4   A   C "C2'" 1 
ATOM   148  C "C2'" B A   A 1 4   ? -6.747  20.679 53.122  0.40 71.26 ? 4   A   C "C2'" 1 
ATOM   149  O "O2'" A A   A 1 4   ? -8.565  18.998 53.745  0.60 48.52 ? 4   A   C "O2'" 1 
ATOM   150  O "O2'" B A   A 1 4   ? -6.636  19.373 52.590  0.40 70.40 ? 4   A   C "O2'" 1 
ATOM   151  C "C1'" A A   A 1 4   ? -8.851  21.208 52.831  0.60 47.83 ? 4   A   C "C1'" 1 
ATOM   152  C "C1'" B A   A 1 4   ? -7.094  21.666 52.007  0.40 71.01 ? 4   A   C "C1'" 1 
ATOM   153  N N9    A A   A 1 4   ? -8.312  22.555 53.026  0.60 45.43 ? 4   A   C N9    1 
ATOM   154  N N9    B A   A 1 4   ? -6.617  23.013 52.314  0.40 71.05 ? 4   A   C N9    1 
ATOM   155  C C8    A A   A 1 4   ? -8.958  23.709 53.390  0.60 43.98 ? 4   A   C C8    1 
ATOM   156  C C8    B A   A 1 4   ? -7.332  24.053 52.851  0.40 70.74 ? 4   A   C C8    1 
ATOM   157  N N7    A A   A 1 4   ? -8.163  24.747 53.495  0.60 43.21 ? 4   A   C N7    1 
ATOM   158  N N7    B A   A 1 4   ? -6.626  25.141 53.034  0.40 70.86 ? 4   A   C N7    1 
ATOM   159  C C5    A A   A 1 4   ? -6.910  24.241 53.174  0.60 43.23 ? 4   A   C C5    1 
ATOM   160  C C5    B A   A 1 4   ? -5.360  24.796 52.583  0.40 71.14 ? 4   A   C C5    1 
ATOM   161  C C6    A A   A 1 4   ? -5.633  24.831 53.102  0.60 42.88 ? 4   A   C C6    1 
ATOM   162  C C6    B A   A 1 4   ? -4.155  25.513 52.511  0.40 71.71 ? 4   A   C C6    1 
ATOM   163  N N6    A A   A 1 4   ? -5.386  26.116 53.361  0.60 43.05 ? 4   A   C N6    1 
ATOM   164  N N6    B A   A 1 4   ? -4.027  26.782 52.904  0.40 71.90 ? 4   A   C N6    1 
ATOM   165  N N1    A A   A 1 4   ? -4.596  24.041 52.755  0.60 43.76 ? 4   A   C N1    1 
ATOM   166  N N1    B A   A 1 4   ? -3.072  24.876 52.015  0.40 71.82 ? 4   A   C N1    1 
ATOM   167  C C2    A A   A 1 4   ? -4.830  22.752 52.504  0.60 45.06 ? 4   A   C C2    1 
ATOM   168  C C2    B A   A 1 4   ? -3.206  23.605 51.617  0.40 71.87 ? 4   A   C C2    1 
ATOM   169  N N3    A A   A 1 4   ? -5.978  22.082 52.538  0.60 45.44 ? 4   A   C N3    1 
ATOM   170  N N3    B A   A 1 4   ? -4.286  22.827 51.630  0.40 71.56 ? 4   A   C N3    1 
ATOM   171  C C4    A A   A 1 4   ? -6.990  22.894 52.883  0.60 44.59 ? 4   A   C C4    1 
ATOM   172  C C4    B A   A 1 4   ? -5.341  23.490 52.133  0.40 71.18 ? 4   A   C C4    1 
ATOM   173  P P     A C   A 1 5   ? -9.906  19.947 57.276  0.60 49.15 ? 5   C   C P     1 
ATOM   174  P P     B C   A 1 5   ? -7.364  19.774 56.348  0.40 74.91 ? 5   C   C P     1 
ATOM   175  O OP1   A C   A 1 5   ? -10.502 18.851 58.082  0.60 52.20 ? 5   C   C OP1   1 
ATOM   176  O OP1   B C   A 1 5   ? -7.787  18.560 57.089  0.40 74.90 ? 5   C   C OP1   1 
ATOM   177  O OP2   A C   A 1 5   ? -10.210 21.355 57.625  0.60 49.44 ? 5   C   C OP2   1 
ATOM   178  O OP2   B C   A 1 5   ? -7.533  21.111 56.972  0.40 74.21 ? 5   C   C OP2   1 
ATOM   179  O "O5'" A C   A 1 5   ? -8.322  19.778 57.254  0.60 46.88 ? 5   C   C "O5'" 1 
ATOM   180  O "O5'" B C   A 1 5   ? -5.836  19.602 55.927  0.40 75.51 ? 5   C   C "O5'" 1 
ATOM   181  C "C5'" A C   A 1 5   ? -7.745  18.567 56.783  0.60 45.45 ? 5   C   C "C5'" 1 
ATOM   182  C "C5'" B C   A 1 5   ? -5.413  18.456 55.192  0.40 76.37 ? 5   C   C "C5'" 1 
ATOM   183  C "C4'" A C   A 1 5   ? -6.248  18.706 56.605  0.60 43.73 ? 5   C   C "C4'" 1 
ATOM   184  C "C4'" B C   A 1 5   ? -3.927  18.256 55.346  0.40 76.66 ? 5   C   C "C4'" 1 
ATOM   185  O "O4'" A C   A 1 5   ? -5.939  19.680 55.572  0.60 43.91 ? 5   C   C "O4'" 1 
ATOM   186  O "O4'" B C   A 1 5   ? -3.189  19.159 54.479  0.40 77.08 ? 5   C   C "O4'" 1 
ATOM   187  C "C3'" A C   A 1 5   ? -5.426  19.207 57.776  0.60 42.23 ? 5   C   C "C3'" 1 
ATOM   188  C "C3'" B C   A 1 5   ? -3.394  18.567 56.728  0.40 76.85 ? 5   C   C "C3'" 1 
ATOM   189  O "O3'" A C   A 1 5   ? -5.235  18.199 58.753  0.60 40.95 ? 5   C   C "O3'" 1 
ATOM   190  O "O3'" B C   A 1 5   ? -3.645  17.509 57.641  0.40 76.10 ? 5   C   C "O3'" 1 
ATOM   191  C "C2'" A C   A 1 5   ? -4.118  19.539 57.072  0.60 42.68 ? 5   C   C "C2'" 1 
ATOM   192  C "C2'" B C   A 1 5   ? -1.914  18.793 56.449  0.40 77.46 ? 5   C   C "C2'" 1 
ATOM   193  O "O2'" A C   A 1 5   ? -3.399  18.374 56.718  0.60 42.19 ? 5   C   C "O2'" 1 
ATOM   194  O "O2'" B C   A 1 5   ? -1.191  17.587 56.304  0.40 77.60 ? 5   C   C "O2'" 1 
ATOM   195  C "C1'" A C   A 1 5   ? -4.636  20.199 55.797  0.60 42.36 ? 5   C   C "C1'" 1 
ATOM   196  C "C1'" B C   A 1 5   ? -1.974  19.537 55.111  0.40 77.56 ? 5   C   C "C1'" 1 
ATOM   197  N N1    A C   A 1 5   ? -4.723  21.655 55.946  0.60 42.33 ? 5   C   C N1    1 
ATOM   198  N N1    B C   A 1 5   ? -1.978  20.999 55.273  0.40 78.36 ? 5   C   C N1    1 
ATOM   199  C C2    A C   A 1 5   ? -3.601  22.414 55.650  0.60 42.51 ? 5   C   C C2    1 
ATOM   200  C C2    B C   A 1 5   ? -0.763  21.665 55.507  0.40 78.74 ? 5   C   C C2    1 
ATOM   201  O O2    A C   A 1 5   ? -2.576  21.830 55.270  0.60 43.39 ? 5   C   C O2    1 
ATOM   202  O O2    B C   A 1 5   ? 0.288   21.004 55.577  0.40 79.37 ? 5   C   C O2    1 
ATOM   203  N N3    A C   A 1 5   ? -3.653  23.760 55.783  0.60 41.29 ? 5   C   C N3    1 
ATOM   204  N N3    B C   A 1 5   ? -0.766  23.012 55.650  0.40 78.65 ? 5   C   C N3    1 
ATOM   205  C C4    A C   A 1 5   ? -4.772  24.345 56.199  0.60 40.20 ? 5   C   C C4    1 
ATOM   206  C C4    B C   A 1 5   ? -1.915  23.688 55.570  0.40 78.79 ? 5   C   C C4    1 
ATOM   207  N N4    A C   A 1 5   ? -4.776  25.675 56.313  0.60 40.29 ? 5   C   C N4    1 
ATOM   208  N N4    B C   A 1 5   ? -1.873  25.015 55.712  0.40 78.26 ? 5   C   C N4    1 
ATOM   209  C C5    A C   A 1 5   ? -5.938  23.593 56.514  0.60 42.23 ? 5   C   C C5    1 
ATOM   210  C C5    B C   A 1 5   ? -3.162  23.035 55.339  0.40 78.90 ? 5   C   C C5    1 
ATOM   211  C C6    A C   A 1 5   ? -5.871  22.260 56.373  0.60 42.87 ? 5   C   C C6    1 
ATOM   212  C C6    B C   A 1 5   ? -3.147  21.704 55.198  0.40 78.51 ? 5   C   C C6    1 
ATOM   213  P P     A G   A 1 6   ? -4.704  18.599 60.219  0.60 40.61 ? 6   G   C P     1 
ATOM   214  P P     B G   A 1 6   ? -3.915  17.855 59.185  0.40 76.01 ? 6   G   C P     1 
ATOM   215  O OP1   A G   A 1 6   ? -4.659  17.318 60.980  0.60 40.25 ? 6   G   C OP1   1 
ATOM   216  O OP1   B G   A 1 6   ? -4.071  16.572 59.923  0.40 75.31 ? 6   G   C OP1   1 
ATOM   217  O OP2   A G   A 1 6   ? -5.514  19.738 60.737  0.60 39.30 ? 6   G   C OP2   1 
ATOM   218  O OP2   B G   A 1 6   ? -4.989  18.880 59.258  0.40 75.88 ? 6   G   C OP2   1 
ATOM   219  O "O5'" A G   A 1 6   ? -3.202  19.080 59.973  0.60 35.69 ? 6   G   C "O5'" 1 
ATOM   220  O "O5'" B G   A 1 6   ? -2.549  18.530 59.635  0.40 74.44 ? 6   G   C "O5'" 1 
ATOM   221  C "C5'" A G   A 1 6   ? -2.219  18.140 59.561  0.60 34.87 ? 6   G   C "C5'" 1 
ATOM   222  C "C5'" B G   A 1 6   ? -1.333  17.806 59.528  0.40 74.19 ? 6   G   C "C5'" 1 
ATOM   223  C "C4'" A G   A 1 6   ? -0.880  18.807 59.360  0.60 35.07 ? 6   G   C "C4'" 1 
ATOM   224  C "C4'" B G   A 1 6   ? -0.182  18.635 60.027  0.40 73.55 ? 6   G   C "C4'" 1 
ATOM   225  O "O4'" A G   A 1 6   ? -0.988  19.810 58.318  0.60 36.11 ? 6   G   C "O4'" 1 
ATOM   226  O "O4'" B G   A 1 6   ? 0.218   19.617 59.033  0.40 73.67 ? 6   G   C "O4'" 1 
ATOM   227  C "C3'" A G   A 1 6   ? -0.301  19.581 60.533  0.60 34.21 ? 6   G   C "C3'" 1 
ATOM   228  C "C3'" B G   A 1 6   ? -0.460  19.479 61.253  0.40 73.05 ? 6   G   C "C3'" 1 
ATOM   229  O "O3'" A G   A 1 6   ? 0.314   18.733 61.492  0.60 31.83 ? 6   G   C "O3'" 1 
ATOM   230  O "O3'" B G   A 1 6   ? -0.479  18.694 62.440  0.40 72.38 ? 6   G   C "O3'" 1 
ATOM   231  C "C2'" A G   A 1 6   ? 0.719   20.472 59.832  0.60 35.02 ? 6   G   C "C2'" 1 
ATOM   232  C "C2'" B G   A 1 6   ? 0.704   20.459 61.197  0.40 73.33 ? 6   G   C "C2'" 1 
ATOM   233  O "O2'" A G   A 1 6   ? 1.925   19.820 59.488  0.60 33.47 ? 6   G   C "O2'" 1 
ATOM   234  O "O2'" B G   A 1 6   ? 1.917   19.878 61.632  0.40 73.24 ? 6   G   C "O2'" 1 
ATOM   235  C "C1'" A G   A 1 6   ? -0.042  20.843 58.559  0.60 35.60 ? 6   G   C "C1'" 1 
ATOM   236  C "C1'" B G   A 1 6   ? 0.781   20.743 59.693  0.40 73.26 ? 6   G   C "C1'" 1 
ATOM   237  N N9    A G   A 1 6   ? -0.757  22.102 58.729  0.60 34.26 ? 6   G   C N9    1 
ATOM   238  N N9    B G   A 1 6   ? 0.025   21.935 59.320  0.40 72.77 ? 6   G   C N9    1 
ATOM   239  C C8    A G   A 1 6   ? -2.106  22.287 58.905  0.60 34.15 ? 6   G   C C8    1 
ATOM   240  C C8    B G   A 1 6   ? -1.328  22.026 59.096  0.40 72.45 ? 6   G   C C8    1 
ATOM   241  N N7    A G   A 1 6   ? -2.437  23.545 59.028  0.60 34.39 ? 6   G   C N7    1 
ATOM   242  N N7    B G   A 1 6   ? -1.721  23.241 58.824  0.40 72.63 ? 6   G   C N7    1 
ATOM   243  C C5    A G   A 1 6   ? -1.232  24.228 58.923  0.60 33.43 ? 6   G   C C5    1 
ATOM   244  C C5    B G   A 1 6   ? -0.557  23.997 58.861  0.40 72.28 ? 6   G   C C5    1 
ATOM   245  C C6    A G   A 1 6   ? -0.952  25.620 58.972  0.60 32.61 ? 6   G   C C6    1 
ATOM   246  C C6    B G   A 1 6   ? -0.353  25.391 58.656  0.40 72.07 ? 6   G   C C6    1 
ATOM   247  O O6    A G   A 1 6   ? -1.744  26.562 59.110  0.60 31.52 ? 6   G   C O6    1 
ATOM   248  O O6    B G   A 1 6   ? -1.190  26.266 58.399  0.40 71.48 ? 6   G   C O6    1 
ATOM   249  N N1    A G   A 1 6   ? 0.410   25.868 58.836  0.60 32.11 ? 6   G   C N1    1 
ATOM   250  N N1    B G   A 1 6   ? 0.988   25.734 58.784  0.40 72.06 ? 6   G   C N1    1 
ATOM   251  C C2    A G   A 1 6   ? 1.378   24.905 58.662  0.60 32.21 ? 6   G   C C2    1 
ATOM   252  C C2    B G   A 1 6   ? 2.003   24.857 59.071  0.40 71.98 ? 6   G   C C2    1 
ATOM   253  N N2    A G   A 1 6   ? 2.639   25.341 58.538  0.60 32.78 ? 6   G   C N2    1 
ATOM   254  N N2    B G   A 1 6   ? 3.235   25.383 59.147  0.40 71.90 ? 6   G   C N2    1 
ATOM   255  N N3    A G   A 1 6   ? 1.129   23.612 58.609  0.60 30.46 ? 6   G   C N3    1 
ATOM   256  N N3    B G   A 1 6   ? 1.827   23.561 59.269  0.40 72.01 ? 6   G   C N3    1 
ATOM   257  C C4    A G   A 1 6   ? -0.186  23.347 58.745  0.60 33.24 ? 6   G   C C4    1 
ATOM   258  C C4    B G   A 1 6   ? 0.532   23.203 59.152  0.40 72.20 ? 6   G   C C4    1 
ATOM   259  P P     A C   A 1 7   ? 0.262   19.130 63.050  0.60 33.11 ? 7   C   C P     1 
ATOM   260  P P     B C   A 1 7   ? -1.283  19.223 63.730  0.40 71.45 ? 7   C   C P     1 
ATOM   261  O OP1   A C   A 1 7   ? 0.713   17.943 63.825  0.60 31.83 ? 7   C   C OP1   1 
ATOM   262  O OP1   B C   A 1 7   ? -1.611  18.044 64.573  0.40 71.28 ? 7   C   C OP1   1 
ATOM   263  O OP2   A C   A 1 7   ? -1.075  19.726 63.336  0.60 32.04 ? 7   C   C OP2   1 
ATOM   264  O OP2   B C   A 1 7   ? -2.372  20.129 63.284  0.40 71.44 ? 7   C   C OP2   1 
ATOM   265  O "O5'" A C   A 1 7   ? 1.352   20.288 63.197  0.60 30.33 ? 7   C   C "O5'" 1 
ATOM   266  O "O5'" B C   A 1 7   ? -0.194  20.095 64.493  0.40 70.95 ? 7   C   C "O5'" 1 
ATOM   267  C "C5'" A C   A 1 7   ? 2.736   20.006 63.065  0.60 29.35 ? 7   C   C "C5'" 1 
ATOM   268  C "C5'" B C   A 1 7   ? 1.118   19.582 64.700  0.40 69.32 ? 7   C   C "C5'" 1 
ATOM   269  C "C4'" A C   A 1 7   ? 3.546   21.275 63.187  0.60 31.08 ? 7   C   C "C4'" 1 
ATOM   270  C "C4'" B C   A 1 7   ? 2.117   20.709 64.749  0.40 67.50 ? 7   C   C "C4'" 1 
ATOM   271  O "O4'" A C   A 1 7   ? 3.238   22.167 62.082  0.60 30.74 ? 7   C   C "O4'" 1 
ATOM   272  O "O4'" B C   A 1 7   ? 2.198   21.352 63.450  0.40 66.81 ? 7   C   C "O4'" 1 
ATOM   273  C "C3'" A C   A 1 7   ? 3.279   22.134 64.411  0.60 31.08 ? 7   C   C "C3'" 1 
ATOM   274  C "C3'" B C   A 1 7   ? 1.750   21.842 65.685  0.40 66.72 ? 7   C   C "C3'" 1 
ATOM   275  O "O3'" A C   A 1 7   ? 3.954   21.651 65.562  0.60 29.19 ? 7   C   C "O3'" 1 
ATOM   276  O "O3'" B C   A 1 7   ? 2.074   21.542 67.031  0.40 65.37 ? 7   C   C "O3'" 1 
ATOM   277  C "C2'" A C   A 1 7   ? 3.834   23.480 63.963  0.60 31.80 ? 7   C   C "C2'" 1 
ATOM   278  C "C2'" B C   A 1 7   ? 2.568   22.990 65.116  0.40 66.87 ? 7   C   C "C2'" 1 
ATOM   279  O "O2'" A C   A 1 7   ? 5.242   23.544 63.995  0.60 31.34 ? 7   C   C "O2'" 1 
ATOM   280  O "O2'" B C   A 1 7   ? 3.935   22.924 65.475  0.40 65.75 ? 7   C   C "O2'" 1 
ATOM   281  C "C1'" A C   A 1 7   ? 3.376   23.515 62.507  0.60 31.41 ? 7   C   C "C1'" 1 
ATOM   282  C "C1'" B C   A 1 7   ? 2.393   22.749 63.615  0.40 67.02 ? 7   C   C "C1'" 1 
ATOM   283  N N1    A C   A 1 7   ? 2.078   24.187 62.374  0.60 33.00 ? 7   C   C N1    1 
ATOM   284  N N1    B C   A 1 7   ? 1.208   23.443 63.080  0.40 67.63 ? 7   C   C N1    1 
ATOM   285  C C2    A C   A 1 7   ? 2.041   25.586 62.393  0.60 34.36 ? 7   C   C C2    1 
ATOM   286  C C2    B C   A 1 7   ? 1.378   24.677 62.443  0.40 68.06 ? 7   C   C C2    1 
ATOM   287  O O2    A C   A 1 7   ? 3.103   26.215 62.521  0.60 34.14 ? 7   C   C O2    1 
ATOM   288  O O2    B C   A 1 7   ? 2.522   25.146 62.336  0.40 68.40 ? 7   C   C O2    1 
ATOM   289  N N3    A C   A 1 7   ? 0.849   26.215 62.274  0.60 34.66 ? 7   C   C N3    1 
ATOM   290  N N3    B C   A 1 7   ? 0.292   25.327 61.960  0.40 67.92 ? 7   C   C N3    1 
ATOM   291  C C4    A C   A 1 7   ? -0.271  25.502 62.139  0.60 33.64 ? 7   C   C C4    1 
ATOM   292  C C4    B C   A 1 7   ? -0.923  24.791 62.098  0.40 68.00 ? 7   C   C C4    1 
ATOM   293  N N4    A C   A 1 7   ? -1.421  26.163 62.024  0.60 35.35 ? 7   C   C N4    1 
ATOM   294  N N4    B C   A 1 7   ? -1.965  25.472 61.614  0.40 68.60 ? 7   C   C N4    1 
ATOM   295  C C5    A C   A 1 7   ? -0.260  24.079 62.116  0.60 33.41 ? 7   C   C C5    1 
ATOM   296  C C5    B C   A 1 7   ? -1.124  23.534 62.739  0.40 67.95 ? 7   C   C C5    1 
ATOM   297  C C6    A C   A 1 7   ? 0.924   23.467 62.237  0.60 33.68 ? 7   C   C C6    1 
ATOM   298  C C6    B C   A 1 7   ? -0.041  22.900 63.209  0.40 67.92 ? 7   C   C C6    1 
ATOM   299  P P     A G   A 1 8   ? 3.281   21.837 67.008  0.60 30.60 ? 8   G   C P     1 
ATOM   300  P P     B G   A 1 8   ? 1.314   22.317 68.210  0.40 64.25 ? 8   G   C P     1 
ATOM   301  O OP1   A G   A 1 8   ? 4.208   21.204 67.982  0.60 30.40 ? 8   G   C OP1   1 
ATOM   302  O OP1   B G   A 1 8   ? 1.687   21.656 69.489  0.40 64.35 ? 8   G   C OP1   1 
ATOM   303  O OP2   A G   A 1 8   ? 1.873   21.364 66.935  0.60 30.15 ? 8   G   C OP2   1 
ATOM   304  O OP2   B G   A 1 8   ? -0.118  22.437 67.835  0.40 63.48 ? 8   G   C OP2   1 
ATOM   305  O "O5'" A G   A 1 8   ? 3.270   23.422 67.223  0.60 28.43 ? 8   G   C "O5'" 1 
ATOM   306  O "O5'" B G   A 1 8   ? 1.962   23.772 68.166  0.40 63.67 ? 8   G   C "O5'" 1 
ATOM   307  C "C5'" A G   A 1 8   ? 4.490   24.146 67.352  0.60 29.83 ? 8   G   C "C5'" 1 
ATOM   308  C "C5'" B G   A 1 8   ? 3.367   23.947 68.336  0.40 62.78 ? 8   G   C "C5'" 1 
ATOM   309  C "C4'" A G   A 1 8   ? 4.245   25.647 67.416  0.60 30.03 ? 8   G   C "C4'" 1 
ATOM   310  C "C4'" B G   A 1 8   ? 3.759   25.380 68.063  0.40 62.22 ? 8   G   C "C4'" 1 
ATOM   311  O "O4'" A G   A 1 8   ? 3.652   26.120 66.175  0.60 30.72 ? 8   G   C "O4'" 1 
ATOM   312  O "O4'" B G   A 1 8   ? 3.653   25.664 66.641  0.40 62.31 ? 8   G   C "O4'" 1 
ATOM   313  C "C3'" A G   A 1 8   ? 3.299   26.209 68.469  0.60 30.77 ? 8   G   C "C3'" 1 
ATOM   314  C "C3'" B G   A 1 8   ? 2.883   26.437 68.711  0.40 61.56 ? 8   G   C "C3'" 1 
ATOM   315  O "O3'" A G   A 1 8   ? 3.895   26.298 69.763  0.60 32.75 ? 8   G   C "O3'" 1 
ATOM   316  O "O3'" B G   A 1 8   ? 3.215   26.641 70.078  0.40 60.65 ? 8   G   C "O3'" 1 
ATOM   317  C "C2'" A G   A 1 8   ? 3.074   27.611 67.923  0.60 30.22 ? 8   G   C "C2'" 1 
ATOM   318  C "C2'" B G   A 1 8   ? 3.188   27.646 67.842  0.40 61.68 ? 8   G   C "C2'" 1 
ATOM   319  O "O2'" A G   A 1 8   ? 4.187   28.440 68.159  0.60 31.21 ? 8   G   C "O2'" 1 
ATOM   320  O "O2'" B G   A 1 8   ? 4.457   28.199 68.116  0.40 61.66 ? 8   G   C "O2'" 1 
ATOM   321  C "C1'" A G   A 1 8   ? 2.966   27.340 66.423  0.60 30.13 ? 8   G   C "C1'" 1 
ATOM   322  C "C1'" B G   A 1 8   ? 3.202   26.999 66.457  0.40 62.16 ? 8   G   C "C1'" 1 
ATOM   323  N N9    A G   A 1 8   ? 1.566   27.206 66.030  0.60 30.03 ? 8   G   C N9    1 
ATOM   324  N N9    B G   A 1 8   ? 1.860   26.945 65.887  0.40 62.66 ? 8   G   C N9    1 
ATOM   325  C C8    A G   A 1 8   ? 0.836   26.049 65.903  0.60 29.03 ? 8   G   C C8    1 
ATOM   326  C C8    B G   A 1 8   ? 1.121   25.820 65.615  0.40 62.60 ? 8   G   C C8    1 
ATOM   327  N N7    A G   A 1 8   ? -0.416  26.266 65.601  0.60 28.91 ? 8   G   C N7    1 
ATOM   328  N N7    B G   A 1 8   ? -0.061  26.088 65.131  0.40 62.65 ? 8   G   C N7    1 
ATOM   329  C C5    A G   A 1 8   ? -0.518  27.650 65.511  0.60 28.15 ? 8   G   C C5    1 
ATOM   330  C C5    B G   A 1 8   ? -0.103  27.474 65.076  0.40 62.84 ? 8   G   C C5    1 
ATOM   331  C C6    A G   A 1 8   ? -1.642  28.482 65.219  0.60 28.07 ? 8   G   C C6    1 
ATOM   332  C C6    B G   A 1 8   ? -1.133  28.345 64.642  0.40 63.12 ? 8   G   C C6    1 
ATOM   333  O O6    A G   A 1 8   ? -2.813  28.150 64.976  0.60 24.61 ? 8   G   C O6    1 
ATOM   334  O O6    B G   A 1 8   ? -2.256  28.054 64.203  0.40 62.97 ? 8   G   C O6    1 
ATOM   335  N N1    A G   A 1 8   ? -1.293  29.830 65.225  0.60 28.09 ? 8   G   C N1    1 
ATOM   336  N N1    B G   A 1 8   ? -0.754  29.679 64.755  0.40 63.08 ? 8   G   C N1    1 
ATOM   337  C C2    A G   A 1 8   ? -0.035  30.319 65.473  0.60 27.68 ? 8   G   C C2    1 
ATOM   338  C C2    B G   A 1 8   ? 0.458   30.120 65.225  0.40 62.57 ? 8   G   C C2    1 
ATOM   339  N N2    A G   A 1 8   ? 0.101   31.651 65.418  0.60 26.27 ? 8   G   C N2    1 
ATOM   340  N N2    B G   A 1 8   ? 0.635   31.447 65.254  0.40 62.23 ? 8   G   C N2    1 
ATOM   341  N N3    A G   A 1 8   ? 1.012   29.560 65.749  0.60 28.05 ? 8   G   C N3    1 
ATOM   342  N N3    B G   A 1 8   ? 1.424   29.318 65.635  0.40 62.79 ? 8   G   C N3    1 
ATOM   343  C C4    A G   A 1 8   ? 0.700   28.245 65.754  0.60 28.92 ? 8   G   C C4    1 
ATOM   344  C C4    B G   A 1 8   ? 1.078   28.018 65.534  0.40 62.83 ? 8   G   C C4    1 
ATOM   345  P P     A U   A 1 9   ? 2.971   26.201 71.082  0.60 32.75 ? 9   U   C P     1 
ATOM   346  P P     B U   A 1 9   ? 2.075   26.472 71.198  0.40 60.10 ? 9   U   C P     1 
ATOM   347  O OP1   A U   A 1 9   ? 3.867   26.334 72.253  0.60 34.46 ? 9   U   C OP1   1 
ATOM   348  O OP1   B U   A 1 9   ? 2.749   26.077 72.460  0.40 59.88 ? 9   U   C OP1   1 
ATOM   349  O OP2   A U   A 1 9   ? 2.090   25.010 70.970  0.60 31.98 ? 9   U   C OP2   1 
ATOM   350  O OP2   B U   A 1 9   ? 1.008   25.604 70.632  0.40 59.20 ? 9   U   C OP2   1 
ATOM   351  O "O5'" A U   A 1 9   ? 2.067   27.513 71.026  0.60 31.56 ? 9   U   C "O5'" 1 
ATOM   352  O "O5'" B U   A 1 9   ? 1.479   27.940 71.372  0.40 58.44 ? 9   U   C "O5'" 1 
ATOM   353  C "C5'" A U   A 1 9   ? 2.673   28.793 70.981  0.60 30.46 ? 9   U   C "C5'" 1 
ATOM   354  C "C5'" B U   A 1 9   ? 2.329   29.033 71.697  0.40 57.81 ? 9   U   C "C5'" 1 
ATOM   355  C "C4'" A U   A 1 9   ? 1.648   29.879 70.710  0.60 32.03 ? 9   U   C "C4'" 1 
ATOM   356  C "C4'" B U   A 1 9   ? 1.704   30.340 71.259  0.40 57.13 ? 9   U   C "C4'" 1 
ATOM   357  O "O4'" A U   A 1 9   ? 1.097   29.781 69.365  0.60 30.89 ? 9   U   C "O4'" 1 
ATOM   358  O "O4'" B U   A 1 9   ? 1.531   30.336 69.815  0.40 57.28 ? 9   U   C "O4'" 1 
ATOM   359  C "C3'" A U   A 1 9   ? 0.391   29.969 71.563  0.60 30.51 ? 9   U   C "C3'" 1 
ATOM   360  C "C3'" B U   A 1 9   ? 0.310   30.645 71.786  0.40 55.63 ? 9   U   C "C3'" 1 
ATOM   361  O "O3'" A U   A 1 9   ? 0.662   30.519 72.845  0.60 30.83 ? 9   U   C "O3'" 1 
ATOM   362  O "O3'" B U   A 1 9   ? 0.349   31.197 73.096  0.40 53.33 ? 9   U   C "O3'" 1 
ATOM   363  C "C2'" A U   A 1 9   ? -0.400  30.982 70.753  0.60 29.94 ? 9   U   C "C2'" 1 
ATOM   364  C "C2'" B U   A 1 9   ? -0.172  31.673 70.775  0.40 56.50 ? 9   U   C "C2'" 1 
ATOM   365  O "O2'" A U   A 1 9   ? 0.141   32.271 70.945  0.60 30.42 ? 9   U   C "O2'" 1 
ATOM   366  O "O2'" B U   A 1 9   ? 0.392   32.950 71.002  0.40 57.30 ? 9   U   C "O2'" 1 
ATOM   367  C "C1'" A U   A 1 9   ? -0.112  30.526 69.319  0.60 29.09 ? 9   U   C "C1'" 1 
ATOM   368  C "C1'" B U   A 1 9   ? 0.373   31.083 69.473  0.40 56.96 ? 9   U   C "C1'" 1 
ATOM   369  N N1    A U   A 1 9   ? -1.210  29.683 68.823  0.60 27.03 ? 9   U   C N1    1 
ATOM   370  N N1    B U   A 1 9   ? -0.604  30.176 68.855  0.40 57.34 ? 9   U   C N1    1 
ATOM   371  C C2    A U   A 1 9   ? -2.309  30.341 68.287  0.60 26.71 ? 9   U   C C2    1 
ATOM   372  C C2    B U   A 1 9   ? -1.505  30.721 67.962  0.40 57.81 ? 9   U   C C2    1 
ATOM   373  O O2    A U   A 1 9   ? -2.330  31.546 68.110  0.60 27.47 ? 9   U   C O2    1 
ATOM   374  O O2    B U   A 1 9   ? -1.478  31.893 67.633  0.40 57.98 ? 9   U   C O2    1 
ATOM   375  N N3    A U   A 1 9   ? -3.374  29.536 67.960  0.60 24.32 ? 9   U   C N3    1 
ATOM   376  N N3    B U   A 1 9   ? -2.435  29.842 67.464  0.40 58.26 ? 9   U   C N3    1 
ATOM   377  C C4    A U   A 1 9   ? -3.442  28.166 68.088  0.60 24.40 ? 9   U   C C4    1 
ATOM   378  C C4    B U   A 1 9   ? -2.544  28.498 67.756  0.40 58.26 ? 9   U   C C4    1 
ATOM   379  O O4    A U   A 1 9   ? -4.524  27.598 67.914  0.60 23.22 ? 9   U   C O4    1 
ATOM   380  O O4    B U   A 1 9   ? -3.484  27.853 67.289  0.40 59.42 ? 9   U   C O4    1 
ATOM   381  C C5    A U   A 1 9   ? -2.239  27.554 68.578  0.60 24.21 ? 9   U   C C5    1 
ATOM   382  C C5    B U   A 1 9   ? -1.555  28.004 68.663  0.40 57.73 ? 9   U   C C5    1 
ATOM   383  C C6    A U   A 1 9   ? -1.190  28.317 68.922  0.60 24.81 ? 9   U   C C6    1 
ATOM   384  C C6    B U   A 1 9   ? -0.642  28.838 69.169  0.40 57.06 ? 9   U   C C6    1 
ATOM   385  P P     A C   A 1 10  ? -0.472  30.498 73.991  0.60 33.15 ? 10  C   C P     1 
ATOM   386  P P     B C   A 1 10  ? -0.994  31.246 73.980  0.40 51.23 ? 10  C   C P     1 
ATOM   387  O OP1   A C   A 1 10  ? 0.178   31.040 75.214  0.60 30.36 ? 10  C   C OP1   1 
ATOM   388  O OP1   B C   A 1 10  ? -0.586  31.630 75.353  0.40 51.39 ? 10  C   C OP1   1 
ATOM   389  O OP2   A C   A 1 10  ? -1.122  29.159 74.031  0.60 31.40 ? 10  C   C OP2   1 
ATOM   390  O OP2   B C   A 1 10  ? -1.753  29.989 73.764  0.40 51.19 ? 10  C   C OP2   1 
ATOM   391  O "O5'" A C   A 1 10  ? -1.562  31.552 73.513  0.60 30.31 ? 10  C   C "O5'" 1 
ATOM   392  O "O5'" B C   A 1 10  ? -1.829  32.452 73.358  0.40 50.06 ? 10  C   C "O5'" 1 
ATOM   393  C "C5'" A C   A 1 10  ? -1.248  32.932 73.422  0.60 32.39 ? 10  C   C "C5'" 1 
ATOM   394  C "C5'" B C   A 1 10  ? -1.351  33.791 73.454  0.40 48.90 ? 10  C   C "C5'" 1 
ATOM   395  C "C4'" A C   A 1 10  ? -2.392  33.682 72.789  0.60 33.59 ? 10  C   C "C4'" 1 
ATOM   396  C "C4'" B C   A 1 10  ? -2.449  34.775 73.119  0.40 48.01 ? 10  C   C "C4'" 1 
ATOM   397  O "O4'" A C   A 1 10  ? -2.675  33.107 71.484  0.60 35.03 ? 10  C   C "O4'" 1 
ATOM   398  O "O4'" B C   A 1 10  ? -2.781  34.695 71.705  0.40 47.92 ? 10  C   C "O4'" 1 
ATOM   399  C "C3'" A C   A 1 10  ? -3.723  33.601 73.520  0.60 33.54 ? 10  C   C "C3'" 1 
ATOM   400  C "C3'" B C   A 1 10  ? -3.783  34.560 73.811  0.40 47.54 ? 10  C   C "C3'" 1 
ATOM   401  O "O3'" A C   A 1 10  ? -3.781  34.599 74.528  0.60 33.65 ? 10  C   C "O3'" 1 
ATOM   402  O "O3'" B C   A 1 10  ? -3.785  35.057 75.144  0.40 47.53 ? 10  C   C "O3'" 1 
ATOM   403  C "C2'" A C   A 1 10  ? -4.712  33.914 72.406  0.60 34.86 ? 10  C   C "C2'" 1 
ATOM   404  C "C2'" B C   A 1 10  ? -4.728  35.338 72.902  0.40 47.31 ? 10  C   C "C2'" 1 
ATOM   405  O "O2'" A C   A 1 10  ? -4.798  35.302 72.141  0.60 35.98 ? 10  C   C "O2'" 1 
ATOM   406  O "O2'" B C   A 1 10  ? -4.694  36.737 73.115  0.40 45.00 ? 10  C   C "O2'" 1 
ATOM   407  C "C1'" A C   A 1 10  ? -4.063  33.207 71.214  0.60 34.97 ? 10  C   C "C1'" 1 
ATOM   408  C "C1'" B C   A 1 10  ? -4.157  35.000 71.522  0.40 47.25 ? 10  C   C "C1'" 1 
ATOM   409  N N1    A C   A 1 10  ? -4.593  31.858 70.986  0.60 34.77 ? 10  C   C N1    1 
ATOM   410  N N1    B C   A 1 10  ? -4.821  33.829 70.928  0.40 47.13 ? 10  C   C N1    1 
ATOM   411  C C2    A C   A 1 10  ? -5.876  31.733 70.460  0.60 35.79 ? 10  C   C C2    1 
ATOM   412  C C2    B C   A 1 10  ? -6.037  34.009 70.262  0.40 47.10 ? 10  C   C C2    1 
ATOM   413  O O2    A C   A 1 10  ? -6.522  32.760 70.210  0.60 36.65 ? 10  C   C O2    1 
ATOM   414  O O2    B C   A 1 10  ? -6.508  35.151 70.168  0.40 46.92 ? 10  C   C O2    1 
ATOM   415  N N3    A C   A 1 10  ? -6.383  30.501 70.236  0.60 36.51 ? 10  C   C N3    1 
ATOM   416  N N3    B C   A 1 10  ? -6.667  32.935 69.736  0.40 47.46 ? 10  C   C N3    1 
ATOM   417  C C4    A C   A 1 10  ? -5.655  29.419 70.517  0.60 36.43 ? 10  C   C C4    1 
ATOM   418  C C4    B C   A 1 10  ? -6.123  31.723 69.847  0.40 47.10 ? 10  C   C C4    1 
ATOM   419  N N4    A C   A 1 10  ? -6.194  28.227 70.260  0.60 37.26 ? 10  C   C N4    1 
ATOM   420  N N4    B C   A 1 10  ? -6.779  30.692 69.310  0.40 47.15 ? 10  C   C N4    1 
ATOM   421  C C5    A C   A 1 10  ? -4.342  29.514 71.066  0.60 35.27 ? 10  C   C C5    1 
ATOM   422  C C5    B C   A 1 10  ? -4.880  31.512 70.512  0.40 47.02 ? 10  C   C C5    1 
ATOM   423  C C6    A C   A 1 10  ? -3.853  30.744 71.280  0.60 35.99 ? 10  C   C C6    1 
ATOM   424  C C6    B C   A 1 10  ? -4.269  32.583 71.031  0.40 46.56 ? 10  C   C C6    1 
ATOM   425  P P     A A   A 1 11  ? -4.696  34.375 75.825  0.60 33.29 ? 11  A   C P     1 
ATOM   426  P P     B A   A 1 11  ? -4.579  34.251 76.284  0.40 47.95 ? 11  A   C P     1 
ATOM   427  O OP1   A A   A 1 11  ? -4.465  35.561 76.689  0.60 33.15 ? 11  A   C OP1   1 
ATOM   428  O OP1   B A   A 1 11  ? -4.464  35.021 77.549  0.40 48.29 ? 11  A   C OP1   1 
ATOM   429  O OP2   A A   A 1 11  ? -4.452  33.009 76.358  0.60 34.31 ? 11  A   C OP2   1 
ATOM   430  O OP2   B A   A 1 11  ? -4.145  32.831 76.244  0.40 48.10 ? 11  A   C OP2   1 
ATOM   431  O "O5'" A A   A 1 11  ? -6.193  34.445 75.286  0.60 33.10 ? 11  A   C "O5'" 1 
ATOM   432  O "O5'" B A   A 1 11  ? -6.095  34.320 75.808  0.40 47.03 ? 11  A   C "O5'" 1 
ATOM   433  C "C5'" A A   A 1 11  ? -6.841  35.700 75.131  0.60 31.54 ? 11  A   C "C5'" 1 
ATOM   434  C "C5'" B A   A 1 11  ? -6.689  35.569 75.486  0.40 45.61 ? 11  A   C "C5'" 1 
ATOM   435  C "C4'" A A   A 1 11  ? -8.212  35.521 74.526  0.60 30.09 ? 11  A   C "C4'" 1 
ATOM   436  C "C4'" B A   A 1 11  ? -7.936  35.361 74.667  0.40 44.41 ? 11  A   C "C4'" 1 
ATOM   437  O "O4'" A A   A 1 11  ? -8.089  34.761 73.294  0.60 27.70 ? 11  A   C "O4'" 1 
ATOM   438  O "O4'" B A   A 1 11  ? -7.604  34.654 73.443  0.40 43.29 ? 11  A   C "O4'" 1 
ATOM   439  C "C3'" A A   A 1 11  ? -9.236  34.712 75.309  0.60 30.05 ? 11  A   C "C3'" 1 
ATOM   440  C "C3'" B A   A 1 11  ? -9.002  34.481 75.291  0.40 43.73 ? 11  A   C "C3'" 1 
ATOM   441  O "O3'" A A   A 1 11  ? -9.859  35.478 76.336  0.60 31.58 ? 11  A   C "O3'" 1 
ATOM   442  O "O3'" B A   A 1 11  ? -9.775  35.213 76.233  0.40 43.20 ? 11  A   C "O3'" 1 
ATOM   443  C "C2'" A A   A 1 11  ? -10.237 34.397 74.209  0.60 29.25 ? 11  A   C "C2'" 1 
ATOM   444  C "C2'" B A   A 1 11  ? -9.822  34.097 74.068  0.40 43.89 ? 11  A   C "C2'" 1 
ATOM   445  O "O2'" A A   A 1 11  ? -11.005 35.536 73.879  0.60 29.52 ? 11  A   C "O2'" 1 
ATOM   446  O "O2'" B A   A 1 11  ? -10.666 35.149 73.644  0.40 43.60 ? 11  A   C "O2'" 1 
ATOM   447  C "C1'" A A   A 1 11  ? -9.300  34.064 73.048  0.60 27.12 ? 11  A   C "C1'" 1 
ATOM   448  C "C1'" B A   A 1 11  ? -8.722  33.886 73.027  0.40 43.37 ? 11  A   C "C1'" 1 
ATOM   449  N N9    A A   A 1 11  ? -9.005  32.635 72.973  0.60 25.71 ? 11  A   C N9    1 
ATOM   450  N N9    B A   A 1 11  ? -8.310  32.489 72.905  0.40 43.43 ? 11  A   C N9    1 
ATOM   451  C C8    A A   A 1 11  ? -7.906  31.971 73.448  0.60 26.54 ? 11  A   C C8    1 
ATOM   452  C C8    B A   A 1 11  ? -7.141  31.898 73.318  0.40 44.21 ? 11  A   C C8    1 
ATOM   453  N N7    A A   A 1 11  ? -7.929  30.678 73.223  0.60 26.49 ? 11  A   C N7    1 
ATOM   454  N N7    B A   A 1 11  ? -7.073  30.615 73.048  0.40 43.88 ? 11  A   C N7    1 
ATOM   455  C C5    A A   A 1 11  ? -9.125  30.481 72.552  0.60 26.29 ? 11  A   C C5    1 
ATOM   456  C C5    B A   A 1 11  ? -8.279  30.344 72.417  0.40 43.82 ? 11  A   C C5    1 
ATOM   457  C C6    A A   A 1 11  ? -9.737  29.328 72.021  0.60 26.32 ? 11  A   C C6    1 
ATOM   458  C C6    B A   A 1 11  ? -8.823  29.164 71.878  0.40 43.42 ? 11  A   C C6    1 
ATOM   459  N N6    A A   A 1 11  ? -9.204  28.104 72.079  0.60 22.76 ? 11  A   C N6    1 
ATOM   460  N N6    B A   A 1 11  ? -8.203  27.983 71.893  0.40 43.22 ? 11  A   C N6    1 
ATOM   461  N N1    A A   A 1 11  ? -10.935 29.480 71.417  0.60 27.53 ? 11  A   C N1    1 
ATOM   462  N N1    B A   A 1 11  ? -10.046 29.240 71.314  0.40 43.42 ? 11  A   C N1    1 
ATOM   463  C C2    A A   A 1 11  ? -11.472 30.706 71.352  0.60 28.65 ? 11  A   C C2    1 
ATOM   464  C C2    B A   A 1 11  ? -10.674 30.422 71.301  0.40 44.19 ? 11  A   C C2    1 
ATOM   465  N N3    A A   A 1 11  ? -10.990 31.863 71.804  0.60 27.94 ? 11  A   C N3    1 
ATOM   466  N N3    B A   A 1 11  ? -10.269 31.597 71.776  0.40 43.91 ? 11  A   C N3    1 
ATOM   467  C C4    A A   A 1 11  ? -9.801  31.678 72.399  0.60 26.07 ? 11  A   C C4    1 
ATOM   468  C C4    B A   A 1 11  ? -9.050  31.489 72.326  0.40 43.57 ? 11  A   C C4    1 
ATOM   469  P P     A C   A 1 12  ? -10.754 34.740 77.455  0.60 29.96 ? 12  C   C P     1 
ATOM   470  P P     B C   A 1 12  ? -10.339 34.476 77.543  0.40 41.53 ? 12  C   C P     1 
ATOM   471  O OP1   A C   A 1 12  ? -11.056 35.752 78.495  0.60 31.75 ? 12  C   C OP1   1 
ATOM   472  O OP1   B C   A 1 12  ? -10.518 35.511 78.593  0.40 42.56 ? 12  C   C OP1   1 
ATOM   473  O OP2   A C   A 1 12  ? -10.106 33.458 77.836  0.60 30.69 ? 12  C   C OP2   1 
ATOM   474  O OP2   B C   A 1 12  ? -9.488  33.287 77.813  0.40 42.04 ? 12  C   C OP2   1 
ATOM   475  O "O5'" A C   A 1 12  ? -12.120 34.401 76.713  0.60 28.76 ? 12  C   C "O5'" 1 
ATOM   476  O "O5'" B C   A 1 12  ? -11.777 33.960 77.101  0.40 40.11 ? 12  C   C "O5'" 1 
ATOM   477  C "C5'" A C   A 1 12  ? -13.061 35.420 76.445  0.60 25.38 ? 12  C   C "C5'" 1 
ATOM   478  C "C5'" B C   A 1 12  ? -12.661 34.805 76.381  0.40 36.07 ? 12  C   C "C5'" 1 
ATOM   479  C "C4'" A C   A 1 12  ? -14.231 34.861 75.680  0.60 25.86 ? 12  C   C "C4'" 1 
ATOM   480  C "C4'" B C   A 1 12  ? -13.611 33.974 75.561  0.40 34.81 ? 12  C   C "C4'" 1 
ATOM   481  O "O4'" A C   A 1 12  ? -13.732 34.200 74.489  0.60 25.54 ? 12  C   C "O4'" 1 
ATOM   482  O "O4'" B C   A 1 12  ? -12.868 33.254 74.543  0.40 34.91 ? 12  C   C "O4'" 1 
ATOM   483  C "C3'" A C   A 1 12  ? -15.068 33.790 76.365  0.60 25.78 ? 12  C   C "C3'" 1 
ATOM   484  C "C3'" B C   A 1 12  ? -14.318 32.862 76.317  0.40 33.68 ? 12  C   C "C3'" 1 
ATOM   485  O "O3'" A C   A 1 12  ? -16.049 34.386 77.201  0.60 27.31 ? 12  C   C "O3'" 1 
ATOM   486  O "O3'" B C   A 1 12  ? -15.433 33.343 77.051  0.40 29.96 ? 12  C   C "O3'" 1 
ATOM   487  C "C2'" A C   A 1 12  ? -15.733 33.135 75.169  0.60 24.91 ? 12  C   C "C2'" 1 
ATOM   488  C "C2'" B C   A 1 12  ? -14.738 31.934 75.188  0.40 34.22 ? 12  C   C "C2'" 1 
ATOM   489  O "O2'" A C   A 1 12  ? -16.764 33.958 74.662  0.60 24.70 ? 12  C   C "O2'" 1 
ATOM   490  O "O2'" B C   A 1 12  ? -15.891 32.396 74.522  0.40 34.34 ? 12  C   C "O2'" 1 
ATOM   491  C "C1'" A C   A 1 12  ? -14.571 33.101 74.174  0.60 26.10 ? 12  C   C "C1'" 1 
ATOM   492  C "C1'" B C   A 1 12  ? -13.529 32.031 74.255  0.40 35.80 ? 12  C   C "C1'" 1 
ATOM   493  N N1    A C   A 1 12  ? -13.776 31.872 74.304  0.60 26.33 ? 12  C   C N1    1 
ATOM   494  N N1    B C   A 1 12  ? -12.585 30.918 74.433  0.40 36.72 ? 12  C   C N1    1 
ATOM   495  C C2    A C   A 1 12  ? -14.100 30.781 73.504  0.60 25.87 ? 12  C   C C2    1 
ATOM   496  C C2    B C   A 1 12  ? -12.930 29.674 73.912  0.40 37.61 ? 12  C   C C2    1 
ATOM   497  O O2    A C   A 1 12  ? -15.034 30.891 72.688  0.60 27.56 ? 12  C   C O2    1 
ATOM   498  O O2    B C   A 1 12  ? -14.009 29.558 73.319  0.40 38.85 ? 12  C   C O2    1 
ATOM   499  N N3    A C   A 1 12  ? -13.395 29.636 73.635  0.60 25.28 ? 12  C   C N3    1 
ATOM   500  N N3    B C   A 1 12  ? -12.086 28.630 74.065  0.40 37.78 ? 12  C   C N3    1 
ATOM   501  C C4    A C   A 1 12  ? -12.403 29.560 74.522  0.60 22.98 ? 12  C   C C4    1 
ATOM   502  C C4    B C   A 1 12  ? -10.931 28.796 74.707  0.40 38.16 ? 12  C   C C4    1 
ATOM   503  N N4    A C   A 1 12  ? -11.747 28.403 74.627  0.60 20.48 ? 12  C   C N4    1 
ATOM   504  N N4    B C   A 1 12  ? -10.130 27.732 74.829  0.40 39.12 ? 12  C   C N4    1 
ATOM   505  C C5    A C   A 1 12  ? -12.043 30.665 75.343  0.60 23.35 ? 12  C   C C5    1 
ATOM   506  C C5    B C   A 1 12  ? -10.547 30.058 75.251  0.40 38.05 ? 12  C   C C5    1 
ATOM   507  C C6    A C   A 1 12  ? -12.746 31.792 75.201  0.60 24.05 ? 12  C   C C6    1 
ATOM   508  C C6    B C   A 1 12  ? -11.399 31.084 75.092  0.40 37.62 ? 12  C   C C6    1 
ATOM   509  P P     A G   A 1 13  ? -16.548 33.627 78.521  0.60 27.87 ? 13  G   C P     1 
ATOM   510  P P     B G   A 1 13  ? -15.827 32.633 78.434  0.40 28.38 ? 13  G   C P     1 
ATOM   511  O OP1   A G   A 1 13  ? -17.333 34.632 79.281  0.60 28.73 ? 13  G   C OP1   1 
ATOM   512  O OP1   B G   A 1 13  ? -16.633 33.589 79.230  0.40 27.89 ? 13  G   C OP1   1 
ATOM   513  O OP2   A G   A 1 13  ? -15.409 32.944 79.172  0.60 27.21 ? 13  G   C OP2   1 
ATOM   514  O OP2   B G   A 1 13  ? -14.597 32.044 79.024  0.40 28.30 ? 13  G   C OP2   1 
ATOM   515  O "O5'" A G   A 1 13  ? -17.540 32.509 77.968  0.60 30.48 ? 13  G   C "O5'" 1 
ATOM   516  O "O5'" B G   A 1 13  ? -16.751 31.423 77.975  0.40 28.28 ? 13  G   C "O5'" 1 
ATOM   517  C "C5'" A G   A 1 13  ? -18.758 32.867 77.326  0.60 32.14 ? 13  G   C "C5'" 1 
ATOM   518  C "C5'" B G   A 1 13  ? -17.912 31.647 77.186  0.40 26.31 ? 13  G   C "C5'" 1 
ATOM   519  C "C4'" A G   A 1 13  ? -19.475 31.630 76.829  0.60 35.46 ? 13  G   C "C4'" 1 
ATOM   520  C "C4'" B G   A 1 13  ? -18.494 30.330 76.737  0.40 24.80 ? 13  G   C "C4'" 1 
ATOM   521  O "O4'" A G   A 1 13  ? -18.706 31.012 75.761  0.60 35.90 ? 13  G   C "O4'" 1 
ATOM   522  O "O4'" B G   A 1 13  ? -17.689 29.752 75.676  0.40 22.91 ? 13  G   C "O4'" 1 
ATOM   523  C "C3'" A G   A 1 13  ? -19.663 30.506 77.836  0.60 35.39 ? 13  G   C "C3'" 1 
ATOM   524  C "C3'" B G   A 1 13  ? -18.509 29.256 77.804  0.40 24.12 ? 13  G   C "C3'" 1 
ATOM   525  O "O3'" A G   A 1 13  ? -20.795 30.743 78.659  0.60 36.19 ? 13  G   C "O3'" 1 
ATOM   526  O "O3'" B G   A 1 13  ? -19.590 29.429 78.704  0.40 24.02 ? 13  G   C "O3'" 1 
ATOM   527  C "C2'" A G   A 1 13  ? -19.880 29.310 76.921  0.60 35.77 ? 13  G   C "C2'" 1 
ATOM   528  C "C2'" B G   A 1 13  ? -18.601 27.990 76.966  0.40 23.94 ? 13  G   C "C2'" 1 
ATOM   529  O "O2'" A G   A 1 13  ? -21.177 29.281 76.371  0.60 37.03 ? 13  G   C "O2'" 1 
ATOM   530  O "O2'" B G   A 1 13  ? -19.898 27.768 76.445  0.40 22.75 ? 13  G   C "O2'" 1 
ATOM   531  C "C1'" A G   A 1 13  ? -18.885 29.609 75.800  0.60 36.17 ? 13  G   C "C1'" 1 
ATOM   532  C "C1'" B G   A 1 13  ? -17.657 28.338 75.817  0.40 23.42 ? 13  G   C "C1'" 1 
ATOM   533  N N9    A G   A 1 13  ? -17.588 28.995 76.033  0.60 35.76 ? 13  G   C N9    1 
ATOM   534  N N9    B G   A 1 13  ? -16.270 27.938 76.047  0.40 25.41 ? 13  G   C N9    1 
ATOM   535  C C8    A G   A 1 13  ? -16.451 29.607 76.499  0.60 37.05 ? 13  G   C C8    1 
ATOM   536  C C8    B G   A 1 13  ? -15.223 28.762 76.384  0.40 25.34 ? 13  G   C C8    1 
ATOM   537  N N7    A G   A 1 13  ? -15.440 28.789 76.612  0.60 37.57 ? 13  G   C N7    1 
ATOM   538  N N7    B G   A 1 13  ? -14.082 28.134 76.474  0.40 25.73 ? 13  G   C N7    1 
ATOM   539  C C5    A G   A 1 13  ? -15.943 27.567 76.192  0.60 38.35 ? 13  G   C C5    1 
ATOM   540  C C5    B G   A 1 13  ? -14.391 26.811 76.186  0.40 25.84 ? 13  G   C C5    1 
ATOM   541  C C6    A G   A 1 13  ? -15.313 26.301 76.092  0.60 39.32 ? 13  G   C C6    1 
ATOM   542  C C6    B G   A 1 13  ? -13.551 25.661 76.110  0.40 25.88 ? 13  G   C C6    1 
ATOM   543  O O6    A G   A 1 13  ? -14.135 26.003 76.347  0.60 38.95 ? 13  G   C O6    1 
ATOM   544  O O6    B G   A 1 13  ? -12.321 25.584 76.265  0.40 24.94 ? 13  G   C O6    1 
ATOM   545  N N1    A G   A 1 13  ? -16.198 25.327 75.633  0.60 39.36 ? 13  G   C N1    1 
ATOM   546  N N1    B G   A 1 13  ? -14.283 24.518 75.806  0.40 26.85 ? 13  G   C N1    1 
ATOM   547  C C2    A G   A 1 13  ? -17.515 25.549 75.299  0.60 39.31 ? 13  G   C C2    1 
ATOM   548  C C2    B G   A 1 13  ? -15.640 24.480 75.593  0.40 26.57 ? 13  G   C C2    1 
ATOM   549  N N2    A G   A 1 13  ? -18.217 24.483 74.878  0.60 40.74 ? 13  G   C N2    1 
ATOM   550  N N2    B G   A 1 13  ? -16.158 23.275 75.325  0.40 26.82 ? 13  G   C N2    1 
ATOM   551  N N3    A G   A 1 13  ? -18.105 26.729 75.375  0.60 38.05 ? 13  G   C N3    1 
ATOM   552  N N3    B G   A 1 13  ? -16.429 25.543 75.642  0.40 26.57 ? 13  G   C N3    1 
ATOM   553  C C4    A G   A 1 13  ? -17.268 27.682 75.830  0.60 37.00 ? 13  G   C C4    1 
ATOM   554  C C4    B G   A 1 13  ? -15.743 26.668 75.941  0.40 26.50 ? 13  G   C C4    1 
ATOM   555  P P     A C   A 1 14  ? -20.848 30.123 80.139  0.60 36.11 ? 14  C   C P     1 
ATOM   556  P P     B C   A 1 14  ? -19.409 29.002 80.241  0.40 25.09 ? 14  C   C P     1 
ATOM   557  O OP1   A C   A 1 14  ? -22.086 30.653 80.752  0.60 36.39 ? 14  C   C OP1   1 
ATOM   558  O OP1   B C   A 1 14  ? -20.641 29.415 80.953  0.40 24.44 ? 14  C   C OP1   1 
ATOM   559  O OP2   A C   A 1 14  ? -19.545 30.327 80.826  0.60 36.80 ? 14  C   C OP2   1 
ATOM   560  O OP2   B C   A 1 14  ? -18.087 29.469 80.731  0.40 24.25 ? 14  C   C OP2   1 
ATOM   561  O "O5'" A C   A 1 14  ? -21.029 28.561 79.888  0.60 38.24 ? 14  C   C "O5'" 1 
ATOM   562  O "O5'" B C   A 1 14  ? -19.384 27.417 80.158  0.40 24.56 ? 14  C   C "O5'" 1 
ATOM   563  C "C5'" A C   A 1 14  ? -22.202 28.055 79.255  0.60 40.32 ? 14  C   C "C5'" 1 
ATOM   564  C "C5'" B C   A 1 14  ? -20.531 26.712 79.708  0.40 27.58 ? 14  C   C "C5'" 1 
ATOM   565  C "C4'" A C   A 1 14  ? -22.083 26.565 79.037  0.60 42.22 ? 14  C   C "C4'" 1 
ATOM   566  C "C4'" B C   A 1 14  ? -20.274 25.231 79.729  0.40 28.75 ? 14  C   C "C4'" 1 
ATOM   567  O "O4'" A C   A 1 14  ? -21.020 26.298 78.080  0.60 40.61 ? 14  C   C "O4'" 1 
ATOM   568  O "O4'" B C   A 1 14  ? -19.335 24.893 78.678  0.40 28.47 ? 14  C   C "O4'" 1 
ATOM   569  C "C3'" A C   A 1 14  ? -21.671 25.750 80.252  0.60 43.96 ? 14  C   C "C3'" 1 
ATOM   570  C "C3'" B C   A 1 14  ? -19.625 24.691 80.993  0.40 29.29 ? 14  C   C "C3'" 1 
ATOM   571  O "O3'" A C   A 1 14  ? -22.745 25.473 81.139  0.60 44.71 ? 14  C   C "O3'" 1 
ATOM   572  O "O3'" B C   A 1 14  ? -20.585 24.473 82.020  0.40 32.30 ? 14  C   C "O3'" 1 
ATOM   573  C "C2'" A C   A 1 14  ? -21.138 24.480 79.605  0.60 43.48 ? 14  C   C "C2'" 1 
ATOM   574  C "C2'" B C   A 1 14  ? -19.024 23.392 80.484  0.40 29.11 ? 14  C   C "C2'" 1 
ATOM   575  O "O2'" A C   A 1 14  ? -22.176 23.614 79.189  0.60 45.92 ? 14  C   C "O2'" 1 
ATOM   576  O "O2'" B C   A 1 14  ? -20.002 22.387 80.327  0.40 29.58 ? 14  C   C "O2'" 1 
ATOM   577  C "C1'" A C   A 1 14  ? -20.404 25.057 78.393  0.60 41.90 ? 14  C   C "C1'" 1 
ATOM   578  C "C1'" B C   A 1 14  ? -18.508 23.827 79.110  0.40 28.70 ? 14  C   C "C1'" 1 
ATOM   579  N N1    A C   A 1 14  ? -18.980 25.297 78.675  0.60 40.91 ? 14  C   C N1    1 
ATOM   580  N N1    B C   A 1 14  ? -17.119 24.311 79.166  0.40 28.10 ? 14  C   C N1    1 
ATOM   581  C C2    A C   A 1 14  ? -18.094 24.214 78.611  0.60 40.57 ? 14  C   C C2    1 
ATOM   582  C C2    B C   A 1 14  ? -16.094 23.400 78.941  0.40 27.99 ? 14  C   C C2    1 
ATOM   583  O O2    A C   A 1 14  ? -18.541 23.088 78.336  0.60 40.49 ? 14  C   C O2    1 
ATOM   584  O O2    B C   A 1 14  ? -16.391 22.227 78.670  0.40 29.79 ? 14  C   C O2    1 
ATOM   585  N N3    A C   A 1 14  ? -16.778 24.419 78.858  0.60 39.48 ? 14  C   C N3    1 
ATOM   586  N N3    B C   A 1 14  ? -14.809 23.815 79.023  0.40 26.81 ? 14  C   C N3    1 
ATOM   587  C C4    A C   A 1 14  ? -16.340 25.639 79.173  0.60 38.32 ? 14  C   C C4    1 
ATOM   588  C C4    B C   A 1 14  ? -14.536 25.089 79.313  0.40 25.26 ? 14  C   C C4    1 
ATOM   589  N N4    A C   A 1 14  ? -15.035 25.786 79.417  0.60 36.54 ? 14  C   C N4    1 
ATOM   590  N N4    B C   A 1 14  ? -13.254 25.448 79.400  0.40 23.21 ? 14  C   C N4    1 
ATOM   591  C C5    A C   A 1 14  ? -17.220 26.760 79.252  0.60 38.60 ? 14  C   C C5    1 
ATOM   592  C C5    B C   A 1 14  ? -15.567 26.047 79.531  0.40 25.00 ? 14  C   C C5    1 
ATOM   593  C C6    A C   A 1 14  ? -18.521 26.547 78.996  0.60 39.95 ? 14  C   C C6    1 
ATOM   594  C C6    B C   A 1 14  ? -16.832 25.619 79.447  0.40 26.92 ? 14  C   C C6    1 
ATOM   595  P P     A G   A 1 15  ? -22.421 25.092 82.665  0.60 46.03 ? 15  G   C P     1 
ATOM   596  P P     B G   A 1 15  ? -20.100 24.283 83.544  0.40 34.02 ? 15  G   C P     1 
ATOM   597  O OP1   A G   A 1 15  ? -23.703 24.753 83.325  0.60 47.98 ? 15  G   C OP1   1 
ATOM   598  O OP1   B G   A 1 15  ? -21.299 23.831 84.293  0.40 32.81 ? 15  G   C OP1   1 
ATOM   599  O OP2   A G   A 1 15  ? -21.559 26.157 83.237  0.60 46.65 ? 15  G   C OP2   1 
ATOM   600  O OP2   B G   A 1 15  ? -19.368 25.495 84.002  0.40 32.74 ? 15  G   C OP2   1 
ATOM   601  O "O5'" A G   A 1 15  ? -21.550 23.761 82.557  0.60 47.02 ? 15  G   C "O5'" 1 
ATOM   602  O "O5'" B G   A 1 15  ? -19.086 23.055 83.457  0.40 34.26 ? 15  G   C "O5'" 1 
ATOM   603  C "C5'" A G   A 1 15  ? -22.152 22.525 82.194  0.60 46.75 ? 15  G   C "C5'" 1 
ATOM   604  C "C5'" B G   A 1 15  ? -19.579 21.737 83.231  0.40 35.75 ? 15  G   C "C5'" 1 
ATOM   605  C "C4'" A G   A 1 15  ? -21.203 21.374 82.447  0.60 47.60 ? 15  G   C "C4'" 1 
ATOM   606  C "C4'" B G   A 1 15  ? -18.457 20.725 83.243  0.40 36.51 ? 15  G   C "C4'" 1 
ATOM   607  O "O4'" A G   A 1 15  ? -20.111 21.378 81.481  0.60 46.95 ? 15  G   C "O4'" 1 
ATOM   608  O "O4'" B G   A 1 15  ? -17.568 20.946 82.115  0.40 37.25 ? 15  G   C "O4'" 1 
ATOM   609  C "C3'" A G   A 1 15  ? -20.468 21.374 83.774  0.60 47.66 ? 15  G   C "C3'" 1 
ATOM   610  C "C3'" B G   A 1 15  ? -17.509 20.738 84.429  0.40 37.15 ? 15  G   C "C3'" 1 
ATOM   611  O "O3'" A G   A 1 15  ? -21.276 20.979 84.874  0.60 47.32 ? 15  G   C "O3'" 1 
ATOM   612  O "O3'" B G   A 1 15  ? -18.063 20.115 85.580  0.40 37.52 ? 15  G   C "O3'" 1 
ATOM   613  C "C2'" A G   A 1 15  ? -19.349 20.381 83.496  0.60 46.92 ? 15  G   C "C2'" 1 
ATOM   614  C "C2'" B G   A 1 15  ? -16.335 19.944 83.876  0.40 37.22 ? 15  G   C "C2'" 1 
ATOM   615  O "O2'" A G   A 1 15  ? -19.786 19.036 83.543  0.60 47.74 ? 15  G   C "O2'" 1 
ATOM   616  O "O2'" B G   A 1 15  ? -16.588 18.553 83.843  0.40 38.75 ? 15  G   C "O2'" 1 
ATOM   617  C "C1'" A G   A 1 15  ? -18.965 20.766 82.065  0.60 45.74 ? 15  G   C "C1'" 1 
ATOM   618  C "C1'" B G   A 1 15  ? -16.265 20.481 82.446  0.40 36.48 ? 15  G   C "C1'" 1 
ATOM   619  N N9    A G   A 1 15  ? -17.863 21.724 82.062  0.60 44.16 ? 15  G   C N9    1 
ATOM   620  N N9    B G   A 1 15  ? -15.335 21.600 82.357  0.40 35.09 ? 15  G   C N9    1 
ATOM   621  C C8    A G   A 1 15  ? -17.954 23.094 82.031  0.60 42.98 ? 15  G   C C8    1 
ATOM   622  C C8    B G   A 1 15  ? -15.643 22.937 82.389  0.40 34.93 ? 15  G   C C8    1 
ATOM   623  N N7    A G   A 1 15  ? -16.790 23.686 82.072  0.60 42.76 ? 15  G   C N7    1 
ATOM   624  N N7    B G   A 1 15  ? -14.591 23.706 82.328  0.40 34.22 ? 15  G   C N7    1 
ATOM   625  C C5    A G   A 1 15  ? -15.872 22.643 82.129  0.60 42.64 ? 15  G   C C5    1 
ATOM   626  C C5    B G   A 1 15  ? -13.525 22.823 82.240  0.40 33.45 ? 15  G   C C5    1 
ATOM   627  C C6    A G   A 1 15  ? -14.448 22.665 82.199  0.60 41.50 ? 15  G   C C6    1 
ATOM   628  C C6    B G   A 1 15  ? -12.134 23.074 82.155  0.40 33.43 ? 15  G   C C6    1 
ATOM   629  O O6    A G   A 1 15  ? -13.691 23.636 82.241  0.60 40.35 ? 15  G   C O6    1 
ATOM   630  O O6    B G   A 1 15  ? -11.549 24.163 82.140  0.40 33.84 ? 15  G   C O6    1 
ATOM   631  N N1    A G   A 1 15  ? -13.917 21.383 82.230  0.60 41.74 ? 15  G   C N1    1 
ATOM   632  N N1    B G   A 1 15  ? -11.405 21.891 82.087  0.40 32.92 ? 15  G   C N1    1 
ATOM   633  C C2    A G   A 1 15  ? -14.647 20.226 82.209  0.60 42.06 ? 15  G   C C2    1 
ATOM   634  C C2    B G   A 1 15  ? -11.943 20.631 82.097  0.40 33.37 ? 15  G   C C2    1 
ATOM   635  N N2    A G   A 1 15  ? -13.934 19.086 82.252  0.60 42.43 ? 15  G   C N2    1 
ATOM   636  N N2    B G   A 1 15  ? -11.071 19.619 82.016  0.40 33.78 ? 15  G   C N2    1 
ATOM   637  N N3    A G   A 1 15  ? -15.972 20.186 82.153  0.60 42.50 ? 15  G   C N3    1 
ATOM   638  N N3    B G   A 1 15  ? -13.241 20.382 82.179  0.40 33.93 ? 15  G   C N3    1 
ATOM   639  C C4    A G   A 1 15  ? -16.515 21.425 82.115  0.60 43.35 ? 15  G   C C4    1 
ATOM   640  C C4    B G   A 1 15  ? -13.967 21.519 82.248  0.40 34.24 ? 15  G   C C4    1 
ATOM   641  P P     A U   A 1 16  ? -20.891 21.491 86.349  0.60 47.68 ? 16  U   C P     1 
ATOM   642  P P     B U   A 1 16  ? -17.418 20.409 87.024  0.40 37.75 ? 16  U   C P     1 
ATOM   643  O OP1   A U   A 1 16  ? -21.905 20.954 87.286  0.60 49.43 ? 16  U   C OP1   1 
ATOM   644  O OP1   B U   A 1 16  ? -18.254 19.719 88.039  0.40 36.41 ? 16  U   C OP1   1 
ATOM   645  O OP2   A U   A 1 16  ? -20.626 22.951 86.313  0.60 47.35 ? 16  U   C OP2   1 
ATOM   646  O OP2   B U   A 1 16  ? -17.183 21.870 87.141  0.40 35.94 ? 16  U   C OP2   1 
ATOM   647  O "O5'" A U   A 1 16  ? -19.507 20.767 86.646  0.60 45.83 ? 16  U   C "O5'" 1 
ATOM   648  O "O5'" B U   A 1 16  ? -16.009 19.667 86.960  0.40 37.69 ? 16  U   C "O5'" 1 
ATOM   649  C "C5'" A U   A 1 16  ? -19.420 19.353 86.614  0.60 43.10 ? 16  U   C "C5'" 1 
ATOM   650  C "C5'" B U   A 1 16  ? -15.944 18.263 86.733  0.40 38.63 ? 16  U   C "C5'" 1 
ATOM   651  C "C4'" A U   A 1 16  ? -17.980 18.907 86.697  0.60 41.66 ? 16  U   C "C4'" 1 
ATOM   652  C "C4'" B U   A 1 16  ? -14.509 17.803 86.644  0.40 39.39 ? 16  U   C "C4'" 1 
ATOM   653  O "O4'" A U   A 1 16  ? -17.236 19.401 85.549  0.60 40.35 ? 16  U   C "O4'" 1 
ATOM   654  O "O4'" B U   A 1 16  ? -13.868 18.399 85.485  0.40 39.54 ? 16  U   C "O4'" 1 
ATOM   655  C "C3'" A U   A 1 16  ? -17.147 19.408 87.865  0.60 39.98 ? 16  U   C "C3'" 1 
ATOM   656  C "C3'" B U   A 1 16  ? -13.598 18.201 87.792  0.40 40.48 ? 16  U   C "C3'" 1 
ATOM   657  O "O3'" A U   A 1 16  ? -17.452 18.723 89.077  0.60 38.69 ? 16  U   C "O3'" 1 
ATOM   658  O "O3'" B U   A 1 16  ? -13.772 17.351 88.923  0.40 41.23 ? 16  U   C "O3'" 1 
ATOM   659  C "C2'" A U   A 1 16  ? -15.742 19.094 87.365  0.60 40.11 ? 16  U   C "C2'" 1 
ATOM   660  C "C2'" B U   A 1 16  ? -12.223 18.033 87.159  0.40 40.77 ? 16  U   C "C2'" 1 
ATOM   661  O "O2'" A U   A 1 16  ? -15.415 17.723 87.449  0.60 40.39 ? 16  U   C "O2'" 1 
ATOM   662  O "O2'" B U   A 1 16  ? -11.823 16.679 87.089  0.40 41.89 ? 16  U   C "O2'" 1 
ATOM   663  C "C1'" A U   A 1 16  ? -15.860 19.484 85.890  0.60 39.88 ? 16  U   C "C1'" 1 
ATOM   664  C "C1'" B U   A 1 16  ? -12.479 18.556 85.745  0.40 40.48 ? 16  U   C "C1'" 1 
ATOM   665  N N1    A U   A 1 16  ? -15.383 20.858 85.686  0.60 40.00 ? 16  U   C N1    1 
ATOM   666  N N1    B U   A 1 16  ? -12.124 19.976 85.598  0.40 40.78 ? 16  U   C N1    1 
ATOM   667  C C2    A U   A 1 16  ? -14.017 21.027 85.605  0.60 39.86 ? 16  U   C C2    1 
ATOM   668  C C2    B U   A 1 16  ? -10.786 20.285 85.423  0.40 40.65 ? 16  U   C C2    1 
ATOM   669  O O2    A U   A 1 16  ? -13.237 20.088 85.620  0.60 41.10 ? 16  U   C O2    1 
ATOM   670  O O2    B U   A 1 16  ? -9.911  19.436 85.378  0.40 41.37 ? 16  U   C O2    1 
ATOM   671  N N3    A U   A 1 16  ? -13.596 22.329 85.501  0.60 38.91 ? 16  U   C N3    1 
ATOM   672  N N3    B U   A 1 16  ? -10.509 21.626 85.302  0.40 39.95 ? 16  U   C N3    1 
ATOM   673  C C4    A U   A 1 16  ? -14.388 23.454 85.454  0.60 38.55 ? 16  U   C C4    1 
ATOM   674  C C4    B U   A 1 16  ? -11.412 22.669 85.338  0.40 39.57 ? 16  U   C C4    1 
ATOM   675  O O4    A U   A 1 16  ? -13.853 24.562 85.455  0.60 39.56 ? 16  U   C O4    1 
ATOM   676  O O4    B U   A 1 16  ? -11.006 23.827 85.205  0.40 38.96 ? 16  U   C O4    1 
ATOM   677  C C5    A U   A 1 16  ? -15.798 23.196 85.497  0.60 38.12 ? 16  U   C C5    1 
ATOM   678  C C5    B U   A 1 16  ? -12.777 22.271 85.520  0.40 39.84 ? 16  U   C C5    1 
ATOM   679  C C6    A U   A 1 16  ? -16.238 21.935 85.609  0.60 39.01 ? 16  U   C C6    1 
ATOM   680  C C6    B U   A 1 16  ? -13.080 20.969 85.639  0.40 40.82 ? 16  U   C C6    1 
ATOM   681  P P     A A   A 1 17  ? -16.938 19.317 90.486  0.60 37.13 ? 17  A   C P     1 
ATOM   682  P P     B A   A 1 17  ? -13.290 17.852 90.377  0.40 42.03 ? 17  A   C P     1 
ATOM   683  O OP1   A A   A 1 17  ? -17.490 18.440 91.552  0.60 35.89 ? 17  A   C OP1   1 
ATOM   684  O OP1   B A   A 1 17  ? -13.770 16.874 91.385  0.40 40.15 ? 17  A   C OP1   1 
ATOM   685  O OP2   A A   A 1 17  ? -17.181 20.780 90.543  0.60 36.06 ? 17  A   C OP2   1 
ATOM   686  O OP2   B A   A 1 17  ? -13.645 19.290 90.527  0.40 41.97 ? 17  A   C OP2   1 
ATOM   687  O "O5'" A A   A 1 17  ? -15.369 19.062 90.439  0.60 37.53 ? 17  A   C "O5'" 1 
ATOM   688  O "O5'" B A   A 1 17  ? -11.705 17.746 90.290  0.40 40.17 ? 17  A   C "O5'" 1 
ATOM   689  C "C5'" A A   A 1 17  ? -14.868 17.733 90.335  0.60 38.79 ? 17  A   C "C5'" 1 
ATOM   690  C "C5'" B A   A 1 17  ? -11.072 16.499 90.041  0.40 38.66 ? 17  A   C "C5'" 1 
ATOM   691  C "C4'" A A   A 1 17  ? -13.359 17.732 90.334  0.60 38.38 ? 17  A   C "C4'" 1 
ATOM   692  C "C4'" B A   A 1 17  ? -9.578  16.685 89.996  0.40 38.58 ? 17  A   C "C4'" 1 
ATOM   693  O "O4'" A A   A 1 17  ? -12.840 18.354 89.125  0.60 37.47 ? 17  A   C "O4'" 1 
ATOM   694  O "O4'" B A   A 1 17  ? -9.211  17.427 88.808  0.40 38.84 ? 17  A   C "O4'" 1 
ATOM   695  C "C3'" A A   A 1 17  ? -12.714 18.506 91.465  0.60 37.41 ? 17  A   C "C3'" 1 
ATOM   696  C "C3'" B A   A 1 17  ? -9.019  17.507 91.142  0.40 37.77 ? 17  A   C "C3'" 1 
ATOM   697  O "O3'" A A   A 1 17  ? -12.713 17.693 92.628  0.60 37.71 ? 17  A   C "O3'" 1 
ATOM   698  O "O3'" B A   A 1 17  ? -8.787  16.674 92.265  0.40 37.42 ? 17  A   C "O3'" 1 
ATOM   699  C "C2'" A A   A 1 17  ? -11.320 18.757 90.902  0.60 37.61 ? 17  A   C "C2'" 1 
ATOM   700  C "C2'" B A   A 1 17  ? -7.724  18.052 90.557  0.40 37.53 ? 17  A   C "C2'" 1 
ATOM   701  O "O2'" A A   A 1 17  ? -10.501 17.608 90.976  0.60 38.25 ? 17  A   C "O2'" 1 
ATOM   702  O "O2'" B A   A 1 17  ? -6.665  17.126 90.629  0.40 37.42 ? 17  A   C "O2'" 1 
ATOM   703  C "C1'" A A   A 1 17  ? -11.635 19.038 89.429  0.60 36.07 ? 17  A   C "C1'" 1 
ATOM   704  C "C1'" B A   A 1 17  ? -8.118  18.279 89.096  0.40 37.65 ? 17  A   C "C1'" 1 
ATOM   705  N N9    A A   A 1 17  ? -11.826 20.459 89.126  0.60 34.34 ? 17  A   C N9    1 
ATOM   706  N N9    B A   A 1 17  ? -8.526  19.649 88.804  0.40 37.47 ? 17  A   C N9    1 
ATOM   707  C C8    A A   A 1 17  ? -13.011 21.148 89.015  0.60 32.37 ? 17  A   C C8    1 
ATOM   708  C C8    B A   A 1 17  ? -9.799  20.158 88.732  0.40 37.31 ? 17  A   C C8    1 
ATOM   709  N N7    A A   A 1 17  ? -12.857 22.417 88.722  0.60 30.17 ? 17  A   C N7    1 
ATOM   710  N N7    B A   A 1 17  ? -9.842  21.434 88.428  0.40 38.21 ? 17  A   C N7    1 
ATOM   711  C C5    A A   A 1 17  ? -11.482 22.577 88.636  0.60 29.28 ? 17  A   C C5    1 
ATOM   712  C C5    B A   A 1 17  ? -8.506  21.791 88.297  0.40 38.19 ? 17  A   C C5    1 
ATOM   713  C C6    A A   A 1 17  ? -10.676 23.692 88.351  0.60 29.25 ? 17  A   C C6    1 
ATOM   714  C C6    B A   A 1 17  ? -7.874  23.009 87.983  0.40 37.50 ? 17  A   C C6    1 
ATOM   715  N N6    A A   A 1 17  ? -11.160 24.901 88.071  0.60 28.10 ? 17  A   C N6    1 
ATOM   716  N N6    B A   A 1 17  ? -8.530  24.144 87.734  0.40 37.18 ? 17  A   C N6    1 
ATOM   717  N N1    A A   A 1 17  ? -9.334  23.519 88.358  0.60 30.44 ? 17  A   C N1    1 
ATOM   718  N N1    B A   A 1 17  ? -6.525  23.021 87.935  0.40 38.00 ? 17  A   C N1    1 
ATOM   719  C C2    A A   A 1 17  ? -8.849  22.302 88.629  0.60 31.73 ? 17  A   C C2    1 
ATOM   720  C C2    B A   A 1 17  ? -5.864  21.884 88.190  0.40 39.05 ? 17  A   C C2    1 
ATOM   721  N N3    A A   A 1 17  ? -9.506  21.172 88.901  0.60 32.53 ? 17  A   C N3    1 
ATOM   722  N N3    B A   A 1 17  ? -6.341  20.680 88.496  0.40 38.41 ? 17  A   C N3    1 
ATOM   723  C C4    A A   A 1 17  ? -10.834 21.382 88.889  0.60 31.97 ? 17  A   C C4    1 
ATOM   724  C C4    B A   A 1 17  ? -7.685  20.701 88.532  0.40 38.54 ? 17  A   C C4    1 
ATOM   725  P P     A C   A 1 18  ? -12.344 18.332 94.055  0.60 38.71 ? 18  C   C P     1 
ATOM   726  P P     B C   A 1 18  ? -8.360  17.330 93.660  0.40 36.92 ? 18  C   C P     1 
ATOM   727  O OP1   A C   A 1 18  ? -12.696 17.329 95.091  0.60 38.74 ? 18  C   C OP1   1 
ATOM   728  O OP1   B C   A 1 18  ? -8.300  16.246 94.674  0.40 36.74 ? 18  C   C OP1   1 
ATOM   729  O OP2   A C   A 1 18  ? -12.908 19.702 94.156  0.60 37.02 ? 18  C   C OP2   1 
ATOM   730  O OP2   B C   A 1 18  ? -9.219  18.516 93.903  0.40 35.38 ? 18  C   C OP2   1 
ATOM   731  O "O5'" A C   A 1 18  ? -10.756 18.428 93.989  0.60 37.41 ? 18  C   C "O5'" 1 
ATOM   732  O "O5'" B C   A 1 18  ? -6.872  17.820 93.391  0.40 35.80 ? 18  C   C "O5'" 1 
ATOM   733  C "C5'" A C   A 1 18  ? -10.061 19.342 94.809  0.60 37.78 ? 18  C   C "C5'" 1 
ATOM   734  C "C5'" B C   A 1 18  ? -6.273  18.756 94.258  0.40 35.17 ? 18  C   C "C5'" 1 
ATOM   735  C "C4'" A C   A 1 18  ? -8.683  19.599 94.262  0.60 39.01 ? 18  C   C "C4'" 1 
ATOM   736  C "C4'" B C   A 1 18  ? -4.890  19.113 93.784  0.40 33.84 ? 18  C   C "C4'" 1 
ATOM   737  O "O4'" A C   A 1 18  ? -8.752  19.907 92.842  0.60 40.27 ? 18  C   C "O4'" 1 
ATOM   738  O "O4'" B C   A 1 18  ? -4.894  19.393 92.359  0.40 33.49 ? 18  C   C "O4'" 1 
ATOM   739  C "C3'" A C   A 1 18  ? -8.047  20.817 94.896  0.60 39.40 ? 18  C   C "C3'" 1 
ATOM   740  C "C3'" B C   A 1 18  ? -4.420  20.394 94.439  0.40 33.45 ? 18  C   C "C3'" 1 
ATOM   741  O "O3'" A C   A 1 18  ? -7.424  20.447 96.107  0.60 39.81 ? 18  C   C "O3'" 1 
ATOM   742  O "O3'" B C   A 1 18  ? -3.827  20.100 95.687  0.40 33.27 ? 18  C   C "O3'" 1 
ATOM   743  C "C2'" A C   A 1 18  ? -7.100  21.301 93.810  0.60 39.08 ? 18  C   C "C2'" 1 
ATOM   744  C "C2'" B C   A 1 18  ? -3.489  20.975 93.393  0.40 33.11 ? 18  C   C "C2'" 1 
ATOM   745  O "O2'" A C   A 1 18  ? -5.898  20.563 93.753  0.60 40.82 ? 18  C   C "O2'" 1 
ATOM   746  O "O2'" B C   A 1 18  ? -2.230  20.342 93.389  0.40 34.68 ? 18  C   C "O2'" 1 
ATOM   747  C "C1'" A C   A 1 18  ? -7.942  21.039 92.560  0.60 38.17 ? 18  C   C "C1'" 1 
ATOM   748  C "C1'" B C   A 1 18  ? -4.258  20.636 92.115  0.40 32.94 ? 18  C   C "C1'" 1 
ATOM   749  N N1    A C   A 1 18  ? -8.840  22.159 92.230  0.60 36.98 ? 18  C   C N1    1 
ATOM   750  N N1    B C   A 1 18  ? -5.320  21.611 91.808  0.40 32.48 ? 18  C   C N1    1 
ATOM   751  C C2    A C   A 1 18  ? -8.282  23.359 91.786  0.60 37.05 ? 18  C   C C2    1 
ATOM   752  C C2    B C   A 1 18  ? -4.996  22.792 91.136  0.40 31.41 ? 18  C   C C2    1 
ATOM   753  O O2    A C   A 1 18  ? -7.049  23.447 91.686  0.60 37.38 ? 18  C   C O2    1 
ATOM   754  O O2    B C   A 1 18  ? -3.820  23.008 90.827  0.40 31.60 ? 18  C   C O2    1 
ATOM   755  N N3    A C   A 1 18  ? -9.099  24.393 91.478  0.60 36.25 ? 18  C   C N3    1 
ATOM   756  N N3    B C   A 1 18  ? -5.978  23.670 90.840  0.40 32.02 ? 18  C   C N3    1 
ATOM   757  C C4    A C   A 1 18  ? -10.420 24.264 91.600  0.60 34.50 ? 18  C   C C4    1 
ATOM   758  C C4    B C   A 1 18  ? -7.237  23.413 91.196  0.40 32.12 ? 18  C   C C4    1 
ATOM   759  N N4    A C   A 1 18  ? -11.177 25.322 91.285  0.60 32.01 ? 18  C   C N4    1 
ATOM   760  N N4    B C   A 1 18  ? -8.168  24.311 90.875  0.40 32.30 ? 18  C   C N4    1 
ATOM   761  C C5    A C   A 1 18  ? -11.020 23.050 92.050  0.60 33.44 ? 18  C   C C5    1 
ATOM   762  C C5    B C   A 1 18  ? -7.594  22.225 91.893  0.40 32.19 ? 18  C   C C5    1 
ATOM   763  C C6    A C   A 1 18  ? -10.199 22.033 92.353  0.60 34.99 ? 18  C   C C6    1 
ATOM   764  C C6    B C   A 1 18  ? -6.615  21.359 92.174  0.40 31.88 ? 18  C   C C6    1 
ATOM   765  P P     A G   A 1 19  ? -7.929  21.100 97.479  0.60 42.04 ? 19  G   C P     1 
ATOM   766  P P     B G   A 1 19  ? -4.476  20.706 97.019  0.40 34.48 ? 19  G   C P     1 
ATOM   767  O OP1   A G   A 1 19  ? -7.403  20.269 98.590  0.60 42.66 ? 19  G   C OP1   1 
ATOM   768  O OP1   B G   A 1 19  ? -3.955  19.935 98.179  0.40 34.56 ? 19  G   C OP1   1 
ATOM   769  O OP2   A G   A 1 19  ? -9.386  21.361 97.390  0.60 42.94 ? 19  G   C OP2   1 
ATOM   770  O OP2   B G   A 1 19  ? -5.942  20.822 96.812  0.40 34.71 ? 19  G   C OP2   1 
ATOM   771  O "O5'" A G   A 1 19  ? -7.174  22.498 97.488  0.60 43.26 ? 19  G   C "O5'" 1 
ATOM   772  O "O5'" B G   A 1 19  ? -3.877  22.177 97.067  0.40 34.09 ? 19  G   C "O5'" 1 
ATOM   773  C "C5'" A G   A 1 19  ? -5.761  22.545 97.376  0.60 44.27 ? 19  G   C "C5'" 1 
ATOM   774  C "C5'" B G   A 1 19  ? -2.481  22.391 96.916  0.40 32.95 ? 19  G   C "C5'" 1 
ATOM   775  C "C4'" A G   A 1 19  ? -5.306  23.953 97.101  0.60 46.72 ? 19  G   C "C4'" 1 
ATOM   776  C "C4'" B G   A 1 19  ? -2.205  23.854 96.718  0.40 33.01 ? 19  G   C "C4'" 1 
ATOM   777  O "O4'" A G   A 1 19  ? -5.692  24.351 95.762  0.60 46.57 ? 19  G   C "O4'" 1 
ATOM   778  O "O4'" B G   A 1 19  ? -2.701  24.275 95.423  0.40 32.39 ? 19  G   C "O4'" 1 
ATOM   779  C "C3'" A G   A 1 19  ? -5.912  25.036 97.980  0.60 46.47 ? 19  G   C "C3'" 1 
ATOM   780  C "C3'" B G   A 1 19  ? -2.915  24.786 97.682  0.40 33.34 ? 19  G   C "C3'" 1 
ATOM   781  O "O3'" A G   A 1 19  ? -5.245  25.082 99.237  0.60 47.38 ? 19  G   C "O3'" 1 
ATOM   782  O "O3'" B G   A 1 19  ? -2.236  24.860 98.930  0.40 34.12 ? 19  G   C "O3'" 1 
ATOM   783  C "C2'" A G   A 1 19  ? -5.639  26.286 97.150  0.60 46.52 ? 19  G   C "C2'" 1 
ATOM   784  C "C2'" B G   A 1 19  ? -2.853  26.106 96.928  0.40 32.71 ? 19  G   C "C2'" 1 
ATOM   785  O "O2'" A G   A 1 19  ? -4.308  26.750 97.282  0.60 44.03 ? 19  G   C "O2'" 1 
ATOM   786  O "O2'" B G   A 1 19  ? -1.583  26.713 97.049  0.40 33.67 ? 19  G   C "O2'" 1 
ATOM   787  C "C1'" A G   A 1 19  ? -5.847  25.758 95.726  0.60 46.84 ? 19  G   C "C1'" 1 
ATOM   788  C "C1'" B G   A 1 19  ? -3.062  25.645 95.483  0.40 33.02 ? 19  G   C "C1'" 1 
ATOM   789  N N9    A G   A 1 19  ? -7.149  26.084 95.152  0.60 47.06 ? 19  G   C N9    1 
ATOM   790  N N9    B G   A 1 19  ? -4.440  25.791 95.022  0.40 33.85 ? 19  G   C N9    1 
ATOM   791  C C8    A G   A 1 19  ? -8.246  25.267 95.011  0.60 48.03 ? 19  G   C C8    1 
ATOM   792  C C8    B G   A 1 19  ? -5.459  24.877 95.139  0.40 33.24 ? 19  G   C C8    1 
ATOM   793  N N7    A G   A 1 19  ? -9.259  25.866 94.441  0.60 47.34 ? 19  G   C N7    1 
ATOM   794  N N7    B G   A 1 19  ? -6.594  25.310 94.656  0.40 33.09 ? 19  G   C N7    1 
ATOM   795  C C5    A G   A 1 19  ? -8.801  27.154 94.196  0.60 47.07 ? 19  G   C C5    1 
ATOM   796  C C5    B G   A 1 19  ? -6.307  26.584 94.183  0.40 33.19 ? 19  G   C C5    1 
ATOM   797  C C6    A G   A 1 19  ? -9.447  28.269 93.598  0.60 47.27 ? 19  G   C C6    1 
ATOM   798  C C6    B G   A 1 19  ? -7.146  27.549 93.557  0.40 33.43 ? 19  G   C C6    1 
ATOM   799  O O6    A G   A 1 19  ? -10.597 28.347 93.142  0.60 48.16 ? 19  G   C O6    1 
ATOM   800  O O6    B G   A 1 19  ? -8.351  27.469 93.282  0.40 32.30 ? 19  G   C O6    1 
ATOM   801  N N1    A G   A 1 19  ? -8.611  29.379 93.555  0.60 46.33 ? 19  G   C N1    1 
ATOM   802  N N1    B G   A 1 19  ? -6.444  28.709 93.244  0.40 34.40 ? 19  G   C N1    1 
ATOM   803  C C2    A G   A 1 19  ? -7.324  29.416 94.020  0.60 45.70 ? 19  G   C C2    1 
ATOM   804  C C2    B G   A 1 19  ? -5.111  28.919 93.495  0.40 34.06 ? 19  G   C C2    1 
ATOM   805  N N2    A G   A 1 19  ? -6.675  30.572 93.883  0.60 45.08 ? 19  G   C N2    1 
ATOM   806  N N2    B G   A 1 19  ? -4.624  30.113 93.117  0.40 33.64 ? 19  G   C N2    1 
ATOM   807  N N3    A G   A 1 19  ? -6.714  28.391 94.578  0.60 46.77 ? 19  G   C N3    1 
ATOM   808  N N3    B G   A 1 19  ? -4.318  28.030 94.074  0.40 33.89 ? 19  G   C N3    1 
ATOM   809  C C4    A G   A 1 19  ? -7.504  27.301 94.632  0.60 47.09 ? 19  G   C C4    1 
ATOM   810  C C4    B G   A 1 19  ? -4.978  26.895 94.393  0.40 33.99 ? 19  G   C C4    1 
ATOM   811  P P     A U   A 1 20  ? -6.079  25.383 100.576 0.60 46.25 ? 20  U   C P     1 
ATOM   812  P P     B U   A 1 20  ? -3.082  25.012 100.288 0.40 36.62 ? 20  U   C P     1 
ATOM   813  O OP1   A U   A 1 20  ? -5.416  24.603 101.647 0.60 46.58 ? 20  U   C OP1   1 
ATOM   814  O OP1   B U   A 1 20  ? -2.198  24.660 101.428 0.40 35.83 ? 20  U   C OP1   1 
ATOM   815  O OP2   A U   A 1 20  ? -7.515  25.163 100.310 0.60 46.37 ? 20  U   C OP2   1 
ATOM   816  O OP2   B U   A 1 20  ? -4.359  24.279 100.104 0.40 36.78 ? 20  U   C OP2   1 
ATOM   817  O "O5'" A U   A 1 20  ? -5.816  26.940 100.847 0.60 50.15 ? 20  U   C "O5'" 1 
ATOM   818  O "O5'" B U   A 1 20  ? -3.424  26.568 100.374 0.40 37.22 ? 20  U   C "O5'" 1 
ATOM   819  C "C5'" A U   A 1 20  ? -6.408  27.963 100.029 0.60 53.54 ? 20  U   C "C5'" 1 
ATOM   820  C "C5'" B U   A 1 20  ? -4.420  27.126 99.528  0.40 40.29 ? 20  U   C "C5'" 1 
ATOM   821  C "C4'" A U   A 1 20  ? -7.081  28.999 100.906 0.60 56.50 ? 20  U   C "C4'" 1 
ATOM   822  C "C4'" B U   A 1 20  ? -5.055  28.349 100.156 0.40 42.06 ? 20  U   C "C4'" 1 
ATOM   823  O "O4'" A U   A 1 20  ? -7.720  28.239 101.959 0.60 58.13 ? 20  U   C "O4'" 1 
ATOM   824  O "O4'" B U   A 1 20  ? -5.590  28.031 101.464 0.40 43.49 ? 20  U   C "O4'" 1 
ATOM   825  C "C3'" A U   A 1 20  ? -6.165  30.007 101.610 0.60 58.00 ? 20  U   C "C3'" 1 
ATOM   826  C "C3'" B U   A 1 20  ? -4.186  29.568 100.423 0.40 42.36 ? 20  U   C "C3'" 1 
ATOM   827  O "O3'" A U   A 1 20  ? -6.180  31.307 100.975 0.60 57.39 ? 20  U   C "O3'" 1 
ATOM   828  O "O3'" B U   A 1 20  ? -3.989  30.286 99.204  0.40 40.89 ? 20  U   C "O3'" 1 
ATOM   829  C "C2'" A U   A 1 20  ? -6.875  30.244 102.948 0.60 60.05 ? 20  U   C "C2'" 1 
ATOM   830  C "C2'" B U   A 1 20  ? -5.053  30.351 101.408 0.40 44.00 ? 20  U   C "C2'" 1 
ATOM   831  O "O2'" A U   A 1 20  ? -7.782  31.326 102.904 0.60 63.17 ? 20  U   C "O2'" 1 
ATOM   832  O "O2'" B U   A 1 20  ? -6.074  31.106 100.783 0.40 45.42 ? 20  U   C "O2'" 1 
ATOM   833  C "C1'" A U   A 1 20  ? -7.655  28.945 103.173 0.60 60.35 ? 20  U   C "C1'" 1 
ATOM   834  C "C1'" B U   A 1 20  ? -5.710  29.227 102.212 0.40 44.20 ? 20  U   C "C1'" 1 
ATOM   835  N N1    A U   A 1 20  ? -7.090  28.065 104.203 0.60 61.52 ? 20  U   C N1    1 
ATOM   836  N N1    B U   A 1 20  ? -5.156  29.022 103.558 0.40 45.74 ? 20  U   C N1    1 
ATOM   837  C C2    A U   A 1 20  ? -7.872  27.804 105.311 0.60 63.48 ? 20  U   C C2    1 
ATOM   838  C C2    B U   A 1 20  ? -5.105  30.124 104.395 0.40 45.56 ? 20  U   C C2    1 
ATOM   839  O O2    A U   A 1 20  ? -9.011  28.224 105.433 0.60 64.39 ? 20  U   C O2    1 
ATOM   840  O O2    B U   A 1 20  ? -5.451  31.239 104.039 0.40 44.56 ? 20  U   C O2    1 
ATOM   841  N N3    A U   A 1 20  ? -7.274  27.028 106.270 0.60 64.42 ? 20  U   C N3    1 
ATOM   842  N N3    B U   A 1 20  ? -4.629  29.872 105.659 0.40 45.93 ? 20  U   C N3    1 
ATOM   843  C C4    A U   A 1 20  ? -6.005  26.492 106.229 0.60 65.33 ? 20  U   C C4    1 
ATOM   844  C C4    B U   A 1 20  ? -4.203  28.658 106.161 0.40 46.12 ? 20  U   C C4    1 
ATOM   845  O O4    A U   A 1 20  ? -5.578  25.874 107.207 0.60 67.71 ? 20  U   C O4    1 
ATOM   846  O O4    B U   A 1 20  ? -3.859  28.580 107.344 0.40 46.25 ? 20  U   C O4    1 
ATOM   847  C C5    A U   A 1 20  ? -5.272  26.783 105.035 0.60 63.99 ? 20  U   C C5    1 
ATOM   848  C C5    B U   A 1 20  ? -4.263  27.571 105.227 0.40 45.95 ? 20  U   C C5    1 
ATOM   849  C C6    A U   A 1 20  ? -5.828  27.540 104.086 0.60 62.60 ? 20  U   C C6    1 
ATOM   850  C C6    B U   A 1 20  ? -4.724  27.785 103.986 0.40 46.05 ? 20  U   C C6    1 
ATOM   851  P P     A U   A 1 21  ? -5.307  31.622 99.647  0.60 55.43 ? 21  U   C P     1 
ATOM   852  P P     B U   A 1 21  ? -3.517  31.822 99.233  0.40 38.13 ? 21  U   C P     1 
ATOM   853  O OP1   A U   A 1 21  ? -5.966  32.786 99.005  0.60 54.45 ? 21  U   C OP1   1 
ATOM   854  O OP1   B U   A 1 21  ? -4.520  32.648 99.948  0.40 37.23 ? 21  U   C OP1   1 
ATOM   855  O OP2   A U   A 1 21  ? -5.090  30.383 98.861  0.60 57.50 ? 21  U   C OP2   1 
ATOM   856  O OP2   B U   A 1 21  ? -3.153  32.165 97.835  0.40 41.41 ? 21  U   C OP2   1 
ATOM   857  O "O5'" A U   A 1 21  ? -3.884  32.137 100.146 0.60 54.78 ? 21  U   C "O5'" 1 
ATOM   858  O "O5'" B U   A 1 21  ? -2.162  31.819 100.066 0.40 40.14 ? 21  U   C "O5'" 1 
ATOM   859  C "C5'" A U   A 1 21  ? -3.054  32.864 99.244  0.60 56.83 ? 21  U   C "C5'" 1 
ATOM   860  C "C5'" B U   A 1 21  ? -1.760  32.973 100.790 0.40 40.01 ? 21  U   C "C5'" 1 
ATOM   861  C "C4'" A U   A 1 21  ? -1.666  33.051 99.803  0.60 57.59 ? 21  U   C "C4'" 1 
ATOM   862  C "C4'" B U   A 1 21  ? -0.551  33.612 100.148 0.40 40.05 ? 21  U   C "C4'" 1 
ATOM   863  O "O4'" A U   A 1 21  ? -1.106  31.770 100.187 0.60 59.28 ? 21  U   C "O4'" 1 
ATOM   864  O "O4'" B U   A 1 21  ? 0.589   32.717 100.198 0.40 41.23 ? 21  U   C "O4'" 1 
ATOM   865  C "C3'" A U   A 1 21  ? -0.680  33.583 98.779  0.60 58.93 ? 21  U   C "C3'" 1 
ATOM   866  C "C3'" B U   A 1 21  ? -0.646  33.937 98.670  0.40 40.84 ? 21  U   C "C3'" 1 
ATOM   867  O "O3'" A U   A 1 21  ? -0.802  34.985 98.517  0.60 59.69 ? 21  U   C "O3'" 1 
ATOM   868  O "O3'" B U   A 1 21  ? -1.520  35.025 98.349  0.40 40.97 ? 21  U   C "O3'" 1 
ATOM   869  C "C2'" A U   A 1 21  ? 0.660   33.131 99.339  0.60 59.71 ? 21  U   C "C2'" 1 
ATOM   870  C "C2'" B U   A 1 21  ? 0.822   34.146 98.311  0.40 40.75 ? 21  U   C "C2'" 1 
ATOM   871  O "O2'" A U   A 1 21  ? 1.174   33.998 100.330 0.60 59.95 ? 21  U   C "O2'" 1 
ATOM   872  O "O2'" B U   A 1 21  ? 1.308   35.416 98.692  0.40 39.88 ? 21  U   C "O2'" 1 
ATOM   873  C "C1'" A U   A 1 21  ? 0.294   31.774 99.948  0.60 59.73 ? 21  U   C "C1'" 1 
ATOM   874  C "C1'" B U   A 1 21  ? 1.499   33.065 99.162  0.40 41.04 ? 21  U   C "C1'" 1 
ATOM   875  N N1    A U   A 1 21  ? 0.616   30.627 99.089  0.60 59.73 ? 21  U   C N1    1 
ATOM   876  N N1    B U   A 1 21  ? 1.817   31.864 98.375  0.40 41.28 ? 21  U   C N1    1 
ATOM   877  C C2    A U   A 1 21  ? 1.925   30.476 98.664  0.60 60.65 ? 21  U   C C2    1 
ATOM   878  C C2    B U   A 1 21  ? 2.938   31.913 97.555  0.40 41.22 ? 21  U   C C2    1 
ATOM   879  O O2    A U   A 1 21  ? 2.819   31.237 98.981  0.60 60.78 ? 21  U   C O2    1 
ATOM   880  O O2    B U   A 1 21  ? 3.691   32.868 97.509  0.40 42.89 ? 21  U   C O2    1 
ATOM   881  N N3    A U   A 1 21  ? 2.147   29.396 97.851  0.60 62.76 ? 21  U   C N3    1 
ATOM   882  N N3    B U   A 1 21  ? 3.146   30.798 96.790  0.40 40.18 ? 21  U   C N3    1 
ATOM   883  C C4    A U   A 1 21  ? 1.217   28.469 97.432  0.60 64.22 ? 21  U   C C4    1 
ATOM   884  C C4    B U   A 1 21  ? 2.379   29.665 96.757  0.40 39.18 ? 21  U   C C4    1 
ATOM   885  O O4    A U   A 1 21  ? 1.558   27.581 96.647  0.60 65.54 ? 21  U   C O4    1 
ATOM   886  O O4    B U   A 1 21  ? 2.627   28.808 95.916  0.40 37.45 ? 21  U   C O4    1 
ATOM   887  C C5    A U   A 1 21  ? -0.108  28.687 97.929  0.60 63.35 ? 21  U   C C5    1 
ATOM   888  C C5    B U   A 1 21  ? 1.262   29.667 97.660  0.40 40.35 ? 21  U   C C5    1 
ATOM   889  C C6    A U   A 1 21  ? -0.355  29.734 98.718  0.60 61.22 ? 21  U   C C6    1 
ATOM   890  C C6    B U   A 1 21  ? 1.026   30.741 98.421  0.40 39.53 ? 21  U   C C6    1 
ATOM   891  O OP3   A C   B 1 1   ? -11.398 37.360 86.614  0.60 24.03 ? 1   C   D OP3   1 
ATOM   892  O OP3   B C   B 1 1   ? -10.793 35.820 86.160  0.40 25.45 ? 1   C   D OP3   1 
ATOM   893  P P     A C   B 1 1   ? -11.903 36.706 87.889  0.60 26.14 ? 1   C   D P     1 
ATOM   894  P P     B C   B 1 1   ? -11.012 34.902 87.354  0.40 24.70 ? 1   C   D P     1 
ATOM   895  O OP1   A C   B 1 1   ? -12.702 37.680 88.743  0.60 28.36 ? 1   C   D OP1   1 
ATOM   896  O OP1   B C   B 1 1   ? -12.064 35.417 88.324  0.40 23.61 ? 1   C   D OP1   1 
ATOM   897  O OP2   A C   B 1 1   ? -12.622 35.385 87.675  0.60 26.53 ? 1   C   D OP2   1 
ATOM   898  O OP2   B C   B 1 1   ? -11.208 33.446 86.956  0.40 22.56 ? 1   C   D OP2   1 
ATOM   899  O "O5'" A C   B 1 1   ? -10.574 36.348 88.750  0.60 24.64 ? 1   C   D "O5'" 1 
ATOM   900  O "O5'" B C   B 1 1   ? -9.613  34.946 88.182  0.40 23.71 ? 1   C   D "O5'" 1 
ATOM   901  C "C5'" A C   B 1 1   ? -9.658  37.384 89.122  0.60 26.15 ? 1   C   D "C5'" 1 
ATOM   902  C "C5'" B C   B 1 1   ? -9.028  36.199 88.560  0.40 22.53 ? 1   C   D "C5'" 1 
ATOM   903  C "C4'" A C   B 1 1   ? -8.489  36.798 89.860  0.60 26.65 ? 1   C   D "C4'" 1 
ATOM   904  C "C4'" B C   B 1 1   ? -7.812  35.960 89.412  0.40 22.51 ? 1   C   D "C4'" 1 
ATOM   905  O "O4'" A C   B 1 1   ? -8.930  36.313 91.156  0.60 26.54 ? 1   C   D "O4'" 1 
ATOM   906  O "O4'" B C   B 1 1   ? -8.219  35.511 90.734  0.40 22.19 ? 1   C   D "O4'" 1 
ATOM   907  C "C3'" A C   B 1 1   ? -7.869  35.574 89.215  0.60 26.36 ? 1   C   D "C3'" 1 
ATOM   908  C "C3'" B C   B 1 1   ? -6.898  34.850 88.930  0.40 22.34 ? 1   C   D "C3'" 1 
ATOM   909  O "O3'" A C   B 1 1   ? -6.955  35.925 88.195  0.60 25.91 ? 1   C   D "O3'" 1 
ATOM   910  O "O3'" B C   B 1 1   ? -6.033  35.289 87.896  0.40 22.48 ? 1   C   D "O3'" 1 
ATOM   911  C "C2'" A C   B 1 1   ? -7.162  34.940 90.396  0.60 26.54 ? 1   C   D "C2'" 1 
ATOM   912  C "C2'" B C   B 1 1   ? -6.142  34.524 90.204  0.40 22.87 ? 1   C   D "C2'" 1 
ATOM   913  O "O2'" A C   B 1 1   ? -5.978  35.640 90.720  0.60 26.15 ? 1   C   D "O2'" 1 
ATOM   914  O "O2'" B C   B 1 1   ? -5.195  35.529 90.510  0.40 23.55 ? 1   C   D "O2'" 1 
ATOM   915  C "C1'" A C   B 1 1   ? -8.200  35.153 91.496  0.60 27.30 ? 1   C   D "C1'" 1 
ATOM   916  C "C1'" B C   B 1 1   ? -7.278  34.568 91.226  0.40 22.56 ? 1   C   D "C1'" 1 
ATOM   917  N N1    A C   B 1 1   ? -9.144  34.037 91.597  0.60 29.94 ? 1   C   D N1    1 
ATOM   918  N N1    B C   B 1 1   ? -7.957  33.270 91.356  0.40 22.50 ? 1   C   D N1    1 
ATOM   919  C C2    A C   B 1 1   ? -8.771  32.926 92.345  0.60 30.10 ? 1   C   D C2    1 
ATOM   920  C C2    B C   B 1 1   ? -7.387  32.284 92.165  0.40 23.40 ? 1   C   D C2    1 
ATOM   921  O O2    A C   B 1 1   ? -7.645  32.913 92.860  0.60 30.58 ? 1   C   D O2    1 
ATOM   922  O O2    B C   B 1 1   ? -6.323  32.529 92.752  0.40 24.70 ? 1   C   D O2    1 
ATOM   923  N N3    A C   B 1 1   ? -9.641  31.900 92.488  0.60 28.91 ? 1   C   D N3    1 
ATOM   924  N N3    B C   B 1 1   ? -8.009  31.088 92.285  0.40 23.28 ? 1   C   D N3    1 
ATOM   925  C C4    A C   B 1 1   ? -10.842 31.960 91.914  0.60 29.25 ? 1   C   D C4    1 
ATOM   926  C C4    B C   B 1 1   ? -9.150  30.861 91.630  0.40 22.40 ? 1   C   D C4    1 
ATOM   927  N N4    A C   B 1 1   ? -11.677 30.941 92.116  0.60 29.59 ? 1   C   D N4    1 
ATOM   928  N N4    B C   B 1 1   ? -9.728  29.662 91.770  0.40 23.01 ? 1   C   D N4    1 
ATOM   929  C C5    A C   B 1 1   ? -11.243 33.073 91.116  0.60 29.38 ? 1   C   D C5    1 
ATOM   930  C C5    B C   B 1 1   ? -9.749  31.848 90.802  0.40 21.19 ? 1   C   D C5    1 
ATOM   931  C C6    A C   B 1 1   ? -10.369 34.083 90.985  0.60 30.06 ? 1   C   D C6    1 
ATOM   932  C C6    B C   B 1 1   ? -9.127  33.026 90.694  0.40 21.47 ? 1   C   D C6    1 
ATOM   933  P P     A G   B 1 2   ? -6.546  34.831 87.102  0.60 27.42 ? 2   G   D P     1 
ATOM   934  P P     B G   B 1 2   ? -5.438  34.220 86.857  0.40 23.46 ? 2   G   D P     1 
ATOM   935  O OP1   A G   B 1 2   ? -5.576  35.471 86.179  0.60 25.24 ? 2   G   D OP1   1 
ATOM   936  O OP1   B G   B 1 2   ? -4.647  34.994 85.871  0.40 23.86 ? 2   G   D OP1   1 
ATOM   937  O OP2   A G   B 1 2   ? -7.796  34.220 86.569  0.60 25.90 ? 2   G   D OP2   1 
ATOM   938  O OP2   B G   B 1 2   ? -6.527  33.327 86.387  0.40 22.97 ? 2   G   D OP2   1 
ATOM   939  O "O5'" A G   B 1 2   ? -5.781  33.728 87.948  0.60 27.13 ? 2   G   D "O5'" 1 
ATOM   940  O "O5'" B G   B 1 2   ? -4.439  33.345 87.735  0.40 24.73 ? 2   G   D "O5'" 1 
ATOM   941  C "C5'" A G   B 1 2   ? -4.571  34.048 88.611  0.60 29.96 ? 2   G   D "C5'" 1 
ATOM   942  C "C5'" B G   B 1 2   ? -3.280  33.928 88.322  0.40 25.85 ? 2   G   D "C5'" 1 
ATOM   943  C "C4'" A G   B 1 2   ? -4.028  32.833 89.306  0.60 31.22 ? 2   G   D "C4'" 1 
ATOM   944  C "C4'" B G   B 1 2   ? -2.450  32.871 89.010  0.40 25.67 ? 2   G   D "C4'" 1 
ATOM   945  O "O4'" A G   B 1 2   ? -4.978  32.406 90.316  0.60 31.82 ? 2   G   D "O4'" 1 
ATOM   946  O "O4'" B G   B 1 2   ? -3.179  32.338 90.145  0.40 25.01 ? 2   G   D "O4'" 1 
ATOM   947  C "C3'" A G   B 1 2   ? -3.878  31.606 88.429  0.60 31.90 ? 2   G   D "C3'" 1 
ATOM   948  C "C3'" B G   B 1 2   ? -2.125  31.652 88.167  0.40 26.93 ? 2   G   D "C3'" 1 
ATOM   949  O "O3'" A G   B 1 2   ? -2.681  31.656 87.666  0.60 34.57 ? 2   G   D "O3'" 1 
ATOM   950  O "O3'" B G   B 1 2   ? -0.997  31.893 87.333  0.40 29.58 ? 2   G   D "O3'" 1 
ATOM   951  C "C2'" A G   B 1 2   ? -3.856  30.502 89.470  0.60 31.77 ? 2   G   D "C2'" 1 
ATOM   952  C "C2'" B G   B 1 2   ? -1.845  30.605 89.234  0.40 26.65 ? 2   G   D "C2'" 1 
ATOM   953  O "O2'" A G   B 1 2   ? -2.619  30.460 90.151  0.60 31.99 ? 2   G   D "O2'" 1 
ATOM   954  O "O2'" B G   B 1 2   ? -0.551  30.734 89.794  0.40 25.22 ? 2   G   D "O2'" 1 
ATOM   955  C "C1'" A G   B 1 2   ? -4.932  30.996 90.437  0.60 32.00 ? 2   G   D "C1'" 1 
ATOM   956  C "C1'" B G   B 1 2   ? -2.913  30.953 90.275  0.40 25.59 ? 2   G   D "C1'" 1 
ATOM   957  N N9    A G   B 1 2   ? -6.265  30.458 90.173  0.60 30.71 ? 2   G   D N9    1 
ATOM   958  N N9    B G   B 1 2   ? -4.167  30.236 90.064  0.40 26.20 ? 2   G   D N9    1 
ATOM   959  C C8    A G   B 1 2   ? -7.312  31.075 89.533  0.60 30.13 ? 2   G   D C8    1 
ATOM   960  C C8    B G   B 1 2   ? -5.322  30.735 89.507  0.40 25.66 ? 2   G   D C8    1 
ATOM   961  N N7    A G   B 1 2   ? -8.388  30.337 89.480  0.60 28.80 ? 2   G   D N7    1 
ATOM   962  N N7    B G   B 1 2   ? -6.277  29.848 89.426  0.40 25.35 ? 2   G   D N7    1 
ATOM   963  C C5    A G   B 1 2   ? -8.025  29.160 90.121  0.60 31.45 ? 2   G   D C5    1 
ATOM   964  C C5    B G   B 1 2   ? -5.722  28.693 89.962  0.40 25.40 ? 2   G   D C5    1 
ATOM   965  C C6    A G   B 1 2   ? -8.776  27.972 90.385  0.60 32.73 ? 2   G   D C6    1 
ATOM   966  C C6    B G   B 1 2   ? -6.275  27.393 90.127  0.40 25.28 ? 2   G   D C6    1 
ATOM   967  O O6    A G   B 1 2   ? -9.960  27.716 90.099  0.60 32.50 ? 2   G   D O6    1 
ATOM   968  O O6    B G   B 1 2   ? -7.400  26.986 89.816  0.40 24.51 ? 2   G   D O6    1 
ATOM   969  N N1    A G   B 1 2   ? -8.005  27.026 91.055  0.60 32.81 ? 2   G   D N1    1 
ATOM   970  N N1    B G   B 1 2   ? -5.364  26.521 90.714  0.40 25.96 ? 2   G   D N1    1 
ATOM   971  C C2    A G   B 1 2   ? -6.695  27.191 91.427  0.60 31.76 ? 2   G   D C2    1 
ATOM   972  C C2    B G   B 1 2   ? -4.088  26.846 91.093  0.40 25.95 ? 2   G   D C2    1 
ATOM   973  N N2    A G   B 1 2   ? -6.128  26.165 92.071  0.60 32.72 ? 2   G   D N2    1 
ATOM   974  N N2    B G   B 1 2   ? -3.363  25.852 91.634  0.40 24.43 ? 2   G   D N2    1 
ATOM   975  N N3    A G   B 1 2   ? -5.991  28.282 91.190  0.60 31.67 ? 2   G   D N3    1 
ATOM   976  N N3    B G   B 1 2   ? -3.559  28.054 90.948  0.40 26.07 ? 2   G   D N3    1 
ATOM   977  C C4    A G   B 1 2   ? -6.713  29.219 90.541  0.60 30.82 ? 2   G   D C4    1 
ATOM   978  C C4    B G   B 1 2   ? -4.424  28.919 90.373  0.40 25.77 ? 2   G   D C4    1 
ATOM   979  P P     A U   B 1 3   ? -2.640  30.959 86.218  0.60 35.22 ? 3   U   D P     1 
ATOM   980  P P     B U   B 1 3   ? -0.937  31.234 85.868  0.40 30.29 ? 3   U   D P     1 
ATOM   981  O OP1   A U   B 1 3   ? -1.329  31.236 85.579  0.60 35.89 ? 3   U   D OP1   1 
ATOM   982  O OP1   B U   B 1 3   ? 0.280   31.762 85.197  0.40 28.71 ? 3   U   D OP1   1 
ATOM   983  O OP2   A U   B 1 3   ? -3.894  31.316 85.505  0.60 36.47 ? 3   U   D OP2   1 
ATOM   984  O OP2   B U   B 1 3   ? -2.261  31.379 85.208  0.40 29.03 ? 3   U   D OP2   1 
ATOM   985  O "O5'" A U   B 1 3   ? -2.687  29.412 86.567  0.60 37.50 ? 3   U   D "O5'" 1 
ATOM   986  O "O5'" B U   B 1 3   ? -0.711  29.693 86.180  0.40 30.72 ? 3   U   D "O5'" 1 
ATOM   987  C "C5'" A U   B 1 3   ? -1.708  28.836 87.418  0.60 40.41 ? 3   U   D "C5'" 1 
ATOM   988  C "C5'" B U   B 1 3   ? 0.369   29.283 87.001  0.40 33.59 ? 3   U   D "C5'" 1 
ATOM   989  C "C4'" A U   B 1 3   ? -1.998  27.373 87.615  0.60 43.09 ? 3   U   D "C4'" 1 
ATOM   990  C "C4'" B U   B 1 3   ? 0.264   27.813 87.299  0.40 35.64 ? 3   U   D "C4'" 1 
ATOM   991  O "O4'" A U   B 1 3   ? -3.152  27.199 88.474  0.60 43.19 ? 3   U   D "O4'" 1 
ATOM   992  O "O4'" B U   B 1 3   ? -0.883  27.549 88.146  0.40 34.93 ? 3   U   D "O4'" 1 
ATOM   993  C "C3'" A U   B 1 3   ? -2.389  26.647 86.346  0.60 45.48 ? 3   U   D "C3'" 1 
ATOM   994  C "C3'" B U   B 1 3   ? 0.031   26.929 86.092  0.40 36.02 ? 3   U   D "C3'" 1 
ATOM   995  O "O3'" A U   B 1 3   ? -1.236  26.315 85.583  0.60 48.69 ? 3   U   D "O3'" 1 
ATOM   996  O "O3'" B U   B 1 3   ? 1.270   26.709 85.434  0.40 38.81 ? 3   U   D "O3'" 1 
ATOM   997  C "C2'" A U   B 1 3   ? -3.123  25.428 86.888  0.60 44.81 ? 3   U   D "C2'" 1 
ATOM   998  C "C2'" B U   B 1 3   ? -0.528  25.666 86.737  0.40 35.16 ? 3   U   D "C2'" 1 
ATOM   999  O "O2'" A U   B 1 3   ? -2.241  24.405 87.289  0.60 47.15 ? 3   U   D "O2'" 1 
ATOM   1000 O "O2'" B U   B 1 3   ? 0.495   24.869 87.295  0.40 35.20 ? 3   U   D "O2'" 1 
ATOM   1001 C "C1'" A U   B 1 3   ? -3.832  26.011 88.114  0.60 44.53 ? 3   U   D "C1'" 1 
ATOM   1002 C "C1'" B U   B 1 3   ? -1.375  26.248 87.874  0.40 35.01 ? 3   U   D "C1'" 1 
ATOM   1003 N N1    A U   B 1 3   ? -5.247  26.333 87.886  0.60 45.61 ? 3   U   D N1    1 
ATOM   1004 N N1    B U   B 1 3   ? -2.815  26.344 87.593  0.40 34.68 ? 3   U   D N1    1 
ATOM   1005 C C2    A U   B 1 3   ? -6.170  25.323 88.086  0.60 45.58 ? 3   U   D C2    1 
ATOM   1006 C C2    B U   B 1 3   ? -3.617  25.291 87.994  0.40 35.50 ? 3   U   D C2    1 
ATOM   1007 O O2    A U   B 1 3   ? -5.853  24.198 88.432  0.60 45.63 ? 3   U   D O2    1 
ATOM   1008 O O2    B U   B 1 3   ? -3.178  24.293 88.545  0.40 37.07 ? 3   U   D O2    1 
ATOM   1009 N N3    A U   B 1 3   ? -7.478  25.679 87.864  0.60 45.59 ? 3   U   D N3    1 
ATOM   1010 N N3    B U   B 1 3   ? -4.955  25.446 87.730  0.40 36.00 ? 3   U   D N3    1 
ATOM   1011 C C4    A U   B 1 3   ? -7.946  26.914 87.464  0.60 45.85 ? 3   U   D C4    1 
ATOM   1012 C C4    B U   B 1 3   ? -5.561  26.525 87.118  0.40 36.12 ? 3   U   D C4    1 
ATOM   1013 O O4    A U   B 1 3   ? -9.160  27.085 87.317  0.60 45.83 ? 3   U   D O4    1 
ATOM   1014 O O4    B U   B 1 3   ? -6.790  26.545 87.010  0.40 36.20 ? 3   U   D O4    1 
ATOM   1015 C C5    A U   B 1 3   ? -6.929  27.902 87.273  0.60 45.47 ? 3   U   D C5    1 
ATOM   1016 C C5    B U   B 1 3   ? -4.663  27.567 86.719  0.40 34.80 ? 3   U   D C5    1 
ATOM   1017 C C6    A U   B 1 3   ? -5.646  27.587 87.488  0.60 44.98 ? 3   U   D C6    1 
ATOM   1018 C C6    B U   B 1 3   ? -3.353  27.443 86.964  0.40 34.63 ? 3   U   D C6    1 
ATOM   1019 P P     A A   B 1 4   ? -1.408  25.817 84.064  0.60 51.32 ? 4   A   D P     1 
ATOM   1020 P P     B A   B 1 4   ? 1.295   26.006 83.993  0.40 40.49 ? 4   A   D P     1 
ATOM   1021 O OP1   A A   B 1 4   ? -0.079  25.923 83.405  0.60 50.12 ? 4   A   D OP1   1 
ATOM   1022 O OP1   B A   B 1 4   ? 2.726   25.858 83.611  0.40 40.28 ? 4   A   D OP1   1 
ATOM   1023 O OP2   A A   B 1 4   ? -2.589  26.486 83.451  0.60 48.69 ? 4   A   D OP2   1 
ATOM   1024 O OP2   B A   B 1 4   ? 0.364   26.729 83.090  0.40 38.72 ? 4   A   D OP2   1 
ATOM   1025 O "O5'" A A   B 1 4   ? -1.762  24.278 84.249  0.60 52.79 ? 4   A   D "O5'" 1 
ATOM   1026 O "O5'" B A   B 1 4   ? 0.711   24.557 84.299  0.40 39.61 ? 4   A   D "O5'" 1 
ATOM   1027 C "C5'" A A   B 1 4   ? -2.846  23.685 83.552  0.60 54.67 ? 4   A   D "C5'" 1 
ATOM   1028 C "C5'" B A   B 1 4   ? 0.017   23.821 83.304  0.40 40.43 ? 4   A   D "C5'" 1 
ATOM   1029 C "C4'" A A   B 1 4   ? -3.492  22.629 84.412  0.60 55.39 ? 4   A   D "C4'" 1 
ATOM   1030 C "C4'" B A   B 1 4   ? -0.576  22.570 83.905  0.40 40.87 ? 4   A   D "C4'" 1 
ATOM   1031 O "O4'" A A   B 1 4   ? -4.344  23.258 85.407  0.60 55.69 ? 4   A   D "O4'" 1 
ATOM   1032 O "O4'" B A   B 1 4   ? -1.454  22.926 85.008  0.40 40.71 ? 4   A   D "O4'" 1 
ATOM   1033 C "C3'" A A   B 1 4   ? -4.436  21.712 83.664  0.60 56.17 ? 4   A   D "C3'" 1 
ATOM   1034 C "C3'" B A   B 1 4   ? -1.456  21.780 82.959  0.40 40.63 ? 4   A   D "C3'" 1 
ATOM   1035 O "O3'" A A   B 1 4   ? -3.678  20.680 83.057  0.60 57.49 ? 4   A   D "O3'" 1 
ATOM   1036 O "O3'" B A   B 1 4   ? -0.658  20.910 82.168  0.40 42.91 ? 4   A   D "O3'" 1 
ATOM   1037 C "C2'" A A   B 1 4   ? -5.308  21.191 84.793  0.60 55.94 ? 4   A   D "C2'" 1 
ATOM   1038 C "C2'" B A   B 1 4   ? -2.362  21.026 83.922  0.40 40.26 ? 4   A   D "C2'" 1 
ATOM   1039 O "O2'" A A   B 1 4   ? -4.606  20.248 85.579  0.60 55.93 ? 4   A   D "O2'" 1 
ATOM   1040 O "O2'" B A   B 1 4   ? -1.734  19.891 84.480  0.40 38.89 ? 4   A   D "O2'" 1 
ATOM   1041 C "C1'" A A   B 1 4   ? -5.506  22.466 85.612  0.60 55.20 ? 4   A   D "C1'" 1 
ATOM   1042 C "C1'" B A   B 1 4   ? -2.591  22.082 85.005  0.40 38.94 ? 4   A   D "C1'" 1 
ATOM   1043 N N9    A A   B 1 4   ? -6.673  23.260 85.216  0.60 54.34 ? 4   A   D N9    1 
ATOM   1044 N N9    B A   B 1 4   ? -3.767  22.916 84.759  0.40 38.50 ? 4   A   D N9    1 
ATOM   1045 C C8    A A   B 1 4   ? -6.662  24.542 84.726  0.60 54.63 ? 4   A   D C8    1 
ATOM   1046 C C8    B A   B 1 4   ? -3.805  24.241 84.396  0.40 37.71 ? 4   A   D C8    1 
ATOM   1047 N N7    A A   B 1 4   ? -7.856  25.029 84.484  0.60 54.39 ? 4   A   D N7    1 
ATOM   1048 N N7    B A   B 1 4   ? -5.019  24.717 84.258  0.40 37.23 ? 4   A   D N7    1 
ATOM   1049 C C5    A A   B 1 4   ? -8.715  23.996 84.832  0.60 54.27 ? 4   A   D C5    1 
ATOM   1050 C C5    B A   B 1 4   ? -5.837  23.632 84.549  0.40 37.60 ? 4   A   D C5    1 
ATOM   1051 C C6    A A   B 1 4   ? -10.125 23.886 84.812  0.60 54.05 ? 4   A   D C6    1 
ATOM   1052 C C6    B A   B 1 4   ? -7.236  23.480 84.591  0.40 37.03 ? 4   A   D C6    1 
ATOM   1053 N N6    A A   B 1 4   ? -10.944 24.873 84.430  0.60 52.66 ? 4   A   D N6    1 
ATOM   1054 N N6    B A   B 1 4   ? -8.104  24.462 84.333  0.40 36.78 ? 4   A   D N6    1 
ATOM   1055 N N1    A A   B 1 4   ? -10.669 22.715 85.210  0.60 53.83 ? 4   A   D N1    1 
ATOM   1056 N N1    B A   B 1 4   ? -7.724  22.265 84.914  0.40 37.33 ? 4   A   D N1    1 
ATOM   1057 C C2    A A   B 1 4   ? -9.846  21.731 85.610  0.60 54.28 ? 4   A   D C2    1 
ATOM   1058 C C2    B A   B 1 4   ? -6.863  21.279 85.177  0.40 38.52 ? 4   A   D C2    1 
ATOM   1059 N N3    A A   B 1 4   ? -8.510  21.719 85.684  0.60 54.58 ? 4   A   D N3    1 
ATOM   1060 N N3    B A   B 1 4   ? -5.533  21.297 85.177  0.40 38.68 ? 4   A   D N3    1 
ATOM   1061 C C4    A A   B 1 4   ? -8.000  22.894 85.275  0.60 54.32 ? 4   A   D C4    1 
ATOM   1062 C C4    B A   B 1 4   ? -5.078  22.517 84.853  0.40 38.20 ? 4   A   D C4    1 
ATOM   1063 P P     A C   B 1 5   ? -3.634  20.567 81.455  0.60 58.06 ? 5   C   D P     1 
ATOM   1064 P P     B C   B 1 5   ? -0.469  21.217 80.602  0.40 44.87 ? 5   C   D P     1 
ATOM   1065 O OP1   A C   B 1 5   ? -2.210  20.541 81.023  0.60 57.31 ? 5   C   D OP1   1 
ATOM   1066 O OP1   B C   B 1 5   ? -0.139  19.926 79.946  0.40 44.22 ? 5   C   D OP1   1 
ATOM   1067 O OP2   A C   B 1 5   ? -4.563  21.576 80.873  0.60 55.73 ? 5   C   D OP2   1 
ATOM   1068 O OP2   B C   B 1 5   ? 0.441   22.379 80.438  0.40 44.49 ? 5   C   D OP2   1 
ATOM   1069 O "O5'" A C   B 1 5   ? -4.249  19.127 81.193  0.60 55.84 ? 5   C   D "O5'" 1 
ATOM   1070 O "O5'" B C   B 1 5   ? -1.920  21.664 80.130  0.40 43.73 ? 5   C   D "O5'" 1 
ATOM   1071 C "C5'" A C   B 1 5   ? -5.428  18.988 80.431  0.60 52.52 ? 5   C   D "C5'" 1 
ATOM   1072 C "C5'" B C   B 1 5   ? -2.711  20.815 79.314  0.40 43.68 ? 5   C   D "C5'" 1 
ATOM   1073 C "C4'" A C   B 1 5   ? -6.383  18.053 81.114  0.60 49.22 ? 5   C   D "C4'" 1 
ATOM   1074 C "C4'" B C   B 1 5   ? -3.540  19.896 80.176  0.40 42.89 ? 5   C   D "C4'" 1 
ATOM   1075 O "O4'" A C   B 1 5   ? -6.865  18.634 82.359  0.60 46.40 ? 5   C   D "O4'" 1 
ATOM   1076 O "O4'" B C   B 1 5   ? -4.115  20.646 81.272  0.40 42.40 ? 5   C   D "O4'" 1 
ATOM   1077 C "C3'" A C   B 1 5   ? -7.641  17.840 80.303  0.60 48.74 ? 5   C   D "C3'" 1 
ATOM   1078 C "C3'" B C   B 1 5   ? -4.720  19.259 79.464  0.40 42.40 ? 5   C   D "C3'" 1 
ATOM   1079 O "O3'" A C   B 1 5   ? -7.394  16.894 79.276  0.60 46.81 ? 5   C   D "O3'" 1 
ATOM   1080 O "O3'" B C   B 1 5   ? -4.300  18.066 78.817  0.40 41.38 ? 5   C   D "O3'" 1 
ATOM   1081 C "C2'" A C   B 1 5   ? -8.626  17.416 81.377  0.60 48.14 ? 5   C   D "C2'" 1 
ATOM   1082 C "C2'" B C   B 1 5   ? -5.703  18.997 80.603  0.40 41.68 ? 5   C   D "C2'" 1 
ATOM   1083 O "O2'" A C   B 1 5   ? -8.387  16.099 81.830  0.60 48.90 ? 5   C   D "O2'" 1 
ATOM   1084 O "O2'" B C   B 1 5   ? -5.450  17.789 81.290  0.40 40.74 ? 5   C   D "O2'" 1 
ATOM   1085 C "C1'" A C   B 1 5   ? -8.264  18.411 82.481  0.60 46.78 ? 5   C   D "C1'" 1 
ATOM   1086 C "C1'" B C   B 1 5   ? -5.421  20.176 81.538  0.40 40.69 ? 5   C   D "C1'" 1 
ATOM   1087 N N1    A C   B 1 5   ? -8.933  19.715 82.314  0.60 46.39 ? 5   C   D N1    1 
ATOM   1088 N N1    B C   B 1 5   ? -6.332  21.319 81.423  0.40 39.11 ? 5   C   D N1    1 
ATOM   1089 C C2    A C   B 1 5   ? -10.338 19.809 82.461  0.60 46.38 ? 5   C   D C2    1 
ATOM   1090 C C2    B C   B 1 5   ? -7.693  21.142 81.687  0.40 38.01 ? 5   C   D C2    1 
ATOM   1091 O O2    A C   B 1 5   ? -11.001 18.787 82.706  0.60 47.43 ? 5   C   D O2    1 
ATOM   1092 O O2    B C   B 1 5   ? -8.108  20.006 81.970  0.40 36.82 ? 5   C   D O2    1 
ATOM   1093 N N3    A C   B 1 5   ? -10.931 21.016 82.325  0.60 44.31 ? 5   C   D N3    1 
ATOM   1094 N N3    B C   B 1 5   ? -8.520  22.214 81.627  0.40 36.80 ? 5   C   D N3    1 
ATOM   1095 C C4    A C   B 1 5   ? -10.198 22.093 82.050  0.60 43.72 ? 5   C   D C4    1 
ATOM   1096 C C4    B C   B 1 5   ? -8.027  23.420 81.317  0.40 37.83 ? 5   C   D C4    1 
ATOM   1097 N N4    A C   B 1 5   ? -10.830 23.260 81.939  0.60 44.79 ? 5   C   D N4    1 
ATOM   1098 N N4    B C   B 1 5   ? -8.866  24.457 81.289  0.40 38.86 ? 5   C   D N4    1 
ATOM   1099 C C5    A C   B 1 5   ? -8.784  22.024 81.880  0.60 43.07 ? 5   C   D C5    1 
ATOM   1100 C C5    B C   B 1 5   ? -6.650  23.619 81.026  0.40 38.29 ? 5   C   D C5    1 
ATOM   1101 C C6    A C   B 1 5   ? -8.199  20.830 82.021  0.60 44.77 ? 5   C   D C6    1 
ATOM   1102 C C6    B C   B 1 5   ? -5.847  22.552 81.086  0.40 38.92 ? 5   C   D C6    1 
ATOM   1103 P P     A G   B 1 6   ? -7.576  17.341 77.745  0.60 46.61 ? 6   G   D P     1 
ATOM   1104 P P     B G   B 1 6   ? -4.647  17.840 77.268  0.40 42.34 ? 6   G   D P     1 
ATOM   1105 O OP1   A G   B 1 6   ? -6.815  16.398 76.875  0.60 45.36 ? 6   G   D OP1   1 
ATOM   1106 O OP1   B G   B 1 6   ? -3.928  16.616 76.835  0.40 41.35 ? 6   G   D OP1   1 
ATOM   1107 O OP2   A G   B 1 6   ? -7.322  18.803 77.642  0.60 44.40 ? 6   G   D OP2   1 
ATOM   1108 O OP2   B G   B 1 6   ? -4.428  19.118 76.543  0.40 40.48 ? 6   G   D OP2   1 
ATOM   1109 O "O5'" A G   B 1 6   ? -9.125  17.089 77.512  0.60 44.67 ? 6   G   D "O5'" 1 
ATOM   1110 O "O5'" B G   B 1 6   ? -6.203  17.512 77.273  0.40 42.14 ? 6   G   D "O5'" 1 
ATOM   1111 C "C5'" A G   B 1 6   ? -9.705  15.867 77.923  0.60 41.58 ? 6   G   D "C5'" 1 
ATOM   1112 C "C5'" B G   B 1 6   ? -6.671  16.231 77.681  0.40 41.77 ? 6   G   D "C5'" 1 
ATOM   1113 C "C4'" A G   B 1 6   ? -11.183 16.034 78.129  0.60 41.29 ? 6   G   D "C4'" 1 
ATOM   1114 C "C4'" B G   B 1 6   ? -8.176  16.180 77.609  0.40 41.22 ? 6   G   D "C4'" 1 
ATOM   1115 O "O4'" A G   B 1 6   ? -11.433 16.930 79.241  0.60 40.44 ? 6   G   D "O4'" 1 
ATOM   1116 O "O4'" B G   B 1 6   ? -8.750  17.002 78.657  0.40 39.50 ? 6   G   D "O4'" 1 
ATOM   1117 C "C3'" A G   B 1 6   ? -11.958 16.677 76.995  0.60 40.47 ? 6   G   D "C3'" 1 
ATOM   1118 C "C3'" B G   B 1 6   ? -8.766  16.743 76.328  0.40 41.57 ? 6   G   D "C3'" 1 
ATOM   1119 O "O3'" A G   B 1 6   ? -12.198 15.740 75.951  0.60 42.02 ? 6   G   D "O3'" 1 
ATOM   1120 O "O3'" B G   B 1 6   ? -8.729  15.770 75.287  0.40 41.32 ? 6   G   D "O3'" 1 
ATOM   1121 C "C2'" A G   B 1 6   ? -13.239 17.045 77.722  0.60 39.54 ? 6   G   D "C2'" 1 
ATOM   1122 C "C2'" B G   B 1 6   ? -10.186 17.103 76.754  0.40 40.65 ? 6   G   D "C2'" 1 
ATOM   1123 O "O2'" A G   B 1 6   ? -14.007 15.895 77.987  0.60 37.85 ? 6   G   D "O2'" 1 
ATOM   1124 O "O2'" B G   B 1 6   ? -11.067 16.002 76.731  0.40 42.30 ? 6   G   D "O2'" 1 
ATOM   1125 C "C1'" A G   B 1 6   ? -12.681 17.572 79.045  0.60 39.37 ? 6   G   D "C1'" 1 
ATOM   1126 C "C1'" B G   B 1 6   ? -9.973  17.556 78.202  0.40 39.59 ? 6   G   D "C1'" 1 
ATOM   1127 N N9    A G   B 1 6   ? -12.460 19.013 79.000  0.60 39.38 ? 6   G   D N9    1 
ATOM   1128 N N9    B G   B 1 6   ? -9.926  19.007 78.363  0.40 37.82 ? 6   G   D N9    1 
ATOM   1129 C C8    A G   B 1 6   ? -11.256 19.676 78.971  0.60 38.56 ? 6   G   D C8    1 
ATOM   1130 C C8    B G   B 1 6   ? -8.814  19.811 78.450  0.40 37.08 ? 6   G   D C8    1 
ATOM   1131 N N7    A G   B 1 6   ? -11.389 20.972 78.898  0.60 39.02 ? 6   G   D N7    1 
ATOM   1132 N N7    B G   B 1 6   ? -9.107  21.077 78.591  0.40 36.21 ? 6   G   D N7    1 
ATOM   1133 C C5    A G   B 1 6   ? -12.764 21.178 78.885  0.60 38.58 ? 6   G   D C5    1 
ATOM   1134 C C5    B G   B 1 6   ? -10.495 21.108 78.597  0.40 35.96 ? 6   G   D C5    1 
ATOM   1135 C C6    A G   B 1 6   ? -13.518 22.383 78.814  0.60 38.43 ? 6   G   D C6    1 
ATOM   1136 C C6    B G   B 1 6   ? -11.398 22.206 78.713  0.40 35.21 ? 6   G   D C6    1 
ATOM   1137 O O6    A G   B 1 6   ? -13.111 23.553 78.738  0.60 38.23 ? 6   G   D O6    1 
ATOM   1138 O O6    B G   B 1 6   ? -11.140 23.414 78.839  0.40 33.44 ? 6   G   D O6    1 
ATOM   1139 N N1    A G   B 1 6   ? -14.885 22.127 78.833  0.60 38.20 ? 6   G   D N1    1 
ATOM   1140 N N1    B G   B 1 6   ? -12.724 21.781 78.670  0.40 34.83 ? 6   G   D N1    1 
ATOM   1141 C C2    A G   B 1 6   ? -15.456 20.880 78.905  0.60 37.08 ? 6   G   D C2    1 
ATOM   1142 C C2    B G   B 1 6   ? -13.133 20.475 78.534  0.40 34.63 ? 6   G   D C2    1 
ATOM   1143 N N2    A G   B 1 6   ? -16.799 20.843 78.900  0.60 37.00 ? 6   G   D N2    1 
ATOM   1144 N N2    B G   B 1 6   ? -14.455 20.259 78.528  0.40 32.57 ? 6   G   D N2    1 
ATOM   1145 N N3    A G   B 1 6   ? -14.767 19.757 78.973  0.60 36.11 ? 6   G   D N3    1 
ATOM   1146 N N3    B G   B 1 6   ? -12.305 19.452 78.416  0.40 35.66 ? 6   G   D N3    1 
ATOM   1147 C C4    A G   B 1 6   ? -13.437 19.979 78.956  0.60 38.18 ? 6   G   D C4    1 
ATOM   1148 C C4    B G   B 1 6   ? -11.013 19.838 78.458  0.40 36.42 ? 6   G   D C4    1 
ATOM   1149 P P     A C   B 1 7   ? -12.101 16.208 74.412  0.60 42.30 ? 7   C   D P     1 
ATOM   1150 P P     B C   B 1 7   ? -8.780  16.240 73.750  0.40 41.51 ? 7   C   D P     1 
ATOM   1151 O OP1   A C   B 1 7   ? -12.139 14.968 73.594  0.60 44.41 ? 7   C   D OP1   1 
ATOM   1152 O OP1   B C   B 1 7   ? -8.596  15.023 72.918  0.40 41.57 ? 7   C   D OP1   1 
ATOM   1153 O OP2   A C   B 1 7   ? -10.984 17.173 74.226  0.60 41.67 ? 7   C   D OP2   1 
ATOM   1154 O OP2   B C   B 1 7   ? -7.886  17.411 73.551  0.40 40.88 ? 7   C   D OP2   1 
ATOM   1155 O "O5'" A C   B 1 7   ? -13.480 16.957 74.162  0.60 39.79 ? 7   C   D "O5'" 1 
ATOM   1156 O "O5'" B C   B 1 7   ? -10.282 16.723 73.566  0.40 41.08 ? 7   C   D "O5'" 1 
ATOM   1157 C "C5'" A C   B 1 7   ? -14.699 16.241 74.227  0.60 35.74 ? 7   C   D "C5'" 1 
ATOM   1158 C "C5'" B C   B 1 7   ? -11.347 15.808 73.764  0.40 42.69 ? 7   C   D "C5'" 1 
ATOM   1159 C "C4'" A C   B 1 7   ? -15.863 17.187 74.145  0.60 35.40 ? 7   C   D "C4'" 1 
ATOM   1160 C "C4'" B C   B 1 7   ? -12.664 16.530 73.729  0.40 42.29 ? 7   C   D "C4'" 1 
ATOM   1161 O "O4'" A C   B 1 7   ? -15.920 18.012 75.339  0.60 34.10 ? 7   C   D "O4'" 1 
ATOM   1162 O "O4'" B C   B 1 7   ? -12.800 17.369 74.903  0.40 43.37 ? 7   C   D "O4'" 1 
ATOM   1163 C "C3'" A C   B 1 7   ? -15.809 18.212 73.028  0.60 34.95 ? 7   C   D "C3'" 1 
ATOM   1164 C "C3'" B C   B 1 7   ? -12.822 17.499 72.577  0.40 41.64 ? 7   C   D "C3'" 1 
ATOM   1165 O "O3'" A C   B 1 7   ? -16.164 17.650 71.771  0.60 35.81 ? 7   C   D "O3'" 1 
ATOM   1166 O "O3'" B C   B 1 7   ? -13.173 16.811 71.389  0.40 39.86 ? 7   C   D "O3'" 1 
ATOM   1167 C "C2'" A C   B 1 7   ? -16.832 19.223 73.521  0.60 34.07 ? 7   C   D "C2'" 1 
ATOM   1168 C "C2'" B C   B 1 7   ? -13.934 18.402 73.090  0.40 42.25 ? 7   C   D "C2'" 1 
ATOM   1169 O "O2'" A C   B 1 7   ? -18.162 18.782 73.334  0.60 34.71 ? 7   C   D "O2'" 1 
ATOM   1170 O "O2'" B C   B 1 7   ? -15.207 17.802 72.972  0.40 41.94 ? 7   C   D "O2'" 1 
ATOM   1171 C "C1'" A C   B 1 7   ? -16.502 19.262 75.014  0.60 33.95 ? 7   C   D "C1'" 1 
ATOM   1172 C "C1'" B C   B 1 7   ? -13.558 18.522 74.569  0.40 43.42 ? 7   C   D "C1'" 1 
ATOM   1173 N N1    A C   B 1 7   ? -15.521 20.318 75.268  0.60 35.76 ? 7   C   D N1    1 
ATOM   1174 N N1    B C   B 1 7   ? -12.750 19.720 74.854  0.40 43.30 ? 7   C   D N1    1 
ATOM   1175 C C2    A C   B 1 7   ? -15.983 21.634 75.369  0.60 37.05 ? 7   C   D C2    1 
ATOM   1176 C C2    B C   B 1 7   ? -13.406 20.869 75.273  0.40 43.11 ? 7   C   D C2    1 
ATOM   1177 O O2    A C   B 1 7   ? -17.212 21.843 75.318  0.60 35.62 ? 7   C   D O2    1 
ATOM   1178 O O2    B C   B 1 7   ? -14.633 20.825 75.429  0.40 44.94 ? 7   C   D O2    1 
ATOM   1179 N N3    A C   B 1 7   ? -15.082 22.640 75.517  0.60 37.38 ? 7   C   D N3    1 
ATOM   1180 N N3    B C   B 1 7   ? -12.694 21.995 75.506  0.40 43.18 ? 7   C   D N3    1 
ATOM   1181 C C4    A C   B 1 7   ? -13.773 22.361 75.573  0.60 36.34 ? 7   C   D C4    1 
ATOM   1182 C C4    B C   B 1 7   ? -11.369 21.989 75.344  0.40 43.06 ? 7   C   D C4    1 
ATOM   1183 N N4    A C   B 1 7   ? -12.921 23.384 75.690  0.60 35.97 ? 7   C   D N4    1 
ATOM   1184 N N4    B C   B 1 7   ? -10.705 23.123 75.582  0.40 42.19 ? 7   C   D N4    1 
ATOM   1185 C C5    A C   B 1 7   ? -13.283 21.022 75.510  0.60 35.12 ? 7   C   D C5    1 
ATOM   1186 C C5    B C   B 1 7   ? -10.666 20.820 74.931  0.40 42.82 ? 7   C   D C5    1 
ATOM   1187 C C6    A C   B 1 7   ? -14.184 20.041 75.366  0.60 35.38 ? 7   C   D C6    1 
ATOM   1188 C C6    B C   B 1 7   ? -11.391 19.717 74.699  0.40 43.41 ? 7   C   D C6    1 
ATOM   1189 P P     A G   B 1 8   ? -15.614 18.323 70.420  0.60 33.66 ? 8   G   D P     1 
ATOM   1190 P P     B G   B 1 8   ? -12.801 17.450 69.966  0.40 38.77 ? 8   G   D P     1 
ATOM   1191 O OP1   A G   B 1 8   ? -16.086 17.508 69.274  0.60 37.85 ? 8   G   D OP1   1 
ATOM   1192 O OP1   B G   B 1 8   ? -13.255 16.474 68.942  0.40 40.12 ? 8   G   D OP1   1 
ATOM   1193 O OP2   A G   B 1 8   ? -14.161 18.575 70.591  0.60 35.60 ? 8   G   D OP2   1 
ATOM   1194 O OP2   B G   B 1 8   ? -11.387 17.903 69.972  0.40 38.01 ? 8   G   D OP2   1 
ATOM   1195 O "O5'" A G   B 1 8   ? -16.385 19.713 70.363  0.60 35.79 ? 8   G   D "O5'" 1 
ATOM   1196 O "O5'" B G   B 1 8   ? -13.739 18.735 69.893  0.40 38.16 ? 8   G   D "O5'" 1 
ATOM   1197 C "C5'" A G   B 1 8   ? -17.801 19.753 70.470  0.60 34.97 ? 8   G   D "C5'" 1 
ATOM   1198 C "C5'" B G   B 1 8   ? -15.152 18.599 70.003  0.40 36.33 ? 8   G   D "C5'" 1 
ATOM   1199 C "C4'" A G   B 1 8   ? -18.283 21.180 70.494  0.60 35.78 ? 8   G   D "C4'" 1 
ATOM   1200 C "C4'" B G   B 1 8   ? -15.803 19.951 70.156  0.40 36.14 ? 8   G   D "C4'" 1 
ATOM   1201 O "O4'" A G   B 1 8   ? -17.905 21.826 71.734  0.60 35.58 ? 8   G   D "O4'" 1 
ATOM   1202 O "O4'" B G   B 1 8   ? -15.506 20.518 71.463  0.40 35.42 ? 8   G   D "O4'" 1 
ATOM   1203 C "C3'" A G   B 1 8   ? -17.695 22.089 69.436  0.60 36.64 ? 8   G   D "C3'" 1 
ATOM   1204 C "C3'" B G   B 1 8   ? -15.330 21.021 69.191  0.40 35.56 ? 8   G   D "C3'" 1 
ATOM   1205 O "O3'" A G   B 1 8   ? -18.336 21.879 68.183  0.60 38.73 ? 8   G   D "O3'" 1 
ATOM   1206 O "O3'" B G   B 1 8   ? -15.943 20.865 67.918  0.40 37.15 ? 8   G   D "O3'" 1 
ATOM   1207 C "C2'" A G   B 1 8   ? -17.991 23.465 70.020  0.60 35.90 ? 8   G   D "C2'" 1 
ATOM   1208 C "C2'" B G   B 1 8   ? -15.769 22.293 69.905  0.40 33.99 ? 8   G   D "C2'" 1 
ATOM   1209 O "O2'" A G   B 1 8   ? -19.335 23.845 69.824  0.60 37.03 ? 8   G   D "O2'" 1 
ATOM   1210 O "O2'" B G   B 1 8   ? -17.153 22.543 69.769  0.40 33.29 ? 8   G   D "O2'" 1 
ATOM   1211 C "C1'" A G   B 1 8   ? -17.751 23.219 71.512  0.60 35.14 ? 8   G   D "C1'" 1 
ATOM   1212 C "C1'" B G   B 1 8   ? -15.474 21.935 71.363  0.40 33.36 ? 8   G   D "C1'" 1 
ATOM   1213 N N9    A G   B 1 8   ? -16.410 23.604 71.939  0.60 34.89 ? 8   G   D N9    1 
ATOM   1214 N N9    B G   B 1 8   ? -14.173 22.418 71.820  0.40 31.94 ? 8   G   D N9    1 
ATOM   1215 C C8    A G   B 1 8   ? -15.328 22.775 72.089  0.60 34.24 ? 8   G   D C8    1 
ATOM   1216 C C8    B G   B 1 8   ? -13.017 21.694 72.011  0.40 31.08 ? 8   G   D C8    1 
ATOM   1217 N N7    A G   B 1 8   ? -14.250 23.403 72.468  0.60 33.75 ? 8   G   D N7    1 
ATOM   1218 N N7    B G   B 1 8   ? -12.014 22.424 72.421  0.40 28.91 ? 8   G   D N7    1 
ATOM   1219 C C5    A G   B 1 8   ? -14.643 24.729 72.576  0.60 33.31 ? 8   G   D C5    1 
ATOM   1220 C C5    B G   B 1 8   ? -12.541 23.707 72.511  0.40 30.23 ? 8   G   D C5    1 
ATOM   1221 C C6    A G   B 1 8   ? -13.899 25.879 72.943  0.60 33.30 ? 8   G   D C6    1 
ATOM   1222 C C6    B G   B 1 8   ? -11.931 24.940 72.908  0.40 29.09 ? 8   G   D C6    1 
ATOM   1223 O O6    A G   B 1 8   ? -12.707 25.961 73.250  0.60 32.72 ? 8   G   D O6    1 
ATOM   1224 O O6    B G   B 1 8   ? -10.759 25.150 73.279  0.40 25.62 ? 8   G   D O6    1 
ATOM   1225 N N1    A G   B 1 8   ? -14.686 27.025 72.929  0.60 34.36 ? 8   G   D N1    1 
ATOM   1226 N N1    B G   B 1 8   ? -12.837 25.997 72.841  0.40 28.21 ? 8   G   D N1    1 
ATOM   1227 C C2    A G   B 1 8   ? -16.013 27.064 72.606  0.60 32.96 ? 8   G   D C2    1 
ATOM   1228 C C2    B G   B 1 8   ? -14.152 25.891 72.450  0.40 29.18 ? 8   G   D C2    1 
ATOM   1229 N N2    A G   B 1 8   ? -16.584 28.268 72.667  0.60 31.89 ? 8   G   D N2    1 
ATOM   1230 N N2    B G   B 1 8   ? -14.868 27.028 72.440  0.40 29.89 ? 8   G   D N2    1 
ATOM   1231 N N3    A G   B 1 8   ? -16.723 26.000 72.253  0.60 34.55 ? 8   G   D N3    1 
ATOM   1232 N N3    B G   B 1 8   ? -14.727 24.758 72.091  0.40 29.10 ? 8   G   D N3    1 
ATOM   1233 C C4    A G   B 1 8   ? -15.975 24.872 72.260  0.60 34.41 ? 8   G   D C4    1 
ATOM   1234 C C4    B G   B 1 8   ? -13.872 23.717 72.143  0.40 30.60 ? 8   G   D C4    1 
ATOM   1235 P P     A U   B 1 9   ? -17.658 22.444 66.844  0.60 40.61 ? 9   U   D P     1 
ATOM   1236 P P     B U   B 1 9   ? -15.347 21.652 66.652  0.40 38.31 ? 9   U   D P     1 
ATOM   1237 O OP1   A U   B 1 9   ? -18.560 22.104 65.712  0.60 39.63 ? 9   U   D OP1   1 
ATOM   1238 O OP1   B U   B 1 9   ? -15.886 21.034 65.413  0.40 37.09 ? 9   U   D OP1   1 
ATOM   1239 O OP2   A U   B 1 9   ? -16.235 22.030 66.798  0.60 40.95 ? 9   U   D OP2   1 
ATOM   1240 O OP2   B U   B 1 9   ? -13.879 21.790 66.824  0.40 37.51 ? 9   U   D OP2   1 
ATOM   1241 O "O5'" A U   B 1 9   ? -17.693 24.019 67.069  0.60 40.13 ? 9   U   D "O5'" 1 
ATOM   1242 O "O5'" B U   B 1 9   ? -15.980 23.099 66.802  0.40 35.97 ? 9   U   D "O5'" 1 
ATOM   1243 C "C5'" A U   B 1 9   ? -16.725 24.867 66.471  0.60 38.00 ? 9   U   D "C5'" 1 
ATOM   1244 C "C5'" B U   B 1 9   ? -15.316 24.227 66.282  0.40 34.80 ? 9   U   D "C5'" 1 
ATOM   1245 C "C4'" A U   B 1 9   ? -16.854 26.261 67.026  0.60 36.57 ? 9   U   D "C4'" 1 
ATOM   1246 C "C4'" B U   B 1 9   ? -15.709 25.455 67.055  0.40 35.12 ? 9   U   D "C4'" 1 
ATOM   1247 O "O4'" A U   B 1 9   ? -16.618 26.222 68.458  0.60 37.24 ? 9   U   D "O4'" 1 
ATOM   1248 O "O4'" B U   B 1 9   ? -15.347 25.303 68.454  0.40 35.10 ? 9   U   D "O4'" 1 
ATOM   1249 C "C3'" A U   B 1 9   ? -15.827 27.251 66.510  0.60 35.74 ? 9   U   D "C3'" 1 
ATOM   1250 C "C3'" B U   B 1 9   ? -14.980 26.702 66.602  0.40 34.41 ? 9   U   D "C3'" 1 
ATOM   1251 O "O3'" A U   B 1 9   ? -16.241 27.816 65.279  0.60 35.54 ? 9   U   D "O3'" 1 
ATOM   1252 O "O3'" B U   B 1 9   ? -15.692 27.253 65.510  0.40 34.57 ? 9   U   D "O3'" 1 
ATOM   1253 C "C2'" A U   B 1 9   ? -15.794 28.282 67.625  0.60 36.26 ? 9   U   D "C2'" 1 
ATOM   1254 C "C2'" B U   B 1 9   ? -15.037 27.573 67.846  0.40 33.74 ? 9   U   D "C2'" 1 
ATOM   1255 O "O2'" A U   B 1 9   ? -16.881 29.184 67.587  0.60 37.61 ? 9   U   D "O2'" 1 
ATOM   1256 O "O2'" B U   B 1 9   ? -16.299 28.186 67.998  0.40 34.48 ? 9   U   D "O2'" 1 
ATOM   1257 C "C1'" A U   B 1 9   ? -15.897 27.381 68.854  0.60 36.41 ? 9   U   D "C1'" 1 
ATOM   1258 C "C1'" B U   B 1 9   ? -14.836 26.530 68.948  0.40 33.59 ? 9   U   D "C1'" 1 
ATOM   1259 N N1    A U   B 1 9   ? -14.568 26.967 69.322  0.60 34.77 ? 9   U   D N1    1 
ATOM   1260 N N1    B U   B 1 9   ? -13.429 26.315 69.312  0.40 33.25 ? 9   U   D N1    1 
ATOM   1261 C C2    A U   B 1 9   ? -13.838 27.883 70.047  0.60 35.35 ? 9   U   D C2    1 
ATOM   1262 C C2    B U   B 1 9   ? -12.738 27.365 69.885  0.40 33.13 ? 9   U   D C2    1 
ATOM   1263 O O2    A U   B 1 9   ? -14.265 28.986 70.338  0.60 35.60 ? 9   U   D O2    1 
ATOM   1264 O O2    B U   B 1 9   ? -13.252 28.446 70.115  0.40 33.82 ? 9   U   D O2    1 
ATOM   1265 N N3    A U   B 1 9   ? -12.588 27.462 70.423  0.60 35.14 ? 9   U   D N3    1 
ATOM   1266 N N3    B U   B 1 9   ? -11.424 27.099 70.183  0.40 32.21 ? 9   U   D N3    1 
ATOM   1267 C C4    A U   B 1 9   ? -12.012 26.241 70.161  0.60 34.95 ? 9   U   D C4    1 
ATOM   1268 C C4    B U   B 1 9   ? -10.746 25.911 69.976  0.40 33.29 ? 9   U   D C4    1 
ATOM   1269 O O4    A U   B 1 9   ? -10.855 26.029 70.527  0.60 37.36 ? 9   U   D O4    1 
ATOM   1270 O O4    B U   B 1 9   ? -9.547  25.830 70.273  0.40 32.34 ? 9   U   D O4    1 
ATOM   1271 C C5    A U   B 1 9   ? -12.840 25.337 69.424  0.60 34.92 ? 9   U   D C5    1 
ATOM   1272 C C5    B U   B 1 9   ? -11.538 24.871 69.391  0.40 32.82 ? 9   U   D C5    1 
ATOM   1273 C C6    A U   B 1 9   ? -14.061 25.723 69.040  0.60 34.61 ? 9   U   D C6    1 
ATOM   1274 C C6    B U   B 1 9   ? -12.817 25.104 69.086  0.40 32.94 ? 9   U   D C6    1 
ATOM   1275 P P     A C   B 1 10  ? -15.185 28.637 64.390  0.60 35.05 ? 10  C   D P     1 
ATOM   1276 P P     B C   B 1 10  ? -14.924 27.567 64.139  0.40 34.69 ? 10  C   D P     1 
ATOM   1277 O OP1   A C   B 1 10  ? -15.878 28.991 63.128  0.60 33.03 ? 10  C   D OP1   1 
ATOM   1278 O OP1   B C   B 1 10  ? -15.969 27.690 63.095  0.40 34.08 ? 10  C   D OP1   1 
ATOM   1279 O OP2   A C   B 1 10  ? -13.907 27.878 64.349  0.60 33.51 ? 10  C   D OP2   1 
ATOM   1280 O OP2   B C   B 1 10  ? -13.805 26.612 63.951  0.40 33.62 ? 10  C   D OP2   1 
ATOM   1281 O "O5'" A C   B 1 10  ? -14.955 29.984 65.207  0.60 33.68 ? 10  C   D "O5'" 1 
ATOM   1282 O "O5'" B C   B 1 10  ? -14.329 29.016 64.392  0.40 34.62 ? 10  C   D "O5'" 1 
ATOM   1283 C "C5'" A C   B 1 10  ? -15.992 30.956 65.305  0.60 32.47 ? 10  C   D "C5'" 1 
ATOM   1284 C "C5'" B C   B 1 10  ? -15.206 30.116 64.585  0.40 34.63 ? 10  C   D "C5'" 1 
ATOM   1285 C "C4'" A C   B 1 10  ? -15.425 32.289 65.729  0.60 30.87 ? 10  C   D "C4'" 1 
ATOM   1286 C "C4'" B C   B 1 10  ? -14.482 31.242 65.268  0.40 34.92 ? 10  C   D "C4'" 1 
ATOM   1287 O "O4'" A C   B 1 10  ? -14.878 32.171 67.066  0.60 31.95 ? 10  C   D "O4'" 1 
ATOM   1288 O "O4'" B C   B 1 10  ? -14.139 30.861 66.627  0.40 34.40 ? 10  C   D "O4'" 1 
ATOM   1289 C "C3'" A C   B 1 10  ? -14.246 32.792 64.915  0.60 29.11 ? 10  C   D "C3'" 1 
ATOM   1290 C "C3'" B C   B 1 10  ? -13.141 31.595 64.658  0.40 34.47 ? 10  C   D "C3'" 1 
ATOM   1291 O "O3'" A C   B 1 10  ? -14.650 33.444 63.725  0.60 28.05 ? 10  C   D "O3'" 1 
ATOM   1292 O "O3'" B C   B 1 10  ? -13.286 32.398 63.502  0.40 34.05 ? 10  C   D "O3'" 1 
ATOM   1293 C "C2'" A C   B 1 10  ? -13.602 33.781 65.867  0.60 29.74 ? 10  C   D "C2'" 1 
ATOM   1294 C "C2'" B C   B 1 10  ? -12.483 32.340 65.803  0.40 34.84 ? 10  C   D "C2'" 1 
ATOM   1295 O "O2'" A C   B 1 10  ? -14.246 35.032 65.864  0.60 29.05 ? 10  C   D "O2'" 1 
ATOM   1296 O "O2'" B C   B 1 10  ? -13.024 33.640 65.945  0.40 35.63 ? 10  C   D "O2'" 1 
ATOM   1297 C "C1'" A C   B 1 10  ? -13.794 33.077 67.209  0.60 32.10 ? 10  C   D "C1'" 1 
ATOM   1298 C "C1'" B C   B 1 10  ? -12.907 31.469 66.988  0.40 34.98 ? 10  C   D "C1'" 1 
ATOM   1299 N N1    A C   B 1 10  ? -12.587 32.330 67.595  0.60 32.34 ? 10  C   D N1    1 
ATOM   1300 N N1    B C   B 1 10  ? -11.929 30.409 67.275  0.40 35.23 ? 10  C   D N1    1 
ATOM   1301 C C2    A C   B 1 10  ? -11.508 33.050 68.093  0.60 33.26 ? 10  C   D C2    1 
ATOM   1302 C C2    B C   B 1 10  ? -10.820 30.724 68.055  0.40 36.08 ? 10  C   D C2    1 
ATOM   1303 O O2    A C   B 1 10  ? -11.607 34.281 68.185  0.60 34.72 ? 10  C   D O2    1 
ATOM   1304 O O2    B C   B 1 10  ? -10.707 31.876 68.490  0.40 37.04 ? 10  C   D O2    1 
ATOM   1305 N N3    A C   B 1 10  ? -10.384 32.397 68.455  0.60 34.46 ? 10  C   D N3    1 
ATOM   1306 N N3    B C   B 1 10  ? -9.901  29.768 68.321  0.40 36.57 ? 10  C   D N3    1 
ATOM   1307 C C4    A C   B 1 10  ? -10.314 31.075 68.324  0.60 32.84 ? 10  C   D C4    1 
ATOM   1308 C C4    B C   B 1 10  ? -10.062 28.533 67.838  0.40 36.48 ? 10  C   D C4    1 
ATOM   1309 N N4    A C   B 1 10  ? -9.182  30.478 68.694  0.60 33.10 ? 10  C   D N4    1 
ATOM   1310 N N4    B C   B 1 10  ? -9.127  27.623 68.129  0.40 35.79 ? 10  C   D N4    1 
ATOM   1311 C C5    A C   B 1 10  ? -11.401 30.310 67.810  0.60 32.36 ? 10  C   D C5    1 
ATOM   1312 C C5    B C   B 1 10  ? -11.188 28.179 67.037  0.40 35.79 ? 10  C   D C5    1 
ATOM   1313 C C6    A C   B 1 10  ? -12.511 30.973 67.464  0.60 31.31 ? 10  C   D C6    1 
ATOM   1314 C C6    B C   B 1 10  ? -12.091 29.140 66.784  0.40 36.31 ? 10  C   D C6    1 
ATOM   1315 P P     A A   B 1 11  ? -13.725 33.334 62.423  0.60 24.64 ? 11  A   D P     1 
ATOM   1316 P P     B A   B 1 11  ? -12.209 32.269 62.324  0.40 34.89 ? 11  A   D P     1 
ATOM   1317 O OP1   A A   B 1 11  ? -14.260 34.318 61.468  0.60 24.61 ? 11  A   D OP1   1 
ATOM   1318 O OP1   B A   B 1 11  ? -12.799 32.848 61.088  0.40 33.23 ? 11  A   D OP1   1 
ATOM   1319 O OP2   A A   B 1 11  ? -13.638 31.903 62.038  0.60 27.07 ? 11  A   D OP2   1 
ATOM   1320 O OP2   B A   B 1 11  ? -11.719 30.863 62.321  0.40 34.30 ? 11  A   D OP2   1 
ATOM   1321 O "O5'" A A   B 1 11  ? -12.281 33.791 62.920  0.60 27.28 ? 11  A   D "O5'" 1 
ATOM   1322 O "O5'" B A   B 1 11  ? -11.023 33.214 62.810  0.40 32.64 ? 11  A   D "O5'" 1 
ATOM   1323 C "C5'" A A   B 1 11  ? -12.021 35.150 63.226  0.60 28.31 ? 11  A   D "C5'" 1 
ATOM   1324 C "C5'" B A   B 1 11  ? -11.269 34.585 63.075  0.40 30.71 ? 11  A   D "C5'" 1 
ATOM   1325 C "C4'" A A   B 1 11  ? -10.633 35.327 63.805  0.60 29.85 ? 11  A   D "C4'" 1 
ATOM   1326 C "C4'" B A   B 1 11  ? -10.205 35.147 63.978  0.40 29.49 ? 11  A   D "C4'" 1 
ATOM   1327 O "O4'" A A   B 1 11  ? -10.479 34.499 64.984  0.60 31.81 ? 11  A   D "O4'" 1 
ATOM   1328 O "O4'" B A   B 1 11  ? -10.143 34.355 65.198  0.40 29.63 ? 11  A   D "O4'" 1 
ATOM   1329 C "C3'" A A   B 1 11  ? -9.413  34.938 62.984  0.60 28.89 ? 11  A   D "C3'" 1 
ATOM   1330 C "C3'" B A   B 1 11  ? -8.775  35.114 63.467  0.40 27.87 ? 11  A   D "C3'" 1 
ATOM   1331 O "O3'" A A   B 1 11  ? -9.075  35.927 62.024  0.60 28.29 ? 11  A   D "O3'" 1 
ATOM   1332 O "O3'" B A   B 1 11  ? -8.515  36.195 62.577  0.40 26.67 ? 11  A   D "O3'" 1 
ATOM   1333 C "C2'" A A   B 1 11  ? -8.342  34.940 64.062  0.60 30.92 ? 11  A   D "C2'" 1 
ATOM   1334 C "C2'" B A   B 1 11  ? -8.013  35.268 64.775  0.40 28.47 ? 11  A   D "C2'" 1 
ATOM   1335 O "O2'" A A   B 1 11  ? -7.999  36.267 64.412  0.60 31.85 ? 11  A   D "O2'" 1 
ATOM   1336 O "O2'" B A   B 1 11  ? -8.129  36.587 65.281  0.40 25.57 ? 11  A   D "O2'" 1 
ATOM   1337 C "C1'" A A   B 1 11  ? -9.094  34.311 65.236  0.60 31.82 ? 11  A   D "C1'" 1 
ATOM   1338 C "C1'" B A   B 1 11  ? -8.808  34.324 65.680  0.40 27.97 ? 11  A   D "C1'" 1 
ATOM   1339 N N9    A A   B 1 11  ? -8.814  32.884 65.380  0.60 32.76 ? 11  A   D N9    1 
ATOM   1340 N N9    B A   B 1 11  ? -8.327  32.942 65.606  0.40 28.17 ? 11  A   D N9    1 
ATOM   1341 C C8    A A   B 1 11  ? -9.558  31.803 64.972  0.60 32.92 ? 11  A   D C8    1 
ATOM   1342 C C8    B A   B 1 11  ? -8.977  31.849 65.085  0.40 28.24 ? 11  A   D C8    1 
ATOM   1343 N N7    A A   B 1 11  ? -9.009  30.646 65.261  0.60 32.66 ? 11  A   D N7    1 
ATOM   1344 N N7    B A   B 1 11  ? -8.274  30.742 65.134  0.40 27.50 ? 11  A   D N7    1 
ATOM   1345 C C5    A A   B 1 11  ? -7.829  30.991 65.906  0.60 32.90 ? 11  A   D C5    1 
ATOM   1346 C C5    B A   B 1 11  ? -7.083  31.131 65.733  0.40 27.73 ? 11  A   D C5    1 
ATOM   1347 C C6    A A   B 1 11  ? -6.799  30.222 66.470  0.60 34.03 ? 11  A   D C6    1 
ATOM   1348 C C6    B A   B 1 11  ? -5.910  30.422 66.062  0.40 28.55 ? 11  A   D C6    1 
ATOM   1349 N N6    A A   B 1 11  ? -6.797  28.887 66.493  0.60 34.07 ? 11  A   D N6    1 
ATOM   1350 N N6    B A   B 1 11  ? -5.734  29.118 65.820  0.40 28.02 ? 11  A   D N6    1 
ATOM   1351 N N1    A A   B 1 11  ? -5.754  30.879 67.021  0.60 34.45 ? 11  A   D N1    1 
ATOM   1352 N N1    B A   B 1 11  ? -4.907  31.108 66.651  0.40 28.19 ? 11  A   D N1    1 
ATOM   1353 C C2    A A   B 1 11  ? -5.760  32.213 67.008  0.60 33.35 ? 11  A   D C2    1 
ATOM   1354 C C2    B A   B 1 11  ? -5.077  32.414 66.883  0.40 28.35 ? 11  A   D C2    1 
ATOM   1355 N N3    A A   B 1 11  ? -6.672  33.045 66.520  0.60 32.83 ? 11  A   D N3    1 
ATOM   1356 N N3    B A   B 1 11  ? -6.125  33.190 66.616  0.40 28.02 ? 11  A   D N3    1 
ATOM   1357 C C4    A A   B 1 11  ? -7.693  32.362 65.978  0.60 32.47 ? 11  A   D C4    1 
ATOM   1358 C C4    B A   B 1 11  ? -7.105  32.480 66.035  0.40 27.60 ? 11  A   D C4    1 
ATOM   1359 P P     A C   B 1 12  ? -7.914  35.629 60.946  0.60 29.50 ? 12  C   D P     1 
ATOM   1360 P P     B C   B 1 12  ? -7.301  36.090 61.522  0.40 27.29 ? 12  C   D P     1 
ATOM   1361 O OP1   A C   B 1 12  ? -8.016  36.685 59.906  0.60 30.52 ? 12  C   D OP1   1 
ATOM   1362 O OP1   B C   B 1 12  ? -7.296  37.351 60.741  0.40 26.45 ? 12  C   D OP1   1 
ATOM   1363 O OP2   A C   B 1 12  ? -7.966  34.197 60.549  0.60 28.73 ? 12  C   D OP2   1 
ATOM   1364 O OP2   B C   B 1 12  ? -7.372  34.789 60.810  0.40 26.08 ? 12  C   D OP2   1 
ATOM   1365 O "O5'" A C   B 1 12  ? -6.556  35.848 61.746  0.60 28.97 ? 12  C   D "O5'" 1 
ATOM   1366 O "O5'" B C   B 1 12  ? -5.991  36.089 62.427  0.40 27.07 ? 12  C   D "O5'" 1 
ATOM   1367 C "C5'" A C   B 1 12  ? -6.115  37.153 62.085  0.60 28.50 ? 12  C   D "C5'" 1 
ATOM   1368 C "C5'" B C   B 1 12  ? -5.579  37.274 63.096  0.40 28.93 ? 12  C   D "C5'" 1 
ATOM   1369 C "C4'" A C   B 1 12  ? -4.758  37.086 62.732  0.60 28.46 ? 12  C   D "C4'" 1 
ATOM   1370 C "C4'" B C   B 1 12  ? -4.290  37.040 63.845  0.40 30.61 ? 12  C   D "C4'" 1 
ATOM   1371 O "O4'" A C   B 1 12  ? -4.848  36.270 63.930  0.60 30.30 ? 12  C   D "O4'" 1 
ATOM   1372 O "O4'" B C   B 1 12  ? -4.495  36.026 64.872  0.40 31.33 ? 12  C   D "O4'" 1 
ATOM   1373 C "C3'" A C   B 1 12  ? -3.678  36.403 61.915  0.60 28.79 ? 12  C   D "C3'" 1 
ATOM   1374 C "C3'" B C   B 1 12  ? -3.141  36.473 63.034  0.40 30.96 ? 12  C   D "C3'" 1 
ATOM   1375 O "O3'" A C   B 1 12  ? -3.082  37.307 60.992  0.60 29.79 ? 12  C   D "O3'" 1 
ATOM   1376 O "O3'" B C   B 1 12  ? -2.491  37.443 62.228  0.40 33.03 ? 12  C   D "O3'" 1 
ATOM   1377 C "C2'" A C   B 1 12  ? -2.697  35.991 62.998  0.60 27.89 ? 12  C   D "C2'" 1 
ATOM   1378 C "C2'" B C   B 1 12  ? -2.259  35.919 64.140  0.40 31.64 ? 12  C   D "C2'" 1 
ATOM   1379 O "O2'" A C   B 1 12  ? -1.994  37.115 63.470  0.60 29.27 ? 12  C   D "O2'" 1 
ATOM   1380 O "O2'" B C   B 1 12  ? -1.618  36.923 64.906  0.40 32.77 ? 12  C   D "O2'" 1 
ATOM   1381 C "C1'" A C   B 1 12  ? -3.650  35.525 64.096  0.60 29.11 ? 12  C   D "C1'" 1 
ATOM   1382 C "C1'" B C   B 1 12  ? -3.313  35.245 65.011  0.40 31.41 ? 12  C   D "C1'" 1 
ATOM   1383 N N1    A C   B 1 12  ? -3.976  34.088 64.019  0.60 28.55 ? 12  C   D N1    1 
ATOM   1384 N N1    B C   B 1 12  ? -3.585  33.886 64.519  0.40 30.96 ? 12  C   D N1    1 
ATOM   1385 C C2    A C   B 1 12  ? -3.069  33.166 64.533  0.60 28.36 ? 12  C   D C2    1 
ATOM   1386 C C2    B C   B 1 12  ? -2.636  32.892 64.758  0.40 31.92 ? 12  C   D C2    1 
ATOM   1387 O O2    A C   B 1 12  ? -2.018  33.574 65.028  0.60 29.94 ? 12  C   D O2    1 
ATOM   1388 O O2    B C   B 1 12  ? -1.604  33.187 65.380  0.40 32.48 ? 12  C   D O2    1 
ATOM   1389 N N3    A C   B 1 12  ? -3.357  31.848 64.473  0.60 30.52 ? 12  C   D N3    1 
ATOM   1390 N N3    B C   B 1 12  ? -2.860  31.639 64.304  0.40 33.13 ? 12  C   D N3    1 
ATOM   1391 C C4    A C   B 1 12  ? -4.499  31.439 63.919  0.60 29.87 ? 12  C   D C4    1 
ATOM   1392 C C4    B C   B 1 12  ? -3.979  31.365 63.631  0.40 33.03 ? 12  C   D C4    1 
ATOM   1393 N N4    A C   B 1 12  ? -4.739  30.125 63.884  0.60 28.02 ? 12  C   D N4    1 
ATOM   1394 N N4    B C   B 1 12  ? -4.158  30.114 63.204  0.40 32.71 ? 12  C   D N4    1 
ATOM   1395 C C5    A C   B 1 12  ? -5.443  32.358 63.379  0.60 28.28 ? 12  C   D C5    1 
ATOM   1396 C C5    B C   B 1 12  ? -4.965  32.361 63.369  0.40 31.86 ? 12  C   D C5    1 
ATOM   1397 C C6    A C   B 1 12  ? -5.146  33.662 63.452  0.60 27.81 ? 12  C   D C6    1 
ATOM   1398 C C6    B C   B 1 12  ? -4.730  33.596 63.831  0.40 31.36 ? 12  C   D C6    1 
ATOM   1399 P P     A G   B 1 13  ? -2.169  36.737 59.803  0.60 29.56 ? 13  G   D P     1 
ATOM   1400 P P     B G   B 1 13  ? -1.869  36.999 60.812  0.40 33.50 ? 13  G   D P     1 
ATOM   1401 O OP1   A G   B 1 13  ? -1.766  37.885 58.953  0.60 29.83 ? 13  G   D OP1   1 
ATOM   1402 O OP1   B G   B 1 13  ? -1.316  38.208 60.163  0.40 33.58 ? 13  G   D OP1   1 
ATOM   1403 O OP2   A G   B 1 13  ? -2.866  35.584 59.186  0.60 32.09 ? 13  G   D OP2   1 
ATOM   1404 O OP2   B G   B 1 13  ? -2.871  36.182 60.094  0.40 33.67 ? 13  G   D OP2   1 
ATOM   1405 O "O5'" A G   B 1 13  ? -0.885  36.170 60.549  0.60 29.57 ? 13  G   D "O5'" 1 
ATOM   1406 O "O5'" B G   B 1 13  ? -0.658  36.049 61.216  0.40 35.33 ? 13  G   D "O5'" 1 
ATOM   1407 C "C5'" A G   B 1 13  ? 0.041   37.050 61.172  0.60 31.52 ? 13  G   D "C5'" 1 
ATOM   1408 C "C5'" B G   B 1 13  ? 0.402   36.537 62.029  0.40 38.50 ? 13  G   D "C5'" 1 
ATOM   1409 C "C4'" A G   B 1 13  ? 1.245   36.278 61.646  0.60 32.95 ? 13  G   D "C4'" 1 
ATOM   1410 C "C4'" B G   B 1 13  ? 1.496   35.504 62.136  0.40 41.44 ? 13  G   D "C4'" 1 
ATOM   1411 O "O4'" A G   B 1 13  ? 0.851   35.396 62.728  0.60 32.35 ? 13  G   D "O4'" 1 
ATOM   1412 O "O4'" B G   B 1 13  ? 1.035   34.373 62.918  0.40 41.41 ? 13  G   D "O4'" 1 
ATOM   1413 C "C3'" A G   B 1 13  ? 1.864   35.352 60.611  0.60 33.62 ? 13  G   D "C3'" 1 
ATOM   1414 C "C3'" B G   B 1 13  ? 1.937   34.882 60.823  0.40 43.26 ? 13  G   D "C3'" 1 
ATOM   1415 O "O3'" A G   B 1 13  ? 2.755   36.067 59.761  0.60 35.31 ? 13  G   D "O3'" 1 
ATOM   1416 O "O3'" B G   B 1 13  ? 2.861   35.727 60.151  0.40 45.69 ? 13  G   D "O3'" 1 
ATOM   1417 C "C2'" A G   B 1 13  ? 2.574   34.334 61.497  0.60 33.95 ? 13  G   D "C2'" 1 
ATOM   1418 C "C2'" B G   B 1 13  ? 2.580   33.585 61.294  0.40 43.31 ? 13  G   D "C2'" 1 
ATOM   1419 O "O2'" A G   B 1 13  ? 3.787   34.818 62.042  0.60 31.34 ? 13  G   D "O2'" 1 
ATOM   1420 O "O2'" B G   B 1 13  ? 3.888   33.774 61.797  0.40 43.16 ? 13  G   D "O2'" 1 
ATOM   1421 C "C1'" A G   B 1 13  ? 1.556   34.173 62.626  0.60 32.84 ? 13  G   D "C1'" 1 
ATOM   1422 C "C1'" B G   B 1 13  ? 1.651   33.189 62.444  0.40 43.13 ? 13  G   D "C1'" 1 
ATOM   1423 N N9    A G   B 1 13  ? 0.583   33.118 62.374  0.60 34.91 ? 13  G   D N9    1 
ATOM   1424 N N9    B G   B 1 13  ? 0.606   32.248 62.052  0.40 44.98 ? 13  G   D N9    1 
ATOM   1425 C C8    A G   B 1 13  ? -0.748  33.270 62.057  0.60 35.43 ? 13  G   D C8    1 
ATOM   1426 C C8    B G   B 1 13  ? -0.669  32.541 61.626  0.40 45.56 ? 13  G   D C8    1 
ATOM   1427 N N7    A G   B 1 13  ? -1.372  32.133 61.907  0.60 35.93 ? 13  G   D N7    1 
ATOM   1428 N N7    B G   B 1 13  ? -1.377  31.476 61.361  0.40 45.75 ? 13  G   D N7    1 
ATOM   1429 C C5    A G   B 1 13  ? -0.393  31.172 62.140  0.60 36.37 ? 13  G   D C5    1 
ATOM   1430 C C5    B G   B 1 13  ? -0.517  30.416 61.626  0.40 45.96 ? 13  G   D C5    1 
ATOM   1431 C C6    A G   B 1 13  ? -0.470  29.756 62.131  0.60 35.78 ? 13  G   D C6    1 
ATOM   1432 C C6    B G   B 1 13  ? -0.721  29.012 61.527  0.40 46.30 ? 13  G   D C6    1 
ATOM   1433 O O6    A G   B 1 13  ? -1.453  29.040 61.927  0.60 33.85 ? 13  G   D O6    1 
ATOM   1434 O O6    B G   B 1 13  ? -1.736  28.399 61.176  0.40 46.59 ? 13  G   D O6    1 
ATOM   1435 N N1    A G   B 1 13  ? 0.767   29.174 62.403  0.60 37.48 ? 13  G   D N1    1 
ATOM   1436 N N1    B G   B 1 13  ? 0.421   28.304 61.889  0.40 47.45 ? 13  G   D N1    1 
ATOM   1437 C C2    A G   B 1 13  ? 1.928   29.862 62.654  0.60 37.52 ? 13  G   D C2    1 
ATOM   1438 C C2    B G   B 1 13  ? 1.606   28.866 62.295  0.40 46.92 ? 13  G   D C2    1 
ATOM   1439 N N2    A G   B 1 13  ? 3.032   29.124 62.868  0.60 36.43 ? 13  G   D N2    1 
ATOM   1440 N N2    B G   B 1 13  ? 2.593   28.014 62.598  0.40 46.97 ? 13  G   D N2    1 
ATOM   1441 N N3    A G   B 1 13  ? 2.007   31.181 62.686  0.60 38.15 ? 13  G   D N3    1 
ATOM   1442 N N3    B G   B 1 13  ? 1.807   30.168 62.394  0.40 46.83 ? 13  G   D N3    1 
ATOM   1443 C C4    A G   B 1 13  ? 0.820   31.767 62.419  0.60 36.16 ? 13  G   D C4    1 
ATOM   1444 C C4    B G   B 1 13  ? 0.712   30.878 62.047  0.40 45.79 ? 13  G   D C4    1 
ATOM   1445 P P     A C   B 1 14  ? 2.961   35.594 58.238  0.60 36.67 ? 14  C   D P     1 
ATOM   1446 P P     B C   B 1 14  ? 3.012   35.628 58.556  0.40 47.13 ? 14  C   D P     1 
ATOM   1447 O OP1   A C   B 1 14  ? 4.000   36.487 57.677  0.60 38.10 ? 14  C   D OP1   1 
ATOM   1448 O OP1   B C   B 1 14  ? 3.818   36.798 58.129  0.40 46.47 ? 14  C   D OP1   1 
ATOM   1449 O OP2   A C   B 1 14  ? 1.662   35.461 57.538  0.60 38.45 ? 14  C   D OP2   1 
ATOM   1450 O OP2   B C   B 1 14  ? 1.677   35.397 57.955  0.40 48.21 ? 14  C   D OP2   1 
ATOM   1451 O "O5'" A C   B 1 14  ? 3.564   34.128 58.378  0.60 38.03 ? 14  C   D "O5'" 1 
ATOM   1452 O "O5'" B C   B 1 14  ? 3.868   34.304 58.339  0.40 49.27 ? 14  C   D "O5'" 1 
ATOM   1453 C "C5'" A C   B 1 14  ? 4.917   33.943 58.760  0.60 36.84 ? 14  C   D "C5'" 1 
ATOM   1454 C "C5'" B C   B 1 14  ? 5.177   34.196 58.878  0.40 51.23 ? 14  C   D "C5'" 1 
ATOM   1455 C "C4'" A C   B 1 14  ? 5.296   32.488 58.658  0.60 36.75 ? 14  C   D "C4'" 1 
ATOM   1456 C "C4'" B C   B 1 14  ? 5.596   32.749 58.956  0.40 52.98 ? 14  C   D "C4'" 1 
ATOM   1457 O "O4'" A C   B 1 14  ? 4.582   31.727 59.666  0.60 36.70 ? 14  C   D "O4'" 1 
ATOM   1458 O "O4'" B C   B 1 14  ? 4.716   32.035 59.863  0.40 52.89 ? 14  C   D "O4'" 1 
ATOM   1459 C "C3'" A C   B 1 14  ? 4.938   31.775 57.365  0.60 36.26 ? 14  C   D "C3'" 1 
ATOM   1460 C "C3'" B C   B 1 14  ? 5.492   31.938 57.677  0.40 53.76 ? 14  C   D "C3'" 1 
ATOM   1461 O "O3'" A C   B 1 14  ? 5.868   32.066 56.331  0.60 37.28 ? 14  C   D "O3'" 1 
ATOM   1462 O "O3'" B C   B 1 14  ? 6.585   32.174 56.800  0.40 56.87 ? 14  C   D "O3'" 1 
ATOM   1463 C "C2'" A C   B 1 14  ? 5.014   30.322 57.807  0.60 35.84 ? 14  C   D "C2'" 1 
ATOM   1464 C "C2'" B C   B 1 14  ? 5.512   30.518 58.221  0.40 53.08 ? 14  C   D "C2'" 1 
ATOM   1465 O "O2'" A C   B 1 14  ? 6.347   29.872 57.953  0.60 36.82 ? 14  C   D "O2'" 1 
ATOM   1466 O "O2'" B C   B 1 14  ? 6.813   30.105 58.591  0.40 51.74 ? 14  C   D "O2'" 1 
ATOM   1467 C "C1'" A C   B 1 14  ? 4.367   30.408 59.190  0.60 35.09 ? 14  C   D "C1'" 1 
ATOM   1468 C "C1'" B C   B 1 14  ? 4.644   30.671 59.471  0.40 52.56 ? 14  C   D "C1'" 1 
ATOM   1469 N N1    A C   B 1 14  ? 2.922   30.166 59.117  0.60 34.19 ? 14  C   D N1    1 
ATOM   1470 N N1    B C   B 1 14  ? 3.240   30.323 59.209  0.40 52.25 ? 14  C   D N1    1 
ATOM   1471 C C2    A C   B 1 14  ? 2.490   28.862 58.999  0.60 34.55 ? 14  C   D C2    1 
ATOM   1472 C C2    B C   B 1 14  ? 2.871   28.984 59.264  0.40 52.32 ? 14  C   D C2    1 
ATOM   1473 O O2    A C   B 1 14  ? 3.334   27.959 58.982  0.60 37.86 ? 14  C   D O2    1 
ATOM   1474 O O2    B C   B 1 14  ? 3.730   28.142 59.557  0.40 54.36 ? 14  C   D O2    1 
ATOM   1475 N N3    A C   B 1 14  ? 1.172   28.606 58.905  0.60 34.63 ? 14  C   D N3    1 
ATOM   1476 N N3    B C   B 1 14  ? 1.594   28.635 59.002  0.40 52.18 ? 14  C   D N3    1 
ATOM   1477 C C4    A C   B 1 14  ? 0.296   29.605 58.929  0.60 32.35 ? 14  C   D C4    1 
ATOM   1478 C C4    B C   B 1 14  ? 0.697   29.572 58.698  0.40 51.23 ? 14  C   D C4    1 
ATOM   1479 N N4    A C   B 1 14  ? -0.990  29.295 58.834  0.60 30.90 ? 14  C   D N4    1 
ATOM   1480 N N4    B C   B 1 14  ? -0.551  29.176 58.446  0.40 50.41 ? 14  C   D N4    1 
ATOM   1481 C C5    A C   B 1 14  ? 0.707   30.960 59.054  0.60 32.48 ? 14  C   D C5    1 
ATOM   1482 C C5    B C   B 1 14  ? 1.041   30.952 58.642  0.40 51.27 ? 14  C   D C5    1 
ATOM   1483 C C6    A C   B 1 14  ? 2.021   31.195 59.148  0.60 33.81 ? 14  C   D C6    1 
ATOM   1484 C C6    B C   B 1 14  ? 2.313   31.282 58.904  0.40 52.07 ? 14  C   D C6    1 
ATOM   1485 P P     A G   B 1 15  ? 5.389   32.033 54.798  0.60 37.43 ? 15  G   D P     1 
ATOM   1486 P P     B G   B 1 15  ? 6.548   31.568 55.313  0.40 57.74 ? 15  G   D P     1 
ATOM   1487 O OP1   A G   B 1 15  ? 6.575   32.383 53.978  0.60 37.39 ? 15  G   D OP1   1 
ATOM   1488 O OP1   B G   B 1 15  ? 7.709   32.120 54.572  0.40 58.66 ? 15  G   D OP1   1 
ATOM   1489 O OP2   A G   B 1 15  ? 4.130   32.801 54.637  0.60 38.19 ? 15  G   D OP2   1 
ATOM   1490 O OP2   B G   B 1 15  ? 5.178   31.747 54.769  0.40 58.35 ? 15  G   D OP2   1 
ATOM   1491 O "O5'" A G   B 1 15  ? 5.040   30.506 54.552  0.60 36.34 ? 15  G   D "O5'" 1 
ATOM   1492 O "O5'" B G   B 1 15  ? 6.775   30.009 55.544  0.40 59.61 ? 15  G   D "O5'" 1 
ATOM   1493 C "C5'" A G   B 1 15  ? 6.034   29.527 54.719  0.60 35.60 ? 15  G   D "C5'" 1 
ATOM   1494 C "C5'" B G   B 1 15  ? 8.058   29.492 55.893  0.40 61.23 ? 15  G   D "C5'" 1 
ATOM   1495 C "C4'" A G   B 1 15  ? 5.444   28.157 54.585  0.60 34.50 ? 15  G   D "C4'" 1 
ATOM   1496 C "C4'" B G   B 1 15  ? 8.113   28.016 55.586  0.40 63.31 ? 15  G   D "C4'" 1 
ATOM   1497 O "O4'" A G   B 1 15  ? 4.478   27.922 55.635  0.60 34.31 ? 15  G   D "O4'" 1 
ATOM   1498 O "O4'" B G   B 1 15  ? 7.314   27.274 56.555  0.40 64.11 ? 15  G   D "O4'" 1 
ATOM   1499 C "C3'" A G   B 1 15  ? 4.628   27.870 53.346  0.60 34.59 ? 15  G   D "C3'" 1 
ATOM   1500 C "C3'" B G   B 1 15  ? 7.494   27.655 54.248  0.40 63.95 ? 15  G   D "C3'" 1 
ATOM   1501 O "O3'" A G   B 1 15  ? 5.469   27.688 52.221  0.60 37.86 ? 15  G   D "O3'" 1 
ATOM   1502 O "O3'" B G   B 1 15  ? 8.371   27.872 53.149  0.40 64.54 ? 15  G   D "O3'" 1 
ATOM   1503 C "C2'" A G   B 1 15  ? 3.949   26.576 53.760  0.60 33.75 ? 15  G   D "C2'" 1 
ATOM   1504 C "C2'" B G   B 1 15  ? 7.112   26.197 54.454  0.40 64.46 ? 15  G   D "C2'" 1 
ATOM   1505 O "O2'" A G   B 1 15  ? 4.847   25.485 53.709  0.60 34.21 ? 15  G   D "O2'" 1 
ATOM   1506 O "O2'" B G   B 1 15  ? 8.209   25.311 54.344  0.40 65.41 ? 15  G   D "O2'" 1 
ATOM   1507 C "C1'" A G   B 1 15  ? 3.609   26.879 55.224  0.60 32.84 ? 15  G   D "C1'" 1 
ATOM   1508 C "C1'" B G   B 1 15  ? 6.598   26.236 55.895  0.40 64.31 ? 15  G   D "C1'" 1 
ATOM   1509 N N9    A G   B 1 15  ? 2.224   27.311 55.388  0.60 31.31 ? 15  G   D N9    1 
ATOM   1510 N N9    B G   B 1 15  ? 5.177   26.568 55.951  0.40 64.61 ? 15  G   D N9    1 
ATOM   1511 C C8    A G   B 1 15  ? 1.738   28.594 55.472  0.60 29.54 ? 15  G   D C8    1 
ATOM   1512 C C8    B G   B 1 15  ? 4.636   27.823 56.096  0.40 64.75 ? 15  G   D C8    1 
ATOM   1513 N N7    A G   B 1 15  ? 0.438   28.640 55.571  0.60 28.36 ? 15  G   D N7    1 
ATOM   1514 N N7    B G   B 1 15  ? 3.331   27.824 56.094  0.40 64.59 ? 15  G   D N7    1 
ATOM   1515 C C5    A G   B 1 15  ? 0.047   27.307 55.565  0.60 29.04 ? 15  G   D C5    1 
ATOM   1516 C C5    B G   B 1 15  ? 2.986   26.488 55.940  0.40 64.00 ? 15  G   D C5    1 
ATOM   1517 C C6    A G   B 1 15  ? -1.241  26.726 55.653  0.60 29.87 ? 15  G   D C6    1 
ATOM   1518 C C6    B G   B 1 15  ? 1.709   25.877 55.859  0.40 63.75 ? 15  G   D C6    1 
ATOM   1519 O O6    A G   B 1 15  ? -2.336  27.292 55.767  0.60 33.13 ? 15  G   D O6    1 
ATOM   1520 O O6    B G   B 1 15  ? 0.596   26.416 55.898  0.40 62.79 ? 15  G   D O6    1 
ATOM   1521 N N1    A G   B 1 15  ? -1.181  25.338 55.607  0.60 30.06 ? 15  G   D N1    1 
ATOM   1522 N N1    B G   B 1 15  ? 1.810   24.496 55.711  0.40 64.01 ? 15  G   D N1    1 
ATOM   1523 C C2    A G   B 1 15  ? -0.025  24.601 55.497  0.60 31.56 ? 15  G   D C2    1 
ATOM   1524 C C2    B G   B 1 15  ? 2.988   23.791 55.640  0.40 64.30 ? 15  G   D C2    1 
ATOM   1525 N N2    A G   B 1 15  ? -0.157  23.264 55.467  0.60 29.58 ? 15  G   D N2    1 
ATOM   1526 N N2    B G   B 1 15  ? 2.871   22.456 55.498  0.40 63.28 ? 15  G   D N2    1 
ATOM   1527 N N3    A G   B 1 15  ? 1.179   25.134 55.422  0.60 30.76 ? 15  G   D N3    1 
ATOM   1528 N N3    B G   B 1 15  ? 4.189   24.352 55.704  0.40 64.73 ? 15  G   D N3    1 
ATOM   1529 C C4    A G   B 1 15  ? 1.139   26.480 55.460  0.60 29.65 ? 15  G   D C4    1 
ATOM   1530 C C4    B G   B 1 15  ? 4.112   25.696 55.855  0.40 64.38 ? 15  G   D C4    1 
ATOM   1531 P P     A U   B 1 16  ? 4.821   27.370 50.788  0.60 39.30 ? 16  U   D P     1 
ATOM   1532 P P     B U   B 1 16  ? 7.755   28.356 51.746  0.40 65.23 ? 16  U   D P     1 
ATOM   1533 O OP1   A U   B 1 16  ? 5.847   27.649 49.752  0.60 40.28 ? 16  U   D OP1   1 
ATOM   1534 O OP1   B U   B 1 16  ? 8.509   27.683 50.658  0.40 65.77 ? 16  U   D OP1   1 
ATOM   1535 O OP2   A U   B 1 16  ? 3.485   28.003 50.670  0.60 37.22 ? 16  U   D OP2   1 
ATOM   1536 O OP2   B U   B 1 16  ? 7.656   29.836 51.759  0.40 64.67 ? 16  U   D OP2   1 
ATOM   1537 O "O5'" A U   B 1 16  ? 4.624   25.798 50.859  0.60 39.02 ? 16  U   D "O5'" 1 
ATOM   1538 O "O5'" B U   B 1 16  ? 6.280   27.750 51.794  0.40 66.27 ? 16  U   D "O5'" 1 
ATOM   1539 C "C5'" A U   B 1 16  ? 3.781   25.158 49.939  0.60 37.06 ? 16  U   D "C5'" 1 
ATOM   1540 C "C5'" B U   B 1 16  ? 5.609   27.317 50.614  0.40 67.27 ? 16  U   D "C5'" 1 
ATOM   1541 C "C4'" A U   B 1 16  ? 3.278   23.861 50.500  0.60 35.37 ? 16  U   D "C4'" 1 
ATOM   1542 C "C4'" B U   B 1 16  ? 5.015   25.942 50.831  0.40 67.51 ? 16  U   D "C4'" 1 
ATOM   1543 O "O4'" A U   B 1 16  ? 2.717   24.037 51.828  0.60 33.39 ? 16  U   D "O4'" 1 
ATOM   1544 O "O4'" B U   B 1 16  ? 4.242   25.930 52.060  0.40 67.66 ? 16  U   D "O4'" 1 
ATOM   1545 C "C3'" A U   B 1 16  ? 2.124   23.356 49.672  0.60 34.62 ? 16  U   D "C3'" 1 
ATOM   1546 C "C3'" B U   B 1 16  ? 4.042   25.467 49.764  0.40 67.35 ? 16  U   D "C3'" 1 
ATOM   1547 O "O3'" A U   B 1 16  ? 2.642   22.708 48.536  0.60 34.67 ? 16  U   D "O3'" 1 
ATOM   1548 O "O3'" B U   B 1 16  ? 4.738   24.878 48.670  0.40 66.65 ? 16  U   D "O3'" 1 
ATOM   1549 C "C2'" A U   B 1 16  ? 1.379   22.475 50.655  0.60 33.74 ? 16  U   D "C2'" 1 
ATOM   1550 C "C2'" B U   B 1 16  ? 3.221   24.431 50.522  0.40 67.68 ? 16  U   D "C2'" 1 
ATOM   1551 O "O2'" A U   B 1 16  ? 2.010   21.226 50.827  0.60 33.35 ? 16  U   D "O2'" 1 
ATOM   1552 O "O2'" B U   B 1 16  ? 3.881   23.186 50.630  0.40 66.90 ? 16  U   D "O2'" 1 
ATOM   1553 C "C1'" A U   B 1 16  ? 1.497   23.318 51.926  0.60 33.44 ? 16  U   D "C1'" 1 
ATOM   1554 C "C1'" B U   B 1 16  ? 3.121   25.074 51.908  0.40 68.10 ? 16  U   D "C1'" 1 
ATOM   1555 N N1    A U   B 1 16  ? 0.416   24.303 52.071  0.60 33.63 ? 16  U   D N1    1 
ATOM   1556 N N1    B U   B 1 16  ? 1.905   25.876 52.108  0.40 69.02 ? 16  U   D N1    1 
ATOM   1557 C C2    A U   B 1 16  ? -0.849  23.845 52.380  0.60 32.44 ? 16  U   D C2    1 
ATOM   1558 C C2    B U   B 1 16  ? 0.678   25.238 52.018  0.40 69.55 ? 16  U   D C2    1 
ATOM   1559 O O2    A U   B 1 16  ? -1.111  22.666 52.492  0.60 33.75 ? 16  U   D O2    1 
ATOM   1560 O O2    B U   B 1 16  ? 0.564   24.048 51.773  0.40 69.39 ? 16  U   D O2    1 
ATOM   1561 N N3    A U   B 1 16  ? -1.797  24.826 52.552  0.60 31.48 ? 16  U   D N3    1 
ATOM   1562 N N3    B U   B 1 16  ? -0.411  26.050 52.222  0.40 69.96 ? 16  U   D N3    1 
ATOM   1563 C C4    A U   B 1 16  ? -1.611  26.190 52.438  0.60 31.64 ? 16  U   D C4    1 
ATOM   1564 C C4    B U   B 1 16  ? -0.398  27.404 52.501  0.40 70.22 ? 16  U   D C4    1 
ATOM   1565 O O4    A U   B 1 16  ? -2.544  26.955 52.688  0.60 29.68 ? 16  U   D O4    1 
ATOM   1566 O O4    B U   B 1 16  ? -1.463  28.004 52.645  0.40 70.41 ? 16  U   D O4    1 
ATOM   1567 C C5    A U   B 1 16  ? -0.280  26.580 52.087  0.60 32.08 ? 16  U   D C5    1 
ATOM   1568 C C5    B U   B 1 16  ? 0.908   27.986 52.577  0.40 69.95 ? 16  U   D C5    1 
ATOM   1569 C C6    A U   B 1 16  ? 0.664   25.648 51.920  0.60 32.93 ? 16  U   D C6    1 
ATOM   1570 C C6    B U   B 1 16  ? 1.986   27.222 52.383  0.40 69.67 ? 16  U   D C6    1 
ATOM   1571 P P     A A   B 1 17  ? 2.198   23.216 47.090  0.60 37.18 ? 17  A   D P     1 
ATOM   1572 P P     B A   B 1 17  ? 4.410   25.348 47.166  0.40 66.12 ? 17  A   D P     1 
ATOM   1573 O OP1   A A   B 1 17  ? 3.261   22.809 46.139  0.60 36.73 ? 17  A   D OP1   1 
ATOM   1574 O OP1   B A   B 1 17  ? 5.466   24.756 46.302  0.40 64.04 ? 17  A   D OP1   1 
ATOM   1575 O OP2   A A   B 1 17  ? 1.814   24.651 47.189  0.60 34.06 ? 17  A   D OP2   1 
ATOM   1576 O OP2   B A   B 1 17  ? 4.211   26.821 47.177  0.40 65.50 ? 17  A   D OP2   1 
ATOM   1577 O "O5'" A A   B 1 17  ? 0.895   22.344 46.830  0.60 34.48 ? 17  A   D "O5'" 1 
ATOM   1578 O "O5'" B A   B 1 17  ? 3.014   24.647 46.830  0.40 63.79 ? 17  A   D "O5'" 1 
ATOM   1579 C "C5'" A A   B 1 17  ? 0.901   20.961 47.135  0.60 32.32 ? 17  A   D "C5'" 1 
ATOM   1580 C "C5'" B A   B 1 17  ? 2.947   23.245 46.563  0.40 61.37 ? 17  A   D "C5'" 1 
ATOM   1581 C "C4'" A A   B 1 17  ? -0.501  20.469 47.359  0.60 33.11 ? 17  A   D "C4'" 1 
ATOM   1582 C "C4'" B A   B 1 17  ? 1.521   22.742 46.668  0.40 59.04 ? 17  A   D "C4'" 1 
ATOM   1583 O "O4'" A A   B 1 17  ? -1.010  20.926 48.637  0.60 32.19 ? 17  A   D "O4'" 1 
ATOM   1584 O "O4'" B A   B 1 17  ? 1.007   23.046 47.992  0.40 58.15 ? 17  A   D "O4'" 1 
ATOM   1585 C "C3'" A A   B 1 17  ? -1.541  20.971 46.378  0.60 33.51 ? 17  A   D "C3'" 1 
ATOM   1586 C "C3'" B A   B 1 17  ? 0.493   23.349 45.721  0.40 57.73 ? 17  A   D "C3'" 1 
ATOM   1587 O "O3'" A A   B 1 17  ? -1.469  20.275 45.147  0.60 32.90 ? 17  A   D "O3'" 1 
ATOM   1588 O "O3'" B A   B 1 17  ? 0.505   22.692 44.451  0.40 55.36 ? 17  A   D "O3'" 1 
ATOM   1589 C "C2'" A A   B 1 17  ? -2.817  20.662 47.137  0.60 32.75 ? 17  A   D "C2'" 1 
ATOM   1590 C "C2'" B A   B 1 17  ? -0.812  23.086 46.463  0.40 57.53 ? 17  A   D "C2'" 1 
ATOM   1591 O "O2'" A A   B 1 17  ? -3.067  19.277 47.125  0.60 31.74 ? 17  A   D "O2'" 1 
ATOM   1592 O "O2'" B A   B 1 17  ? -1.283  21.761 46.305  0.40 58.29 ? 17  A   D "O2'" 1 
ATOM   1593 C "C1'" A A   B 1 17  ? -2.419  21.086 48.551  0.60 32.57 ? 17  A   D "C1'" 1 
ATOM   1594 C "C1'" B A   B 1 17  ? -0.385  23.299 47.916  0.40 56.81 ? 17  A   D "C1'" 1 
ATOM   1595 N N9    A A   B 1 17  ? -2.736  22.488 48.819  0.60 34.19 ? 17  A   D N9    1 
ATOM   1596 N N9    B A   B 1 17  ? -0.636  24.659 48.393  0.40 56.02 ? 17  A   D N9    1 
ATOM   1597 C C8    A A   B 1 17  ? -1.885  23.563 48.770  0.60 34.86 ? 17  A   D C8    1 
ATOM   1598 C C8    B A   B 1 17  ? 0.271   25.666 48.614  0.40 55.67 ? 17  A   D C8    1 
ATOM   1599 N N7    A A   B 1 17  ? -2.457  24.704 49.075  0.60 35.90 ? 17  A   D N7    1 
ATOM   1600 N N7    B A   B 1 17  ? -0.269  26.779 49.048  0.40 54.56 ? 17  A   D N7    1 
ATOM   1601 C C5    A A   B 1 17  ? -3.773  24.357 49.342  0.60 34.79 ? 17  A   D C5    1 
ATOM   1602 C C5    B A   B 1 17  ? -1.624  26.487 49.118  0.40 54.50 ? 17  A   D C5    1 
ATOM   1603 C C6    A A   B 1 17  ? -4.891  25.115 49.736  0.60 35.51 ? 17  A   D C6    1 
ATOM   1604 C C6    B A   B 1 17  ? -2.739  27.247 49.512  0.40 53.78 ? 17  A   D C6    1 
ATOM   1605 N N6    A A   B 1 17  ? -4.858  26.434 49.963  0.60 34.37 ? 17  A   D N6    1 
ATOM   1606 N N6    B A   B 1 17  ? -2.669  28.515 49.928  0.40 52.47 ? 17  A   D N6    1 
ATOM   1607 N N1    A A   B 1 17  ? -6.061  24.465 49.901  0.60 36.72 ? 17  A   D N1    1 
ATOM   1608 N N1    B A   B 1 17  ? -3.950  26.651 49.466  0.40 53.99 ? 17  A   D N1    1 
ATOM   1609 C C2    A A   B 1 17  ? -6.093  23.142 49.695  0.60 37.35 ? 17  A   D C2    1 
ATOM   1610 C C2    B A   B 1 17  ? -4.028  25.380 49.052  0.40 54.32 ? 17  A   D C2    1 
ATOM   1611 N N3    A A   B 1 17  ? -5.109  22.319 49.341  0.60 36.97 ? 17  A   D N3    1 
ATOM   1612 N N3    B A   B 1 17  ? -3.057  24.564 48.658  0.40 54.68 ? 17  A   D N3    1 
ATOM   1613 C C4    A A   B 1 17  ? -3.962  22.998 49.178  0.60 34.83 ? 17  A   D C4    1 
ATOM   1614 C C4    B A   B 1 17  ? -1.865  25.184 48.715  0.40 55.29 ? 17  A   D C4    1 
ATOM   1615 P P     A C   B 1 18  ? -1.807  21.050 43.785  0.60 35.24 ? 18  C   D P     1 
ATOM   1616 P P     B C   B 1 18  ? -0.244  23.363 43.190  0.40 53.74 ? 18  C   D P     1 
ATOM   1617 O OP1   A C   B 1 18  ? -1.487  20.107 42.670  0.60 36.48 ? 18  C   D OP1   1 
ATOM   1618 O OP1   B C   B 1 18  ? 0.079   22.535 42.003  0.40 52.97 ? 18  C   D OP1   1 
ATOM   1619 O OP2   A C   B 1 18  ? -1.176  22.394 43.800  0.60 34.57 ? 18  C   D OP2   1 
ATOM   1620 O OP2   B C   B 1 18  ? 0.043   24.822 43.169  0.40 53.35 ? 18  C   D OP2   1 
ATOM   1621 O "O5'" A C   B 1 18  ? -3.388  21.228 43.859  0.60 33.95 ? 18  C   D "O5'" 1 
ATOM   1622 O "O5'" B C   B 1 18  ? -1.795  23.170 43.496  0.40 53.15 ? 18  C   D "O5'" 1 
ATOM   1623 C "C5'" A C   B 1 18  ? -4.227  20.088 43.934  0.60 34.06 ? 18  C   D "C5'" 1 
ATOM   1624 C "C5'" B C   B 1 18  ? -2.407  21.888 43.378  0.40 52.13 ? 18  C   D "C5'" 1 
ATOM   1625 C "C4'" A C   B 1 18  ? -5.646  20.487 44.250  0.60 35.67 ? 18  C   D "C4'" 1 
ATOM   1626 C "C4'" B C   B 1 18  ? -3.904  21.998 43.565  0.40 51.17 ? 18  C   D "C4'" 1 
ATOM   1627 O "O4'" A C   B 1 18  ? -5.728  21.050 45.584  0.60 33.90 ? 18  C   D "O4'" 1 
ATOM   1628 O "O4'" B C   B 1 18  ? -4.199  22.408 44.927  0.40 51.27 ? 18  C   D "O4'" 1 
ATOM   1629 C "C3'" A C   B 1 18  ? -6.271  21.569 43.388  0.60 36.65 ? 18  C   D "C3'" 1 
ATOM   1630 C "C3'" B C   B 1 18  ? -4.606  23.039 42.707  0.40 50.23 ? 18  C   D "C3'" 1 
ATOM   1631 O "O3'" A C   B 1 18  ? -6.699  21.079 42.126  0.60 37.49 ? 18  C   D "O3'" 1 
ATOM   1632 O "O3'" B C   B 1 18  ? -4.895  22.528 41.415  0.40 49.78 ? 18  C   D "O3'" 1 
ATOM   1633 C "C2'" A C   B 1 18  ? -7.455  21.974 44.250  0.60 36.35 ? 18  C   D "C2'" 1 
ATOM   1634 C "C2'" B C   B 1 18  ? -5.880  23.291 43.500  0.40 50.60 ? 18  C   D "C2'" 1 
ATOM   1635 O "O2'" A C   B 1 18  ? -8.500  21.023 44.179  0.60 36.37 ? 18  C   D "O2'" 1 
ATOM   1636 O "O2'" B C   B 1 18  ? -6.861  22.291 43.305  0.40 50.15 ? 18  C   D "O2'" 1 
ATOM   1637 C "C1'" A C   B 1 18  ? -6.817  21.960 45.642  0.60 35.68 ? 18  C   D "C1'" 1 
ATOM   1638 C "C1'" B C   B 1 18  ? -5.353  23.236 44.936  0.40 50.73 ? 18  C   D "C1'" 1 
ATOM   1639 N N1    A C   B 1 18  ? -6.299  23.290 45.995  0.60 36.03 ? 18  C   D N1    1 
ATOM   1640 N N1    B C   B 1 18  ? -4.974  24.569 45.436  0.40 50.34 ? 18  C   D N1    1 
ATOM   1641 C C2    A C   B 1 18  ? -7.164  24.208 46.590  0.60 35.42 ? 18  C   D C2    1 
ATOM   1642 C C2    B C   B 1 18  ? -5.940  25.334 46.092  0.40 49.57 ? 18  C   D C2    1 
ATOM   1643 O O2    A C   B 1 18  ? -8.324  23.853 46.848  0.60 34.65 ? 18  C   D O2    1 
ATOM   1644 O O2    B C   B 1 18  ? -7.076  24.859 46.245  0.40 48.47 ? 18  C   D O2    1 
ATOM   1645 N N3    A C   B 1 18  ? -6.716  25.451 46.874  0.60 35.19 ? 18  C   D N3    1 
ATOM   1646 N N3    B C   B 1 18  ? -5.613  26.567 46.542  0.40 49.93 ? 18  C   D N3    1 
ATOM   1647 C C4    A C   B 1 18  ? -5.455  25.788 46.594  0.60 36.53 ? 18  C   D C4    1 
ATOM   1648 C C4    B C   B 1 18  ? -4.379  27.041 46.360  0.40 49.32 ? 18  C   D C4    1 
ATOM   1649 N N4    A C   B 1 18  ? -5.057  27.037 46.878  0.60 35.35 ? 18  C   D N4    1 
ATOM   1650 N N4    B C   B 1 18  ? -4.109  28.264 46.821  0.40 49.60 ? 18  C   D N4    1 
ATOM   1651 C C5    A C   B 1 18  ? -4.544  24.865 46.008  0.60 36.81 ? 18  C   D C5    1 
ATOM   1652 C C5    B C   B 1 18  ? -3.371  26.281 45.700  0.40 49.80 ? 18  C   D C5    1 
ATOM   1653 C C6    A C   B 1 18  ? -5.003  23.636 45.730  0.60 37.04 ? 18  C   D C6    1 
ATOM   1654 C C6    B C   B 1 18  ? -3.708  25.060 45.259  0.40 50.03 ? 18  C   D C6    1 
ATOM   1655 P P     A G   B 1 19  ? -6.723  22.070 40.864  0.60 38.77 ? 19  G   D P     1 
ATOM   1656 P P     B G   B 1 19  ? -5.044  23.537 40.174  0.40 49.24 ? 19  G   D P     1 
ATOM   1657 O OP1   A G   B 1 19  ? -7.059  21.232 39.689  0.60 38.91 ? 19  G   D OP1   1 
ATOM   1658 O OP1   B G   B 1 19  ? -5.201  22.690 38.965  0.40 47.85 ? 19  G   D OP1   1 
ATOM   1659 O OP2   A G   B 1 19  ? -5.466  22.862 40.858  0.60 39.54 ? 19  G   D OP2   1 
ATOM   1660 O OP2   B G   B 1 19  ? -3.945  24.537 40.233  0.40 48.43 ? 19  G   D OP2   1 
ATOM   1661 O "O5'" A G   B 1 19  ? -7.927  23.068 41.190  0.60 38.51 ? 19  G   D "O5'" 1 
ATOM   1662 O "O5'" B G   B 1 19  ? -6.421  24.291 40.450  0.40 48.46 ? 19  G   D "O5'" 1 
ATOM   1663 C "C5'" A G   B 1 19  ? -9.251  22.576 41.364  0.60 40.84 ? 19  G   D "C5'" 1 
ATOM   1664 C "C5'" B G   B 1 19  ? -7.664  23.606 40.329  0.40 47.65 ? 19  G   D "C5'" 1 
ATOM   1665 C "C4'" A G   B 1 19  ? -10.236 23.713 41.558  0.60 42.34 ? 19  G   D "C4'" 1 
ATOM   1666 C "C4'" B G   B 1 19  ? -8.816  24.557 40.564  0.40 47.45 ? 19  G   D "C4'" 1 
ATOM   1667 O "O4'" A G   B 1 19  ? -10.083 24.305 42.877  0.60 42.73 ? 19  G   D "O4'" 1 
ATOM   1668 O "O4'" B G   B 1 19  ? -8.815  24.992 41.946  0.40 47.89 ? 19  G   D "O4'" 1 
ATOM   1669 C "C3'" A G   B 1 19  ? -10.148 24.906 40.619  0.60 43.31 ? 19  G   D "C3'" 1 
ATOM   1670 C "C3'" B G   B 1 19  ? -8.786  25.852 39.769  0.40 47.22 ? 19  G   D "C3'" 1 
ATOM   1671 O "O3'" A G   B 1 19  ? -10.743 24.636 39.351  0.60 44.00 ? 19  G   D "O3'" 1 
ATOM   1672 O "O3'" B G   B 1 19  ? -9.331  25.660 38.469  0.40 45.58 ? 19  G   D "O3'" 1 
ATOM   1673 C "C2'" A G   B 1 19  ? -10.934 25.955 41.401  0.60 43.23 ? 19  G   D "C2'" 1 
ATOM   1674 C "C2'" B G   B 1 19  ? -9.671  26.765 40.608  0.40 47.44 ? 19  G   D "C2'" 1 
ATOM   1675 O "O2'" A G   B 1 19  ? -12.333 25.759 41.341  0.60 43.10 ? 19  G   D "O2'" 1 
ATOM   1676 O "O2'" B G   B 1 19  ? -11.048 26.569 40.364  0.40 47.88 ? 19  G   D "O2'" 1 
ATOM   1677 C "C1'" A G   B 1 19  ? -10.484 25.667 42.833  0.60 42.33 ? 19  G   D "C1'" 1 
ATOM   1678 C "C1'" B G   B 1 19  ? -9.327  26.312 42.028  0.40 47.85 ? 19  G   D "C1'" 1 
ATOM   1679 N N9    A G   B 1 19  ? -9.369  26.509 43.260  0.60 41.74 ? 19  G   D N9    1 
ATOM   1680 N N9    B G   B 1 19  ? -8.327  27.151 42.677  0.40 48.50 ? 19  G   D N9    1 
ATOM   1681 C C8    A G   B 1 19  ? -8.029  26.216 43.195  0.60 41.58 ? 19  G   D C8    1 
ATOM   1682 C C8    B G   B 1 19  ? -6.975  26.920 42.748  0.40 49.11 ? 19  G   D C8    1 
ATOM   1683 N N7    A G   B 1 19  ? -7.272  27.170 43.666  0.60 42.78 ? 19  G   D N7    1 
ATOM   1684 N N7    B G   B 1 19  ? -6.331  27.850 43.398  0.40 49.71 ? 19  G   D N7    1 
ATOM   1685 C C5    A G   B 1 19  ? -8.165  28.156 44.064  0.60 42.18 ? 19  G   D C5    1 
ATOM   1686 C C5    B G   B 1 19  ? -7.317  28.749 43.782  0.40 49.42 ? 19  G   D C5    1 
ATOM   1687 C C6    A G   B 1 19  ? -7.932  29.431 44.653  0.60 41.48 ? 19  G   D C6    1 
ATOM   1688 C C6    B G   B 1 19  ? -7.222  29.959 44.515  0.40 49.36 ? 19  G   D C6    1 
ATOM   1689 O O6    A G   B 1 19  ? -6.857  29.960 44.957  0.60 41.07 ? 19  G   D O6    1 
ATOM   1690 O O6    B G   B 1 19  ? -6.213  30.499 44.982  0.40 49.00 ? 19  G   D O6    1 
ATOM   1691 N N1    A G   B 1 19  ? -9.123  30.109 44.888  0.60 42.95 ? 19  G   D N1    1 
ATOM   1692 N N1    B G   B 1 19  ? -8.466  30.555 44.683  0.40 49.89 ? 19  G   D N1    1 
ATOM   1693 C C2    A G   B 1 19  ? -10.379 29.630 44.602  0.60 42.30 ? 19  G   D C2    1 
ATOM   1694 C C2    B G   B 1 19  ? -9.654  30.056 44.204  0.40 50.01 ? 19  G   D C2    1 
ATOM   1695 N N2    A G   B 1 19  ? -11.409 30.442 44.909  0.60 40.00 ? 19  G   D N2    1 
ATOM   1696 N N2    B G   B 1 19  ? -10.756 30.784 44.476  0.40 49.61 ? 19  G   D N2    1 
ATOM   1697 N N3    A G   B 1 19  ? -10.609 28.445 44.058  0.60 42.75 ? 19  G   D N3    1 
ATOM   1698 N N3    B G   B 1 19  ? -9.756  28.931 43.513  0.40 49.58 ? 19  G   D N3    1 
ATOM   1699 C C4    A G   B 1 19  ? -9.464  27.766 43.817  0.60 42.38 ? 19  G   D C4    1 
ATOM   1700 C C4    B G   B 1 19  ? -8.556  28.333 43.342  0.40 49.18 ? 19  G   D C4    1 
ATOM   1701 P P     A U   B 1 20  ? -10.415 25.588 38.091  0.60 45.61 ? 20  U   D P     1 
ATOM   1702 P P     B U   B 1 20  ? -9.006  26.717 37.304  0.40 44.67 ? 20  U   D P     1 
ATOM   1703 O OP1   A U   B 1 20  ? -10.732 24.815 36.864  0.60 45.68 ? 20  U   D OP1   1 
ATOM   1704 O OP1   B U   B 1 20  ? -8.748  25.939 36.068  0.40 44.93 ? 20  U   D OP1   1 
ATOM   1705 O OP2   A U   B 1 20  ? -9.047  26.131 38.275  0.60 45.79 ? 20  U   D OP2   1 
ATOM   1706 O OP2   B U   B 1 20  ? -7.972  27.659 37.801  0.40 44.58 ? 20  U   D OP2   1 
ATOM   1707 O "O5'" A U   B 1 20  ? -11.472 26.787 38.201  0.60 47.07 ? 20  U   D "O5'" 1 
ATOM   1708 O "O5'" B U   B 1 20  ? -10.368 27.530 37.124  0.40 43.64 ? 20  U   D "O5'" 1 
ATOM   1709 C "C5'" A U   B 1 20  ? -11.090 28.090 38.662  0.60 49.06 ? 20  U   D "C5'" 1 
ATOM   1710 C "C5'" B U   B 1 20  ? -10.612 28.742 37.844  0.40 42.77 ? 20  U   D "C5'" 1 
ATOM   1711 C "C4'" A U   B 1 20  ? -11.271 29.104 37.554  0.60 50.04 ? 20  U   D "C4'" 1 
ATOM   1712 C "C4'" B U   B 1 20  ? -10.806 29.890 36.876  0.40 41.57 ? 20  U   D "C4'" 1 
ATOM   1713 O "O4'" A U   B 1 20  ? -10.508 28.623 36.434  0.60 52.53 ? 20  U   D "O4'" 1 
ATOM   1714 O "O4'" B U   B 1 20  ? -10.568 29.401 35.536  0.40 43.50 ? 20  U   D "O4'" 1 
ATOM   1715 C "C3'" A U   B 1 20  ? -12.704 29.285 37.063  0.60 49.25 ? 20  U   D "C3'" 1 
ATOM   1716 C "C3'" B U   B 1 20  ? -12.193 30.522 36.843  0.40 39.40 ? 20  U   D "C3'" 1 
ATOM   1717 O "O3'" A U   B 1 20  ? -13.241 30.545 37.496  0.60 47.83 ? 20  U   D "O3'" 1 
ATOM   1718 O "O3'" B U   B 1 20  ? -12.224 31.646 37.726  0.40 32.89 ? 20  U   D "O3'" 1 
ATOM   1719 C "C2'" A U   B 1 20  ? -12.578 29.455 35.543  0.60 51.35 ? 20  U   D "C2'" 1 
ATOM   1720 C "C2'" B U   B 1 20  ? -12.285 31.056 35.409  0.40 42.24 ? 20  U   D "C2'" 1 
ATOM   1721 O "O2'" A U   B 1 20  ? -12.712 30.799 35.140  0.60 53.08 ? 20  U   D "O2'" 1 
ATOM   1722 O "O2'" B U   B 1 20  ? -11.742 32.356 35.268  0.40 43.22 ? 20  U   D "O2'" 1 
ATOM   1723 C "C1'" A U   B 1 20  ? -11.158 28.962 35.235  0.60 54.28 ? 20  U   D "C1'" 1 
ATOM   1724 C "C1'" B U   B 1 20  ? -11.407 30.076 34.624  0.40 43.25 ? 20  U   D "C1'" 1 
ATOM   1725 N N1    A U   B 1 20  ? -11.004 27.845 34.293  0.60 56.31 ? 20  U   D N1    1 
ATOM   1726 N N1    B U   B 1 20  ? -12.128 29.073 33.828  0.40 44.91 ? 20  U   D N1    1 
ATOM   1727 C C2    A U   B 1 20  ? -10.518 28.147 33.039  0.60 57.39 ? 20  U   D C2    1 
ATOM   1728 C C2    B U   B 1 20  ? -12.222 29.294 32.471  0.40 46.01 ? 20  U   D C2    1 
ATOM   1729 O O2    A U   B 1 20  ? -10.275 29.288 32.688  0.60 58.23 ? 20  U   D O2    1 
ATOM   1730 O O2    B U   B 1 20  ? -11.758 30.285 31.934  0.40 45.96 ? 20  U   D O2    1 
ATOM   1731 N N3    A U   B 1 20  ? -10.329 27.067 32.214  0.60 58.57 ? 20  U   D N3    1 
ATOM   1732 N N3    B U   B 1 20  ? -12.878 28.312 31.766  0.40 47.41 ? 20  U   D N3    1 
ATOM   1733 C C4    A U   B 1 20  ? -10.584 25.740 32.512  0.60 59.40 ? 20  U   D C4    1 
ATOM   1734 C C4    B U   B 1 20  ? -13.444 27.156 32.276  0.40 47.21 ? 20  U   D C4    1 
ATOM   1735 O O4    A U   B 1 20  ? -10.299 24.867 31.688  0.60 59.98 ? 20  U   D O4    1 
ATOM   1736 O O4    B U   B 1 20  ? -13.956 26.334 31.506  0.40 45.80 ? 20  U   D O4    1 
ATOM   1737 C C5    A U   B 1 20  ? -11.116 25.515 33.822  0.60 58.35 ? 20  U   D C5    1 
ATOM   1738 C C5    B U   B 1 20  ? -13.318 27.014 33.695  0.40 46.32 ? 20  U   D C5    1 
ATOM   1739 C C6    A U   B 1 20  ? -11.304 26.551 34.647  0.60 57.32 ? 20  U   D C6    1 
ATOM   1740 C C6    B U   B 1 20  ? -12.681 27.954 34.404  0.40 45.48 ? 20  U   D C6    1 
ATOM   1741 P P     A U   B 1 21  ? -13.375 30.916 39.063  0.60 45.26 ? 21  U   D P     1 
ATOM   1742 P P     B U   B 1 21  ? -13.024 31.584 39.122  0.40 28.83 ? 21  U   D P     1 
ATOM   1743 O OP1   A U   B 1 21  ? -12.959 32.338 39.173  0.60 43.42 ? 21  U   D OP1   1 
ATOM   1744 O OP1   B U   B 1 21  ? -13.431 32.986 39.396  0.40 27.78 ? 21  U   D OP1   1 
ATOM   1745 O OP2   A U   B 1 21  ? -12.706 29.899 39.896  0.60 47.02 ? 21  U   D OP2   1 
ATOM   1746 O OP2   B U   B 1 21  ? -12.193 30.858 40.111  0.40 29.72 ? 21  U   D OP2   1 
ATOM   1747 O "O5'" A U   B 1 21  ? -14.945 30.854 39.347  0.60 44.09 ? 21  U   D "O5'" 1 
ATOM   1748 O "O5'" B U   B 1 21  ? -14.347 30.736 38.843  0.40 28.96 ? 21  U   D "O5'" 1 
ATOM   1749 C "C5'" A U   B 1 21  ? -15.845 31.725 38.656  0.60 45.13 ? 21  U   D "C5'" 1 
ATOM   1750 C "C5'" B U   B 1 21  ? -15.375 31.242 37.990  0.40 28.44 ? 21  U   D "C5'" 1 
ATOM   1751 C "C4'" A U   B 1 21  ? -17.284 31.365 38.962  0.60 46.66 ? 21  U   D "C4'" 1 
ATOM   1752 C "C4'" B U   B 1 21  ? -16.713 31.210 38.689  0.40 27.87 ? 21  U   D "C4'" 1 
ATOM   1753 O "O4'" A U   B 1 21  ? -17.521 29.983 38.578  0.60 47.40 ? 21  U   D "O4'" 1 
ATOM   1754 O "O4'" B U   B 1 21  ? -17.297 29.881 38.609  0.40 28.06 ? 21  U   D "O4'" 1 
ATOM   1755 C "C3'" A U   B 1 21  ? -17.705 31.411 40.424  0.60 47.11 ? 21  U   D "C3'" 1 
ATOM   1756 C "C3'" B U   B 1 21  ? -16.612 31.549 40.170  0.40 27.96 ? 21  U   D "C3'" 1 
ATOM   1757 O "O3'" A U   B 1 21  ? -17.926 32.722 40.970  0.60 47.95 ? 21  U   D "O3'" 1 
ATOM   1758 O "O3'" B U   B 1 21  ? -17.867 32.105 40.567  0.40 28.39 ? 21  U   D "O3'" 1 
ATOM   1759 C "C2'" A U   B 1 21  ? -18.914 30.484 40.430  0.60 46.84 ? 21  U   D "C2'" 1 
ATOM   1760 C "C2'" B U   B 1 21  ? -16.538 30.182 40.853  0.40 26.61 ? 21  U   D "C2'" 1 
ATOM   1761 O "O2'" A U   B 1 21  ? -20.089 31.069 39.905  0.60 45.90 ? 21  U   D "O2'" 1 
ATOM   1762 O "O2'" B U   B 1 21  ? -17.117 30.151 42.138  0.40 24.21 ? 21  U   D "O2'" 1 
ATOM   1763 C "C1'" A U   B 1 21  ? -18.433 29.385 39.483  0.60 46.32 ? 21  U   D "C1'" 1 
ATOM   1764 C "C1'" B U   B 1 21  ? -17.287 29.273 39.880  0.40 25.85 ? 21  U   D "C1'" 1 
ATOM   1765 N N1    A U   B 1 21  ? -17.717 28.332 40.208  0.60 46.54 ? 21  U   D N1    1 
ATOM   1766 N N1    B U   B 1 21  ? -16.776 27.902 39.767  0.40 26.58 ? 21  U   D N1    1 
ATOM   1767 C C2    A U   B 1 21  ? -18.465 27.439 40.952  0.60 47.31 ? 21  U   D C2    1 
ATOM   1768 C C2    B U   B 1 21  ? -17.547 26.896 40.325  0.40 26.48 ? 21  U   D C2    1 
ATOM   1769 O O2    A U   B 1 21  ? -19.681 27.469 41.008  0.60 46.91 ? 21  U   D O2    1 
ATOM   1770 O O2    B U   B 1 21  ? -18.603 27.113 40.901  0.40 26.07 ? 21  U   D O2    1 
ATOM   1771 N N3    A U   B 1 21  ? -17.735 26.503 41.628  0.60 47.89 ? 21  U   D N3    1 
ATOM   1772 N N3    B U   B 1 21  ? -17.036 25.628 40.191  0.40 25.15 ? 21  U   D N3    1 
ATOM   1773 C C4    A U   B 1 21  ? -16.369 26.362 41.631  0.60 48.64 ? 21  U   D C4    1 
ATOM   1774 C C4    B U   B 1 21  ? -15.855 25.270 39.586  0.40 25.55 ? 21  U   D C4    1 
ATOM   1775 O O4    A U   B 1 21  ? -15.858 25.499 42.347  0.60 49.51 ? 21  U   D O4    1 
ATOM   1776 O O4    B U   B 1 21  ? -15.488 24.095 39.633  0.40 25.60 ? 21  U   D O4    1 
ATOM   1777 C C5    A U   B 1 21  ? -15.665 27.314 40.822  0.60 47.60 ? 21  U   D C5    1 
ATOM   1778 C C5    B U   B 1 21  ? -15.111 26.364 39.035  0.40 26.79 ? 21  U   D C5    1 
ATOM   1779 C C6    A U   B 1 21  ? -16.349 28.244 40.157  0.60 46.71 ? 21  U   D C6    1 
ATOM   1780 C C6    B U   B 1 21  ? -15.587 27.614 39.142  0.40 27.41 ? 21  U   D C6    1 
ATOM   1781 C C     . ASN C 2 8   ? 10.677  28.705 76.795  1.00 76.64 ? 8   ASN A C     1 
ATOM   1782 O O     . ASN C 2 8   ? 10.032  28.069 75.957  1.00 77.72 ? 8   ASN A O     1 
ATOM   1783 N N     . ASP C 2 9   ? 11.990  28.895 76.706  1.00 75.36 ? 9   ASP A N     1 
ATOM   1784 C CA    . ASP C 2 9   ? 12.759  29.487 77.795  1.00 74.05 ? 9   ASP A CA    1 
ATOM   1785 C C     . ASP C 2 9   ? 12.296  30.912 78.076  1.00 71.18 ? 9   ASP A C     1 
ATOM   1786 O O     . ASP C 2 9   ? 11.832  31.221 79.178  1.00 70.78 ? 9   ASP A O     1 
ATOM   1787 C CB    . ASP C 2 9   ? 14.252  29.475 77.447  1.00 77.21 ? 9   ASP A CB    1 
ATOM   1788 C CG    . ASP C 2 9   ? 15.088  30.284 78.426  1.00 79.87 ? 9   ASP A CG    1 
ATOM   1789 O OD1   . ASP C 2 9   ? 14.980  30.037 79.653  1.00 80.32 ? 9   ASP A OD1   1 
ATOM   1790 O OD2   . ASP C 2 9   ? 15.855  31.164 77.963  1.00 81.33 ? 9   ASP A OD2   1 
ATOM   1791 N N     . THR C 2 10  ? 12.430  31.780 77.078  1.00 67.76 ? 10  THR A N     1 
ATOM   1792 C CA    . THR C 2 10  ? 12.007  33.163 77.222  1.00 64.44 ? 10  THR A CA    1 
ATOM   1793 C C     . THR C 2 10  ? 10.509  33.197 77.502  1.00 62.05 ? 10  THR A C     1 
ATOM   1794 O O     . THR C 2 10  ? 10.013  34.113 78.153  1.00 62.14 ? 10  THR A O     1 
ATOM   1795 C CB    . THR C 2 10  ? 12.278  33.972 75.951  1.00 64.49 ? 10  THR A CB    1 
ATOM   1796 O OG1   . THR C 2 10  ? 13.687  34.004 75.689  1.00 66.04 ? 10  THR A OG1   1 
ATOM   1797 C CG2   . THR C 2 10  ? 11.770  35.389 76.124  1.00 64.38 ? 10  THR A CG2   1 
ATOM   1798 N N     . ARG C 2 11  ? 9.795   32.187 77.013  1.00 58.71 ? 11  ARG A N     1 
ATOM   1799 C CA    . ARG C 2 11  ? 8.358   32.097 77.210  1.00 56.10 ? 11  ARG A CA    1 
ATOM   1800 C C     . ARG C 2 11  ? 8.006   31.847 78.673  1.00 57.79 ? 11  ARG A C     1 
ATOM   1801 O O     . ARG C 2 11  ? 7.048   32.419 79.201  1.00 58.56 ? 11  ARG A O     1 
ATOM   1802 C CB    . ARG C 2 11  ? 7.777   30.987 76.337  1.00 51.24 ? 11  ARG A CB    1 
ATOM   1803 C CG    . ARG C 2 11  ? 6.310   30.703 76.603  1.00 46.05 ? 11  ARG A CG    1 
ATOM   1804 C CD    . ARG C 2 11  ? 5.781   29.651 75.657  1.00 42.20 ? 11  ARG A CD    1 
ATOM   1805 N NE    . ARG C 2 11  ? 4.397   29.270 75.943  1.00 40.22 ? 11  ARG A NE    1 
ATOM   1806 C CZ    . ARG C 2 11  ? 3.323   29.949 75.553  1.00 40.27 ? 11  ARG A CZ    1 
ATOM   1807 N NH1   . ARG C 2 11  ? 3.456   31.066 74.846  1.00 40.49 ? 11  ARG A NH1   1 
ATOM   1808 N NH2   . ARG C 2 11  ? 2.111   29.510 75.868  1.00 35.56 ? 11  ARG A NH2   1 
ATOM   1809 N N     . GLU C 2 12  ? 8.777   30.989 79.334  1.00 59.95 ? 12  GLU A N     1 
ATOM   1810 C CA    . GLU C 2 12  ? 8.530   30.688 80.743  1.00 60.55 ? 12  GLU A CA    1 
ATOM   1811 C C     . GLU C 2 12  ? 8.825   31.921 81.590  1.00 58.25 ? 12  GLU A C     1 
ATOM   1812 O O     . GLU C 2 12  ? 8.124   32.191 82.563  1.00 57.17 ? 12  GLU A O     1 
ATOM   1813 C CB    . GLU C 2 12  ? 9.401   29.517 81.190  1.00 64.11 ? 12  GLU A CB    1 
ATOM   1814 C CG    . GLU C 2 12  ? 9.105   28.231 80.433  1.00 72.09 ? 12  GLU A CG    1 
ATOM   1815 C CD    . GLU C 2 12  ? 10.260  27.235 80.484  1.00 76.75 ? 12  GLU A CD    1 
ATOM   1816 O OE1   . GLU C 2 12  ? 11.374  27.603 80.035  1.00 79.54 ? 12  GLU A OE1   1 
ATOM   1817 O OE2   . GLU C 2 12  ? 10.055  26.092 80.965  1.00 77.58 ? 12  GLU A OE2   1 
ATOM   1818 N N     . GLN C 2 13  ? 9.860   32.666 81.213  1.00 55.96 ? 13  GLN A N     1 
ATOM   1819 C CA    . GLN C 2 13  ? 10.222  33.882 81.931  1.00 56.04 ? 13  GLN A CA    1 
ATOM   1820 C C     . GLN C 2 13  ? 9.096   34.925 81.851  1.00 54.84 ? 13  GLN A C     1 
ATOM   1821 O O     . GLN C 2 13  ? 8.609   35.400 82.879  1.00 55.10 ? 13  GLN A O     1 
ATOM   1822 C CB    . GLN C 2 13  ? 11.522  34.453 81.363  1.00 58.99 ? 13  GLN A CB    1 
ATOM   1823 C CG    . GLN C 2 13  ? 12.752  33.590 81.649  1.00 61.18 ? 13  GLN A CG    1 
ATOM   1824 C CD    . GLN C 2 13  ? 14.013  34.124 80.989  1.00 62.95 ? 13  GLN A CD    1 
ATOM   1825 O OE1   . GLN C 2 13  ? 14.446  35.248 81.255  1.00 64.15 ? 13  GLN A OE1   1 
ATOM   1826 N NE2   . GLN C 2 13  ? 14.608  33.317 80.119  1.00 64.51 ? 13  GLN A NE2   1 
ATOM   1827 N N     . ALA C 2 14  ? 8.683   35.268 80.631  1.00 52.48 ? 14  ALA A N     1 
ATOM   1828 C CA    . ALA C 2 14  ? 7.603   36.230 80.422  1.00 49.20 ? 14  ALA A CA    1 
ATOM   1829 C C     . ALA C 2 14  ? 6.372   35.805 81.207  1.00 46.62 ? 14  ALA A C     1 
ATOM   1830 O O     . ALA C 2 14  ? 5.594   36.640 81.654  1.00 47.88 ? 14  ALA A O     1 
ATOM   1831 C CB    . ALA C 2 14  ? 7.259   36.325 78.948  1.00 48.77 ? 14  ALA A CB    1 
ATOM   1832 N N     . ASN C 2 15  ? 6.177   34.505 81.361  1.00 43.23 ? 15  ASN A N     1 
ATOM   1833 C CA    . ASN C 2 15  ? 5.034   34.030 82.124  1.00 41.63 ? 15  ASN A CA    1 
ATOM   1834 C C     . ASN C 2 15  ? 5.213   34.377 83.591  1.00 39.85 ? 15  ASN A C     1 
ATOM   1835 O O     . ASN C 2 15  ? 4.293   34.876 84.235  1.00 39.11 ? 15  ASN A O     1 
ATOM   1836 C CB    . ASN C 2 15  ? 4.891   32.518 82.027  1.00 42.55 ? 15  ASN A CB    1 
ATOM   1837 C CG    . ASN C 2 15  ? 3.768   31.996 82.890  1.00 43.80 ? 15  ASN A CG    1 
ATOM   1838 O OD1   . ASN C 2 15  ? 2.652   31.780 82.413  1.00 45.59 ? 15  ASN A OD1   1 
ATOM   1839 N ND2   . ASN C 2 15  ? 4.044   31.816 84.179  1.00 46.33 ? 15  ASN A ND2   1 
ATOM   1840 N N     . GLY C 2 16  ? 6.407   34.096 84.112  1.00 37.81 ? 16  GLY A N     1 
ATOM   1841 C CA    . GLY C 2 16  ? 6.688   34.356 85.509  1.00 35.85 ? 16  GLY A CA    1 
ATOM   1842 C C     . GLY C 2 16  ? 6.896   35.822 85.812  1.00 35.31 ? 16  GLY A C     1 
ATOM   1843 O O     . GLY C 2 16  ? 6.800   36.254 86.972  1.00 31.45 ? 16  GLY A O     1 
ATOM   1844 N N     . GLU C 2 17  ? 7.183   36.591 84.766  1.00 33.61 ? 17  GLU A N     1 
ATOM   1845 C CA    . GLU C 2 17  ? 7.404   38.015 84.932  1.00 32.41 ? 17  GLU A CA    1 
ATOM   1846 C C     . GLU C 2 17  ? 6.204   38.592 85.650  1.00 32.33 ? 17  GLU A C     1 
ATOM   1847 O O     . GLU C 2 17  ? 6.344   39.525 86.423  1.00 33.61 ? 17  GLU A O     1 
ATOM   1848 C CB    . GLU C 2 17  ? 7.608   38.686 83.568  1.00 33.68 ? 17  GLU A CB    1 
ATOM   1849 C CG    . GLU C 2 17  ? 7.868   40.190 83.592  1.00 34.29 ? 17  GLU A CG    1 
ATOM   1850 C CD    . GLU C 2 17  ? 6.588   41.020 83.541  1.00 36.54 ? 17  GLU A CD    1 
ATOM   1851 O OE1   . GLU C 2 17  ? 5.508   40.449 83.294  1.00 38.61 ? 17  GLU A OE1   1 
ATOM   1852 O OE2   . GLU C 2 17  ? 6.656   42.250 83.737  1.00 35.79 ? 17  GLU A OE2   1 
ATOM   1853 N N     . ARG C 2 18  ? 5.027   38.017 85.425  1.00 32.02 ? 18  ARG A N     1 
ATOM   1854 C CA    . ARG C 2 18  ? 3.812   38.519 86.062  1.00 33.85 ? 18  ARG A CA    1 
ATOM   1855 C C     . ARG C 2 18  ? 3.940   38.580 87.589  1.00 36.95 ? 18  ARG A C     1 
ATOM   1856 O O     . ARG C 2 18  ? 3.241   39.361 88.247  1.00 37.85 ? 18  ARG A O     1 
ATOM   1857 C CB    . ARG C 2 18  ? 2.598   37.651 85.681  1.00 31.48 ? 18  ARG A CB    1 
ATOM   1858 C CG    . ARG C 2 18  ? 1.253   38.096 86.304  1.00 29.41 ? 18  ARG A CG    1 
ATOM   1859 C CD    . ARG C 2 18  ? 0.070   37.225 85.845  1.00 25.85 ? 18  ARG A CD    1 
ATOM   1860 N NE    . ARG C 2 18  ? -1.197  37.668 86.434  1.00 27.97 ? 18  ARG A NE    1 
ATOM   1861 C CZ    . ARG C 2 18  ? -2.388  37.108 86.202  1.00 26.31 ? 18  ARG A CZ    1 
ATOM   1862 N NH1   . ARG C 2 18  ? -2.495  36.072 85.388  1.00 27.24 ? 18  ARG A NH1   1 
ATOM   1863 N NH2   . ARG C 2 18  ? -3.478  37.577 86.785  1.00 23.58 ? 18  ARG A NH2   1 
ATOM   1864 N N     . TRP C 2 19  ? 4.840   37.781 88.157  1.00 37.91 ? 19  TRP A N     1 
ATOM   1865 C CA    . TRP C 2 19  ? 4.972   37.773 89.604  1.00 40.40 ? 19  TRP A CA    1 
ATOM   1866 C C     . TRP C 2 19  ? 6.298   38.288 90.159  1.00 42.28 ? 19  TRP A C     1 
ATOM   1867 O O     . TRP C 2 19  ? 6.676   37.928 91.267  1.00 42.13 ? 19  TRP A O     1 
ATOM   1868 C CB    . TRP C 2 19  ? 4.704   36.367 90.143  1.00 37.65 ? 19  TRP A CB    1 
ATOM   1869 C CG    . TRP C 2 19  ? 3.634   35.621 89.398  1.00 37.39 ? 19  TRP A CG    1 
ATOM   1870 C CD1   . TRP C 2 19  ? 3.819   34.620 88.466  1.00 38.17 ? 19  TRP A CD1   1 
ATOM   1871 C CD2   . TRP C 2 19  ? 2.217   35.802 89.507  1.00 34.98 ? 19  TRP A CD2   1 
ATOM   1872 N NE1   . TRP C 2 19  ? 2.605   34.177 87.999  1.00 34.90 ? 19  TRP A NE1   1 
ATOM   1873 C CE2   . TRP C 2 19  ? 1.606   34.883 88.617  1.00 34.29 ? 19  TRP A CE2   1 
ATOM   1874 C CE3   . TRP C 2 19  ? 1.402   36.650 90.267  1.00 34.17 ? 19  TRP A CE3   1 
ATOM   1875 C CZ2   . TRP C 2 19  ? 0.221   34.791 88.471  1.00 32.26 ? 19  TRP A CZ2   1 
ATOM   1876 C CZ3   . TRP C 2 19  ? 0.026   36.560 90.124  1.00 32.29 ? 19  TRP A CZ3   1 
ATOM   1877 C CH2   . TRP C 2 19  ? -0.551  35.633 89.229  1.00 33.62 ? 19  TRP A CH2   1 
ATOM   1878 N N     . ASP C 2 20  ? 6.988   39.138 89.401  1.00 45.27 ? 20  ASP A N     1 
ATOM   1879 C CA    . ASP C 2 20  ? 8.265   39.702 89.842  1.00 47.83 ? 20  ASP A CA    1 
ATOM   1880 C C     . ASP C 2 20  ? 8.081   40.965 90.654  1.00 49.25 ? 20  ASP A C     1 
ATOM   1881 O O     . ASP C 2 20  ? 9.058   41.539 91.133  1.00 50.31 ? 20  ASP A O     1 
ATOM   1882 C CB    . ASP C 2 20  ? 9.159   40.056 88.656  1.00 50.14 ? 20  ASP A CB    1 
ATOM   1883 C CG    . ASP C 2 20  ? 9.577   38.849 87.857  1.00 54.33 ? 20  ASP A CG    1 
ATOM   1884 O OD1   . ASP C 2 20  ? 9.484   37.710 88.376  1.00 56.43 ? 20  ASP A OD1   1 
ATOM   1885 O OD2   . ASP C 2 20  ? 10.020  39.046 86.704  1.00 57.03 ? 20  ASP A OD2   1 
ATOM   1886 N N     . GLY C 2 21  ? 6.838   41.411 90.792  1.00 50.66 ? 21  GLY A N     1 
ATOM   1887 C CA    . GLY C 2 21  ? 6.577   42.624 91.544  1.00 52.83 ? 21  GLY A CA    1 
ATOM   1888 C C     . GLY C 2 21  ? 7.517   43.753 91.162  1.00 55.29 ? 21  GLY A C     1 
ATOM   1889 O O     . GLY C 2 21  ? 7.586   44.149 89.997  1.00 53.69 ? 21  GLY A O     1 
ATOM   1890 N N     . GLY C 2 22  ? 8.248   44.266 92.149  1.00 58.30 ? 22  GLY A N     1 
ATOM   1891 C CA    . GLY C 2 22  ? 9.187   45.352 91.904  1.00 61.89 ? 22  GLY A CA    1 
ATOM   1892 C C     . GLY C 2 22  ? 10.455  44.948 91.163  1.00 63.60 ? 22  GLY A C     1 
ATOM   1893 O O     . GLY C 2 22  ? 10.700  45.388 90.034  1.00 64.97 ? 22  GLY A O     1 
ATOM   1894 N N     . SER C 2 23  ? 11.271  44.114 91.793  1.00 64.22 ? 23  SER A N     1 
ATOM   1895 C CA    . SER C 2 23  ? 12.503  43.671 91.162  1.00 65.68 ? 23  SER A CA    1 
ATOM   1896 C C     . SER C 2 23  ? 12.196  43.001 89.830  1.00 66.25 ? 23  SER A C     1 
ATOM   1897 O O     . SER C 2 23  ? 11.039  42.935 89.410  1.00 67.41 ? 23  SER A O     1 
ATOM   1898 C CB    . SER C 2 23  ? 13.257  42.705 92.086  1.00 66.34 ? 23  SER A CB    1 
ATOM   1899 O OG    . SER C 2 23  ? 12.405  41.679 92.565  1.00 67.98 ? 23  SER A OG    1 
ATOM   1900 N N     . GLY C 2 24  ? 13.234  42.505 89.168  1.00 66.21 ? 24  GLY A N     1 
ATOM   1901 C CA    . GLY C 2 24  ? 13.052  41.855 87.884  1.00 65.50 ? 24  GLY A CA    1 
ATOM   1902 C C     . GLY C 2 24  ? 14.016  42.439 86.872  1.00 65.32 ? 24  GLY A C     1 
ATOM   1903 O O     . GLY C 2 24  ? 14.517  43.546 87.057  1.00 65.59 ? 24  GLY A O     1 
ATOM   1904 N N     . GLY C 2 25  ? 14.281  41.698 85.802  1.00 65.29 ? 25  GLY A N     1 
ATOM   1905 C CA    . GLY C 2 25  ? 15.197  42.183 84.788  1.00 63.84 ? 25  GLY A CA    1 
ATOM   1906 C C     . GLY C 2 25  ? 14.707  42.000 83.361  1.00 63.40 ? 25  GLY A C     1 
ATOM   1907 O O     . GLY C 2 25  ? 15.174  42.712 82.454  1.00 63.72 ? 25  GLY A O     1 
ATOM   1908 N N     . ILE C 2 26  ? 13.779  41.059 83.147  1.00 60.65 ? 26  ILE A N     1 
ATOM   1909 C CA    . ILE C 2 26  ? 13.257  40.816 81.798  1.00 57.11 ? 26  ILE A CA    1 
ATOM   1910 C C     . ILE C 2 26  ? 12.406  41.975 81.315  1.00 55.08 ? 26  ILE A C     1 
ATOM   1911 O O     . ILE C 2 26  ? 11.425  42.356 81.961  1.00 54.06 ? 26  ILE A O     1 
ATOM   1912 C CB    . ILE C 2 26  ? 12.399  39.530 81.705  1.00 56.05 ? 26  ILE A CB    1 
ATOM   1913 C CG1   . ILE C 2 26  ? 11.826  39.408 80.288  1.00 54.27 ? 26  ILE A CG1   1 
ATOM   1914 C CG2   . ILE C 2 26  ? 11.297  39.553 82.748  1.00 56.85 ? 26  ILE A CG2   1 
ATOM   1915 C CD1   . ILE C 2 26  ? 11.048  38.152 80.030  1.00 52.08 ? 26  ILE A CD1   1 
ATOM   1916 N N     . THR C 2 27  ? 12.795  42.539 80.177  1.00 52.69 ? 27  THR A N     1 
ATOM   1917 C CA    . THR C 2 27  ? 12.060  43.651 79.616  1.00 50.57 ? 27  THR A CA    1 
ATOM   1918 C C     . THR C 2 27  ? 10.616  43.231 79.474  1.00 47.47 ? 27  THR A C     1 
ATOM   1919 O O     . THR C 2 27  ? 10.328  42.113 79.063  1.00 47.16 ? 27  THR A O     1 
ATOM   1920 C CB    . THR C 2 27  ? 12.603  44.045 78.260  1.00 53.16 ? 27  THR A CB    1 
ATOM   1921 O OG1   . THR C 2 27  ? 13.983  44.408 78.395  1.00 55.56 ? 27  THR A OG1   1 
ATOM   1922 C CG2   . THR C 2 27  ? 11.825  45.235 77.717  1.00 54.48 ? 27  THR A CG2   1 
ATOM   1923 N N     . SER C 2 28  ? 9.718   44.144 79.818  1.00 44.58 ? 28  SER A N     1 
ATOM   1924 C CA    . SER C 2 28  ? 8.285   43.890 79.785  1.00 41.81 ? 28  SER A CA    1 
ATOM   1925 C C     . SER C 2 28  ? 7.517   45.032 79.126  1.00 40.06 ? 28  SER A C     1 
ATOM   1926 O O     . SER C 2 28  ? 7.954   46.179 79.158  1.00 41.42 ? 28  SER A O     1 
ATOM   1927 C CB    . SER C 2 28  ? 7.790   43.696 81.214  1.00 40.53 ? 28  SER A CB    1 
ATOM   1928 O OG    . SER C 2 28  ? 6.389   43.833 81.284  1.00 43.82 ? 28  SER A OG    1 
ATOM   1929 N N     . PRO C 2 29  ? 6.362   44.729 78.510  1.00 37.52 ? 29  PRO A N     1 
ATOM   1930 C CA    . PRO C 2 29  ? 5.542   45.745 77.845  1.00 34.28 ? 29  PRO A CA    1 
ATOM   1931 C C     . PRO C 2 29  ? 4.792   46.566 78.885  1.00 34.14 ? 29  PRO A C     1 
ATOM   1932 O O     . PRO C 2 29  ? 4.378   47.701 78.617  1.00 34.60 ? 29  PRO A O     1 
ATOM   1933 C CB    . PRO C 2 29  ? 4.559   44.925 77.010  1.00 33.89 ? 29  PRO A CB    1 
ATOM   1934 C CG    . PRO C 2 29  ? 5.115   43.533 76.999  1.00 35.45 ? 29  PRO A CG    1 
ATOM   1935 C CD    . PRO C 2 29  ? 5.770   43.394 78.332  1.00 37.27 ? 29  PRO A CD    1 
ATOM   1936 N N     . PHE C 2 30  ? 4.612   45.981 80.068  1.00 31.49 ? 30  PHE A N     1 
ATOM   1937 C CA    . PHE C 2 30  ? 3.874   46.631 81.138  1.00 32.43 ? 30  PHE A CA    1 
ATOM   1938 C C     . PHE C 2 30  ? 4.694   47.537 82.040  1.00 33.65 ? 30  PHE A C     1 
ATOM   1939 O O     . PHE C 2 30  ? 5.867   47.279 82.297  1.00 37.05 ? 30  PHE A O     1 
ATOM   1940 C CB    . PHE C 2 30  ? 3.151   45.574 81.972  1.00 31.70 ? 30  PHE A CB    1 
ATOM   1941 C CG    . PHE C 2 30  ? 2.040   44.877 81.231  1.00 31.05 ? 30  PHE A CG    1 
ATOM   1942 C CD1   . PHE C 2 30  ? 2.082   43.507 81.013  1.00 30.54 ? 30  PHE A CD1   1 
ATOM   1943 C CD2   . PHE C 2 30  ? 0.965   45.601 80.723  1.00 31.44 ? 30  PHE A CD2   1 
ATOM   1944 C CE1   . PHE C 2 30  ? 1.077   42.862 80.296  1.00 30.29 ? 30  PHE A CE1   1 
ATOM   1945 C CE2   . PHE C 2 30  ? -0.047  44.964 80.005  1.00 31.99 ? 30  PHE A CE2   1 
ATOM   1946 C CZ    . PHE C 2 30  ? 0.012   43.591 79.791  1.00 30.37 ? 30  PHE A CZ    1 
ATOM   1947 N N     . LYS C 2 31  ? 4.063   48.594 82.538  1.00 32.32 ? 31  LYS A N     1 
ATOM   1948 C CA    . LYS C 2 31  ? 4.746   49.548 83.393  1.00 29.73 ? 31  LYS A CA    1 
ATOM   1949 C C     . LYS C 2 31  ? 4.165   49.604 84.802  1.00 31.04 ? 31  LYS A C     1 
ATOM   1950 O O     . LYS C 2 31  ? 4.504   50.485 85.587  1.00 31.77 ? 31  LYS A O     1 
ATOM   1951 C CB    . LYS C 2 31  ? 4.688   50.931 82.754  1.00 28.06 ? 31  LYS A CB    1 
ATOM   1952 C CG    . LYS C 2 31  ? 4.942   50.919 81.258  1.00 27.76 ? 31  LYS A CG    1 
ATOM   1953 C CD    . LYS C 2 31  ? 5.543   52.228 80.779  1.00 27.95 ? 31  LYS A CD    1 
ATOM   1954 C CE    . LYS C 2 31  ? 4.805   53.436 81.319  1.00 29.45 ? 31  LYS A CE    1 
ATOM   1955 N NZ    . LYS C 2 31  ? 5.431   54.698 80.831  1.00 29.01 ? 31  LYS A NZ    1 
ATOM   1956 N N     . LEU C 2 32  ? 3.275   48.676 85.120  1.00 30.35 ? 32  LEU A N     1 
ATOM   1957 C CA    . LEU C 2 32  ? 2.686   48.629 86.446  1.00 30.02 ? 32  LEU A CA    1 
ATOM   1958 C C     . LEU C 2 32  ? 2.609   47.188 86.860  1.00 31.32 ? 32  LEU A C     1 
ATOM   1959 O O     . LEU C 2 32  ? 2.168   46.331 86.099  1.00 32.45 ? 32  LEU A O     1 
ATOM   1960 C CB    . LEU C 2 32  ? 1.282   49.210 86.469  1.00 31.15 ? 32  LEU A CB    1 
ATOM   1961 C CG    . LEU C 2 32  ? 1.134   50.669 86.085  1.00 33.68 ? 32  LEU A CG    1 
ATOM   1962 C CD1   . LEU C 2 32  ? -0.311  51.092 86.292  1.00 31.70 ? 32  LEU A CD1   1 
ATOM   1963 C CD2   . LEU C 2 32  ? 2.077   51.506 86.938  1.00 34.85 ? 32  LEU A CD2   1 
ATOM   1964 N N     . PRO C 2 33  ? 3.030   46.899 88.086  1.00 32.05 ? 33  PRO A N     1 
ATOM   1965 C CA    . PRO C 2 33  ? 3.001   45.533 88.588  1.00 32.48 ? 33  PRO A CA    1 
ATOM   1966 C C     . PRO C 2 33  ? 1.592   44.940 88.613  1.00 33.18 ? 33  PRO A C     1 
ATOM   1967 O O     . PRO C 2 33  ? 0.611   45.665 88.699  1.00 32.17 ? 33  PRO A O     1 
ATOM   1968 C CB    . PRO C 2 33  ? 3.583   45.689 89.985  1.00 34.23 ? 33  PRO A CB    1 
ATOM   1969 C CG    . PRO C 2 33  ? 3.087   47.053 90.387  1.00 31.77 ? 33  PRO A CG    1 
ATOM   1970 C CD    . PRO C 2 33  ? 3.384   47.846 89.158  1.00 30.57 ? 33  PRO A CD    1 
ATOM   1971 N N     . ASP C 2 34  ? 1.529   43.611 88.544  1.00 34.61 ? 34  ASP A N     1 
ATOM   1972 C CA    . ASP C 2 34  ? 0.294   42.829 88.588  1.00 33.77 ? 34  ASP A CA    1 
ATOM   1973 C C     . ASP C 2 34  ? -0.424  43.118 89.894  1.00 32.79 ? 34  ASP A C     1 
ATOM   1974 O O     . ASP C 2 34  ? 0.202   43.515 90.866  1.00 33.24 ? 34  ASP A O     1 
ATOM   1975 C CB    . ASP C 2 34  ? 0.648   41.344 88.523  1.00 36.18 ? 34  ASP A CB    1 
ATOM   1976 C CG    . ASP C 2 34  ? -0.562  40.445 88.640  1.00 38.73 ? 34  ASP A CG    1 
ATOM   1977 O OD1   . ASP C 2 34  ? -1.317  40.323 87.649  1.00 41.01 ? 34  ASP A OD1   1 
ATOM   1978 O OD2   . ASP C 2 34  ? -0.759  39.863 89.726  1.00 39.26 ? 34  ASP A OD2   1 
ATOM   1979 N N     . GLU C 2 35  ? -1.732  42.915 89.927  1.00 32.47 ? 35  GLU A N     1 
ATOM   1980 C CA    . GLU C 2 35  ? -2.500  43.172 91.144  1.00 32.38 ? 35  GLU A CA    1 
ATOM   1981 C C     . GLU C 2 35  ? -3.538  42.072 91.396  1.00 33.32 ? 35  GLU A C     1 
ATOM   1982 O O     . GLU C 2 35  ? -4.604  42.327 91.957  1.00 33.14 ? 35  GLU A O     1 
ATOM   1983 C CB    . GLU C 2 35  ? -3.189  44.544 91.062  1.00 32.49 ? 35  GLU A CB    1 
ATOM   1984 C CG    . GLU C 2 35  ? -2.240  45.757 91.067  1.00 32.74 ? 35  GLU A CG    1 
ATOM   1985 C CD    . GLU C 2 35  ? -2.914  47.081 90.635  1.00 37.22 ? 35  GLU A CD    1 
ATOM   1986 O OE1   . GLU C 2 35  ? -4.162  47.182 90.641  1.00 37.78 ? 35  GLU A OE1   1 
ATOM   1987 O OE2   . GLU C 2 35  ? -2.190  48.043 90.298  1.00 37.74 ? 35  GLU A OE2   1 
ATOM   1988 N N     . SER C 2 36  ? -3.214  40.847 90.985  1.00 33.52 ? 36  SER A N     1 
ATOM   1989 C CA    . SER C 2 36  ? -4.105  39.703 91.167  1.00 34.52 ? 36  SER A CA    1 
ATOM   1990 C C     . SER C 2 36  ? -4.408  39.492 92.648  1.00 34.69 ? 36  SER A C     1 
ATOM   1991 O O     . SER C 2 36  ? -3.494  39.438 93.467  1.00 34.27 ? 36  SER A O     1 
ATOM   1992 C CB    . SER C 2 36  ? -3.453  38.424 90.632  1.00 35.90 ? 36  SER A CB    1 
ATOM   1993 O OG    . SER C 2 36  ? -2.861  38.624 89.360  1.00 37.54 ? 36  SER A OG    1 
ATOM   1994 N N     . PRO C 2 37  ? -5.697  39.342 93.003  1.00 34.83 ? 37  PRO A N     1 
ATOM   1995 C CA    . PRO C 2 37  ? -6.116  39.131 94.389  1.00 33.93 ? 37  PRO A CA    1 
ATOM   1996 C C     . PRO C 2 37  ? -5.736  37.725 94.785  1.00 36.37 ? 37  PRO A C     1 
ATOM   1997 O O     . PRO C 2 37  ? -5.601  36.856 93.919  1.00 37.44 ? 37  PRO A O     1 
ATOM   1998 C CB    . PRO C 2 37  ? -7.619  39.280 94.312  1.00 33.30 ? 37  PRO A CB    1 
ATOM   1999 C CG    . PRO C 2 37  ? -7.920  38.598 93.013  1.00 31.70 ? 37  PRO A CG    1 
ATOM   2000 C CD    . PRO C 2 37  ? -6.849  39.184 92.092  1.00 34.86 ? 37  PRO A CD    1 
ATOM   2001 N N     . SER C 2 38  ? -5.540  37.495 96.078  1.00 36.41 ? 38  SER A N     1 
ATOM   2002 C CA    . SER C 2 38  ? -5.212  36.157 96.524  1.00 37.96 ? 38  SER A CA    1 
ATOM   2003 C C     . SER C 2 38  ? -6.547  35.469 96.368  1.00 39.94 ? 38  SER A C     1 
ATOM   2004 O O     . SER C 2 38  ? -7.583  36.136 96.280  1.00 37.46 ? 38  SER A O     1 
ATOM   2005 C CB    . SER C 2 38  ? -4.810  36.143 98.003  1.00 38.01 ? 38  SER A CB    1 
ATOM   2006 O OG    . SER C 2 38  ? -5.883  36.580 98.829  1.00 36.79 ? 38  SER A OG    1 
ATOM   2007 N N     . TRP C 2 39  ? -6.535  34.146 96.334  1.00 42.98 ? 39  TRP A N     1 
ATOM   2008 C CA    . TRP C 2 39  ? -7.780  33.421 96.208  1.00 45.78 ? 39  TRP A CA    1 
ATOM   2009 C C     . TRP C 2 39  ? -8.751  33.863 97.305  1.00 45.25 ? 39  TRP A C     1 
ATOM   2010 O O     . TRP C 2 39  ? -9.949  34.033 97.064  1.00 44.89 ? 39  TRP A O     1 
ATOM   2011 C CB    . TRP C 2 39  ? -7.518  31.918 96.288  1.00 50.60 ? 39  TRP A CB    1 
ATOM   2012 C CG    . TRP C 2 39  ? -8.774  31.103 96.270  1.00 56.37 ? 39  TRP A CG    1 
ATOM   2013 C CD1   . TRP C 2 39  ? -10.003 31.493 95.809  1.00 57.34 ? 39  TRP A CD1   1 
ATOM   2014 C CD2   . TRP C 2 39  ? -8.934  29.769 96.759  1.00 58.17 ? 39  TRP A CD2   1 
ATOM   2015 N NE1   . TRP C 2 39  ? -10.918 30.486 95.991  1.00 60.18 ? 39  TRP A NE1   1 
ATOM   2016 C CE2   . TRP C 2 39  ? -10.290 29.416 96.571  1.00 60.15 ? 39  TRP A CE2   1 
ATOM   2017 C CE3   . TRP C 2 39  ? -8.065  28.837 97.339  1.00 59.13 ? 39  TRP A CE3   1 
ATOM   2018 C CZ2   . TRP C 2 39  ? -10.798 28.167 96.946  1.00 61.40 ? 39  TRP A CZ2   1 
ATOM   2019 C CZ3   . TRP C 2 39  ? -8.567  27.596 97.711  1.00 60.45 ? 39  TRP A CZ3   1 
ATOM   2020 C CH2   . TRP C 2 39  ? -9.923  27.273 97.514  1.00 62.25 ? 39  TRP A CH2   1 
ATOM   2021 N N     . THR C 2 40  ? -8.223  34.076 98.505  1.00 44.89 ? 40  THR A N     1 
ATOM   2022 C CA    . THR C 2 40  ? -9.038  34.483 99.642  1.00 44.81 ? 40  THR A CA    1 
ATOM   2023 C C     . THR C 2 40  ? -9.741  35.823 99.414  1.00 47.33 ? 40  THR A C     1 
ATOM   2024 O O     . THR C 2 40  ? -10.948 35.959 99.632  1.00 47.47 ? 40  THR A O     1 
ATOM   2025 C CB    . THR C 2 40  ? -8.178  34.617 100.887 1.00 44.80 ? 40  THR A CB    1 
ATOM   2026 O OG1   . THR C 2 40  ? -7.329  33.471 101.006 1.00 42.97 ? 40  THR A OG1   1 
ATOM   2027 C CG2   . THR C 2 40  ? -9.055  34.764 102.110 1.00 43.86 ? 40  THR A CG2   1 
ATOM   2028 N N     . GLU C 2 41  ? -8.982  36.829 98.993  1.00 49.06 ? 41  GLU A N     1 
ATOM   2029 C CA    . GLU C 2 41  ? -9.584  38.127 98.753  1.00 49.44 ? 41  GLU A CA    1 
ATOM   2030 C C     . GLU C 2 41  ? -10.607 38.006 97.643  1.00 51.15 ? 41  GLU A C     1 
ATOM   2031 O O     . GLU C 2 41  ? -11.540 38.797 97.564  1.00 51.12 ? 41  GLU A O     1 
ATOM   2032 C CB    . GLU C 2 41  ? -8.537  39.169 98.359  1.00 45.59 ? 41  GLU A CB    1 
ATOM   2033 C CG    . GLU C 2 41  ? -9.183  40.463 97.903  1.00 42.86 ? 41  GLU A CG    1 
ATOM   2034 C CD    . GLU C 2 41  ? -8.188  41.516 97.528  1.00 42.43 ? 41  GLU A CD    1 
ATOM   2035 O OE1   . GLU C 2 41  ? -7.077  41.148 97.101  1.00 42.15 ? 41  GLU A OE1   1 
ATOM   2036 O OE2   . GLU C 2 41  ? -8.520  42.713 97.647  1.00 43.23 ? 41  GLU A OE2   1 
ATOM   2037 N N     . TRP C 2 42  ? -10.436 37.014 96.781  1.00 54.58 ? 42  TRP A N     1 
ATOM   2038 C CA    . TRP C 2 42  ? -11.378 36.855 95.692  1.00 59.82 ? 42  TRP A CA    1 
ATOM   2039 C C     . TRP C 2 42  ? -12.758 36.441 96.183  1.00 60.79 ? 42  TRP A C     1 
ATOM   2040 O O     . TRP C 2 42  ? -13.688 37.248 96.179  1.00 60.23 ? 42  TRP A O     1 
ATOM   2041 C CB    . TRP C 2 42  ? -10.884 35.833 94.676  1.00 63.95 ? 42  TRP A CB    1 
ATOM   2042 C CG    . TRP C 2 42  ? -11.729 35.852 93.454  1.00 69.47 ? 42  TRP A CG    1 
ATOM   2043 C CD1   . TRP C 2 42  ? -11.752 36.819 92.490  1.00 71.55 ? 42  TRP A CD1   1 
ATOM   2044 C CD2   . TRP C 2 42  ? -12.729 34.902 93.093  1.00 72.00 ? 42  TRP A CD2   1 
ATOM   2045 N NE1   . TRP C 2 42  ? -12.707 36.531 91.548  1.00 72.93 ? 42  TRP A NE1   1 
ATOM   2046 C CE2   . TRP C 2 42  ? -13.323 35.357 91.892  1.00 73.65 ? 42  TRP A CE2   1 
ATOM   2047 C CE3   . TRP C 2 42  ? -13.184 33.708 93.665  1.00 73.78 ? 42  TRP A CE3   1 
ATOM   2048 C CZ2   . TRP C 2 42  ? -14.352 34.658 91.250  1.00 75.17 ? 42  TRP A CZ2   1 
ATOM   2049 C CZ3   . TRP C 2 42  ? -14.208 33.011 93.028  1.00 76.23 ? 42  TRP A CZ3   1 
ATOM   2050 C CH2   . TRP C 2 42  ? -14.781 33.491 91.830  1.00 76.08 ? 42  TRP A CH2   1 
ATOM   2051 N N     . ARG C 2 43  ? -12.886 35.185 96.607  1.00 62.41 ? 43  ARG A N     1 
ATOM   2052 C CA    . ARG C 2 43  ? -14.165 34.671 97.084  1.00 63.87 ? 43  ARG A CA    1 
ATOM   2053 C C     . ARG C 2 43  ? -14.780 35.578 98.124  1.00 63.46 ? 43  ARG A C     1 
ATOM   2054 O O     . ARG C 2 43  ? -16.000 35.739 98.179  1.00 63.33 ? 43  ARG A O     1 
ATOM   2055 C CB    . ARG C 2 43  ? -14.013 33.254 97.647  1.00 65.42 ? 43  ARG A CB    1 
ATOM   2056 C CG    . ARG C 2 43  ? -12.865 33.062 98.600  1.00 69.12 ? 43  ARG A CG    1 
ATOM   2057 C CD    . ARG C 2 43  ? -12.719 31.594 98.984  1.00 72.55 ? 43  ARG A CD    1 
ATOM   2058 N NE    . ARG C 2 43  ? -11.549 31.377 99.834  1.00 76.77 ? 43  ARG A NE    1 
ATOM   2059 C CZ    . ARG C 2 43  ? -11.234 30.219 100.408 1.00 78.29 ? 43  ARG A CZ    1 
ATOM   2060 N NH1   . ARG C 2 43  ? -12.006 29.150 100.231 1.00 78.83 ? 43  ARG A NH1   1 
ATOM   2061 N NH2   . ARG C 2 43  ? -10.141 30.132 101.161 1.00 77.51 ? 43  ARG A NH2   1 
ATOM   2062 N N     . LEU C 2 44  ? -13.934 36.187 98.940  1.00 63.28 ? 44  LEU A N     1 
ATOM   2063 C CA    . LEU C 2 44  ? -14.428 37.078 99.969  1.00 64.12 ? 44  LEU A CA    1 
ATOM   2064 C C     . LEU C 2 44  ? -15.074 38.308 99.333  1.00 64.75 ? 44  LEU A C     1 
ATOM   2065 O O     . LEU C 2 44  ? -16.062 38.836 99.843  1.00 64.81 ? 44  LEU A O     1 
ATOM   2066 C CB    . LEU C 2 44  ? -13.284 37.474 100.901 1.00 63.40 ? 44  LEU A CB    1 
ATOM   2067 C CG    . LEU C 2 44  ? -13.657 38.239 102.171 1.00 62.76 ? 44  LEU A CG    1 
ATOM   2068 C CD1   . LEU C 2 44  ? -12.565 38.050 103.191 1.00 63.46 ? 44  LEU A CD1   1 
ATOM   2069 C CD2   . LEU C 2 44  ? -13.855 39.715 101.868 1.00 63.24 ? 44  LEU A CD2   1 
ATOM   2070 N N     . TYR C 2 45  ? -14.523 38.757 98.210  1.00 66.44 ? 45  TYR A N     1 
ATOM   2071 C CA    . TYR C 2 45  ? -15.062 39.920 97.512  1.00 67.80 ? 45  TYR A CA    1 
ATOM   2072 C C     . TYR C 2 45  ? -16.368 39.528 96.829  1.00 71.02 ? 45  TYR A C     1 
ATOM   2073 O O     . TYR C 2 45  ? -17.268 40.358 96.659  1.00 71.97 ? 45  TYR A O     1 
ATOM   2074 C CB    . TYR C 2 45  ? -14.071 40.420 96.464  1.00 64.14 ? 45  TYR A CB    1 
ATOM   2075 C CG    . TYR C 2 45  ? -14.565 41.617 95.681  1.00 61.77 ? 45  TYR A CG    1 
ATOM   2076 C CD1   . TYR C 2 45  ? -14.435 42.907 96.188  1.00 60.37 ? 45  TYR A CD1   1 
ATOM   2077 C CD2   . TYR C 2 45  ? -15.165 41.458 94.431  1.00 60.11 ? 45  TYR A CD2   1 
ATOM   2078 C CE1   . TYR C 2 45  ? -14.885 44.006 95.471  1.00 59.15 ? 45  TYR A CE1   1 
ATOM   2079 C CE2   . TYR C 2 45  ? -15.621 42.547 93.709  1.00 57.66 ? 45  TYR A CE2   1 
ATOM   2080 C CZ    . TYR C 2 45  ? -15.477 43.817 94.231  1.00 58.45 ? 45  TYR A CZ    1 
ATOM   2081 O OH    . TYR C 2 45  ? -15.912 44.905 93.511  1.00 56.11 ? 45  TYR A OH    1 
ATOM   2082 N N     . ASN C 2 46  ? -16.462 38.259 96.437  1.00 73.39 ? 46  ASN A N     1 
ATOM   2083 C CA    . ASN C 2 46  ? -17.653 37.747 95.780  1.00 76.70 ? 46  ASN A CA    1 
ATOM   2084 C C     . ASN C 2 46  ? -18.698 37.289 96.787  1.00 79.35 ? 46  ASN A C     1 
ATOM   2085 O O     . ASN C 2 46  ? -19.150 36.140 96.772  1.00 79.04 ? 46  ASN A O     1 
ATOM   2086 C CB    . ASN C 2 46  ? -17.287 36.605 94.838  1.00 77.60 ? 46  ASN A CB    1 
ATOM   2087 C CG    . ASN C 2 46  ? -16.541 37.090 93.611  1.00 78.73 ? 46  ASN A CG    1 
ATOM   2088 O OD1   . ASN C 2 46  ? -16.982 38.019 92.927  1.00 78.68 ? 46  ASN A OD1   1 
ATOM   2089 N ND2   . ASN C 2 46  ? -15.408 36.465 93.324  1.00 78.37 ? 46  ASN A ND2   1 
ATOM   2090 N N     . ASP C 2 47  ? -19.058 38.217 97.666  1.00 82.17 ? 47  ASP A N     1 
ATOM   2091 C CA    . ASP C 2 47  ? -20.058 38.020 98.709  1.00 85.24 ? 47  ASP A CA    1 
ATOM   2092 C C     . ASP C 2 47  ? -20.728 39.382 98.823  1.00 87.12 ? 47  ASP A C     1 
ATOM   2093 O O     . ASP C 2 47  ? -21.856 39.513 99.309  1.00 87.40 ? 47  ASP A O     1 
ATOM   2094 C CB    . ASP C 2 47  ? -19.396 37.662 100.042 1.00 85.81 ? 47  ASP A CB    1 
ATOM   2095 C CG    . ASP C 2 47  ? -18.961 36.208 100.116 1.00 86.16 ? 47  ASP A CG    1 
ATOM   2096 O OD1   . ASP C 2 47  ? -18.354 35.830 101.143 1.00 86.14 ? 47  ASP A OD1   1 
ATOM   2097 O OD2   . ASP C 2 47  ? -19.228 35.447 99.160  1.00 85.38 ? 47  ASP A OD2   1 
ATOM   2098 N N     . GLU C 2 48  ? -19.996 40.391 98.357  1.00 88.70 ? 48  GLU A N     1 
ATOM   2099 C CA    . GLU C 2 48  ? -20.442 41.776 98.352  1.00 89.87 ? 48  GLU A CA    1 
ATOM   2100 C C     . GLU C 2 48  ? -21.143 42.098 97.026  1.00 90.65 ? 48  GLU A C     1 
ATOM   2101 O O     . GLU C 2 48  ? -20.622 41.817 95.939  1.00 90.80 ? 48  GLU A O     1 
ATOM   2102 C CB    . GLU C 2 48  ? -19.235 42.693 98.531  1.00 90.51 ? 48  GLU A CB    1 
ATOM   2103 C CG    . GLU C 2 48  ? -19.525 44.160 98.300  1.00 91.78 ? 48  GLU A CG    1 
ATOM   2104 C CD    . GLU C 2 48  ? -18.277 44.934 97.915  1.00 92.94 ? 48  GLU A CD    1 
ATOM   2105 O OE1   . GLU C 2 48  ? -17.325 44.988 98.727  1.00 93.13 ? 48  GLU A OE1   1 
ATOM   2106 O OE2   . GLU C 2 48  ? -18.250 45.483 96.791  1.00 93.23 ? 48  GLU A OE2   1 
ATOM   2107 N N     . ASN C 2 55  ? -20.322 44.243 91.406  1.00 68.27 ? 55  ASN A N     1 
ATOM   2108 C CA    . ASN C 2 55  ? -19.429 44.898 90.459  1.00 67.02 ? 55  ASN A CA    1 
ATOM   2109 C C     . ASN C 2 55  ? -17.996 44.405 90.613  1.00 63.87 ? 55  ASN A C     1 
ATOM   2110 O O     . ASN C 2 55  ? -17.472 44.333 91.725  1.00 64.54 ? 55  ASN A O     1 
ATOM   2111 C CB    . ASN C 2 55  ? -19.505 46.412 90.629  1.00 69.91 ? 55  ASN A CB    1 
ATOM   2112 C CG    . ASN C 2 55  ? -20.606 47.031 89.778  1.00 73.74 ? 55  ASN A CG    1 
ATOM   2113 O OD1   . ASN C 2 55  ? -21.799 46.777 89.988  1.00 74.83 ? 55  ASN A OD1   1 
ATOM   2114 N ND2   . ASN C 2 55  ? -20.207 47.837 88.796  1.00 75.72 ? 55  ASN A ND2   1 
ATOM   2115 N N     . PRO C 2 56  ? -17.347 44.067 89.483  1.00 59.56 ? 56  PRO A N     1 
ATOM   2116 C CA    . PRO C 2 56  ? -15.986 43.551 89.286  1.00 55.43 ? 56  PRO A CA    1 
ATOM   2117 C C     . PRO C 2 56  ? -14.854 44.252 90.029  1.00 52.48 ? 56  PRO A C     1 
ATOM   2118 O O     . PRO C 2 56  ? -14.874 45.467 90.227  1.00 52.45 ? 56  PRO A O     1 
ATOM   2119 C CB    . PRO C 2 56  ? -15.799 43.648 87.780  1.00 55.10 ? 56  PRO A CB    1 
ATOM   2120 C CG    . PRO C 2 56  ? -17.168 43.530 87.259  1.00 57.48 ? 56  PRO A CG    1 
ATOM   2121 C CD    . PRO C 2 56  ? -17.947 44.403 88.183  1.00 58.26 ? 56  PRO A CD    1 
ATOM   2122 N N     . LEU C 2 57  ? -13.852 43.466 90.407  1.00 48.66 ? 57  LEU A N     1 
ATOM   2123 C CA    . LEU C 2 57  ? -12.679 43.964 91.116  1.00 44.42 ? 57  LEU A CA    1 
ATOM   2124 C C     . LEU C 2 57  ? -11.744 44.685 90.140  1.00 43.61 ? 57  LEU A C     1 
ATOM   2125 O O     . LEU C 2 57  ? -11.175 45.731 90.452  1.00 43.66 ? 57  LEU A O     1 
ATOM   2126 C CB    . LEU C 2 57  ? -11.930 42.795 91.736  1.00 43.18 ? 57  LEU A CB    1 
ATOM   2127 C CG    . LEU C 2 57  ? -10.991 43.123 92.888  1.00 43.92 ? 57  LEU A CG    1 
ATOM   2128 C CD1   . LEU C 2 57  ? -11.817 43.370 94.147  1.00 42.35 ? 57  LEU A CD1   1 
ATOM   2129 C CD2   . LEU C 2 57  ? -10.038 41.964 93.111  1.00 44.04 ? 57  LEU A CD2   1 
ATOM   2130 N N     . GLY C 2 58  ? -11.583 44.104 88.957  1.00 41.04 ? 58  GLY A N     1 
ATOM   2131 C CA    . GLY C 2 58  ? -10.713 44.686 87.958  1.00 38.55 ? 58  GLY A CA    1 
ATOM   2132 C C     . GLY C 2 58  ? -10.814 43.971 86.627  1.00 36.48 ? 58  GLY A C     1 
ATOM   2133 O O     . GLY C 2 58  ? -11.813 43.309 86.343  1.00 37.35 ? 58  GLY A O     1 
ATOM   2134 N N     . PHE C 2 59  ? -9.787  44.109 85.801  1.00 32.32 ? 59  PHE A N     1 
ATOM   2135 C CA    . PHE C 2 59  ? -9.785  43.464 84.504  1.00 30.07 ? 59  PHE A CA    1 
ATOM   2136 C C     . PHE C 2 59  ? -8.480  42.738 84.295  1.00 31.00 ? 59  PHE A C     1 
ATOM   2137 O O     . PHE C 2 59  ? -7.561  42.869 85.095  1.00 34.59 ? 59  PHE A O     1 
ATOM   2138 C CB    . PHE C 2 59  ? -9.985  44.497 83.408  1.00 27.73 ? 59  PHE A CB    1 
ATOM   2139 C CG    . PHE C 2 59  ? -8.844  45.463 83.257  1.00 26.33 ? 59  PHE A CG    1 
ATOM   2140 C CD1   . PHE C 2 59  ? -7.803  45.195 82.379  1.00 24.60 ? 59  PHE A CD1   1 
ATOM   2141 C CD2   . PHE C 2 59  ? -8.829  46.659 83.971  1.00 25.39 ? 59  PHE A CD2   1 
ATOM   2142 C CE1   . PHE C 2 59  ? -6.765  46.104 82.210  1.00 24.49 ? 59  PHE A CE1   1 
ATOM   2143 C CE2   . PHE C 2 59  ? -7.802  47.569 83.810  1.00 23.87 ? 59  PHE A CE2   1 
ATOM   2144 C CZ    . PHE C 2 59  ? -6.762  47.294 82.926  1.00 23.85 ? 59  PHE A CZ    1 
ATOM   2145 N N     . LYS C 2 60  ? -8.390  41.963 83.227  1.00 30.91 ? 60  LYS A N     1 
ATOM   2146 C CA    . LYS C 2 60  ? -7.168  41.229 82.949  1.00 30.09 ? 60  LYS A CA    1 
ATOM   2147 C C     . LYS C 2 60  ? -6.786  41.565 81.535  1.00 28.70 ? 60  LYS A C     1 
ATOM   2148 O O     . LYS C 2 60  ? -7.670  41.751 80.696  1.00 29.82 ? 60  LYS A O     1 
ATOM   2149 C CB    . LYS C 2 60  ? -7.400  39.719 83.094  1.00 32.31 ? 60  LYS A CB    1 
ATOM   2150 C CG    . LYS C 2 60  ? -6.175  38.863 82.750  1.00 36.97 ? 60  LYS A CG    1 
ATOM   2151 C CD    . LYS C 2 60  ? -6.398  37.378 83.074  1.00 39.84 ? 60  LYS A CD    1 
ATOM   2152 C CE    . LYS C 2 60  ? -5.176  36.525 82.705  1.00 42.16 ? 60  LYS A CE    1 
ATOM   2153 N NZ    . LYS C 2 60  ? -5.316  35.075 83.058  1.00 40.94 ? 60  LYS A NZ    1 
ATOM   2154 N N     . GLU C 2 61  ? -5.485  41.672 81.267  1.00 26.70 ? 61  GLU A N     1 
ATOM   2155 C CA    . GLU C 2 61  ? -5.022  41.983 79.912  1.00 27.28 ? 61  GLU A CA    1 
ATOM   2156 C C     . GLU C 2 61  ? -3.723  41.260 79.637  1.00 24.56 ? 61  GLU A C     1 
ATOM   2157 O O     . GLU C 2 61  ? -3.065  40.813 80.556  1.00 25.71 ? 61  GLU A O     1 
ATOM   2158 C CB    . GLU C 2 61  ? -4.842  43.497 79.722  1.00 28.37 ? 61  GLU A CB    1 
ATOM   2159 C CG    . GLU C 2 61  ? -3.710  44.107 80.528  1.00 30.90 ? 61  GLU A CG    1 
ATOM   2160 C CD    . GLU C 2 61  ? -3.741  45.631 80.543  1.00 32.76 ? 61  GLU A CD    1 
ATOM   2161 O OE1   . GLU C 2 61  ? -4.009  46.249 79.488  1.00 33.27 ? 61  GLU A OE1   1 
ATOM   2162 O OE2   . GLU C 2 61  ? -3.482  46.216 81.612  1.00 33.25 ? 61  GLU A OE2   1 
ATOM   2163 N N     . SER C 2 62  ? -3.354  41.134 78.373  1.00 24.43 ? 62  SER A N     1 
ATOM   2164 C CA    . SER C 2 62  ? -2.123  40.436 78.028  1.00 25.73 ? 62  SER A CA    1 
ATOM   2165 C C     . SER C 2 62  ? -1.579  40.890 76.687  1.00 25.28 ? 62  SER A C     1 
ATOM   2166 O O     . SER C 2 62  ? -2.342  41.263 75.817  1.00 28.49 ? 62  SER A O     1 
ATOM   2167 C CB    . SER C 2 62  ? -2.377  38.940 77.964  1.00 26.56 ? 62  SER A CB    1 
ATOM   2168 O OG    . SER C 2 62  ? -3.258  38.642 76.900  1.00 27.98 ? 62  SER A OG    1 
ATOM   2169 N N     . TRP C 2 63  ? -0.259  40.865 76.540  1.00 23.54 ? 63  TRP A N     1 
ATOM   2170 C CA    . TRP C 2 63  ? 0.410   41.252 75.311  1.00 22.90 ? 63  TRP A CA    1 
ATOM   2171 C C     . TRP C 2 63  ? 1.258   40.062 74.984  1.00 25.97 ? 63  TRP A C     1 
ATOM   2172 O O     . TRP C 2 63  ? 1.908   39.516 75.876  1.00 29.22 ? 63  TRP A O     1 
ATOM   2173 C CB    . TRP C 2 63  ? 1.334   42.450 75.516  1.00 21.24 ? 63  TRP A CB    1 
ATOM   2174 C CG    . TRP C 2 63  ? 0.714   43.762 75.211  1.00 22.33 ? 63  TRP A CG    1 
ATOM   2175 C CD1   . TRP C 2 63  ? 0.307   44.718 76.109  1.00 21.92 ? 63  TRP A CD1   1 
ATOM   2176 C CD2   . TRP C 2 63  ? 0.418   44.278 73.910  1.00 21.50 ? 63  TRP A CD2   1 
ATOM   2177 N NE1   . TRP C 2 63  ? -0.221  45.802 75.439  1.00 19.97 ? 63  TRP A NE1   1 
ATOM   2178 C CE2   . TRP C 2 63  ? -0.166  45.555 74.090  1.00 21.19 ? 63  TRP A CE2   1 
ATOM   2179 C CE3   . TRP C 2 63  ? 0.589   43.784 72.607  1.00 21.76 ? 63  TRP A CE3   1 
ATOM   2180 C CZ2   . TRP C 2 63  ? -0.579  46.341 73.017  1.00 21.87 ? 63  TRP A CZ2   1 
ATOM   2181 C CZ3   . TRP C 2 63  ? 0.184   44.555 71.543  1.00 20.59 ? 63  TRP A CZ3   1 
ATOM   2182 C CH2   . TRP C 2 63  ? -0.398  45.829 71.751  1.00 24.12 ? 63  TRP A CH2   1 
ATOM   2183 N N     . GLY C 2 64  ? 1.254   39.646 73.723  1.00 26.21 ? 64  GLY A N     1 
ATOM   2184 C CA    . GLY C 2 64  ? 2.044   38.504 73.343  1.00 26.20 ? 64  GLY A CA    1 
ATOM   2185 C C     . GLY C 2 64  ? 2.797   38.814 72.080  1.00 29.90 ? 64  GLY A C     1 
ATOM   2186 O O     . GLY C 2 64  ? 2.219   39.269 71.101  1.00 29.31 ? 64  GLY A O     1 
ATOM   2187 N N     . PHE C 2 65  ? 4.104   38.596 72.110  1.00 33.32 ? 65  PHE A N     1 
ATOM   2188 C CA    . PHE C 2 65  ? 4.946   38.822 70.939  1.00 35.12 ? 65  PHE A CA    1 
ATOM   2189 C C     . PHE C 2 65  ? 5.388   37.432 70.554  1.00 36.00 ? 65  PHE A C     1 
ATOM   2190 O O     . PHE C 2 65  ? 6.434   36.949 70.960  1.00 36.96 ? 65  PHE A O     1 
ATOM   2191 C CB    . PHE C 2 65  ? 6.135   39.708 71.294  1.00 33.89 ? 65  PHE A CB    1 
ATOM   2192 C CG    . PHE C 2 65  ? 5.735   40.970 71.980  1.00 35.35 ? 65  PHE A CG    1 
ATOM   2193 C CD1   . PHE C 2 65  ? 5.669   41.029 73.363  1.00 35.62 ? 65  PHE A CD1   1 
ATOM   2194 C CD2   . PHE C 2 65  ? 5.358   42.081 71.242  1.00 36.21 ? 65  PHE A CD2   1 
ATOM   2195 C CE1   . PHE C 2 65  ? 5.231   42.177 74.010  1.00 35.95 ? 65  PHE A CE1   1 
ATOM   2196 C CE2   . PHE C 2 65  ? 4.916   43.237 71.876  1.00 37.80 ? 65  PHE A CE2   1 
ATOM   2197 C CZ    . PHE C 2 65  ? 4.852   43.285 73.268  1.00 37.83 ? 65  PHE A CZ    1 
ATOM   2198 N N     . GLY C 2 66  ? 4.535   36.782 69.785  1.00 37.56 ? 66  GLY A N     1 
ATOM   2199 C CA    . GLY C 2 66  ? 4.804   35.431 69.381  1.00 37.71 ? 66  GLY A CA    1 
ATOM   2200 C C     . GLY C 2 66  ? 4.473   34.524 70.546  1.00 38.70 ? 66  GLY A C     1 
ATOM   2201 O O     . GLY C 2 66  ? 3.370   34.532 71.092  1.00 37.77 ? 66  GLY A O     1 
ATOM   2202 N N     . LYS C 2 67  ? 5.463   33.753 70.947  1.00 41.26 ? 67  LYS A N     1 
ATOM   2203 C CA    . LYS C 2 67  ? 5.299   32.789 72.009  1.00 43.69 ? 67  LYS A CA    1 
ATOM   2204 C C     . LYS C 2 67  ? 5.464   33.427 73.376  1.00 42.74 ? 67  LYS A C     1 
ATOM   2205 O O     . LYS C 2 67  ? 5.038   32.863 74.380  1.00 42.96 ? 67  LYS A O     1 
ATOM   2206 C CB    . LYS C 2 67  ? 6.333   31.682 71.804  1.00 47.75 ? 67  LYS A CB    1 
ATOM   2207 C CG    . LYS C 2 67  ? 5.998   30.379 72.478  1.00 55.79 ? 67  LYS A CG    1 
ATOM   2208 C CD    . LYS C 2 67  ? 6.644   29.226 71.722  1.00 59.05 ? 67  LYS A CD    1 
ATOM   2209 C CE    . LYS C 2 67  ? 6.215   27.885 72.281  1.00 60.19 ? 67  LYS A CE    1 
ATOM   2210 N NZ    . LYS C 2 67  ? 6.714   26.791 71.401  1.00 63.96 ? 67  LYS A NZ    1 
ATOM   2211 N N     . VAL C 2 68  ? 6.078   34.607 73.403  1.00 40.63 ? 68  VAL A N     1 
ATOM   2212 C CA    . VAL C 2 68  ? 6.336   35.328 74.647  1.00 39.43 ? 68  VAL A CA    1 
ATOM   2213 C C     . VAL C 2 68  ? 5.121   36.139 75.135  1.00 38.81 ? 68  VAL A C     1 
ATOM   2214 O O     . VAL C 2 68  ? 4.964   37.308 74.787  1.00 41.22 ? 68  VAL A O     1 
ATOM   2215 C CB    . VAL C 2 68  ? 7.528   36.278 74.452  1.00 38.49 ? 68  VAL A CB    1 
ATOM   2216 C CG1   . VAL C 2 68  ? 8.066   36.725 75.782  1.00 38.11 ? 68  VAL A CG1   1 
ATOM   2217 C CG2   . VAL C 2 68  ? 8.595   35.597 73.641  1.00 38.87 ? 68  VAL A CG2   1 
ATOM   2218 N N     . VAL C 2 69  ? 4.273   35.535 75.954  1.00 36.20 ? 69  VAL A N     1 
ATOM   2219 C CA    . VAL C 2 69  ? 3.092   36.235 76.435  1.00 36.37 ? 69  VAL A CA    1 
ATOM   2220 C C     . VAL C 2 69  ? 3.254   36.841 77.830  1.00 36.72 ? 69  VAL A C     1 
ATOM   2221 O O     . VAL C 2 69  ? 3.787   36.180 78.729  1.00 37.83 ? 69  VAL A O     1 
ATOM   2222 C CB    . VAL C 2 69  ? 1.875   35.281 76.465  1.00 36.73 ? 69  VAL A CB    1 
ATOM   2223 C CG1   . VAL C 2 69  ? 0.662   35.997 77.016  1.00 36.77 ? 69  VAL A CG1   1 
ATOM   2224 C CG2   . VAL C 2 69  ? 1.588   34.766 75.073  1.00 36.65 ? 69  VAL A CG2   1 
ATOM   2225 N N     . PHE C 2 70  ? 2.808   38.094 78.004  1.00 33.66 ? 70  PHE A N     1 
ATOM   2226 C CA    . PHE C 2 70  ? 2.858   38.771 79.307  1.00 31.04 ? 70  PHE A CA    1 
ATOM   2227 C C     . PHE C 2 70  ? 1.425   39.056 79.744  1.00 29.73 ? 70  PHE A C     1 
ATOM   2228 O O     . PHE C 2 70  ? 0.587   39.377 78.912  1.00 31.41 ? 70  PHE A O     1 
ATOM   2229 C CB    . PHE C 2 70  ? 3.604   40.100 79.232  1.00 30.32 ? 70  PHE A CB    1 
ATOM   2230 C CG    . PHE C 2 70  ? 5.019   39.982 78.771  1.00 32.40 ? 70  PHE A CG    1 
ATOM   2231 C CD1   . PHE C 2 70  ? 5.319   39.918 77.408  1.00 31.67 ? 70  PHE A CD1   1 
ATOM   2232 C CD2   . PHE C 2 70  ? 6.064   39.955 79.699  1.00 32.06 ? 70  PHE A CD2   1 
ATOM   2233 C CE1   . PHE C 2 70  ? 6.639   39.832 76.973  1.00 32.04 ? 70  PHE A CE1   1 
ATOM   2234 C CE2   . PHE C 2 70  ? 7.389   39.868 79.280  1.00 31.84 ? 70  PHE A CE2   1 
ATOM   2235 C CZ    . PHE C 2 70  ? 7.682   39.808 77.912  1.00 33.58 ? 70  PHE A CZ    1 
ATOM   2236 N N     . LYS C 2 71  ? 1.138   38.966 81.035  1.00 26.76 ? 71  LYS A N     1 
ATOM   2237 C CA    . LYS C 2 71  ? -0.213  39.227 81.507  1.00 26.75 ? 71  LYS A CA    1 
ATOM   2238 C C     . LYS C 2 71  ? -0.269  40.118 82.735  1.00 27.94 ? 71  LYS A C     1 
ATOM   2239 O O     . LYS C 2 71  ? 0.713   40.263 83.468  1.00 29.06 ? 71  LYS A O     1 
ATOM   2240 C CB    . LYS C 2 71  ? -0.930  37.926 81.843  1.00 29.11 ? 71  LYS A CB    1 
ATOM   2241 C CG    . LYS C 2 71  ? -1.045  36.940 80.701  1.00 34.35 ? 71  LYS A CG    1 
ATOM   2242 C CD    . LYS C 2 71  ? -2.027  35.847 81.071  1.00 37.57 ? 71  LYS A CD    1 
ATOM   2243 C CE    . LYS C 2 71  ? -2.272  34.899 79.916  1.00 40.69 ? 71  LYS A CE    1 
ATOM   2244 N NZ    . LYS C 2 71  ? -3.479  34.045 80.173  1.00 43.16 ? 71  LYS A NZ    1 
ATOM   2245 N N     . ARG C 2 72  ? -1.436  40.711 82.961  1.00 26.83 ? 72  ARG A N     1 
ATOM   2246 C CA    . ARG C 2 72  ? -1.654  41.571 84.111  1.00 26.73 ? 72  ARG A CA    1 
ATOM   2247 C C     . ARG C 2 72  ? -3.113  41.578 84.515  1.00 27.35 ? 72  ARG A C     1 
ATOM   2248 O O     . ARG C 2 72  ? -4.002  41.528 83.667  1.00 28.01 ? 72  ARG A O     1 
ATOM   2249 C CB    . ARG C 2 72  ? -1.249  43.016 83.806  1.00 26.09 ? 72  ARG A CB    1 
ATOM   2250 C CG    . ARG C 2 72  ? 0.235   43.280 83.779  1.00 27.76 ? 72  ARG A CG    1 
ATOM   2251 C CD    . ARG C 2 72  ? 0.779   43.275 85.175  1.00 29.24 ? 72  ARG A CD    1 
ATOM   2252 N NE    . ARG C 2 72  ? 2.171   43.696 85.217  1.00 30.61 ? 72  ARG A NE    1 
ATOM   2253 C CZ    . ARG C 2 72  ? 3.185   42.991 84.727  1.00 32.02 ? 72  ARG A CZ    1 
ATOM   2254 N NH1   . ARG C 2 72  ? 2.973   41.814 84.149  1.00 30.72 ? 72  ARG A NH1   1 
ATOM   2255 N NH2   . ARG C 2 72  ? 4.422   43.465 84.829  1.00 34.41 ? 72  ARG A NH2   1 
ATOM   2256 N N     . TYR C 2 73  ? -3.352  41.603 85.820  1.00 27.89 ? 73  TYR A N     1 
ATOM   2257 C CA    . TYR C 2 73  ? -4.699  41.719 86.334  1.00 28.40 ? 73  TYR A CA    1 
ATOM   2258 C C     . TYR C 2 73  ? -4.584  43.016 87.127  1.00 29.23 ? 73  TYR A C     1 
ATOM   2259 O O     . TYR C 2 73  ? -3.738  43.121 88.015  1.00 29.74 ? 73  TYR A O     1 
ATOM   2260 C CB    . TYR C 2 73  ? -5.069  40.573 87.274  1.00 28.08 ? 73  TYR A CB    1 
ATOM   2261 C CG    . TYR C 2 73  ? -6.480  40.713 87.810  1.00 26.92 ? 73  TYR A CG    1 
ATOM   2262 C CD1   . TYR C 2 73  ? -7.537  40.000 87.257  1.00 26.20 ? 73  TYR A CD1   1 
ATOM   2263 C CD2   . TYR C 2 73  ? -6.759  41.604 88.836  1.00 27.08 ? 73  TYR A CD2   1 
ATOM   2264 C CE1   . TYR C 2 73  ? -8.842  40.179 87.714  1.00 28.58 ? 73  TYR A CE1   1 
ATOM   2265 C CE2   . TYR C 2 73  ? -8.047  41.790 89.303  1.00 28.15 ? 73  TYR A CE2   1 
ATOM   2266 C CZ    . TYR C 2 73  ? -9.090  41.082 88.739  1.00 31.06 ? 73  TYR A CZ    1 
ATOM   2267 O OH    . TYR C 2 73  ? -10.378 41.322 89.183  1.00 33.15 ? 73  TYR A OH    1 
ATOM   2268 N N     . LEU C 2 74  ? -5.403  44.006 86.794  1.00 27.26 ? 74  LEU A N     1 
ATOM   2269 C CA    . LEU C 2 74  ? -5.344  45.279 87.487  1.00 27.47 ? 74  LEU A CA    1 
ATOM   2270 C C     . LEU C 2 74  ? -6.676  45.634 88.137  1.00 28.24 ? 74  LEU A C     1 
ATOM   2271 O O     . LEU C 2 74  ? -7.732  45.412 87.547  1.00 29.70 ? 74  LEU A O     1 
ATOM   2272 C CB    . LEU C 2 74  ? -4.916  46.380 86.508  1.00 25.08 ? 74  LEU A CB    1 
ATOM   2273 C CG    . LEU C 2 74  ? -3.490  46.219 85.944  1.00 26.20 ? 74  LEU A CG    1 
ATOM   2274 C CD1   . LEU C 2 74  ? -3.230  47.226 84.822  1.00 19.05 ? 74  LEU A CD1   1 
ATOM   2275 C CD2   . LEU C 2 74  ? -2.467  46.389 87.077  1.00 21.67 ? 74  LEU A CD2   1 
ATOM   2276 N N     . ARG C 2 75  ? -6.625  46.152 89.362  1.00 26.47 ? 75  ARG A N     1 
ATOM   2277 C CA    . ARG C 2 75  ? -7.841  46.543 90.047  1.00 27.22 ? 75  ARG A CA    1 
ATOM   2278 C C     . ARG C 2 75  ? -8.282  47.808 89.332  1.00 27.11 ? 75  ARG A C     1 
ATOM   2279 O O     . ARG C 2 75  ? -7.457  48.637 88.967  1.00 29.44 ? 75  ARG A O     1 
ATOM   2280 C CB    . ARG C 2 75  ? -7.585  46.853 91.532  1.00 28.03 ? 75  ARG A CB    1 
ATOM   2281 C CG    . ARG C 2 75  ? -6.721  45.851 92.310  1.00 28.98 ? 75  ARG A CG    1 
ATOM   2282 C CD    . ARG C 2 75  ? -7.208  44.442 92.124  1.00 35.03 ? 75  ARG A CD    1 
ATOM   2283 N NE    . ARG C 2 75  ? -6.594  43.446 93.014  1.00 38.26 ? 75  ARG A NE    1 
ATOM   2284 C CZ    . ARG C 2 75  ? -6.679  43.457 94.345  1.00 39.82 ? 75  ARG A CZ    1 
ATOM   2285 N NH1   . ARG C 2 75  ? -7.338  44.422 94.964  1.00 42.09 ? 75  ARG A NH1   1 
ATOM   2286 N NH2   . ARG C 2 75  ? -6.145  42.474 95.059  1.00 38.73 ? 75  ARG A NH2   1 
ATOM   2287 N N     . TYR C 2 76  ? -9.583  47.952 89.134  1.00 28.74 ? 76  TYR A N     1 
ATOM   2288 C CA    . TYR C 2 76  ? -10.166 49.104 88.448  1.00 29.37 ? 76  TYR A CA    1 
ATOM   2289 C C     . TYR C 2 76  ? -11.558 49.319 89.036  1.00 32.86 ? 76  TYR A C     1 
ATOM   2290 O O     . TYR C 2 76  ? -12.405 48.439 88.936  1.00 35.25 ? 76  TYR A O     1 
ATOM   2291 C CB    . TYR C 2 76  ? -10.260 48.781 86.962  1.00 27.67 ? 76  TYR A CB    1 
ATOM   2292 C CG    . TYR C 2 76  ? -11.117 49.711 86.167  1.00 26.77 ? 76  TYR A CG    1 
ATOM   2293 C CD1   . TYR C 2 76  ? -10.833 51.072 86.109  1.00 29.13 ? 76  TYR A CD1   1 
ATOM   2294 C CD2   . TYR C 2 76  ? -12.203 49.235 85.448  1.00 27.26 ? 76  TYR A CD2   1 
ATOM   2295 C CE1   . TYR C 2 76  ? -11.615 51.943 85.349  1.00 27.67 ? 76  TYR A CE1   1 
ATOM   2296 C CE2   . TYR C 2 76  ? -12.989 50.096 84.678  1.00 27.90 ? 76  TYR A CE2   1 
ATOM   2297 C CZ    . TYR C 2 76  ? -12.684 51.444 84.633  1.00 27.83 ? 76  TYR A CZ    1 
ATOM   2298 O OH    . TYR C 2 76  ? -13.416 52.287 83.841  1.00 28.20 ? 76  TYR A OH    1 
ATOM   2299 N N     . ASP C 2 77  ? -11.809 50.466 89.665  1.00 35.17 ? 77  ASP A N     1 
ATOM   2300 C CA    . ASP C 2 77  ? -13.124 50.686 90.260  1.00 35.80 ? 77  ASP A CA    1 
ATOM   2301 C C     . ASP C 2 77  ? -14.059 51.533 89.407  1.00 37.38 ? 77  ASP A C     1 
ATOM   2302 O O     . ASP C 2 77  ? -15.054 52.055 89.898  1.00 39.86 ? 77  ASP A O     1 
ATOM   2303 C CB    . ASP C 2 77  ? -13.001 51.306 91.652  1.00 35.35 ? 77  ASP A CB    1 
ATOM   2304 C CG    . ASP C 2 77  ? -12.473 52.731 91.623  1.00 37.93 ? 77  ASP A CG    1 
ATOM   2305 O OD1   . ASP C 2 77  ? -12.478 53.371 90.549  1.00 38.17 ? 77  ASP A OD1   1 
ATOM   2306 O OD2   . ASP C 2 77  ? -12.065 53.219 92.696  1.00 39.74 ? 77  ASP A OD2   1 
ATOM   2307 N N     . ARG C 2 78  ? -13.737 51.683 88.133  1.00 36.68 ? 78  ARG A N     1 
ATOM   2308 C CA    . ARG C 2 78  ? -14.597 52.437 87.239  1.00 38.92 ? 78  ARG A CA    1 
ATOM   2309 C C     . ARG C 2 78  ? -14.622 53.949 87.436  1.00 38.29 ? 78  ARG A C     1 
ATOM   2310 O O     . ARG C 2 78  ? -15.361 54.643 86.750  1.00 40.20 ? 78  ARG A O     1 
ATOM   2311 C CB    . ARG C 2 78  ? -16.020 51.872 87.307  1.00 40.43 ? 78  ARG A CB    1 
ATOM   2312 C CG    . ARG C 2 78  ? -16.074 50.383 86.967  1.00 43.48 ? 78  ARG A CG    1 
ATOM   2313 C CD    . ARG C 2 78  ? -17.482 49.803 87.024  1.00 47.08 ? 78  ARG A CD    1 
ATOM   2314 N NE    . ARG C 2 78  ? -18.010 49.704 88.385  1.00 50.17 ? 78  ARG A NE    1 
ATOM   2315 C CZ    . ARG C 2 78  ? -17.439 49.003 89.360  1.00 51.83 ? 78  ARG A CZ    1 
ATOM   2316 N NH1   . ARG C 2 78  ? -16.305 48.334 89.130  1.00 52.78 ? 78  ARG A NH1   1 
ATOM   2317 N NH2   . ARG C 2 78  ? -18.007 48.959 90.560  1.00 50.23 ? 78  ARG A NH2   1 
ATOM   2318 N N     . THR C 2 79  ? -13.820 54.472 88.354  1.00 36.74 ? 79  THR A N     1 
ATOM   2319 C CA    . THR C 2 79  ? -13.777 55.921 88.541  1.00 36.19 ? 79  THR A CA    1 
ATOM   2320 C C     . THR C 2 79  ? -12.829 56.539 87.517  1.00 34.60 ? 79  THR A C     1 
ATOM   2321 O O     . THR C 2 79  ? -12.022 55.836 86.911  1.00 33.81 ? 79  THR A O     1 
ATOM   2322 C CB    . THR C 2 79  ? -13.258 56.308 89.933  1.00 36.77 ? 79  THR A CB    1 
ATOM   2323 O OG1   . THR C 2 79  ? -11.895 55.896 90.055  1.00 37.44 ? 79  THR A OG1   1 
ATOM   2324 C CG2   . THR C 2 79  ? -14.090 55.652 91.020  1.00 36.65 ? 79  THR A CG2   1 
ATOM   2325 N N     . GLU C 2 80  ? -12.924 57.854 87.336  1.00 33.98 ? 80  GLU A N     1 
ATOM   2326 C CA    . GLU C 2 80  ? -12.063 58.564 86.392  1.00 34.22 ? 80  GLU A CA    1 
ATOM   2327 C C     . GLU C 2 80  ? -10.598 58.432 86.804  1.00 33.41 ? 80  GLU A C     1 
ATOM   2328 O O     . GLU C 2 80  ? -9.736  58.111 85.987  1.00 33.10 ? 80  GLU A O     1 
ATOM   2329 C CB    . GLU C 2 80  ? -12.469 60.036 86.305  1.00 35.03 ? 80  GLU A CB    1 
ATOM   2330 C CG    . GLU C 2 80  ? -13.211 60.358 85.026  1.00 41.48 ? 80  GLU A CG    1 
ATOM   2331 C CD    . GLU C 2 80  ? -14.141 61.551 85.153  1.00 45.88 ? 80  GLU A CD    1 
ATOM   2332 O OE1   . GLU C 2 80  ? -13.670 62.641 85.541  1.00 49.58 ? 80  GLU A OE1   1 
ATOM   2333 O OE2   . GLU C 2 80  ? -15.350 61.403 84.853  1.00 49.20 ? 80  GLU A OE2   1 
ATOM   2334 N N     . ALA C 2 81  ? -10.317 58.662 88.075  1.00 30.69 ? 81  ALA A N     1 
ATOM   2335 C CA    . ALA C 2 81  ? -8.958  58.524 88.556  1.00 31.67 ? 81  ALA A CA    1 
ATOM   2336 C C     . ALA C 2 81  ? -8.450  57.116 88.216  1.00 32.38 ? 81  ALA A C     1 
ATOM   2337 O O     . ALA C 2 81  ? -7.373  56.955 87.631  1.00 33.82 ? 81  ALA A O     1 
ATOM   2338 C CB    . ALA C 2 81  ? -8.912  58.744 90.074  1.00 29.57 ? 81  ALA A CB    1 
ATOM   2339 N N     . SER C 2 82  ? -9.238  56.105 88.585  1.00 29.97 ? 82  SER A N     1 
ATOM   2340 C CA    . SER C 2 82  ? -8.874  54.718 88.352  1.00 28.58 ? 82  SER A CA    1 
ATOM   2341 C C     . SER C 2 82  ? -8.670  54.433 86.875  1.00 29.37 ? 82  SER A C     1 
ATOM   2342 O O     . SER C 2 82  ? -7.735  53.735 86.485  1.00 29.24 ? 82  SER A O     1 
ATOM   2343 C CB    . SER C 2 82  ? -9.948  53.796 88.902  1.00 29.12 ? 82  SER A CB    1 
ATOM   2344 O OG    . SER C 2 82  ? -9.524  52.453 88.842  1.00 29.25 ? 82  SER A OG    1 
ATOM   2345 N N     . LEU C 2 83  ? -9.548  54.972 86.044  1.00 28.34 ? 83  LEU A N     1 
ATOM   2346 C CA    . LEU C 2 83  ? -9.411  54.757 84.614  1.00 26.92 ? 83  LEU A CA    1 
ATOM   2347 C C     . LEU C 2 83  ? -8.038  55.274 84.135  1.00 27.65 ? 83  LEU A C     1 
ATOM   2348 O O     . LEU C 2 83  ? -7.282  54.564 83.457  1.00 26.60 ? 83  LEU A O     1 
ATOM   2349 C CB    . LEU C 2 83  ? -10.537 55.475 83.879  1.00 22.89 ? 83  LEU A CB    1 
ATOM   2350 C CG    . LEU C 2 83  ? -10.400 55.437 82.364  1.00 24.51 ? 83  LEU A CG    1 
ATOM   2351 C CD1   . LEU C 2 83  ? -10.448 53.988 81.931  1.00 24.58 ? 83  LEU A CD1   1 
ATOM   2352 C CD2   . LEU C 2 83  ? -11.485 56.259 81.693  1.00 16.71 ? 83  LEU A CD2   1 
ATOM   2353 N N     . HIS C 2 84  ? -7.722  56.511 84.503  1.00 28.10 ? 84  HIS A N     1 
ATOM   2354 C CA    . HIS C 2 84  ? -6.466  57.130 84.111  1.00 28.84 ? 84  HIS A CA    1 
ATOM   2355 C C     . HIS C 2 84  ? -5.261  56.317 84.559  1.00 27.41 ? 84  HIS A C     1 
ATOM   2356 O O     . HIS C 2 84  ? -4.283  56.189 83.831  1.00 24.88 ? 84  HIS A O     1 
ATOM   2357 C CB    . HIS C 2 84  ? -6.367  58.530 84.699  1.00 32.78 ? 84  HIS A CB    1 
ATOM   2358 C CG    . HIS C 2 84  ? -5.181  59.306 84.213  1.00 39.14 ? 84  HIS A CG    1 
ATOM   2359 N ND1   . HIS C 2 84  ? -4.133  59.660 85.038  1.00 39.30 ? 84  HIS A ND1   1 
ATOM   2360 C CD2   . HIS C 2 84  ? -4.881  59.806 82.988  1.00 40.67 ? 84  HIS A CD2   1 
ATOM   2361 C CE1   . HIS C 2 84  ? -3.238  60.344 84.344  1.00 41.10 ? 84  HIS A CE1   1 
ATOM   2362 N NE2   . HIS C 2 84  ? -3.668  60.447 83.098  1.00 42.18 ? 84  HIS A NE2   1 
ATOM   2363 N N     . ARG C 2 85  ? -5.344  55.757 85.756  1.00 26.13 ? 85  ARG A N     1 
ATOM   2364 C CA    . ARG C 2 85  ? -4.253  54.969 86.296  1.00 24.86 ? 85  ARG A CA    1 
ATOM   2365 C C     . ARG C 2 85  ? -3.978  53.693 85.492  1.00 26.67 ? 85  ARG A C     1 
ATOM   2366 O O     . ARG C 2 85  ? -2.846  53.457 85.074  1.00 28.91 ? 85  ARG A O     1 
ATOM   2367 C CB    . ARG C 2 85  ? -4.556  54.624 87.746  1.00 23.44 ? 85  ARG A CB    1 
ATOM   2368 C CG    . ARG C 2 85  ? -3.515  53.750 88.427  1.00 24.29 ? 85  ARG A CG    1 
ATOM   2369 C CD    . ARG C 2 85  ? -3.980  53.359 89.818  1.00 22.87 ? 85  ARG A CD    1 
ATOM   2370 N NE    . ARG C 2 85  ? -4.796  52.156 89.797  1.00 26.73 ? 85  ARG A NE    1 
ATOM   2371 C CZ    . ARG C 2 85  ? -4.291  50.928 89.712  1.00 31.35 ? 85  ARG A CZ    1 
ATOM   2372 N NH1   . ARG C 2 85  ? -2.970  50.761 89.645  1.00 28.65 ? 85  ARG A NH1   1 
ATOM   2373 N NH2   . ARG C 2 85  ? -5.098  49.865 89.695  1.00 29.51 ? 85  ARG A NH2   1 
ATOM   2374 N N     . VAL C 2 86  ? -5.003  52.876 85.262  1.00 25.05 ? 86  VAL A N     1 
ATOM   2375 C CA    . VAL C 2 86  ? -4.806  51.638 84.526  1.00 23.45 ? 86  VAL A CA    1 
ATOM   2376 C C     . VAL C 2 86  ? -4.503  51.890 83.040  1.00 26.71 ? 86  VAL A C     1 
ATOM   2377 O O     . VAL C 2 86  ? -3.911  51.043 82.376  1.00 27.54 ? 86  VAL A O     1 
ATOM   2378 C CB    . VAL C 2 86  ? -6.032  50.689 84.695  1.00 20.59 ? 86  VAL A CB    1 
ATOM   2379 C CG1   . VAL C 2 86  ? -6.391  50.594 86.159  1.00 20.46 ? 86  VAL A CG1   1 
ATOM   2380 C CG2   . VAL C 2 86  ? -7.230  51.184 83.910  1.00 18.91 ? 86  VAL A CG2   1 
ATOM   2381 N N     . LEU C 2 87  ? -4.890  53.048 82.508  1.00 27.58 ? 87  LEU A N     1 
ATOM   2382 C CA    . LEU C 2 87  ? -4.592  53.334 81.100  1.00 27.80 ? 87  LEU A CA    1 
ATOM   2383 C C     . LEU C 2 87  ? -3.094  53.493 80.925  1.00 28.94 ? 87  LEU A C     1 
ATOM   2384 O O     . LEU C 2 87  ? -2.592  53.467 79.804  1.00 30.26 ? 87  LEU A O     1 
ATOM   2385 C CB    . LEU C 2 87  ? -5.313  54.604 80.603  1.00 23.52 ? 87  LEU A CB    1 
ATOM   2386 C CG    . LEU C 2 87  ? -6.759  54.376 80.120  1.00 24.52 ? 87  LEU A CG    1 
ATOM   2387 C CD1   . LEU C 2 87  ? -7.318  55.603 79.460  1.00 21.32 ? 87  LEU A CD1   1 
ATOM   2388 C CD2   . LEU C 2 87  ? -6.769  53.227 79.109  1.00 20.95 ? 87  LEU A CD2   1 
ATOM   2389 N N     . GLY C 2 88  ? -2.378  53.652 82.036  1.00 29.24 ? 88  GLY A N     1 
ATOM   2390 C CA    . GLY C 2 88  ? -0.931  53.798 81.961  1.00 31.04 ? 88  GLY A CA    1 
ATOM   2391 C C     . GLY C 2 88  ? -0.211  52.468 82.135  1.00 31.49 ? 88  GLY A C     1 
ATOM   2392 O O     . GLY C 2 88  ? 1.013   52.405 82.265  1.00 30.80 ? 88  GLY A O     1 
ATOM   2393 N N     . SER C 2 89  ? -1.008  51.407 82.155  1.00 30.21 ? 89  SER A N     1 
ATOM   2394 C CA    . SER C 2 89  ? -0.551  50.040 82.302  1.00 29.52 ? 89  SER A CA    1 
ATOM   2395 C C     . SER C 2 89  ? 0.525   49.743 81.248  1.00 29.15 ? 89  SER A C     1 
ATOM   2396 O O     . SER C 2 89  ? 1.472   48.982 81.494  1.00 28.04 ? 89  SER A O     1 
ATOM   2397 C CB    . SER C 2 89  ? -1.764  49.124 82.123  1.00 31.90 ? 89  SER A CB    1 
ATOM   2398 O OG    . SER C 2 89  ? -1.442  47.767 82.292  1.00 36.95 ? 89  SER A OG    1 
ATOM   2399 N N     . TRP C 2 90  ? 0.360   50.330 80.065  1.00 27.09 ? 90  TRP A N     1 
ATOM   2400 C CA    . TRP C 2 90  ? 1.325   50.164 78.981  1.00 27.08 ? 90  TRP A CA    1 
ATOM   2401 C C     . TRP C 2 90  ? 1.190   51.310 77.994  1.00 27.37 ? 90  TRP A C     1 
ATOM   2402 O O     . TRP C 2 90  ? 0.233   52.069 78.046  1.00 30.03 ? 90  TRP A O     1 
ATOM   2403 C CB    . TRP C 2 90  ? 1.143   48.830 78.250  1.00 24.20 ? 90  TRP A CB    1 
ATOM   2404 C CG    . TRP C 2 90  ? -0.215  48.620 77.709  1.00 24.41 ? 90  TRP A CG    1 
ATOM   2405 C CD1   . TRP C 2 90  ? -1.270  48.043 78.352  1.00 25.81 ? 90  TRP A CD1   1 
ATOM   2406 C CD2   . TRP C 2 90  ? -0.696  49.020 76.427  1.00 23.99 ? 90  TRP A CD2   1 
ATOM   2407 N NE1   . TRP C 2 90  ? -2.377  48.059 77.550  1.00 25.49 ? 90  TRP A NE1   1 
ATOM   2408 C CE2   . TRP C 2 90  ? -2.055  48.654 76.360  1.00 24.92 ? 90  TRP A CE2   1 
ATOM   2409 C CE3   . TRP C 2 90  ? -0.112  49.653 75.323  1.00 26.14 ? 90  TRP A CE3   1 
ATOM   2410 C CZ2   . TRP C 2 90  ? -2.849  48.900 75.228  1.00 25.86 ? 90  TRP A CZ2   1 
ATOM   2411 C CZ3   . TRP C 2 90  ? -0.904  49.901 74.192  1.00 27.97 ? 90  TRP A CZ3   1 
ATOM   2412 C CH2   . TRP C 2 90  ? -2.259  49.523 74.158  1.00 25.61 ? 90  TRP A CH2   1 
ATOM   2413 N N     . THR C 2 91  ? 2.154   51.448 77.098  1.00 27.74 ? 91  THR A N     1 
ATOM   2414 C CA    . THR C 2 91  ? 2.114   52.523 76.119  1.00 29.54 ? 91  THR A CA    1 
ATOM   2415 C C     . THR C 2 91  ? 2.704   51.988 74.823  1.00 32.54 ? 91  THR A C     1 
ATOM   2416 O O     . THR C 2 91  ? 3.267   50.885 74.798  1.00 32.78 ? 91  THR A O     1 
ATOM   2417 C CB    . THR C 2 91  ? 2.973   53.747 76.567  1.00 30.18 ? 91  THR A CB    1 
ATOM   2418 O OG1   . THR C 2 91  ? 4.357   53.367 76.595  1.00 31.24 ? 91  THR A OG1   1 
ATOM   2419 C CG2   . THR C 2 91  ? 2.565   54.246 77.955  1.00 22.30 ? 91  THR A CG2   1 
ATOM   2420 N N     . GLY C 2 92  ? 2.582   52.769 73.751  1.00 34.28 ? 92  GLY A N     1 
ATOM   2421 C CA    . GLY C 2 92  ? 3.130   52.342 72.480  1.00 35.03 ? 92  GLY A CA    1 
ATOM   2422 C C     . GLY C 2 92  ? 4.621   52.150 72.661  1.00 38.58 ? 92  GLY A C     1 
ATOM   2423 O O     . GLY C 2 92  ? 5.216   51.168 72.191  1.00 38.88 ? 92  GLY A O     1 
ATOM   2424 N N     . ASP C 2 93  ? 5.236   53.088 73.369  1.00 39.16 ? 93  ASP A N     1 
ATOM   2425 C CA    . ASP C 2 93  ? 6.657   53.001 73.592  1.00 40.66 ? 93  ASP A CA    1 
ATOM   2426 C C     . ASP C 2 93  ? 7.036   51.779 74.410  1.00 39.76 ? 93  ASP A C     1 
ATOM   2427 O O     . ASP C 2 93  ? 7.866   50.977 73.974  1.00 41.31 ? 93  ASP A O     1 
ATOM   2428 C CB    . ASP C 2 93  ? 7.167   54.283 74.250  1.00 43.90 ? 93  ASP A CB    1 
ATOM   2429 C CG    . ASP C 2 93  ? 7.132   55.466 73.298  1.00 46.58 ? 93  ASP A CG    1 
ATOM   2430 O OD1   . ASP C 2 93  ? 7.486   55.276 72.110  1.00 46.99 ? 93  ASP A OD1   1 
ATOM   2431 O OD2   . ASP C 2 93  ? 6.761   56.581 73.730  1.00 49.51 ? 93  ASP A OD2   1 
ATOM   2432 N N     . SER C 2 94  ? 6.427   51.610 75.579  1.00 37.07 ? 94  SER A N     1 
ATOM   2433 C CA    . SER C 2 94  ? 6.762   50.463 76.413  1.00 35.61 ? 94  SER A CA    1 
ATOM   2434 C C     . SER C 2 94  ? 6.569   49.167 75.650  1.00 35.95 ? 94  SER A C     1 
ATOM   2435 O O     . SER C 2 94  ? 7.341   48.234 75.807  1.00 37.13 ? 94  SER A O     1 
ATOM   2436 C CB    . SER C 2 94  ? 5.897   50.428 77.662  1.00 35.43 ? 94  SER A CB    1 
ATOM   2437 O OG    . SER C 2 94  ? 4.602   49.952 77.353  1.00 37.70 ? 94  SER A OG    1 
ATOM   2438 N N     . VAL C 2 95  ? 5.536   49.109 74.814  1.00 36.79 ? 95  VAL A N     1 
ATOM   2439 C CA    . VAL C 2 95  ? 5.251   47.900 74.045  1.00 35.64 ? 95  VAL A CA    1 
ATOM   2440 C C     . VAL C 2 95  ? 6.217   47.695 72.891  1.00 36.08 ? 95  VAL A C     1 
ATOM   2441 O O     . VAL C 2 95  ? 6.638   46.571 72.631  1.00 32.04 ? 95  VAL A O     1 
ATOM   2442 C CB    . VAL C 2 95  ? 3.793   47.918 73.506  1.00 35.63 ? 95  VAL A CB    1 
ATOM   2443 C CG1   . VAL C 2 95  ? 3.543   46.735 72.573  1.00 32.50 ? 95  VAL A CG1   1 
ATOM   2444 C CG2   . VAL C 2 95  ? 2.828   47.862 74.668  1.00 32.96 ? 95  VAL A CG2   1 
ATOM   2445 N N     . ASN C 2 96  ? 6.556   48.779 72.196  1.00 38.52 ? 96  ASN A N     1 
ATOM   2446 C CA    . ASN C 2 96  ? 7.482   48.690 71.075  1.00 42.89 ? 96  ASN A CA    1 
ATOM   2447 C C     . ASN C 2 96  ? 8.865   48.299 71.580  1.00 44.37 ? 96  ASN A C     1 
ATOM   2448 O O     . ASN C 2 96  ? 9.520   47.406 71.026  1.00 44.93 ? 96  ASN A O     1 
ATOM   2449 C CB    . ASN C 2 96  ? 7.549   50.022 70.320  1.00 45.55 ? 96  ASN A CB    1 
ATOM   2450 C CG    . ASN C 2 96  ? 6.432   50.170 69.273  1.00 48.48 ? 96  ASN A CG    1 
ATOM   2451 O OD1   . ASN C 2 96  ? 6.397   49.447 68.271  1.00 48.22 ? 96  ASN A OD1   1 
ATOM   2452 N ND2   . ASN C 2 96  ? 5.516   51.111 69.509  1.00 50.03 ? 96  ASN A ND2   1 
ATOM   2453 N N     . TYR C 2 97  ? 9.303   48.946 72.650  1.00 45.08 ? 97  TYR A N     1 
ATOM   2454 C CA    . TYR C 2 97  ? 10.605  48.628 73.200  1.00 47.34 ? 97  TYR A CA    1 
ATOM   2455 C C     . TYR C 2 97  ? 10.716  47.153 73.600  1.00 46.37 ? 97  TYR A C     1 
ATOM   2456 O O     . TYR C 2 97  ? 11.708  46.503 73.300  1.00 47.11 ? 97  TYR A O     1 
ATOM   2457 C CB    . TYR C 2 97  ? 10.919  49.508 74.407  1.00 51.05 ? 97  TYR A CB    1 
ATOM   2458 C CG    . TYR C 2 97  ? 12.246  49.141 75.010  1.00 54.86 ? 97  TYR A CG    1 
ATOM   2459 C CD1   . TYR C 2 97  ? 13.438  49.459 74.363  1.00 56.67 ? 97  TYR A CD1   1 
ATOM   2460 C CD2   . TYR C 2 97  ? 12.311  48.393 76.179  1.00 56.22 ? 97  TYR A CD2   1 
ATOM   2461 C CE1   . TYR C 2 97  ? 14.662  49.032 74.866  1.00 59.05 ? 97  TYR A CE1   1 
ATOM   2462 C CE2   . TYR C 2 97  ? 13.523  47.961 76.690  1.00 58.60 ? 97  TYR A CE2   1 
ATOM   2463 C CZ    . TYR C 2 97  ? 14.695  48.279 76.032  1.00 59.65 ? 97  TYR A CZ    1 
ATOM   2464 O OH    . TYR C 2 97  ? 15.893  47.826 76.536  1.00 60.90 ? 97  TYR A OH    1 
ATOM   2465 N N     . ALA C 2 98  ? 9.709   46.629 74.287  1.00 45.64 ? 98  ALA A N     1 
ATOM   2466 C CA    . ALA C 2 98  ? 9.725   45.225 74.684  1.00 45.56 ? 98  ALA A CA    1 
ATOM   2467 C C     . ALA C 2 98  ? 9.674   44.309 73.461  1.00 47.03 ? 98  ALA A C     1 
ATOM   2468 O O     . ALA C 2 98  ? 10.262  43.236 73.452  1.00 47.36 ? 98  ALA A O     1 
ATOM   2469 C CB    . ALA C 2 98  ? 8.549   44.928 75.591  1.00 42.66 ? 98  ALA A CB    1 
ATOM   2470 N N     . ALA C 2 99  ? 8.974   44.732 72.419  1.00 49.03 ? 99  ALA A N     1 
ATOM   2471 C CA    . ALA C 2 99  ? 8.859   43.906 71.225  1.00 51.88 ? 99  ALA A CA    1 
ATOM   2472 C C     . ALA C 2 99  ? 10.197  43.743 70.519  1.00 53.90 ? 99  ALA A C     1 
ATOM   2473 O O     . ALA C 2 99  ? 10.547  42.643 70.083  1.00 54.18 ? 99  ALA A O     1 
ATOM   2474 C CB    . ALA C 2 99  ? 7.839   44.505 70.270  1.00 53.41 ? 99  ALA A CB    1 
ATOM   2475 N N     . SER C 2 100 ? 10.941  44.839 70.394  1.00 54.90 ? 100 SER A N     1 
ATOM   2476 C CA    . SER C 2 100 ? 12.239  44.791 69.733  1.00 55.53 ? 100 SER A CA    1 
ATOM   2477 C C     . SER C 2 100 ? 13.138  43.727 70.369  1.00 56.19 ? 100 SER A C     1 
ATOM   2478 O O     . SER C 2 100 ? 13.919  43.070 69.679  1.00 57.20 ? 100 SER A O     1 
ATOM   2479 C CB    . SER C 2 100 ? 12.922  46.159 69.802  1.00 54.45 ? 100 SER A CB    1 
ATOM   2480 O OG    . SER C 2 100 ? 13.201  46.518 71.139  1.00 55.28 ? 100 SER A OG    1 
ATOM   2481 N N     . ARG C 2 101 ? 13.017  43.547 71.680  1.00 56.16 ? 101 ARG A N     1 
ATOM   2482 C CA    . ARG C 2 101 ? 13.828  42.560 72.383  1.00 56.79 ? 101 ARG A CA    1 
ATOM   2483 C C     . ARG C 2 101 ? 13.494  41.097 72.099  1.00 55.72 ? 101 ARG A C     1 
ATOM   2484 O O     . ARG C 2 101 ? 14.304  40.232 72.381  1.00 57.14 ? 101 ARG A O     1 
ATOM   2485 C CB    . ARG C 2 101 ? 13.772  42.811 73.894  1.00 58.59 ? 101 ARG A CB    1 
ATOM   2486 C CG    . ARG C 2 101 ? 14.657  43.963 74.366  1.00 62.70 ? 101 ARG A CG    1 
ATOM   2487 C CD    . ARG C 2 101 ? 16.134  43.547 74.404  1.00 67.85 ? 101 ARG A CD    1 
ATOM   2488 N NE    . ARG C 2 101 ? 16.396  42.533 75.432  1.00 71.53 ? 101 ARG A NE    1 
ATOM   2489 C CZ    . ARG C 2 101 ? 16.525  42.796 76.732  1.00 72.90 ? 101 ARG A CZ    1 
ATOM   2490 N NH1   . ARG C 2 101 ? 16.428  44.048 77.170  1.00 73.70 ? 101 ARG A NH1   1 
ATOM   2491 N NH2   . ARG C 2 101 ? 16.728  41.808 77.600  1.00 72.88 ? 101 ARG A NH2   1 
ATOM   2492 N N     . PHE C 2 102 ? 12.316  40.806 71.556  1.00 55.41 ? 102 PHE A N     1 
ATOM   2493 C CA    . PHE C 2 102 ? 11.961  39.415 71.265  1.00 54.93 ? 102 PHE A CA    1 
ATOM   2494 C C     . PHE C 2 102 ? 11.623  39.220 69.807  1.00 54.57 ? 102 PHE A C     1 
ATOM   2495 O O     . PHE C 2 102 ? 11.281  38.118 69.390  1.00 54.47 ? 102 PHE A O     1 
ATOM   2496 C CB    . PHE C 2 102 ? 10.754  38.941 72.083  1.00 55.04 ? 102 PHE A CB    1 
ATOM   2497 C CG    . PHE C 2 102 ? 10.811  39.317 73.518  1.00 54.73 ? 102 PHE A CG    1 
ATOM   2498 C CD1   . PHE C 2 102 ? 10.138  40.438 73.971  1.00 54.84 ? 102 PHE A CD1   1 
ATOM   2499 C CD2   . PHE C 2 102 ? 11.551  38.566 74.418  1.00 55.46 ? 102 PHE A CD2   1 
ATOM   2500 C CE1   . PHE C 2 102 ? 10.195  40.813 75.307  1.00 56.24 ? 102 PHE A CE1   1 
ATOM   2501 C CE2   . PHE C 2 102 ? 11.620  38.928 75.755  1.00 55.98 ? 102 PHE A CE2   1 
ATOM   2502 C CZ    . PHE C 2 102 ? 10.938  40.058 76.202  1.00 56.10 ? 102 PHE A CZ    1 
ATOM   2503 N N     . LEU C 2 103 ? 11.689  40.288 69.028  1.00 55.04 ? 103 LEU A N     1 
ATOM   2504 C CA    . LEU C 2 103 ? 11.379  40.169 67.615  1.00 55.99 ? 103 LEU A CA    1 
ATOM   2505 C C     . LEU C 2 103 ? 12.646  40.014 66.787  1.00 57.75 ? 103 LEU A C     1 
ATOM   2506 O O     . LEU C 2 103 ? 13.577  40.816 66.884  1.00 57.71 ? 103 LEU A O     1 
ATOM   2507 C CB    . LEU C 2 103 ? 10.577  41.382 67.136  1.00 53.87 ? 103 LEU A CB    1 
ATOM   2508 C CG    . LEU C 2 103 ? 9.144   41.500 67.653  1.00 52.88 ? 103 LEU A CG    1 
ATOM   2509 C CD1   . LEU C 2 103 ? 8.466   42.670 66.956  1.00 51.12 ? 103 LEU A CD1   1 
ATOM   2510 C CD2   . LEU C 2 103 ? 8.383   40.206 67.401  1.00 49.78 ? 103 LEU A CD2   1 
ATOM   2511 N N     . GLY C 2 104 ? 12.683  38.952 65.994  1.00 59.06 ? 104 GLY A N     1 
ATOM   2512 C CA    . GLY C 2 104 ? 13.829  38.724 65.144  1.00 62.56 ? 104 GLY A CA    1 
ATOM   2513 C C     . GLY C 2 104 ? 13.710  39.573 63.894  1.00 64.05 ? 104 GLY A C     1 
ATOM   2514 O O     . GLY C 2 104 ? 13.066  40.627 63.912  1.00 63.55 ? 104 GLY A O     1 
ATOM   2515 N N     . ALA C 2 105 ? 14.346  39.127 62.813  1.00 66.15 ? 105 ALA A N     1 
ATOM   2516 C CA    . ALA C 2 105 ? 14.276  39.837 61.537  1.00 67.65 ? 105 ALA A CA    1 
ATOM   2517 C C     . ALA C 2 105 ? 13.033  39.287 60.846  1.00 67.85 ? 105 ALA A C     1 
ATOM   2518 O O     . ALA C 2 105 ? 12.713  39.660 59.713  1.00 69.51 ? 105 ALA A O     1 
ATOM   2519 C CB    . ALA C 2 105 ? 15.522  39.559 60.691  1.00 67.97 ? 105 ALA A CB    1 
ATOM   2520 N N     . ASN C 2 106 ? 12.348  38.384 61.544  1.00 66.30 ? 106 ASN A N     1 
ATOM   2521 C CA    . ASN C 2 106 ? 11.131  37.779 61.029  1.00 65.62 ? 106 ASN A CA    1 
ATOM   2522 C C     . ASN C 2 106 ? 9.870   38.369 61.638  1.00 64.23 ? 106 ASN A C     1 
ATOM   2523 O O     . ASN C 2 106 ? 9.909   39.122 62.619  1.00 64.44 ? 106 ASN A O     1 
ATOM   2524 C CB    . ASN C 2 106 ? 11.120  36.275 61.279  1.00 66.54 ? 106 ASN A CB    1 
ATOM   2525 C CG    . ASN C 2 106 ? 12.063  35.543 60.381  1.00 69.25 ? 106 ASN A CG    1 
ATOM   2526 O OD1   . ASN C 2 106 ? 12.166  35.860 59.196  1.00 71.03 ? 106 ASN A OD1   1 
ATOM   2527 N ND2   . ASN C 2 106 ? 12.756  34.549 60.926  1.00 69.78 ? 106 ASN A ND2   1 
ATOM   2528 N N     . GLN C 2 107 ? 8.745   38.019 61.032  1.00 60.78 ? 107 GLN A N     1 
ATOM   2529 C CA    . GLN C 2 107 ? 7.466   38.475 61.515  1.00 57.91 ? 107 GLN A CA    1 
ATOM   2530 C C     . GLN C 2 107 ? 6.850   37.305 62.243  1.00 56.47 ? 107 GLN A C     1 
ATOM   2531 O O     . GLN C 2 107 ? 6.947   36.156 61.793  1.00 56.48 ? 107 GLN A O     1 
ATOM   2532 C CB    . GLN C 2 107 ? 6.568   38.922 60.359  1.00 56.49 ? 107 GLN A CB    1 
ATOM   2533 C CG    . GLN C 2 107 ? 5.100   39.048 60.737  1.00 55.02 ? 107 GLN A CG    1 
ATOM   2534 C CD    . GLN C 2 107 ? 4.322   39.926 59.778  1.00 54.75 ? 107 GLN A CD    1 
ATOM   2535 O OE1   . GLN C 2 107 ? 4.423   41.154 59.825  1.00 53.80 ? 107 GLN A OE1   1 
ATOM   2536 N NE2   . GLN C 2 107 ? 3.551   39.303 58.893  1.00 51.38 ? 107 GLN A NE2   1 
ATOM   2537 N N     . VAL C 2 108 ? 6.236   37.607 63.381  1.00 53.35 ? 108 VAL A N     1 
ATOM   2538 C CA    . VAL C 2 108 ? 5.583   36.604 64.205  1.00 50.86 ? 108 VAL A CA    1 
ATOM   2539 C C     . VAL C 2 108 ? 4.225   37.150 64.641  1.00 48.55 ? 108 VAL A C     1 
ATOM   2540 O O     . VAL C 2 108 ? 3.976   38.347 64.543  1.00 48.82 ? 108 VAL A O     1 
ATOM   2541 C CB    . VAL C 2 108 ? 6.440   36.291 65.439  1.00 51.79 ? 108 VAL A CB    1 
ATOM   2542 C CG1   . VAL C 2 108 ? 7.695   35.548 65.016  1.00 51.84 ? 108 VAL A CG1   1 
ATOM   2543 C CG2   . VAL C 2 108 ? 6.817   37.589 66.142  1.00 50.59 ? 108 VAL A CG2   1 
ATOM   2544 N N     . GLY C 2 109 ? 3.345   36.280 65.112  1.00 45.01 ? 109 GLY A N     1 
ATOM   2545 C CA    . GLY C 2 109 ? 2.043   36.748 65.530  1.00 42.92 ? 109 GLY A CA    1 
ATOM   2546 C C     . GLY C 2 109 ? 2.113   37.514 66.833  1.00 42.70 ? 109 GLY A C     1 
ATOM   2547 O O     . GLY C 2 109 ? 2.759   37.069 67.775  1.00 43.74 ? 109 GLY A O     1 
ATOM   2548 N N     . CYS C 2 110 ? 1.468   38.675 66.885  1.00 39.93 ? 110 CYS A N     1 
ATOM   2549 C CA    . CYS C 2 110 ? 1.433   39.478 68.102  1.00 38.18 ? 110 CYS A CA    1 
ATOM   2550 C C     . CYS C 2 110 ? -0.020  39.611 68.528  1.00 36.39 ? 110 CYS A C     1 
ATOM   2551 O O     . CYS C 2 110 ? -0.923  39.477 67.707  1.00 36.92 ? 110 CYS A O     1 
ATOM   2552 C CB    . CYS C 2 110 ? 2.041   40.854 67.869  1.00 39.09 ? 110 CYS A CB    1 
ATOM   2553 S SG    . CYS C 2 110 ? 3.753   40.759 67.436  1.00 35.34 ? 110 CYS A SG    1 
ATOM   2554 N N     . THR C 2 111 ? -0.245  39.897 69.804  1.00 34.88 ? 111 THR A N     1 
ATOM   2555 C CA    . THR C 2 111 ? -1.604  39.962 70.322  1.00 32.31 ? 111 THR A CA    1 
ATOM   2556 C C     . THR C 2 111 ? -1.772  40.769 71.579  1.00 30.08 ? 111 THR A C     1 
ATOM   2557 O O     . THR C 2 111 ? -0.927  40.729 72.468  1.00 31.73 ? 111 THR A O     1 
ATOM   2558 C CB    . THR C 2 111 ? -2.093  38.575 70.706  1.00 31.35 ? 111 THR A CB    1 
ATOM   2559 O OG1   . THR C 2 111 ? -2.013  37.711 69.581  1.00 37.39 ? 111 THR A OG1   1 
ATOM   2560 C CG2   . THR C 2 111 ? -3.509  38.627 71.182  1.00 36.96 ? 111 THR A CG2   1 
ATOM   2561 N N     . TYR C 2 112 ? -2.882  41.487 71.656  1.00 27.73 ? 112 TYR A N     1 
ATOM   2562 C CA    . TYR C 2 112 ? -3.226  42.221 72.859  1.00 24.88 ? 112 TYR A CA    1 
ATOM   2563 C C     . TYR C 2 112 ? -4.628  41.768 73.164  1.00 25.85 ? 112 TYR A C     1 
ATOM   2564 O O     . TYR C 2 112 ? -5.469  41.749 72.273  1.00 28.31 ? 112 TYR A O     1 
ATOM   2565 C CB    . TYR C 2 112 ? -3.279  43.716 72.655  1.00 20.87 ? 112 TYR A CB    1 
ATOM   2566 C CG    . TYR C 2 112 ? -3.886  44.386 73.875  1.00 21.17 ? 112 TYR A CG    1 
ATOM   2567 C CD1   . TYR C 2 112 ? -3.154  44.514 75.058  1.00 16.36 ? 112 TYR A CD1   1 
ATOM   2568 C CD2   . TYR C 2 112 ? -5.203  44.862 73.861  1.00 19.01 ? 112 TYR A CD2   1 
ATOM   2569 C CE1   . TYR C 2 112 ? -3.697  45.090 76.176  1.00 13.90 ? 112 TYR A CE1   1 
ATOM   2570 C CE2   . TYR C 2 112 ? -5.761  45.450 74.988  1.00 17.95 ? 112 TYR A CE2   1 
ATOM   2571 C CZ    . TYR C 2 112 ? -4.993  45.566 76.146  1.00 17.22 ? 112 TYR A CZ    1 
ATOM   2572 O OH    . TYR C 2 112 ? -5.500  46.217 77.256  1.00 18.28 ? 112 TYR A OH    1 
ATOM   2573 N N     . SER C 2 113 ? -4.905  41.411 74.404  1.00 27.22 ? 113 SER A N     1 
ATOM   2574 C CA    . SER C 2 113 ? -6.253  40.976 74.724  1.00 30.71 ? 113 SER A CA    1 
ATOM   2575 C C     . SER C 2 113 ? -6.698  41.455 76.095  1.00 30.95 ? 113 SER A C     1 
ATOM   2576 O O     . SER C 2 113 ? -5.937  41.370 77.057  1.00 35.47 ? 113 SER A O     1 
ATOM   2577 C CB    . SER C 2 113 ? -6.321  39.461 74.641  1.00 30.24 ? 113 SER A CB    1 
ATOM   2578 O OG    . SER C 2 113 ? -7.541  39.007 75.153  1.00 37.86 ? 113 SER A OG    1 
ATOM   2579 N N     . ILE C 2 114 ? -7.920  41.965 76.192  1.00 28.49 ? 114 ILE A N     1 
ATOM   2580 C CA    . ILE C 2 114 ? -8.430  42.457 77.471  1.00 27.47 ? 114 ILE A CA    1 
ATOM   2581 C C     . ILE C 2 114 ? -9.840  41.940 77.711  1.00 29.59 ? 114 ILE A C     1 
ATOM   2582 O O     . ILE C 2 114 ? -10.624 41.811 76.775  1.00 32.01 ? 114 ILE A O     1 
ATOM   2583 C CB    . ILE C 2 114 ? -8.429  44.002 77.510  1.00 25.26 ? 114 ILE A CB    1 
ATOM   2584 C CG1   . ILE C 2 114 ? -9.003  44.492 78.836  1.00 23.43 ? 114 ILE A CG1   1 
ATOM   2585 C CG2   . ILE C 2 114 ? -9.206  44.556 76.343  1.00 20.42 ? 114 ILE A CG2   1 
ATOM   2586 C CD1   . ILE C 2 114 ? -8.852  45.985 79.038  1.00 24.94 ? 114 ILE A CD1   1 
ATOM   2587 N N     . ARG C 2 115 ? -10.163 41.642 78.963  1.00 30.07 ? 115 ARG A N     1 
ATOM   2588 C CA    . ARG C 2 115 ? -11.475 41.105 79.304  1.00 29.75 ? 115 ARG A CA    1 
ATOM   2589 C C     . ARG C 2 115 ? -12.046 41.851 80.496  1.00 30.04 ? 115 ARG A C     1 
ATOM   2590 O O     . ARG C 2 115 ? -11.361 42.033 81.493  1.00 32.06 ? 115 ARG A O     1 
ATOM   2591 C CB    . ARG C 2 115 ? -11.325 39.623 79.634  1.00 31.70 ? 115 ARG A CB    1 
ATOM   2592 C CG    . ARG C 2 115 ? -12.613 38.924 79.995  1.00 36.92 ? 115 ARG A CG    1 
ATOM   2593 C CD    . ARG C 2 115 ? -12.329 37.509 80.458  1.00 41.24 ? 115 ARG A CD    1 
ATOM   2594 N NE    . ARG C 2 115 ? -13.418 36.955 81.265  1.00 45.78 ? 115 ARG A NE    1 
ATOM   2595 C CZ    . ARG C 2 115 ? -14.602 36.605 80.780  1.00 47.76 ? 115 ARG A CZ    1 
ATOM   2596 N NH1   . ARG C 2 115 ? -14.852 36.747 79.482  1.00 50.48 ? 115 ARG A NH1   1 
ATOM   2597 N NH2   . ARG C 2 115 ? -15.539 36.128 81.593  1.00 46.26 ? 115 ARG A NH2   1 
ATOM   2598 N N     . PHE C 2 116 ? -13.295 42.279 80.405  1.00 29.69 ? 116 PHE A N     1 
ATOM   2599 C CA    . PHE C 2 116 ? -13.924 43.018 81.494  1.00 31.01 ? 116 PHE A CA    1 
ATOM   2600 C C     . PHE C 2 116 ? -15.443 42.886 81.433  1.00 34.42 ? 116 PHE A C     1 
ATOM   2601 O O     . PHE C 2 116 ? -16.035 42.979 80.357  1.00 36.15 ? 116 PHE A O     1 
ATOM   2602 C CB    . PHE C 2 116 ? -13.535 44.495 81.410  1.00 29.17 ? 116 PHE A CB    1 
ATOM   2603 C CG    . PHE C 2 116 ? -14.043 45.319 82.552  1.00 25.03 ? 116 PHE A CG    1 
ATOM   2604 C CD1   . PHE C 2 116 ? -13.727 44.991 83.855  1.00 25.49 ? 116 PHE A CD1   1 
ATOM   2605 C CD2   . PHE C 2 116 ? -14.842 46.414 82.328  1.00 24.64 ? 116 PHE A CD2   1 
ATOM   2606 C CE1   . PHE C 2 116 ? -14.211 45.754 84.927  1.00 24.50 ? 116 PHE A CE1   1 
ATOM   2607 C CE2   . PHE C 2 116 ? -15.325 47.177 83.396  1.00 23.53 ? 116 PHE A CE2   1 
ATOM   2608 C CZ    . PHE C 2 116 ? -15.011 46.845 84.689  1.00 20.38 ? 116 PHE A CZ    1 
ATOM   2609 N N     . ARG C 2 117 ? -16.075 42.679 82.585  1.00 37.34 ? 117 ARG A N     1 
ATOM   2610 C CA    . ARG C 2 117 ? -17.530 42.517 82.645  1.00 39.29 ? 117 ARG A CA    1 
ATOM   2611 C C     . ARG C 2 117 ? -18.019 41.522 81.598  1.00 38.51 ? 117 ARG A C     1 
ATOM   2612 O O     . ARG C 2 117 ? -19.045 41.747 80.959  1.00 39.12 ? 117 ARG A O     1 
ATOM   2613 C CB    . ARG C 2 117 ? -18.234 43.863 82.442  1.00 42.63 ? 117 ARG A CB    1 
ATOM   2614 C CG    . ARG C 2 117 ? -18.159 44.799 83.646  1.00 48.81 ? 117 ARG A CG    1 
ATOM   2615 C CD    . ARG C 2 117 ? -18.436 46.243 83.242  1.00 53.60 ? 117 ARG A CD    1 
ATOM   2616 N NE    . ARG C 2 117 ? -19.848 46.534 83.005  1.00 60.77 ? 117 ARG A NE    1 
ATOM   2617 C CZ    . ARG C 2 117 ? -20.290 47.633 82.387  1.00 63.91 ? 117 ARG A CZ    1 
ATOM   2618 N NH1   . ARG C 2 117 ? -19.423 48.541 81.939  1.00 64.61 ? 117 ARG A NH1   1 
ATOM   2619 N NH2   . ARG C 2 117 ? -21.597 47.831 82.218  1.00 64.10 ? 117 ARG A NH2   1 
ATOM   2620 N N     . GLY C 2 118 ? -17.269 40.436 81.415  1.00 37.15 ? 118 GLY A N     1 
ATOM   2621 C CA    . GLY C 2 118 ? -17.654 39.413 80.454  1.00 38.36 ? 118 GLY A CA    1 
ATOM   2622 C C     . GLY C 2 118 ? -17.171 39.542 79.010  1.00 38.76 ? 118 GLY A C     1 
ATOM   2623 O O     . GLY C 2 118 ? -16.757 38.555 78.390  1.00 38.81 ? 118 GLY A O     1 
ATOM   2624 N N     . VAL C 2 119 ? -17.244 40.752 78.463  1.00 37.92 ? 119 VAL A N     1 
ATOM   2625 C CA    . VAL C 2 119 ? -16.817 41.025 77.095  1.00 35.25 ? 119 VAL A CA    1 
ATOM   2626 C C     . VAL C 2 119 ? -15.298 40.893 77.022  1.00 35.20 ? 119 VAL A C     1 
ATOM   2627 O O     . VAL C 2 119 ? -14.591 41.317 77.936  1.00 36.85 ? 119 VAL A O     1 
ATOM   2628 C CB    . VAL C 2 119 ? -17.198 42.465 76.693  1.00 35.43 ? 119 VAL A CB    1 
ATOM   2629 C CG1   . VAL C 2 119 ? -16.842 42.725 75.243  1.00 34.36 ? 119 VAL A CG1   1 
ATOM   2630 C CG2   . VAL C 2 119 ? -18.672 42.701 76.941  1.00 35.68 ? 119 VAL A CG2   1 
ATOM   2631 N N     . SER C 2 120 ? -14.797 40.308 75.941  1.00 33.19 ? 120 SER A N     1 
ATOM   2632 C CA    . SER C 2 120 ? -13.363 40.132 75.755  1.00 31.85 ? 120 SER A CA    1 
ATOM   2633 C C     . SER C 2 120 ? -12.941 40.672 74.400  1.00 31.70 ? 120 SER A C     1 
ATOM   2634 O O     . SER C 2 120 ? -13.494 40.270 73.391  1.00 35.53 ? 120 SER A O     1 
ATOM   2635 C CB    . SER C 2 120 ? -13.019 38.661 75.810  1.00 32.90 ? 120 SER A CB    1 
ATOM   2636 O OG    . SER C 2 120 ? -11.790 38.417 75.145  1.00 38.90 ? 120 SER A OG    1 
ATOM   2637 N N     . VAL C 2 121 ? -11.962 41.564 74.353  1.00 29.50 ? 121 VAL A N     1 
ATOM   2638 C CA    . VAL C 2 121 ? -11.516 42.115 73.070  1.00 28.82 ? 121 VAL A CA    1 
ATOM   2639 C C     . VAL C 2 121 ? -10.117 41.633 72.739  1.00 28.68 ? 121 VAL A C     1 
ATOM   2640 O O     . VAL C 2 121 ? -9.233  41.711 73.585  1.00 30.61 ? 121 VAL A O     1 
ATOM   2641 C CB    . VAL C 2 121 ? -11.467 43.658 73.099  1.00 28.56 ? 121 VAL A CB    1 
ATOM   2642 C CG1   . VAL C 2 121 ? -11.009 44.182 71.755  1.00 27.98 ? 121 VAL A CG1   1 
ATOM   2643 C CG2   . VAL C 2 121 ? -12.834 44.228 73.464  1.00 29.47 ? 121 VAL A CG2   1 
ATOM   2644 N N     . THR C 2 122 ? -9.899  41.133 71.526  1.00 26.75 ? 122 THR A N     1 
ATOM   2645 C CA    . THR C 2 122 ? -8.561  40.690 71.162  1.00 26.57 ? 122 THR A CA    1 
ATOM   2646 C C     . THR C 2 122 ? -8.082  41.340 69.873  1.00 27.80 ? 122 THR A C     1 
ATOM   2647 O O     . THR C 2 122 ? -8.748  41.258 68.849  1.00 28.94 ? 122 THR A O     1 
ATOM   2648 C CB    . THR C 2 122 ? -8.473  39.171 70.993  1.00 26.35 ? 122 THR A CB    1 
ATOM   2649 O OG1   . THR C 2 122 ? -8.718  38.529 72.246  1.00 27.67 ? 122 THR A OG1   1 
ATOM   2650 C CG2   . THR C 2 122 ? -7.084  38.782 70.520  1.00 26.01 ? 122 THR A CG2   1 
ATOM   2651 N N     . ILE C 2 123 ? -6.919  41.988 69.929  1.00 27.45 ? 123 ILE A N     1 
ATOM   2652 C CA    . ILE C 2 123 ? -6.346  42.653 68.759  1.00 25.64 ? 123 ILE A CA    1 
ATOM   2653 C C     . ILE C 2 123 ? -5.171  41.812 68.276  1.00 25.79 ? 123 ILE A C     1 
ATOM   2654 O O     . ILE C 2 123 ? -4.301  41.454 69.069  1.00 27.03 ? 123 ILE A O     1 
ATOM   2655 C CB    . ILE C 2 123 ? -5.813  44.058 69.119  1.00 25.32 ? 123 ILE A CB    1 
ATOM   2656 C CG1   . ILE C 2 123 ? -6.902  44.881 69.825  1.00 22.80 ? 123 ILE A CG1   1 
ATOM   2657 C CG2   . ILE C 2 123 ? -5.265  44.744 67.853  1.00 25.47 ? 123 ILE A CG2   1 
ATOM   2658 C CD1   . ILE C 2 123 ? -8.094  45.190 68.973  1.00 24.64 ? 123 ILE A CD1   1 
ATOM   2659 N N     . SER C 2 124 ? -5.109  41.498 66.993  1.00 23.56 ? 124 SER A N     1 
ATOM   2660 C CA    . SER C 2 124 ? -3.991  40.682 66.550  1.00 24.03 ? 124 SER A CA    1 
ATOM   2661 C C     . SER C 2 124 ? -3.568  40.831 65.105  1.00 23.73 ? 124 SER A C     1 
ATOM   2662 O O     . SER C 2 124 ? -4.332  41.299 64.266  1.00 23.63 ? 124 SER A O     1 
ATOM   2663 C CB    . SER C 2 124 ? -4.294  39.224 66.830  1.00 27.20 ? 124 SER A CB    1 
ATOM   2664 O OG    . SER C 2 124 ? -5.595  38.894 66.387  1.00 30.13 ? 124 SER A OG    1 
ATOM   2665 N N     . GLY C 2 125 ? -2.331  40.416 64.839  1.00 23.81 ? 125 GLY A N     1 
ATOM   2666 C CA    . GLY C 2 125 ? -1.751  40.482 63.508  1.00 23.63 ? 125 GLY A CA    1 
ATOM   2667 C C     . GLY C 2 125 ? -0.243  40.262 63.549  1.00 24.92 ? 125 GLY A C     1 
ATOM   2668 O O     . GLY C 2 125 ? 0.346   40.065 64.617  1.00 23.88 ? 125 GLY A O     1 
ATOM   2669 N N     . GLY C 2 126 ? 0.391   40.282 62.385  1.00 24.24 ? 126 GLY A N     1 
ATOM   2670 C CA    . GLY C 2 126 ? 1.827   40.100 62.340  1.00 26.85 ? 126 GLY A CA    1 
ATOM   2671 C C     . GLY C 2 126 ? 2.557   41.265 62.979  1.00 27.94 ? 126 GLY A C     1 
ATOM   2672 O O     . GLY C 2 126 ? 2.021   42.367 63.068  1.00 27.73 ? 126 GLY A O     1 
ATOM   2673 N N     . SER C 2 127 ? 3.795   41.027 63.401  1.00 30.94 ? 127 SER A N     1 
ATOM   2674 C CA    . SER C 2 127 ? 4.598   42.051 64.055  1.00 33.49 ? 127 SER A CA    1 
ATOM   2675 C C     . SER C 2 127 ? 4.827   43.317 63.229  1.00 34.92 ? 127 SER A C     1 
ATOM   2676 O O     . SER C 2 127 ? 5.151   44.364 63.781  1.00 34.60 ? 127 SER A O     1 
ATOM   2677 C CB    . SER C 2 127 ? 5.934   41.451 64.492  1.00 35.70 ? 127 SER A CB    1 
ATOM   2678 O OG    . SER C 2 127 ? 6.543   40.732 63.433  1.00 40.64 ? 127 SER A OG    1 
ATOM   2679 N N     . ARG C 2 128 ? 4.647   43.236 61.913  1.00 37.34 ? 128 ARG A N     1 
ATOM   2680 C CA    . ARG C 2 128 ? 4.840   44.413 61.059  1.00 38.66 ? 128 ARG A CA    1 
ATOM   2681 C C     . ARG C 2 128 ? 3.795   45.499 61.327  1.00 38.93 ? 128 ARG A C     1 
ATOM   2682 O O     . ARG C 2 128 ? 4.050   46.683 61.098  1.00 38.57 ? 128 ARG A O     1 
ATOM   2683 C CB    . ARG C 2 128 ? 4.791   44.025 59.574  1.00 36.40 ? 128 ARG A CB    1 
ATOM   2684 N N     . THR C 2 129 ? 2.629   45.099 61.830  1.00 38.91 ? 129 THR A N     1 
ATOM   2685 C CA    . THR C 2 129 ? 1.548   46.052 62.089  1.00 38.87 ? 129 THR A CA    1 
ATOM   2686 C C     . THR C 2 129 ? 1.439   46.470 63.548  1.00 38.95 ? 129 THR A C     1 
ATOM   2687 O O     . THR C 2 129 ? 0.446   47.078 63.950  1.00 38.79 ? 129 THR A O     1 
ATOM   2688 C CB    . THR C 2 129 ? 0.188   45.466 61.681  1.00 38.25 ? 129 THR A CB    1 
ATOM   2689 O OG1   . THR C 2 129 ? -0.110  44.336 62.513  1.00 40.53 ? 129 THR A OG1   1 
ATOM   2690 C CG2   . THR C 2 129 ? 0.216   45.017 60.247  1.00 36.92 ? 129 THR A CG2   1 
ATOM   2691 N N     . LEU C 2 130 ? 2.458   46.154 64.338  1.00 38.78 ? 130 LEU A N     1 
ATOM   2692 C CA    . LEU C 2 130 ? 2.441   46.490 65.756  1.00 37.26 ? 130 LEU A CA    1 
ATOM   2693 C C     . LEU C 2 130 ? 2.018   47.917 66.096  1.00 37.08 ? 130 LEU A C     1 
ATOM   2694 O O     . LEU C 2 130 ? 1.392   48.148 67.128  1.00 37.97 ? 130 LEU A O     1 
ATOM   2695 C CB    . LEU C 2 130 ? 3.808   46.239 66.373  1.00 37.41 ? 130 LEU A CB    1 
ATOM   2696 C CG    . LEU C 2 130 ? 3.803   46.454 67.884  1.00 36.82 ? 130 LEU A CG    1 
ATOM   2697 C CD1   . LEU C 2 130 ? 2.997   45.356 68.533  1.00 34.84 ? 130 LEU A CD1   1 
ATOM   2698 C CD2   . LEU C 2 130 ? 5.214   46.457 68.406  1.00 36.75 ? 130 LEU A CD2   1 
ATOM   2699 N N     . GLN C 2 131 ? 2.354   48.890 65.260  1.00 36.73 ? 131 GLN A N     1 
ATOM   2700 C CA    . GLN C 2 131 ? 1.962   50.243 65.605  1.00 36.73 ? 131 GLN A CA    1 
ATOM   2701 C C     . GLN C 2 131 ? 0.455   50.321 65.586  1.00 36.38 ? 131 GLN A C     1 
ATOM   2702 O O     . GLN C 2 131 ? -0.157  50.889 66.491  1.00 36.98 ? 131 GLN A O     1 
ATOM   2703 C CB    . GLN C 2 131 ? 2.546   51.267 64.639  1.00 39.36 ? 131 GLN A CB    1 
ATOM   2704 C CG    . GLN C 2 131 ? 2.537   52.666 65.233  1.00 45.24 ? 131 GLN A CG    1 
ATOM   2705 C CD    . GLN C 2 131 ? 3.292   52.718 66.571  1.00 51.90 ? 131 GLN A CD    1 
ATOM   2706 O OE1   . GLN C 2 131 ? 4.530   52.621 66.610  1.00 53.58 ? 131 GLN A OE1   1 
ATOM   2707 N NE2   . GLN C 2 131 ? 2.545   52.853 67.674  1.00 51.78 ? 131 GLN A NE2   1 
ATOM   2708 N N     . HIS C 2 132 ? -0.146  49.734 64.555  1.00 34.85 ? 132 HIS A N     1 
ATOM   2709 C CA    . HIS C 2 132 ? -1.594  49.739 64.431  1.00 32.54 ? 132 HIS A CA    1 
ATOM   2710 C C     . HIS C 2 132 ? -2.236  48.919 65.522  1.00 31.60 ? 132 HIS A C     1 
ATOM   2711 O O     . HIS C 2 132 ? -3.288  49.275 66.032  1.00 32.26 ? 132 HIS A O     1 
ATOM   2712 C CB    . HIS C 2 132 ? -2.020  49.216 63.068  1.00 30.83 ? 132 HIS A CB    1 
ATOM   2713 C CG    . HIS C 2 132 ? -1.924  50.242 61.986  1.00 32.97 ? 132 HIS A CG    1 
ATOM   2714 N ND1   . HIS C 2 132 ? -1.966  51.595 62.248  1.00 34.09 ? 132 HIS A ND1   1 
ATOM   2715 C CD2   . HIS C 2 132 ? -1.865  50.121 60.638  1.00 33.90 ? 132 HIS A CD2   1 
ATOM   2716 C CE1   . HIS C 2 132 ? -1.942  52.264 61.110  1.00 33.99 ? 132 HIS A CE1   1 
ATOM   2717 N NE2   . HIS C 2 132 ? -1.883  51.394 60.118  1.00 35.72 ? 132 HIS A NE2   1 
ATOM   2718 N N     . LEU C 2 133 ? -1.604  47.817 65.887  1.00 31.76 ? 133 LEU A N     1 
ATOM   2719 C CA    . LEU C 2 133 ? -2.149  46.994 66.945  1.00 32.74 ? 133 LEU A CA    1 
ATOM   2720 C C     . LEU C 2 133 ? -2.242  47.851 68.193  1.00 33.01 ? 133 LEU A C     1 
ATOM   2721 O O     . LEU C 2 133 ? -3.214  47.763 68.940  1.00 33.29 ? 133 LEU A O     1 
ATOM   2722 C CB    . LEU C 2 133 ? -1.249  45.788 67.208  1.00 34.68 ? 133 LEU A CB    1 
ATOM   2723 C CG    . LEU C 2 133 ? -1.127  44.800 66.047  1.00 38.41 ? 133 LEU A CG    1 
ATOM   2724 C CD1   . LEU C 2 133 ? -0.090  43.741 66.372  1.00 39.26 ? 133 LEU A CD1   1 
ATOM   2725 C CD2   . LEU C 2 133 ? -2.480  44.161 65.783  1.00 39.11 ? 133 LEU A CD2   1 
ATOM   2726 N N     . CYS C 2 134 ? -1.244  48.704 68.400  1.00 32.82 ? 134 CYS A N     1 
ATOM   2727 C CA    . CYS C 2 134 ? -1.215  49.559 69.582  1.00 35.23 ? 134 CYS A CA    1 
ATOM   2728 C C     . CYS C 2 134 ? -2.256  50.657 69.622  1.00 36.33 ? 134 CYS A C     1 
ATOM   2729 O O     . CYS C 2 134 ? -2.740  51.016 70.699  1.00 38.03 ? 134 CYS A O     1 
ATOM   2730 C CB    . CYS C 2 134 ? 0.172   50.166 69.765  1.00 35.12 ? 134 CYS A CB    1 
ATOM   2731 S SG    . CYS C 2 134 ? 1.362   48.968 70.367  1.00 35.88 ? 134 CYS A SG    1 
ATOM   2732 N N     . GLU C 2 135 ? -2.598  51.205 68.462  1.00 37.00 ? 135 GLU A N     1 
ATOM   2733 C CA    . GLU C 2 135 ? -3.607  52.249 68.423  1.00 37.67 ? 135 GLU A CA    1 
ATOM   2734 C C     . GLU C 2 135 ? -4.952  51.620 68.686  1.00 36.33 ? 135 GLU A C     1 
ATOM   2735 O O     . GLU C 2 135 ? -5.735  52.139 69.475  1.00 36.26 ? 135 GLU A O     1 
ATOM   2736 C CB    . GLU C 2 135 ? -3.614  52.933 67.072  1.00 40.42 ? 135 GLU A CB    1 
ATOM   2737 C CG    . GLU C 2 135 ? -2.510  53.931 66.924  1.00 48.90 ? 135 GLU A CG    1 
ATOM   2738 C CD    . GLU C 2 135 ? -2.006  53.997 65.504  1.00 54.58 ? 135 GLU A CD    1 
ATOM   2739 O OE1   . GLU C 2 135 ? -2.842  53.823 64.588  1.00 55.74 ? 135 GLU A OE1   1 
ATOM   2740 O OE2   . GLU C 2 135 ? -0.782  54.228 65.309  1.00 58.94 ? 135 GLU A OE2   1 
ATOM   2741 N N     . MET C 2 136 ? -5.210  50.493 68.030  1.00 33.89 ? 136 MET A N     1 
ATOM   2742 C CA    . MET C 2 136 ? -6.471  49.787 68.209  1.00 32.69 ? 136 MET A CA    1 
ATOM   2743 C C     . MET C 2 136 ? -6.603  49.313 69.647  1.00 32.09 ? 136 MET A C     1 
ATOM   2744 O O     . MET C 2 136 ? -7.668  49.444 70.252  1.00 34.00 ? 136 MET A O     1 
ATOM   2745 C CB    . MET C 2 136 ? -6.558  48.565 67.286  1.00 32.77 ? 136 MET A CB    1 
ATOM   2746 C CG    . MET C 2 136 ? -6.870  48.869 65.844  1.00 31.90 ? 136 MET A CG    1 
ATOM   2747 S SD    . MET C 2 136 ? -8.426  49.749 65.692  1.00 36.20 ? 136 MET A SD    1 
ATOM   2748 C CE    . MET C 2 136 ? -9.599  48.640 66.465  1.00 29.58 ? 136 MET A CE    1 
ATOM   2749 N N     . ALA C 2 137 ? -5.523  48.759 70.190  1.00 28.26 ? 137 ALA A N     1 
ATOM   2750 C CA    . ALA C 2 137 ? -5.557  48.254 71.549  1.00 27.17 ? 137 ALA A CA    1 
ATOM   2751 C C     . ALA C 2 137 ? -5.834  49.339 72.573  1.00 26.96 ? 137 ALA A C     1 
ATOM   2752 O O     . ALA C 2 137 ? -6.638  49.141 73.474  1.00 26.88 ? 137 ALA A O     1 
ATOM   2753 C CB    . ALA C 2 137 ? -4.251  47.536 71.894  1.00 24.44 ? 137 ALA A CB    1 
ATOM   2754 N N     . ILE C 2 138 ? -5.191  50.491 72.451  1.00 26.61 ? 138 ILE A N     1 
ATOM   2755 C CA    . ILE C 2 138 ? -5.433  51.508 73.455  1.00 25.94 ? 138 ILE A CA    1 
ATOM   2756 C C     . ILE C 2 138 ? -6.863  51.994 73.374  1.00 25.12 ? 138 ILE A C     1 
ATOM   2757 O O     . ILE C 2 138 ? -7.480  52.251 74.389  1.00 27.57 ? 138 ILE A O     1 
ATOM   2758 C CB    . ILE C 2 138 ? -4.419  52.712 73.349  1.00 29.79 ? 138 ILE A CB    1 
ATOM   2759 C CG1   . ILE C 2 138 ? -4.580  53.625 74.577  1.00 29.73 ? 138 ILE A CG1   1 
ATOM   2760 C CG2   . ILE C 2 138 ? -4.612  53.507 72.049  1.00 27.36 ? 138 ILE A CG2   1 
ATOM   2761 C CD1   . ILE C 2 138 ? -4.241  52.934 75.906  1.00 26.77 ? 138 ILE A CD1   1 
ATOM   2762 N N     . ARG C 2 139 ? -7.410  52.106 72.173  1.00 27.61 ? 139 ARG A N     1 
ATOM   2763 C CA    . ARG C 2 139 ? -8.793  52.552 72.028  1.00 29.59 ? 139 ARG A CA    1 
ATOM   2764 C C     . ARG C 2 139 ? -9.773  51.486 72.543  1.00 29.67 ? 139 ARG A C     1 
ATOM   2765 O O     . ARG C 2 139 ? -10.689 51.803 73.307  1.00 29.86 ? 139 ARG A O     1 
ATOM   2766 C CB    . ARG C 2 139 ? -9.103  52.884 70.575  1.00 32.23 ? 139 ARG A CB    1 
ATOM   2767 C CG    . ARG C 2 139 ? -8.210  53.951 70.008  1.00 40.63 ? 139 ARG A CG    1 
ATOM   2768 C CD    . ARG C 2 139 ? -8.890  54.681 68.872  1.00 48.71 ? 139 ARG A CD    1 
ATOM   2769 N NE    . ARG C 2 139 ? -10.164 55.248 69.312  1.00 56.15 ? 139 ARG A NE    1 
ATOM   2770 C CZ    . ARG C 2 139 ? -10.995 55.918 68.520  1.00 59.19 ? 139 ARG A CZ    1 
ATOM   2771 N NH1   . ARG C 2 139 ? -10.678 56.111 67.244  1.00 60.10 ? 139 ARG A NH1   1 
ATOM   2772 N NH2   . ARG C 2 139 ? -12.149 56.377 68.999  1.00 60.70 ? 139 ARG A NH2   1 
ATOM   2773 N N     . SER C 2 140 ? -9.580  50.230 72.145  1.00 26.47 ? 140 SER A N     1 
ATOM   2774 C CA    . SER C 2 140 ? -10.455 49.175 72.621  1.00 25.64 ? 140 SER A CA    1 
ATOM   2775 C C     . SER C 2 140 ? -10.421 49.189 74.133  1.00 25.75 ? 140 SER A C     1 
ATOM   2776 O O     . SER C 2 140 ? -11.448 49.144 74.796  1.00 27.06 ? 140 SER A O     1 
ATOM   2777 C CB    . SER C 2 140 ? -9.994  47.828 72.096  1.00 25.44 ? 140 SER A CB    1 
ATOM   2778 O OG    . SER C 2 140 ? -10.036 47.821 70.674  1.00 28.28 ? 140 SER A OG    1 
ATOM   2779 N N     . LYS C 2 141 ? -9.232  49.278 74.694  1.00 27.49 ? 141 LYS A N     1 
ATOM   2780 C CA    . LYS C 2 141 ? -9.116  49.319 76.140  1.00 28.15 ? 141 LYS A CA    1 
ATOM   2781 C C     . LYS C 2 141 ? -10.037 50.392 76.763  1.00 29.26 ? 141 LYS A C     1 
ATOM   2782 O O     . LYS C 2 141 ? -10.849 50.075 77.630  1.00 31.70 ? 141 LYS A O     1 
ATOM   2783 C CB    . LYS C 2 141 ? -7.656  49.567 76.546  1.00 25.58 ? 141 LYS A CB    1 
ATOM   2784 C CG    . LYS C 2 141 ? -7.413  49.579 78.055  1.00 26.54 ? 141 LYS A CG    1 
ATOM   2785 C CD    . LYS C 2 141 ? -5.927  49.501 78.377  1.00 25.32 ? 141 LYS A CD    1 
ATOM   2786 C CE    . LYS C 2 141 ? -5.683  49.414 79.868  1.00 24.53 ? 141 LYS A CE    1 
ATOM   2787 N NZ    . LYS C 2 141 ? -4.257  49.108 80.164  1.00 27.55 ? 141 LYS A NZ    1 
ATOM   2788 N N     . GLN C 2 142 ? -9.950  51.646 76.328  1.00 28.29 ? 142 GLN A N     1 
ATOM   2789 C CA    . GLN C 2 142 ? -10.794 52.654 76.955  1.00 29.85 ? 142 GLN A CA    1 
ATOM   2790 C C     . GLN C 2 142 ? -12.281 52.475 76.704  1.00 29.29 ? 142 GLN A C     1 
ATOM   2791 O O     . GLN C 2 142 ? -13.092 52.748 77.579  1.00 30.08 ? 142 GLN A O     1 
ATOM   2792 C CB    . GLN C 2 142 ? -10.352 54.067 76.571  1.00 31.66 ? 142 GLN A CB    1 
ATOM   2793 C CG    . GLN C 2 142 ? -9.674  54.171 75.234  1.00 40.20 ? 142 GLN A CG    1 
ATOM   2794 C CD    . GLN C 2 142 ? -8.854  55.449 75.105  1.00 46.43 ? 142 GLN A CD    1 
ATOM   2795 O OE1   . GLN C 2 142 ? -8.204  55.887 76.065  1.00 48.22 ? 142 GLN A OE1   1 
ATOM   2796 N NE2   . GLN C 2 142 ? -8.864  56.045 73.910  1.00 49.00 ? 142 GLN A NE2   1 
ATOM   2797 N N     . GLU C 2 143 ? -12.655 52.015 75.522  1.00 28.81 ? 143 GLU A N     1 
ATOM   2798 C CA    . GLU C 2 143 ? -14.067 51.808 75.246  1.00 28.21 ? 143 GLU A CA    1 
ATOM   2799 C C     . GLU C 2 143 ? -14.585 50.675 76.122  1.00 27.77 ? 143 GLU A C     1 
ATOM   2800 O O     . GLU C 2 143 ? -15.587 50.822 76.812  1.00 28.00 ? 143 GLU A O     1 
ATOM   2801 C CB    . GLU C 2 143 ? -14.265 51.517 73.765  1.00 28.93 ? 143 GLU A CB    1 
ATOM   2802 C CG    . GLU C 2 143 ? -13.939 52.750 72.924  1.00 35.36 ? 143 GLU A CG    1 
ATOM   2803 C CD    . GLU C 2 143 ? -13.843 52.465 71.432  1.00 40.84 ? 143 GLU A CD    1 
ATOM   2804 O OE1   . GLU C 2 143 ? -13.132 51.508 71.025  1.00 40.10 ? 143 GLU A OE1   1 
ATOM   2805 O OE2   . GLU C 2 143 ? -14.480 53.218 70.662  1.00 45.97 ? 143 GLU A OE2   1 
ATOM   2806 N N     . LEU C 2 144 ? -13.881 49.553 76.137  1.00 26.05 ? 144 LEU A N     1 
ATOM   2807 C CA    . LEU C 2 144 ? -14.323 48.439 76.952  1.00 25.72 ? 144 LEU A CA    1 
ATOM   2808 C C     . LEU C 2 144 ? -14.461 48.846 78.398  1.00 27.95 ? 144 LEU A C     1 
ATOM   2809 O O     . LEU C 2 144 ? -15.393 48.426 79.074  1.00 29.75 ? 144 LEU A O     1 
ATOM   2810 C CB    . LEU C 2 144 ? -13.350 47.265 76.842  1.00 23.70 ? 144 LEU A CB    1 
ATOM   2811 C CG    . LEU C 2 144 ? -13.683 46.037 77.695  1.00 22.60 ? 144 LEU A CG    1 
ATOM   2812 C CD1   . LEU C 2 144 ? -15.063 45.506 77.360  1.00 21.41 ? 144 LEU A CD1   1 
ATOM   2813 C CD2   . LEU C 2 144 ? -12.638 44.977 77.463  1.00 21.90 ? 144 LEU A CD2   1 
ATOM   2814 N N     . LEU C 2 145 ? -13.545 49.676 78.885  1.00 31.43 ? 145 LEU A N     1 
ATOM   2815 C CA    . LEU C 2 145 ? -13.606 50.083 80.288  1.00 34.59 ? 145 LEU A CA    1 
ATOM   2816 C C     . LEU C 2 145 ? -14.641 51.170 80.577  1.00 36.95 ? 145 LEU A C     1 
ATOM   2817 O O     . LEU C 2 145 ? -14.896 51.500 81.731  1.00 37.81 ? 145 LEU A O     1 
ATOM   2818 C CB    . LEU C 2 145 ? -12.223 50.536 80.775  1.00 32.22 ? 145 LEU A CB    1 
ATOM   2819 C CG    . LEU C 2 145 ? -11.050 49.549 80.671  1.00 30.16 ? 145 LEU A CG    1 
ATOM   2820 C CD1   . LEU C 2 145 ? -9.821  50.240 81.200  1.00 27.65 ? 145 LEU A CD1   1 
ATOM   2821 C CD2   . LEU C 2 145 ? -11.311 48.262 81.447  1.00 27.00 ? 145 LEU A CD2   1 
ATOM   2822 N N     . GLN C 2 146 ? -15.257 51.708 79.534  1.00 39.22 ? 146 GLN A N     1 
ATOM   2823 C CA    . GLN C 2 146 ? -16.245 52.753 79.722  1.00 42.16 ? 146 GLN A CA    1 
ATOM   2824 C C     . GLN C 2 146 ? -17.626 52.434 79.145  1.00 45.30 ? 146 GLN A C     1 
ATOM   2825 O O     . GLN C 2 146 ? -18.428 53.340 78.918  1.00 46.16 ? 146 GLN A O     1 
ATOM   2826 C CB    . GLN C 2 146 ? -15.732 54.055 79.111  1.00 42.47 ? 146 GLN A CB    1 
ATOM   2827 C CG    . GLN C 2 146 ? -14.535 54.656 79.820  1.00 44.40 ? 146 GLN A CG    1 
ATOM   2828 C CD    . GLN C 2 146 ? -14.001 55.890 79.105  1.00 45.03 ? 146 GLN A CD    1 
ATOM   2829 O OE1   . GLN C 2 146 ? -13.471 55.797 77.996  1.00 46.92 ? 146 GLN A OE1   1 
ATOM   2830 N NE2   . GLN C 2 146 ? -14.142 57.052 79.738  1.00 44.01 ? 146 GLN A NE2   1 
ATOM   2831 N N     . LEU C 2 147 ? -17.908 51.161 78.891  1.00 48.78 ? 147 LEU A N     1 
ATOM   2832 C CA    . LEU C 2 147 ? -19.219 50.786 78.363  1.00 51.56 ? 147 LEU A CA    1 
ATOM   2833 C C     . LEU C 2 147 ? -20.232 51.118 79.445  1.00 55.14 ? 147 LEU A C     1 
ATOM   2834 O O     . LEU C 2 147 ? -20.030 50.746 80.600  1.00 55.51 ? 147 LEU A O     1 
ATOM   2835 C CB    . LEU C 2 147 ? -19.289 49.288 78.075  1.00 50.67 ? 147 LEU A CB    1 
ATOM   2836 C CG    . LEU C 2 147 ? -18.684 48.702 76.803  1.00 48.73 ? 147 LEU A CG    1 
ATOM   2837 C CD1   . LEU C 2 147 ? -18.720 47.183 76.901  1.00 49.23 ? 147 LEU A CD1   1 
ATOM   2838 C CD2   . LEU C 2 147 ? -19.453 49.176 75.594  1.00 47.33 ? 147 LEU A CD2   1 
ATOM   2839 N N     . THR C 2 148 ? -21.312 51.803 79.065  1.00 59.30 ? 148 THR A N     1 
ATOM   2840 C CA    . THR C 2 148 ? -22.364 52.215 80.000  1.00 63.68 ? 148 THR A CA    1 
ATOM   2841 C C     . THR C 2 148 ? -22.173 51.585 81.373  1.00 66.31 ? 148 THR A C     1 
ATOM   2842 O O     . THR C 2 148 ? -22.224 50.361 81.515  1.00 65.07 ? 148 THR A O     1 
ATOM   2843 C CB    . THR C 2 148 ? -23.773 51.841 79.494  1.00 64.30 ? 148 THR A CB    1 
ATOM   2844 O OG1   . THR C 2 148 ? -23.941 52.294 78.142  1.00 65.48 ? 148 THR A OG1   1 
ATOM   2845 C CG2   . THR C 2 148 ? -24.829 52.489 80.384  1.00 62.50 ? 148 THR A CG2   1 
ATOM   2846 N N     . PRO C 2 149 ? -21.957 52.423 82.403  1.00 69.68 ? 149 PRO A N     1 
ATOM   2847 C CA    . PRO C 2 149 ? -21.750 51.947 83.771  1.00 72.59 ? 149 PRO A CA    1 
ATOM   2848 C C     . PRO C 2 149 ? -22.638 50.767 84.128  1.00 75.91 ? 149 PRO A C     1 
ATOM   2849 O O     . PRO C 2 149 ? -23.794 50.685 83.695  1.00 76.74 ? 149 PRO A O     1 
ATOM   2850 C CB    . PRO C 2 149 ? -22.021 53.191 84.622  1.00 71.72 ? 149 PRO A CB    1 
ATOM   2851 C CG    . PRO C 2 149 ? -22.893 54.041 83.747  1.00 71.54 ? 149 PRO A CG    1 
ATOM   2852 C CD    . PRO C 2 149 ? -22.246 53.866 82.405  1.00 70.58 ? 149 PRO A CD    1 
ATOM   2853 N N     . VAL C 2 150 ? -22.071 49.845 84.901  1.00 78.70 ? 150 VAL A N     1 
ATOM   2854 C CA    . VAL C 2 150 ? -22.774 48.642 85.335  1.00 81.42 ? 150 VAL A CA    1 
ATOM   2855 C C     . VAL C 2 150 ? -24.035 49.024 86.118  1.00 82.28 ? 150 VAL A C     1 
ATOM   2856 O O     . VAL C 2 150 ? -25.099 48.416 85.952  1.00 81.77 ? 150 VAL A O     1 
ATOM   2857 C CB    . VAL C 2 150 ? -21.862 47.776 86.249  1.00 82.61 ? 150 VAL A CB    1 
ATOM   2858 C CG1   . VAL C 2 150 ? -22.405 46.351 86.328  1.00 84.32 ? 150 VAL A CG1   1 
ATOM   2859 C CG2   . VAL C 2 150 ? -20.420 47.797 85.735  1.00 81.33 ? 150 VAL A CG2   1 
ATOM   2860 N N     . GLU C 2 151 ? -23.892 50.046 86.962  1.00 82.87 ? 151 GLU A N     1 
ATOM   2861 C CA    . GLU C 2 151 ? -24.969 50.550 87.804  1.00 83.20 ? 151 GLU A CA    1 
ATOM   2862 C C     . GLU C 2 151 ? -26.280 50.738 87.036  1.00 83.68 ? 151 GLU A C     1 
ATOM   2863 O O     . GLU C 2 151 ? -27.311 50.188 87.425  1.00 84.60 ? 151 GLU A O     1 
ATOM   2864 C CB    . GLU C 2 151 ? -24.548 51.877 88.453  1.00 83.51 ? 151 GLU A CB    1 
ATOM   2865 C CG    . GLU C 2 151 ? -23.247 51.829 89.271  1.00 84.30 ? 151 GLU A CG    1 
ATOM   2866 C CD    . GLU C 2 151 ? -21.979 51.844 88.409  1.00 85.06 ? 151 GLU A CD    1 
ATOM   2867 O OE1   . GLU C 2 151 ? -21.843 52.739 87.547  1.00 84.53 ? 151 GLU A OE1   1 
ATOM   2868 O OE2   . GLU C 2 151 ? -21.107 50.969 88.603  1.00 85.29 ? 151 GLU A OE2   1 
ATOM   2869 N N     . VAL C 2 152 ? -26.236 51.514 85.954  1.00 83.26 ? 152 VAL A N     1 
ATOM   2870 C CA    . VAL C 2 152 ? -27.415 51.777 85.128  1.00 82.72 ? 152 VAL A CA    1 
ATOM   2871 C C     . VAL C 2 152 ? -27.510 50.790 83.971  1.00 83.05 ? 152 VAL A C     1 
ATOM   2872 O O     . VAL C 2 152 ? -28.592 50.554 83.434  1.00 83.59 ? 152 VAL A O     1 
ATOM   2873 C CB    . VAL C 2 152 ? -27.379 53.213 84.553  1.00 82.30 ? 152 VAL A CB    1 
ATOM   2874 C CG1   . VAL C 2 152 ? -28.449 53.389 83.490  1.00 81.56 ? 152 VAL A CG1   1 
ATOM   2875 C CG2   . VAL C 2 152 ? -27.579 54.217 85.675  1.00 82.34 ? 152 VAL A CG2   1 
ATOM   2876 C CA    . ASN D 2 8   ? -24.169 20.008 62.946  1.00 64.81 ? 8   ASN B CA    1 
ATOM   2877 C C     . ASN D 2 8   ? -24.628 20.505 61.575  1.00 65.06 ? 8   ASN B C     1 
ATOM   2878 O O     . ASN D 2 8   ? -23.814 20.907 60.744  1.00 64.72 ? 8   ASN B O     1 
ATOM   2879 N N     . ASP D 2 9   ? -25.937 20.477 61.347  1.00 64.64 ? 9   ASP B N     1 
ATOM   2880 C CA    . ASP D 2 9   ? -26.511 20.923 60.080  1.00 63.74 ? 9   ASP B CA    1 
ATOM   2881 C C     . ASP D 2 9   ? -26.698 22.435 60.052  1.00 61.65 ? 9   ASP B C     1 
ATOM   2882 O O     . ASP D 2 9   ? -26.241 23.110 59.126  1.00 60.85 ? 9   ASP B O     1 
ATOM   2883 C CB    . ASP D 2 9   ? -27.866 20.236 59.844  1.00 66.86 ? 9   ASP B CB    1 
ATOM   2884 C CG    . ASP D 2 9   ? -28.580 20.744 58.589  1.00 70.24 ? 9   ASP B CG    1 
ATOM   2885 O OD1   . ASP D 2 9   ? -28.003 20.676 57.475  1.00 71.82 ? 9   ASP B OD1   1 
ATOM   2886 O OD2   . ASP D 2 9   ? -29.732 21.210 58.719  1.00 72.12 ? 9   ASP B OD2   1 
ATOM   2887 N N     . THR D 2 10  ? -27.375 22.959 61.071  1.00 58.69 ? 10  THR B N     1 
ATOM   2888 C CA    . THR D 2 10  ? -27.646 24.388 61.164  1.00 56.11 ? 10  THR B CA    1 
ATOM   2889 C C     . THR D 2 10  ? -26.371 25.196 60.995  1.00 54.60 ? 10  THR B C     1 
ATOM   2890 O O     . THR D 2 10  ? -26.414 26.349 60.575  1.00 53.88 ? 10  THR B O     1 
ATOM   2891 C CB    . THR D 2 10  ? -28.259 24.754 62.517  1.00 56.29 ? 10  THR B CB    1 
ATOM   2892 O OG1   . THR D 2 10  ? -28.997 23.637 63.023  1.00 57.04 ? 10  THR B OG1   1 
ATOM   2893 C CG2   . THR D 2 10  ? -29.197 25.940 62.364  1.00 54.07 ? 10  THR B CG2   1 
ATOM   2894 N N     . ARG D 2 11  ? -25.239 24.588 61.332  1.00 52.54 ? 11  ARG B N     1 
ATOM   2895 C CA    . ARG D 2 11  ? -23.951 25.256 61.209  1.00 50.84 ? 11  ARG B CA    1 
ATOM   2896 C C     . ARG D 2 11  ? -23.588 25.338 59.749  1.00 51.90 ? 11  ARG B C     1 
ATOM   2897 O O     . ARG D 2 11  ? -22.993 26.313 59.294  1.00 52.16 ? 11  ARG B O     1 
ATOM   2898 C CB    . ARG D 2 11  ? -22.868 24.477 61.953  1.00 49.27 ? 11  ARG B CB    1 
ATOM   2899 C CG    . ARG D 2 11  ? -21.451 25.004 61.751  1.00 44.75 ? 11  ARG B CG    1 
ATOM   2900 C CD    . ARG D 2 11  ? -20.416 24.078 62.398  1.00 41.48 ? 11  ARG B CD    1 
ATOM   2901 N NE    . ARG D 2 11  ? -19.042 24.480 62.094  1.00 40.30 ? 11  ARG B NE    1 
ATOM   2902 C CZ    . ARG D 2 11  ? -18.426 25.537 62.625  1.00 38.97 ? 11  ARG B CZ    1 
ATOM   2903 N NH1   . ARG D 2 11  ? -19.049 26.311 63.501  1.00 36.08 ? 11  ARG B NH1   1 
ATOM   2904 N NH2   . ARG D 2 11  ? -17.188 25.832 62.265  1.00 36.73 ? 11  ARG B NH2   1 
ATOM   2905 N N     . GLU D 2 12  ? -23.968 24.303 59.011  1.00 53.75 ? 12  GLU B N     1 
ATOM   2906 C CA    . GLU D 2 12  ? -23.669 24.238 57.595  1.00 53.64 ? 12  GLU B CA    1 
ATOM   2907 C C     . GLU D 2 12  ? -24.569 25.154 56.781  1.00 52.06 ? 12  GLU B C     1 
ATOM   2908 O O     . GLU D 2 12  ? -24.159 25.656 55.730  1.00 51.84 ? 12  GLU B O     1 
ATOM   2909 C CB    . GLU D 2 12  ? -23.792 22.803 57.101  1.00 56.63 ? 12  GLU B CB    1 
ATOM   2910 C CG    . GLU D 2 12  ? -22.963 22.551 55.873  1.00 63.21 ? 12  GLU B CG    1 
ATOM   2911 C CD    . GLU D 2 12  ? -21.532 23.016 56.063  1.00 67.10 ? 12  GLU B CD    1 
ATOM   2912 O OE1   . GLU D 2 12  ? -20.883 22.556 57.033  1.00 68.69 ? 12  GLU B OE1   1 
ATOM   2913 O OE2   . GLU D 2 12  ? -21.060 23.842 55.248  1.00 68.61 ? 12  GLU B OE2   1 
ATOM   2914 N N     . GLN D 2 13  ? -25.789 25.378 57.264  1.00 49.36 ? 13  GLN B N     1 
ATOM   2915 C CA    . GLN D 2 13  ? -26.712 26.260 56.558  1.00 47.66 ? 13  GLN B CA    1 
ATOM   2916 C C     . GLN D 2 13  ? -26.251 27.687 56.739  1.00 45.24 ? 13  GLN B C     1 
ATOM   2917 O O     . GLN D 2 13  ? -26.462 28.528 55.870  1.00 44.70 ? 13  GLN B O     1 
ATOM   2918 C CB    . GLN D 2 13  ? -28.129 26.149 57.109  1.00 49.29 ? 13  GLN B CB    1 
ATOM   2919 C CG    . GLN D 2 13  ? -28.830 24.838 56.852  1.00 52.56 ? 13  GLN B CG    1 
ATOM   2920 C CD    . GLN D 2 13  ? -30.271 24.873 57.341  1.00 57.09 ? 13  GLN B CD    1 
ATOM   2921 O OE1   . GLN D 2 13  ? -31.112 25.626 56.818  1.00 58.11 ? 13  GLN B OE1   1 
ATOM   2922 N NE2   . GLN D 2 13  ? -30.564 24.069 58.361  1.00 58.44 ? 13  GLN B NE2   1 
ATOM   2923 N N     . ALA D 2 14  ? -25.636 27.952 57.892  1.00 43.20 ? 14  ALA B N     1 
ATOM   2924 C CA    . ALA D 2 14  ? -25.133 29.282 58.219  1.00 39.13 ? 14  ALA B CA    1 
ATOM   2925 C C     . ALA D 2 14  ? -23.935 29.558 57.346  1.00 36.75 ? 14  ALA B C     1 
ATOM   2926 O O     . ALA D 2 14  ? -23.793 30.651 56.808  1.00 36.25 ? 14  ALA B O     1 
ATOM   2927 C CB    . ALA D 2 14  ? -24.739 29.348 59.664  1.00 41.05 ? 14  ALA B CB    1 
ATOM   2928 N N     . ASN D 2 15  ? -23.064 28.567 57.203  1.00 34.02 ? 15  ASN B N     1 
ATOM   2929 C CA    . ASN D 2 15  ? -21.911 28.760 56.350  1.00 31.84 ? 15  ASN B CA    1 
ATOM   2930 C C     . ASN D 2 15  ? -22.432 29.079 54.958  1.00 31.54 ? 15  ASN B C     1 
ATOM   2931 O O     . ASN D 2 15  ? -22.058 30.089 54.375  1.00 33.30 ? 15  ASN B O     1 
ATOM   2932 C CB    . ASN D 2 15  ? -21.036 27.515 56.313  1.00 30.05 ? 15  ASN B CB    1 
ATOM   2933 C CG    . ASN D 2 15  ? -19.827 27.689 55.415  1.00 31.80 ? 15  ASN B CG    1 
ATOM   2934 O OD1   . ASN D 2 15  ? -19.968 27.885 54.210  1.00 32.88 ? 15  ASN B OD1   1 
ATOM   2935 N ND2   . ASN D 2 15  ? -18.625 27.627 55.998  1.00 32.41 ? 15  ASN B ND2   1 
ATOM   2936 N N     . GLY D 2 16  ? -23.320 28.233 54.440  1.00 30.77 ? 16  GLY B N     1 
ATOM   2937 C CA    . GLY D 2 16  ? -23.877 28.452 53.109  1.00 27.94 ? 16  GLY B CA    1 
ATOM   2938 C C     . GLY D 2 16  ? -24.666 29.738 52.907  1.00 27.29 ? 16  GLY B C     1 
ATOM   2939 O O     . GLY D 2 16  ? -24.754 30.243 51.784  1.00 26.71 ? 16  GLY B O     1 
ATOM   2940 N N     . GLU D 2 17  ? -25.216 30.285 53.990  1.00 25.58 ? 17  GLU B N     1 
ATOM   2941 C CA    . GLU D 2 17  ? -26.022 31.507 53.924  1.00 26.07 ? 17  GLU B CA    1 
ATOM   2942 C C     . GLU D 2 17  ? -25.276 32.616 53.235  1.00 26.77 ? 17  GLU B C     1 
ATOM   2943 O O     . GLU D 2 17  ? -25.869 33.448 52.561  1.00 28.31 ? 17  GLU B O     1 
ATOM   2944 C CB    . GLU D 2 17  ? -26.421 31.954 55.336  1.00 26.85 ? 17  GLU B CB    1 
ATOM   2945 C CG    . GLU D 2 17  ? -27.290 33.197 55.429  1.00 23.34 ? 17  GLU B CG    1 
ATOM   2946 C CD    . GLU D 2 17  ? -26.506 34.486 55.307  1.00 25.74 ? 17  GLU B CD    1 
ATOM   2947 O OE1   . GLU D 2 17  ? -25.299 34.507 55.616  1.00 24.50 ? 17  GLU B OE1   1 
ATOM   2948 O OE2   . GLU D 2 17  ? -27.108 35.499 54.913  1.00 29.02 ? 17  GLU B OE2   1 
ATOM   2949 N N     . ARG D 2 18  ? -23.964 32.630 53.422  1.00 27.37 ? 18  ARG B N     1 
ATOM   2950 C CA    . ARG D 2 18  ? -23.126 33.634 52.809  1.00 27.50 ? 18  ARG B CA    1 
ATOM   2951 C C     . ARG D 2 18  ? -23.383 33.629 51.312  1.00 30.44 ? 18  ARG B C     1 
ATOM   2952 O O     . ARG D 2 18  ? -23.420 34.688 50.672  1.00 29.18 ? 18  ARG B O     1 
ATOM   2953 C CB    . ARG D 2 18  ? -21.659 33.304 53.091  1.00 26.87 ? 18  ARG B CB    1 
ATOM   2954 C CG    . ARG D 2 18  ? -20.643 34.244 52.444  1.00 25.49 ? 18  ARG B CG    1 
ATOM   2955 C CD    . ARG D 2 18  ? -19.235 33.929 52.928  1.00 23.40 ? 18  ARG B CD    1 
ATOM   2956 N NE    . ARG D 2 18  ? -18.251 34.825 52.340  1.00 21.47 ? 18  ARG B NE    1 
ATOM   2957 C CZ    . ARG D 2 18  ? -16.940 34.723 52.516  1.00 22.87 ? 18  ARG B CZ    1 
ATOM   2958 N NH1   . ARG D 2 18  ? -16.441 33.753 53.273  1.00 22.74 ? 18  ARG B NH1   1 
ATOM   2959 N NH2   . ARG D 2 18  ? -16.124 35.595 51.930  1.00 24.24 ? 18  ARG B NH2   1 
ATOM   2960 N N     . TRP D 2 19  ? -23.605 32.429 50.770  1.00 33.74 ? 19  TRP B N     1 
ATOM   2961 C CA    . TRP D 2 19  ? -23.820 32.252 49.335  1.00 36.96 ? 19  TRP B CA    1 
ATOM   2962 C C     . TRP D 2 19  ? -25.259 32.092 48.839  1.00 38.59 ? 19  TRP B C     1 
ATOM   2963 O O     . TRP D 2 19  ? -25.462 31.760 47.674  1.00 35.97 ? 19  TRP B O     1 
ATOM   2964 C CB    . TRP D 2 19  ? -22.988 31.070 48.846  1.00 35.02 ? 19  TRP B CB    1 
ATOM   2965 C CG    . TRP D 2 19  ? -21.658 30.956 49.530  1.00 33.79 ? 19  TRP B CG    1 
ATOM   2966 C CD1   . TRP D 2 19  ? -21.304 30.047 50.478  1.00 35.03 ? 19  TRP B CD1   1 
ATOM   2967 C CD2   . TRP D 2 19  ? -20.499 31.769 49.304  1.00 32.59 ? 19  TRP B CD2   1 
ATOM   2968 N NE1   . TRP D 2 19  ? -19.994 30.236 50.857  1.00 33.31 ? 19  TRP B NE1   1 
ATOM   2969 C CE2   . TRP D 2 19  ? -19.479 31.287 50.151  1.00 30.50 ? 19  TRP B CE2   1 
ATOM   2970 C CE3   . TRP D 2 19  ? -20.223 32.854 48.465  1.00 31.22 ? 19  TRP B CE3   1 
ATOM   2971 C CZ2   . TRP D 2 19  ? -18.206 31.849 50.183  1.00 29.94 ? 19  TRP B CZ2   1 
ATOM   2972 C CZ3   . TRP D 2 19  ? -18.953 33.413 48.495  1.00 30.78 ? 19  TRP B CZ3   1 
ATOM   2973 C CH2   . TRP D 2 19  ? -17.961 32.909 49.350  1.00 30.56 ? 19  TRP B CH2   1 
ATOM   2974 N N     . ASP D 2 20  ? -26.241 32.322 49.712  1.00 43.07 ? 20  ASP B N     1 
ATOM   2975 C CA    . ASP D 2 20  ? -27.652 32.218 49.334  1.00 47.27 ? 20  ASP B CA    1 
ATOM   2976 C C     . ASP D 2 20  ? -27.980 33.328 48.370  1.00 49.54 ? 20  ASP B C     1 
ATOM   2977 O O     . ASP D 2 20  ? -29.063 33.354 47.803  1.00 49.39 ? 20  ASP B O     1 
ATOM   2978 C CB    . ASP D 2 20  ? -28.579 32.369 50.539  1.00 50.41 ? 20  ASP B CB    1 
ATOM   2979 C CG    . ASP D 2 20  ? -28.594 31.145 51.420  1.00 55.19 ? 20  ASP B CG    1 
ATOM   2980 O OD1   . ASP D 2 20  ? -28.113 30.088 50.953  1.00 58.14 ? 20  ASP B OD1   1 
ATOM   2981 O OD2   . ASP D 2 20  ? -29.098 31.234 52.568  1.00 55.86 ? 20  ASP B OD2   1 
ATOM   2982 N N     . GLY D 2 21  ? -27.046 34.260 48.223  1.00 52.48 ? 21  GLY B N     1 
ATOM   2983 C CA    . GLY D 2 21  ? -27.231 35.376 47.317  1.00 57.01 ? 21  GLY B CA    1 
ATOM   2984 C C     . GLY D 2 21  ? -28.565 36.082 47.435  1.00 60.07 ? 21  GLY B C     1 
ATOM   2985 O O     . GLY D 2 21  ? -28.646 37.170 48.005  1.00 60.27 ? 21  GLY B O     1 
ATOM   2986 N N     . GLY D 2 22  ? -29.607 35.463 46.885  1.00 63.10 ? 22  GLY B N     1 
ATOM   2987 C CA    . GLY D 2 22  ? -30.933 36.050 46.929  1.00 67.98 ? 22  GLY B CA    1 
ATOM   2988 C C     . GLY D 2 22  ? -31.908 35.338 47.850  1.00 71.20 ? 22  GLY B C     1 
ATOM   2989 O O     . GLY D 2 22  ? -32.745 34.558 47.390  1.00 71.76 ? 22  GLY B O     1 
ATOM   2990 N N     . SER D 2 23  ? -31.808 35.609 49.151  1.00 73.42 ? 23  SER B N     1 
ATOM   2991 C CA    . SER D 2 23  ? -32.694 34.994 50.133  1.00 76.05 ? 23  SER B CA    1 
ATOM   2992 C C     . SER D 2 23  ? -32.545 33.476 50.169  1.00 77.22 ? 23  SER B C     1 
ATOM   2993 O O     . SER D 2 23  ? -32.390 32.826 49.131  1.00 77.61 ? 23  SER B O     1 
ATOM   2994 C CB    . SER D 2 23  ? -34.146 35.352 49.824  1.00 77.56 ? 23  SER B CB    1 
ATOM   2995 O OG    . SER D 2 23  ? -34.309 36.757 49.758  1.00 80.14 ? 23  SER B OG    1 
ATOM   2996 N N     . GLY D 2 24  ? -32.600 32.916 51.373  1.00 78.04 ? 24  GLY B N     1 
ATOM   2997 C CA    . GLY D 2 24  ? -32.463 31.478 51.527  1.00 78.27 ? 24  GLY B CA    1 
ATOM   2998 C C     . GLY D 2 24  ? -33.358 30.912 52.610  1.00 77.76 ? 24  GLY B C     1 
ATOM   2999 O O     . GLY D 2 24  ? -33.350 29.705 52.873  1.00 77.61 ? 24  GLY B O     1 
ATOM   3000 N N     . GLY D 2 25  ? -34.133 31.794 53.236  1.00 77.01 ? 25  GLY B N     1 
ATOM   3001 C CA    . GLY D 2 25  ? -35.037 31.376 54.293  1.00 74.69 ? 25  GLY B CA    1 
ATOM   3002 C C     . GLY D 2 25  ? -34.371 31.319 55.658  1.00 72.53 ? 25  GLY B C     1 
ATOM   3003 O O     . GLY D 2 25  ? -35.057 31.273 56.689  1.00 71.59 ? 25  GLY B O     1 
ATOM   3004 N N     . ILE D 2 26  ? -33.038 31.324 55.678  1.00 69.22 ? 26  ILE B N     1 
ATOM   3005 C CA    . ILE D 2 26  ? -32.326 31.258 56.948  1.00 66.31 ? 26  ILE B CA    1 
ATOM   3006 C C     . ILE D 2 26  ? -32.085 32.619 57.594  1.00 63.79 ? 26  ILE B C     1 
ATOM   3007 O O     . ILE D 2 26  ? -31.692 33.586 56.939  1.00 63.70 ? 26  ILE B O     1 
ATOM   3008 C CB    . ILE D 2 26  ? -30.986 30.527 56.802  1.00 66.04 ? 26  ILE B CB    1 
ATOM   3009 C CG1   . ILE D 2 26  ? -30.259 30.513 58.156  1.00 64.19 ? 26  ILE B CG1   1 
ATOM   3010 C CG2   . ILE D 2 26  ? -30.182 31.159 55.680  1.00 66.37 ? 26  ILE B CG2   1 
ATOM   3011 C CD1   . ILE D 2 26  ? -29.059 29.593 58.205  1.00 62.76 ? 26  ILE B CD1   1 
ATOM   3012 N N     . THR D 2 27  ? -32.340 32.677 58.893  1.00 60.39 ? 27  THR B N     1 
ATOM   3013 C CA    . THR D 2 27  ? -32.173 33.902 59.649  1.00 56.98 ? 27  THR B CA    1 
ATOM   3014 C C     . THR D 2 27  ? -30.691 34.213 59.707  1.00 53.08 ? 27  THR B C     1 
ATOM   3015 O O     . THR D 2 27  ? -29.899 33.397 60.162  1.00 52.59 ? 27  THR B O     1 
ATOM   3016 C CB    . THR D 2 27  ? -32.700 33.735 61.077  1.00 58.44 ? 27  THR B CB    1 
ATOM   3017 O OG1   . THR D 2 27  ? -33.791 32.803 61.073  1.00 60.01 ? 27  THR B OG1   1 
ATOM   3018 C CG2   . THR D 2 27  ? -33.186 35.074 61.620  1.00 59.21 ? 27  THR B CG2   1 
ATOM   3019 N N     . SER D 2 28  ? -30.318 35.393 59.239  1.00 48.71 ? 28  SER B N     1 
ATOM   3020 C CA    . SER D 2 28  ? -28.923 35.793 59.244  1.00 45.11 ? 28  SER B CA    1 
ATOM   3021 C C     . SER D 2 28  ? -28.732 37.082 60.026  1.00 41.89 ? 28  SER B C     1 
ATOM   3022 O O     . SER D 2 28  ? -29.604 37.942 60.039  1.00 40.54 ? 28  SER B O     1 
ATOM   3023 C CB    . SER D 2 28  ? -28.433 35.983 57.809  1.00 45.58 ? 28  SER B CB    1 
ATOM   3024 O OG    . SER D 2 28  ? -27.184 36.640 57.795  1.00 46.79 ? 28  SER B OG    1 
ATOM   3025 N N     . PRO D 2 29  ? -27.582 37.230 60.699  1.00 40.02 ? 29  PRO B N     1 
ATOM   3026 C CA    . PRO D 2 29  ? -27.347 38.456 61.465  1.00 37.35 ? 29  PRO B CA    1 
ATOM   3027 C C     . PRO D 2 29  ? -27.035 39.623 60.543  1.00 37.14 ? 29  PRO B C     1 
ATOM   3028 O O     . PRO D 2 29  ? -27.141 40.788 60.943  1.00 36.31 ? 29  PRO B O     1 
ATOM   3029 C CB    . PRO D 2 29  ? -26.175 38.078 62.359  1.00 36.59 ? 29  PRO B CB    1 
ATOM   3030 C CG    . PRO D 2 29  ? -25.422 37.095 61.528  1.00 37.45 ? 29  PRO B CG    1 
ATOM   3031 C CD    . PRO D 2 29  ? -26.511 36.246 60.933  1.00 38.09 ? 29  PRO B CD    1 
ATOM   3032 N N     . PHE D 2 30  ? -26.688 39.296 59.298  1.00 36.41 ? 30  PHE B N     1 
ATOM   3033 C CA    . PHE D 2 30  ? -26.327 40.297 58.293  1.00 37.52 ? 30  PHE B CA    1 
ATOM   3034 C C     . PHE D 2 30  ? -27.474 40.817 57.437  1.00 38.67 ? 30  PHE B C     1 
ATOM   3035 O O     . PHE D 2 30  ? -28.403 40.083 57.109  1.00 40.35 ? 30  PHE B O     1 
ATOM   3036 C CB    . PHE D 2 30  ? -25.212 39.751 57.387  1.00 34.23 ? 30  PHE B CB    1 
ATOM   3037 C CG    . PHE D 2 30  ? -23.893 39.608 58.083  1.00 31.06 ? 30  PHE B CG    1 
ATOM   3038 C CD1   . PHE D 2 30  ? -23.381 38.356 58.378  1.00 29.00 ? 30  PHE B CD1   1 
ATOM   3039 C CD2   . PHE D 2 30  ? -23.168 40.740 58.455  1.00 31.31 ? 30  PHE B CD2   1 
ATOM   3040 C CE1   . PHE D 2 30  ? -22.164 38.224 59.032  1.00 30.15 ? 30  PHE B CE1   1 
ATOM   3041 C CE2   . PHE D 2 30  ? -21.950 40.626 59.108  1.00 29.67 ? 30  PHE B CE2   1 
ATOM   3042 C CZ    . PHE D 2 30  ? -21.444 39.368 59.398  1.00 29.89 ? 30  PHE B CZ    1 
ATOM   3043 N N     . LYS D 2 31  ? -27.378 42.086 57.054  1.00 38.28 ? 31  LYS B N     1 
ATOM   3044 C CA    . LYS D 2 31  ? -28.411 42.734 56.270  1.00 37.91 ? 31  LYS B CA    1 
ATOM   3045 C C     . LYS D 2 31  ? -27.945 43.118 54.880  1.00 38.37 ? 31  LYS B C     1 
ATOM   3046 O O     . LYS D 2 31  ? -28.708 43.674 54.088  1.00 38.66 ? 31  LYS B O     1 
ATOM   3047 C CB    . LYS D 2 31  ? -28.899 43.983 56.998  1.00 38.78 ? 31  LYS B CB    1 
ATOM   3048 C CG    . LYS D 2 31  ? -29.265 43.753 58.451  1.00 41.01 ? 31  LYS B CG    1 
ATOM   3049 C CD    . LYS D 2 31  ? -30.319 44.750 58.903  1.00 46.29 ? 31  LYS B CD    1 
ATOM   3050 C CE    . LYS D 2 31  ? -29.935 46.188 58.529  1.00 50.51 ? 31  LYS B CE    1 
ATOM   3051 N NZ    . LYS D 2 31  ? -30.993 47.189 58.914  1.00 51.70 ? 31  LYS B NZ    1 
ATOM   3052 N N     . LEU D 2 32  ? -26.679 42.870 54.584  1.00 37.47 ? 32  LEU B N     1 
ATOM   3053 C CA    . LEU D 2 32  ? -26.184 43.177 53.254  1.00 36.39 ? 32  LEU B CA    1 
ATOM   3054 C C     . LEU D 2 32  ? -25.633 41.889 52.666  1.00 38.36 ? 32  LEU B C     1 
ATOM   3055 O O     . LEU D 2 32  ? -25.018 41.078 53.375  1.00 38.44 ? 32  LEU B O     1 
ATOM   3056 C CB    . LEU D 2 32  ? -25.087 44.252 53.292  1.00 35.35 ? 32  LEU B CB    1 
ATOM   3057 C CG    . LEU D 2 32  ? -25.505 45.688 53.627  1.00 32.15 ? 32  LEU B CG    1 
ATOM   3058 C CD1   . LEU D 2 32  ? -24.335 46.617 53.537  1.00 31.04 ? 32  LEU B CD1   1 
ATOM   3059 C CD2   . LEU D 2 32  ? -26.546 46.138 52.661  1.00 33.00 ? 32  LEU B CD2   1 
ATOM   3060 N N     . PRO D 2 33  ? -25.890 41.657 51.370  1.00 38.45 ? 33  PRO B N     1 
ATOM   3061 C CA    . PRO D 2 33  ? -25.435 40.476 50.635  1.00 38.19 ? 33  PRO B CA    1 
ATOM   3062 C C     . PRO D 2 33  ? -23.902 40.451 50.559  1.00 37.55 ? 33  PRO B C     1 
ATOM   3063 O O     . PRO D 2 33  ? -23.262 41.504 50.442  1.00 38.89 ? 33  PRO B O     1 
ATOM   3064 C CB    . PRO D 2 33  ? -26.046 40.684 49.252  1.00 39.06 ? 33  PRO B CB    1 
ATOM   3065 C CG    . PRO D 2 33  ? -27.277 41.444 49.541  1.00 38.61 ? 33  PRO B CG    1 
ATOM   3066 C CD    . PRO D 2 33  ? -26.823 42.444 50.548  1.00 38.75 ? 33  PRO B CD    1 
ATOM   3067 N N     . ASP D 2 34  ? -23.328 39.252 50.611  1.00 34.51 ? 34  ASP B N     1 
ATOM   3068 C CA    . ASP D 2 34  ? -21.887 39.076 50.522  1.00 31.98 ? 34  ASP B CA    1 
ATOM   3069 C C     . ASP D 2 34  ? -21.432 39.745 49.243  1.00 32.07 ? 34  ASP B C     1 
ATOM   3070 O O     . ASP D 2 34  ? -22.242 39.991 48.350  1.00 33.03 ? 34  ASP B O     1 
ATOM   3071 C CB    . ASP D 2 34  ? -21.558 37.582 50.499  1.00 32.52 ? 34  ASP B CB    1 
ATOM   3072 C CG    . ASP D 2 34  ? -20.094 37.305 50.262  1.00 33.20 ? 34  ASP B CG    1 
ATOM   3073 O OD1   . ASP D 2 34  ? -19.664 37.280 49.099  1.00 36.43 ? 34  ASP B OD1   1 
ATOM   3074 O OD2   . ASP D 2 34  ? -19.363 37.113 51.239  1.00 35.50 ? 34  ASP B OD2   1 
ATOM   3075 N N     . GLU D 2 35  ? -20.146 40.056 49.142  1.00 31.83 ? 35  GLU B N     1 
ATOM   3076 C CA    . GLU D 2 35  ? -19.638 40.700 47.936  1.00 30.37 ? 35  GLU B CA    1 
ATOM   3077 C C     . GLU D 2 35  ? -18.239 40.210 47.598  1.00 29.91 ? 35  GLU B C     1 
ATOM   3078 O O     . GLU D 2 35  ? -17.454 40.911 46.968  1.00 31.50 ? 35  GLU B O     1 
ATOM   3079 C CB    . GLU D 2 35  ? -19.672 42.219 48.124  1.00 30.35 ? 35  GLU B CB    1 
ATOM   3080 C CG    . GLU D 2 35  ? -21.072 42.714 48.529  1.00 32.24 ? 35  GLU B CG    1 
ATOM   3081 C CD    . GLU D 2 35  ? -21.149 44.199 48.818  1.00 36.19 ? 35  GLU B CD    1 
ATOM   3082 O OE1   . GLU D 2 35  ? -22.263 44.685 49.108  1.00 38.93 ? 35  GLU B OE1   1 
ATOM   3083 O OE2   . GLU D 2 35  ? -20.110 44.890 48.767  1.00 38.74 ? 35  GLU B OE2   1 
ATOM   3084 N N     . SER D 2 36  ? -17.948 38.987 48.020  1.00 28.26 ? 36  SER B N     1 
ATOM   3085 C CA    . SER D 2 36  ? -16.657 38.353 47.783  1.00 28.77 ? 36  SER B CA    1 
ATOM   3086 C C     . SER D 2 36  ? -16.362 38.328 46.295  1.00 28.72 ? 36  SER B C     1 
ATOM   3087 O O     . SER D 2 36  ? -17.238 38.037 45.497  1.00 31.03 ? 36  SER B O     1 
ATOM   3088 C CB    . SER D 2 36  ? -16.679 36.916 48.321  1.00 28.58 ? 36  SER B CB    1 
ATOM   3089 O OG    . SER D 2 36  ? -17.020 36.892 49.707  1.00 30.60 ? 36  SER B OG    1 
ATOM   3090 N N     . PRO D 2 37  ? -15.118 38.625 45.897  1.00 28.94 ? 37  PRO B N     1 
ATOM   3091 C CA    . PRO D 2 37  ? -14.795 38.613 44.472  1.00 29.01 ? 37  PRO B CA    1 
ATOM   3092 C C     . PRO D 2 37  ? -14.468 37.210 44.010  1.00 31.08 ? 37  PRO B C     1 
ATOM   3093 O O     . PRO D 2 37  ? -13.973 36.395 44.787  1.00 33.15 ? 37  PRO B O     1 
ATOM   3094 C CB    . PRO D 2 37  ? -13.571 39.495 44.405  1.00 29.03 ? 37  PRO B CB    1 
ATOM   3095 C CG    . PRO D 2 37  ? -12.838 39.079 45.648  1.00 26.75 ? 37  PRO B CG    1 
ATOM   3096 C CD    . PRO D 2 37  ? -13.950 39.061 46.684  1.00 28.83 ? 37  PRO B CD    1 
ATOM   3097 N N     . SER D 2 38  ? -14.755 36.920 42.751  1.00 30.30 ? 38  SER B N     1 
ATOM   3098 C CA    . SER D 2 38  ? -14.420 35.619 42.208  1.00 30.15 ? 38  SER B CA    1 
ATOM   3099 C C     . SER D 2 38  ? -12.886 35.536 42.269  1.00 31.14 ? 38  SER B C     1 
ATOM   3100 O O     . SER D 2 38  ? -12.192 36.563 42.345  1.00 28.01 ? 38  SER B O     1 
ATOM   3101 C CB    . SER D 2 38  ? -14.874 35.526 40.747  1.00 30.83 ? 38  SER B CB    1 
ATOM   3102 O OG    . SER D 2 38  ? -14.265 36.542 39.947  1.00 30.96 ? 38  SER B OG    1 
ATOM   3103 N N     . TRP D 2 39  ? -12.351 34.325 42.233  1.00 30.97 ? 39  TRP B N     1 
ATOM   3104 C CA    . TRP D 2 39  ? -10.911 34.178 42.258  1.00 33.92 ? 39  TRP B CA    1 
ATOM   3105 C C     . TRP D 2 39  ? -10.316 34.958 41.086  1.00 33.88 ? 39  TRP B C     1 
ATOM   3106 O O     . TRP D 2 39  ? -9.201  35.475 41.176  1.00 33.08 ? 39  TRP B O     1 
ATOM   3107 C CB    . TRP D 2 39  ? -10.535 32.697 42.172  1.00 36.50 ? 39  TRP B CB    1 
ATOM   3108 C CG    . TRP D 2 39  ? -9.075  32.439 42.129  1.00 40.93 ? 39  TRP B CG    1 
ATOM   3109 C CD1   . TRP D 2 39  ? -8.099  33.130 42.786  1.00 44.58 ? 39  TRP B CD1   1 
ATOM   3110 C CD2   . TRP D 2 39  ? -8.418  31.358 41.460  1.00 44.30 ? 39  TRP B CD2   1 
ATOM   3111 N NE1   . TRP D 2 39  ? -6.869  32.541 42.571  1.00 45.64 ? 39  TRP B NE1   1 
ATOM   3112 C CE2   . TRP D 2 39  ? -7.039  31.452 41.760  1.00 45.32 ? 39  TRP B CE2   1 
ATOM   3113 C CE3   . TRP D 2 39  ? -8.859  30.314 40.640  1.00 45.19 ? 39  TRP B CE3   1 
ATOM   3114 C CZ2   . TRP D 2 39  ? -6.102  30.543 41.270  1.00 46.07 ? 39  TRP B CZ2   1 
ATOM   3115 C CZ3   . TRP D 2 39  ? -7.922  29.409 40.152  1.00 46.99 ? 39  TRP B CZ3   1 
ATOM   3116 C CH2   . TRP D 2 39  ? -6.560  29.531 40.470  1.00 45.41 ? 39  TRP B CH2   1 
ATOM   3117 N N     . THR D 2 40  ? -11.079 35.041 39.995  1.00 33.26 ? 40  THR B N     1 
ATOM   3118 C CA    . THR D 2 40  ? -10.654 35.742 38.793  1.00 32.63 ? 40  THR B CA    1 
ATOM   3119 C C     . THR D 2 40  ? -10.606 37.235 39.011  1.00 34.30 ? 40  THR B C     1 
ATOM   3120 O O     . THR D 2 40  ? -9.665  37.891 38.587  1.00 34.58 ? 40  THR B O     1 
ATOM   3121 C CB    . THR D 2 40  ? -11.607 35.491 37.624  1.00 32.12 ? 40  THR B CB    1 
ATOM   3122 O OG1   . THR D 2 40  ? -11.701 34.086 37.370  1.00 37.97 ? 40  THR B OG1   1 
ATOM   3123 C CG2   . THR D 2 40  ? -11.112 36.180 36.384  1.00 25.95 ? 40  THR B CG2   1 
ATOM   3124 N N     . GLU D 2 41  ? -11.638 37.780 39.646  1.00 35.70 ? 41  GLU B N     1 
ATOM   3125 C CA    . GLU D 2 41  ? -11.672 39.209 39.890  1.00 37.48 ? 41  GLU B CA    1 
ATOM   3126 C C     . GLU D 2 41  ? -10.589 39.576 40.885  1.00 39.13 ? 41  GLU B C     1 
ATOM   3127 O O     . GLU D 2 41  ? -10.036 40.671 40.829  1.00 39.79 ? 41  GLU B O     1 
ATOM   3128 C CB    . GLU D 2 41  ? -13.039 39.652 40.433  1.00 38.41 ? 41  GLU B CB    1 
ATOM   3129 C CG    . GLU D 2 41  ? -13.076 41.134 40.820  1.00 39.87 ? 41  GLU B CG    1 
ATOM   3130 C CD    . GLU D 2 41  ? -14.400 41.583 41.413  1.00 42.07 ? 41  GLU B CD    1 
ATOM   3131 O OE1   . GLU D 2 41  ? -15.111 40.749 42.009  1.00 43.77 ? 41  GLU B OE1   1 
ATOM   3132 O OE2   . GLU D 2 41  ? -14.724 42.783 41.304  1.00 41.79 ? 41  GLU B OE2   1 
ATOM   3133 N N     . TRP D 2 42  ? -10.280 38.651 41.789  1.00 40.12 ? 42  TRP B N     1 
ATOM   3134 C CA    . TRP D 2 42  ? -9.265  38.890 42.807  1.00 41.08 ? 42  TRP B CA    1 
ATOM   3135 C C     . TRP D 2 42  ? -7.871  38.947 42.204  1.00 41.61 ? 42  TRP B C     1 
ATOM   3136 O O     . TRP D 2 42  ? -7.125  39.883 42.468  1.00 40.63 ? 42  TRP B O     1 
ATOM   3137 C CB    . TRP D 2 42  ? -9.315  37.798 43.859  1.00 42.57 ? 42  TRP B CB    1 
ATOM   3138 C CG    . TRP D 2 42  ? -8.428  38.049 45.033  1.00 45.58 ? 42  TRP B CG    1 
ATOM   3139 C CD1   . TRP D 2 42  ? -8.665  38.893 46.086  1.00 46.39 ? 42  TRP B CD1   1 
ATOM   3140 C CD2   . TRP D 2 42  ? -7.190  37.396 45.313  1.00 45.53 ? 42  TRP B CD2   1 
ATOM   3141 N NE1   . TRP D 2 42  ? -7.654  38.794 47.008  1.00 46.33 ? 42  TRP B NE1   1 
ATOM   3142 C CE2   . TRP D 2 42  ? -6.735  37.881 46.560  1.00 46.17 ? 42  TRP B CE2   1 
ATOM   3143 C CE3   . TRP D 2 42  ? -6.420  36.444 44.631  1.00 45.51 ? 42  TRP B CE3   1 
ATOM   3144 C CZ2   . TRP D 2 42  ? -5.543  37.444 47.142  1.00 47.30 ? 42  TRP B CZ2   1 
ATOM   3145 C CZ3   . TRP D 2 42  ? -5.235  36.009 45.208  1.00 47.37 ? 42  TRP B CZ3   1 
ATOM   3146 C CH2   . TRP D 2 42  ? -4.808  36.509 46.454  1.00 48.05 ? 42  TRP B CH2   1 
ATOM   3147 N N     . ARG D 2 43  ? -7.511  37.947 41.408  1.00 42.86 ? 43  ARG B N     1 
ATOM   3148 C CA    . ARG D 2 43  ? -6.201  37.952 40.766  1.00 45.94 ? 43  ARG B CA    1 
ATOM   3149 C C     . ARG D 2 43  ? -6.055  39.251 39.986  1.00 47.22 ? 43  ARG B C     1 
ATOM   3150 O O     . ARG D 2 43  ? -5.019  39.919 40.049  1.00 47.07 ? 43  ARG B O     1 
ATOM   3151 C CB    . ARG D 2 43  ? -6.056  36.784 39.795  1.00 46.86 ? 43  ARG B CB    1 
ATOM   3152 C CG    . ARG D 2 43  ? -5.752  35.457 40.439  1.00 52.83 ? 43  ARG B CG    1 
ATOM   3153 C CD    . ARG D 2 43  ? -5.730  34.349 39.394  1.00 57.33 ? 43  ARG B CD    1 
ATOM   3154 N NE    . ARG D 2 43  ? -7.003  33.638 39.314  1.00 61.81 ? 43  ARG B NE    1 
ATOM   3155 C CZ    . ARG D 2 43  ? -7.334  32.809 38.327  1.00 64.55 ? 43  ARG B CZ    1 
ATOM   3156 N NH1   . ARG D 2 43  ? -6.483  32.593 37.333  1.00 65.29 ? 43  ARG B NH1   1 
ATOM   3157 N NH2   . ARG D 2 43  ? -8.513  32.194 38.334  1.00 65.34 ? 43  ARG B NH2   1 
ATOM   3158 N N     . LEU D 2 44  ? -7.112  39.609 39.265  1.00 47.58 ? 44  LEU B N     1 
ATOM   3159 C CA    . LEU D 2 44  ? -7.116  40.813 38.453  1.00 51.25 ? 44  LEU B CA    1 
ATOM   3160 C C     . LEU D 2 44  ? -6.823  42.076 39.260  1.00 52.32 ? 44  LEU B C     1 
ATOM   3161 O O     . LEU D 2 44  ? -6.006  42.908 38.863  1.00 53.87 ? 44  LEU B O     1 
ATOM   3162 C CB    . LEU D 2 44  ? -8.462  40.972 37.743  1.00 52.62 ? 44  LEU B CB    1 
ATOM   3163 C CG    . LEU D 2 44  ? -8.488  42.167 36.787  1.00 54.16 ? 44  LEU B CG    1 
ATOM   3164 C CD1   . LEU D 2 44  ? -7.890  41.728 35.471  1.00 54.50 ? 44  LEU B CD1   1 
ATOM   3165 C CD2   . LEU D 2 44  ? -9.900  42.680 36.582  1.00 54.82 ? 44  LEU B CD2   1 
ATOM   3166 N N     . TYR D 2 45  ? -7.503  42.224 40.386  1.00 53.85 ? 45  TYR B N     1 
ATOM   3167 C CA    . TYR D 2 45  ? -7.313  43.390 41.235  1.00 55.39 ? 45  TYR B CA    1 
ATOM   3168 C C     . TYR D 2 45  ? -5.916  43.385 41.840  1.00 57.96 ? 45  TYR B C     1 
ATOM   3169 O O     . TYR D 2 45  ? -5.302  44.434 42.010  1.00 59.34 ? 45  TYR B O     1 
ATOM   3170 C CB    . TYR D 2 45  ? -8.349  43.393 42.349  1.00 53.46 ? 45  TYR B CB    1 
ATOM   3171 C CG    . TYR D 2 45  ? -8.288  44.600 43.240  1.00 52.38 ? 45  TYR B CG    1 
ATOM   3172 C CD1   . TYR D 2 45  ? -8.745  45.837 42.801  1.00 51.31 ? 45  TYR B CD1   1 
ATOM   3173 C CD2   . TYR D 2 45  ? -7.794  44.502 44.542  1.00 52.38 ? 45  TYR B CD2   1 
ATOM   3174 C CE1   . TYR D 2 45  ? -8.719  46.952 43.641  1.00 50.82 ? 45  TYR B CE1   1 
ATOM   3175 C CE2   . TYR D 2 45  ? -7.763  45.608 45.390  1.00 51.12 ? 45  TYR B CE2   1 
ATOM   3176 C CZ    . TYR D 2 45  ? -8.230  46.829 44.934  1.00 50.56 ? 45  TYR B CZ    1 
ATOM   3177 O OH    . TYR D 2 45  ? -8.230  47.915 45.780  1.00 49.02 ? 45  TYR B OH    1 
ATOM   3178 N N     . ASN D 2 46  ? -5.407  42.204 42.170  1.00 60.45 ? 46  ASN B N     1 
ATOM   3179 C CA    . ASN D 2 46  ? -4.080  42.127 42.748  1.00 62.98 ? 46  ASN B CA    1 
ATOM   3180 C C     . ASN D 2 46  ? -3.000  42.268 41.691  1.00 65.77 ? 46  ASN B C     1 
ATOM   3181 O O     . ASN D 2 46  ? -1.929  41.660 41.767  1.00 65.59 ? 46  ASN B O     1 
ATOM   3182 C CB    . ASN D 2 46  ? -3.925  40.847 43.556  1.00 61.71 ? 46  ASN B CB    1 
ATOM   3183 C CG    . ASN D 2 46  ? -4.734  40.892 44.831  1.00 61.18 ? 46  ASN B CG    1 
ATOM   3184 O OD1   . ASN D 2 46  ? -4.717  41.887 45.547  1.00 60.69 ? 46  ASN B OD1   1 
ATOM   3185 N ND2   . ASN D 2 46  ? -5.447  39.822 45.121  1.00 63.32 ? 46  ASN B ND2   1 
ATOM   3186 N N     . ASP D 2 47  ? -3.331  43.095 40.704  1.00 68.66 ? 47  ASP B N     1 
ATOM   3187 C CA    . ASP D 2 47  ? -2.469  43.464 39.590  1.00 71.84 ? 47  ASP B CA    1 
ATOM   3188 C C     . ASP D 2 47  ? -2.811  44.932 39.351  1.00 73.54 ? 47  ASP B C     1 
ATOM   3189 O O     . ASP D 2 47  ? -2.102  45.648 38.647  1.00 74.33 ? 47  ASP B O     1 
ATOM   3190 C CB    . ASP D 2 47  ? -2.775  42.642 38.331  1.00 71.95 ? 47  ASP B CB    1 
ATOM   3191 C CG    . ASP D 2 47  ? -2.115  41.272 38.351  1.00 72.90 ? 47  ASP B CG    1 
ATOM   3192 O OD1   . ASP D 2 47  ? -0.955  41.184 38.810  1.00 72.59 ? 47  ASP B OD1   1 
ATOM   3193 O OD2   . ASP D 2 47  ? -2.744  40.288 37.897  1.00 72.95 ? 47  ASP B OD2   1 
ATOM   3194 N N     . GLU D 2 48  ? -3.911  45.362 39.966  1.00 75.03 ? 48  GLU B N     1 
ATOM   3195 C CA    . GLU D 2 48  ? -4.398  46.737 39.877  1.00 76.34 ? 48  GLU B CA    1 
ATOM   3196 C C     . GLU D 2 48  ? -4.822  47.089 38.458  1.00 75.89 ? 48  GLU B C     1 
ATOM   3197 O O     . GLU D 2 48  ? -5.327  46.240 37.725  1.00 75.61 ? 48  GLU B O     1 
ATOM   3198 C CB    . GLU D 2 48  ? -3.317  47.718 40.352  1.00 77.71 ? 48  GLU B CB    1 
ATOM   3199 C CG    . GLU D 2 48  ? -2.642  47.354 41.685  1.00 80.73 ? 48  GLU B CG    1 
ATOM   3200 C CD    . GLU D 2 48  ? -3.581  47.388 42.891  1.00 82.60 ? 48  GLU B CD    1 
ATOM   3201 O OE1   . GLU D 2 48  ? -3.085  47.179 44.023  1.00 83.48 ? 48  GLU B OE1   1 
ATOM   3202 O OE2   . GLU D 2 48  ? -4.801  47.621 42.719  1.00 82.12 ? 48  GLU B OE2   1 
ATOM   3203 N N     . ASN D 2 55  ? -5.897  50.495 48.862  1.00 58.55 ? 55  ASN B N     1 
ATOM   3204 C CA    . ASN D 2 55  ? -5.114  49.278 49.001  1.00 57.08 ? 55  ASN B CA    1 
ATOM   3205 C C     . ASN D 2 55  ? -5.990  48.012 48.828  1.00 54.87 ? 55  ASN B C     1 
ATOM   3206 O O     . ASN D 2 55  ? -6.114  47.516 47.707  1.00 55.82 ? 55  ASN B O     1 
ATOM   3207 C CB    . ASN D 2 55  ? -4.359  49.297 50.352  1.00 59.65 ? 55  ASN B CB    1 
ATOM   3208 C CG    . ASN D 2 55  ? -3.437  48.083 50.546  1.00 63.64 ? 55  ASN B CG    1 
ATOM   3209 O OD1   . ASN D 2 55  ? -2.581  47.781 49.700  1.00 65.26 ? 55  ASN B OD1   1 
ATOM   3210 N ND2   . ASN D 2 55  ? -3.607  47.387 51.673  1.00 63.06 ? 55  ASN B ND2   1 
ATOM   3211 N N     . PRO D 2 56  ? -6.639  47.493 49.899  1.00 51.72 ? 56  PRO B N     1 
ATOM   3212 C CA    . PRO D 2 56  ? -7.427  46.286 49.616  1.00 48.60 ? 56  PRO B CA    1 
ATOM   3213 C C     . PRO D 2 56  ? -8.839  46.522 49.090  1.00 45.72 ? 56  PRO B C     1 
ATOM   3214 O O     . PRO D 2 56  ? -9.408  47.601 49.239  1.00 45.47 ? 56  PRO B O     1 
ATOM   3215 C CB    . PRO D 2 56  ? -7.429  45.563 50.957  1.00 46.59 ? 56  PRO B CB    1 
ATOM   3216 C CG    . PRO D 2 56  ? -7.599  46.685 51.900  1.00 46.98 ? 56  PRO B CG    1 
ATOM   3217 C CD    . PRO D 2 56  ? -6.668  47.784 51.347  1.00 50.88 ? 56  PRO B CD    1 
ATOM   3218 N N     . LEU D 2 57  ? -9.396  45.480 48.492  1.00 42.98 ? 57  LEU B N     1 
ATOM   3219 C CA    . LEU D 2 57  ? -10.736 45.517 47.925  1.00 41.79 ? 57  LEU B CA    1 
ATOM   3220 C C     . LEU D 2 57  ? -11.814 45.781 48.979  1.00 38.71 ? 57  LEU B C     1 
ATOM   3221 O O     . LEU D 2 57  ? -12.726 46.572 48.752  1.00 38.61 ? 57  LEU B O     1 
ATOM   3222 C CB    . LEU D 2 57  ? -11.002 44.187 47.218  1.00 43.50 ? 57  LEU B CB    1 
ATOM   3223 C CG    . LEU D 2 57  ? -12.115 44.007 46.192  1.00 46.31 ? 57  LEU B CG    1 
ATOM   3224 C CD1   . LEU D 2 57  ? -12.585 45.341 45.607  1.00 46.54 ? 57  LEU B CD1   1 
ATOM   3225 C CD2   . LEU D 2 57  ? -11.558 43.100 45.097  1.00 44.23 ? 57  LEU B CD2   1 
ATOM   3226 N N     . GLY D 2 58  ? -11.706 45.118 50.126  1.00 34.68 ? 58  GLY B N     1 
ATOM   3227 C CA    . GLY D 2 58  ? -12.687 45.297 51.182  1.00 31.71 ? 58  GLY B CA    1 
ATOM   3228 C C     . GLY D 2 58  ? -12.209 44.688 52.486  1.00 30.63 ? 58  GLY B C     1 
ATOM   3229 O O     . GLY D 2 58  ? -11.019 44.717 52.788  1.00 32.81 ? 58  GLY B O     1 
ATOM   3230 N N     . PHE D 2 59  ? -13.125 44.133 53.265  1.00 28.07 ? 59  PHE B N     1 
ATOM   3231 C CA    . PHE D 2 59  ? -12.771 43.525 54.536  1.00 26.03 ? 59  PHE B CA    1 
ATOM   3232 C C     . PHE D 2 59  ? -13.695 42.341 54.811  1.00 28.26 ? 59  PHE B C     1 
ATOM   3233 O O     . PHE D 2 59  ? -14.735 42.195 54.164  1.00 29.91 ? 59  PHE B O     1 
ATOM   3234 C CB    . PHE D 2 59  ? -12.916 44.551 55.645  1.00 23.98 ? 59  PHE B CB    1 
ATOM   3235 C CG    . PHE D 2 59  ? -14.337 44.936 55.925  1.00 23.96 ? 59  PHE B CG    1 
ATOM   3236 C CD1   . PHE D 2 59  ? -15.114 44.191 56.803  1.00 25.44 ? 59  PHE B CD1   1 
ATOM   3237 C CD2   . PHE D 2 59  ? -14.910 46.031 55.298  1.00 22.77 ? 59  PHE B CD2   1 
ATOM   3238 C CE1   . PHE D 2 59  ? -16.457 44.541 57.048  1.00 25.59 ? 59  PHE B CE1   1 
ATOM   3239 C CE2   . PHE D 2 59  ? -16.233 46.385 55.533  1.00 22.12 ? 59  PHE B CE2   1 
ATOM   3240 C CZ    . PHE D 2 59  ? -17.007 45.641 56.407  1.00 23.99 ? 59  PHE B CZ    1 
ATOM   3241 N N     . LYS D 2 60  ? -13.338 41.516 55.789  1.00 25.85 ? 60  LYS B N     1 
ATOM   3242 C CA    . LYS D 2 60  ? -14.130 40.356 56.116  1.00 25.43 ? 60  LYS B CA    1 
ATOM   3243 C C     . LYS D 2 60  ? -14.592 40.415 57.558  1.00 26.95 ? 60  LYS B C     1 
ATOM   3244 O O     . LYS D 2 60  ? -13.815 40.751 58.442  1.00 30.84 ? 60  LYS B O     1 
ATOM   3245 C CB    . LYS D 2 60  ? -13.301 39.099 55.870  1.00 26.87 ? 60  LYS B CB    1 
ATOM   3246 C CG    . LYS D 2 60  ? -14.069 37.810 56.074  1.00 33.37 ? 60  LYS B CG    1 
ATOM   3247 C CD    . LYS D 2 60  ? -13.312 36.584 55.561  1.00 35.61 ? 60  LYS B CD    1 
ATOM   3248 C CE    . LYS D 2 60  ? -14.034 35.297 55.976  1.00 37.03 ? 60  LYS B CE    1 
ATOM   3249 N NZ    . LYS D 2 60  ? -13.295 34.080 55.525  1.00 36.85 ? 60  LYS B NZ    1 
ATOM   3250 N N     . GLU D 2 61  ? -15.867 40.127 57.809  1.00 26.22 ? 61  GLU B N     1 
ATOM   3251 C CA    . GLU D 2 61  ? -16.377 40.148 59.173  1.00 25.70 ? 61  GLU B CA    1 
ATOM   3252 C C     . GLU D 2 61  ? -17.144 38.876 59.365  1.00 27.60 ? 61  GLU B C     1 
ATOM   3253 O O     . GLU D 2 61  ? -17.472 38.214 58.390  1.00 32.78 ? 61  GLU B O     1 
ATOM   3254 C CB    . GLU D 2 61  ? -17.288 41.343 59.401  1.00 25.18 ? 61  GLU B CB    1 
ATOM   3255 C CG    . GLU D 2 61  ? -18.317 41.572 58.312  1.00 27.05 ? 61  GLU B CG    1 
ATOM   3256 C CD    . GLU D 2 61  ? -19.237 42.763 58.618  1.00 27.00 ? 61  GLU B CD    1 
ATOM   3257 O OE1   . GLU D 2 61  ? -19.143 43.322 59.727  1.00 27.49 ? 61  GLU B OE1   1 
ATOM   3258 O OE2   . GLU D 2 61  ? -20.063 43.136 57.757  1.00 27.26 ? 61  GLU B OE2   1 
ATOM   3259 N N     . SER D 2 62  ? -17.421 38.501 60.605  1.00 26.77 ? 62  SER B N     1 
ATOM   3260 C CA    . SER D 2 62  ? -18.168 37.283 60.832  1.00 26.42 ? 62  SER B CA    1 
ATOM   3261 C C     . SER D 2 62  ? -18.797 37.297 62.212  1.00 26.93 ? 62  SER B C     1 
ATOM   3262 O O     . SER D 2 62  ? -18.208 37.814 63.150  1.00 29.38 ? 62  SER B O     1 
ATOM   3263 C CB    . SER D 2 62  ? -17.253 36.072 60.687  1.00 27.74 ? 62  SER B CB    1 
ATOM   3264 O OG    . SER D 2 62  ? -16.601 35.760 61.911  1.00 32.19 ? 62  SER B OG    1 
ATOM   3265 N N     . TRP D 2 63  ? -20.004 36.746 62.314  1.00 26.44 ? 63  TRP B N     1 
ATOM   3266 C CA    . TRP D 2 63  ? -20.752 36.663 63.567  1.00 25.50 ? 63  TRP B CA    1 
ATOM   3267 C C     . TRP D 2 63  ? -20.986 35.203 63.840  1.00 27.06 ? 63  TRP B C     1 
ATOM   3268 O O     . TRP D 2 63  ? -21.375 34.456 62.938  1.00 29.08 ? 63  TRP B O     1 
ATOM   3269 C CB    . TRP D 2 63  ? -22.122 37.336 63.461  1.00 23.91 ? 63  TRP B CB    1 
ATOM   3270 C CG    . TRP D 2 63  ? -22.161 38.771 63.826  1.00 18.97 ? 63  TRP B CG    1 
ATOM   3271 C CD1   . TRP D 2 63  ? -22.260 39.821 62.978  1.00 19.27 ? 63  TRP B CD1   1 
ATOM   3272 C CD2   . TRP D 2 63  ? -22.103 39.319 65.145  1.00 19.26 ? 63  TRP B CD2   1 
ATOM   3273 N NE1   . TRP D 2 63  ? -22.269 41.006 63.681  1.00 20.62 ? 63  TRP B NE1   1 
ATOM   3274 C CE2   . TRP D 2 63  ? -22.169 40.724 65.017  1.00 19.57 ? 63  TRP B CE2   1 
ATOM   3275 C CE3   . TRP D 2 63  ? -21.998 38.759 66.427  1.00 21.23 ? 63  TRP B CE3   1 
ATOM   3276 C CZ2   . TRP D 2 63  ? -22.131 41.582 66.123  1.00 19.68 ? 63  TRP B CZ2   1 
ATOM   3277 C CZ3   . TRP D 2 63  ? -21.962 39.615 67.537  1.00 20.55 ? 63  TRP B CZ3   1 
ATOM   3278 C CH2   . TRP D 2 63  ? -22.028 41.010 67.374  1.00 19.83 ? 63  TRP B CH2   1 
ATOM   3279 N N     . GLY D 2 64  ? -20.754 34.796 65.079  1.00 26.54 ? 64  GLY B N     1 
ATOM   3280 C CA    . GLY D 2 64  ? -20.945 33.411 65.445  1.00 26.91 ? 64  GLY B CA    1 
ATOM   3281 C C     . GLY D 2 64  ? -21.739 33.356 66.728  1.00 30.30 ? 64  GLY B C     1 
ATOM   3282 O O     . GLY D 2 64  ? -21.563 34.187 67.621  1.00 28.78 ? 64  GLY B O     1 
ATOM   3283 N N     . PHE D 2 65  ? -22.664 32.409 66.792  1.00 32.74 ? 65  PHE B N     1 
ATOM   3284 C CA    . PHE D 2 65  ? -23.484 32.198 67.978  1.00 32.95 ? 65  PHE B CA    1 
ATOM   3285 C C     . PHE D 2 65  ? -23.283 30.724 68.164  1.00 36.04 ? 65  PHE B C     1 
ATOM   3286 O O     . PHE D 2 65  ? -23.879 29.920 67.456  1.00 38.05 ? 65  PHE B O     1 
ATOM   3287 C CB    . PHE D 2 65  ? -24.938 32.483 67.679  1.00 30.25 ? 65  PHE B CB    1 
ATOM   3288 C CG    . PHE D 2 65  ? -25.163 33.790 67.013  1.00 28.19 ? 65  PHE B CG    1 
ATOM   3289 C CD1   . PHE D 2 65  ? -25.593 33.842 65.704  1.00 27.26 ? 65  PHE B CD1   1 
ATOM   3290 C CD2   . PHE D 2 65  ? -24.957 34.979 67.700  1.00 29.43 ? 65  PHE B CD2   1 
ATOM   3291 C CE1   . PHE D 2 65  ? -25.823 35.063 65.073  1.00 30.15 ? 65  PHE B CE1   1 
ATOM   3292 C CE2   . PHE D 2 65  ? -25.183 36.216 67.083  1.00 30.78 ? 65  PHE B CE2   1 
ATOM   3293 C CZ    . PHE D 2 65  ? -25.618 36.253 65.761  1.00 30.51 ? 65  PHE B CZ    1 
ATOM   3294 N N     . GLY D 2 66  ? -22.415 30.358 69.093  1.00 39.16 ? 66  GLY B N     1 
ATOM   3295 C CA    . GLY D 2 66  ? -22.136 28.953 69.281  1.00 39.14 ? 66  GLY B CA    1 
ATOM   3296 C C     . GLY D 2 66  ? -21.364 28.614 68.031  1.00 40.46 ? 66  GLY B C     1 
ATOM   3297 O O     . GLY D 2 66  ? -20.501 29.382 67.621  1.00 41.41 ? 66  GLY B O     1 
ATOM   3298 N N     . LYS D 2 67  ? -21.680 27.493 67.403  1.00 42.23 ? 67  LYS B N     1 
ATOM   3299 C CA    . LYS D 2 67  ? -20.976 27.103 66.195  1.00 42.70 ? 67  LYS B CA    1 
ATOM   3300 C C     . LYS D 2 67  ? -21.712 27.540 64.938  1.00 40.55 ? 67  LYS B C     1 
ATOM   3301 O O     . LYS D 2 67  ? -21.337 27.170 63.832  1.00 40.49 ? 67  LYS B O     1 
ATOM   3302 C CB    . LYS D 2 67  ? -20.740 25.585 66.181  1.00 48.37 ? 67  LYS B CB    1 
ATOM   3303 C CG    . LYS D 2 67  ? -21.891 24.722 66.705  1.00 53.01 ? 67  LYS B CG    1 
ATOM   3304 C CD    . LYS D 2 67  ? -21.376 23.319 67.070  1.00 57.66 ? 67  LYS B CD    1 
ATOM   3305 C CE    . LYS D 2 67  ? -22.402 22.519 67.874  1.00 60.75 ? 67  LYS B CE    1 
ATOM   3306 N NZ    . LYS D 2 67  ? -21.860 21.210 68.375  1.00 63.75 ? 67  LYS B NZ    1 
ATOM   3307 N N     . VAL D 2 68  ? -22.758 28.335 65.109  1.00 37.71 ? 68  VAL B N     1 
ATOM   3308 C CA    . VAL D 2 68  ? -23.517 28.823 63.969  1.00 35.57 ? 68  VAL B CA    1 
ATOM   3309 C C     . VAL D 2 68  ? -22.897 30.156 63.536  1.00 35.99 ? 68  VAL B C     1 
ATOM   3310 O O     . VAL D 2 68  ? -23.277 31.238 64.007  1.00 36.79 ? 68  VAL B O     1 
ATOM   3311 C CB    . VAL D 2 68  ? -24.977 29.000 64.347  1.00 33.20 ? 68  VAL B CB    1 
ATOM   3312 C CG1   . VAL D 2 68  ? -25.786 29.304 63.109  1.00 33.45 ? 68  VAL B CG1   1 
ATOM   3313 C CG2   . VAL D 2 68  ? -25.480 27.727 65.023  1.00 31.18 ? 68  VAL B CG2   1 
ATOM   3314 N N     . VAL D 2 69  ? -21.936 30.048 62.625  1.00 33.71 ? 69  VAL B N     1 
ATOM   3315 C CA    . VAL D 2 69  ? -21.173 31.180 62.131  1.00 31.78 ? 69  VAL B CA    1 
ATOM   3316 C C     . VAL D 2 69  ? -21.577 31.720 60.770  1.00 30.97 ? 69  VAL B C     1 
ATOM   3317 O O     . VAL D 2 69  ? -21.676 30.964 59.812  1.00 29.80 ? 69  VAL B O     1 
ATOM   3318 C CB    . VAL D 2 69  ? -19.680 30.788 62.056  1.00 32.53 ? 69  VAL B CB    1 
ATOM   3319 C CG1   . VAL D 2 69  ? -18.830 32.007 61.731  1.00 34.07 ? 69  VAL B CG1   1 
ATOM   3320 C CG2   . VAL D 2 69  ? -19.239 30.158 63.386  1.00 33.80 ? 69  VAL B CG2   1 
ATOM   3321 N N     . PHE D 2 70  ? -21.792 33.031 60.679  1.00 30.10 ? 70  PHE B N     1 
ATOM   3322 C CA    . PHE D 2 70  ? -22.132 33.655 59.396  1.00 31.28 ? 70  PHE B CA    1 
ATOM   3323 C C     . PHE D 2 70  ? -20.961 34.573 58.996  1.00 31.20 ? 70  PHE B C     1 
ATOM   3324 O O     . PHE D 2 70  ? -20.245 35.078 59.856  1.00 32.09 ? 70  PHE B O     1 
ATOM   3325 C CB    . PHE D 2 70  ? -23.405 34.494 59.504  1.00 32.20 ? 70  PHE B CB    1 
ATOM   3326 C CG    . PHE D 2 70  ? -24.563 33.776 60.127  1.00 33.87 ? 70  PHE B CG    1 
ATOM   3327 C CD1   . PHE D 2 70  ? -24.545 33.435 61.472  1.00 33.68 ? 70  PHE B CD1   1 
ATOM   3328 C CD2   . PHE D 2 70  ? -25.702 33.489 59.379  1.00 36.36 ? 70  PHE B CD2   1 
ATOM   3329 C CE1   . PHE D 2 70  ? -25.642 32.825 62.071  1.00 33.37 ? 70  PHE B CE1   1 
ATOM   3330 C CE2   . PHE D 2 70  ? -26.809 32.879 59.971  1.00 34.78 ? 70  PHE B CE2   1 
ATOM   3331 C CZ    . PHE D 2 70  ? -26.776 32.548 61.321  1.00 34.22 ? 70  PHE B CZ    1 
ATOM   3332 N N     . LYS D 2 71  ? -20.763 34.799 57.704  1.00 28.62 ? 71  LYS B N     1 
ATOM   3333 C CA    . LYS D 2 71  ? -19.663 35.653 57.277  1.00 27.83 ? 71  LYS B CA    1 
ATOM   3334 C C     . LYS D 2 71  ? -19.988 36.539 56.077  1.00 28.14 ? 71  LYS B C     1 
ATOM   3335 O O     . LYS D 2 71  ? -20.959 36.310 55.346  1.00 28.08 ? 71  LYS B O     1 
ATOM   3336 C CB    . LYS D 2 71  ? -18.434 34.814 56.925  1.00 26.86 ? 71  LYS B CB    1 
ATOM   3337 C CG    . LYS D 2 71  ? -17.930 33.923 58.018  1.00 27.62 ? 71  LYS B CG    1 
ATOM   3338 C CD    . LYS D 2 71  ? -16.556 33.415 57.652  1.00 29.08 ? 71  LYS B CD    1 
ATOM   3339 C CE    . LYS D 2 71  ? -16.034 32.388 58.651  1.00 30.91 ? 71  LYS B CE    1 
ATOM   3340 N NZ    . LYS D 2 71  ? -16.708 31.059 58.533  1.00 33.08 ? 71  LYS B NZ    1 
ATOM   3341 N N     . ARG D 2 72  ? -19.145 37.542 55.870  1.00 24.85 ? 72  ARG B N     1 
ATOM   3342 C CA    . ARG D 2 72  ? -19.321 38.446 54.760  1.00 25.44 ? 72  ARG B CA    1 
ATOM   3343 C C     . ARG D 2 72  ? -17.985 39.084 54.431  1.00 26.41 ? 72  ARG B C     1 
ATOM   3344 O O     . ARG D 2 72  ? -17.095 39.174 55.279  1.00 26.12 ? 72  ARG B O     1 
ATOM   3345 C CB    . ARG D 2 72  ? -20.320 39.549 55.116  1.00 26.38 ? 72  ARG B CB    1 
ATOM   3346 C CG    . ARG D 2 72  ? -21.783 39.121 55.217  1.00 26.50 ? 72  ARG B CG    1 
ATOM   3347 C CD    . ARG D 2 72  ? -22.431 39.018 53.845  1.00 25.62 ? 72  ARG B CD    1 
ATOM   3348 N NE    . ARG D 2 72  ? -23.875 38.806 53.926  1.00 26.35 ? 72  ARG B NE    1 
ATOM   3349 C CZ    . ARG D 2 72  ? -24.457 37.716 54.429  1.00 28.25 ? 72  ARG B CZ    1 
ATOM   3350 N NH1   . ARG D 2 72  ? -23.738 36.713 54.909  1.00 28.58 ? 72  ARG B NH1   1 
ATOM   3351 N NH2   . ARG D 2 72  ? -25.773 37.624 54.450  1.00 30.85 ? 72  ARG B NH2   1 
ATOM   3352 N N     . TYR D 2 73  ? -17.864 39.511 53.181  1.00 26.13 ? 73  TYR B N     1 
ATOM   3353 C CA    . TYR D 2 73  ? -16.695 40.195 52.663  1.00 25.49 ? 73  TYR B CA    1 
ATOM   3354 C C     . TYR D 2 73  ? -17.385 41.337 51.952  1.00 25.69 ? 73  TYR B C     1 
ATOM   3355 O O     . TYR D 2 73  ? -18.187 41.105 51.060  1.00 27.40 ? 73  TYR B O     1 
ATOM   3356 C CB    . TYR D 2 73  ? -15.947 39.348 51.628  1.00 25.80 ? 73  TYR B CB    1 
ATOM   3357 C CG    . TYR D 2 73  ? -14.737 40.068 51.056  1.00 26.14 ? 73  TYR B CG    1 
ATOM   3358 C CD1   . TYR D 2 73  ? -13.465 39.842 51.568  1.00 25.81 ? 73  TYR B CD1   1 
ATOM   3359 C CD2   . TYR D 2 73  ? -14.885 41.063 50.095  1.00 26.42 ? 73  TYR B CD2   1 
ATOM   3360 C CE1   . TYR D 2 73  ? -12.387 40.588 51.158  1.00 26.94 ? 73  TYR B CE1   1 
ATOM   3361 C CE2   . TYR D 2 73  ? -13.806 41.821 49.681  1.00 26.77 ? 73  TYR B CE2   1 
ATOM   3362 C CZ    . TYR D 2 73  ? -12.557 41.582 50.225  1.00 27.98 ? 73  TYR B CZ    1 
ATOM   3363 O OH    . TYR D 2 73  ? -11.489 42.389 49.895  1.00 30.13 ? 73  TYR B OH    1 
ATOM   3364 N N     . LEU D 2 74  ? -17.092 42.566 52.337  1.00 25.66 ? 74  LEU B N     1 
ATOM   3365 C CA    . LEU D 2 74  ? -17.740 43.705 51.713  1.00 24.97 ? 74  LEU B CA    1 
ATOM   3366 C C     . LEU D 2 74  ? -16.718 44.641 51.079  1.00 28.21 ? 74  LEU B C     1 
ATOM   3367 O O     . LEU D 2 74  ? -15.616 44.828 51.592  1.00 30.62 ? 74  LEU B O     1 
ATOM   3368 C CB    . LEU D 2 74  ? -18.586 44.421 52.768  1.00 21.53 ? 74  LEU B CB    1 
ATOM   3369 C CG    . LEU D 2 74  ? -19.708 43.522 53.331  1.00 20.02 ? 74  LEU B CG    1 
ATOM   3370 C CD1   . LEU D 2 74  ? -20.216 43.969 54.681  1.00 17.28 ? 74  LEU B CD1   1 
ATOM   3371 C CD2   . LEU D 2 74  ? -20.834 43.519 52.341  1.00 21.93 ? 74  LEU B CD2   1 
ATOM   3372 N N     . ARG D 2 75  ? -17.066 45.211 49.937  1.00 28.37 ? 75  ARG B N     1 
ATOM   3373 C CA    . ARG D 2 75  ? -16.150 46.110 49.272  1.00 28.24 ? 75  ARG B CA    1 
ATOM   3374 C C     . ARG D 2 75  ? -16.056 47.371 50.123  1.00 29.22 ? 75  ARG B C     1 
ATOM   3375 O O     . ARG D 2 75  ? -17.067 47.861 50.611  1.00 29.40 ? 75  ARG B O     1 
ATOM   3376 C CB    . ARG D 2 75  ? -16.690 46.448 47.886  1.00 30.17 ? 75  ARG B CB    1 
ATOM   3377 C CG    . ARG D 2 75  ? -17.142 45.239 47.098  1.00 33.11 ? 75  ARG B CG    1 
ATOM   3378 C CD    . ARG D 2 75  ? -16.028 44.664 46.250  1.00 36.69 ? 75  ARG B CD    1 
ATOM   3379 N NE    . ARG D 2 75  ? -16.316 43.292 45.832  1.00 39.57 ? 75  ARG B NE    1 
ATOM   3380 C CZ    . ARG D 2 75  ? -16.004 42.785 44.639  1.00 40.11 ? 75  ARG B CZ    1 
ATOM   3381 N NH1   . ARG D 2 75  ? -15.398 43.539 43.728  1.00 40.67 ? 75  ARG B NH1   1 
ATOM   3382 N NH2   . ARG D 2 75  ? -16.271 41.514 44.363  1.00 37.84 ? 75  ARG B NH2   1 
ATOM   3383 N N     . TYR D 2 76  ? -14.849 47.890 50.313  1.00 30.95 ? 76  TYR B N     1 
ATOM   3384 C CA    . TYR D 2 76  ? -14.661 49.112 51.095  1.00 33.12 ? 76  TYR B CA    1 
ATOM   3385 C C     . TYR D 2 76  ? -13.532 49.907 50.475  1.00 36.10 ? 76  TYR B C     1 
ATOM   3386 O O     . TYR D 2 76  ? -12.432 49.385 50.303  1.00 37.20 ? 76  TYR B O     1 
ATOM   3387 C CB    . TYR D 2 76  ? -14.310 48.766 52.535  1.00 32.53 ? 76  TYR B CB    1 
ATOM   3388 C CG    . TYR D 2 76  ? -14.013 49.970 53.382  1.00 31.55 ? 76  TYR B CG    1 
ATOM   3389 C CD1   . TYR D 2 76  ? -14.952 50.977 53.546  1.00 30.21 ? 76  TYR B CD1   1 
ATOM   3390 C CD2   . TYR D 2 76  ? -12.792 50.096 54.033  1.00 32.02 ? 76  TYR B CD2   1 
ATOM   3391 C CE1   . TYR D 2 76  ? -14.685 52.090 54.346  1.00 30.42 ? 76  TYR B CE1   1 
ATOM   3392 C CE2   . TYR D 2 76  ? -12.511 51.200 54.835  1.00 31.15 ? 76  TYR B CE2   1 
ATOM   3393 C CZ    . TYR D 2 76  ? -13.460 52.195 54.989  1.00 31.25 ? 76  TYR B CZ    1 
ATOM   3394 O OH    . TYR D 2 76  ? -13.176 53.286 55.783  1.00 26.46 ? 76  TYR B OH    1 
ATOM   3395 N N     . ASP D 2 77  ? -13.784 51.167 50.139  1.00 39.19 ? 77  ASP B N     1 
ATOM   3396 C CA    . ASP D 2 77  ? -12.738 51.975 49.505  1.00 42.99 ? 77  ASP B CA    1 
ATOM   3397 C C     . ASP D 2 77  ? -12.183 53.094 50.388  1.00 45.12 ? 77  ASP B C     1 
ATOM   3398 O O     . ASP D 2 77  ? -11.246 53.791 49.996  1.00 46.45 ? 77  ASP B O     1 
ATOM   3399 C CB    . ASP D 2 77  ? -13.251 52.564 48.193  1.00 43.89 ? 77  ASP B CB    1 
ATOM   3400 C CG    . ASP D 2 77  ? -14.395 53.536 48.401  1.00 45.86 ? 77  ASP B CG    1 
ATOM   3401 O OD1   . ASP D 2 77  ? -14.981 53.990 47.394  1.00 45.98 ? 77  ASP B OD1   1 
ATOM   3402 O OD2   . ASP D 2 77  ? -14.706 53.849 49.573  1.00 47.28 ? 77  ASP B OD2   1 
ATOM   3403 N N     . ARG D 2 78  ? -12.771 53.267 51.570  1.00 46.36 ? 78  ARG B N     1 
ATOM   3404 C CA    . ARG D 2 78  ? -12.323 54.266 52.537  1.00 46.69 ? 78  ARG B CA    1 
ATOM   3405 C C     . ARG D 2 78  ? -12.814 55.697 52.353  1.00 46.70 ? 78  ARG B C     1 
ATOM   3406 O O     . ARG D 2 78  ? -12.074 56.634 52.616  1.00 47.14 ? 78  ARG B O     1 
ATOM   3407 C CB    . ARG D 2 78  ? -10.797 54.261 52.611  1.00 46.58 ? 78  ARG B CB    1 
ATOM   3408 C CG    . ARG D 2 78  ? -10.228 52.961 53.125  1.00 49.47 ? 78  ARG B CG    1 
ATOM   3409 C CD    . ARG D 2 78  ? -8.724  52.927 52.988  1.00 52.68 ? 78  ARG B CD    1 
ATOM   3410 N NE    . ARG D 2 78  ? -8.336  52.966 51.585  1.00 57.83 ? 78  ARG B NE    1 
ATOM   3411 C CZ    . ARG D 2 78  ? -8.670  52.035 50.694  1.00 60.95 ? 78  ARG B CZ    1 
ATOM   3412 N NH1   . ARG D 2 78  ? -9.400  50.986 51.063  1.00 62.02 ? 78  ARG B NH1   1 
ATOM   3413 N NH2   . ARG D 2 78  ? -8.281  52.154 49.430  1.00 61.53 ? 78  ARG B NH2   1 
ATOM   3414 N N     . THR D 2 79  ? -14.056 55.863 51.912  1.00 46.35 ? 79  THR B N     1 
ATOM   3415 C CA    . THR D 2 79  ? -14.649 57.186 51.737  1.00 46.25 ? 79  THR B CA    1 
ATOM   3416 C C     . THR D 2 79  ? -15.825 57.242 52.709  1.00 47.15 ? 79  THR B C     1 
ATOM   3417 O O     . THR D 2 79  ? -16.452 56.211 52.959  1.00 49.05 ? 79  THR B O     1 
ATOM   3418 C CB    . THR D 2 79  ? -15.196 57.369 50.322  1.00 46.90 ? 79  THR B CB    1 
ATOM   3419 O OG1   . THR D 2 79  ? -16.401 56.605 50.177  1.00 46.84 ? 79  THR B OG1   1 
ATOM   3420 C CG2   . THR D 2 79  ? -14.184 56.894 49.301  1.00 45.45 ? 79  THR B CG2   1 
ATOM   3421 N N     . GLU D 2 80  ? -16.141 58.419 53.249  1.00 46.41 ? 80  GLU B N     1 
ATOM   3422 C CA    . GLU D 2 80  ? -17.253 58.527 54.201  1.00 46.07 ? 80  GLU B CA    1 
ATOM   3423 C C     . GLU D 2 80  ? -18.499 57.789 53.693  1.00 45.47 ? 80  GLU B C     1 
ATOM   3424 O O     . GLU D 2 80  ? -19.174 57.080 54.456  1.00 44.44 ? 80  GLU B O     1 
ATOM   3425 C CB    . GLU D 2 80  ? -17.608 59.999 54.465  1.00 46.97 ? 80  GLU B CB    1 
ATOM   3426 C CG    . GLU D 2 80  ? -18.496 60.266 55.715  1.00 49.41 ? 80  GLU B CG    1 
ATOM   3427 C CD    . GLU D 2 80  ? -19.947 59.768 55.592  1.00 51.57 ? 80  GLU B CD    1 
ATOM   3428 O OE1   . GLU D 2 80  ? -20.547 59.991 54.518  1.00 51.26 ? 80  GLU B OE1   1 
ATOM   3429 O OE2   . GLU D 2 80  ? -20.492 59.175 56.570  1.00 51.01 ? 80  GLU B OE2   1 
ATOM   3430 N N     . ALA D 2 81  ? -18.797 57.950 52.406  1.00 43.70 ? 81  ALA B N     1 
ATOM   3431 C CA    . ALA D 2 81  ? -19.974 57.313 51.814  1.00 43.53 ? 81  ALA B CA    1 
ATOM   3432 C C     . ALA D 2 81  ? -19.939 55.807 52.019  1.00 41.86 ? 81  ALA B C     1 
ATOM   3433 O O     . ALA D 2 81  ? -20.899 55.214 52.532  1.00 42.09 ? 81  ALA B O     1 
ATOM   3434 C CB    . ALA D 2 81  ? -20.060 57.638 50.315  1.00 42.55 ? 81  ALA B CB    1 
ATOM   3435 N N     . SER D 2 82  ? -18.821 55.205 51.620  1.00 38.94 ? 82  SER B N     1 
ATOM   3436 C CA    . SER D 2 82  ? -18.622 53.771 51.738  1.00 37.83 ? 82  SER B CA    1 
ATOM   3437 C C     . SER D 2 82  ? -18.599 53.329 53.189  1.00 37.45 ? 82  SER B C     1 
ATOM   3438 O O     . SER D 2 82  ? -19.121 52.265 53.528  1.00 38.28 ? 82  SER B O     1 
ATOM   3439 C CB    . SER D 2 82  ? -17.313 53.359 51.071  1.00 37.49 ? 82  SER B CB    1 
ATOM   3440 O OG    . SER D 2 82  ? -17.163 51.954 51.104  1.00 35.30 ? 82  SER B OG    1 
ATOM   3441 N N     . LEU D 2 83  ? -17.991 54.141 54.048  1.00 35.67 ? 83  LEU B N     1 
ATOM   3442 C CA    . LEU D 2 83  ? -17.924 53.795 55.454  1.00 34.98 ? 83  LEU B CA    1 
ATOM   3443 C C     . LEU D 2 83  ? -19.313 53.687 56.050  1.00 35.08 ? 83  LEU B C     1 
ATOM   3444 O O     . LEU D 2 83  ? -19.596 52.769 56.827  1.00 35.55 ? 83  LEU B O     1 
ATOM   3445 C CB    . LEU D 2 83  ? -17.121 54.825 56.237  1.00 33.97 ? 83  LEU B CB    1 
ATOM   3446 C CG    . LEU D 2 83  ? -17.213 54.635 57.757  1.00 32.69 ? 83  LEU B CG    1 
ATOM   3447 C CD1   . LEU D 2 83  ? -16.724 53.253 58.136  1.00 31.31 ? 83  LEU B CD1   1 
ATOM   3448 C CD2   . LEU D 2 83  ? -16.402 55.718 58.458  1.00 31.92 ? 83  LEU B CD2   1 
ATOM   3449 N N     . HIS D 2 84  ? -20.184 54.622 55.697  1.00 35.41 ? 84  HIS B N     1 
ATOM   3450 C CA    . HIS D 2 84  ? -21.532 54.584 56.233  1.00 35.36 ? 84  HIS B CA    1 
ATOM   3451 C C     . HIS D 2 84  ? -22.261 53.380 55.668  1.00 34.14 ? 84  HIS B C     1 
ATOM   3452 O O     . HIS D 2 84  ? -23.049 52.740 56.356  1.00 33.59 ? 84  HIS B O     1 
ATOM   3453 C CB    . HIS D 2 84  ? -22.294 55.857 55.887  1.00 38.23 ? 84  HIS B CB    1 
ATOM   3454 C CG    . HIS D 2 84  ? -23.742 55.807 56.268  1.00 43.58 ? 84  HIS B CG    1 
ATOM   3455 N ND1   . HIS D 2 84  ? -24.168 55.448 57.532  1.00 45.41 ? 84  HIS B ND1   1 
ATOM   3456 C CD2   . HIS D 2 84  ? -24.862 56.089 55.558  1.00 43.71 ? 84  HIS B CD2   1 
ATOM   3457 C CE1   . HIS D 2 84  ? -25.487 55.518 57.583  1.00 46.82 ? 84  HIS B CE1   1 
ATOM   3458 N NE2   . HIS D 2 84  ? -25.933 55.904 56.399  1.00 45.36 ? 84  HIS B NE2   1 
ATOM   3459 N N     . ARG D 2 85  ? -21.987 53.063 54.407  1.00 32.90 ? 85  ARG B N     1 
ATOM   3460 C CA    . ARG D 2 85  ? -22.640 51.927 53.780  1.00 30.85 ? 85  ARG B CA    1 
ATOM   3461 C C     . ARG D 2 85  ? -22.279 50.624 54.500  1.00 29.39 ? 85  ARG B C     1 
ATOM   3462 O O     . ARG D 2 85  ? -23.144 49.993 55.096  1.00 30.32 ? 85  ARG B O     1 
ATOM   3463 C CB    . ARG D 2 85  ? -22.266 51.851 52.292  1.00 30.58 ? 85  ARG B CB    1 
ATOM   3464 C CG    . ARG D 2 85  ? -23.025 50.767 51.520  1.00 30.02 ? 85  ARG B CG    1 
ATOM   3465 C CD    . ARG D 2 85  ? -22.616 50.687 50.037  1.00 31.92 ? 85  ARG B CD    1 
ATOM   3466 N NE    . ARG D 2 85  ? -21.382 49.941 49.783  1.00 33.28 ? 85  ARG B NE    1 
ATOM   3467 C CZ    . ARG D 2 85  ? -21.241 48.624 49.955  1.00 34.94 ? 85  ARG B CZ    1 
ATOM   3468 N NH1   . ARG D 2 85  ? -22.257 47.891 50.389  1.00 33.64 ? 85  ARG B NH1   1 
ATOM   3469 N NH2   . ARG D 2 85  ? -20.080 48.035 49.686  1.00 33.55 ? 85  ARG B NH2   1 
ATOM   3470 N N     . VAL D 2 86  ? -21.008 50.226 54.476  1.00 28.36 ? 86  VAL B N     1 
ATOM   3471 C CA    . VAL D 2 86  ? -20.626 48.974 55.139  1.00 28.22 ? 86  VAL B CA    1 
ATOM   3472 C C     . VAL D 2 86  ? -20.958 48.949 56.617  1.00 28.06 ? 86  VAL B C     1 
ATOM   3473 O O     . VAL D 2 86  ? -21.168 47.876 57.185  1.00 27.65 ? 86  VAL B O     1 
ATOM   3474 C CB    . VAL D 2 86  ? -19.137 48.653 54.969  1.00 26.11 ? 86  VAL B CB    1 
ATOM   3475 C CG1   . VAL D 2 86  ? -18.820 48.523 53.486  1.00 24.62 ? 86  VAL B CG1   1 
ATOM   3476 C CG2   . VAL D 2 86  ? -18.295 49.716 55.643  1.00 25.44 ? 86  VAL B CG2   1 
ATOM   3477 N N     . LEU D 2 87  ? -21.024 50.120 57.245  1.00 29.29 ? 87  LEU B N     1 
ATOM   3478 C CA    . LEU D 2 87  ? -21.367 50.156 58.664  1.00 31.83 ? 87  LEU B CA    1 
ATOM   3479 C C     . LEU D 2 87  ? -22.795 49.674 58.936  1.00 32.89 ? 87  LEU B C     1 
ATOM   3480 O O     . LEU D 2 87  ? -23.175 49.450 60.089  1.00 32.62 ? 87  LEU B O     1 
ATOM   3481 C CB    . LEU D 2 87  ? -21.167 51.562 59.235  1.00 30.70 ? 87  LEU B CB    1 
ATOM   3482 C CG    . LEU D 2 87  ? -19.737 51.831 59.696  1.00 29.81 ? 87  LEU B CG    1 
ATOM   3483 C CD1   . LEU D 2 87  ? -19.556 53.267 60.075  1.00 32.35 ? 87  LEU B CD1   1 
ATOM   3484 C CD2   . LEU D 2 87  ? -19.446 50.954 60.876  1.00 31.42 ? 87  LEU B CD2   1 
ATOM   3485 N N     . GLY D 2 88  ? -23.584 49.513 57.874  1.00 34.20 ? 88  GLY B N     1 
ATOM   3486 C CA    . GLY D 2 88  ? -24.946 49.039 58.045  1.00 35.18 ? 88  GLY B CA    1 
ATOM   3487 C C     . GLY D 2 88  ? -25.110 47.540 57.813  1.00 35.79 ? 88  GLY B C     1 
ATOM   3488 O O     . GLY D 2 88  ? -26.198 46.993 57.994  1.00 38.56 ? 88  GLY B O     1 
ATOM   3489 N N     . SER D 2 89  ? -24.037 46.863 57.420  1.00 33.87 ? 89  SER B N     1 
ATOM   3490 C CA    . SER D 2 89  ? -24.118 45.437 57.141  1.00 31.58 ? 89  SER B CA    1 
ATOM   3491 C C     . SER D 2 89  ? -24.824 44.655 58.251  1.00 29.81 ? 89  SER B C     1 
ATOM   3492 O O     . SER D 2 89  ? -25.282 43.540 58.034  1.00 29.07 ? 89  SER B O     1 
ATOM   3493 C CB    . SER D 2 89  ? -22.723 44.871 56.895  1.00 29.22 ? 89  SER B CB    1 
ATOM   3494 O OG    . SER D 2 89  ? -22.049 44.675 58.117  1.00 33.72 ? 89  SER B OG    1 
ATOM   3495 N N     . TRP D 2 90  ? -24.893 45.237 59.440  1.00 29.90 ? 90  TRP B N     1 
ATOM   3496 C CA    . TRP D 2 90  ? -25.571 44.607 60.569  1.00 32.02 ? 90  TRP B CA    1 
ATOM   3497 C C     . TRP D 2 90  ? -25.907 45.624 61.651  1.00 35.28 ? 90  TRP B C     1 
ATOM   3498 O O     . TRP D 2 90  ? -25.266 46.677 61.760  1.00 36.80 ? 90  TRP B O     1 
ATOM   3499 C CB    . TRP D 2 90  ? -24.736 43.483 61.175  1.00 32.06 ? 90  TRP B CB    1 
ATOM   3500 C CG    . TRP D 2 90  ? -23.411 43.901 61.724  1.00 34.43 ? 90  TRP B CG    1 
ATOM   3501 C CD1   . TRP D 2 90  ? -22.219 43.958 61.050  1.00 35.62 ? 90  TRP B CD1   1 
ATOM   3502 C CD2   . TRP D 2 90  ? -23.131 44.305 63.063  1.00 33.32 ? 90  TRP B CD2   1 
ATOM   3503 N NE1   . TRP D 2 90  ? -21.218 44.368 61.894  1.00 34.58 ? 90  TRP B NE1   1 
ATOM   3504 C CE2   . TRP D 2 90  ? -21.753 44.590 63.136  1.00 33.66 ? 90  TRP B CE2   1 
ATOM   3505 C CE3   . TRP D 2 90  ? -23.910 44.457 64.213  1.00 35.44 ? 90  TRP B CE3   1 
ATOM   3506 C CZ2   . TRP D 2 90  ? -21.141 45.019 64.313  1.00 32.90 ? 90  TRP B CZ2   1 
ATOM   3507 C CZ3   . TRP D 2 90  ? -23.295 44.885 65.388  1.00 33.97 ? 90  TRP B CZ3   1 
ATOM   3508 C CH2   . TRP D 2 90  ? -21.926 45.159 65.424  1.00 32.64 ? 90  TRP B CH2   1 
ATOM   3509 N N     . THR D 2 91  ? -26.930 45.323 62.443  1.00 35.68 ? 91  THR B N     1 
ATOM   3510 C CA    . THR D 2 91  ? -27.333 46.227 63.512  1.00 36.59 ? 91  THR B CA    1 
ATOM   3511 C C     . THR D 2 91  ? -27.596 45.443 64.786  1.00 38.33 ? 91  THR B C     1 
ATOM   3512 O O     . THR D 2 91  ? -27.589 44.207 64.785  1.00 38.01 ? 91  THR B O     1 
ATOM   3513 C CB    . THR D 2 91  ? -28.628 46.965 63.164  1.00 35.51 ? 91  THR B CB    1 
ATOM   3514 O OG1   . THR D 2 91  ? -29.658 45.999 62.947  1.00 36.56 ? 91  THR B OG1   1 
ATOM   3515 C CG2   . THR D 2 91  ? -28.459 47.808 61.926  1.00 33.64 ? 91  THR B CG2   1 
ATOM   3516 N N     . GLY D 2 92  ? -27.835 46.173 65.872  1.00 39.92 ? 92  GLY B N     1 
ATOM   3517 C CA    . GLY D 2 92  ? -28.130 45.529 67.134  1.00 41.39 ? 92  GLY B CA    1 
ATOM   3518 C C     . GLY D 2 92  ? -29.329 44.623 66.935  1.00 43.73 ? 92  GLY B C     1 
ATOM   3519 O O     . GLY D 2 92  ? -29.325 43.475 67.387  1.00 44.89 ? 92  GLY B O     1 
ATOM   3520 N N     . ASP D 2 93  ? -30.343 45.127 66.232  1.00 44.34 ? 93  ASP B N     1 
ATOM   3521 C CA    . ASP D 2 93  ? -31.561 44.358 65.976  1.00 47.18 ? 93  ASP B CA    1 
ATOM   3522 C C     . ASP D 2 93  ? -31.329 43.106 65.129  1.00 47.82 ? 93  ASP B C     1 
ATOM   3523 O O     . ASP D 2 93  ? -31.697 41.988 65.533  1.00 47.15 ? 93  ASP B O     1 
ATOM   3524 C CB    . ASP D 2 93  ? -32.607 45.222 65.275  1.00 50.41 ? 93  ASP B CB    1 
ATOM   3525 C CG    . ASP D 2 93  ? -33.039 46.415 66.107  1.00 56.34 ? 93  ASP B CG    1 
ATOM   3526 O OD1   . ASP D 2 93  ? -33.512 46.211 67.255  1.00 55.62 ? 93  ASP B OD1   1 
ATOM   3527 O OD2   . ASP D 2 93  ? -32.912 47.560 65.598  1.00 58.86 ? 93  ASP B OD2   1 
ATOM   3528 N N     . SER D 2 94  ? -30.728 43.293 63.954  1.00 45.52 ? 94  SER B N     1 
ATOM   3529 C CA    . SER D 2 94  ? -30.480 42.172 63.067  1.00 43.86 ? 94  SER B CA    1 
ATOM   3530 C C     . SER D 2 94  ? -29.687 41.089 63.774  1.00 43.36 ? 94  SER B C     1 
ATOM   3531 O O     . SER D 2 94  ? -29.955 39.907 63.577  1.00 44.26 ? 94  SER B O     1 
ATOM   3532 C CB    . SER D 2 94  ? -29.745 42.629 61.798  1.00 43.83 ? 94  SER B CB    1 
ATOM   3533 O OG    . SER D 2 94  ? -28.393 42.957 62.047  1.00 45.98 ? 94  SER B OG    1 
ATOM   3534 N N     . VAL D 2 95  ? -28.738 41.487 64.619  1.00 41.81 ? 95  VAL B N     1 
ATOM   3535 C CA    . VAL D 2 95  ? -27.910 40.519 65.333  1.00 41.40 ? 95  VAL B CA    1 
ATOM   3536 C C     . VAL D 2 95  ? -28.677 39.771 66.409  1.00 44.07 ? 95  VAL B C     1 
ATOM   3537 O O     . VAL D 2 95  ? -28.630 38.542 66.470  1.00 42.26 ? 95  VAL B O     1 
ATOM   3538 C CB    . VAL D 2 95  ? -26.681 41.195 65.994  1.00 39.65 ? 95  VAL B CB    1 
ATOM   3539 C CG1   . VAL D 2 95  ? -25.928 40.193 66.853  1.00 35.74 ? 95  VAL B CG1   1 
ATOM   3540 C CG2   . VAL D 2 95  ? -25.762 41.747 64.935  1.00 38.83 ? 95  VAL B CG2   1 
ATOM   3541 N N     . ASN D 2 96  ? -29.374 40.515 67.265  1.00 47.50 ? 96  ASN B N     1 
ATOM   3542 C CA    . ASN D 2 96  ? -30.142 39.906 68.348  1.00 50.39 ? 96  ASN B CA    1 
ATOM   3543 C C     . ASN D 2 96  ? -31.228 38.978 67.811  1.00 50.65 ? 96  ASN B C     1 
ATOM   3544 O O     . ASN D 2 96  ? -31.370 37.839 68.274  1.00 50.88 ? 96  ASN B O     1 
ATOM   3545 C CB    . ASN D 2 96  ? -30.767 40.982 69.252  1.00 51.90 ? 96  ASN B CB    1 
ATOM   3546 C CG    . ASN D 2 96  ? -29.818 41.447 70.349  1.00 54.01 ? 96  ASN B CG    1 
ATOM   3547 O OD1   . ASN D 2 96  ? -29.333 40.644 71.144  1.00 56.18 ? 96  ASN B OD1   1 
ATOM   3548 N ND2   . ASN D 2 96  ? -29.553 42.747 70.399  1.00 56.10 ? 96  ASN B ND2   1 
ATOM   3549 N N     . TYR D 2 97  ? -31.996 39.451 66.838  1.00 49.52 ? 97  TYR B N     1 
ATOM   3550 C CA    . TYR D 2 97  ? -33.023 38.593 66.294  1.00 50.79 ? 97  TYR B CA    1 
ATOM   3551 C C     . TYR D 2 97  ? -32.365 37.336 65.757  1.00 49.00 ? 97  TYR B C     1 
ATOM   3552 O O     . TYR D 2 97  ? -32.651 36.238 66.222  1.00 49.39 ? 97  TYR B O     1 
ATOM   3553 C CB    . TYR D 2 97  ? -33.818 39.280 65.175  1.00 54.60 ? 97  TYR B CB    1 
ATOM   3554 C CG    . TYR D 2 97  ? -34.846 38.355 64.551  1.00 59.27 ? 97  TYR B CG    1 
ATOM   3555 C CD1   . TYR D 2 97  ? -35.531 37.411 65.334  1.00 61.54 ? 97  TYR B CD1   1 
ATOM   3556 C CD2   . TYR D 2 97  ? -35.119 38.396 63.183  1.00 61.13 ? 97  TYR B CD2   1 
ATOM   3557 C CE1   . TYR D 2 97  ? -36.457 36.525 64.768  1.00 62.67 ? 97  TYR B CE1   1 
ATOM   3558 C CE2   . TYR D 2 97  ? -36.047 37.516 62.606  1.00 63.36 ? 97  TYR B CE2   1 
ATOM   3559 C CZ    . TYR D 2 97  ? -36.711 36.581 63.406  1.00 63.42 ? 97  TYR B CZ    1 
ATOM   3560 O OH    . TYR D 2 97  ? -37.619 35.703 62.845  1.00 62.98 ? 97  TYR B OH    1 
ATOM   3561 N N     . ALA D 2 98  ? -31.469 37.494 64.791  1.00 46.21 ? 98  ALA B N     1 
ATOM   3562 C CA    . ALA D 2 98  ? -30.806 36.340 64.215  1.00 44.67 ? 98  ALA B CA    1 
ATOM   3563 C C     . ALA D 2 98  ? -30.238 35.428 65.285  1.00 44.16 ? 98  ALA B C     1 
ATOM   3564 O O     . ALA D 2 98  ? -30.139 34.226 65.089  1.00 43.25 ? 98  ALA B O     1 
ATOM   3565 C CB    . ALA D 2 98  ? -29.709 36.782 63.272  1.00 44.28 ? 98  ALA B CB    1 
ATOM   3566 N N     . ALA D 2 99  ? -29.880 35.988 66.431  1.00 45.85 ? 99  ALA B N     1 
ATOM   3567 C CA    . ALA D 2 99  ? -29.306 35.174 67.503  1.00 47.89 ? 99  ALA B CA    1 
ATOM   3568 C C     . ALA D 2 99  ? -30.346 34.334 68.211  1.00 48.69 ? 99  ALA B C     1 
ATOM   3569 O O     . ALA D 2 99  ? -30.084 33.185 68.572  1.00 46.64 ? 99  ALA B O     1 
ATOM   3570 C CB    . ALA D 2 99  ? -28.584 36.060 68.521  1.00 48.91 ? 99  ALA B CB    1 
ATOM   3571 N N     . SER D 2 100 ? -31.522 34.920 68.420  1.00 51.33 ? 100 SER B N     1 
ATOM   3572 C CA    . SER D 2 100 ? -32.613 34.228 69.097  1.00 53.44 ? 100 SER B CA    1 
ATOM   3573 C C     . SER D 2 100 ? -32.900 32.872 68.476  1.00 53.80 ? 100 SER B C     1 
ATOM   3574 O O     . SER D 2 100 ? -33.112 31.900 69.186  1.00 53.84 ? 100 SER B O     1 
ATOM   3575 C CB    . SER D 2 100 ? -33.876 35.090 69.087  1.00 54.60 ? 100 SER B CB    1 
ATOM   3576 O OG    . SER D 2 100 ? -34.166 35.580 67.790  1.00 58.26 ? 100 SER B OG    1 
ATOM   3577 N N     . ARG D 2 101 ? -32.884 32.801 67.152  1.00 55.61 ? 101 ARG B N     1 
ATOM   3578 C CA    . ARG D 2 101 ? -33.148 31.542 66.464  1.00 58.73 ? 101 ARG B CA    1 
ATOM   3579 C C     . ARG D 2 101 ? -32.063 30.487 66.719  1.00 59.80 ? 101 ARG B C     1 
ATOM   3580 O O     . ARG D 2 101 ? -32.063 29.438 66.078  1.00 61.69 ? 101 ARG B O     1 
ATOM   3581 C CB    . ARG D 2 101 ? -33.291 31.781 64.950  1.00 59.45 ? 101 ARG B CB    1 
ATOM   3582 C CG    . ARG D 2 101 ? -34.514 32.605 64.520  1.00 59.62 ? 101 ARG B CG    1 
ATOM   3583 C CD    . ARG D 2 101 ? -35.810 31.795 64.599  1.00 60.18 ? 101 ARG B CD    1 
ATOM   3584 N N     . PHE D 2 102 ? -31.140 30.766 67.639  1.00 60.11 ? 102 PHE B N     1 
ATOM   3585 C CA    . PHE D 2 102 ? -30.064 29.827 67.973  1.00 60.40 ? 102 PHE B CA    1 
ATOM   3586 C C     . PHE D 2 102 ? -29.751 29.912 69.460  1.00 62.14 ? 102 PHE B C     1 
ATOM   3587 O O     . PHE D 2 102 ? -28.997 29.102 69.990  1.00 60.81 ? 102 PHE B O     1 
ATOM   3588 C CB    . PHE D 2 102 ? -28.779 30.133 67.187  1.00 58.67 ? 102 PHE B CB    1 
ATOM   3589 C CG    . PHE D 2 102 ? -29.001 30.385 65.728  1.00 57.05 ? 102 PHE B CG    1 
ATOM   3590 C CD1   . PHE D 2 102 ? -28.911 31.667 65.210  1.00 57.04 ? 102 PHE B CD1   1 
ATOM   3591 C CD2   . PHE D 2 102 ? -29.356 29.356 64.880  1.00 57.18 ? 102 PHE B CD2   1 
ATOM   3592 C CE1   . PHE D 2 102 ? -29.179 31.922 63.865  1.00 56.19 ? 102 PHE B CE1   1 
ATOM   3593 C CE2   . PHE D 2 102 ? -29.626 29.606 63.533  1.00 58.06 ? 102 PHE B CE2   1 
ATOM   3594 C CZ    . PHE D 2 102 ? -29.537 30.892 63.029  1.00 56.03 ? 102 PHE B CZ    1 
ATOM   3595 N N     . LEU D 2 103 ? -30.327 30.911 70.121  1.00 65.51 ? 103 LEU B N     1 
ATOM   3596 C CA    . LEU D 2 103 ? -30.130 31.126 71.549  1.00 68.86 ? 103 LEU B CA    1 
ATOM   3597 C C     . LEU D 2 103 ? -29.786 29.831 72.285  1.00 71.35 ? 103 LEU B C     1 
ATOM   3598 O O     . LEU D 2 103 ? -28.729 29.733 72.918  1.00 73.33 ? 103 LEU B O     1 
ATOM   3599 C CB    . LEU D 2 103 ? -31.387 31.769 72.155  1.00 69.85 ? 103 LEU B CB    1 
ATOM   3600 C CG    . LEU D 2 103 ? -32.751 31.073 72.023  1.00 69.88 ? 103 LEU B CG    1 
ATOM   3601 C CD1   . LEU D 2 103 ? -32.987 30.159 73.210  1.00 70.74 ? 103 LEU B CD1   1 
ATOM   3602 C CD2   . LEU D 2 103 ? -33.854 32.123 71.977  1.00 70.30 ? 103 LEU B CD2   1 
ATOM   3603 N N     . GLY D 2 104 ? -30.672 28.840 72.202  1.00 71.73 ? 104 GLY B N     1 
ATOM   3604 C CA    . GLY D 2 104 ? -30.417 27.567 72.860  1.00 72.42 ? 104 GLY B CA    1 
ATOM   3605 C C     . GLY D 2 104 ? -30.822 27.442 74.323  1.00 72.50 ? 104 GLY B C     1 
ATOM   3606 O O     . GLY D 2 104 ? -30.623 26.383 74.926  1.00 72.66 ? 104 GLY B O     1 
ATOM   3607 N N     . ALA D 2 105 ? -31.377 28.506 74.901  1.00 71.67 ? 105 ALA B N     1 
ATOM   3608 C CA    . ALA D 2 105 ? -31.817 28.485 76.299  1.00 72.43 ? 105 ALA B CA    1 
ATOM   3609 C C     . ALA D 2 105 ? -30.661 28.292 77.282  1.00 71.38 ? 105 ALA B C     1 
ATOM   3610 O O     . ALA D 2 105 ? -30.800 28.540 78.480  1.00 71.77 ? 105 ALA B O     1 
ATOM   3611 C CB    . ALA D 2 105 ? -32.866 27.382 76.504  1.00 74.09 ? 105 ALA B CB    1 
ATOM   3612 N N     . ASN D 2 106 ? -29.529 27.832 76.768  1.00 69.61 ? 106 ASN B N     1 
ATOM   3613 C CA    . ASN D 2 106 ? -28.338 27.631 77.579  1.00 67.62 ? 106 ASN B CA    1 
ATOM   3614 C C     . ASN D 2 106 ? -27.297 28.600 77.007  1.00 65.85 ? 106 ASN B C     1 
ATOM   3615 O O     . ASN D 2 106 ? -27.364 28.952 75.822  1.00 66.33 ? 106 ASN B O     1 
ATOM   3616 C CB    . ASN D 2 106 ? -27.867 26.186 77.456  1.00 67.82 ? 106 ASN B CB    1 
ATOM   3617 C CG    . ASN D 2 106 ? -27.436 25.610 78.776  1.00 69.35 ? 106 ASN B CG    1 
ATOM   3618 O OD1   . ASN D 2 106 ? -28.076 25.844 79.797  1.00 70.50 ? 106 ASN B OD1   1 
ATOM   3619 N ND2   . ASN D 2 106 ? -26.357 24.839 78.766  1.00 71.60 ? 106 ASN B ND2   1 
ATOM   3620 N N     . GLN D 2 107 ? -26.355 29.047 77.835  1.00 61.86 ? 107 GLN B N     1 
ATOM   3621 C CA    . GLN D 2 107 ? -25.346 29.991 77.368  1.00 57.64 ? 107 GLN B CA    1 
ATOM   3622 C C     . GLN D 2 107 ? -24.363 29.369 76.399  1.00 55.93 ? 107 GLN B C     1 
ATOM   3623 O O     . GLN D 2 107 ? -23.860 28.263 76.613  1.00 55.49 ? 107 GLN B O     1 
ATOM   3624 C CB    . GLN D 2 107 ? -24.583 30.604 78.544  1.00 57.27 ? 107 GLN B CB    1 
ATOM   3625 C CG    . GLN D 2 107 ? -23.415 31.490 78.125  1.00 55.19 ? 107 GLN B CG    1 
ATOM   3626 C CD    . GLN D 2 107 ? -23.443 32.867 78.773  1.00 55.90 ? 107 GLN B CD    1 
ATOM   3627 O OE1   . GLN D 2 107 ? -24.316 33.692 78.479  1.00 55.06 ? 107 GLN B OE1   1 
ATOM   3628 N NE2   . GLN D 2 107 ? -22.486 33.123 79.661  1.00 52.02 ? 107 GLN B NE2   1 
ATOM   3629 N N     . VAL D 2 108 ? -24.099 30.102 75.325  1.00 53.12 ? 108 VAL B N     1 
ATOM   3630 C CA    . VAL D 2 108 ? -23.182 29.670 74.288  1.00 52.59 ? 108 VAL B CA    1 
ATOM   3631 C C     . VAL D 2 108 ? -22.200 30.803 73.998  1.00 51.37 ? 108 VAL B C     1 
ATOM   3632 O O     . VAL D 2 108 ? -22.513 31.971 74.236  1.00 51.52 ? 108 VAL B O     1 
ATOM   3633 C CB    . VAL D 2 108 ? -23.955 29.324 73.010  1.00 54.19 ? 108 VAL B CB    1 
ATOM   3634 C CG1   . VAL D 2 108 ? -24.913 28.176 73.296  1.00 54.71 ? 108 VAL B CG1   1 
ATOM   3635 C CG2   . VAL D 2 108 ? -24.736 30.552 72.520  1.00 54.80 ? 108 VAL B CG2   1 
ATOM   3636 N N     . GLY D 2 109 ? -21.022 30.464 73.486  1.00 49.14 ? 109 GLY B N     1 
ATOM   3637 C CA    . GLY D 2 109 ? -20.031 31.485 73.194  1.00 46.41 ? 109 GLY B CA    1 
ATOM   3638 C C     . GLY D 2 109 ? -20.242 32.238 71.893  1.00 45.35 ? 109 GLY B C     1 
ATOM   3639 O O     . GLY D 2 109 ? -20.041 31.682 70.820  1.00 45.95 ? 109 GLY B O     1 
ATOM   3640 N N     . CYS D 2 110 ? -20.649 33.501 71.980  1.00 44.07 ? 110 CYS B N     1 
ATOM   3641 C CA    . CYS D 2 110 ? -20.863 34.323 70.791  1.00 42.48 ? 110 CYS B CA    1 
ATOM   3642 C C     . CYS D 2 110 ? -19.563 35.002 70.381  1.00 41.50 ? 110 CYS B C     1 
ATOM   3643 O O     . CYS D 2 110 ? -18.604 35.025 71.158  1.00 42.87 ? 110 CYS B O     1 
ATOM   3644 C CB    . CYS D 2 110 ? -21.932 35.365 71.056  1.00 42.76 ? 110 CYS B CB    1 
ATOM   3645 S SG    . CYS D 2 110 ? -23.495 34.599 71.396  1.00 46.98 ? 110 CYS B SG    1 
ATOM   3646 N N     . THR D 2 111 ? -19.530 35.557 69.171  1.00 38.88 ? 111 THR B N     1 
ATOM   3647 C CA    . THR D 2 111 ? -18.313 36.174 68.668  1.00 35.43 ? 111 THR B CA    1 
ATOM   3648 C C     . THR D 2 111 ? -18.495 37.063 67.461  1.00 33.63 ? 111 THR B C     1 
ATOM   3649 O O     . THR D 2 111 ? -19.413 36.874 66.679  1.00 34.66 ? 111 THR B O     1 
ATOM   3650 C CB    . THR D 2 111 ? -17.316 35.111 68.228  1.00 35.71 ? 111 THR B CB    1 
ATOM   3651 O OG1   . THR D 2 111 ? -16.919 34.317 69.344  1.00 39.62 ? 111 THR B OG1   1 
ATOM   3652 C CG2   . THR D 2 111 ? -16.107 35.756 67.658  1.00 39.05 ? 111 THR B CG2   1 
ATOM   3653 N N     . TYR D 2 112 ? -17.593 38.029 67.319  1.00 31.09 ? 112 TYR B N     1 
ATOM   3654 C CA    . TYR D 2 112 ? -17.558 38.924 66.172  1.00 27.94 ? 112 TYR B CA    1 
ATOM   3655 C C     . TYR D 2 112 ? -16.074 39.147 65.838  1.00 29.10 ? 112 TYR B C     1 
ATOM   3656 O O     . TYR D 2 112 ? -15.251 39.397 66.725  1.00 29.12 ? 112 TYR B O     1 
ATOM   3657 C CB    . TYR D 2 112 ? -18.218 40.256 66.477  1.00 22.89 ? 112 TYR B CB    1 
ATOM   3658 C CG    . TYR D 2 112 ? -18.141 41.199 65.301  1.00 24.34 ? 112 TYR B CG    1 
ATOM   3659 C CD1   . TYR D 2 112 ? -18.931 40.994 64.176  1.00 25.32 ? 112 TYR B CD1   1 
ATOM   3660 C CD2   . TYR D 2 112 ? -17.259 42.287 65.293  1.00 23.77 ? 112 TYR B CD2   1 
ATOM   3661 C CE1   . TYR D 2 112 ? -18.858 41.838 63.066  1.00 21.40 ? 112 TYR B CE1   1 
ATOM   3662 C CE2   . TYR D 2 112 ? -17.177 43.141 64.189  1.00 22.62 ? 112 TYR B CE2   1 
ATOM   3663 C CZ    . TYR D 2 112 ? -17.989 42.900 63.076  1.00 25.10 ? 112 TYR B CZ    1 
ATOM   3664 O OH    . TYR D 2 112 ? -17.946 43.721 61.969  1.00 25.84 ? 112 TYR B OH    1 
ATOM   3665 N N     . SER D 2 113 ? -15.716 39.019 64.570  1.00 28.87 ? 113 SER B N     1 
ATOM   3666 C CA    . SER D 2 113 ? -14.326 39.221 64.165  1.00 28.59 ? 113 SER B CA    1 
ATOM   3667 C C     . SER D 2 113 ? -14.355 40.010 62.891  1.00 29.27 ? 113 SER B C     1 
ATOM   3668 O O     . SER D 2 113 ? -15.276 39.855 62.092  1.00 33.37 ? 113 SER B O     1 
ATOM   3669 C CB    . SER D 2 113 ? -13.620 37.895 63.888  1.00 26.38 ? 113 SER B CB    1 
ATOM   3670 O OG    . SER D 2 113 ? -13.407 37.165 65.083  1.00 30.36 ? 113 SER B OG    1 
ATOM   3671 N N     . ILE D 2 114 ? -13.364 40.863 62.697  1.00 26.24 ? 114 ILE B N     1 
ATOM   3672 C CA    . ILE D 2 114 ? -13.285 41.654 61.480  1.00 24.17 ? 114 ILE B CA    1 
ATOM   3673 C C     . ILE D 2 114 ? -11.797 41.859 61.194  1.00 24.57 ? 114 ILE B C     1 
ATOM   3674 O O     . ILE D 2 114 ? -10.995 42.013 62.115  1.00 23.25 ? 114 ILE B O     1 
ATOM   3675 C CB    . ILE D 2 114 ? -14.039 43.003 61.655  1.00 20.16 ? 114 ILE B CB    1 
ATOM   3676 C CG1   . ILE D 2 114 ? -13.803 43.917 60.452  1.00 17.64 ? 114 ILE B CG1   1 
ATOM   3677 C CG2   . ILE D 2 114 ? -13.628 43.654 62.936  1.00 18.39 ? 114 ILE B CG2   1 
ATOM   3678 C CD1   . ILE D 2 114 ? -14.621 45.217 60.495  1.00 13.83 ? 114 ILE B CD1   1 
ATOM   3679 N N     . ARG D 2 115 ? -11.423 41.831 59.922  1.00 23.78 ? 115 ARG B N     1 
ATOM   3680 C CA    . ARG D 2 115 ? -10.033 42.000 59.557  1.00 22.83 ? 115 ARG B CA    1 
ATOM   3681 C C     . ARG D 2 115 ? -9.865  42.999 58.431  1.00 23.44 ? 115 ARG B C     1 
ATOM   3682 O O     . ARG D 2 115 ? -10.515 42.890 57.403  1.00 24.78 ? 115 ARG B O     1 
ATOM   3683 C CB    . ARG D 2 115 ? -9.460  40.664 59.121  1.00 24.74 ? 115 ARG B CB    1 
ATOM   3684 C CG    . ARG D 2 115 ? -7.954  40.667 58.905  1.00 28.29 ? 115 ARG B CG    1 
ATOM   3685 C CD    . ARG D 2 115 ? -7.595  39.564 57.947  1.00 33.29 ? 115 ARG B CD    1 
ATOM   3686 N NE    . ARG D 2 115 ? -6.207  39.615 57.507  1.00 36.54 ? 115 ARG B NE    1 
ATOM   3687 C CZ    . ARG D 2 115 ? -5.202  39.068 58.171  1.00 39.94 ? 115 ARG B CZ    1 
ATOM   3688 N NH1   . ARG D 2 115 ? -5.429  38.423 59.310  1.00 41.66 ? 115 ARG B NH1   1 
ATOM   3689 N NH2   . ARG D 2 115 ? -3.973  39.154 57.690  1.00 43.14 ? 115 ARG B NH2   1 
ATOM   3690 N N     . PHE D 2 116 ? -8.981  43.970 58.615  1.00 22.52 ? 116 PHE B N     1 
ATOM   3691 C CA    . PHE D 2 116 ? -8.739  44.956 57.578  1.00 23.78 ? 116 PHE B CA    1 
ATOM   3692 C C     . PHE D 2 116 ? -7.285  45.431 57.632  1.00 25.09 ? 116 PHE B C     1 
ATOM   3693 O O     . PHE D 2 116 ? -6.811  45.852 58.679  1.00 23.62 ? 116 PHE B O     1 
ATOM   3694 C CB    . PHE D 2 116 ? -9.695  46.147 57.754  1.00 23.27 ? 116 PHE B CB    1 
ATOM   3695 C CG    . PHE D 2 116 ? -9.621  47.162 56.639  1.00 21.09 ? 116 PHE B CG    1 
ATOM   3696 C CD1   . PHE D 2 116 ? -9.819  46.777 55.315  1.00 18.28 ? 116 PHE B CD1   1 
ATOM   3697 C CD2   . PHE D 2 116 ? -9.357  48.504 56.915  1.00 19.17 ? 116 PHE B CD2   1 
ATOM   3698 C CE1   . PHE D 2 116 ? -9.754  47.717 54.274  1.00 17.52 ? 116 PHE B CE1   1 
ATOM   3699 C CE2   . PHE D 2 116 ? -9.292  49.444 55.883  1.00 16.47 ? 116 PHE B CE2   1 
ATOM   3700 C CZ    . PHE D 2 116 ? -9.493  49.044 54.561  1.00 14.88 ? 116 PHE B CZ    1 
ATOM   3701 N N     . ARG D 2 117 ? -6.577  45.351 56.505  1.00 28.23 ? 117 ARG B N     1 
ATOM   3702 C CA    . ARG D 2 117 ? -5.184  45.795 56.445  1.00 29.95 ? 117 ARG B CA    1 
ATOM   3703 C C     . ARG D 2 117 ? -4.281  45.125 57.470  1.00 29.44 ? 117 ARG B C     1 
ATOM   3704 O O     . ARG D 2 117 ? -3.560  45.807 58.201  1.00 29.07 ? 117 ARG B O     1 
ATOM   3705 C CB    . ARG D 2 117 ? -5.106  47.315 56.645  1.00 33.12 ? 117 ARG B CB    1 
ATOM   3706 C CG    . ARG D 2 117 ? -5.401  48.141 55.404  1.00 39.68 ? 117 ARG B CG    1 
ATOM   3707 C CD    . ARG D 2 117 ? -5.324  49.626 55.719  1.00 45.70 ? 117 ARG B CD    1 
ATOM   3708 N NE    . ARG D 2 117 ? -5.305  50.438 54.503  1.00 52.88 ? 117 ARG B NE    1 
ATOM   3709 C CZ    . ARG D 2 117 ? -5.444  51.763 54.489  1.00 55.77 ? 117 ARG B CZ    1 
ATOM   3710 N NH1   . ARG D 2 117 ? -5.613  52.424 55.630  1.00 58.16 ? 117 ARG B NH1   1 
ATOM   3711 N NH2   . ARG D 2 117 ? -5.415  52.429 53.338  1.00 56.23 ? 117 ARG B NH2   1 
ATOM   3712 N N     . GLY D 2 118 ? -4.333  43.799 57.546  1.00 29.82 ? 118 GLY B N     1 
ATOM   3713 C CA    . GLY D 2 118 ? -3.471  43.081 58.478  1.00 28.57 ? 118 GLY B CA    1 
ATOM   3714 C C     . GLY D 2 118 ? -3.862  43.052 59.945  1.00 29.49 ? 118 GLY B C     1 
ATOM   3715 O O     . GLY D 2 118 ? -3.270  42.309 60.733  1.00 30.53 ? 118 GLY B O     1 
ATOM   3716 N N     . VAL D 2 119 ? -4.855  43.840 60.334  1.00 27.94 ? 119 VAL B N     1 
ATOM   3717 C CA    . VAL D 2 119 ? -5.262  43.850 61.730  1.00 27.01 ? 119 VAL B CA    1 
ATOM   3718 C C     . VAL D 2 119 ? -6.615  43.195 61.946  1.00 28.85 ? 119 VAL B C     1 
ATOM   3719 O O     . VAL D 2 119 ? -7.578  43.499 61.246  1.00 31.98 ? 119 VAL B O     1 
ATOM   3720 C CB    . VAL D 2 119 ? -5.287  45.272 62.268  1.00 25.23 ? 119 VAL B CB    1 
ATOM   3721 C CG1   . VAL D 2 119 ? -5.723  45.280 63.711  1.00 23.14 ? 119 VAL B CG1   1 
ATOM   3722 C CG2   . VAL D 2 119 ? -3.899  45.871 62.131  1.00 25.91 ? 119 VAL B CG2   1 
ATOM   3723 N N     . SER D 2 120 ? -6.680  42.284 62.916  1.00 27.99 ? 120 SER B N     1 
ATOM   3724 C CA    . SER D 2 120 ? -7.912  41.579 63.227  1.00 25.24 ? 120 SER B CA    1 
ATOM   3725 C C     . SER D 2 120 ? -8.421  41.888 64.630  1.00 24.64 ? 120 SER B C     1 
ATOM   3726 O O     . SER D 2 120 ? -7.648  41.953 65.579  1.00 24.62 ? 120 SER B O     1 
ATOM   3727 C CB    . SER D 2 120 ? -7.683  40.090 63.088  1.00 25.09 ? 120 SER B CB    1 
ATOM   3728 O OG    . SER D 2 120 ? -8.399  39.390 64.086  1.00 32.20 ? 120 SER B OG    1 
ATOM   3729 N N     . VAL D 2 121 ? -9.728  42.090 64.755  1.00 24.36 ? 121 VAL B N     1 
ATOM   3730 C CA    . VAL D 2 121 ? -10.346 42.374 66.047  1.00 23.59 ? 121 VAL B CA    1 
ATOM   3731 C C     . VAL D 2 121 ? -11.418 41.326 66.296  1.00 25.44 ? 121 VAL B C     1 
ATOM   3732 O O     . VAL D 2 121 ? -12.281 41.117 65.444  1.00 28.68 ? 121 VAL B O     1 
ATOM   3733 C CB    . VAL D 2 121 ? -11.044 43.749 66.081  1.00 20.78 ? 121 VAL B CB    1 
ATOM   3734 C CG1   . VAL D 2 121 ? -11.621 43.994 67.472  1.00 20.37 ? 121 VAL B CG1   1 
ATOM   3735 C CG2   . VAL D 2 121 ? -10.068 44.849 65.734  1.00 20.10 ? 121 VAL B CG2   1 
ATOM   3736 N N     . THR D 2 122 ? -11.370 40.675 67.452  1.00 24.71 ? 122 THR B N     1 
ATOM   3737 C CA    . THR D 2 122 ? -12.355 39.674 67.787  1.00 25.70 ? 122 THR B CA    1 
ATOM   3738 C C     . THR D 2 122 ? -12.996 40.001 69.128  1.00 26.99 ? 122 THR B C     1 
ATOM   3739 O O     . THR D 2 122 ? -12.294 40.148 70.122  1.00 29.40 ? 122 THR B O     1 
ATOM   3740 C CB    . THR D 2 122 ? -11.706 38.281 67.846  1.00 28.02 ? 122 THR B CB    1 
ATOM   3741 O OG1   . THR D 2 122 ? -11.156 37.955 66.568  1.00 28.32 ? 122 THR B OG1   1 
ATOM   3742 C CG2   . THR D 2 122 ? -12.740 37.216 68.188  1.00 30.10 ? 122 THR B CG2   1 
ATOM   3743 N N     . ILE D 2 123 ? -14.325 40.132 69.153  1.00 27.18 ? 123 ILE B N     1 
ATOM   3744 C CA    . ILE D 2 123 ? -15.073 40.426 70.386  1.00 27.13 ? 123 ILE B CA    1 
ATOM   3745 C C     . ILE D 2 123 ? -15.717 39.108 70.817  1.00 28.32 ? 123 ILE B C     1 
ATOM   3746 O O     . ILE D 2 123 ? -16.571 38.596 70.107  1.00 30.79 ? 123 ILE B O     1 
ATOM   3747 C CB    . ILE D 2 123 ? -16.227 41.443 70.137  1.00 27.96 ? 123 ILE B CB    1 
ATOM   3748 C CG1   . ILE D 2 123 ? -15.709 42.693 69.424  1.00 27.16 ? 123 ILE B CG1   1 
ATOM   3749 C CG2   . ILE D 2 123 ? -16.903 41.798 71.444  1.00 24.77 ? 123 ILE B CG2   1 
ATOM   3750 C CD1   . ILE D 2 123 ? -14.702 43.467 70.190  1.00 29.87 ? 123 ILE B CD1   1 
ATOM   3751 N N     . SER D 2 124 ? -15.320 38.567 71.964  1.00 28.87 ? 124 SER B N     1 
ATOM   3752 C CA    . SER D 2 124 ? -15.844 37.289 72.462  1.00 29.66 ? 124 SER B CA    1 
ATOM   3753 C C     . SER D 2 124 ? -16.677 37.413 73.744  1.00 32.68 ? 124 SER B C     1 
ATOM   3754 O O     . SER D 2 124 ? -16.264 38.066 74.701  1.00 34.42 ? 124 SER B O     1 
ATOM   3755 C CB    . SER D 2 124 ? -14.688 36.336 72.753  1.00 29.06 ? 124 SER B CB    1 
ATOM   3756 O OG    . SER D 2 124 ? -13.910 36.047 71.608  1.00 33.17 ? 124 SER B OG    1 
ATOM   3757 N N     . GLY D 2 125 ? -17.834 36.764 73.786  1.00 34.85 ? 125 GLY B N     1 
ATOM   3758 C CA    . GLY D 2 125 ? -18.655 36.836 74.984  1.00 35.40 ? 125 GLY B CA    1 
ATOM   3759 C C     . GLY D 2 125 ? -19.760 35.801 75.078  1.00 37.20 ? 125 GLY B C     1 
ATOM   3760 O O     . GLY D 2 125 ? -20.168 35.224 74.079  1.00 38.77 ? 125 GLY B O     1 
ATOM   3761 N N     . GLY D 2 126 ? -20.234 35.549 76.292  1.00 37.90 ? 126 GLY B N     1 
ATOM   3762 C CA    . GLY D 2 126 ? -21.312 34.605 76.479  1.00 37.45 ? 126 GLY B CA    1 
ATOM   3763 C C     . GLY D 2 126 ? -22.597 35.279 76.041  1.00 39.52 ? 126 GLY B C     1 
ATOM   3764 O O     . GLY D 2 126 ? -22.769 36.494 76.216  1.00 40.71 ? 126 GLY B O     1 
ATOM   3765 N N     . SER D 2 127 ? -23.503 34.489 75.475  1.00 38.66 ? 127 SER B N     1 
ATOM   3766 C CA    . SER D 2 127 ? -24.779 34.979 74.985  1.00 37.38 ? 127 SER B CA    1 
ATOM   3767 C C     . SER D 2 127 ? -25.394 36.030 75.887  1.00 37.06 ? 127 SER B C     1 
ATOM   3768 O O     . SER D 2 127 ? -26.029 36.972 75.411  1.00 36.41 ? 127 SER B O     1 
ATOM   3769 C CB    . SER D 2 127 ? -25.742 33.808 74.840  1.00 40.40 ? 127 SER B CB    1 
ATOM   3770 O OG    . SER D 2 127 ? -25.051 32.572 74.996  1.00 44.97 ? 127 SER B OG    1 
ATOM   3771 N N     . ARG D 2 128 ? -25.210 35.878 77.194  1.00 38.28 ? 128 ARG B N     1 
ATOM   3772 C CA    . ARG D 2 128 ? -25.786 36.835 78.131  1.00 40.80 ? 128 ARG B CA    1 
ATOM   3773 C C     . ARG D 2 128 ? -25.281 38.255 77.851  1.00 42.53 ? 128 ARG B C     1 
ATOM   3774 O O     . ARG D 2 128 ? -26.042 39.220 77.948  1.00 41.54 ? 128 ARG B O     1 
ATOM   3775 C CB    . ARG D 2 128 ? -25.461 36.434 79.574  1.00 38.75 ? 128 ARG B CB    1 
ATOM   3776 N N     . THR D 2 129 ? -24.009 38.372 77.469  1.00 43.26 ? 129 THR B N     1 
ATOM   3777 C CA    . THR D 2 129 ? -23.403 39.678 77.207  1.00 45.20 ? 129 THR B CA    1 
ATOM   3778 C C     . THR D 2 129 ? -23.547 40.154 75.775  1.00 45.92 ? 129 THR B C     1 
ATOM   3779 O O     . THR D 2 129 ? -22.945 41.154 75.393  1.00 48.20 ? 129 THR B O     1 
ATOM   3780 C CB    . THR D 2 129 ? -21.917 39.659 77.472  1.00 45.51 ? 129 THR B CB    1 
ATOM   3781 O OG1   . THR D 2 129 ? -21.270 39.017 76.365  1.00 46.95 ? 129 THR B OG1   1 
ATOM   3782 C CG2   . THR D 2 129 ? -21.607 38.888 78.752  1.00 46.10 ? 129 THR B CG2   1 
ATOM   3783 N N     . LEU D 2 130 ? -24.339 39.446 74.983  1.00 45.47 ? 130 LEU B N     1 
ATOM   3784 C CA    . LEU D 2 130 ? -24.517 39.801 73.583  1.00 43.13 ? 130 LEU B CA    1 
ATOM   3785 C C     . LEU D 2 130 ? -24.814 41.271 73.311  1.00 44.19 ? 130 LEU B C     1 
ATOM   3786 O O     . LEU D 2 130 ? -24.453 41.793 72.258  1.00 45.93 ? 130 LEU B O     1 
ATOM   3787 C CB    . LEU D 2 130 ? -25.621 38.948 72.970  1.00 40.95 ? 130 LEU B CB    1 
ATOM   3788 C CG    . LEU D 2 130 ? -25.882 39.261 71.500  1.00 40.81 ? 130 LEU B CG    1 
ATOM   3789 C CD1   . LEU D 2 130 ? -24.653 38.905 70.696  1.00 40.83 ? 130 LEU B CD1   1 
ATOM   3790 C CD2   . LEU D 2 130 ? -27.073 38.480 71.015  1.00 40.45 ? 130 LEU B CD2   1 
ATOM   3791 N N     . GLN D 2 131 ? -25.460 41.954 74.246  1.00 44.25 ? 131 GLN B N     1 
ATOM   3792 C CA    . GLN D 2 131 ? -25.793 43.345 74.004  1.00 44.59 ? 131 GLN B CA    1 
ATOM   3793 C C     . GLN D 2 131 ? -24.563 44.226 74.038  1.00 43.62 ? 131 GLN B C     1 
ATOM   3794 O O     . GLN D 2 131 ? -24.475 45.219 73.315  1.00 42.61 ? 131 GLN B O     1 
ATOM   3795 C CB    . GLN D 2 131 ? -26.810 43.839 75.024  1.00 48.41 ? 131 GLN B CB    1 
ATOM   3796 C CG    . GLN D 2 131 ? -27.372 45.197 74.676  1.00 52.41 ? 131 GLN B CG    1 
ATOM   3797 C CD    . GLN D 2 131 ? -27.790 45.276 73.225  1.00 57.86 ? 131 GLN B CD    1 
ATOM   3798 O OE1   . GLN D 2 131 ? -28.657 44.517 72.768  1.00 60.39 ? 131 GLN B OE1   1 
ATOM   3799 N NE2   . GLN D 2 131 ? -27.167 46.189 72.481  1.00 60.06 ? 131 GLN B NE2   1 
ATOM   3800 N N     . HIS D 2 132 ? -23.613 43.874 74.889  1.00 41.38 ? 132 HIS B N     1 
ATOM   3801 C CA    . HIS D 2 132 ? -22.395 44.655 74.972  1.00 40.57 ? 132 HIS B CA    1 
ATOM   3802 C C     . HIS D 2 132 ? -21.492 44.296 73.794  1.00 38.55 ? 132 HIS B C     1 
ATOM   3803 O O     . HIS D 2 132 ? -20.835 45.168 73.217  1.00 37.60 ? 132 HIS B O     1 
ATOM   3804 C CB    . HIS D 2 132 ? -21.692 44.402 76.309  1.00 41.41 ? 132 HIS B CB    1 
ATOM   3805 C CG    . HIS D 2 132 ? -22.416 44.988 77.483  1.00 42.74 ? 132 HIS B CG    1 
ATOM   3806 N ND1   . HIS D 2 132 ? -22.913 46.276 77.481  1.00 43.41 ? 132 HIS B ND1   1 
ATOM   3807 C CD2   . HIS D 2 132 ? -22.706 44.474 78.702  1.00 42.03 ? 132 HIS B CD2   1 
ATOM   3808 C CE1   . HIS D 2 132 ? -23.479 46.529 78.648  1.00 43.84 ? 132 HIS B CE1   1 
ATOM   3809 N NE2   . HIS D 2 132 ? -23.367 45.452 79.406  1.00 44.46 ? 132 HIS B NE2   1 
ATOM   3810 N N     . LEU D 2 133 ? -21.470 43.015 73.433  1.00 36.07 ? 133 LEU B N     1 
ATOM   3811 C CA    . LEU D 2 133 ? -20.667 42.570 72.305  1.00 34.94 ? 133 LEU B CA    1 
ATOM   3812 C C     . LEU D 2 133 ? -21.004 43.444 71.106  1.00 34.06 ? 133 LEU B C     1 
ATOM   3813 O O     . LEU D 2 133 ? -20.109 43.899 70.389  1.00 34.29 ? 133 LEU B O     1 
ATOM   3814 C CB    . LEU D 2 133 ? -20.956 41.104 71.958  1.00 34.73 ? 133 LEU B CB    1 
ATOM   3815 C CG    . LEU D 2 133 ? -20.667 40.087 73.053  1.00 35.99 ? 133 LEU B CG    1 
ATOM   3816 C CD1   . LEU D 2 133 ? -20.622 38.669 72.507  1.00 34.52 ? 133 LEU B CD1   1 
ATOM   3817 C CD2   . LEU D 2 133 ? -19.329 40.425 73.649  1.00 38.44 ? 133 LEU B CD2   1 
ATOM   3818 N N     . CYS D 2 134 ? -22.292 43.695 70.894  1.00 31.70 ? 134 CYS B N     1 
ATOM   3819 C CA    . CYS D 2 134 ? -22.688 44.522 69.764  1.00 33.31 ? 134 CYS B CA    1 
ATOM   3820 C C     . CYS D 2 134 ? -22.160 45.937 69.876  1.00 34.78 ? 134 CYS B C     1 
ATOM   3821 O O     . CYS D 2 134 ? -21.824 46.565 68.871  1.00 38.05 ? 134 CYS B O     1 
ATOM   3822 C CB    . CYS D 2 134 ? -24.202 44.546 69.616  1.00 32.24 ? 134 CYS B CB    1 
ATOM   3823 S SG    . CYS D 2 134 ? -24.863 42.949 69.156  1.00 30.59 ? 134 CYS B SG    1 
ATOM   3824 N N     . GLU D 2 135 ? -22.080 46.445 71.097  1.00 35.44 ? 135 GLU B N     1 
ATOM   3825 C CA    . GLU D 2 135 ? -21.574 47.791 71.311  1.00 36.03 ? 135 GLU B CA    1 
ATOM   3826 C C     . GLU D 2 135 ? -20.082 47.856 71.013  1.00 34.99 ? 135 GLU B C     1 
ATOM   3827 O O     . GLU D 2 135 ? -19.618 48.738 70.276  1.00 32.76 ? 135 GLU B O     1 
ATOM   3828 C CB    . GLU D 2 135 ? -21.823 48.215 72.749  1.00 39.39 ? 135 GLU B CB    1 
ATOM   3829 C CG    . GLU D 2 135 ? -22.948 49.192 72.905  1.00 44.63 ? 135 GLU B CG    1 
ATOM   3830 C CD    . GLU D 2 135 ? -23.706 48.951 74.189  1.00 48.88 ? 135 GLU B CD    1 
ATOM   3831 O OE1   . GLU D 2 135 ? -23.051 48.655 75.217  1.00 49.83 ? 135 GLU B OE1   1 
ATOM   3832 O OE2   . GLU D 2 135 ? -24.955 49.059 74.168  1.00 51.53 ? 135 GLU B OE2   1 
ATOM   3833 N N     . MET D 2 136 ? -19.327 46.928 71.594  1.00 32.40 ? 136 MET B N     1 
ATOM   3834 C CA    . MET D 2 136 ? -17.901 46.919 71.355  1.00 31.74 ? 136 MET B CA    1 
ATOM   3835 C C     . MET D 2 136 ? -17.627 46.652 69.884  1.00 32.46 ? 136 MET B C     1 
ATOM   3836 O O     . MET D 2 136 ? -16.805 47.330 69.274  1.00 34.37 ? 136 MET B O     1 
ATOM   3837 C CB    . MET D 2 136 ? -17.213 45.858 72.199  1.00 30.19 ? 136 MET B CB    1 
ATOM   3838 C CG    . MET D 2 136 ? -16.936 46.284 73.611  1.00 33.65 ? 136 MET B CG    1 
ATOM   3839 S SD    . MET D 2 136 ? -15.901 47.766 73.728  1.00 35.22 ? 136 MET B SD    1 
ATOM   3840 C CE    . MET D 2 136 ? -14.487 47.314 72.762  1.00 30.25 ? 136 MET B CE    1 
ATOM   3841 N N     . ALA D 2 137 ? -18.324 45.672 69.316  1.00 29.49 ? 137 ALA B N     1 
ATOM   3842 C CA    . ALA D 2 137 ? -18.128 45.305 67.922  1.00 26.29 ? 137 ALA B CA    1 
ATOM   3843 C C     . ALA D 2 137 ? -18.325 46.456 66.955  1.00 24.71 ? 137 ALA B C     1 
ATOM   3844 O O     . ALA D 2 137 ? -17.552 46.624 66.028  1.00 24.19 ? 137 ALA B O     1 
ATOM   3845 C CB    . ALA D 2 137 ? -19.060 44.162 67.551  1.00 25.10 ? 137 ALA B CB    1 
ATOM   3846 N N     . ILE D 2 138 ? -19.362 47.253 67.148  1.00 24.60 ? 138 ILE B N     1 
ATOM   3847 C CA    . ILE D 2 138 ? -19.576 48.339 66.211  1.00 25.72 ? 138 ILE B CA    1 
ATOM   3848 C C     . ILE D 2 138 ? -18.495 49.404 66.336  1.00 26.58 ? 138 ILE B C     1 
ATOM   3849 O O     . ILE D 2 138 ? -18.073 49.985 65.335  1.00 28.23 ? 138 ILE B O     1 
ATOM   3850 C CB    . ILE D 2 138 ? -20.972 48.977 66.380  1.00 25.12 ? 138 ILE B CB    1 
ATOM   3851 C CG1   . ILE D 2 138 ? -21.282 49.848 65.165  1.00 23.04 ? 138 ILE B CG1   1 
ATOM   3852 C CG2   . ILE D 2 138 ? -21.032 49.818 67.643  1.00 25.82 ? 138 ILE B CG2   1 
ATOM   3853 C CD1   . ILE D 2 138 ? -21.152 49.106 63.853  1.00 23.02 ? 138 ILE B CD1   1 
ATOM   3854 N N     . ARG D 2 139 ? -18.048 49.659 67.561  1.00 27.83 ? 139 ARG B N     1 
ATOM   3855 C CA    . ARG D 2 139 ? -17.010 50.641 67.797  1.00 29.23 ? 139 ARG B CA    1 
ATOM   3856 C C     . ARG D 2 139 ? -15.702 50.135 67.192  1.00 29.60 ? 139 ARG B C     1 
ATOM   3857 O O     . ARG D 2 139 ? -15.005 50.886 66.507  1.00 33.09 ? 139 ARG B O     1 
ATOM   3858 C CB    . ARG D 2 139 ? -16.881 50.913 69.298  1.00 33.28 ? 139 ARG B CB    1 
ATOM   3859 C CG    . ARG D 2 139 ? -18.118 51.619 69.862  1.00 40.55 ? 139 ARG B CG    1 
ATOM   3860 C CD    . ARG D 2 139 ? -18.017 51.970 71.355  1.00 47.81 ? 139 ARG B CD    1 
ATOM   3861 N NE    . ARG D 2 139 ? -19.224 52.662 71.836  1.00 54.24 ? 139 ARG B NE    1 
ATOM   3862 C CZ    . ARG D 2 139 ? -19.608 53.885 71.451  1.00 57.05 ? 139 ARG B CZ    1 
ATOM   3863 N NH1   . ARG D 2 139 ? -18.887 54.583 70.578  1.00 58.67 ? 139 ARG B NH1   1 
ATOM   3864 N NH2   . ARG D 2 139 ? -20.729 54.414 71.927  1.00 56.87 ? 139 ARG B NH2   1 
ATOM   3865 N N     . SER D 2 140 ? -15.380 48.864 67.410  1.00 26.35 ? 140 SER B N     1 
ATOM   3866 C CA    . SER D 2 140 ? -14.172 48.277 66.846  1.00 26.16 ? 140 SER B CA    1 
ATOM   3867 C C     . SER D 2 140 ? -14.238 48.386 65.327  1.00 24.73 ? 140 SER B C     1 
ATOM   3868 O O     . SER D 2 140 ? -13.256 48.692 64.654  1.00 24.94 ? 140 SER B O     1 
ATOM   3869 C CB    . SER D 2 140 ? -14.055 46.794 67.220  1.00 28.53 ? 140 SER B CB    1 
ATOM   3870 O OG    . SER D 2 140 ? -13.979 46.613 68.621  1.00 32.74 ? 140 SER B OG    1 
ATOM   3871 N N     . LYS D 2 141 ? -15.404 48.111 64.781  1.00 23.93 ? 141 LYS B N     1 
ATOM   3872 C CA    . LYS D 2 141 ? -15.572 48.192 63.341  1.00 25.40 ? 141 LYS B CA    1 
ATOM   3873 C C     . LYS D 2 141 ? -15.289 49.608 62.830  1.00 26.93 ? 141 LYS B C     1 
ATOM   3874 O O     . LYS D 2 141 ? -14.456 49.788 61.933  1.00 27.19 ? 141 LYS B O     1 
ATOM   3875 C CB    . LYS D 2 141 ? -16.987 47.765 62.954  1.00 23.49 ? 141 LYS B CB    1 
ATOM   3876 C CG    . LYS D 2 141 ? -17.235 47.730 61.470  1.00 22.01 ? 141 LYS B CG    1 
ATOM   3877 C CD    . LYS D 2 141 ? -18.596 47.168 61.205  1.00 19.27 ? 141 LYS B CD    1 
ATOM   3878 C CE    . LYS D 2 141 ? -18.828 46.983 59.755  1.00 17.22 ? 141 LYS B CE    1 
ATOM   3879 N NZ    . LYS D 2 141 ? -19.925 46.037 59.618  1.00 21.66 ? 141 LYS B NZ    1 
ATOM   3880 N N     . GLN D 2 142 ? -15.973 50.607 63.390  1.00 26.98 ? 142 GLN B N     1 
ATOM   3881 C CA    . GLN D 2 142 ? -15.755 51.987 62.960  1.00 28.15 ? 142 GLN B CA    1 
ATOM   3882 C C     . GLN D 2 142 ? -14.285 52.325 62.966  1.00 27.30 ? 142 GLN B C     1 
ATOM   3883 O O     . GLN D 2 142 ? -13.744 52.732 61.959  1.00 28.07 ? 142 GLN B O     1 
ATOM   3884 C CB    . GLN D 2 142 ? -16.428 52.988 63.881  1.00 28.88 ? 142 GLN B CB    1 
ATOM   3885 C CG    . GLN D 2 142 ? -17.870 53.263 63.646  1.00 35.06 ? 142 GLN B CG    1 
ATOM   3886 C CD    . GLN D 2 142 ? -18.347 54.416 64.522  1.00 39.30 ? 142 GLN B CD    1 
ATOM   3887 O OE1   . GLN D 2 142 ? -18.099 54.426 65.735  1.00 40.13 ? 142 GLN B OE1   1 
ATOM   3888 N NE2   . GLN D 2 142 ? -19.029 55.393 63.914  1.00 39.28 ? 142 GLN B NE2   1 
ATOM   3889 N N     . GLU D 2 143 ? -13.650 52.149 64.120  1.00 28.73 ? 143 GLU B N     1 
ATOM   3890 C CA    . GLU D 2 143 ? -12.240 52.476 64.306  1.00 29.27 ? 143 GLU B CA    1 
ATOM   3891 C C     . GLU D 2 143 ? -11.309 51.757 63.338  1.00 27.55 ? 143 GLU B C     1 
ATOM   3892 O O     . GLU D 2 143 ? -10.556 52.394 62.599  1.00 27.88 ? 143 GLU B O     1 
ATOM   3893 C CB    . GLU D 2 143 ? -11.853 52.197 65.767  1.00 31.46 ? 143 GLU B CB    1 
ATOM   3894 C CG    . GLU D 2 143 ? -12.920 52.762 66.729  1.00 40.35 ? 143 GLU B CG    1 
ATOM   3895 C CD    . GLU D 2 143 ? -12.689 52.481 68.223  1.00 44.10 ? 143 GLU B CD    1 
ATOM   3896 O OE1   . GLU D 2 143 ? -12.478 51.306 68.626  1.00 43.48 ? 143 GLU B OE1   1 
ATOM   3897 O OE2   . GLU D 2 143 ? -12.744 53.462 69.003  1.00 47.48 ? 143 GLU B OE2   1 
ATOM   3898 N N     . LEU D 2 144 ? -11.384 50.435 63.319  1.00 26.48 ? 144 LEU B N     1 
ATOM   3899 C CA    . LEU D 2 144 ? -10.530 49.636 62.457  1.00 25.57 ? 144 LEU B CA    1 
ATOM   3900 C C     . LEU D 2 144 ? -10.567 50.084 61.009  1.00 26.01 ? 144 LEU B C     1 
ATOM   3901 O O     . LEU D 2 144 ? -9.535  50.152 60.353  1.00 26.90 ? 144 LEU B O     1 
ATOM   3902 C CB    . LEU D 2 144 ? -10.927 48.169 62.557  1.00 25.52 ? 144 LEU B CB    1 
ATOM   3903 C CG    . LEU D 2 144 ? -10.132 47.207 61.680  1.00 27.02 ? 144 LEU B CG    1 
ATOM   3904 C CD1   . LEU D 2 144 ? -8.677  47.334 62.007  1.00 27.83 ? 144 LEU B CD1   1 
ATOM   3905 C CD2   . LEU D 2 144 ? -10.594 45.778 61.907  1.00 25.56 ? 144 LEU B CD2   1 
ATOM   3906 N N     . LEU D 2 145 ? -11.754 50.419 60.516  1.00 27.24 ? 145 LEU B N     1 
ATOM   3907 C CA    . LEU D 2 145 ? -11.899 50.830 59.127  1.00 27.18 ? 145 LEU B CA    1 
ATOM   3908 C C     . LEU D 2 145 ? -11.395 52.222 58.895  1.00 29.10 ? 145 LEU B C     1 
ATOM   3909 O O     . LEU D 2 145 ? -11.311 52.670 57.759  1.00 27.95 ? 145 LEU B O     1 
ATOM   3910 C CB    . LEU D 2 145 ? -13.352 50.736 58.686  1.00 24.14 ? 145 LEU B CB    1 
ATOM   3911 C CG    . LEU D 2 145 ? -13.868 49.303 58.714  1.00 24.39 ? 145 LEU B CG    1 
ATOM   3912 C CD1   . LEU D 2 145 ? -15.253 49.283 58.164  1.00 23.94 ? 145 LEU B CD1   1 
ATOM   3913 C CD2   . LEU D 2 145 ? -12.944 48.386 57.906  1.00 21.88 ? 145 LEU B CD2   1 
ATOM   3914 N N     . GLN D 2 146 ? -11.041 52.909 59.970  1.00 31.55 ? 146 GLN B N     1 
ATOM   3915 C CA    . GLN D 2 146 ? -10.548 54.256 59.816  1.00 35.73 ? 146 GLN B CA    1 
ATOM   3916 C C     . GLN D 2 146 ? -9.061  54.394 60.111  1.00 40.73 ? 146 GLN B C     1 
ATOM   3917 O O     . GLN D 2 146 ? -8.555  55.498 60.292  1.00 41.67 ? 146 GLN B O     1 
ATOM   3918 C CB    . GLN D 2 146 ? -11.380 55.199 60.668  1.00 35.44 ? 146 GLN B CB    1 
ATOM   3919 C CG    . GLN D 2 146 ? -12.819 55.251 60.202  1.00 33.45 ? 146 GLN B CG    1 
ATOM   3920 C CD    . GLN D 2 146 ? -13.643 56.228 60.980  1.00 35.04 ? 146 GLN B CD    1 
ATOM   3921 O OE1   . GLN D 2 146 ? -13.325 57.415 61.036  1.00 38.61 ? 146 GLN B OE1   1 
ATOM   3922 N NE2   . GLN D 2 146 ? -14.715 55.747 61.586  1.00 33.56 ? 146 GLN B NE2   1 
ATOM   3923 N N     . LEU D 2 147 ? -8.359  53.266 60.159  1.00 46.48 ? 147 LEU B N     1 
ATOM   3924 C CA    . LEU D 2 147 ? -6.914  53.300 60.368  1.00 51.31 ? 147 LEU B CA    1 
ATOM   3925 C C     . LEU D 2 147 ? -6.295  53.748 59.043  1.00 53.79 ? 147 LEU B C     1 
ATOM   3926 O O     . LEU D 2 147 ? -6.729  53.328 57.967  1.00 52.72 ? 147 LEU B O     1 
ATOM   3927 C CB    . LEU D 2 147 ? -6.369  51.912 60.749  1.00 50.91 ? 147 LEU B CB    1 
ATOM   3928 C CG    . LEU D 2 147 ? -6.419  51.529 62.236  1.00 51.58 ? 147 LEU B CG    1 
ATOM   3929 C CD1   . LEU D 2 147 ? -5.977  50.098 62.415  1.00 50.42 ? 147 LEU B CD1   1 
ATOM   3930 C CD2   . LEU D 2 147 ? -5.527  52.451 63.048  1.00 51.86 ? 147 LEU B CD2   1 
ATOM   3931 N N     . THR D 2 148 ? -5.295  54.613 59.119  1.00 57.86 ? 148 THR B N     1 
ATOM   3932 C CA    . THR D 2 148 ? -4.631  55.103 57.917  1.00 63.24 ? 148 THR B CA    1 
ATOM   3933 C C     . THR D 2 148 ? -3.122  54.963 58.105  1.00 65.67 ? 148 THR B C     1 
ATOM   3934 O O     . THR D 2 148 ? -2.585  55.311 59.163  1.00 65.56 ? 148 THR B O     1 
ATOM   3935 C CB    . THR D 2 148 ? -5.004  56.595 57.640  1.00 64.67 ? 148 THR B CB    1 
ATOM   3936 O OG1   . THR D 2 148 ? -4.527  56.983 56.344  1.00 65.88 ? 148 THR B OG1   1 
ATOM   3937 C CG2   . THR D 2 148 ? -4.402  57.514 58.707  1.00 64.28 ? 148 THR B CG2   1 
ATOM   3938 N N     . PRO D 2 149 ? -2.422  54.428 57.088  1.00 68.40 ? 149 PRO B N     1 
ATOM   3939 C CA    . PRO D 2 149 ? -0.965  54.238 57.144  1.00 69.89 ? 149 PRO B CA    1 
ATOM   3940 C C     . PRO D 2 149 ? -0.207  55.516 57.529  1.00 70.44 ? 149 PRO B C     1 
ATOM   3941 O O     . PRO D 2 149 ? 0.558   55.534 58.500  1.00 70.71 ? 149 PRO B O     1 
ATOM   3942 C CB    . PRO D 2 149 ? -0.626  53.763 55.730  1.00 69.71 ? 149 PRO B CB    1 
ATOM   3943 C CG    . PRO D 2 149 ? -1.857  52.998 55.339  1.00 69.48 ? 149 PRO B CG    1 
ATOM   3944 C CD    . PRO D 2 149 ? -2.963  53.921 55.814  1.00 69.10 ? 149 PRO B CD    1 
HETATM 3945 O O     . HOH E 3 .   ? -10.540 36.089 70.643  1.00 39.33 ? 22  HOH C O     1 
HETATM 3946 O O     . HOH E 3 .   ? -8.012  38.485 78.968  1.00 46.91 ? 23  HOH C O     1 
HETATM 3947 O O     . HOH E 3 .   ? -2.575  30.200 102.942 1.00 43.21 ? 24  HOH C O     1 
HETATM 3948 O O     . HOH E 3 .   ? -17.397 16.711 93.550  1.00 74.78 ? 25  HOH C O     1 
HETATM 3949 O O     . HOH E 3 .   ? -1.691  34.458 67.940  1.00 55.88 ? 26  HOH C O     1 
HETATM 3950 O O     . HOH E 3 .   ? -5.900  35.916 67.600  1.00 32.10 ? 27  HOH C O     1 
HETATM 3951 O O     . HOH E 3 .   ? 4.459   34.561 99.382  1.00 32.43 ? 28  HOH C O     1 
HETATM 3952 O O     . HOH E 3 .   ? -13.911 33.753 45.888  1.00 34.24 ? 29  HOH C O     1 
HETATM 3953 O O     . HOH E 3 .   ? -9.124  41.317 51.097  1.00 37.59 ? 30  HOH C O     1 
HETATM 3954 O O     . HOH E 3 .   ? -5.428  37.119 79.119  1.00 32.91 ? 31  HOH C O     1 
HETATM 3955 O O     . HOH E 3 .   ? -7.367  32.857 50.328  1.00 53.04 ? 32  HOH C O     1 
HETATM 3956 O O     . HOH E 3 .   ? -5.497  40.915 50.165  1.00 52.04 ? 33  HOH C O     1 
HETATM 3957 O O     . HOH E 3 .   ? -8.153  42.395 47.994  1.00 58.69 ? 34  HOH C O     1 
HETATM 3958 O O     . HOH E 3 .   ? -10.478 30.887 52.613  1.00 45.59 ? 35  HOH C O     1 
HETATM 3959 O O     . HOH E 3 .   ? -2.374  24.335 66.014  1.00 40.70 ? 36  HOH C O     1 
HETATM 3960 O O     . HOH F 3 .   ? -13.894 35.902 59.653  1.00 31.10 ? 22  HOH D O     1 
HETATM 3961 O O     . HOH F 3 .   ? -20.699 27.894 43.264  1.00 60.96 ? 23  HOH D O     1 
HETATM 3962 O O     . HOH F 3 .   ? -0.739  34.067 57.438  1.00 42.54 ? 24  HOH D O     1 
HETATM 3963 O O     . HOH F 3 .   ? 1.643   32.714 55.483  1.00 43.32 ? 25  HOH D O     1 
HETATM 3964 O O     . HOH F 3 .   ? -12.497 28.613 41.984  1.00 33.49 ? 26  HOH D O     1 
HETATM 3965 O O     . HOH F 3 .   ? -1.205  40.632 60.149  1.00 27.94 ? 27  HOH D O     1 
HETATM 3966 O O     . HOH F 3 .   ? 0.764   41.416 58.097  1.00 29.70 ? 28  HOH D O     1 
HETATM 3967 O O     . HOH F 3 .   ? -6.657  29.209 61.408  1.00 43.97 ? 29  HOH D O     1 
HETATM 3968 O O     . HOH F 3 .   ? 0.509   29.303 48.987  1.00 60.09 ? 30  HOH D O     1 
HETATM 3969 O O     . HOH G 3 .   ? 15.129  36.477 63.502  1.00 49.25 ? 173 HOH A O     1 
HETATM 3970 O O     . HOH G 3 .   ? 15.131  39.573 77.009  1.00 58.14 ? 174 HOH A O     1 
HETATM 3971 O O     . HOH G 3 .   ? -28.433 48.148 84.476  1.00 51.78 ? 175 HOH A O     1 
HETATM 3972 O O     . HOH G 3 .   ? -15.392 55.764 71.107  1.00 63.95 ? 176 HOH A O     1 
HETATM 3973 O O     . HOH G 3 .   ? 4.142   42.303 87.799  1.00 36.91 ? 177 HOH A O     1 
HETATM 3974 O O     . HOH G 3 .   ? -23.699 40.844 96.498  1.00 50.53 ? 178 HOH A O     1 
HETATM 3975 O O     . HOH G 3 .   ? 6.842   33.288 62.298  1.00 63.72 ? 179 HOH A O     1 
HETATM 3976 O O     . HOH G 3 .   ? -0.733  53.383 71.960  1.00 41.68 ? 180 HOH A O     1 
HETATM 3977 O O     . HOH G 3 .   ? 0.215   54.817 74.224  1.00 51.68 ? 181 HOH A O     1 
HETATM 3978 O O     . HOH G 3 .   ? -12.016 59.571 90.108  1.00 42.98 ? 182 HOH A O     1 
HETATM 3979 O O     . HOH G 3 .   ? 3.230   33.702 65.967  1.00 45.20 ? 183 HOH A O     1 
HETATM 3980 O O     . HOH G 3 .   ? -0.259  52.272 90.234  1.00 35.22 ? 184 HOH A O     1 
HETATM 3981 O O     . HOH G 3 .   ? 3.753   55.908 73.408  1.00 45.34 ? 185 HOH A O     1 
HETATM 3982 O O     . HOH G 3 .   ? 14.805  40.755 57.380  1.00 48.41 ? 186 HOH A O     1 
HETATM 3983 O O     . HOH G 3 .   ? 1.955   35.253 80.562  1.00 38.12 ? 187 HOH A O     1 
HETATM 3984 O O     . HOH G 3 .   ? -15.672 39.558 90.786  1.00 65.78 ? 188 HOH A O     1 
HETATM 3985 O O     . HOH G 3 .   ? -22.339 42.425 88.561  1.00 51.51 ? 189 HOH A O     1 
HETATM 3986 O O     . HOH G 3 .   ? -19.881 41.727 92.497  1.00 51.26 ? 190 HOH A O     1 
HETATM 3987 O O     . HOH G 3 .   ? 12.728  34.279 71.864  1.00 46.30 ? 191 HOH A O     1 
HETATM 3988 O O     . HOH G 3 .   ? -9.592  59.750 83.397  1.00 41.00 ? 192 HOH A O     1 
HETATM 3989 O O     . HOH G 3 .   ? -16.873 33.662 100.916 1.00 49.89 ? 193 HOH A O     1 
HETATM 3990 O O     . HOH G 3 .   ? 2.544   54.809 83.958  1.00 40.01 ? 194 HOH A O     1 
HETATM 3991 O O     . HOH G 3 .   ? -23.710 44.813 90.002  1.00 53.42 ? 195 HOH A O     1 
HETATM 3992 O O     . HOH G 3 .   ? 10.424  32.115 71.639  1.00 58.43 ? 196 HOH A O     1 
HETATM 3993 O O     . HOH G 3 .   ? 6.412   46.725 85.848  1.00 51.30 ? 197 HOH A O     1 
HETATM 3994 O O     . HOH G 3 .   ? 8.647   42.891 62.837  1.00 50.33 ? 198 HOH A O     1 
HETATM 3995 O O     . HOH G 3 .   ? 17.400  42.561 61.593  1.00 55.85 ? 199 HOH A O     1 
HETATM 3996 O O     . HOH G 3 .   ? 12.584  43.039 66.234  1.00 58.55 ? 200 HOH A O     1 
HETATM 3997 O O     . HOH G 3 .   ? -2.840  50.971 78.241  1.00 35.80 ? 201 HOH A O     1 
HETATM 3998 O O     . HOH G 3 .   ? -7.368  52.137 90.961  1.00 34.97 ? 202 HOH A O     1 
HETATM 3999 O O     . HOH G 3 .   ? 4.554   33.088 78.291  1.00 25.81 ? 203 HOH A O     1 
HETATM 4000 O O     . HOH G 3 .   ? -12.123 38.272 72.135  1.00 20.08 ? 204 HOH A O     1 
HETATM 4001 O O     . HOH G 3 .   ? 3.755   38.373 82.888  1.00 33.65 ? 205 HOH A O     1 
HETATM 4002 O O     . HOH G 3 .   ? 9.244   47.969 77.904  1.00 35.79 ? 206 HOH A O     1 
HETATM 4003 O O     . HOH G 3 .   ? 5.848   54.858 78.318  1.00 43.15 ? 207 HOH A O     1 
HETATM 4004 O O     . HOH G 3 .   ? -0.461  55.126 85.706  1.00 48.40 ? 208 HOH A O     1 
HETATM 4005 O O     . HOH G 3 .   ? -4.817  39.942 97.788  1.00 44.58 ? 209 HOH A O     1 
HETATM 4006 O O     . HOH G 3 .   ? 3.337   42.473 91.501  1.00 44.28 ? 210 HOH A O     1 
HETATM 4007 O O     . HOH G 3 .   ? 7.626   46.225 63.898  1.00 44.09 ? 211 HOH A O     1 
HETATM 4008 O O     . HOH G 3 .   ? -24.354 41.481 91.365  1.00 67.83 ? 212 HOH A O     1 
HETATM 4009 O O     . HOH G 3 .   ? 0.655   39.241 92.399  1.00 57.08 ? 213 HOH A O     1 
HETATM 4010 O O     . HOH G 3 .   ? 0.433   54.641 88.646  1.00 37.52 ? 214 HOH A O     1 
HETATM 4011 O O     . HOH G 3 .   ? -22.086 40.002 93.976  1.00 54.56 ? 215 HOH A O     1 
HETATM 4012 O O     . HOH G 3 .   ? 3.221   48.849 62.644  1.00 40.97 ? 216 HOH A O     1 
HETATM 4013 O O     . HOH H 3 .   ? -12.441 38.236 59.858  1.00 37.40 ? 173 HOH B O     1 
HETATM 4014 O O     . HOH H 3 .   ? -6.014  55.652 52.594  1.00 48.16 ? 174 HOH B O     1 
HETATM 4015 O O     . HOH H 3 .   ? -29.920 54.899 67.156  1.00 51.17 ? 175 HOH B O     1 
HETATM 4016 O O     . HOH H 3 .   ? -30.365 47.844 66.254  1.00 47.07 ? 176 HOH B O     1 
HETATM 4017 O O     . HOH H 3 .   ? -20.584 56.894 59.861  1.00 46.09 ? 177 HOH B O     1 
HETATM 4018 O O     . HOH H 3 .   ? -12.035 34.045 58.115  1.00 38.31 ? 178 HOH B O     1 
HETATM 4019 O O     . HOH H 3 .   ? -28.048 28.384 53.157  1.00 40.21 ? 179 HOH B O     1 
HETATM 4020 O O     . HOH H 3 .   ? -24.902 37.197 51.268  1.00 38.19 ? 180 HOH B O     1 
HETATM 4021 O O     . HOH H 3 .   ? -32.325 31.642 46.484  1.00 42.57 ? 181 HOH B O     1 
HETATM 4022 O O     . HOH H 3 .   ? -28.237 26.091 66.870  1.00 47.84 ? 182 HOH B O     1 
HETATM 4023 O O     . HOH H 3 .   ? -19.928 53.475 48.502  1.00 39.39 ? 183 HOH B O     1 
HETATM 4024 O O     . HOH H 3 .   ? -24.120 26.704 69.023  1.00 36.57 ? 184 HOH B O     1 
HETATM 4025 O O     . HOH H 3 .   ? -30.890 50.658 68.411  1.00 64.56 ? 185 HOH B O     1 
HETATM 4026 O O     . HOH H 3 .   ? -27.736 37.704 52.050  1.00 55.82 ? 186 HOH B O     1 
HETATM 4027 O O     . HOH H 3 .   ? -7.291  31.441 34.567  1.00 48.80 ? 187 HOH B O     1 
HETATM 4028 O O     . HOH H 3 .   ? -3.477  46.107 46.424  1.00 74.53 ? 188 HOH B O     1 
HETATM 4029 O O     . HOH H 3 .   ? -28.210 52.867 68.651  1.00 69.38 ? 189 HOH B O     1 
HETATM 4030 O O     . HOH H 3 .   ? 3.128   54.613 55.113  1.00 51.11 ? 190 HOH B O     1 
HETATM 4031 O O     . HOH H 3 .   ? -17.994 27.516 59.396  1.00 44.32 ? 191 HOH B O     1 
HETATM 4032 O O     . HOH H 3 .   ? -26.552 28.223 69.126  1.00 43.24 ? 192 HOH B O     1 
HETATM 4033 O O     . HOH H 3 .   ? -32.312 23.789 74.926  1.00 48.56 ? 193 HOH B O     1 
HETATM 4034 O O     . HOH H 3 .   ? -22.981 33.215 56.404  1.00 36.31 ? 194 HOH B O     1 
HETATM 4035 O O     . HOH H 3 .   ? -21.958 46.955 61.220  1.00 31.57 ? 195 HOH B O     1 
HETATM 4036 O O     . HOH H 3 .   ? -5.694  41.763 55.486  1.00 31.40 ? 196 HOH B O     1 
HETATM 4037 O O     . HOH H 3 .   ? -21.167 28.392 60.224  1.00 25.38 ? 197 HOH B O     1 
HETATM 4038 O O     . HOH H 3 .   ? -16.561 38.475 41.153  1.00 36.04 ? 198 HOH B O     1 
HETATM 4039 O O     . HOH H 3 .   ? -8.559  43.067 53.817  1.00 46.19 ? 199 HOH B O     1 
HETATM 4040 O O     . HOH H 3 .   ? -8.338  39.630 66.726  1.00 32.81 ? 200 HOH B O     1 
HETATM 4041 O O     . HOH H 3 .   ? -20.547 36.303 46.675  1.00 35.65 ? 201 HOH B O     1 
HETATM 4042 O O     . HOH H 3 .   ? -13.029 57.970 55.581  1.00 44.55 ? 202 HOH B O     1 
HETATM 4043 O O     . HOH H 3 .   ? 0.364   46.242 42.612  1.00 62.41 ? 203 HOH B O     1 
HETATM 4044 O O     . HOH H 3 .   ? -0.869  46.188 48.004  1.00 50.95 ? 204 HOH B O     1 
HETATM 4045 O O     . HOH H 3 .   ? -24.898 44.001 49.034  1.00 36.74 ? 205 HOH B O     1 
HETATM 4046 O O     . HOH H 3 .   ? -17.517 59.978 50.521  1.00 54.05 ? 206 HOH B O     1 
HETATM 4047 O O     . HOH H 3 .   ? -19.696 39.241 44.686  1.00 39.38 ? 207 HOH B O     1 
HETATM 4048 O O     . HOH H 3 .   ? -3.042  40.974 54.818  1.00 30.49 ? 208 HOH B O     1 
HETATM 4049 O O     . HOH H 3 .   ? -15.835 54.618 67.917  1.00 63.40 ? 209 HOH B O     1 
HETATM 4050 O O     . HOH H 3 .   ? -5.040  43.188 48.313  1.00 53.31 ? 210 HOH B O     1 
HETATM 4051 O O     . HOH H 3 .   ? -18.322 35.493 44.957  1.00 37.80 ? 211 HOH B O     1 
HETATM 4052 O O     . HOH H 3 .   ? -5.356  55.606 61.461  1.00 56.04 ? 212 HOH B O     1 
HETATM 4053 O O     . HOH H 3 .   ? -18.780 50.703 49.189  1.00 36.44 ? 213 HOH B O     1 
HETATM 4054 O O     . HOH H 3 .   ? -19.347 31.312 55.077  1.00 36.16 ? 214 HOH B O     1 
HETATM 4055 O O     . HOH H 3 .   ? -8.971  36.813 68.037  1.00 31.55 ? 215 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   C   1   1   1   C   C   C . n 
A 1 2   G   2   2   2   G   G   C . n 
A 1 3   U   3   3   3   U   U   C . n 
A 1 4   A   4   4   4   A   A   C . n 
A 1 5   C   5   5   5   C   C   C . n 
A 1 6   G   6   6   6   G   G   C . n 
A 1 7   C   7   7   7   C   C   C . n 
A 1 8   G   8   8   8   G   G   C . n 
A 1 9   U   9   9   9   U   U   C . n 
A 1 10  C   10  10  10  C   C   C . n 
A 1 11  A   11  11  11  A   A   C . n 
A 1 12  C   12  12  12  C   C   C . n 
A 1 13  G   13  13  13  G   G   C . n 
A 1 14  C   14  14  14  C   C   C . n 
A 1 15  G   15  15  15  G   G   C . n 
A 1 16  U   16  16  16  U   U   C . n 
A 1 17  A   17  17  17  A   A   C . n 
A 1 18  C   18  18  18  C   C   C . n 
A 1 19  G   19  19  19  G   G   C . n 
A 1 20  U   20  20  20  U   U   C . n 
A 1 21  U   21  21  21  U   U   C . n 
B 1 1   C   1   1   1   C   C   D . n 
B 1 2   G   2   2   2   G   G   D . n 
B 1 3   U   3   3   3   U   U   D . n 
B 1 4   A   4   4   4   A   A   D . n 
B 1 5   C   5   5   5   C   C   D . n 
B 1 6   G   6   6   6   G   G   D . n 
B 1 7   C   7   7   7   C   C   D . n 
B 1 8   G   8   8   8   G   G   D . n 
B 1 9   U   9   9   9   U   U   D . n 
B 1 10  C   10  10  10  C   C   D . n 
B 1 11  A   11  11  11  A   A   D . n 
B 1 12  C   12  12  12  C   C   D . n 
B 1 13  G   13  13  13  G   G   D . n 
B 1 14  C   14  14  14  C   C   D . n 
B 1 15  G   15  15  15  G   G   D . n 
B 1 16  U   16  16  16  U   U   D . n 
B 1 17  A   17  17  17  A   A   D . n 
B 1 18  C   18  18  18  C   C   D . n 
B 1 19  G   19  19  19  G   G   D . n 
B 1 20  U   20  20  20  U   U   D . n 
B 1 21  U   21  21  21  U   U   D . n 
C 2 1   MET 1   1   ?   ?   ?   A . n 
C 2 2   GLU 2   2   ?   ?   ?   A . n 
C 2 3   ARG 3   3   ?   ?   ?   A . n 
C 2 4   ALA 4   4   ?   ?   ?   A . n 
C 2 5   ILE 5   5   ?   ?   ?   A . n 
C 2 6   GLN 6   6   ?   ?   ?   A . n 
C 2 7   GLY 7   7   ?   ?   ?   A . n 
C 2 8   ASN 8   8   8   ASN ASN A . n 
C 2 9   ASP 9   9   9   ASP ASP A . n 
C 2 10  THR 10  10  10  THR THR A . n 
C 2 11  ARG 11  11  11  ARG ARG A . n 
C 2 12  GLU 12  12  12  GLU GLU A . n 
C 2 13  GLN 13  13  13  GLN GLN A . n 
C 2 14  ALA 14  14  14  ALA ALA A . n 
C 2 15  ASN 15  15  15  ASN ASN A . n 
C 2 16  GLY 16  16  16  GLY GLY A . n 
C 2 17  GLU 17  17  17  GLU GLU A . n 
C 2 18  ARG 18  18  18  ARG ARG A . n 
C 2 19  TRP 19  19  19  TRP TRP A . n 
C 2 20  ASP 20  20  20  ASP ASP A . n 
C 2 21  GLY 21  21  21  GLY GLY A . n 
C 2 22  GLY 22  22  22  GLY GLY A . n 
C 2 23  SER 23  23  23  SER SER A . n 
C 2 24  GLY 24  24  24  GLY GLY A . n 
C 2 25  GLY 25  25  25  GLY GLY A . n 
C 2 26  ILE 26  26  26  ILE ILE A . n 
C 2 27  THR 27  27  27  THR THR A . n 
C 2 28  SER 28  28  28  SER SER A . n 
C 2 29  PRO 29  29  29  PRO PRO A . n 
C 2 30  PHE 30  30  30  PHE PHE A . n 
C 2 31  LYS 31  31  31  LYS LYS A . n 
C 2 32  LEU 32  32  32  LEU LEU A . n 
C 2 33  PRO 33  33  33  PRO PRO A . n 
C 2 34  ASP 34  34  34  ASP ASP A . n 
C 2 35  GLU 35  35  35  GLU GLU A . n 
C 2 36  SER 36  36  36  SER SER A . n 
C 2 37  PRO 37  37  37  PRO PRO A . n 
C 2 38  SER 38  38  38  SER SER A . n 
C 2 39  TRP 39  39  39  TRP TRP A . n 
C 2 40  THR 40  40  40  THR THR A . n 
C 2 41  GLU 41  41  41  GLU GLU A . n 
C 2 42  TRP 42  42  42  TRP TRP A . n 
C 2 43  ARG 43  43  43  ARG ARG A . n 
C 2 44  LEU 44  44  44  LEU LEU A . n 
C 2 45  TYR 45  45  45  TYR TYR A . n 
C 2 46  ASN 46  46  46  ASN ASN A . n 
C 2 47  ASP 47  47  47  ASP ASP A . n 
C 2 48  GLU 48  48  48  GLU GLU A . n 
C 2 49  THR 49  49  ?   ?   ?   A . n 
C 2 50  ASN 50  50  ?   ?   ?   A . n 
C 2 51  SER 51  51  ?   ?   ?   A . n 
C 2 52  ASN 52  52  ?   ?   ?   A . n 
C 2 53  GLN 53  53  ?   ?   ?   A . n 
C 2 54  ASP 54  54  ?   ?   ?   A . n 
C 2 55  ASN 55  55  55  ASN ASN A . n 
C 2 56  PRO 56  56  56  PRO PRO A . n 
C 2 57  LEU 57  57  57  LEU LEU A . n 
C 2 58  GLY 58  58  58  GLY GLY A . n 
C 2 59  PHE 59  59  59  PHE PHE A . n 
C 2 60  LYS 60  60  60  LYS LYS A . n 
C 2 61  GLU 61  61  61  GLU GLU A . n 
C 2 62  SER 62  62  62  SER SER A . n 
C 2 63  TRP 63  63  63  TRP TRP A . n 
C 2 64  GLY 64  64  64  GLY GLY A . n 
C 2 65  PHE 65  65  65  PHE PHE A . n 
C 2 66  GLY 66  66  66  GLY GLY A . n 
C 2 67  LYS 67  67  67  LYS LYS A . n 
C 2 68  VAL 68  68  68  VAL VAL A . n 
C 2 69  VAL 69  69  69  VAL VAL A . n 
C 2 70  PHE 70  70  70  PHE PHE A . n 
C 2 71  LYS 71  71  71  LYS LYS A . n 
C 2 72  ARG 72  72  72  ARG ARG A . n 
C 2 73  TYR 73  73  73  TYR TYR A . n 
C 2 74  LEU 74  74  74  LEU LEU A . n 
C 2 75  ARG 75  75  75  ARG ARG A . n 
C 2 76  TYR 76  76  76  TYR TYR A . n 
C 2 77  ASP 77  77  77  ASP ASP A . n 
C 2 78  ARG 78  78  78  ARG ARG A . n 
C 2 79  THR 79  79  79  THR THR A . n 
C 2 80  GLU 80  80  80  GLU GLU A . n 
C 2 81  ALA 81  81  81  ALA ALA A . n 
C 2 82  SER 82  82  82  SER SER A . n 
C 2 83  LEU 83  83  83  LEU LEU A . n 
C 2 84  HIS 84  84  84  HIS HIS A . n 
C 2 85  ARG 85  85  85  ARG ARG A . n 
C 2 86  VAL 86  86  86  VAL VAL A . n 
C 2 87  LEU 87  87  87  LEU LEU A . n 
C 2 88  GLY 88  88  88  GLY GLY A . n 
C 2 89  SER 89  89  89  SER SER A . n 
C 2 90  TRP 90  90  90  TRP TRP A . n 
C 2 91  THR 91  91  91  THR THR A . n 
C 2 92  GLY 92  92  92  GLY GLY A . n 
C 2 93  ASP 93  93  93  ASP ASP A . n 
C 2 94  SER 94  94  94  SER SER A . n 
C 2 95  VAL 95  95  95  VAL VAL A . n 
C 2 96  ASN 96  96  96  ASN ASN A . n 
C 2 97  TYR 97  97  97  TYR TYR A . n 
C 2 98  ALA 98  98  98  ALA ALA A . n 
C 2 99  ALA 99  99  99  ALA ALA A . n 
C 2 100 SER 100 100 100 SER SER A . n 
C 2 101 ARG 101 101 101 ARG ARG A . n 
C 2 102 PHE 102 102 102 PHE PHE A . n 
C 2 103 LEU 103 103 103 LEU LEU A . n 
C 2 104 GLY 104 104 104 GLY GLY A . n 
C 2 105 ALA 105 105 105 ALA ALA A . n 
C 2 106 ASN 106 106 106 ASN ASN A . n 
C 2 107 GLN 107 107 107 GLN GLN A . n 
C 2 108 VAL 108 108 108 VAL VAL A . n 
C 2 109 GLY 109 109 109 GLY GLY A . n 
C 2 110 CYS 110 110 110 CYS CYS A . n 
C 2 111 THR 111 111 111 THR THR A . n 
C 2 112 TYR 112 112 112 TYR TYR A . n 
C 2 113 SER 113 113 113 SER SER A . n 
C 2 114 ILE 114 114 114 ILE ILE A . n 
C 2 115 ARG 115 115 115 ARG ARG A . n 
C 2 116 PHE 116 116 116 PHE PHE A . n 
C 2 117 ARG 117 117 117 ARG ARG A . n 
C 2 118 GLY 118 118 118 GLY GLY A . n 
C 2 119 VAL 119 119 119 VAL VAL A . n 
C 2 120 SER 120 120 120 SER SER A . n 
C 2 121 VAL 121 121 121 VAL VAL A . n 
C 2 122 THR 122 122 122 THR THR A . n 
C 2 123 ILE 123 123 123 ILE ILE A . n 
C 2 124 SER 124 124 124 SER SER A . n 
C 2 125 GLY 125 125 125 GLY GLY A . n 
C 2 126 GLY 126 126 126 GLY GLY A . n 
C 2 127 SER 127 127 127 SER SER A . n 
C 2 128 ARG 128 128 128 ARG ARG A . n 
C 2 129 THR 129 129 129 THR THR A . n 
C 2 130 LEU 130 130 130 LEU LEU A . n 
C 2 131 GLN 131 131 131 GLN GLN A . n 
C 2 132 HIS 132 132 132 HIS HIS A . n 
C 2 133 LEU 133 133 133 LEU LEU A . n 
C 2 134 CYS 134 134 134 CYS CYS A . n 
C 2 135 GLU 135 135 135 GLU GLU A . n 
C 2 136 MET 136 136 136 MET MET A . n 
C 2 137 ALA 137 137 137 ALA ALA A . n 
C 2 138 ILE 138 138 138 ILE ILE A . n 
C 2 139 ARG 139 139 139 ARG ARG A . n 
C 2 140 SER 140 140 140 SER SER A . n 
C 2 141 LYS 141 141 141 LYS LYS A . n 
C 2 142 GLN 142 142 142 GLN GLN A . n 
C 2 143 GLU 143 143 143 GLU GLU A . n 
C 2 144 LEU 144 144 144 LEU LEU A . n 
C 2 145 LEU 145 145 145 LEU LEU A . n 
C 2 146 GLN 146 146 146 GLN GLN A . n 
C 2 147 LEU 147 147 147 LEU LEU A . n 
C 2 148 THR 148 148 148 THR THR A . n 
C 2 149 PRO 149 149 149 PRO PRO A . n 
C 2 150 VAL 150 150 150 VAL VAL A . n 
C 2 151 GLU 151 151 151 GLU GLU A . n 
C 2 152 VAL 152 152 152 VAL VAL A . n 
C 2 153 GLU 153 153 ?   ?   ?   A . n 
C 2 154 SER 154 154 ?   ?   ?   A . n 
C 2 155 ASN 155 155 ?   ?   ?   A . n 
C 2 156 VAL 156 156 ?   ?   ?   A . n 
C 2 157 SER 157 157 ?   ?   ?   A . n 
C 2 158 ARG 158 158 ?   ?   ?   A . n 
C 2 159 GLY 159 159 ?   ?   ?   A . n 
C 2 160 CYS 160 160 ?   ?   ?   A . n 
C 2 161 PRO 161 161 ?   ?   ?   A . n 
C 2 162 GLU 162 162 ?   ?   ?   A . n 
C 2 163 GLY 163 163 ?   ?   ?   A . n 
C 2 164 ILE 164 164 ?   ?   ?   A . n 
C 2 165 GLU 165 165 ?   ?   ?   A . n 
C 2 166 THR 166 166 ?   ?   ?   A . n 
C 2 167 PHE 167 167 ?   ?   ?   A . n 
C 2 168 LYS 168 168 ?   ?   ?   A . n 
C 2 169 LYS 169 169 ?   ?   ?   A . n 
C 2 170 GLU 170 170 ?   ?   ?   A . n 
C 2 171 SER 171 171 ?   ?   ?   A . n 
C 2 172 GLU 172 172 ?   ?   ?   A . n 
D 2 1   MET 1   1   ?   ?   ?   B . n 
D 2 2   GLU 2   2   ?   ?   ?   B . n 
D 2 3   ARG 3   3   ?   ?   ?   B . n 
D 2 4   ALA 4   4   ?   ?   ?   B . n 
D 2 5   ILE 5   5   ?   ?   ?   B . n 
D 2 6   GLN 6   6   ?   ?   ?   B . n 
D 2 7   GLY 7   7   ?   ?   ?   B . n 
D 2 8   ASN 8   8   8   ASN ASN B . n 
D 2 9   ASP 9   9   9   ASP ASP B . n 
D 2 10  THR 10  10  10  THR THR B . n 
D 2 11  ARG 11  11  11  ARG ARG B . n 
D 2 12  GLU 12  12  12  GLU GLU B . n 
D 2 13  GLN 13  13  13  GLN GLN B . n 
D 2 14  ALA 14  14  14  ALA ALA B . n 
D 2 15  ASN 15  15  15  ASN ASN B . n 
D 2 16  GLY 16  16  16  GLY GLY B . n 
D 2 17  GLU 17  17  17  GLU GLU B . n 
D 2 18  ARG 18  18  18  ARG ARG B . n 
D 2 19  TRP 19  19  19  TRP TRP B . n 
D 2 20  ASP 20  20  20  ASP ASP B . n 
D 2 21  GLY 21  21  21  GLY GLY B . n 
D 2 22  GLY 22  22  22  GLY GLY B . n 
D 2 23  SER 23  23  23  SER SER B . n 
D 2 24  GLY 24  24  24  GLY GLY B . n 
D 2 25  GLY 25  25  25  GLY GLY B . n 
D 2 26  ILE 26  26  26  ILE ILE B . n 
D 2 27  THR 27  27  27  THR THR B . n 
D 2 28  SER 28  28  28  SER SER B . n 
D 2 29  PRO 29  29  29  PRO PRO B . n 
D 2 30  PHE 30  30  30  PHE PHE B . n 
D 2 31  LYS 31  31  31  LYS LYS B . n 
D 2 32  LEU 32  32  32  LEU LEU B . n 
D 2 33  PRO 33  33  33  PRO PRO B . n 
D 2 34  ASP 34  34  34  ASP ASP B . n 
D 2 35  GLU 35  35  35  GLU GLU B . n 
D 2 36  SER 36  36  36  SER SER B . n 
D 2 37  PRO 37  37  37  PRO PRO B . n 
D 2 38  SER 38  38  38  SER SER B . n 
D 2 39  TRP 39  39  39  TRP TRP B . n 
D 2 40  THR 40  40  40  THR THR B . n 
D 2 41  GLU 41  41  41  GLU GLU B . n 
D 2 42  TRP 42  42  42  TRP TRP B . n 
D 2 43  ARG 43  43  43  ARG ARG B . n 
D 2 44  LEU 44  44  44  LEU LEU B . n 
D 2 45  TYR 45  45  45  TYR TYR B . n 
D 2 46  ASN 46  46  46  ASN ASN B . n 
D 2 47  ASP 47  47  47  ASP ASP B . n 
D 2 48  GLU 48  48  48  GLU GLU B . n 
D 2 49  THR 49  49  ?   ?   ?   B . n 
D 2 50  ASN 50  50  ?   ?   ?   B . n 
D 2 51  SER 51  51  ?   ?   ?   B . n 
D 2 52  ASN 52  52  ?   ?   ?   B . n 
D 2 53  GLN 53  53  ?   ?   ?   B . n 
D 2 54  ASP 54  54  ?   ?   ?   B . n 
D 2 55  ASN 55  55  55  ASN ASN B . n 
D 2 56  PRO 56  56  56  PRO PRO B . n 
D 2 57  LEU 57  57  57  LEU LEU B . n 
D 2 58  GLY 58  58  58  GLY GLY B . n 
D 2 59  PHE 59  59  59  PHE PHE B . n 
D 2 60  LYS 60  60  60  LYS LYS B . n 
D 2 61  GLU 61  61  61  GLU GLU B . n 
D 2 62  SER 62  62  62  SER SER B . n 
D 2 63  TRP 63  63  63  TRP TRP B . n 
D 2 64  GLY 64  64  64  GLY GLY B . n 
D 2 65  PHE 65  65  65  PHE PHE B . n 
D 2 66  GLY 66  66  66  GLY GLY B . n 
D 2 67  LYS 67  67  67  LYS LYS B . n 
D 2 68  VAL 68  68  68  VAL VAL B . n 
D 2 69  VAL 69  69  69  VAL VAL B . n 
D 2 70  PHE 70  70  70  PHE PHE B . n 
D 2 71  LYS 71  71  71  LYS LYS B . n 
D 2 72  ARG 72  72  72  ARG ARG B . n 
D 2 73  TYR 73  73  73  TYR TYR B . n 
D 2 74  LEU 74  74  74  LEU LEU B . n 
D 2 75  ARG 75  75  75  ARG ARG B . n 
D 2 76  TYR 76  76  76  TYR TYR B . n 
D 2 77  ASP 77  77  77  ASP ASP B . n 
D 2 78  ARG 78  78  78  ARG ARG B . n 
D 2 79  THR 79  79  79  THR THR B . n 
D 2 80  GLU 80  80  80  GLU GLU B . n 
D 2 81  ALA 81  81  81  ALA ALA B . n 
D 2 82  SER 82  82  82  SER SER B . n 
D 2 83  LEU 83  83  83  LEU LEU B . n 
D 2 84  HIS 84  84  84  HIS HIS B . n 
D 2 85  ARG 85  85  85  ARG ARG B . n 
D 2 86  VAL 86  86  86  VAL VAL B . n 
D 2 87  LEU 87  87  87  LEU LEU B . n 
D 2 88  GLY 88  88  88  GLY GLY B . n 
D 2 89  SER 89  89  89  SER SER B . n 
D 2 90  TRP 90  90  90  TRP TRP B . n 
D 2 91  THR 91  91  91  THR THR B . n 
D 2 92  GLY 92  92  92  GLY GLY B . n 
D 2 93  ASP 93  93  93  ASP ASP B . n 
D 2 94  SER 94  94  94  SER SER B . n 
D 2 95  VAL 95  95  95  VAL VAL B . n 
D 2 96  ASN 96  96  96  ASN ASN B . n 
D 2 97  TYR 97  97  97  TYR TYR B . n 
D 2 98  ALA 98  98  98  ALA ALA B . n 
D 2 99  ALA 99  99  99  ALA ALA B . n 
D 2 100 SER 100 100 100 SER SER B . n 
D 2 101 ARG 101 101 101 ARG ARG B . n 
D 2 102 PHE 102 102 102 PHE PHE B . n 
D 2 103 LEU 103 103 103 LEU LEU B . n 
D 2 104 GLY 104 104 104 GLY GLY B . n 
D 2 105 ALA 105 105 105 ALA ALA B . n 
D 2 106 ASN 106 106 106 ASN ASN B . n 
D 2 107 GLN 107 107 107 GLN GLN B . n 
D 2 108 VAL 108 108 108 VAL VAL B . n 
D 2 109 GLY 109 109 109 GLY GLY B . n 
D 2 110 CYS 110 110 110 CYS CYS B . n 
D 2 111 THR 111 111 111 THR THR B . n 
D 2 112 TYR 112 112 112 TYR TYR B . n 
D 2 113 SER 113 113 113 SER SER B . n 
D 2 114 ILE 114 114 114 ILE ILE B . n 
D 2 115 ARG 115 115 115 ARG ARG B . n 
D 2 116 PHE 116 116 116 PHE PHE B . n 
D 2 117 ARG 117 117 117 ARG ARG B . n 
D 2 118 GLY 118 118 118 GLY GLY B . n 
D 2 119 VAL 119 119 119 VAL VAL B . n 
D 2 120 SER 120 120 120 SER SER B . n 
D 2 121 VAL 121 121 121 VAL VAL B . n 
D 2 122 THR 122 122 122 THR THR B . n 
D 2 123 ILE 123 123 123 ILE ILE B . n 
D 2 124 SER 124 124 124 SER SER B . n 
D 2 125 GLY 125 125 125 GLY GLY B . n 
D 2 126 GLY 126 126 126 GLY GLY B . n 
D 2 127 SER 127 127 127 SER SER B . n 
D 2 128 ARG 128 128 128 ARG ARG B . n 
D 2 129 THR 129 129 129 THR THR B . n 
D 2 130 LEU 130 130 130 LEU LEU B . n 
D 2 131 GLN 131 131 131 GLN GLN B . n 
D 2 132 HIS 132 132 132 HIS HIS B . n 
D 2 133 LEU 133 133 133 LEU LEU B . n 
D 2 134 CYS 134 134 134 CYS CYS B . n 
D 2 135 GLU 135 135 135 GLU GLU B . n 
D 2 136 MET 136 136 136 MET MET B . n 
D 2 137 ALA 137 137 137 ALA ALA B . n 
D 2 138 ILE 138 138 138 ILE ILE B . n 
D 2 139 ARG 139 139 139 ARG ARG B . n 
D 2 140 SER 140 140 140 SER SER B . n 
D 2 141 LYS 141 141 141 LYS LYS B . n 
D 2 142 GLN 142 142 142 GLN GLN B . n 
D 2 143 GLU 143 143 143 GLU GLU B . n 
D 2 144 LEU 144 144 144 LEU LEU B . n 
D 2 145 LEU 145 145 145 LEU LEU B . n 
D 2 146 GLN 146 146 146 GLN GLN B . n 
D 2 147 LEU 147 147 147 LEU LEU B . n 
D 2 148 THR 148 148 148 THR THR B . n 
D 2 149 PRO 149 149 149 PRO PRO B . n 
D 2 150 VAL 150 150 ?   ?   ?   B . n 
D 2 151 GLU 151 151 ?   ?   ?   B . n 
D 2 152 VAL 152 152 ?   ?   ?   B . n 
D 2 153 GLU 153 153 ?   ?   ?   B . n 
D 2 154 SER 154 154 ?   ?   ?   B . n 
D 2 155 ASN 155 155 ?   ?   ?   B . n 
D 2 156 VAL 156 156 ?   ?   ?   B . n 
D 2 157 SER 157 157 ?   ?   ?   B . n 
D 2 158 ARG 158 158 ?   ?   ?   B . n 
D 2 159 GLY 159 159 ?   ?   ?   B . n 
D 2 160 CYS 160 160 ?   ?   ?   B . n 
D 2 161 PRO 161 161 ?   ?   ?   B . n 
D 2 162 GLU 162 162 ?   ?   ?   B . n 
D 2 163 GLY 163 163 ?   ?   ?   B . n 
D 2 164 ILE 164 164 ?   ?   ?   B . n 
D 2 165 GLU 165 165 ?   ?   ?   B . n 
D 2 166 THR 166 166 ?   ?   ?   B . n 
D 2 167 PHE 167 167 ?   ?   ?   B . n 
D 2 168 LYS 168 168 ?   ?   ?   B . n 
D 2 169 LYS 169 169 ?   ?   ?   B . n 
D 2 170 GLU 170 170 ?   ?   ?   B . n 
D 2 171 SER 171 171 ?   ?   ?   B . n 
D 2 172 GLU 172 172 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  22  5   HOH HOH C . 
E 3 HOH 2  23  9   HOH HOH C . 
E 3 HOH 3  24  10  HOH HOH C . 
E 3 HOH 4  25  23  HOH HOH C . 
E 3 HOH 5  26  31  HOH HOH C . 
E 3 HOH 6  27  62  HOH HOH C . 
E 3 HOH 7  28  70  HOH HOH C . 
E 3 HOH 8  29  77  HOH HOH C . 
E 3 HOH 9  30  79  HOH HOH C . 
E 3 HOH 10 31  82  HOH HOH C . 
E 3 HOH 11 32  87  HOH HOH C . 
E 3 HOH 12 33  94  HOH HOH C . 
E 3 HOH 13 34  99  HOH HOH C . 
E 3 HOH 14 35  102 HOH HOH C . 
E 3 HOH 15 36  108 HOH HOH C . 
F 3 HOH 1  22  6   HOH HOH D . 
F 3 HOH 2  23  11  HOH HOH D . 
F 3 HOH 3  24  21  HOH HOH D . 
F 3 HOH 4  25  22  HOH HOH D . 
F 3 HOH 5  26  60  HOH HOH D . 
F 3 HOH 6  27  72  HOH HOH D . 
F 3 HOH 7  28  97  HOH HOH D . 
F 3 HOH 8  29  104 HOH HOH D . 
F 3 HOH 9  30  110 HOH HOH D . 
G 3 HOH 1  173 1   HOH HOH A . 
G 3 HOH 2  174 2   HOH HOH A . 
G 3 HOH 3  175 3   HOH HOH A . 
G 3 HOH 4  176 13  HOH HOH A . 
G 3 HOH 5  177 15  HOH HOH A . 
G 3 HOH 6  178 16  HOH HOH A . 
G 3 HOH 7  179 17  HOH HOH A . 
G 3 HOH 8  180 18  HOH HOH A . 
G 3 HOH 9  181 19  HOH HOH A . 
G 3 HOH 10 182 20  HOH HOH A . 
G 3 HOH 11 183 25  HOH HOH A . 
G 3 HOH 12 184 26  HOH HOH A . 
G 3 HOH 13 185 28  HOH HOH A . 
G 3 HOH 14 186 30  HOH HOH A . 
G 3 HOH 15 187 33  HOH HOH A . 
G 3 HOH 16 188 36  HOH HOH A . 
G 3 HOH 17 189 39  HOH HOH A . 
G 3 HOH 18 190 40  HOH HOH A . 
G 3 HOH 19 191 41  HOH HOH A . 
G 3 HOH 20 192 44  HOH HOH A . 
G 3 HOH 21 193 45  HOH HOH A . 
G 3 HOH 22 194 46  HOH HOH A . 
G 3 HOH 23 195 48  HOH HOH A . 
G 3 HOH 24 196 49  HOH HOH A . 
G 3 HOH 25 197 51  HOH HOH A . 
G 3 HOH 26 198 53  HOH HOH A . 
G 3 HOH 27 199 57  HOH HOH A . 
G 3 HOH 28 200 58  HOH HOH A . 
G 3 HOH 29 201 59  HOH HOH A . 
G 3 HOH 30 202 63  HOH HOH A . 
G 3 HOH 31 203 65  HOH HOH A . 
G 3 HOH 32 204 75  HOH HOH A . 
G 3 HOH 33 205 78  HOH HOH A . 
G 3 HOH 34 206 80  HOH HOH A . 
G 3 HOH 35 207 81  HOH HOH A . 
G 3 HOH 36 208 84  HOH HOH A . 
G 3 HOH 37 209 85  HOH HOH A . 
G 3 HOH 38 210 88  HOH HOH A . 
G 3 HOH 39 211 89  HOH HOH A . 
G 3 HOH 40 212 90  HOH HOH A . 
G 3 HOH 41 213 93  HOH HOH A . 
G 3 HOH 42 214 106 HOH HOH A . 
G 3 HOH 43 215 107 HOH HOH A . 
G 3 HOH 44 216 111 HOH HOH A . 
H 3 HOH 1  173 4   HOH HOH B . 
H 3 HOH 2  174 7   HOH HOH B . 
H 3 HOH 3  175 8   HOH HOH B . 
H 3 HOH 4  176 12  HOH HOH B . 
H 3 HOH 5  177 14  HOH HOH B . 
H 3 HOH 6  178 24  HOH HOH B . 
H 3 HOH 7  179 27  HOH HOH B . 
H 3 HOH 8  180 29  HOH HOH B . 
H 3 HOH 9  181 32  HOH HOH B . 
H 3 HOH 10 182 34  HOH HOH B . 
H 3 HOH 11 183 35  HOH HOH B . 
H 3 HOH 12 184 37  HOH HOH B . 
H 3 HOH 13 185 38  HOH HOH B . 
H 3 HOH 14 186 42  HOH HOH B . 
H 3 HOH 15 187 43  HOH HOH B . 
H 3 HOH 16 188 47  HOH HOH B . 
H 3 HOH 17 189 50  HOH HOH B . 
H 3 HOH 18 190 52  HOH HOH B . 
H 3 HOH 19 191 54  HOH HOH B . 
H 3 HOH 20 192 55  HOH HOH B . 
H 3 HOH 21 193 56  HOH HOH B . 
H 3 HOH 22 194 61  HOH HOH B . 
H 3 HOH 23 195 64  HOH HOH B . 
H 3 HOH 24 196 66  HOH HOH B . 
H 3 HOH 25 197 67  HOH HOH B . 
H 3 HOH 26 198 68  HOH HOH B . 
H 3 HOH 27 199 69  HOH HOH B . 
H 3 HOH 28 200 71  HOH HOH B . 
H 3 HOH 29 201 73  HOH HOH B . 
H 3 HOH 30 202 74  HOH HOH B . 
H 3 HOH 31 203 76  HOH HOH B . 
H 3 HOH 32 204 83  HOH HOH B . 
H 3 HOH 33 205 86  HOH HOH B . 
H 3 HOH 34 206 91  HOH HOH B . 
H 3 HOH 35 207 92  HOH HOH B . 
H 3 HOH 36 208 95  HOH HOH B . 
H 3 HOH 37 209 96  HOH HOH B . 
H 3 HOH 38 210 98  HOH HOH B . 
H 3 HOH 39 211 100 HOH HOH B . 
H 3 HOH 40 212 101 HOH HOH B . 
H 3 HOH 41 213 103 HOH HOH B . 
H 3 HOH 42 214 105 HOH HOH B . 
H 3 HOH 43 215 109 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345    'data collection' .   ? 1 
SCALEPACK 'data scaling'    .   ? 2 
SHARP     phasing           .   ? 3 
CNS       refinement        1.1 ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P C C 1 ? A OP3 C C 1 ? A 1.518 1.607 -0.089 0.012 N 
2 1 P C C 1 ? B OP3 C C 1 ? B 1.521 1.607 -0.086 0.012 N 
3 1 P D C 1 ? A OP3 D C 1 ? A 1.519 1.607 -0.088 0.012 N 
4 1 P D C 1 ? B OP3 D C 1 ? B 1.522 1.607 -0.085 0.012 N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASN 
_pdbx_validate_rmsd_angle.auth_seq_id_1              55 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              56 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              56 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.35 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            11.05 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 23  ? ? -57.33  -177.68 
2  1 TRP A 42  ? ? -67.71  -73.06  
3  1 ASP A 47  ? ? -145.58 -21.27  
4  1 THR A 148 ? ? -8.84   117.37  
5  1 PRO A 149 ? ? -38.73  142.75  
6  1 SER B 23  ? ? 62.02   141.08  
7  1 GLU B 35  ? ? -143.92 27.22   
8  1 ASN B 46  ? ? -78.09  34.41   
9  1 ASP B 47  ? ? -143.35 -13.16  
10 1 ARG B 78  ? ? 82.78   36.43   
11 1 SER B 89  ? ? -48.52  -19.98  
12 1 ARG B 101 ? ? -66.13  8.41    
13 1 PHE B 102 ? ? -144.50 -9.60   
14 1 LEU B 103 ? ? -26.43  -58.61  
15 1 ALA B 105 ? ? 64.15   -16.93  
16 1 SER B 127 ? ? -39.08  -35.72  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    U 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     9 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    A 
_pdbx_validate_planes.rmsd            0.080 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 8   ? N   ? C ASN 8   N   
2  1 Y 1 A ASN 8   ? CA  ? C ASN 8   CA  
3  1 Y 1 A ASN 8   ? CB  ? C ASN 8   CB  
4  1 Y 1 A ASN 8   ? CG  ? C ASN 8   CG  
5  1 Y 1 A ASN 8   ? OD1 ? C ASN 8   OD1 
6  1 Y 1 A ASN 8   ? ND2 ? C ASN 8   ND2 
7  1 Y 1 A ARG 128 ? CG  ? C ARG 128 CG  
8  1 Y 1 A ARG 128 ? CD  ? C ARG 128 CD  
9  1 Y 1 A ARG 128 ? NE  ? C ARG 128 NE  
10 1 Y 1 A ARG 128 ? CZ  ? C ARG 128 CZ  
11 1 Y 1 A ARG 128 ? NH1 ? C ARG 128 NH1 
12 1 Y 1 A ARG 128 ? NH2 ? C ARG 128 NH2 
13 1 Y 1 B ASN 8   ? N   ? D ASN 8   N   
14 1 Y 1 B ASN 8   ? CB  ? D ASN 8   CB  
15 1 Y 1 B ASN 8   ? CG  ? D ASN 8   CG  
16 1 Y 1 B ASN 8   ? OD1 ? D ASN 8   OD1 
17 1 Y 1 B ASN 8   ? ND2 ? D ASN 8   ND2 
18 1 Y 1 B ARG 101 ? NE  ? D ARG 101 NE  
19 1 Y 1 B ARG 101 ? CZ  ? D ARG 101 CZ  
20 1 Y 1 B ARG 101 ? NH1 ? D ARG 101 NH1 
21 1 Y 1 B ARG 101 ? NH2 ? D ARG 101 NH2 
22 1 Y 1 B ARG 128 ? CG  ? D ARG 128 CG  
23 1 Y 1 B ARG 128 ? CD  ? D ARG 128 CD  
24 1 Y 1 B ARG 128 ? NE  ? D ARG 128 NE  
25 1 Y 1 B ARG 128 ? CZ  ? D ARG 128 CZ  
26 1 Y 1 B ARG 128 ? NH1 ? D ARG 128 NH1 
27 1 Y 1 B ARG 128 ? NH2 ? D ARG 128 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? C MET 1   
2  1 Y 1 A GLU 2   ? C GLU 2   
3  1 Y 1 A ARG 3   ? C ARG 3   
4  1 Y 1 A ALA 4   ? C ALA 4   
5  1 Y 1 A ILE 5   ? C ILE 5   
6  1 Y 1 A GLN 6   ? C GLN 6   
7  1 Y 1 A GLY 7   ? C GLY 7   
8  1 Y 1 A THR 49  ? C THR 49  
9  1 Y 1 A ASN 50  ? C ASN 50  
10 1 Y 1 A SER 51  ? C SER 51  
11 1 Y 1 A ASN 52  ? C ASN 52  
12 1 Y 1 A GLN 53  ? C GLN 53  
13 1 Y 1 A ASP 54  ? C ASP 54  
14 1 Y 1 A GLU 153 ? C GLU 153 
15 1 Y 1 A SER 154 ? C SER 154 
16 1 Y 1 A ASN 155 ? C ASN 155 
17 1 Y 1 A VAL 156 ? C VAL 156 
18 1 Y 1 A SER 157 ? C SER 157 
19 1 Y 1 A ARG 158 ? C ARG 158 
20 1 Y 1 A GLY 159 ? C GLY 159 
21 1 Y 1 A CYS 160 ? C CYS 160 
22 1 Y 1 A PRO 161 ? C PRO 161 
23 1 Y 1 A GLU 162 ? C GLU 162 
24 1 Y 1 A GLY 163 ? C GLY 163 
25 1 Y 1 A ILE 164 ? C ILE 164 
26 1 Y 1 A GLU 165 ? C GLU 165 
27 1 Y 1 A THR 166 ? C THR 166 
28 1 Y 1 A PHE 167 ? C PHE 167 
29 1 Y 1 A LYS 168 ? C LYS 168 
30 1 Y 1 A LYS 169 ? C LYS 169 
31 1 Y 1 A GLU 170 ? C GLU 170 
32 1 Y 1 A SER 171 ? C SER 171 
33 1 Y 1 A GLU 172 ? C GLU 172 
34 1 Y 1 B MET 1   ? D MET 1   
35 1 Y 1 B GLU 2   ? D GLU 2   
36 1 Y 1 B ARG 3   ? D ARG 3   
37 1 Y 1 B ALA 4   ? D ALA 4   
38 1 Y 1 B ILE 5   ? D ILE 5   
39 1 Y 1 B GLN 6   ? D GLN 6   
40 1 Y 1 B GLY 7   ? D GLY 7   
41 1 Y 1 B THR 49  ? D THR 49  
42 1 Y 1 B ASN 50  ? D ASN 50  
43 1 Y 1 B SER 51  ? D SER 51  
44 1 Y 1 B ASN 52  ? D ASN 52  
45 1 Y 1 B GLN 53  ? D GLN 53  
46 1 Y 1 B ASP 54  ? D ASP 54  
47 1 Y 1 B VAL 150 ? D VAL 150 
48 1 Y 1 B GLU 151 ? D GLU 151 
49 1 Y 1 B VAL 152 ? D VAL 152 
50 1 Y 1 B GLU 153 ? D GLU 153 
51 1 Y 1 B SER 154 ? D SER 154 
52 1 Y 1 B ASN 155 ? D ASN 155 
53 1 Y 1 B VAL 156 ? D VAL 156 
54 1 Y 1 B SER 157 ? D SER 157 
55 1 Y 1 B ARG 158 ? D ARG 158 
56 1 Y 1 B GLY 159 ? D GLY 159 
57 1 Y 1 B CYS 160 ? D CYS 160 
58 1 Y 1 B PRO 161 ? D PRO 161 
59 1 Y 1 B GLU 162 ? D GLU 162 
60 1 Y 1 B GLY 163 ? D GLY 163 
61 1 Y 1 B ILE 164 ? D ILE 164 
62 1 Y 1 B GLU 165 ? D GLU 165 
63 1 Y 1 B THR 166 ? D THR 166 
64 1 Y 1 B PHE 167 ? D PHE 167 
65 1 Y 1 B LYS 168 ? D LYS 168 
66 1 Y 1 B LYS 169 ? D LYS 169 
67 1 Y 1 B GLU 170 ? D GLU 170 
68 1 Y 1 B SER 171 ? D SER 171 
69 1 Y 1 B GLU 172 ? D GLU 172 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RPU 'a-form double helix'  
1RPU 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A C 1  1_555 B G 19 1_555 0.142  -0.024 -0.537 9.053  -5.665  -0.156  1  C_C1:G19_D  C 1  ? D 19 ? 19 1 
1 A G 2  1_555 B C 18 1_555 -0.209 -0.059 -0.387 -8.524 -18.492 4.751   2  C_G2:C18_D  C 2  ? D 18 ? 19 1 
1 A U 3  1_555 B A 17 1_555 -0.033 -0.071 -0.600 1.806  -22.604 4.317   3  C_U3:A17_D  C 3  ? D 17 ? 20 1 
1 A A 4  1_555 B U 16 1_555 0.157  -0.011 -0.279 -7.447 -14.505 1.732   4  C_A4:U16_D  C 4  ? D 16 ? 20 1 
1 A C 5  1_555 B G 15 1_555 0.064  -0.061 -0.237 8.326  -11.120 1.497   5  C_C5:G15_D  C 5  ? D 15 ? 19 1 
1 A G 6  1_555 B C 14 1_555 -0.191 -0.200 0.250  4.922  -8.619  -0.084  6  C_G6:C14_D  C 6  ? D 14 ? 19 1 
1 A C 7  1_555 B G 13 1_555 0.120  -0.082 -0.026 -2.029 -6.325  -2.127  7  C_C7:G13_D  C 7  ? D 13 ? 19 1 
1 A G 8  1_555 B C 12 1_555 -0.064 -0.016 -0.146 -9.244 -10.607 -0.112  8  C_G8:C12_D  C 8  ? D 12 ? 19 1 
1 A U 9  1_555 B A 11 1_555 -0.053 -0.059 -0.064 -4.712 -7.037  0.027   9  C_U9:A11_D  C 9  ? D 11 ? 20 1 
1 A C 10 1_555 B C 10 1_555 3.160  -1.181 0.303  -0.573 -5.768  -10.924 10 C_C10:C10_D C 10 ? D 10 ? ?  ? 
1 A A 11 1_555 B U 9  1_555 0.007  -0.111 -0.319 -5.288 -11.698 6.337   11 C_A11:U9_D  C 11 ? D 9  ? 20 1 
1 A C 12 1_555 B G 8  1_555 0.131  -0.026 -0.697 19.507 -21.594 0.911   12 C_C12:G8_D  C 12 ? D 8  ? 19 1 
1 A G 13 1_555 B C 7  1_555 -0.259 -0.126 0.108  4.841  -12.991 0.221   13 C_G13:C7_D  C 13 ? D 7  ? 19 1 
1 A C 14 1_555 B G 6  1_555 0.058  -0.033 0.133  3.174  -16.707 -0.055  14 C_C14:G6_D  C 14 ? D 6  ? 19 1 
1 A G 15 1_555 B C 5  1_555 0.082  -0.004 -0.185 -7.267 -11.068 -2.691  15 C_G15:C5_D  C 15 ? D 5  ? 19 1 
1 A U 16 1_555 B A 4  1_555 -0.028 0.002  0.360  -0.028 -16.574 -1.765  16 C_U16:A4_D  C 16 ? D 4  ? 20 1 
1 A A 17 1_555 B U 3  1_555 -0.083 -0.046 0.108  3.027  -6.905  2.099   17 C_A17:U3_D  C 17 ? D 3  ? 20 1 
1 A C 18 1_555 B G 2  1_555 0.059  -0.129 -0.230 1.915  -20.939 2.483   18 C_C18:G2_D  C 18 ? D 2  ? 19 1 
1 A G 19 1_555 B C 1  1_555 -0.096 -0.083 -0.512 -9.977 -0.822  1.956   19 C_G19:C1_D  C 19 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A C 1  1_555 B G 19 1_555 A G 2  1_555 B C 18 1_555 -0.072 -2.100 3.855 -3.844 13.571 29.533 -6.200 -0.570 2.650 24.910 7.056   
32.661 1  CC_C1G2:C18G19_DD  C 1  ? D 19 ? C 2  ? D 18 ? 
1 A G 2  1_555 B C 18 1_555 A U 3  1_555 B A 17 1_555 -0.297 -1.537 2.914 2.245  2.964  32.101 -3.217 0.878  2.739 5.338  -4.042  
32.310 2  CC_G2U3:A17C18_DD  C 2  ? D 18 ? C 3  ? D 17 ? 
1 A U 3  1_555 B A 17 1_555 A A 4  1_555 B U 16 1_555 0.210  -1.485 3.604 0.039  14.933 32.098 -4.676 -0.341 2.673 25.363 -0.067  
35.319 3  CC_U3A4:U16A17_DD  C 3  ? D 17 ? C 4  ? D 16 ? 
1 A A 4  1_555 B U 16 1_555 A C 5  1_555 B G 15 1_555 0.256  -1.789 2.866 0.600  1.325  26.811 -4.147 -0.418 2.781 2.855  -1.293  
26.850 4  CC_A4C5:G15U16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 A C 5  1_555 B G 15 1_555 A G 6  1_555 B C 14 1_555 -0.475 -2.134 3.367 -6.438 7.006  25.167 -6.325 -0.572 2.721 15.393 14.146  
26.879 5  CC_C5G6:C14G15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 A G 6  1_555 B C 14 1_555 A C 7  1_555 B G 13 1_555 -0.199 -1.904 3.352 1.866  11.637 36.392 -4.287 0.525  2.629 18.059 -2.896  
38.192 6  CC_G6C7:G13C14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 A C 7  1_555 B G 13 1_555 A G 8  1_555 B C 12 1_555 0.898  -1.892 3.370 7.687  7.780  29.980 -4.856 -0.242 2.935 14.449 -14.275 
31.869 7  CC_C7G8:C12G13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 A G 8  1_555 B C 12 1_555 A U 9  1_555 B A 11 1_555 1.226  -1.893 3.135 3.681  3.340  28.181 -4.550 -1.690 3.027 6.792  -7.486  
28.607 8  CC_G8U9:A11C12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 A U 9  1_555 B A 11 1_555 A C 10 1_555 B C 10 1_555 -1.179 -1.713 3.174 -3.189 5.939  39.416 -3.153 1.378  2.978 8.727  4.687   
39.966 9  CC_U9C10:C10A11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 A C 10 1_555 B C 10 1_555 A A 11 1_555 B U 9  1_555 1.157  -2.307 3.359 9.229  7.749  23.335 -7.150 -0.091 2.724 17.724 -21.108 
26.225 10 CC_C10A11:U9C10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 A A 11 1_555 B U 9  1_555 A C 12 1_555 B G 8  1_555 -1.171 -1.521 2.748 0.563  -2.108 26.832 -2.805 2.638  2.832 -4.532 -1.211  
26.919 11 CC_A11C12:G8U9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 A C 12 1_555 B G 8  1_555 A G 13 1_555 B C 7  1_555 -0.449 -1.892 3.622 -7.379 16.931 29.675 -5.689 -0.353 2.292 29.712 12.949  
34.843 12 CC_C12G13:C7G8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 A G 13 1_555 B C 7  1_555 A C 14 1_555 B G 6  1_555 0.023  -1.711 3.219 -1.353 7.077  35.314 -3.706 -0.217 2.832 11.518 2.203   
36.019 13 CC_G13C14:G6C7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 A C 14 1_555 B G 6  1_555 A G 15 1_555 B C 5  1_555 -0.269 -2.143 3.455 1.659  11.277 31.398 -5.506 0.730  2.538 20.029 -2.947  
33.354 14 CC_C14G15:C5G6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 A G 15 1_555 B C 5  1_555 A U 16 1_555 B A 4  1_555 0.799  -1.765 3.028 -2.450 7.106  27.536 -4.958 -2.097 2.426 14.588 5.030   
28.525 15 CC_G15U16:A4C5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 A U 16 1_555 B A 4  1_555 A A 17 1_555 B U 3  1_555 -0.550 -1.946 3.076 -0.128 2.480  26.223 -4.877 1.176  2.885 5.451  0.282   
26.338 16 CC_U16A17:U3A4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 A A 17 1_555 B U 3  1_555 A C 18 1_555 B G 2  1_555 -0.015 -1.570 3.218 2.677  8.126  31.530 -4.098 0.456  2.729 14.620 -4.817  
32.641 17 CC_A17C18:G2U3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 A C 18 1_555 B G 2  1_555 A G 19 1_555 B C 1  1_555 -0.090 -1.983 3.608 1.040  13.907 29.560 -5.886 0.337  2.448 25.544 -1.910  
32.618 18 CC_C18G19:C1G2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#