data_1RQQ
# 
_entry.id   1RQQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RQQ         pdb_00001rqq 10.2210/pdb1rqq/pdb 
RCSB  RCSB020964   ?            ?                   
WWPDB D_1000020964 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RQQ 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hu, J.'        1 
'Liu, J.'       2 
'Ghirlando, R.' 3 
'Saltiel, A.R.' 4 
'Hubbard, S.R.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            12 
_citation.page_first                1379 
_citation.page_last                 1389 
_citation.year                      2003 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14690593 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(03)00487-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hu, J.'        1 ? 
primary 'Liu, J.'       2 ? 
primary 'Ghirlando, R.' 3 ? 
primary 'Saltiel, A.R.' 4 ? 
primary 'Hubbard, S.R.' 5 ? 
# 
_cell.entry_id           1RQQ 
_cell.length_a           87.216 
_cell.length_b           96.443 
_cell.length_c           121.993 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.entry_id                         1RQQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Insulin receptor'                                                       35033.660 2  2.7.1.112 'C980S, K1251N' 
'Kinase domain' ? 
2 polymer     man 'adaptor protein APS'                                                    12891.678 2  ?         ?               
'SH2 domain'    ? 
3 polymer     syn 'BISUBSTRATE INHIBITOR'                                                  1939.280  2  ?         ?               
?               ? 
4 non-polymer syn 'MANGANESE (II) ION'                                                     54.938    2  ?         ?               
?               ? 
5 non-polymer syn 'THIOPHOSPHORIC ACID O-((ADENOSYL-PHOSPHO)PHOSPHO)-S-ACETAMIDYL-DIESTER' 580.298   2  ?         ?               
?               ? 
6 water       nat water                                                                    18.015    79 ?         ?               
?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IR 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;VFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARN
CMVAHDFTVKIGDFGMTRDI(PTR)ETD(PTR)(PTR)RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSL
AEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
;
;VFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARN
CMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
;
A,B ? 
2 'polypeptide(L)' no no  
;GSHMELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWF
QSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQ
;
;GSHMELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWF
QSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQ
;
C,D ? 
3 'polypeptide(L)' no no  KKKLPATGDFMNMSPVGD KKKLPATGDFMNMSPVGD E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PHE n 
1 3   PRO n 
1 4   SER n 
1 5   SER n 
1 6   VAL n 
1 7   TYR n 
1 8   VAL n 
1 9   PRO n 
1 10  ASP n 
1 11  GLU n 
1 12  TRP n 
1 13  GLU n 
1 14  VAL n 
1 15  SER n 
1 16  ARG n 
1 17  GLU n 
1 18  LYS n 
1 19  ILE n 
1 20  THR n 
1 21  LEU n 
1 22  LEU n 
1 23  ARG n 
1 24  GLU n 
1 25  LEU n 
1 26  GLY n 
1 27  GLN n 
1 28  GLY n 
1 29  SER n 
1 30  PHE n 
1 31  GLY n 
1 32  MET n 
1 33  VAL n 
1 34  TYR n 
1 35  GLU n 
1 36  GLY n 
1 37  ASN n 
1 38  ALA n 
1 39  ARG n 
1 40  ASP n 
1 41  ILE n 
1 42  ILE n 
1 43  LYS n 
1 44  GLY n 
1 45  GLU n 
1 46  ALA n 
1 47  GLU n 
1 48  THR n 
1 49  ARG n 
1 50  VAL n 
1 51  ALA n 
1 52  VAL n 
1 53  LYS n 
1 54  THR n 
1 55  VAL n 
1 56  ASN n 
1 57  GLU n 
1 58  SER n 
1 59  ALA n 
1 60  SER n 
1 61  LEU n 
1 62  ARG n 
1 63  GLU n 
1 64  ARG n 
1 65  ILE n 
1 66  GLU n 
1 67  PHE n 
1 68  LEU n 
1 69  ASN n 
1 70  GLU n 
1 71  ALA n 
1 72  SER n 
1 73  VAL n 
1 74  MET n 
1 75  LYS n 
1 76  GLY n 
1 77  PHE n 
1 78  THR n 
1 79  CYS n 
1 80  HIS n 
1 81  HIS n 
1 82  VAL n 
1 83  VAL n 
1 84  ARG n 
1 85  LEU n 
1 86  LEU n 
1 87  GLY n 
1 88  VAL n 
1 89  VAL n 
1 90  SER n 
1 91  LYS n 
1 92  GLY n 
1 93  GLN n 
1 94  PRO n 
1 95  THR n 
1 96  LEU n 
1 97  VAL n 
1 98  VAL n 
1 99  MET n 
1 100 GLU n 
1 101 LEU n 
1 102 MET n 
1 103 ALA n 
1 104 HIS n 
1 105 GLY n 
1 106 ASP n 
1 107 LEU n 
1 108 LYS n 
1 109 SER n 
1 110 TYR n 
1 111 LEU n 
1 112 ARG n 
1 113 SER n 
1 114 LEU n 
1 115 ARG n 
1 116 PRO n 
1 117 GLU n 
1 118 ALA n 
1 119 GLU n 
1 120 ASN n 
1 121 ASN n 
1 122 PRO n 
1 123 GLY n 
1 124 ARG n 
1 125 PRO n 
1 126 PRO n 
1 127 PRO n 
1 128 THR n 
1 129 LEU n 
1 130 GLN n 
1 131 GLU n 
1 132 MET n 
1 133 ILE n 
1 134 GLN n 
1 135 MET n 
1 136 ALA n 
1 137 ALA n 
1 138 GLU n 
1 139 ILE n 
1 140 ALA n 
1 141 ASP n 
1 142 GLY n 
1 143 MET n 
1 144 ALA n 
1 145 TYR n 
1 146 LEU n 
1 147 ASN n 
1 148 ALA n 
1 149 LYS n 
1 150 LYS n 
1 151 PHE n 
1 152 VAL n 
1 153 HIS n 
1 154 ARG n 
1 155 ASP n 
1 156 LEU n 
1 157 ALA n 
1 158 ALA n 
1 159 ARG n 
1 160 ASN n 
1 161 CYS n 
1 162 MET n 
1 163 VAL n 
1 164 ALA n 
1 165 HIS n 
1 166 ASP n 
1 167 PHE n 
1 168 THR n 
1 169 VAL n 
1 170 LYS n 
1 171 ILE n 
1 172 GLY n 
1 173 ASP n 
1 174 PHE n 
1 175 GLY n 
1 176 MET n 
1 177 THR n 
1 178 ARG n 
1 179 ASP n 
1 180 ILE n 
1 181 PTR n 
1 182 GLU n 
1 183 THR n 
1 184 ASP n 
1 185 PTR n 
1 186 PTR n 
1 187 ARG n 
1 188 LYS n 
1 189 GLY n 
1 190 GLY n 
1 191 LYS n 
1 192 GLY n 
1 193 LEU n 
1 194 LEU n 
1 195 PRO n 
1 196 VAL n 
1 197 ARG n 
1 198 TRP n 
1 199 MET n 
1 200 ALA n 
1 201 PRO n 
1 202 GLU n 
1 203 SER n 
1 204 LEU n 
1 205 LYS n 
1 206 ASP n 
1 207 GLY n 
1 208 VAL n 
1 209 PHE n 
1 210 THR n 
1 211 THR n 
1 212 SER n 
1 213 SER n 
1 214 ASP n 
1 215 MET n 
1 216 TRP n 
1 217 SER n 
1 218 PHE n 
1 219 GLY n 
1 220 VAL n 
1 221 VAL n 
1 222 LEU n 
1 223 TRP n 
1 224 GLU n 
1 225 ILE n 
1 226 THR n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 GLU n 
1 231 GLN n 
1 232 PRO n 
1 233 TYR n 
1 234 GLN n 
1 235 GLY n 
1 236 LEU n 
1 237 SER n 
1 238 ASN n 
1 239 GLU n 
1 240 GLN n 
1 241 VAL n 
1 242 LEU n 
1 243 LYS n 
1 244 PHE n 
1 245 VAL n 
1 246 MET n 
1 247 ASP n 
1 248 GLY n 
1 249 GLY n 
1 250 TYR n 
1 251 LEU n 
1 252 ASP n 
1 253 GLN n 
1 254 PRO n 
1 255 ASP n 
1 256 ASN n 
1 257 CYS n 
1 258 PRO n 
1 259 GLU n 
1 260 ARG n 
1 261 VAL n 
1 262 THR n 
1 263 ASP n 
1 264 LEU n 
1 265 MET n 
1 266 ARG n 
1 267 MET n 
1 268 CYS n 
1 269 TRP n 
1 270 GLN n 
1 271 PHE n 
1 272 ASN n 
1 273 PRO n 
1 274 ASN n 
1 275 MET n 
1 276 ARG n 
1 277 PRO n 
1 278 THR n 
1 279 PHE n 
1 280 LEU n 
1 281 GLU n 
1 282 ILE n 
1 283 VAL n 
1 284 ASN n 
1 285 LEU n 
1 286 LEU n 
1 287 LYS n 
1 288 ASP n 
1 289 ASP n 
1 290 LEU n 
1 291 HIS n 
1 292 PRO n 
1 293 SER n 
1 294 PHE n 
1 295 PRO n 
1 296 GLU n 
1 297 VAL n 
1 298 SER n 
1 299 PHE n 
1 300 PHE n 
1 301 HIS n 
1 302 SER n 
1 303 GLU n 
1 304 GLU n 
1 305 ASN n 
1 306 LYS n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MET n 
2 5   GLU n 
2 6   LEU n 
2 7   GLU n 
2 8   LEU n 
2 9   SER n 
2 10  ASP n 
2 11  TYR n 
2 12  PRO n 
2 13  TRP n 
2 14  PHE n 
2 15  HIS n 
2 16  GLY n 
2 17  THR n 
2 18  LEU n 
2 19  SER n 
2 20  ARG n 
2 21  VAL n 
2 22  LYS n 
2 23  ALA n 
2 24  ALA n 
2 25  GLN n 
2 26  LEU n 
2 27  VAL n 
2 28  LEU n 
2 29  ALA n 
2 30  GLY n 
2 31  GLY n 
2 32  PRO n 
2 33  ARG n 
2 34  SER n 
2 35  HIS n 
2 36  GLY n 
2 37  LEU n 
2 38  PHE n 
2 39  VAL n 
2 40  ILE n 
2 41  ARG n 
2 42  GLN n 
2 43  SER n 
2 44  GLU n 
2 45  THR n 
2 46  ARG n 
2 47  PRO n 
2 48  GLY n 
2 49  GLU n 
2 50  CYS n 
2 51  VAL n 
2 52  LEU n 
2 53  THR n 
2 54  PHE n 
2 55  ASN n 
2 56  PHE n 
2 57  GLN n 
2 58  GLY n 
2 59  LYS n 
2 60  ALA n 
2 61  LYS n 
2 62  HIS n 
2 63  LEU n 
2 64  ARG n 
2 65  LEU n 
2 66  SER n 
2 67  LEU n 
2 68  ASN n 
2 69  GLY n 
2 70  HIS n 
2 71  GLY n 
2 72  GLN n 
2 73  CYS n 
2 74  HIS n 
2 75  VAL n 
2 76  GLN n 
2 77  HIS n 
2 78  LEU n 
2 79  TRP n 
2 80  PHE n 
2 81  GLN n 
2 82  SER n 
2 83  VAL n 
2 84  PHE n 
2 85  ASP n 
2 86  MET n 
2 87  LEU n 
2 88  ARG n 
2 89  HIS n 
2 90  PHE n 
2 91  HIS n 
2 92  THR n 
2 93  HIS n 
2 94  PRO n 
2 95  ILE n 
2 96  PRO n 
2 97  LEU n 
2 98  GLU n 
2 99  SER n 
2 100 GLY n 
2 101 GLY n 
2 102 SER n 
2 103 ALA n 
2 104 ASP n 
2 105 ILE n 
2 106 THR n 
2 107 LEU n 
2 108 ARG n 
2 109 SER n 
2 110 TYR n 
2 111 VAL n 
2 112 ARG n 
2 113 ALA n 
2 114 GLN n 
3 1   LYS n 
3 2   LYS n 
3 3   LYS n 
3 4   LEU n 
3 5   PRO n 
3 6   ALA n 
3 7   THR n 
3 8   GLY n 
3 9   ASP n 
3 10  PHE n 
3 11  MET n 
3 12  ASN n 
3 13  MET n 
3 14  SER n 
3 15  PRO n 
3 16  VAL n 
3 17  GLY n 
3 18  ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human        Homo   INSR ? ? ? ? ? ? 'Homo sapiens'      9606  ? ? ? ? ? ? ? 'fall armyworm' 
'Spodoptera frugiperda' 7108 Spodoptera  ? ? ? ? ? ? ? SF9 ? ? ? ? ? ? Baculovirus ? ? ? ? ? 
2 1 sample ? ? ? 'Norway rat' Rattus ?    ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ?               'Escherichia coli' 
562  Escherichia ? ? ? ? ? ? ? ?   ? ? ? ? ? ? ?           ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP INSR_HUMAN P06213 1 1005 ? ? 
2 UNP APS_RAT    Q9Z200 2 401  ? ? 
3 PDB 1RQQ       1RQQ   3 ?    ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RQQ A 1 ? 306 ? P06213 1005 ? 1310 ? 978 1283 
2 1 1RQQ B 1 ? 306 ? P06213 1005 ? 1310 ? 978 1283 
3 2 1RQQ C 5 ? 114 ? Q9Z200 401  ? 510  ? 401 510  
4 2 1RQQ D 5 ? 114 ? Q9Z200 401  ? 510  ? 401 510  
5 3 1RQQ E 1 ? 18  ? 1RQQ   99   ? 116  ? 99  116  
6 3 1RQQ F 1 ? 18  ? 1RQQ   99   ? 116  ? 99  116  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RQQ SER A 4   ? UNP P06213 CYS 1008 'engineered mutation' 981  1  
1 1RQQ PTR A 181 ? UNP P06213 TYR 1185 'modified residue'    1158 2  
1 1RQQ PTR A 185 ? UNP P06213 TYR 1189 'modified residue'    1162 3  
1 1RQQ PTR A 186 ? UNP P06213 TYR 1190 'modified residue'    1163 4  
1 1RQQ ASN A 274 ? UNP P06213 LYS 1278 variant               1251 5  
2 1RQQ SER B 4   ? UNP P06213 CYS 1008 'engineered mutation' 981  6  
2 1RQQ PTR B 181 ? UNP P06213 TYR 1185 'modified residue'    1158 7  
2 1RQQ PTR B 185 ? UNP P06213 TYR 1189 'modified residue'    1162 8  
2 1RQQ PTR B 186 ? UNP P06213 TYR 1190 'modified residue'    1163 9  
2 1RQQ ASN B 274 ? UNP P06213 LYS 1278 variant               1251 10 
3 1RQQ GLY C 1   ? UNP Q9Z200 ?   ?    'expression tag'      397  11 
3 1RQQ SER C 2   ? UNP Q9Z200 ?   ?    'expression tag'      398  12 
3 1RQQ HIS C 3   ? UNP Q9Z200 ?   ?    'expression tag'      399  13 
3 1RQQ MET C 4   ? UNP Q9Z200 ?   ?    'expression tag'      400  14 
4 1RQQ GLY D 1   ? UNP Q9Z200 ?   ?    'expression tag'      397  15 
4 1RQQ SER D 2   ? UNP Q9Z200 ?   ?    'expression tag'      398  16 
4 1RQQ HIS D 3   ? UNP Q9Z200 ?   ?    'expression tag'      399  17 
4 1RQQ MET D 4   ? UNP Q9Z200 ?   ?    'expression tag'      400  18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
112 non-polymer         . 'THIOPHOSPHORIC ACID O-((ADENOSYL-PHOSPHO)PHOSPHO)-S-ACETAMIDYL-DIESTER' ?                 
'C12 H19 N6 O13 P3 S' 580.298 
ALA 'L-peptide linking' y ALANINE                                                                  ?                 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                 ?                 
'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                               ?                 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                          ?                 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                 ?                 
'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                ?                 
'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                          ?                 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                  ?                 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                ?                 
'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                                                    ?                 'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                               ?                 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                  ?                 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                   ?                 
'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                                               ?                 
'C5 H11 N O2 S'       149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                                     ?                 'Mn 2' 54.938 
PHE 'L-peptide linking' y PHENYLALANINE                                                            ?                 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                  ?                 'C5 H9 N O2' 
115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                                                        PHOSPHONOTYROSINE 
'C9 H12 N O6 P'       261.168 
SER 'L-peptide linking' y SERINE                                                                   ?                 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                ?                 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                               ?                 
'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                                                 ?                 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                   ?                 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          1RQQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'pH 8.0' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2003-11-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RQQ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   32437 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.039 
_reflns.pdbx_netI_over_sigmaI        22.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.164 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RQQ 
_refine.ls_number_reflns_obs                     31446 
_refine.ls_number_reflns_all                     32303 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    97.3 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.277 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1556 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.9 
_refine.aniso_B[1][1]                            -7.90000 
_refine.aniso_B[2][2]                            5.40000 
_refine.aniso_B[3][3]                            2.50000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    CNS 
_refine.solvent_model_param_ksol                 0.32 
_refine.solvent_model_param_bsol                 31.06 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 1GAG, 1RPY' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6149 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             79 
_refine_hist.number_atoms_total               6300 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.450 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.803 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.33  1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.31  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.95  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.90  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RQQ 
_struct.title                     'Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RQQ 
_struct_keywords.pdbx_keywords   'TRANSFERASE/SIGNALING PROTEIN' 
_struct_keywords.text            'Protein tyrosine kinase, adaptor protein, SH2 domain, TRANSFERASE-SIGNALING PROTEIN COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 60  ? LYS A 75  ? SER A 1037 LYS A 1052 1 ? 16 
HELX_P HELX_P2  2  ASP A 106 ? LEU A 114 ? ASP A 1083 LEU A 1091 1 ? 9  
HELX_P HELX_P3  3  THR A 128 ? LYS A 149 ? THR A 1105 LYS A 1126 1 ? 22 
HELX_P HELX_P4  4  ALA A 157 ? ARG A 159 ? ALA A 1134 ARG A 1136 5 ? 3  
HELX_P HELX_P5  5  PRO A 195 ? MET A 199 ? PRO A 1172 MET A 1176 5 ? 5  
HELX_P HELX_P6  6  ALA A 200 ? GLY A 207 ? ALA A 1177 GLY A 1184 1 ? 8  
HELX_P HELX_P7  7  THR A 210 ? SER A 227 ? THR A 1187 SER A 1204 1 ? 18 
HELX_P HELX_P8  8  SER A 237 ? ASP A 247 ? SER A 1214 ASP A 1224 1 ? 11 
HELX_P HELX_P9  9  PRO A 258 ? TRP A 269 ? PRO A 1235 TRP A 1246 1 ? 12 
HELX_P HELX_P10 10 ASN A 272 ? ARG A 276 ? ASN A 1249 ARG A 1253 5 ? 5  
HELX_P HELX_P11 11 THR A 278 ? LYS A 287 ? THR A 1255 LYS A 1264 1 ? 10 
HELX_P HELX_P12 12 SER A 293 ? SER A 298 ? SER A 1270 SER A 1275 1 ? 6  
HELX_P HELX_P13 13 SER B 60  ? LYS B 75  ? SER B 1037 LYS B 1052 1 ? 16 
HELX_P HELX_P14 14 ASP B 106 ? LEU B 114 ? ASP B 1083 LEU B 1091 1 ? 9  
HELX_P HELX_P15 15 THR B 128 ? LYS B 149 ? THR B 1105 LYS B 1126 1 ? 22 
HELX_P HELX_P16 16 ALA B 157 ? ARG B 159 ? ALA B 1134 ARG B 1136 5 ? 3  
HELX_P HELX_P17 17 PRO B 195 ? MET B 199 ? PRO B 1172 MET B 1176 5 ? 5  
HELX_P HELX_P18 18 ALA B 200 ? GLY B 207 ? ALA B 1177 GLY B 1184 1 ? 8  
HELX_P HELX_P19 19 THR B 210 ? SER B 227 ? THR B 1187 SER B 1204 1 ? 18 
HELX_P HELX_P20 20 SER B 237 ? ASP B 247 ? SER B 1214 ASP B 1224 1 ? 11 
HELX_P HELX_P21 21 PRO B 258 ? TRP B 269 ? PRO B 1235 TRP B 1246 1 ? 12 
HELX_P HELX_P22 22 ASN B 272 ? ARG B 276 ? ASN B 1249 ARG B 1253 5 ? 5  
HELX_P HELX_P23 23 THR B 278 ? LYS B 287 ? THR B 1255 LYS B 1264 1 ? 10 
HELX_P HELX_P24 24 SER B 293 ? SER B 298 ? SER B 1270 SER B 1275 1 ? 6  
HELX_P HELX_P25 25 GLU C 7   ? TYR C 11  ? GLU C 403  TYR C 407  5 ? 5  
HELX_P HELX_P26 26 SER C 19  ? ALA C 29  ? SER C 415  ALA C 425  1 ? 11 
HELX_P HELX_P27 27 GLY C 30  ? HIS C 35  ? GLY C 426  HIS C 431  5 ? 6  
HELX_P HELX_P28 28 CYS C 73  ? HIS C 89  ? CYS C 469  HIS C 485  1 ? 17 
HELX_P HELX_P29 29 GLU D 7   ? TYR D 11  ? GLU D 403  TYR D 407  5 ? 5  
HELX_P HELX_P30 30 SER D 19  ? ALA D 29  ? SER D 415  ALA D 425  1 ? 11 
HELX_P HELX_P31 31 GLY D 30  ? HIS D 35  ? GLY D 426  HIS D 431  5 ? 6  
HELX_P HELX_P32 32 CYS D 73  ? HIS D 89  ? CYS D 469  HIS D 485  1 ? 17 
HELX_P HELX_P33 33 ALA E 6   ? PHE E 10  ? ALA E 104  PHE E 108  5 ? 5  
HELX_P HELX_P34 34 ALA F 6   ? PHE F 10  ? ALA F 104  PHE F 108  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A ILE 180 C  ? ? ? 1_555 A PTR 181 N   ? ? A ILE 1157 A PTR 1158 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale2  covale both ? A PTR 181 C  ? ? ? 1_555 A GLU 182 N   ? ? A PTR 1158 A GLU 1159 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale3  covale both ? A ASP 184 C  ? ? ? 1_555 A PTR 185 N   ? ? A ASP 1161 A PTR 1162 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale4  covale both ? A PTR 185 C  ? ? ? 1_555 A PTR 186 N   ? ? A PTR 1162 A PTR 1163 1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale5  covale both ? A PTR 186 C  ? ? ? 1_555 A ARG 187 N   ? ? A PTR 1163 A ARG 1164 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale6  covale both ? B ILE 180 C  ? ? ? 1_555 B PTR 181 N   ? ? B ILE 1157 B PTR 1158 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale7  covale both ? B PTR 181 C  ? ? ? 1_555 B GLU 182 N   ? ? B PTR 1158 B GLU 1159 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale8  covale both ? B ASP 184 C  ? ? ? 1_555 B PTR 185 N   ? ? B ASP 1161 B PTR 1162 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale9  covale both ? B PTR 185 C  ? ? ? 1_555 B PTR 186 N   ? ? B PTR 1162 B PTR 1163 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale10 covale both ? B PTR 186 C  ? ? ? 1_555 B ARG 187 N   ? ? B PTR 1163 B ARG 1164 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale11 covale none ? E PHE 10  CZ ? ? ? 1_555 I 112 .   NS  ? ? E PHE 108  E 112 117  1_555 ? ? ? ? ? ? ? 1.460 ? ? 
covale12 covale none ? F PHE 10  CZ ? ? ? 1_555 J 112 .   NS  ? ? F PHE 108  F 112 117  1_555 ? ? ? ? ? ? ? 1.458 ? ? 
metalc1  metalc ?    ? K HOH .   O  ? ? ? 1_555 G MN  .   MN  ? ? A HOH 63   A MN  201  1_555 ? ? ? ? ? ? ? 1.931 ? ? 
metalc2  metalc ?    ? G MN  .   MN ? ? ? 1_555 A ASN 160 OD1 ? ? A MN  201  A ASN 1137 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc3  metalc ?    ? G MN  .   MN ? ? ? 1_555 A ASP 173 OD2 ? ? A MN  201  A ASP 1150 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc4  metalc ?    ? G MN  .   MN ? ? ? 1_555 I 112 .   O2S ? ? A MN  201  E 112 117  1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc5  metalc ?    ? G MN  .   MN ? ? ? 1_555 I 112 .   O2G ? ? A MN  201  E 112 117  1_555 ? ? ? ? ? ? ? 2.158 ? ? 
metalc6  metalc ?    ? G MN  .   MN ? ? ? 1_555 I 112 .   O2B ? ? A MN  201  E 112 117  1_555 ? ? ? ? ? ? ? 2.177 ? ? 
metalc7  metalc ?    ? H MN  .   MN ? ? ? 1_555 B ASN 160 OD1 ? ? B MN  202  B ASN 1137 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc8  metalc ?    ? H MN  .   MN ? ? ? 1_555 B ASP 173 OD2 ? ? B MN  202  B ASP 1150 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc9  metalc ?    ? H MN  .   MN ? ? ? 1_555 P HOH .   O   ? ? B MN  202  F HOH 66   1_555 ? ? ? ? ? ? ? 2.210 ? ? 
metalc10 metalc ?    ? H MN  .   MN ? ? ? 1_555 J 112 .   O2G ? ? B MN  202  F 112 117  1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc11 metalc ?    ? H MN  .   MN ? ? ? 1_555 J 112 .   O2S ? ? B MN  202  F 112 117  1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc12 metalc ?    ? H MN  .   MN ? ? ? 1_555 J 112 .   O2B ? ? B MN  202  F 112 117  1_555 ? ? ? ? ? ? ? 2.180 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 93 A . ? GLN 1070 A PRO 94 A ? PRO 1071 A 1 0.26  
2 GLN 93 B . ? GLN 1070 B PRO 94 B ? PRO 1071 B 1 -0.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 5 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
K ? 3 ? 
L ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 19  ? GLY A 28  ? ILE A 996  GLY A 1005 
A 2 GLY A 31  ? ARG A 39  ? GLY A 1008 ARG A 1016 
A 3 GLU A 47  ? LYS A 53  ? GLU A 1024 LYS A 1030 
A 4 LEU A 96  ? GLU A 100 ? LEU A 1073 GLU A 1077 
A 5 LEU A 85  ? VAL A 89  ? LEU A 1062 VAL A 1066 
B 1 PHE A 151 ? VAL A 152 ? PHE A 1128 VAL A 1129 
B 2 ARG A 178 ? ASP A 179 ? ARG A 1155 ASP A 1156 
C 1 CYS A 161 ? VAL A 163 ? CYS A 1138 VAL A 1140 
C 2 VAL A 169 ? ILE A 171 ? VAL A 1146 ILE A 1148 
D 1 PTR A 186 ? ARG A 187 ? PTR A 1163 ARG A 1164 
D 2 VAL A 208 ? PHE A 209 ? VAL A 1185 PHE A 1186 
E 1 GLY A 192 ? LEU A 194 ? GLY A 1169 LEU A 1171 
E 2 MET E 11  ? MET E 13  ? MET E 109  MET E 111  
F 1 ILE B 19  ? GLY B 28  ? ILE B 996  GLY B 1005 
F 2 GLY B 31  ? ARG B 39  ? GLY B 1008 ARG B 1016 
F 3 GLU B 47  ? LYS B 53  ? GLU B 1024 LYS B 1030 
F 4 LEU B 96  ? GLU B 100 ? LEU B 1073 GLU B 1077 
F 5 LEU B 85  ? VAL B 89  ? LEU B 1062 VAL B 1066 
G 1 PHE B 151 ? VAL B 152 ? PHE B 1128 VAL B 1129 
G 2 ARG B 178 ? ASP B 179 ? ARG B 1155 ASP B 1156 
H 1 CYS B 161 ? VAL B 163 ? CYS B 1138 VAL B 1140 
H 2 VAL B 169 ? ILE B 171 ? VAL B 1146 ILE B 1148 
I 1 PTR B 186 ? ARG B 187 ? PTR B 1163 ARG B 1164 
I 2 VAL B 208 ? PHE B 209 ? VAL B 1185 PHE B 1186 
J 1 GLY B 192 ? LEU B 194 ? GLY B 1169 LEU B 1171 
J 2 MET F 11  ? MET F 13  ? MET F 109  MET F 111  
K 1 PHE C 38  ? GLN C 42  ? PHE C 434  GLN C 438  
K 2 CYS C 50  ? PHE C 56  ? CYS C 446  PHE C 452  
K 3 LYS C 59  ? LEU C 65  ? LYS C 455  LEU C 461  
L 1 PHE D 38  ? GLN D 42  ? PHE D 434  GLN D 438  
L 2 CYS D 50  ? PHE D 56  ? CYS D 446  PHE D 452  
L 3 LYS D 59  ? LEU D 65  ? LYS D 455  LEU D 461  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 28  ? N GLY A 1005 O GLY A 31  ? O GLY A 1008 
A 2 3 N TYR A 34  ? N TYR A 1011 O VAL A 52  ? O VAL A 1029 
A 3 4 N LYS A 53  ? N LYS A 1030 O VAL A 97  ? O VAL A 1074 
A 4 5 O VAL A 98  ? O VAL A 1075 N GLY A 87  ? N GLY A 1064 
B 1 2 N VAL A 152 ? N VAL A 1129 O ARG A 178 ? O ARG A 1155 
C 1 2 N MET A 162 ? N MET A 1139 O LYS A 170 ? O LYS A 1147 
D 1 2 N PTR A 186 ? N PTR A 1163 O PHE A 209 ? O PHE A 1186 
E 1 2 N GLY A 192 ? N GLY A 1169 O MET E 13  ? O MET E 111  
F 1 2 N GLY B 28  ? N GLY B 1005 O GLY B 31  ? O GLY B 1008 
F 2 3 N TYR B 34  ? N TYR B 1011 O VAL B 52  ? O VAL B 1029 
F 3 4 N LYS B 53  ? N LYS B 1030 O VAL B 97  ? O VAL B 1074 
F 4 5 O VAL B 98  ? O VAL B 1075 N GLY B 87  ? N GLY B 1064 
G 1 2 N VAL B 152 ? N VAL B 1129 O ARG B 178 ? O ARG B 1155 
H 1 2 N MET B 162 ? N MET B 1139 O LYS B 170 ? O LYS B 1147 
I 1 2 N PTR B 186 ? N PTR B 1163 O PHE B 209 ? O PHE B 1186 
J 1 2 N GLY B 192 ? N GLY B 1169 O MET F 13  ? O MET F 111  
K 1 2 N ARG C 41  ? N ARG C 437  O VAL C 51  ? O VAL C 447  
K 2 3 N PHE C 56  ? N PHE C 452  O LYS C 59  ? O LYS C 455  
L 1 2 N ARG D 41  ? N ARG D 437  O VAL D 51  ? O VAL D 447  
L 2 3 N PHE D 56  ? N PHE D 452  O LYS D 59  ? O LYS D 455  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  201 ? 4  'BINDING SITE FOR RESIDUE MN A 201'  
AC2 Software B MN  202 ? 4  'BINDING SITE FOR RESIDUE MN B 202'  
AC3 Software E 112 117 ? 21 'BINDING SITE FOR RESIDUE 112 E 117' 
AC4 Software F 112 117 ? 18 'BINDING SITE FOR RESIDUE 112 F 117' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HOH K .   ? HOH A 63   . ? 1_555 ? 
2  AC1 4  ASN A 160 ? ASN A 1137 . ? 1_555 ? 
3  AC1 4  ASP A 173 ? ASP A 1150 . ? 1_555 ? 
4  AC1 4  112 I .   ? 112 E 117  . ? 1_555 ? 
5  AC2 4  ASN B 160 ? ASN B 1137 . ? 1_555 ? 
6  AC2 4  ASP B 173 ? ASP B 1150 . ? 1_555 ? 
7  AC2 4  HOH P .   ? HOH F 66   . ? 1_555 ? 
8  AC2 4  112 J .   ? 112 F 117  . ? 1_555 ? 
9  AC3 21 HOH K .   ? HOH A 63   . ? 1_555 ? 
10 AC3 21 MN  G .   ? MN  A 201  . ? 1_555 ? 
11 AC3 21 GLN A 27  ? GLN A 1004 . ? 1_555 ? 
12 AC3 21 GLY A 28  ? GLY A 1005 . ? 1_555 ? 
13 AC3 21 SER A 29  ? SER A 1006 . ? 1_555 ? 
14 AC3 21 VAL A 33  ? VAL A 1010 . ? 1_555 ? 
15 AC3 21 ALA A 51  ? ALA A 1028 . ? 1_555 ? 
16 AC3 21 LYS A 53  ? LYS A 1030 . ? 1_555 ? 
17 AC3 21 MET A 99  ? MET A 1076 . ? 1_555 ? 
18 AC3 21 GLU A 100 ? GLU A 1077 . ? 1_555 ? 
19 AC3 21 MET A 102 ? MET A 1079 . ? 1_555 ? 
20 AC3 21 ASP A 106 ? ASP A 1083 . ? 1_555 ? 
21 AC3 21 ASP A 155 ? ASP A 1132 . ? 1_555 ? 
22 AC3 21 ARG A 159 ? ARG A 1136 . ? 1_555 ? 
23 AC3 21 ASN A 160 ? ASN A 1137 . ? 1_555 ? 
24 AC3 21 MET A 162 ? MET A 1139 . ? 1_555 ? 
25 AC3 21 ASP A 173 ? ASP A 1150 . ? 1_555 ? 
26 AC3 21 HOH O .   ? HOH E 62   . ? 1_555 ? 
27 AC3 21 HOH O .   ? HOH E 64   . ? 1_555 ? 
28 AC3 21 ALA E 6   ? ALA E 104  . ? 1_555 ? 
29 AC3 21 PHE E 10  ? PHE E 108  . ? 1_555 ? 
30 AC4 18 MN  H .   ? MN  B 202  . ? 1_555 ? 
31 AC4 18 GLN B 27  ? GLN B 1004 . ? 1_555 ? 
32 AC4 18 GLY B 28  ? GLY B 1005 . ? 1_555 ? 
33 AC4 18 SER B 29  ? SER B 1006 . ? 1_555 ? 
34 AC4 18 VAL B 33  ? VAL B 1010 . ? 1_555 ? 
35 AC4 18 ALA B 51  ? ALA B 1028 . ? 1_555 ? 
36 AC4 18 LYS B 53  ? LYS B 1030 . ? 1_555 ? 
37 AC4 18 MET B 99  ? MET B 1076 . ? 1_555 ? 
38 AC4 18 GLU B 100 ? GLU B 1077 . ? 1_555 ? 
39 AC4 18 MET B 102 ? MET B 1079 . ? 1_555 ? 
40 AC4 18 ASP B 155 ? ASP B 1132 . ? 1_555 ? 
41 AC4 18 ARG B 159 ? ARG B 1136 . ? 1_555 ? 
42 AC4 18 ASN B 160 ? ASN B 1137 . ? 1_555 ? 
43 AC4 18 MET B 162 ? MET B 1139 . ? 1_555 ? 
44 AC4 18 ASP B 173 ? ASP B 1150 . ? 1_555 ? 
45 AC4 18 HOH P .   ? HOH F 11   . ? 1_555 ? 
46 AC4 18 HOH P .   ? HOH F 66   . ? 1_555 ? 
47 AC4 18 PHE F 10  ? PHE F 108  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RQQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RQQ 
_atom_sites.fract_transf_matrix[1][1]   0.011466 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010369 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008197 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 10  ? 13.472  34.152  23.787  1.00 72.74 ? 987  ASP A N     1 
ATOM   2    C  CA    . ASP A 1 10  ? 14.194  35.226  24.522  1.00 72.44 ? 987  ASP A CA    1 
ATOM   3    C  C     . ASP A 1 10  ? 13.141  36.118  25.174  1.00 71.34 ? 987  ASP A C     1 
ATOM   4    O  O     . ASP A 1 10  ? 13.318  37.331  25.311  1.00 71.80 ? 987  ASP A O     1 
ATOM   5    C  CB    . ASP A 1 10  ? 15.071  36.034  23.550  1.00 73.50 ? 987  ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 10  ? 14.271  37.025  22.714  1.00 74.78 ? 987  ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 10  ? 13.159  36.672  22.268  1.00 74.98 ? 987  ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 10  ? 14.765  38.157  22.499  1.00 75.56 ? 987  ASP A OD2   1 
ATOM   9    N  N     . GLU A 1 11  ? 12.038  35.501  25.585  1.00 68.90 ? 988  GLU A N     1 
ATOM   10   C  CA    . GLU A 1 11  ? 10.955  36.250  26.204  1.00 65.52 ? 988  GLU A CA    1 
ATOM   11   C  C     . GLU A 1 11  ? 11.371  36.733  27.590  1.00 63.79 ? 988  GLU A C     1 
ATOM   12   O  O     . GLU A 1 11  ? 10.714  37.593  28.178  1.00 63.87 ? 988  GLU A O     1 
ATOM   13   C  CB    . GLU A 1 11  ? 9.706   35.371  26.318  1.00 64.25 ? 988  GLU A CB    1 
ATOM   14   N  N     . TRP A 1 12  ? 12.465  36.169  28.104  1.00 61.20 ? 989  TRP A N     1 
ATOM   15   C  CA    . TRP A 1 12  ? 12.986  36.519  29.424  1.00 57.26 ? 989  TRP A CA    1 
ATOM   16   C  C     . TRP A 1 12  ? 14.147  37.500  29.358  1.00 58.17 ? 989  TRP A C     1 
ATOM   17   O  O     . TRP A 1 12  ? 14.642  37.955  30.391  1.00 57.20 ? 989  TRP A O     1 
ATOM   18   C  CB    . TRP A 1 12  ? 13.458  35.274  30.176  1.00 51.05 ? 989  TRP A CB    1 
ATOM   19   C  CG    . TRP A 1 12  ? 12.371  34.366  30.637  1.00 45.24 ? 989  TRP A CG    1 
ATOM   20   C  CD1   . TRP A 1 12  ? 11.799  33.342  29.932  1.00 43.76 ? 989  TRP A CD1   1 
ATOM   21   C  CD2   . TRP A 1 12  ? 11.735  34.368  31.929  1.00 42.04 ? 989  TRP A CD2   1 
ATOM   22   N  NE1   . TRP A 1 12  ? 10.851  32.703  30.707  1.00 42.18 ? 989  TRP A NE1   1 
ATOM   23   C  CE2   . TRP A 1 12  ? 10.792  33.312  31.934  1.00 39.53 ? 989  TRP A CE2   1 
ATOM   24   C  CE3   . TRP A 1 12  ? 11.875  35.161  33.082  1.00 39.18 ? 989  TRP A CE3   1 
ATOM   25   C  CZ2   . TRP A 1 12  ? 9.991   33.026  33.046  1.00 36.96 ? 989  TRP A CZ2   1 
ATOM   26   C  CZ3   . TRP A 1 12  ? 11.076  34.877  34.193  1.00 36.06 ? 989  TRP A CZ3   1 
ATOM   27   C  CH2   . TRP A 1 12  ? 10.145  33.815  34.164  1.00 36.10 ? 989  TRP A CH2   1 
ATOM   28   N  N     . GLU A 1 13  ? 14.587  37.819  28.145  1.00 59.16 ? 990  GLU A N     1 
ATOM   29   C  CA    . GLU A 1 13  ? 15.690  38.752  27.969  1.00 59.56 ? 990  GLU A CA    1 
ATOM   30   C  C     . GLU A 1 13  ? 15.354  40.121  28.529  1.00 60.36 ? 990  GLU A C     1 
ATOM   31   O  O     . GLU A 1 13  ? 14.213  40.580  28.438  1.00 60.20 ? 990  GLU A O     1 
ATOM   32   C  CB    . GLU A 1 13  ? 16.048  38.889  26.491  1.00 57.59 ? 990  GLU A CB    1 
ATOM   33   C  CG    . GLU A 1 13  ? 17.008  37.826  26.011  1.00 58.93 ? 990  GLU A CG    1 
ATOM   34   C  CD    . GLU A 1 13  ? 18.379  37.941  26.653  1.00 56.87 ? 990  GLU A CD    1 
ATOM   35   O  OE1   . GLU A 1 13  ? 18.995  36.892  26.907  1.00 58.08 ? 990  GLU A OE1   1 
ATOM   36   O  OE2   . GLU A 1 13  ? 18.843  39.073  26.892  1.00 55.07 ? 990  GLU A OE2   1 
ATOM   37   N  N     . VAL A 1 14  ? 16.357  40.764  29.114  1.00 60.37 ? 991  VAL A N     1 
ATOM   38   C  CA    . VAL A 1 14  ? 16.184  42.095  29.666  1.00 61.10 ? 991  VAL A CA    1 
ATOM   39   C  C     . VAL A 1 14  ? 17.390  42.955  29.308  1.00 62.57 ? 991  VAL A C     1 
ATOM   40   O  O     . VAL A 1 14  ? 18.533  42.485  29.332  1.00 63.73 ? 991  VAL A O     1 
ATOM   41   C  CB    . VAL A 1 14  ? 16.037  42.061  31.187  1.00 60.71 ? 991  VAL A CB    1 
ATOM   42   C  CG1   . VAL A 1 14  ? 15.798  43.469  31.717  1.00 61.08 ? 991  VAL A CG1   1 
ATOM   43   C  CG2   . VAL A 1 14  ? 14.894  41.155  31.563  1.00 60.90 ? 991  VAL A CG2   1 
ATOM   44   N  N     . SER A 1 15  ? 17.129  44.214  28.974  1.00 61.98 ? 992  SER A N     1 
ATOM   45   C  CA    . SER A 1 15  ? 18.187  45.141  28.603  1.00 62.00 ? 992  SER A CA    1 
ATOM   46   C  C     . SER A 1 15  ? 19.161  45.340  29.756  1.00 61.45 ? 992  SER A C     1 
ATOM   47   O  O     . SER A 1 15  ? 18.755  45.638  30.875  1.00 60.70 ? 992  SER A O     1 
ATOM   48   C  CB    . SER A 1 15  ? 17.577  46.479  28.209  1.00 63.77 ? 992  SER A CB    1 
ATOM   49   O  OG    . SER A 1 15  ? 16.504  46.291  27.304  1.00 67.27 ? 992  SER A OG    1 
ATOM   50   N  N     . ARG A 1 16  ? 20.448  45.175  29.471  1.00 61.28 ? 993  ARG A N     1 
ATOM   51   C  CA    . ARG A 1 16  ? 21.498  45.326  30.474  1.00 61.22 ? 993  ARG A CA    1 
ATOM   52   C  C     . ARG A 1 16  ? 21.460  46.706  31.127  1.00 61.86 ? 993  ARG A C     1 
ATOM   53   O  O     . ARG A 1 16  ? 22.070  46.932  32.177  1.00 60.77 ? 993  ARG A O     1 
ATOM   54   C  CB    . ARG A 1 16  ? 22.855  45.107  29.808  1.00 59.68 ? 993  ARG A CB    1 
ATOM   55   C  CG    . ARG A 1 16  ? 24.044  45.070  30.752  1.00 60.00 ? 993  ARG A CG    1 
ATOM   56   C  CD    . ARG A 1 16  ? 25.292  44.775  29.951  1.00 58.96 ? 993  ARG A CD    1 
ATOM   57   N  NE    . ARG A 1 16  ? 25.103  43.554  29.179  1.00 58.89 ? 993  ARG A NE    1 
ATOM   58   C  CZ    . ARG A 1 16  ? 25.395  42.338  29.625  1.00 58.17 ? 993  ARG A CZ    1 
ATOM   59   N  NH1   . ARG A 1 16  ? 25.911  42.174  30.837  1.00 56.86 ? 993  ARG A NH1   1 
ATOM   60   N  NH2   . ARG A 1 16  ? 25.125  41.284  28.873  1.00 57.33 ? 993  ARG A NH2   1 
ATOM   61   N  N     . GLU A 1 17  ? 20.736  47.620  30.489  1.00 63.23 ? 994  GLU A N     1 
ATOM   62   C  CA    . GLU A 1 17  ? 20.600  48.995  30.960  1.00 64.04 ? 994  GLU A CA    1 
ATOM   63   C  C     . GLU A 1 17  ? 19.586  49.106  32.087  1.00 62.37 ? 994  GLU A C     1 
ATOM   64   O  O     . GLU A 1 17  ? 19.678  49.997  32.931  1.00 61.63 ? 994  GLU A O     1 
ATOM   65   C  CB    . GLU A 1 17  ? 20.164  49.881  29.797  1.00 66.45 ? 994  GLU A CB    1 
ATOM   66   C  CG    . GLU A 1 17  ? 19.002  49.275  29.027  1.00 71.49 ? 994  GLU A CG    1 
ATOM   67   C  CD    . GLU A 1 17  ? 18.513  50.144  27.885  1.00 74.28 ? 994  GLU A CD    1 
ATOM   68   O  OE1   . GLU A 1 17  ? 19.355  50.554  27.054  1.00 77.94 ? 994  GLU A OE1   1 
ATOM   69   O  OE2   . GLU A 1 17  ? 17.287  50.404  27.809  1.00 74.06 ? 994  GLU A OE2   1 
ATOM   70   N  N     . LYS A 1 18  ? 18.618  48.195  32.091  1.00 60.79 ? 995  LYS A N     1 
ATOM   71   C  CA    . LYS A 1 18  ? 17.579  48.188  33.111  1.00 59.70 ? 995  LYS A CA    1 
ATOM   72   C  C     . LYS A 1 18  ? 18.124  47.624  34.419  1.00 58.11 ? 995  LYS A C     1 
ATOM   73   O  O     . LYS A 1 18  ? 17.435  47.641  35.438  1.00 58.12 ? 995  LYS A O     1 
ATOM   74   C  CB    . LYS A 1 18  ? 16.395  47.353  32.631  1.00 60.82 ? 995  LYS A CB    1 
ATOM   75   C  CG    . LYS A 1 18  ? 16.202  47.423  31.122  1.00 64.59 ? 995  LYS A CG    1 
ATOM   76   C  CD    . LYS A 1 18  ? 14.883  46.826  30.657  1.00 65.87 ? 995  LYS A CD    1 
ATOM   77   C  CE    . LYS A 1 18  ? 13.732  47.777  30.954  1.00 67.52 ? 995  LYS A CE    1 
ATOM   78   N  NZ    . LYS A 1 18  ? 13.965  49.145  30.385  1.00 66.95 ? 995  LYS A NZ    1 
ATOM   79   N  N     . ILE A 1 19  ? 19.364  47.134  34.382  1.00 55.72 ? 996  ILE A N     1 
ATOM   80   C  CA    . ILE A 1 19  ? 20.003  46.543  35.553  1.00 53.21 ? 996  ILE A CA    1 
ATOM   81   C  C     . ILE A 1 19  ? 21.086  47.419  36.157  1.00 53.70 ? 996  ILE A C     1 
ATOM   82   O  O     . ILE A 1 19  ? 21.875  48.028  35.443  1.00 53.98 ? 996  ILE A O     1 
ATOM   83   C  CB    . ILE A 1 19  ? 20.673  45.181  35.226  1.00 51.67 ? 996  ILE A CB    1 
ATOM   84   C  CG1   . ILE A 1 19  ? 19.716  44.276  34.445  1.00 49.27 ? 996  ILE A CG1   1 
ATOM   85   C  CG2   . ILE A 1 19  ? 21.111  44.503  36.515  1.00 48.81 ? 996  ILE A CG2   1 
ATOM   86   C  CD1   . ILE A 1 19  ? 18.429  43.923  35.178  1.00 47.12 ? 996  ILE A CD1   1 
ATOM   87   N  N     . THR A 1 20  ? 21.117  47.459  37.486  1.00 54.89 ? 997  THR A N     1 
ATOM   88   C  CA    . THR A 1 20  ? 22.090  48.235  38.239  1.00 55.24 ? 997  THR A CA    1 
ATOM   89   C  C     . THR A 1 20  ? 22.517  47.437  39.462  1.00 56.99 ? 997  THR A C     1 
ATOM   90   O  O     . THR A 1 20  ? 21.692  47.090  40.303  1.00 58.79 ? 997  THR A O     1 
ATOM   91   C  CB    . THR A 1 20  ? 21.479  49.565  38.724  1.00 54.89 ? 997  THR A CB    1 
ATOM   92   O  OG1   . THR A 1 20  ? 21.085  50.353  37.595  1.00 55.66 ? 997  THR A OG1   1 
ATOM   93   C  CG2   . THR A 1 20  ? 22.482  50.348  39.555  1.00 53.29 ? 997  THR A CG2   1 
ATOM   94   N  N     . LEU A 1 21  ? 23.805  47.144  39.568  1.00 57.96 ? 998  LEU A N     1 
ATOM   95   C  CA    . LEU A 1 21  ? 24.304  46.394  40.712  1.00 59.07 ? 998  LEU A CA    1 
ATOM   96   C  C     . LEU A 1 21  ? 24.582  47.330  41.889  1.00 60.79 ? 998  LEU A C     1 
ATOM   97   O  O     . LEU A 1 21  ? 25.237  48.362  41.732  1.00 61.45 ? 998  LEU A O     1 
ATOM   98   C  CB    . LEU A 1 21  ? 25.566  45.629  40.311  1.00 57.91 ? 998  LEU A CB    1 
ATOM   99   C  CG    . LEU A 1 21  ? 25.352  44.322  39.527  1.00 59.28 ? 998  LEU A CG    1 
ATOM   100  C  CD1   . LEU A 1 21  ? 24.160  44.417  38.593  1.00 57.65 ? 998  LEU A CD1   1 
ATOM   101  C  CD2   . LEU A 1 21  ? 26.618  43.994  38.755  1.00 57.09 ? 998  LEU A CD2   1 
ATOM   102  N  N     . LEU A 1 22  ? 24.070  46.964  43.062  1.00 61.86 ? 999  LEU A N     1 
ATOM   103  C  CA    . LEU A 1 22  ? 24.236  47.748  44.285  1.00 62.66 ? 999  LEU A CA    1 
ATOM   104  C  C     . LEU A 1 22  ? 25.470  47.311  45.050  1.00 64.07 ? 999  LEU A C     1 
ATOM   105  O  O     . LEU A 1 22  ? 26.447  48.050  45.150  1.00 65.71 ? 999  LEU A O     1 
ATOM   106  C  CB    . LEU A 1 22  ? 23.006  47.590  45.181  1.00 61.83 ? 999  LEU A CB    1 
ATOM   107  C  CG    . LEU A 1 22  ? 21.798  48.498  44.937  1.00 62.20 ? 999  LEU A CG    1 
ATOM   108  C  CD1   . LEU A 1 22  ? 22.036  49.828  45.631  1.00 64.32 ? 999  LEU A CD1   1 
ATOM   109  C  CD2   . LEU A 1 22  ? 21.562  48.693  43.446  1.00 61.91 ? 999  LEU A CD2   1 
ATOM   110  N  N     . ARG A 1 23  ? 25.420  46.103  45.596  1.00 64.40 ? 1000 ARG A N     1 
ATOM   111  C  CA    . ARG A 1 23  ? 26.543  45.575  46.346  1.00 65.33 ? 1000 ARG A CA    1 
ATOM   112  C  C     . ARG A 1 23  ? 26.740  44.111  46.004  1.00 64.88 ? 1000 ARG A C     1 
ATOM   113  O  O     . ARG A 1 23  ? 26.104  43.583  45.096  1.00 65.30 ? 1000 ARG A O     1 
ATOM   114  C  CB    . ARG A 1 23  ? 26.295  45.719  47.847  1.00 66.39 ? 1000 ARG A CB    1 
ATOM   115  C  CG    . ARG A 1 23  ? 25.144  44.894  48.353  1.00 69.42 ? 1000 ARG A CG    1 
ATOM   116  C  CD    . ARG A 1 23  ? 24.949  45.108  49.835  1.00 71.89 ? 1000 ARG A CD    1 
ATOM   117  N  NE    . ARG A 1 23  ? 23.725  44.470  50.300  1.00 73.72 ? 1000 ARG A NE    1 
ATOM   118  C  CZ    . ARG A 1 23  ? 23.262  44.555  51.543  1.00 75.02 ? 1000 ARG A CZ    1 
ATOM   119  N  NH1   . ARG A 1 23  ? 23.926  45.259  52.456  1.00 75.70 ? 1000 ARG A NH1   1 
ATOM   120  N  NH2   . ARG A 1 23  ? 22.130  43.937  51.872  1.00 74.29 ? 1000 ARG A NH2   1 
ATOM   121  N  N     . GLU A 1 24  ? 27.634  43.463  46.734  1.00 64.11 ? 1001 GLU A N     1 
ATOM   122  C  CA    . GLU A 1 24  ? 27.897  42.053  46.532  1.00 63.43 ? 1001 GLU A CA    1 
ATOM   123  C  C     . GLU A 1 24  ? 27.195  41.350  47.674  1.00 62.58 ? 1001 GLU A C     1 
ATOM   124  O  O     . GLU A 1 24  ? 27.337  41.749  48.830  1.00 63.05 ? 1001 GLU A O     1 
ATOM   125  C  CB    . GLU A 1 24  ? 29.397  41.767  46.584  1.00 63.92 ? 1001 GLU A CB    1 
ATOM   126  C  CG    . GLU A 1 24  ? 30.157  42.316  45.388  1.00 65.68 ? 1001 GLU A CG    1 
ATOM   127  C  CD    . GLU A 1 24  ? 31.649  42.023  45.444  1.00 66.94 ? 1001 GLU A CD    1 
ATOM   128  O  OE1   . GLU A 1 24  ? 32.340  42.307  44.437  1.00 66.75 ? 1001 GLU A OE1   1 
ATOM   129  O  OE2   . GLU A 1 24  ? 32.128  41.516  46.489  1.00 66.36 ? 1001 GLU A OE2   1 
ATOM   130  N  N     . LEU A 1 25  ? 26.430  40.314  47.353  1.00 60.93 ? 1002 LEU A N     1 
ATOM   131  C  CA    . LEU A 1 25  ? 25.710  39.566  48.372  1.00 59.57 ? 1002 LEU A CA    1 
ATOM   132  C  C     . LEU A 1 25  ? 26.531  38.403  48.883  1.00 59.40 ? 1002 LEU A C     1 
ATOM   133  O  O     . LEU A 1 25  ? 26.537  38.108  50.077  1.00 58.83 ? 1002 LEU A O     1 
ATOM   134  C  CB    . LEU A 1 25  ? 24.388  39.046  47.815  1.00 59.10 ? 1002 LEU A CB    1 
ATOM   135  C  CG    . LEU A 1 25  ? 23.284  40.092  47.657  1.00 60.59 ? 1002 LEU A CG    1 
ATOM   136  C  CD1   . LEU A 1 25  ? 22.051  39.466  47.023  1.00 61.27 ? 1002 LEU A CD1   1 
ATOM   137  C  CD2   . LEU A 1 25  ? 22.941  40.660  49.021  1.00 59.14 ? 1002 LEU A CD2   1 
ATOM   138  N  N     . GLY A 1 26  ? 27.226  37.740  47.968  1.00 59.18 ? 1003 GLY A N     1 
ATOM   139  C  CA    . GLY A 1 26  ? 28.034  36.605  48.352  1.00 57.94 ? 1003 GLY A CA    1 
ATOM   140  C  C     . GLY A 1 26  ? 28.705  35.973  47.157  1.00 57.57 ? 1003 GLY A C     1 
ATOM   141  O  O     . GLY A 1 26  ? 28.270  36.129  46.017  1.00 57.25 ? 1003 GLY A O     1 
ATOM   142  N  N     . GLN A 1 27  ? 29.782  35.253  47.425  1.00 57.70 ? 1004 GLN A N     1 
ATOM   143  C  CA    . GLN A 1 27  ? 30.516  34.604  46.369  1.00 56.50 ? 1004 GLN A CA    1 
ATOM   144  C  C     . GLN A 1 27  ? 29.986  33.203  46.155  1.00 54.89 ? 1004 GLN A C     1 
ATOM   145  O  O     . GLN A 1 27  ? 29.704  32.482  47.109  1.00 54.97 ? 1004 GLN A O     1 
ATOM   146  C  CB    . GLN A 1 27  ? 31.990  34.555  46.725  1.00 58.45 ? 1004 GLN A CB    1 
ATOM   147  C  CG    . GLN A 1 27  ? 32.834  33.904  45.672  1.00 62.96 ? 1004 GLN A CG    1 
ATOM   148  C  CD    . GLN A 1 27  ? 34.282  34.271  45.821  1.00 66.17 ? 1004 GLN A CD    1 
ATOM   149  O  OE1   . GLN A 1 27  ? 34.849  34.186  46.914  1.00 67.16 ? 1004 GLN A OE1   1 
ATOM   150  N  NE2   . GLN A 1 27  ? 34.901  34.686  44.717  1.00 68.18 ? 1004 GLN A NE2   1 
ATOM   151  N  N     . GLY A 1 28  ? 29.845  32.834  44.889  1.00 52.68 ? 1005 GLY A N     1 
ATOM   152  C  CA    . GLY A 1 28  ? 29.376  31.509  44.544  1.00 53.29 ? 1005 GLY A CA    1 
ATOM   153  C  C     . GLY A 1 28  ? 30.603  30.729  44.119  1.00 52.96 ? 1005 GLY A C     1 
ATOM   154  O  O     . GLY A 1 28  ? 31.661  31.322  43.923  1.00 53.31 ? 1005 GLY A O     1 
ATOM   155  N  N     . SER A 1 29  ? 30.484  29.415  43.966  1.00 52.12 ? 1006 SER A N     1 
ATOM   156  C  CA    . SER A 1 29  ? 31.646  28.621  43.581  1.00 52.06 ? 1006 SER A CA    1 
ATOM   157  C  C     . SER A 1 29  ? 32.318  29.040  42.266  1.00 50.96 ? 1006 SER A C     1 
ATOM   158  O  O     . SER A 1 29  ? 33.523  28.856  42.111  1.00 51.84 ? 1006 SER A O     1 
ATOM   159  C  CB    . SER A 1 29  ? 31.318  27.121  43.565  1.00 50.55 ? 1006 SER A CB    1 
ATOM   160  O  OG    . SER A 1 29  ? 30.268  26.814  42.677  1.00 56.44 ? 1006 SER A OG    1 
ATOM   161  N  N     . PHE A 1 30  ? 31.570  29.600  41.322  1.00 49.83 ? 1007 PHE A N     1 
ATOM   162  C  CA    . PHE A 1 30  ? 32.189  30.045  40.075  1.00 47.97 ? 1007 PHE A CA    1 
ATOM   163  C  C     . PHE A 1 30  ? 31.557  31.321  39.557  1.00 47.36 ? 1007 PHE A C     1 
ATOM   164  O  O     . PHE A 1 30  ? 31.560  31.594  38.364  1.00 48.12 ? 1007 PHE A O     1 
ATOM   165  C  CB    . PHE A 1 30  ? 32.147  28.956  38.990  1.00 46.35 ? 1007 PHE A CB    1 
ATOM   166  C  CG    . PHE A 1 30  ? 30.776  28.386  38.728  1.00 44.60 ? 1007 PHE A CG    1 
ATOM   167  C  CD1   . PHE A 1 30  ? 30.404  27.152  39.273  1.00 43.39 ? 1007 PHE A CD1   1 
ATOM   168  C  CD2   . PHE A 1 30  ? 29.863  29.069  37.922  1.00 41.94 ? 1007 PHE A CD2   1 
ATOM   169  C  CE1   . PHE A 1 30  ? 29.138  26.606  39.017  1.00 42.70 ? 1007 PHE A CE1   1 
ATOM   170  C  CE2   . PHE A 1 30  ? 28.598  28.534  37.660  1.00 42.95 ? 1007 PHE A CE2   1 
ATOM   171  C  CZ    . PHE A 1 30  ? 28.233  27.302  38.209  1.00 41.98 ? 1007 PHE A CZ    1 
ATOM   172  N  N     . GLY A 1 31  ? 31.021  32.106  40.473  1.00 46.43 ? 1008 GLY A N     1 
ATOM   173  C  CA    . GLY A 1 31  ? 30.401  33.349  40.088  1.00 46.97 ? 1008 GLY A CA    1 
ATOM   174  C  C     . GLY A 1 31  ? 30.203  34.192  41.320  1.00 47.21 ? 1008 GLY A C     1 
ATOM   175  O  O     . GLY A 1 31  ? 30.518  33.768  42.426  1.00 48.09 ? 1008 GLY A O     1 
ATOM   176  N  N     . MET A 1 32  ? 29.673  35.388  41.127  1.00 47.35 ? 1009 MET A N     1 
ATOM   177  C  CA    . MET A 1 32  ? 29.434  36.302  42.226  1.00 47.68 ? 1009 MET A CA    1 
ATOM   178  C  C     . MET A 1 32  ? 27.960  36.652  42.224  1.00 47.04 ? 1009 MET A C     1 
ATOM   179  O  O     . MET A 1 32  ? 27.374  36.851  41.163  1.00 47.23 ? 1009 MET A O     1 
ATOM   180  C  CB    . MET A 1 32  ? 30.257  37.572  42.022  1.00 48.73 ? 1009 MET A CB    1 
ATOM   181  C  CG    . MET A 1 32  ? 30.048  38.634  43.082  1.00 51.93 ? 1009 MET A CG    1 
ATOM   182  S  SD    . MET A 1 32  ? 30.770  38.180  44.655  1.00 57.10 ? 1009 MET A SD    1 
ATOM   183  C  CE    . MET A 1 32  ? 29.476  38.646  45.766  1.00 58.90 ? 1009 MET A CE    1 
ATOM   184  N  N     . VAL A 1 33  ? 27.353  36.720  43.403  1.00 46.24 ? 1010 VAL A N     1 
ATOM   185  C  CA    . VAL A 1 33  ? 25.947  37.092  43.478  1.00 45.85 ? 1010 VAL A CA    1 
ATOM   186  C  C     . VAL A 1 33  ? 25.854  38.502  44.032  1.00 46.96 ? 1010 VAL A C     1 
ATOM   187  O  O     . VAL A 1 33  ? 26.354  38.798  45.111  1.00 47.01 ? 1010 VAL A O     1 
ATOM   188  C  CB    . VAL A 1 33  ? 25.125  36.121  44.351  1.00 43.69 ? 1010 VAL A CB    1 
ATOM   189  C  CG1   . VAL A 1 33  ? 23.704  36.639  44.529  1.00 41.16 ? 1010 VAL A CG1   1 
ATOM   190  C  CG2   . VAL A 1 33  ? 25.074  34.769  43.683  1.00 42.72 ? 1010 VAL A CG2   1 
ATOM   191  N  N     . TYR A 1 34  ? 25.208  39.368  43.264  1.00 49.47 ? 1011 TYR A N     1 
ATOM   192  C  CA    . TYR A 1 34  ? 25.041  40.775  43.615  1.00 50.51 ? 1011 TYR A CA    1 
ATOM   193  C  C     . TYR A 1 34  ? 23.602  41.142  43.931  1.00 49.97 ? 1011 TYR A C     1 
ATOM   194  O  O     . TYR A 1 34  ? 22.662  40.470  43.488  1.00 49.39 ? 1011 TYR A O     1 
ATOM   195  C  CB    . TYR A 1 34  ? 25.449  41.654  42.435  1.00 50.78 ? 1011 TYR A CB    1 
ATOM   196  C  CG    . TYR A 1 34  ? 26.875  41.507  42.021  1.00 53.56 ? 1011 TYR A CG    1 
ATOM   197  C  CD1   . TYR A 1 34  ? 27.867  42.245  42.646  1.00 54.56 ? 1011 TYR A CD1   1 
ATOM   198  C  CD2   . TYR A 1 34  ? 27.237  40.641  40.991  1.00 53.65 ? 1011 TYR A CD2   1 
ATOM   199  C  CE1   . TYR A 1 34  ? 29.187  42.132  42.264  1.00 54.81 ? 1011 TYR A CE1   1 
ATOM   200  C  CE2   . TYR A 1 34  ? 28.560  40.517  40.600  1.00 54.45 ? 1011 TYR A CE2   1 
ATOM   201  C  CZ    . TYR A 1 34  ? 29.531  41.275  41.243  1.00 54.88 ? 1011 TYR A CZ    1 
ATOM   202  O  OH    . TYR A 1 34  ? 30.856  41.188  40.880  1.00 56.70 ? 1011 TYR A OH    1 
ATOM   203  N  N     . GLU A 1 35  ? 23.442  42.220  44.694  1.00 48.71 ? 1012 GLU A N     1 
ATOM   204  C  CA    . GLU A 1 35  ? 22.121  42.751  44.979  1.00 47.19 ? 1012 GLU A CA    1 
ATOM   205  C  C     . GLU A 1 35  ? 22.054  43.909  43.999  1.00 47.47 ? 1012 GLU A C     1 
ATOM   206  O  O     . GLU A 1 35  ? 23.081  44.497  43.681  1.00 48.23 ? 1012 GLU A O     1 
ATOM   207  C  CB    . GLU A 1 35  ? 22.017  43.303  46.394  1.00 45.30 ? 1012 GLU A CB    1 
ATOM   208  C  CG    . GLU A 1 35  ? 20.791  44.197  46.564  1.00 46.10 ? 1012 GLU A CG    1 
ATOM   209  C  CD    . GLU A 1 35  ? 20.480  44.517  48.009  1.00 45.81 ? 1012 GLU A CD    1 
ATOM   210  O  OE1   . GLU A 1 35  ? 21.141  43.928  48.889  1.00 48.13 ? 1012 GLU A OE1   1 
ATOM   211  O  OE2   . GLU A 1 35  ? 19.571  45.339  48.270  1.00 42.20 ? 1012 GLU A OE2   1 
ATOM   212  N  N     . GLY A 1 36  ? 20.869  44.244  43.513  1.00 47.55 ? 1013 GLY A N     1 
ATOM   213  C  CA    . GLY A 1 36  ? 20.778  45.346  42.577  1.00 47.31 ? 1013 GLY A CA    1 
ATOM   214  C  C     . GLY A 1 36  ? 19.353  45.789  42.353  1.00 47.65 ? 1013 GLY A C     1 
ATOM   215  O  O     . GLY A 1 36  ? 18.445  45.344  43.045  1.00 48.74 ? 1013 GLY A O     1 
ATOM   216  N  N     . ASN A 1 37  ? 19.159  46.677  41.388  1.00 47.93 ? 1014 ASN A N     1 
ATOM   217  C  CA    . ASN A 1 37  ? 17.835  47.183  41.064  1.00 49.83 ? 1014 ASN A CA    1 
ATOM   218  C  C     . ASN A 1 37  ? 17.538  46.819  39.620  1.00 50.03 ? 1014 ASN A C     1 
ATOM   219  O  O     . ASN A 1 37  ? 18.450  46.726  38.804  1.00 49.57 ? 1014 ASN A O     1 
ATOM   220  C  CB    . ASN A 1 37  ? 17.786  48.713  41.203  1.00 51.92 ? 1014 ASN A CB    1 
ATOM   221  C  CG    . ASN A 1 37  ? 17.913  49.190  42.650  1.00 55.22 ? 1014 ASN A CG    1 
ATOM   222  O  OD1   . ASN A 1 37  ? 18.521  50.238  42.924  1.00 54.60 ? 1014 ASN A OD1   1 
ATOM   223  N  ND2   . ASN A 1 37  ? 17.323  48.441  43.577  1.00 54.13 ? 1014 ASN A ND2   1 
ATOM   224  N  N     . ALA A 1 38  ? 16.263  46.618  39.312  1.00 50.16 ? 1015 ALA A N     1 
ATOM   225  C  CA    . ALA A 1 38  ? 15.849  46.295  37.960  1.00 50.69 ? 1015 ALA A CA    1 
ATOM   226  C  C     . ALA A 1 38  ? 14.637  47.145  37.628  1.00 51.42 ? 1015 ALA A C     1 
ATOM   227  O  O     . ALA A 1 38  ? 13.624  47.092  38.319  1.00 49.71 ? 1015 ALA A O     1 
ATOM   228  C  CB    . ALA A 1 38  ? 15.516  44.820  37.844  1.00 48.98 ? 1015 ALA A CB    1 
ATOM   229  N  N     . ARG A 1 39  ? 14.752  47.931  36.565  1.00 53.09 ? 1016 ARG A N     1 
ATOM   230  C  CA    . ARG A 1 39  ? 13.668  48.798  36.154  1.00 55.47 ? 1016 ARG A CA    1 
ATOM   231  C  C     . ARG A 1 39  ? 12.713  48.070  35.210  1.00 57.46 ? 1016 ARG A C     1 
ATOM   232  O  O     . ARG A 1 39  ? 13.135  47.432  34.246  1.00 57.76 ? 1016 ARG A O     1 
ATOM   233  C  CB    . ARG A 1 39  ? 14.234  50.057  35.486  1.00 53.29 ? 1016 ARG A CB    1 
ATOM   234  N  N     . ASP A 1 40  ? 11.422  48.163  35.506  1.00 59.49 ? 1017 ASP A N     1 
ATOM   235  C  CA    . ASP A 1 40  ? 10.391  47.554  34.668  1.00 62.40 ? 1017 ASP A CA    1 
ATOM   236  C  C     . ASP A 1 40  ? 10.612  46.076  34.405  1.00 62.23 ? 1017 ASP A C     1 
ATOM   237  O  O     . ASP A 1 40  ? 10.458  45.629  33.266  1.00 61.55 ? 1017 ASP A O     1 
ATOM   238  C  CB    . ASP A 1 40  ? 10.338  48.246  33.300  1.00 64.80 ? 1017 ASP A CB    1 
ATOM   239  C  CG    . ASP A 1 40  ? 10.173  49.751  33.399  1.00 70.15 ? 1017 ASP A CG    1 
ATOM   240  O  OD1   . ASP A 1 40  ? 10.520  50.444  32.412  1.00 72.63 ? 1017 ASP A OD1   1 
ATOM   241  O  OD2   . ASP A 1 40  ? 9.692   50.248  34.445  1.00 72.26 ? 1017 ASP A OD2   1 
ATOM   242  N  N     . ILE A 1 41  ? 10.971  45.315  35.430  1.00 61.14 ? 1018 ILE A N     1 
ATOM   243  C  CA    . ILE A 1 41  ? 11.190  43.895  35.235  1.00 60.05 ? 1018 ILE A CA    1 
ATOM   244  C  C     . ILE A 1 41  ? 9.900   43.142  35.582  1.00 60.48 ? 1018 ILE A C     1 
ATOM   245  O  O     . ILE A 1 41  ? 9.661   42.029  35.117  1.00 62.06 ? 1018 ILE A O     1 
ATOM   246  C  CB    . ILE A 1 41  ? 12.388  43.440  36.084  1.00 57.82 ? 1018 ILE A CB    1 
ATOM   247  C  CG1   . ILE A 1 41  ? 12.882  42.088  35.586  1.00 56.57 ? 1018 ILE A CG1   1 
ATOM   248  C  CG2   . ILE A 1 41  ? 12.017  43.411  37.557  1.00 56.45 ? 1018 ILE A CG2   1 
ATOM   249  C  CD1   . ILE A 1 41  ? 14.263  41.740  36.069  1.00 55.78 ? 1018 ILE A CD1   1 
ATOM   250  N  N     . ILE A 1 42  ? 9.069   43.775  36.401  1.00 60.06 ? 1019 ILE A N     1 
ATOM   251  C  CA    . ILE A 1 42  ? 7.787   43.225  36.804  1.00 60.17 ? 1019 ILE A CA    1 
ATOM   252  C  C     . ILE A 1 42  ? 6.738   44.283  36.489  1.00 61.49 ? 1019 ILE A C     1 
ATOM   253  O  O     . ILE A 1 42  ? 6.759   45.368  37.068  1.00 61.64 ? 1019 ILE A O     1 
ATOM   254  C  CB    . ILE A 1 42  ? 7.744   42.948  38.309  1.00 59.22 ? 1019 ILE A CB    1 
ATOM   255  C  CG1   . ILE A 1 42  ? 8.767   41.870  38.672  1.00 58.60 ? 1019 ILE A CG1   1 
ATOM   256  C  CG2   . ILE A 1 42  ? 6.342   42.529  38.713  1.00 57.55 ? 1019 ILE A CG2   1 
ATOM   257  C  CD1   . ILE A 1 42  ? 8.878   41.592  40.159  1.00 53.73 ? 1019 ILE A CD1   1 
ATOM   258  N  N     . LYS A 1 43  ? 5.827   43.975  35.571  1.00 62.39 ? 1020 LYS A N     1 
ATOM   259  C  CA    . LYS A 1 43  ? 4.784   44.923  35.202  1.00 62.95 ? 1020 LYS A CA    1 
ATOM   260  C  C     . LYS A 1 43  ? 4.093   45.437  36.460  1.00 62.85 ? 1020 LYS A C     1 
ATOM   261  O  O     . LYS A 1 43  ? 3.630   44.655  37.294  1.00 62.64 ? 1020 LYS A O     1 
ATOM   262  C  CB    . LYS A 1 43  ? 3.770   44.254  34.273  1.00 62.84 ? 1020 LYS A CB    1 
ATOM   263  N  N     . GLY A 1 44  ? 4.032   46.757  36.594  1.00 63.38 ? 1021 GLY A N     1 
ATOM   264  C  CA    . GLY A 1 44  ? 3.401   47.353  37.757  1.00 63.92 ? 1021 GLY A CA    1 
ATOM   265  C  C     . GLY A 1 44  ? 4.422   47.917  38.727  1.00 63.79 ? 1021 GLY A C     1 
ATOM   266  O  O     . GLY A 1 44  ? 4.068   48.584  39.707  1.00 64.50 ? 1021 GLY A O     1 
ATOM   267  N  N     . GLU A 1 45  ? 5.696   47.651  38.451  1.00 62.85 ? 1022 GLU A N     1 
ATOM   268  C  CA    . GLU A 1 45  ? 6.782   48.125  39.298  1.00 61.63 ? 1022 GLU A CA    1 
ATOM   269  C  C     . GLU A 1 45  ? 7.834   48.896  38.520  1.00 61.03 ? 1022 GLU A C     1 
ATOM   270  O  O     . GLU A 1 45  ? 8.340   48.421  37.508  1.00 60.93 ? 1022 GLU A O     1 
ATOM   271  C  CB    . GLU A 1 45  ? 7.434   46.948  40.028  1.00 58.92 ? 1022 GLU A CB    1 
ATOM   272  C  CG    . GLU A 1 45  ? 6.611   46.443  41.185  1.00 57.53 ? 1022 GLU A CG    1 
ATOM   273  C  CD    . GLU A 1 45  ? 7.249   45.278  41.913  1.00 57.61 ? 1022 GLU A CD    1 
ATOM   274  O  OE1   . GLU A 1 45  ? 8.476   45.315  42.168  1.00 58.07 ? 1022 GLU A OE1   1 
ATOM   275  O  OE2   . GLU A 1 45  ? 6.511   44.331  42.249  1.00 55.59 ? 1022 GLU A OE2   1 
ATOM   276  N  N     . ALA A 1 46  ? 8.150   50.092  39.007  1.00 60.50 ? 1023 ALA A N     1 
ATOM   277  C  CA    . ALA A 1 46  ? 9.150   50.945  38.387  1.00 60.55 ? 1023 ALA A CA    1 
ATOM   278  C  C     . ALA A 1 46  ? 10.496  50.236  38.491  1.00 60.49 ? 1023 ALA A C     1 
ATOM   279  O  O     . ALA A 1 46  ? 11.099  49.877  37.480  1.00 59.90 ? 1023 ALA A O     1 
ATOM   280  C  CB    . ALA A 1 46  ? 9.197   52.285  39.096  1.00 60.69 ? 1023 ALA A CB    1 
ATOM   281  N  N     . GLU A 1 47  ? 10.965  50.047  39.720  1.00 60.08 ? 1024 GLU A N     1 
ATOM   282  C  CA    . GLU A 1 47  ? 12.211  49.337  39.963  1.00 59.37 ? 1024 GLU A CA    1 
ATOM   283  C  C     . GLU A 1 47  ? 11.976  48.296  41.042  1.00 57.53 ? 1024 GLU A C     1 
ATOM   284  O  O     . GLU A 1 47  ? 11.201  48.508  41.971  1.00 58.91 ? 1024 GLU A O     1 
ATOM   285  C  CB    . GLU A 1 47  ? 13.357  50.286  40.352  1.00 62.18 ? 1024 GLU A CB    1 
ATOM   286  C  CG    . GLU A 1 47  ? 13.065  51.304  41.449  1.00 67.04 ? 1024 GLU A CG    1 
ATOM   287  C  CD    . GLU A 1 47  ? 14.296  52.149  41.791  1.00 69.36 ? 1024 GLU A CD    1 
ATOM   288  O  OE1   . GLU A 1 47  ? 14.972  52.619  40.844  1.00 70.19 ? 1024 GLU A OE1   1 
ATOM   289  O  OE2   . GLU A 1 47  ? 14.583  52.343  42.997  1.00 68.88 ? 1024 GLU A OE2   1 
ATOM   290  N  N     . THR A 1 48  ? 12.643  47.158  40.902  1.00 55.43 ? 1025 THR A N     1 
ATOM   291  C  CA    . THR A 1 48  ? 12.503  46.059  41.848  1.00 50.91 ? 1025 THR A CA    1 
ATOM   292  C  C     . THR A 1 48  ? 13.870  45.629  42.361  1.00 50.33 ? 1025 THR A C     1 
ATOM   293  O  O     . THR A 1 48  ? 14.800  45.438  41.582  1.00 49.79 ? 1025 THR A O     1 
ATOM   294  C  CB    . THR A 1 48  ? 11.848  44.844  41.181  1.00 48.25 ? 1025 THR A CB    1 
ATOM   295  O  OG1   . THR A 1 48  ? 10.659  45.249  40.498  1.00 45.38 ? 1025 THR A OG1   1 
ATOM   296  C  CG2   . THR A 1 48  ? 11.498  43.808  42.220  1.00 45.78 ? 1025 THR A CG2   1 
ATOM   297  N  N     . ARG A 1 49  ? 13.995  45.480  43.671  1.00 49.51 ? 1026 ARG A N     1 
ATOM   298  C  CA    . ARG A 1 49  ? 15.257  45.055  44.252  1.00 49.68 ? 1026 ARG A CA    1 
ATOM   299  C  C     . ARG A 1 49  ? 15.387  43.570  43.917  1.00 48.24 ? 1026 ARG A C     1 
ATOM   300  O  O     . ARG A 1 49  ? 14.459  42.794  44.142  1.00 47.78 ? 1026 ARG A O     1 
ATOM   301  C  CB    . ARG A 1 49  ? 15.233  45.294  45.768  1.00 51.40 ? 1026 ARG A CB    1 
ATOM   302  C  CG    . ARG A 1 49  ? 16.594  45.197  46.463  1.00 54.97 ? 1026 ARG A CG    1 
ATOM   303  C  CD    . ARG A 1 49  ? 17.643  46.094  45.819  1.00 57.10 ? 1026 ARG A CD    1 
ATOM   304  N  NE    . ARG A 1 49  ? 17.381  47.525  45.995  1.00 60.34 ? 1026 ARG A NE    1 
ATOM   305  C  CZ    . ARG A 1 49  ? 17.586  48.204  47.125  1.00 62.37 ? 1026 ARG A CZ    1 
ATOM   306  N  NH1   . ARG A 1 49  ? 18.059  47.592  48.209  1.00 63.52 ? 1026 ARG A NH1   1 
ATOM   307  N  NH2   . ARG A 1 49  ? 17.337  49.507  47.166  1.00 61.51 ? 1026 ARG A NH2   1 
ATOM   308  N  N     . VAL A 1 50  ? 16.534  43.178  43.371  1.00 46.15 ? 1027 VAL A N     1 
ATOM   309  C  CA    . VAL A 1 50  ? 16.742  41.791  42.970  1.00 42.60 ? 1027 VAL A CA    1 
ATOM   310  C  C     . VAL A 1 50  ? 18.125  41.265  43.289  1.00 40.98 ? 1027 VAL A C     1 
ATOM   311  O  O     . VAL A 1 50  ? 18.993  41.994  43.771  1.00 40.29 ? 1027 VAL A O     1 
ATOM   312  C  CB    . VAL A 1 50  ? 16.529  41.628  41.446  1.00 42.63 ? 1027 VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 50  ? 15.120  42.058  41.066  1.00 39.28 ? 1027 VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 50  ? 17.562  42.463  40.684  1.00 37.26 ? 1027 VAL A CG2   1 
ATOM   315  N  N     . ALA A 1 51  ? 18.311  39.980  43.013  1.00 39.54 ? 1028 ALA A N     1 
ATOM   316  C  CA    . ALA A 1 51  ? 19.593  39.315  43.198  1.00 39.17 ? 1028 ALA A CA    1 
ATOM   317  C  C     . ALA A 1 51  ? 20.068  39.091  41.774  1.00 38.03 ? 1028 ALA A C     1 
ATOM   318  O  O     . ALA A 1 51  ? 19.252  38.870  40.883  1.00 38.16 ? 1028 ALA A O     1 
ATOM   319  C  CB    . ALA A 1 51  ? 19.405  37.981  43.904  1.00 35.98 ? 1028 ALA A CB    1 
ATOM   320  N  N     . VAL A 1 52  ? 21.372  39.145  41.549  1.00 38.70 ? 1029 VAL A N     1 
ATOM   321  C  CA    . VAL A 1 52  ? 21.899  38.948  40.204  1.00 39.16 ? 1029 VAL A CA    1 
ATOM   322  C  C     . VAL A 1 52  ? 23.072  37.980  40.238  1.00 40.32 ? 1029 VAL A C     1 
ATOM   323  O  O     . VAL A 1 52  ? 24.094  38.263  40.868  1.00 40.50 ? 1029 VAL A O     1 
ATOM   324  C  CB    . VAL A 1 52  ? 22.373  40.296  39.592  1.00 38.24 ? 1029 VAL A CB    1 
ATOM   325  C  CG1   . VAL A 1 52  ? 22.885  40.075  38.197  1.00 37.87 ? 1029 VAL A CG1   1 
ATOM   326  C  CG2   . VAL A 1 52  ? 21.232  41.315  39.581  1.00 35.58 ? 1029 VAL A CG2   1 
ATOM   327  N  N     . LYS A 1 53  ? 22.919  36.842  39.564  1.00 41.91 ? 1030 LYS A N     1 
ATOM   328  C  CA    . LYS A 1 53  ? 23.973  35.835  39.503  1.00 44.33 ? 1030 LYS A CA    1 
ATOM   329  C  C     . LYS A 1 53  ? 24.846  36.059  38.281  1.00 46.05 ? 1030 LYS A C     1 
ATOM   330  O  O     . LYS A 1 53  ? 24.347  36.430  37.214  1.00 45.42 ? 1030 LYS A O     1 
ATOM   331  C  CB    . LYS A 1 53  ? 23.378  34.422  39.445  1.00 44.34 ? 1030 LYS A CB    1 
ATOM   332  C  CG    . LYS A 1 53  ? 23.220  33.766  40.806  1.00 47.69 ? 1030 LYS A CG    1 
ATOM   333  C  CD    . LYS A 1 53  ? 22.806  32.286  40.725  1.00 48.16 ? 1030 LYS A CD    1 
ATOM   334  C  CE    . LYS A 1 53  ? 22.501  31.743  42.136  1.00 48.09 ? 1030 LYS A CE    1 
ATOM   335  N  NZ    . LYS A 1 53  ? 21.969  30.351  42.189  1.00 44.87 ? 1030 LYS A NZ    1 
ATOM   336  N  N     . THR A 1 54  ? 26.147  35.836  38.443  1.00 47.87 ? 1031 THR A N     1 
ATOM   337  C  CA    . THR A 1 54  ? 27.101  35.995  37.349  1.00 49.62 ? 1031 THR A CA    1 
ATOM   338  C  C     . THR A 1 54  ? 28.134  34.878  37.341  1.00 51.29 ? 1031 THR A C     1 
ATOM   339  O  O     . THR A 1 54  ? 28.218  34.076  38.273  1.00 52.74 ? 1031 THR A O     1 
ATOM   340  C  CB    . THR A 1 54  ? 27.850  37.326  37.448  1.00 48.84 ? 1031 THR A CB    1 
ATOM   341  O  OG1   . THR A 1 54  ? 28.554  37.386  38.693  1.00 46.98 ? 1031 THR A OG1   1 
ATOM   342  C  CG2   . THR A 1 54  ? 26.878  38.479  37.358  1.00 48.08 ? 1031 THR A CG2   1 
ATOM   343  N  N     . VAL A 1 55  ? 28.923  34.844  36.279  1.00 52.42 ? 1032 VAL A N     1 
ATOM   344  C  CA    . VAL A 1 55  ? 29.954  33.838  36.102  1.00 54.01 ? 1032 VAL A CA    1 
ATOM   345  C  C     . VAL A 1 55  ? 31.314  34.512  35.985  1.00 54.88 ? 1032 VAL A C     1 
ATOM   346  O  O     . VAL A 1 55  ? 31.448  35.512  35.290  1.00 55.52 ? 1032 VAL A O     1 
ATOM   347  C  CB    . VAL A 1 55  ? 29.662  33.027  34.817  1.00 53.70 ? 1032 VAL A CB    1 
ATOM   348  C  CG1   . VAL A 1 55  ? 30.914  32.373  34.302  1.00 54.81 ? 1032 VAL A CG1   1 
ATOM   349  C  CG2   . VAL A 1 55  ? 28.602  31.985  35.105  1.00 54.42 ? 1032 VAL A CG2   1 
ATOM   350  N  N     . ASN A 1 56  ? 32.321  33.976  36.663  1.00 56.91 ? 1033 ASN A N     1 
ATOM   351  C  CA    . ASN A 1 56  ? 33.661  34.544  36.569  1.00 58.92 ? 1033 ASN A CA    1 
ATOM   352  C  C     . ASN A 1 56  ? 34.186  34.298  35.158  1.00 59.38 ? 1033 ASN A C     1 
ATOM   353  O  O     . ASN A 1 56  ? 33.869  33.276  34.549  1.00 59.85 ? 1033 ASN A O     1 
ATOM   354  C  CB    . ASN A 1 56  ? 34.595  33.872  37.571  1.00 59.26 ? 1033 ASN A CB    1 
ATOM   355  C  CG    . ASN A 1 56  ? 34.156  34.079  39.000  1.00 61.78 ? 1033 ASN A CG    1 
ATOM   356  O  OD1   . ASN A 1 56  ? 33.864  35.205  39.411  1.00 63.32 ? 1033 ASN A OD1   1 
ATOM   357  N  ND2   . ASN A 1 56  ? 34.113  32.995  39.775  1.00 62.01 ? 1033 ASN A ND2   1 
ATOM   358  N  N     . GLU A 1 57  ? 34.986  35.222  34.632  1.00 59.56 ? 1034 GLU A N     1 
ATOM   359  C  CA    . GLU A 1 57  ? 35.533  35.046  33.291  1.00 59.68 ? 1034 GLU A CA    1 
ATOM   360  C  C     . GLU A 1 57  ? 36.293  33.713  33.229  1.00 59.79 ? 1034 GLU A C     1 
ATOM   361  O  O     . GLU A 1 57  ? 36.226  32.991  32.237  1.00 59.92 ? 1034 GLU A O     1 
ATOM   362  C  CB    . GLU A 1 57  ? 36.466  36.212  32.941  1.00 58.13 ? 1034 GLU A CB    1 
ATOM   363  N  N     . SER A 1 58  ? 37.005  33.389  34.302  1.00 59.83 ? 1035 SER A N     1 
ATOM   364  C  CA    . SER A 1 58  ? 37.783  32.157  34.362  1.00 60.77 ? 1035 SER A CA    1 
ATOM   365  C  C     . SER A 1 58  ? 36.938  30.898  34.554  1.00 62.06 ? 1035 SER A C     1 
ATOM   366  O  O     . SER A 1 58  ? 37.485  29.810  34.751  1.00 62.62 ? 1035 SER A O     1 
ATOM   367  C  CB    . SER A 1 58  ? 38.796  32.233  35.503  1.00 59.69 ? 1035 SER A CB    1 
ATOM   368  O  OG    . SER A 1 58  ? 38.154  32.048  36.754  1.00 58.49 ? 1035 SER A OG    1 
ATOM   369  N  N     . ALA A 1 59  ? 35.615  31.033  34.505  1.00 62.23 ? 1036 ALA A N     1 
ATOM   370  C  CA    . ALA A 1 59  ? 34.743  29.877  34.690  1.00 61.72 ? 1036 ALA A CA    1 
ATOM   371  C  C     . ALA A 1 59  ? 34.784  28.952  33.487  1.00 61.44 ? 1036 ALA A C     1 
ATOM   372  O  O     . ALA A 1 59  ? 34.788  29.400  32.341  1.00 61.40 ? 1036 ALA A O     1 
ATOM   373  C  CB    . ALA A 1 59  ? 33.318  30.322  34.952  1.00 61.77 ? 1036 ALA A CB    1 
ATOM   374  N  N     . SER A 1 60  ? 34.815  27.653  33.763  1.00 61.63 ? 1037 SER A N     1 
ATOM   375  C  CA    . SER A 1 60  ? 34.864  26.630  32.725  1.00 60.80 ? 1037 SER A CA    1 
ATOM   376  C  C     . SER A 1 60  ? 33.538  26.484  31.990  1.00 60.04 ? 1037 SER A C     1 
ATOM   377  O  O     . SER A 1 60  ? 32.488  26.890  32.483  1.00 60.69 ? 1037 SER A O     1 
ATOM   378  C  CB    . SER A 1 60  ? 35.221  25.284  33.341  1.00 60.03 ? 1037 SER A CB    1 
ATOM   379  O  OG    . SER A 1 60  ? 34.155  24.818  34.149  1.00 60.95 ? 1037 SER A OG    1 
ATOM   380  N  N     . LEU A 1 61  ? 33.608  25.893  30.806  1.00 58.51 ? 1038 LEU A N     1 
ATOM   381  C  CA    . LEU A 1 61  ? 32.449  25.645  29.959  1.00 58.36 ? 1038 LEU A CA    1 
ATOM   382  C  C     . LEU A 1 61  ? 31.413  24.822  30.735  1.00 57.98 ? 1038 LEU A C     1 
ATOM   383  O  O     . LEU A 1 61  ? 30.216  25.112  30.722  1.00 57.65 ? 1038 LEU A O     1 
ATOM   384  C  CB    . LEU A 1 61  ? 32.918  24.840  28.743  1.00 55.32 ? 1038 LEU A CB    1 
ATOM   385  C  CG    . LEU A 1 61  ? 32.079  24.640  27.486  1.00 53.77 ? 1038 LEU A CG    1 
ATOM   386  C  CD1   . LEU A 1 61  ? 32.469  23.306  26.878  1.00 51.59 ? 1038 LEU A CD1   1 
ATOM   387  C  CD2   . LEU A 1 61  ? 30.603  24.652  27.791  1.00 52.71 ? 1038 LEU A CD2   1 
ATOM   388  N  N     . ARG A 1 62  ? 31.899  23.783  31.403  1.00 58.10 ? 1039 ARG A N     1 
ATOM   389  C  CA    . ARG A 1 62  ? 31.047  22.895  32.181  1.00 59.91 ? 1039 ARG A CA    1 
ATOM   390  C  C     . ARG A 1 62  ? 30.259  23.672  33.218  1.00 59.57 ? 1039 ARG A C     1 
ATOM   391  O  O     . ARG A 1 62  ? 29.112  23.346  33.521  1.00 58.07 ? 1039 ARG A O     1 
ATOM   392  C  CB    . ARG A 1 62  ? 31.887  21.841  32.901  1.00 61.36 ? 1039 ARG A CB    1 
ATOM   393  C  CG    . ARG A 1 62  ? 31.075  20.943  33.835  1.00 64.10 ? 1039 ARG A CG    1 
ATOM   394  C  CD    . ARG A 1 62  ? 31.940  20.189  34.840  1.00 66.09 ? 1039 ARG A CD    1 
ATOM   395  N  NE    . ARG A 1 62  ? 32.615  21.079  35.787  1.00 70.45 ? 1039 ARG A NE    1 
ATOM   396  C  CZ    . ARG A 1 62  ? 33.724  21.772  35.520  1.00 72.20 ? 1039 ARG A CZ    1 
ATOM   397  N  NH1   . ARG A 1 62  ? 34.302  21.688  34.327  1.00 73.07 ? 1039 ARG A NH1   1 
ATOM   398  N  NH2   . ARG A 1 62  ? 34.263  22.550  36.451  1.00 72.30 ? 1039 ARG A NH2   1 
ATOM   399  N  N     . GLU A 1 63  ? 30.897  24.699  33.764  1.00 59.20 ? 1040 GLU A N     1 
ATOM   400  C  CA    . GLU A 1 63  ? 30.277  25.534  34.769  1.00 57.95 ? 1040 GLU A CA    1 
ATOM   401  C  C     . GLU A 1 63  ? 29.320  26.521  34.124  1.00 57.85 ? 1040 GLU A C     1 
ATOM   402  O  O     . GLU A 1 63  ? 28.297  26.867  34.709  1.00 56.80 ? 1040 GLU A O     1 
ATOM   403  C  CB    . GLU A 1 63  ? 31.358  26.258  35.573  1.00 55.56 ? 1040 GLU A CB    1 
ATOM   404  C  CG    . GLU A 1 63  ? 32.030  25.343  36.600  1.00 54.15 ? 1040 GLU A CG    1 
ATOM   405  C  CD    . GLU A 1 63  ? 33.329  25.903  37.184  1.00 54.04 ? 1040 GLU A CD    1 
ATOM   406  O  OE1   . GLU A 1 63  ? 33.876  25.247  38.098  1.00 53.53 ? 1040 GLU A OE1   1 
ATOM   407  O  OE2   . GLU A 1 63  ? 33.812  26.973  36.736  1.00 50.92 ? 1040 GLU A OE2   1 
ATOM   408  N  N     . ARG A 1 64  ? 29.653  26.967  32.916  1.00 57.86 ? 1041 ARG A N     1 
ATOM   409  C  CA    . ARG A 1 64  ? 28.804  27.908  32.195  1.00 57.42 ? 1041 ARG A CA    1 
ATOM   410  C  C     . ARG A 1 64  ? 27.503  27.219  31.814  1.00 56.31 ? 1041 ARG A C     1 
ATOM   411  O  O     . ARG A 1 64  ? 26.423  27.807  31.908  1.00 55.62 ? 1041 ARG A O     1 
ATOM   412  C  CB    . ARG A 1 64  ? 29.523  28.428  30.946  1.00 57.11 ? 1041 ARG A CB    1 
ATOM   413  C  CG    . ARG A 1 64  ? 30.628  29.417  31.278  1.00 58.58 ? 1041 ARG A CG    1 
ATOM   414  C  CD    . ARG A 1 64  ? 31.592  29.656  30.125  1.00 58.58 ? 1041 ARG A CD    1 
ATOM   415  N  NE    . ARG A 1 64  ? 32.761  30.411  30.580  1.00 58.51 ? 1041 ARG A NE    1 
ATOM   416  C  CZ    . ARG A 1 64  ? 32.769  31.720  30.820  1.00 58.25 ? 1041 ARG A CZ    1 
ATOM   417  N  NH1   . ARG A 1 64  ? 31.671  32.446  30.640  1.00 58.24 ? 1041 ARG A NH1   1 
ATOM   418  N  NH2   . ARG A 1 64  ? 33.873  32.298  31.268  1.00 58.73 ? 1041 ARG A NH2   1 
ATOM   419  N  N     . ILE A 1 65  ? 27.615  25.964  31.388  1.00 55.10 ? 1042 ILE A N     1 
ATOM   420  C  CA    . ILE A 1 65  ? 26.449  25.176  31.003  1.00 53.18 ? 1042 ILE A CA    1 
ATOM   421  C  C     . ILE A 1 65  ? 25.540  24.970  32.198  1.00 52.91 ? 1042 ILE A C     1 
ATOM   422  O  O     . ILE A 1 65  ? 24.318  25.062  32.084  1.00 52.86 ? 1042 ILE A O     1 
ATOM   423  C  CB    . ILE A 1 65  ? 26.845  23.793  30.481  1.00 50.72 ? 1042 ILE A CB    1 
ATOM   424  C  CG1   . ILE A 1 65  ? 27.586  23.935  29.155  1.00 49.34 ? 1042 ILE A CG1   1 
ATOM   425  C  CG2   . ILE A 1 65  ? 25.607  22.923  30.317  1.00 49.60 ? 1042 ILE A CG2   1 
ATOM   426  C  CD1   . ILE A 1 65  ? 28.009  22.619  28.549  1.00 45.53 ? 1042 ILE A CD1   1 
ATOM   427  N  N     . GLU A 1 66  ? 26.144  24.684  33.345  1.00 52.08 ? 1043 GLU A N     1 
ATOM   428  C  CA    . GLU A 1 66  ? 25.387  24.480  34.570  1.00 51.67 ? 1043 GLU A CA    1 
ATOM   429  C  C     . GLU A 1 66  ? 24.635  25.771  34.913  1.00 50.52 ? 1043 GLU A C     1 
ATOM   430  O  O     . GLU A 1 66  ? 23.439  25.742  35.221  1.00 49.36 ? 1043 GLU A O     1 
ATOM   431  C  CB    . GLU A 1 66  ? 26.329  24.102  35.711  1.00 51.37 ? 1043 GLU A CB    1 
ATOM   432  C  CG    . GLU A 1 66  ? 25.604  23.827  37.000  1.00 55.98 ? 1043 GLU A CG    1 
ATOM   433  C  CD    . GLU A 1 66  ? 26.501  23.272  38.090  1.00 57.83 ? 1043 GLU A CD    1 
ATOM   434  O  OE1   . GLU A 1 66  ? 27.319  24.030  38.654  1.00 57.39 ? 1043 GLU A OE1   1 
ATOM   435  O  OE2   . GLU A 1 66  ? 26.382  22.063  38.384  1.00 61.25 ? 1043 GLU A OE2   1 
ATOM   436  N  N     . PHE A 1 67  ? 25.356  26.890  34.853  1.00 47.68 ? 1044 PHE A N     1 
ATOM   437  C  CA    . PHE A 1 67  ? 24.818  28.213  35.130  1.00 45.75 ? 1044 PHE A CA    1 
ATOM   438  C  C     . PHE A 1 67  ? 23.621  28.478  34.229  1.00 46.41 ? 1044 PHE A C     1 
ATOM   439  O  O     . PHE A 1 67  ? 22.591  28.965  34.679  1.00 45.45 ? 1044 PHE A O     1 
ATOM   440  C  CB    . PHE A 1 67  ? 25.912  29.257  34.887  1.00 45.56 ? 1044 PHE A CB    1 
ATOM   441  C  CG    . PHE A 1 67  ? 25.439  30.693  34.936  1.00 44.31 ? 1044 PHE A CG    1 
ATOM   442  C  CD1   . PHE A 1 67  ? 25.134  31.306  36.142  1.00 44.79 ? 1044 PHE A CD1   1 
ATOM   443  C  CD2   . PHE A 1 67  ? 25.367  31.452  33.771  1.00 45.57 ? 1044 PHE A CD2   1 
ATOM   444  C  CE1   . PHE A 1 67  ? 24.771  32.661  36.190  1.00 46.29 ? 1044 PHE A CE1   1 
ATOM   445  C  CE2   . PHE A 1 67  ? 25.005  32.811  33.808  1.00 45.34 ? 1044 PHE A CE2   1 
ATOM   446  C  CZ    . PHE A 1 67  ? 24.709  33.413  35.019  1.00 44.92 ? 1044 PHE A CZ    1 
ATOM   447  N  N     . LEU A 1 68  ? 23.759  28.151  32.950  1.00 46.70 ? 1045 LEU A N     1 
ATOM   448  C  CA    . LEU A 1 68  ? 22.679  28.346  31.992  1.00 47.02 ? 1045 LEU A CA    1 
ATOM   449  C  C     . LEU A 1 68  ? 21.542  27.349  32.214  1.00 47.16 ? 1045 LEU A C     1 
ATOM   450  O  O     . LEU A 1 68  ? 20.393  27.605  31.850  1.00 47.11 ? 1045 LEU A O     1 
ATOM   451  C  CB    . LEU A 1 68  ? 23.211  28.217  30.561  1.00 47.28 ? 1045 LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 68  ? 24.186  29.326  30.144  1.00 49.66 ? 1045 LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 68  ? 24.741  29.047  28.761  1.00 47.20 ? 1045 LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 68  ? 23.464  30.677  30.178  1.00 48.87 ? 1045 LEU A CD2   1 
ATOM   455  N  N     . ASN A 1 69  ? 21.863  26.208  32.812  1.00 45.65 ? 1046 ASN A N     1 
ATOM   456  C  CA    . ASN A 1 69  ? 20.855  25.191  33.085  1.00 43.88 ? 1046 ASN A CA    1 
ATOM   457  C  C     . ASN A 1 69  ? 19.897  25.686  34.181  1.00 42.57 ? 1046 ASN A C     1 
ATOM   458  O  O     . ASN A 1 69  ? 18.674  25.571  34.059  1.00 40.04 ? 1046 ASN A O     1 
ATOM   459  C  CB    . ASN A 1 69  ? 21.541  23.881  33.513  1.00 43.90 ? 1046 ASN A CB    1 
ATOM   460  C  CG    . ASN A 1 69  ? 20.549  22.795  33.895  1.00 43.79 ? 1046 ASN A CG    1 
ATOM   461  O  OD1   . ASN A 1 69  ? 19.753  22.355  33.071  1.00 44.80 ? 1046 ASN A OD1   1 
ATOM   462  N  ND2   . ASN A 1 69  ? 20.592  22.359  35.156  1.00 43.47 ? 1046 ASN A ND2   1 
ATOM   463  N  N     . GLU A 1 70  ? 20.463  26.238  35.248  1.00 40.63 ? 1047 GLU A N     1 
ATOM   464  C  CA    . GLU A 1 70  ? 19.667  26.748  36.342  1.00 41.76 ? 1047 GLU A CA    1 
ATOM   465  C  C     . GLU A 1 70  ? 18.659  27.771  35.826  1.00 41.14 ? 1047 GLU A C     1 
ATOM   466  O  O     . GLU A 1 70  ? 17.472  27.724  36.150  1.00 40.66 ? 1047 GLU A O     1 
ATOM   467  C  CB    . GLU A 1 70  ? 20.572  27.390  37.392  1.00 42.73 ? 1047 GLU A CB    1 
ATOM   468  C  CG    . GLU A 1 70  ? 19.800  28.058  38.512  1.00 47.46 ? 1047 GLU A CG    1 
ATOM   469  C  CD    . GLU A 1 70  ? 20.690  28.606  39.602  1.00 51.30 ? 1047 GLU A CD    1 
ATOM   470  O  OE1   . GLU A 1 70  ? 20.145  28.989  40.665  1.00 51.96 ? 1047 GLU A OE1   1 
ATOM   471  O  OE2   . GLU A 1 70  ? 21.931  28.650  39.393  1.00 54.62 ? 1047 GLU A OE2   1 
ATOM   472  N  N     . ALA A 1 71  ? 19.138  28.698  35.014  1.00 40.46 ? 1048 ALA A N     1 
ATOM   473  C  CA    . ALA A 1 71  ? 18.263  29.719  34.464  1.00 40.43 ? 1048 ALA A CA    1 
ATOM   474  C  C     . ALA A 1 71  ? 17.179  29.073  33.638  1.00 39.62 ? 1048 ALA A C     1 
ATOM   475  O  O     . ALA A 1 71  ? 15.997  29.332  33.816  1.00 39.91 ? 1048 ALA A O     1 
ATOM   476  C  CB    . ALA A 1 71  ? 19.059  30.671  33.604  1.00 40.06 ? 1048 ALA A CB    1 
ATOM   477  N  N     . SER A 1 72  ? 17.603  28.217  32.727  1.00 40.71 ? 1049 SER A N     1 
ATOM   478  C  CA    . SER A 1 72  ? 16.687  27.537  31.842  1.00 40.32 ? 1049 SER A CA    1 
ATOM   479  C  C     . SER A 1 72  ? 15.555  26.830  32.599  1.00 40.13 ? 1049 SER A C     1 
ATOM   480  O  O     . SER A 1 72  ? 14.386  27.048  32.288  1.00 41.20 ? 1049 SER A O     1 
ATOM   481  C  CB    . SER A 1 72  ? 17.475  26.568  30.953  1.00 41.71 ? 1049 SER A CB    1 
ATOM   482  O  OG    . SER A 1 72  ? 16.733  26.188  29.809  1.00 42.37 ? 1049 SER A OG    1 
ATOM   483  N  N     . VAL A 1 73  ? 15.870  26.006  33.594  1.00 37.98 ? 1050 VAL A N     1 
ATOM   484  C  CA    . VAL A 1 73  ? 14.801  25.320  34.313  1.00 38.27 ? 1050 VAL A CA    1 
ATOM   485  C  C     . VAL A 1 73  ? 13.892  26.223  35.158  1.00 38.76 ? 1050 VAL A C     1 
ATOM   486  O  O     . VAL A 1 73  ? 12.701  25.933  35.315  1.00 38.53 ? 1050 VAL A O     1 
ATOM   487  C  CB    . VAL A 1 73  ? 15.344  24.158  35.188  1.00 37.63 ? 1050 VAL A CB    1 
ATOM   488  C  CG1   . VAL A 1 73  ? 16.166  23.213  34.334  1.00 35.82 ? 1050 VAL A CG1   1 
ATOM   489  C  CG2   . VAL A 1 73  ? 16.159  24.688  36.330  1.00 37.15 ? 1050 VAL A CG2   1 
ATOM   490  N  N     . MET A 1 74  ? 14.428  27.310  35.700  1.00 37.88 ? 1051 MET A N     1 
ATOM   491  C  CA    . MET A 1 74  ? 13.597  28.219  36.493  1.00 39.17 ? 1051 MET A CA    1 
ATOM   492  C  C     . MET A 1 74  ? 12.515  28.885  35.632  1.00 39.81 ? 1051 MET A C     1 
ATOM   493  O  O     . MET A 1 74  ? 11.465  29.292  36.135  1.00 40.37 ? 1051 MET A O     1 
ATOM   494  C  CB    . MET A 1 74  ? 14.458  29.306  37.153  1.00 38.66 ? 1051 MET A CB    1 
ATOM   495  C  CG    . MET A 1 74  ? 15.350  28.801  38.289  1.00 37.81 ? 1051 MET A CG    1 
ATOM   496  S  SD    . MET A 1 74  ? 16.401  30.100  38.979  1.00 35.55 ? 1051 MET A SD    1 
ATOM   497  C  CE    . MET A 1 74  ? 15.290  30.857  40.139  1.00 33.50 ? 1051 MET A CE    1 
ATOM   498  N  N     . LYS A 1 75  ? 12.771  28.996  34.333  1.00 39.16 ? 1052 LYS A N     1 
ATOM   499  C  CA    . LYS A 1 75  ? 11.804  29.613  33.429  1.00 38.68 ? 1052 LYS A CA    1 
ATOM   500  C  C     . LYS A 1 75  ? 10.415  28.984  33.513  1.00 38.44 ? 1052 LYS A C     1 
ATOM   501  O  O     . LYS A 1 75  ? 9.413   29.677  33.393  1.00 39.09 ? 1052 LYS A O     1 
ATOM   502  C  CB    . LYS A 1 75  ? 12.315  29.557  31.983  1.00 37.04 ? 1052 LYS A CB    1 
ATOM   503  C  CG    . LYS A 1 75  ? 13.450  30.539  31.721  1.00 36.13 ? 1052 LYS A CG    1 
ATOM   504  C  CD    . LYS A 1 75  ? 13.897  30.556  30.276  1.00 33.63 ? 1052 LYS A CD    1 
ATOM   505  C  CE    . LYS A 1 75  ? 14.997  31.596  30.079  1.00 34.48 ? 1052 LYS A CE    1 
ATOM   506  N  NZ    . LYS A 1 75  ? 15.599  31.579  28.703  1.00 37.54 ? 1052 LYS A NZ    1 
ATOM   507  N  N     . GLY A 1 76  ? 10.350  27.677  33.725  1.00 37.50 ? 1053 GLY A N     1 
ATOM   508  C  CA    . GLY A 1 76  ? 9.058   27.032  33.806  1.00 37.50 ? 1053 GLY A CA    1 
ATOM   509  C  C     . GLY A 1 76  ? 8.454   26.946  35.197  1.00 39.25 ? 1053 GLY A C     1 
ATOM   510  O  O     . GLY A 1 76  ? 7.429   26.280  35.382  1.00 40.83 ? 1053 GLY A O     1 
ATOM   511  N  N     . PHE A 1 77  ? 9.056   27.612  36.180  1.00 37.60 ? 1054 PHE A N     1 
ATOM   512  C  CA    . PHE A 1 77  ? 8.524   27.535  37.537  1.00 38.62 ? 1054 PHE A CA    1 
ATOM   513  C  C     . PHE A 1 77  ? 7.759   28.742  38.028  1.00 38.83 ? 1054 PHE A C     1 
ATOM   514  O  O     . PHE A 1 77  ? 8.132   29.880  37.778  1.00 39.62 ? 1054 PHE A O     1 
ATOM   515  C  CB    . PHE A 1 77  ? 9.632   27.258  38.559  1.00 36.84 ? 1054 PHE A CB    1 
ATOM   516  C  CG    . PHE A 1 77  ? 10.405  26.010  38.291  1.00 37.89 ? 1054 PHE A CG    1 
ATOM   517  C  CD1   . PHE A 1 77  ? 9.884   25.009  37.484  1.00 36.72 ? 1054 PHE A CD1   1 
ATOM   518  C  CD2   . PHE A 1 77  ? 11.661  25.833  38.850  1.00 38.34 ? 1054 PHE A CD2   1 
ATOM   519  C  CE1   . PHE A 1 77  ? 10.602  23.861  37.242  1.00 37.20 ? 1054 PHE A CE1   1 
ATOM   520  C  CE2   . PHE A 1 77  ? 12.384  24.683  38.609  1.00 37.89 ? 1054 PHE A CE2   1 
ATOM   521  C  CZ    . PHE A 1 77  ? 11.851  23.697  37.805  1.00 38.15 ? 1054 PHE A CZ    1 
ATOM   522  N  N     . THR A 1 78  ? 6.681   28.472  38.745  1.00 39.06 ? 1055 THR A N     1 
ATOM   523  C  CA    . THR A 1 78  ? 5.878   29.527  39.322  1.00 39.77 ? 1055 THR A CA    1 
ATOM   524  C  C     . THR A 1 78  ? 5.353   28.989  40.634  1.00 39.20 ? 1055 THR A C     1 
ATOM   525  O  O     . THR A 1 78  ? 4.245   28.465  40.699  1.00 42.22 ? 1055 THR A O     1 
ATOM   526  C  CB    . THR A 1 78  ? 4.690   29.895  38.441  1.00 40.24 ? 1055 THR A CB    1 
ATOM   527  O  OG1   . THR A 1 78  ? 5.133   30.087  37.090  1.00 42.92 ? 1055 THR A OG1   1 
ATOM   528  C  CG2   . THR A 1 78  ? 4.068   31.176  38.943  1.00 37.76 ? 1055 THR A CG2   1 
ATOM   529  N  N     . CYS A 1 79  ? 6.156   29.113  41.681  1.00 36.40 ? 1056 CYS A N     1 
ATOM   530  C  CA    . CYS A 1 79  ? 5.755   28.612  42.980  1.00 34.05 ? 1056 CYS A CA    1 
ATOM   531  C  C     . CYS A 1 79  ? 6.251   29.528  44.075  1.00 32.52 ? 1056 CYS A C     1 
ATOM   532  O  O     . CYS A 1 79  ? 7.392   29.977  44.059  1.00 30.61 ? 1056 CYS A O     1 
ATOM   533  C  CB    . CYS A 1 79  ? 6.298   27.197  43.189  1.00 33.62 ? 1056 CYS A CB    1 
ATOM   534  S  SG    . CYS A 1 79  ? 5.747   26.411  44.707  1.00 35.72 ? 1056 CYS A SG    1 
ATOM   535  N  N     . HIS A 1 80  ? 5.373   29.800  45.029  1.00 32.31 ? 1057 HIS A N     1 
ATOM   536  C  CA    . HIS A 1 80  ? 5.697   30.680  46.136  1.00 32.79 ? 1057 HIS A CA    1 
ATOM   537  C  C     . HIS A 1 80  ? 6.845   30.155  46.982  1.00 32.74 ? 1057 HIS A C     1 
ATOM   538  O  O     . HIS A 1 80  ? 7.504   30.921  47.681  1.00 33.08 ? 1057 HIS A O     1 
ATOM   539  C  CB    . HIS A 1 80  ? 4.486   30.863  47.039  1.00 32.40 ? 1057 HIS A CB    1 
ATOM   540  C  CG    . HIS A 1 80  ? 4.726   31.800  48.180  1.00 31.94 ? 1057 HIS A CG    1 
ATOM   541  N  ND1   . HIS A 1 80  ? 4.831   33.166  48.012  1.00 34.14 ? 1057 HIS A ND1   1 
ATOM   542  C  CD2   . HIS A 1 80  ? 4.889   31.571  49.503  1.00 30.68 ? 1057 HIS A CD2   1 
ATOM   543  C  CE1   . HIS A 1 80  ? 5.044   33.734  49.184  1.00 34.02 ? 1057 HIS A CE1   1 
ATOM   544  N  NE2   . HIS A 1 80  ? 5.085   32.787  50.107  1.00 30.97 ? 1057 HIS A NE2   1 
ATOM   545  N  N     . HIS A 1 81  ? 7.083   28.850  46.930  1.00 30.96 ? 1058 HIS A N     1 
ATOM   546  C  CA    . HIS A 1 81  ? 8.151   28.267  47.733  1.00 30.20 ? 1058 HIS A CA    1 
ATOM   547  C  C     . HIS A 1 81  ? 9.371   27.870  46.921  1.00 28.77 ? 1058 HIS A C     1 
ATOM   548  O  O     . HIS A 1 81  ? 10.143  27.004  47.322  1.00 27.45 ? 1058 HIS A O     1 
ATOM   549  C  CB    . HIS A 1 81  ? 7.630   27.054  48.519  1.00 30.02 ? 1058 HIS A CB    1 
ATOM   550  C  CG    . HIS A 1 81  ? 6.555   27.399  49.503  1.00 32.46 ? 1058 HIS A CG    1 
ATOM   551  N  ND1   . HIS A 1 81  ? 5.299   26.828  49.468  1.00 31.57 ? 1058 HIS A ND1   1 
ATOM   552  C  CD2   . HIS A 1 81  ? 6.539   28.273  50.539  1.00 31.97 ? 1058 HIS A CD2   1 
ATOM   553  C  CE1   . HIS A 1 81  ? 4.558   27.338  50.435  1.00 31.76 ? 1058 HIS A CE1   1 
ATOM   554  N  NE2   . HIS A 1 81  ? 5.286   28.218  51.099  1.00 32.24 ? 1058 HIS A NE2   1 
ATOM   555  N  N     . VAL A 1 82  ? 9.527   28.513  45.776  1.00 27.25 ? 1059 VAL A N     1 
ATOM   556  C  CA    . VAL A 1 82  ? 10.661  28.279  44.900  1.00 27.82 ? 1059 VAL A CA    1 
ATOM   557  C  C     . VAL A 1 82  ? 11.167  29.651  44.492  1.00 27.81 ? 1059 VAL A C     1 
ATOM   558  O  O     . VAL A 1 82  ? 10.390  30.477  43.997  1.00 27.63 ? 1059 VAL A O     1 
ATOM   559  C  CB    . VAL A 1 82  ? 10.249  27.509  43.627  1.00 27.64 ? 1059 VAL A CB    1 
ATOM   560  C  CG1   . VAL A 1 82  ? 11.475  27.204  42.784  1.00 26.78 ? 1059 VAL A CG1   1 
ATOM   561  C  CG2   . VAL A 1 82  ? 9.538   26.230  44.011  1.00 28.82 ? 1059 VAL A CG2   1 
ATOM   562  N  N     . VAL A 1 83  ? 12.455  29.902  44.699  1.00 27.73 ? 1060 VAL A N     1 
ATOM   563  C  CA    . VAL A 1 83  ? 13.029  31.195  44.340  1.00 28.65 ? 1060 VAL A CA    1 
ATOM   564  C  C     . VAL A 1 83  ? 12.630  31.450  42.902  1.00 31.51 ? 1060 VAL A C     1 
ATOM   565  O  O     . VAL A 1 83  ? 12.803  30.588  42.037  1.00 33.80 ? 1060 VAL A O     1 
ATOM   566  C  CB    . VAL A 1 83  ? 14.559  31.175  44.472  1.00 27.06 ? 1060 VAL A CB    1 
ATOM   567  C  CG1   . VAL A 1 83  ? 15.146  32.466  43.942  1.00 26.15 ? 1060 VAL A CG1   1 
ATOM   568  C  CG2   . VAL A 1 83  ? 14.939  30.984  45.927  1.00 25.23 ? 1060 VAL A CG2   1 
ATOM   569  N  N     . ARG A 1 84  ? 12.098  32.634  42.645  1.00 33.13 ? 1061 ARG A N     1 
ATOM   570  C  CA    . ARG A 1 84  ? 11.612  32.971  41.318  1.00 36.35 ? 1061 ARG A CA    1 
ATOM   571  C  C     . ARG A 1 84  ? 12.601  33.640  40.362  1.00 36.14 ? 1061 ARG A C     1 
ATOM   572  O  O     . ARG A 1 84  ? 13.382  34.505  40.748  1.00 34.75 ? 1061 ARG A O     1 
ATOM   573  C  CB    . ARG A 1 84  ? 10.367  33.839  41.483  1.00 37.92 ? 1061 ARG A CB    1 
ATOM   574  C  CG    . ARG A 1 84  ? 9.705   34.225  40.214  1.00 42.71 ? 1061 ARG A CG    1 
ATOM   575  C  CD    . ARG A 1 84  ? 8.713   35.323  40.497  1.00 48.33 ? 1061 ARG A CD    1 
ATOM   576  N  NE    . ARG A 1 84  ? 8.256   35.961  39.267  1.00 54.00 ? 1061 ARG A NE    1 
ATOM   577  C  CZ    . ARG A 1 84  ? 7.563   37.097  39.219  1.00 56.09 ? 1061 ARG A CZ    1 
ATOM   578  N  NH1   . ARG A 1 84  ? 7.234   37.734  40.346  1.00 53.33 ? 1061 ARG A NH1   1 
ATOM   579  N  NH2   . ARG A 1 84  ? 7.212   37.602  38.036  1.00 56.99 ? 1061 ARG A NH2   1 
ATOM   580  N  N     . LEU A 1 85  ? 12.553  33.216  39.106  1.00 36.61 ? 1062 LEU A N     1 
ATOM   581  C  CA    . LEU A 1 85  ? 13.400  33.780  38.075  1.00 37.82 ? 1062 LEU A CA    1 
ATOM   582  C  C     . LEU A 1 85  ? 12.719  35.058  37.594  1.00 39.14 ? 1062 LEU A C     1 
ATOM   583  O  O     . LEU A 1 85  ? 11.510  35.061  37.348  1.00 39.23 ? 1062 LEU A O     1 
ATOM   584  C  CB    . LEU A 1 85  ? 13.539  32.806  36.910  1.00 35.20 ? 1062 LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 85  ? 14.317  33.388  35.734  1.00 35.30 ? 1062 LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 85  ? 15.698  33.855  36.212  1.00 33.06 ? 1062 LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 85  ? 14.435  32.354  34.627  1.00 33.40 ? 1062 LEU A CD2   1 
ATOM   588  N  N     . LEU A 1 86  ? 13.484  36.139  37.460  1.00 39.42 ? 1063 LEU A N     1 
ATOM   589  C  CA    . LEU A 1 86  ? 12.911  37.405  37.015  1.00 41.08 ? 1063 LEU A CA    1 
ATOM   590  C  C     . LEU A 1 86  ? 13.321  37.818  35.606  1.00 42.57 ? 1063 LEU A C     1 
ATOM   591  O  O     . LEU A 1 86  ? 12.531  38.426  34.886  1.00 43.66 ? 1063 LEU A O     1 
ATOM   592  C  CB    . LEU A 1 86  ? 13.239  38.524  38.012  1.00 38.07 ? 1063 LEU A CB    1 
ATOM   593  C  CG    . LEU A 1 86  ? 12.498  38.420  39.350  1.00 35.75 ? 1063 LEU A CG    1 
ATOM   594  C  CD1   . LEU A 1 86  ? 12.833  39.626  40.206  1.00 33.05 ? 1063 LEU A CD1   1 
ATOM   595  C  CD2   . LEU A 1 86  ? 10.991  38.336  39.117  1.00 31.72 ? 1063 LEU A CD2   1 
ATOM   596  N  N     . GLY A 1 87  ? 14.544  37.488  35.211  1.00 43.30 ? 1064 GLY A N     1 
ATOM   597  C  CA    . GLY A 1 87  ? 14.995  37.842  33.880  1.00 44.40 ? 1064 GLY A CA    1 
ATOM   598  C  C     . GLY A 1 87  ? 16.414  37.409  33.588  1.00 45.32 ? 1064 GLY A C     1 
ATOM   599  O  O     . GLY A 1 87  ? 17.136  36.944  34.475  1.00 43.95 ? 1064 GLY A O     1 
ATOM   600  N  N     . VAL A 1 88  ? 16.812  37.578  32.332  1.00 46.69 ? 1065 VAL A N     1 
ATOM   601  C  CA    . VAL A 1 88  ? 18.142  37.204  31.885  1.00 48.23 ? 1065 VAL A CA    1 
ATOM   602  C  C     . VAL A 1 88  ? 18.720  38.231  30.917  1.00 51.06 ? 1065 VAL A C     1 
ATOM   603  O  O     . VAL A 1 88  ? 17.992  38.871  30.152  1.00 51.10 ? 1065 VAL A O     1 
ATOM   604  C  CB    . VAL A 1 88  ? 18.109  35.838  31.167  1.00 47.19 ? 1065 VAL A CB    1 
ATOM   605  C  CG1   . VAL A 1 88  ? 19.518  35.409  30.770  1.00 46.34 ? 1065 VAL A CG1   1 
ATOM   606  C  CG2   . VAL A 1 88  ? 17.457  34.800  32.053  1.00 46.41 ? 1065 VAL A CG2   1 
ATOM   607  N  N     . VAL A 1 89  ? 20.037  38.377  30.963  1.00 53.61 ? 1066 VAL A N     1 
ATOM   608  C  CA    . VAL A 1 89  ? 20.753  39.277  30.075  1.00 56.75 ? 1066 VAL A CA    1 
ATOM   609  C  C     . VAL A 1 89  ? 21.805  38.401  29.411  1.00 59.66 ? 1066 VAL A C     1 
ATOM   610  O  O     . VAL A 1 89  ? 22.829  38.068  30.015  1.00 60.53 ? 1066 VAL A O     1 
ATOM   611  C  CB    . VAL A 1 89  ? 21.453  40.406  30.851  1.00 57.21 ? 1066 VAL A CB    1 
ATOM   612  C  CG1   . VAL A 1 89  ? 22.142  41.360  29.880  1.00 57.21 ? 1066 VAL A CG1   1 
ATOM   613  C  CG2   . VAL A 1 89  ? 20.441  41.151  31.701  1.00 57.17 ? 1066 VAL A CG2   1 
ATOM   614  N  N     . SER A 1 90  ? 21.542  38.021  28.167  1.00 62.22 ? 1067 SER A N     1 
ATOM   615  C  CA    . SER A 1 90  ? 22.449  37.161  27.418  1.00 64.84 ? 1067 SER A CA    1 
ATOM   616  C  C     . SER A 1 90  ? 23.241  37.949  26.379  1.00 65.81 ? 1067 SER A C     1 
ATOM   617  O  O     . SER A 1 90  ? 24.355  37.564  26.014  1.00 66.52 ? 1067 SER A O     1 
ATOM   618  C  CB    . SER A 1 90  ? 21.648  36.060  26.726  1.00 63.97 ? 1067 SER A CB    1 
ATOM   619  O  OG    . SER A 1 90  ? 22.506  35.159  26.054  1.00 68.56 ? 1067 SER A OG    1 
ATOM   620  N  N     . LYS A 1 91  ? 22.654  39.050  25.910  1.00 66.25 ? 1068 LYS A N     1 
ATOM   621  C  CA    . LYS A 1 91  ? 23.286  39.909  24.912  1.00 66.04 ? 1068 LYS A CA    1 
ATOM   622  C  C     . LYS A 1 91  ? 24.618  40.466  25.417  1.00 66.26 ? 1068 LYS A C     1 
ATOM   623  O  O     . LYS A 1 91  ? 24.654  41.366  26.262  1.00 65.93 ? 1068 LYS A O     1 
ATOM   624  C  CB    . LYS A 1 91  ? 22.348  41.062  24.536  1.00 65.75 ? 1068 LYS A CB    1 
ATOM   625  N  N     . GLY A 1 92  ? 25.711  39.922  24.891  1.00 66.30 ? 1069 GLY A N     1 
ATOM   626  C  CA    . GLY A 1 92  ? 27.031  40.365  25.296  1.00 67.93 ? 1069 GLY A CA    1 
ATOM   627  C  C     . GLY A 1 92  ? 27.319  39.994  26.732  1.00 68.71 ? 1069 GLY A C     1 
ATOM   628  O  O     . GLY A 1 92  ? 26.437  40.067  27.574  1.00 71.42 ? 1069 GLY A O     1 
ATOM   629  N  N     . GLN A 1 93  ? 28.550  39.593  27.018  1.00 68.57 ? 1070 GLN A N     1 
ATOM   630  C  CA    . GLN A 1 93  ? 28.934  39.208  28.372  1.00 68.51 ? 1070 GLN A CA    1 
ATOM   631  C  C     . GLN A 1 93  ? 29.176  40.451  29.238  1.00 68.08 ? 1070 GLN A C     1 
ATOM   632  O  O     . GLN A 1 93  ? 29.351  41.549  28.721  1.00 68.72 ? 1070 GLN A O     1 
ATOM   633  C  CB    . GLN A 1 93  ? 30.206  38.344  28.325  1.00 67.66 ? 1070 GLN A CB    1 
ATOM   634  N  N     . PRO A 1 94  ? 29.157  40.292  30.572  1.00 67.63 ? 1071 PRO A N     1 
ATOM   635  C  CA    . PRO A 1 94  ? 28.930  39.030  31.290  1.00 66.01 ? 1071 PRO A CA    1 
ATOM   636  C  C     . PRO A 1 94  ? 27.436  38.712  31.295  1.00 64.21 ? 1071 PRO A C     1 
ATOM   637  O  O     . PRO A 1 94  ? 26.601  39.618  31.231  1.00 64.09 ? 1071 PRO A O     1 
ATOM   638  C  CB    . PRO A 1 94  ? 29.459  39.334  32.685  1.00 65.73 ? 1071 PRO A CB    1 
ATOM   639  C  CG    . PRO A 1 94  ? 29.056  40.770  32.862  1.00 66.46 ? 1071 PRO A CG    1 
ATOM   640  C  CD    . PRO A 1 94  ? 29.398  41.399  31.520  1.00 66.55 ? 1071 PRO A CD    1 
ATOM   641  N  N     . THR A 1 95  ? 27.096  37.433  31.365  1.00 61.93 ? 1072 THR A N     1 
ATOM   642  C  CA    . THR A 1 95  ? 25.693  37.051  31.379  1.00 59.74 ? 1072 THR A CA    1 
ATOM   643  C  C     . THR A 1 95  ? 25.115  37.237  32.773  1.00 56.99 ? 1072 THR A C     1 
ATOM   644  O  O     . THR A 1 95  ? 25.774  36.966  33.776  1.00 57.35 ? 1072 THR A O     1 
ATOM   645  C  CB    . THR A 1 95  ? 25.505  35.605  30.903  1.00 60.88 ? 1072 THR A CB    1 
ATOM   646  O  OG1   . THR A 1 95  ? 25.713  35.556  29.484  1.00 62.24 ? 1072 THR A OG1   1 
ATOM   647  C  CG2   . THR A 1 95  ? 24.094  35.108  31.231  1.00 61.38 ? 1072 THR A CG2   1 
ATOM   648  N  N     . LEU A 1 96  ? 23.877  37.707  32.828  1.00 53.97 ? 1073 LEU A N     1 
ATOM   649  C  CA    . LEU A 1 96  ? 23.236  37.963  34.102  1.00 50.98 ? 1073 LEU A CA    1 
ATOM   650  C  C     . LEU A 1 96  ? 21.927  37.215  34.306  1.00 47.89 ? 1073 LEU A C     1 
ATOM   651  O  O     . LEU A 1 96  ? 21.046  37.240  33.446  1.00 46.05 ? 1073 LEU A O     1 
ATOM   652  C  CB    . LEU A 1 96  ? 22.962  39.459  34.236  1.00 52.11 ? 1073 LEU A CB    1 
ATOM   653  C  CG    . LEU A 1 96  ? 24.087  40.441  33.901  1.00 53.20 ? 1073 LEU A CG    1 
ATOM   654  C  CD1   . LEU A 1 96  ? 23.509  41.844  33.710  1.00 52.94 ? 1073 LEU A CD1   1 
ATOM   655  C  CD2   . LEU A 1 96  ? 25.121  40.425  35.009  1.00 54.47 ? 1073 LEU A CD2   1 
ATOM   656  N  N     . VAL A 1 97  ? 21.807  36.551  35.450  1.00 45.12 ? 1074 VAL A N     1 
ATOM   657  C  CA    . VAL A 1 97  ? 20.572  35.854  35.795  1.00 42.90 ? 1074 VAL A CA    1 
ATOM   658  C  C     . VAL A 1 97  ? 19.934  36.656  36.928  1.00 41.32 ? 1074 VAL A C     1 
ATOM   659  O  O     . VAL A 1 97  ? 20.481  36.744  38.026  1.00 38.40 ? 1074 VAL A O     1 
ATOM   660  C  CB    . VAL A 1 97  ? 20.814  34.402  36.289  1.00 42.20 ? 1074 VAL A CB    1 
ATOM   661  C  CG1   . VAL A 1 97  ? 19.495  33.756  36.677  1.00 38.42 ? 1074 VAL A CG1   1 
ATOM   662  C  CG2   . VAL A 1 97  ? 21.468  33.585  35.201  1.00 42.03 ? 1074 VAL A CG2   1 
ATOM   663  N  N     . VAL A 1 98  ? 18.778  37.246  36.651  1.00 40.78 ? 1075 VAL A N     1 
ATOM   664  C  CA    . VAL A 1 98  ? 18.084  38.040  37.660  1.00 40.69 ? 1075 VAL A CA    1 
ATOM   665  C  C     . VAL A 1 98  ? 16.961  37.250  38.317  1.00 40.19 ? 1075 VAL A C     1 
ATOM   666  O  O     . VAL A 1 98  ? 16.087  36.719  37.641  1.00 40.11 ? 1075 VAL A O     1 
ATOM   667  C  CB    . VAL A 1 98  ? 17.474  39.311  37.063  1.00 39.56 ? 1075 VAL A CB    1 
ATOM   668  C  CG1   . VAL A 1 98  ? 17.167  40.298  38.178  1.00 39.64 ? 1075 VAL A CG1   1 
ATOM   669  C  CG2   . VAL A 1 98  ? 18.409  39.908  36.045  1.00 38.97 ? 1075 VAL A CG2   1 
ATOM   670  N  N     . MET A 1 99  ? 16.982  37.181  39.639  1.00 40.15 ? 1076 MET A N     1 
ATOM   671  C  CA    . MET A 1 99  ? 15.961  36.439  40.360  1.00 40.46 ? 1076 MET A CA    1 
ATOM   672  C  C     . MET A 1 99  ? 15.494  37.220  41.579  1.00 40.45 ? 1076 MET A C     1 
ATOM   673  O  O     . MET A 1 99  ? 16.029  38.295  41.843  1.00 40.52 ? 1076 MET A O     1 
ATOM   674  C  CB    . MET A 1 99  ? 16.526  35.101  40.793  1.00 41.69 ? 1076 MET A CB    1 
ATOM   675  C  CG    . MET A 1 99  ? 17.848  35.211  41.507  1.00 42.50 ? 1076 MET A CG    1 
ATOM   676  S  SD    . MET A 1 99  ? 18.436  33.574  41.950  1.00 47.61 ? 1076 MET A SD    1 
ATOM   677  C  CE    . MET A 1 99  ? 18.485  32.818  40.309  1.00 42.54 ? 1076 MET A CE    1 
ATOM   678  N  N     . GLU A 1 100 ? 14.507  36.689  42.319  1.00 39.55 ? 1077 GLU A N     1 
ATOM   679  C  CA    . GLU A 1 100 ? 14.002  37.369  43.504  1.00 37.80 ? 1077 GLU A CA    1 
ATOM   680  C  C     . GLU A 1 100 ? 15.057  37.384  44.599  1.00 36.81 ? 1077 GLU A C     1 
ATOM   681  O  O     . GLU A 1 100 ? 15.844  36.460  44.754  1.00 35.76 ? 1077 GLU A O     1 
ATOM   682  C  CB    . GLU A 1 100 ? 12.689  36.735  44.013  1.00 37.11 ? 1077 GLU A CB    1 
ATOM   683  C  CG    . GLU A 1 100 ? 12.813  35.494  44.876  1.00 39.22 ? 1077 GLU A CG    1 
ATOM   684  C  CD    . GLU A 1 100 ? 11.458  34.996  45.417  1.00 39.05 ? 1077 GLU A CD    1 
ATOM   685  O  OE1   . GLU A 1 100 ? 10.882  35.614  46.338  1.00 37.98 ? 1077 GLU A OE1   1 
ATOM   686  O  OE2   . GLU A 1 100 ? 10.966  33.971  44.911  1.00 39.49 ? 1077 GLU A OE2   1 
ATOM   687  N  N     . LEU A 1 101 ? 15.058  38.468  45.352  1.00 37.37 ? 1078 LEU A N     1 
ATOM   688  C  CA    . LEU A 1 101 ? 15.999  38.680  46.420  1.00 36.84 ? 1078 LEU A CA    1 
ATOM   689  C  C     . LEU A 1 101 ? 15.541  37.964  47.677  1.00 37.19 ? 1078 LEU A C     1 
ATOM   690  O  O     . LEU A 1 101 ? 14.457  38.220  48.177  1.00 37.68 ? 1078 LEU A O     1 
ATOM   691  C  CB    . LEU A 1 101 ? 16.093  40.184  46.673  1.00 35.45 ? 1078 LEU A CB    1 
ATOM   692  C  CG    . LEU A 1 101 ? 17.065  40.680  47.732  1.00 36.14 ? 1078 LEU A CG    1 
ATOM   693  C  CD1   . LEU A 1 101 ? 18.466  40.253  47.362  1.00 34.32 ? 1078 LEU A CD1   1 
ATOM   694  C  CD2   . LEU A 1 101 ? 16.962  42.197  47.836  1.00 36.03 ? 1078 LEU A CD2   1 
ATOM   695  N  N     . MET A 1 102 ? 16.367  37.063  48.185  1.00 37.82 ? 1079 MET A N     1 
ATOM   696  C  CA    . MET A 1 102 ? 16.041  36.356  49.405  1.00 37.23 ? 1079 MET A CA    1 
ATOM   697  C  C     . MET A 1 102 ? 16.768  37.123  50.503  1.00 38.67 ? 1079 MET A C     1 
ATOM   698  O  O     . MET A 1 102 ? 17.917  36.844  50.834  1.00 39.38 ? 1079 MET A O     1 
ATOM   699  C  CB    . MET A 1 102 ? 16.518  34.916  49.296  1.00 34.76 ? 1079 MET A CB    1 
ATOM   700  C  CG    . MET A 1 102 ? 15.830  34.157  48.169  1.00 33.90 ? 1079 MET A CG    1 
ATOM   701  S  SD    . MET A 1 102 ? 14.005  34.321  48.210  1.00 32.23 ? 1079 MET A SD    1 
ATOM   702  C  CE    . MET A 1 102 ? 13.645  33.252  49.711  1.00 29.80 ? 1079 MET A CE    1 
ATOM   703  N  N     . ALA A 1 103 ? 16.065  38.106  51.050  1.00 40.58 ? 1080 ALA A N     1 
ATOM   704  C  CA    . ALA A 1 103 ? 16.580  39.001  52.084  1.00 41.07 ? 1080 ALA A CA    1 
ATOM   705  C  C     . ALA A 1 103 ? 17.406  38.396  53.200  1.00 41.90 ? 1080 ALA A C     1 
ATOM   706  O  O     . ALA A 1 103 ? 18.342  39.033  53.659  1.00 43.85 ? 1080 ALA A O     1 
ATOM   707  C  CB    . ALA A 1 103 ? 15.432  39.809  52.679  1.00 40.81 ? 1080 ALA A CB    1 
ATOM   708  N  N     . HIS A 1 104 ? 17.080  37.185  53.645  1.00 42.41 ? 1081 HIS A N     1 
ATOM   709  C  CA    . HIS A 1 104 ? 17.838  36.565  54.730  1.00 42.53 ? 1081 HIS A CA    1 
ATOM   710  C  C     . HIS A 1 104 ? 18.836  35.510  54.292  1.00 41.20 ? 1081 HIS A C     1 
ATOM   711  O  O     . HIS A 1 104 ? 19.233  34.662  55.097  1.00 41.63 ? 1081 HIS A O     1 
ATOM   712  C  CB    . HIS A 1 104 ? 16.888  35.950  55.751  1.00 46.62 ? 1081 HIS A CB    1 
ATOM   713  C  CG    . HIS A 1 104 ? 16.265  36.955  56.665  1.00 51.73 ? 1081 HIS A CG    1 
ATOM   714  N  ND1   . HIS A 1 104 ? 16.948  37.524  57.719  1.00 51.70 ? 1081 HIS A ND1   1 
ATOM   715  C  CD2   . HIS A 1 104 ? 15.037  37.529  56.655  1.00 53.64 ? 1081 HIS A CD2   1 
ATOM   716  C  CE1   . HIS A 1 104 ? 16.167  38.407  58.318  1.00 54.16 ? 1081 HIS A CE1   1 
ATOM   717  N  NE2   . HIS A 1 104 ? 15.003  38.430  57.692  1.00 54.42 ? 1081 HIS A NE2   1 
ATOM   718  N  N     . GLY A 1 105 ? 19.234  35.563  53.023  1.00 38.52 ? 1082 GLY A N     1 
ATOM   719  C  CA    . GLY A 1 105 ? 20.196  34.612  52.496  1.00 37.03 ? 1082 GLY A CA    1 
ATOM   720  C  C     . GLY A 1 105 ? 19.818  33.143  52.592  1.00 36.79 ? 1082 GLY A C     1 
ATOM   721  O  O     . GLY A 1 105 ? 18.641  32.775  52.644  1.00 36.03 ? 1082 GLY A O     1 
ATOM   722  N  N     . ASP A 1 106 ? 20.832  32.291  52.627  1.00 36.13 ? 1083 ASP A N     1 
ATOM   723  C  CA    . ASP A 1 106 ? 20.591  30.865  52.692  1.00 38.45 ? 1083 ASP A CA    1 
ATOM   724  C  C     . ASP A 1 106 ? 20.276  30.367  54.098  1.00 39.04 ? 1083 ASP A C     1 
ATOM   725  O  O     . ASP A 1 106 ? 20.729  30.929  55.101  1.00 40.05 ? 1083 ASP A O     1 
ATOM   726  C  CB    . ASP A 1 106 ? 21.792  30.101  52.143  1.00 37.79 ? 1083 ASP A CB    1 
ATOM   727  C  CG    . ASP A 1 106 ? 23.034  30.327  52.960  1.00 39.58 ? 1083 ASP A CG    1 
ATOM   728  O  OD1   . ASP A 1 106 ? 23.610  31.438  52.873  1.00 42.16 ? 1083 ASP A OD1   1 
ATOM   729  O  OD2   . ASP A 1 106 ? 23.428  29.400  53.700  1.00 37.21 ? 1083 ASP A OD2   1 
ATOM   730  N  N     . LEU A 1 107 ? 19.498  29.294  54.144  1.00 37.48 ? 1084 LEU A N     1 
ATOM   731  C  CA    . LEU A 1 107 ? 19.082  28.668  55.382  1.00 37.97 ? 1084 LEU A CA    1 
ATOM   732  C  C     . LEU A 1 107 ? 20.242  28.195  56.244  1.00 38.98 ? 1084 LEU A C     1 
ATOM   733  O  O     . LEU A 1 107 ? 20.234  28.399  57.449  1.00 40.28 ? 1084 LEU A O     1 
ATOM   734  C  CB    . LEU A 1 107 ? 18.187  27.472  55.084  1.00 36.63 ? 1084 LEU A CB    1 
ATOM   735  C  CG    . LEU A 1 107 ? 17.680  26.807  56.353  1.00 37.67 ? 1084 LEU A CG    1 
ATOM   736  C  CD1   . LEU A 1 107 ? 16.740  27.777  57.085  1.00 37.65 ? 1084 LEU A CD1   1 
ATOM   737  C  CD2   . LEU A 1 107 ? 16.955  25.517  56.008  1.00 36.51 ? 1084 LEU A CD2   1 
ATOM   738  N  N     . LYS A 1 108 ? 21.239  27.557  55.645  1.00 40.34 ? 1085 LYS A N     1 
ATOM   739  C  CA    . LYS A 1 108 ? 22.356  27.072  56.441  1.00 42.02 ? 1085 LYS A CA    1 
ATOM   740  C  C     . LYS A 1 108 ? 22.969  28.204  57.232  1.00 43.17 ? 1085 LYS A C     1 
ATOM   741  O  O     . LYS A 1 108 ? 23.090  28.128  58.454  1.00 43.22 ? 1085 LYS A O     1 
ATOM   742  C  CB    . LYS A 1 108 ? 23.443  26.453  55.578  1.00 44.01 ? 1085 LYS A CB    1 
ATOM   743  C  CG    . LYS A 1 108 ? 24.634  26.042  56.415  1.00 46.33 ? 1085 LYS A CG    1 
ATOM   744  C  CD    . LYS A 1 108 ? 25.774  25.533  55.575  1.00 51.42 ? 1085 LYS A CD    1 
ATOM   745  C  CE    . LYS A 1 108 ? 26.967  25.211  56.449  1.00 52.07 ? 1085 LYS A CE    1 
ATOM   746  N  NZ    . LYS A 1 108 ? 28.060  24.615  55.653  1.00 56.58 ? 1085 LYS A NZ    1 
ATOM   747  N  N     . SER A 1 109 ? 23.362  29.256  56.521  1.00 44.34 ? 1086 SER A N     1 
ATOM   748  C  CA    . SER A 1 109 ? 23.962  30.428  57.146  1.00 45.09 ? 1086 SER A CA    1 
ATOM   749  C  C     . SER A 1 109 ? 23.042  30.978  58.212  1.00 46.52 ? 1086 SER A C     1 
ATOM   750  O  O     . SER A 1 109 ? 23.486  31.399  59.274  1.00 47.00 ? 1086 SER A O     1 
ATOM   751  C  CB    . SER A 1 109 ? 24.221  31.530  56.114  1.00 44.79 ? 1086 SER A CB    1 
ATOM   752  O  OG    . SER A 1 109 ? 25.408  31.284  55.373  1.00 45.66 ? 1086 SER A OG    1 
ATOM   753  N  N     . TYR A 1 110 ? 21.750  30.978  57.922  1.00 48.21 ? 1087 TYR A N     1 
ATOM   754  C  CA    . TYR A 1 110 ? 20.770  31.493  58.864  1.00 50.46 ? 1087 TYR A CA    1 
ATOM   755  C  C     . TYR A 1 110 ? 20.726  30.629  60.125  1.00 50.88 ? 1087 TYR A C     1 
ATOM   756  O  O     . TYR A 1 110 ? 20.740  31.141  61.242  1.00 51.26 ? 1087 TYR A O     1 
ATOM   757  C  CB    . TYR A 1 110 ? 19.397  31.524  58.193  1.00 52.31 ? 1087 TYR A CB    1 
ATOM   758  C  CG    . TYR A 1 110 ? 18.300  32.050  59.074  1.00 53.75 ? 1087 TYR A CG    1 
ATOM   759  C  CD1   . TYR A 1 110 ? 18.209  33.410  59.372  1.00 55.31 ? 1087 TYR A CD1   1 
ATOM   760  C  CD2   . TYR A 1 110 ? 17.360  31.187  59.625  1.00 54.79 ? 1087 TYR A CD2   1 
ATOM   761  C  CE1   . TYR A 1 110 ? 17.198  33.904  60.209  1.00 56.16 ? 1087 TYR A CE1   1 
ATOM   762  C  CE2   . TYR A 1 110 ? 16.350  31.661  60.458  1.00 57.29 ? 1087 TYR A CE2   1 
ATOM   763  C  CZ    . TYR A 1 110 ? 16.271  33.021  60.748  1.00 57.34 ? 1087 TYR A CZ    1 
ATOM   764  O  OH    . TYR A 1 110 ? 15.267  33.483  61.574  1.00 57.63 ? 1087 TYR A OH    1 
ATOM   765  N  N     . LEU A 1 111 ? 20.668  29.316  59.941  1.00 51.24 ? 1088 LEU A N     1 
ATOM   766  C  CA    . LEU A 1 111 ? 20.640  28.392  61.065  1.00 52.82 ? 1088 LEU A CA    1 
ATOM   767  C  C     . LEU A 1 111 ? 21.874  28.549  61.954  1.00 55.02 ? 1088 LEU A C     1 
ATOM   768  O  O     . LEU A 1 111 ? 21.774  28.476  63.183  1.00 56.58 ? 1088 LEU A O     1 
ATOM   769  C  CB    . LEU A 1 111 ? 20.563  26.941  60.576  1.00 51.80 ? 1088 LEU A CB    1 
ATOM   770  C  CG    . LEU A 1 111 ? 19.245  26.486  59.951  1.00 51.25 ? 1088 LEU A CG    1 
ATOM   771  C  CD1   . LEU A 1 111 ? 19.337  25.032  59.515  1.00 49.67 ? 1088 LEU A CD1   1 
ATOM   772  C  CD2   . LEU A 1 111 ? 18.136  26.668  60.965  1.00 50.69 ? 1088 LEU A CD2   1 
ATOM   773  N  N     . ARG A 1 112 ? 23.036  28.762  61.344  1.00 55.73 ? 1089 ARG A N     1 
ATOM   774  C  CA    . ARG A 1 112 ? 24.252  28.910  62.128  1.00 57.23 ? 1089 ARG A CA    1 
ATOM   775  C  C     . ARG A 1 112 ? 24.261  30.200  62.930  1.00 58.25 ? 1089 ARG A C     1 
ATOM   776  O  O     . ARG A 1 112 ? 24.877  30.274  63.996  1.00 58.83 ? 1089 ARG A O     1 
ATOM   777  C  CB    . ARG A 1 112 ? 25.481  28.809  61.230  1.00 56.37 ? 1089 ARG A CB    1 
ATOM   778  C  CG    . ARG A 1 112 ? 25.699  27.388  60.763  1.00 57.18 ? 1089 ARG A CG    1 
ATOM   779  C  CD    . ARG A 1 112 ? 27.078  27.163  60.222  1.00 58.24 ? 1089 ARG A CD    1 
ATOM   780  N  NE    . ARG A 1 112 ? 27.300  25.750  59.916  1.00 61.85 ? 1089 ARG A NE    1 
ATOM   781  C  CZ    . ARG A 1 112 ? 28.361  25.279  59.259  1.00 63.60 ? 1089 ARG A CZ    1 
ATOM   782  N  NH1   . ARG A 1 112 ? 29.311  26.110  58.830  1.00 62.70 ? 1089 ARG A NH1   1 
ATOM   783  N  NH2   . ARG A 1 112 ? 28.475  23.975  59.024  1.00 63.64 ? 1089 ARG A NH2   1 
ATOM   784  N  N     . SER A 1 113 ? 23.567  31.213  62.428  1.00 58.53 ? 1090 SER A N     1 
ATOM   785  C  CA    . SER A 1 113 ? 23.505  32.476  63.137  1.00 59.21 ? 1090 SER A CA    1 
ATOM   786  C  C     . SER A 1 113 ? 22.797  32.234  64.464  1.00 60.48 ? 1090 SER A C     1 
ATOM   787  O  O     . SER A 1 113 ? 23.079  32.902  65.451  1.00 60.65 ? 1090 SER A O     1 
ATOM   788  C  CB    . SER A 1 113 ? 22.731  33.520  62.328  1.00 59.28 ? 1090 SER A CB    1 
ATOM   789  O  OG    . SER A 1 113 ? 21.329  33.374  62.501  1.00 59.76 ? 1090 SER A OG    1 
ATOM   790  N  N     . LEU A 1 114 ? 21.882  31.271  64.485  1.00 62.19 ? 1091 LEU A N     1 
ATOM   791  C  CA    . LEU A 1 114 ? 21.130  30.980  65.700  1.00 63.87 ? 1091 LEU A CA    1 
ATOM   792  C  C     . LEU A 1 114 ? 21.895  30.211  66.772  1.00 65.40 ? 1091 LEU A C     1 
ATOM   793  O  O     . LEU A 1 114 ? 21.414  30.075  67.896  1.00 66.42 ? 1091 LEU A O     1 
ATOM   794  C  CB    . LEU A 1 114 ? 19.834  30.254  65.347  1.00 62.75 ? 1091 LEU A CB    1 
ATOM   795  C  CG    . LEU A 1 114 ? 18.891  31.103  64.492  1.00 62.37 ? 1091 LEU A CG    1 
ATOM   796  C  CD1   . LEU A 1 114 ? 17.563  30.382  64.329  1.00 61.95 ? 1091 LEU A CD1   1 
ATOM   797  C  CD2   . LEU A 1 114 ? 18.682  32.463  65.146  1.00 60.82 ? 1091 LEU A CD2   1 
ATOM   798  N  N     . ARG A 1 115 ? 23.077  29.706  66.433  1.00 67.51 ? 1092 ARG A N     1 
ATOM   799  C  CA    . ARG A 1 115 ? 23.881  28.992  67.418  1.00 69.75 ? 1092 ARG A CA    1 
ATOM   800  C  C     . ARG A 1 115 ? 24.132  30.051  68.504  1.00 71.97 ? 1092 ARG A C     1 
ATOM   801  O  O     . ARG A 1 115 ? 24.430  31.207  68.197  1.00 72.57 ? 1092 ARG A O     1 
ATOM   802  C  CB    . ARG A 1 115 ? 25.221  28.534  66.807  1.00 70.39 ? 1092 ARG A CB    1 
ATOM   803  C  CG    . ARG A 1 115 ? 25.134  27.711  65.502  1.00 70.95 ? 1092 ARG A CG    1 
ATOM   804  C  CD    . ARG A 1 115 ? 25.145  26.193  65.734  1.00 71.49 ? 1092 ARG A CD    1 
ATOM   805  N  NE    . ARG A 1 115 ? 26.428  25.529  65.448  1.00 72.54 ? 1092 ARG A NE    1 
ATOM   806  C  CZ    . ARG A 1 115 ? 26.919  25.276  64.229  1.00 73.66 ? 1092 ARG A CZ    1 
ATOM   807  N  NH1   . ARG A 1 115 ? 26.252  25.630  63.139  1.00 72.64 ? 1092 ARG A NH1   1 
ATOM   808  N  NH2   . ARG A 1 115 ? 28.083  24.642  64.095  1.00 73.47 ? 1092 ARG A NH2   1 
ATOM   809  N  N     . PRO A 1 116 ? 24.006  29.680  69.784  1.00 73.79 ? 1093 PRO A N     1 
ATOM   810  C  CA    . PRO A 1 116 ? 24.235  30.666  70.846  1.00 74.63 ? 1093 PRO A CA    1 
ATOM   811  C  C     . PRO A 1 116 ? 25.607  31.337  70.739  1.00 75.50 ? 1093 PRO A C     1 
ATOM   812  O  O     . PRO A 1 116 ? 25.737  32.553  70.908  1.00 75.17 ? 1093 PRO A O     1 
ATOM   813  C  CB    . PRO A 1 116 ? 24.108  29.831  72.110  1.00 74.66 ? 1093 PRO A CB    1 
ATOM   814  C  CG    . PRO A 1 116 ? 24.680  28.505  71.670  1.00 74.72 ? 1093 PRO A CG    1 
ATOM   815  C  CD    . PRO A 1 116 ? 23.991  28.313  70.336  1.00 74.80 ? 1093 PRO A CD    1 
ATOM   816  N  N     . GLU A 1 117 ? 26.623  30.530  70.454  1.00 76.51 ? 1094 GLU A N     1 
ATOM   817  C  CA    . GLU A 1 117 ? 27.993  31.019  70.334  1.00 78.05 ? 1094 GLU A CA    1 
ATOM   818  C  C     . GLU A 1 117 ? 28.227  31.887  69.102  1.00 78.99 ? 1094 GLU A C     1 
ATOM   819  O  O     . GLU A 1 117 ? 29.195  32.647  69.044  1.00 79.47 ? 1094 GLU A O     1 
ATOM   820  C  CB    . GLU A 1 117 ? 28.962  29.832  70.297  1.00 78.13 ? 1094 GLU A CB    1 
ATOM   821  N  N     . ALA A 1 118 ? 27.339  31.768  68.119  1.00 80.30 ? 1095 ALA A N     1 
ATOM   822  C  CA    . ALA A 1 118 ? 27.451  32.519  66.868  1.00 81.02 ? 1095 ALA A CA    1 
ATOM   823  C  C     . ALA A 1 118 ? 27.809  33.996  67.039  1.00 80.97 ? 1095 ALA A C     1 
ATOM   824  O  O     . ALA A 1 118 ? 27.077  34.762  67.673  1.00 79.48 ? 1095 ALA A O     1 
ATOM   825  C  CB    . ALA A 1 118 ? 26.154  32.390  66.068  1.00 81.26 ? 1095 ALA A CB    1 
ATOM   826  N  N     . GLU A 1 119 ? 28.943  34.382  66.458  1.00 81.22 ? 1096 GLU A N     1 
ATOM   827  C  CA    . GLU A 1 119 ? 29.423  35.757  66.519  1.00 81.58 ? 1096 GLU A CA    1 
ATOM   828  C  C     . GLU A 1 119 ? 28.391  36.702  65.909  1.00 81.96 ? 1096 GLU A C     1 
ATOM   829  O  O     . GLU A 1 119 ? 28.243  37.846  66.338  1.00 82.20 ? 1096 GLU A O     1 
ATOM   830  C  CB    . GLU A 1 119 ? 30.747  35.884  65.754  1.00 80.02 ? 1096 GLU A CB    1 
ATOM   831  N  N     . ASN A 1 120 ? 27.676  36.211  64.903  1.00 82.48 ? 1097 ASN A N     1 
ATOM   832  C  CA    . ASN A 1 120 ? 26.666  37.010  64.217  1.00 82.59 ? 1097 ASN A CA    1 
ATOM   833  C  C     . ASN A 1 120 ? 25.259  36.684  64.701  1.00 82.28 ? 1097 ASN A C     1 
ATOM   834  O  O     . ASN A 1 120 ? 24.277  36.956  64.004  1.00 81.70 ? 1097 ASN A O     1 
ATOM   835  C  CB    . ASN A 1 120 ? 26.771  36.787  62.704  1.00 83.74 ? 1097 ASN A CB    1 
ATOM   836  C  CG    . ASN A 1 120 ? 26.546  35.336  62.307  1.00 84.43 ? 1097 ASN A CG    1 
ATOM   837  O  OD1   . ASN A 1 120 ? 26.846  34.408  63.068  1.00 85.34 ? 1097 ASN A OD1   1 
ATOM   838  N  ND2   . ASN A 1 120 ? 26.032  35.133  61.099  1.00 84.78 ? 1097 ASN A ND2   1 
ATOM   839  N  N     . ASN A 1 121 ? 25.160  36.102  65.896  1.00 81.99 ? 1098 ASN A N     1 
ATOM   840  C  CA    . ASN A 1 121 ? 23.854  35.752  66.440  1.00 81.69 ? 1098 ASN A CA    1 
ATOM   841  C  C     . ASN A 1 121 ? 22.963  36.981  66.364  1.00 81.64 ? 1098 ASN A C     1 
ATOM   842  O  O     . ASN A 1 121 ? 23.334  38.058  66.830  1.00 81.44 ? 1098 ASN A O     1 
ATOM   843  C  CB    . ASN A 1 121 ? 23.951  35.279  67.898  1.00 81.08 ? 1098 ASN A CB    1 
ATOM   844  C  CG    . ASN A 1 121 ? 22.619  34.725  68.427  1.00 81.37 ? 1098 ASN A CG    1 
ATOM   845  O  OD1   . ASN A 1 121 ? 21.594  35.418  68.428  1.00 79.96 ? 1098 ASN A OD1   1 
ATOM   846  N  ND2   . ASN A 1 121 ? 22.635  33.467  68.875  1.00 81.49 ? 1098 ASN A ND2   1 
ATOM   847  N  N     . PRO A 1 122 ? 21.778  36.840  65.751  1.00 82.25 ? 1099 PRO A N     1 
ATOM   848  C  CA    . PRO A 1 122 ? 20.864  37.979  65.642  1.00 82.18 ? 1099 PRO A CA    1 
ATOM   849  C  C     . PRO A 1 122 ? 20.430  38.453  67.025  1.00 81.93 ? 1099 PRO A C     1 
ATOM   850  O  O     . PRO A 1 122 ? 21.116  39.262  67.650  1.00 81.99 ? 1099 PRO A O     1 
ATOM   851  C  CB    . PRO A 1 122 ? 19.707  37.419  64.813  1.00 81.77 ? 1099 PRO A CB    1 
ATOM   852  C  CG    . PRO A 1 122 ? 19.701  35.970  65.180  1.00 82.38 ? 1099 PRO A CG    1 
ATOM   853  C  CD    . PRO A 1 122 ? 21.174  35.624  65.177  1.00 82.67 ? 1099 PRO A CD    1 
ATOM   854  N  N     . GLY A 1 123 ? 19.296  37.945  67.497  1.00 81.43 ? 1100 GLY A N     1 
ATOM   855  C  CA    . GLY A 1 123 ? 18.799  38.333  68.804  1.00 80.67 ? 1100 GLY A CA    1 
ATOM   856  C  C     . GLY A 1 123 ? 17.666  37.435  69.257  1.00 80.41 ? 1100 GLY A C     1 
ATOM   857  O  O     . GLY A 1 123 ? 16.811  37.839  70.046  1.00 80.44 ? 1100 GLY A O     1 
ATOM   858  N  N     . ARG A 1 124 ? 17.661  36.207  68.753  1.00 79.67 ? 1101 ARG A N     1 
ATOM   859  C  CA    . ARG A 1 124 ? 16.627  35.252  69.103  1.00 78.55 ? 1101 ARG A CA    1 
ATOM   860  C  C     . ARG A 1 124 ? 17.236  33.886  69.367  1.00 77.42 ? 1101 ARG A C     1 
ATOM   861  O  O     . ARG A 1 124 ? 18.411  33.643  69.070  1.00 77.26 ? 1101 ARG A O     1 
ATOM   862  C  CB    . ARG A 1 124 ? 15.613  35.138  67.971  1.00 80.67 ? 1101 ARG A CB    1 
ATOM   863  C  CG    . ARG A 1 124 ? 16.252  34.803  66.635  1.00 84.43 ? 1101 ARG A CG    1 
ATOM   864  C  CD    . ARG A 1 124 ? 15.233  34.267  65.647  1.00 86.51 ? 1101 ARG A CD    1 
ATOM   865  N  NE    . ARG A 1 124 ? 14.815  32.911  65.990  1.00 88.58 ? 1101 ARG A NE    1 
ATOM   866  C  CZ    . ARG A 1 124 ? 13.855  32.243  65.359  1.00 90.25 ? 1101 ARG A CZ    1 
ATOM   867  N  NH1   . ARG A 1 124 ? 13.206  32.808  64.347  1.00 91.26 ? 1101 ARG A NH1   1 
ATOM   868  N  NH2   . ARG A 1 124 ? 13.549  31.007  65.737  1.00 91.34 ? 1101 ARG A NH2   1 
ATOM   869  N  N     . PRO A 1 125 ? 16.440  32.970  69.932  1.00 76.10 ? 1102 PRO A N     1 
ATOM   870  C  CA    . PRO A 1 125 ? 16.899  31.618  70.238  1.00 74.92 ? 1102 PRO A CA    1 
ATOM   871  C  C     . PRO A 1 125 ? 16.778  30.727  69.008  1.00 74.52 ? 1102 PRO A C     1 
ATOM   872  O  O     . PRO A 1 125 ? 16.360  31.179  67.939  1.00 74.27 ? 1102 PRO A O     1 
ATOM   873  C  CB    . PRO A 1 125 ? 15.936  31.189  71.328  1.00 75.75 ? 1102 PRO A CB    1 
ATOM   874  C  CG    . PRO A 1 125 ? 14.638  31.764  70.820  1.00 75.83 ? 1102 PRO A CG    1 
ATOM   875  C  CD    . PRO A 1 125 ? 15.053  33.166  70.397  1.00 76.09 ? 1102 PRO A CD    1 
ATOM   876  N  N     . PRO A 1 126 ? 17.153  29.448  69.141  1.00 73.70 ? 1103 PRO A N     1 
ATOM   877  C  CA    . PRO A 1 126 ? 17.054  28.530  68.008  1.00 72.52 ? 1103 PRO A CA    1 
ATOM   878  C  C     . PRO A 1 126 ? 15.598  28.411  67.570  1.00 71.33 ? 1103 PRO A C     1 
ATOM   879  O  O     . PRO A 1 126 ? 14.678  28.747  68.324  1.00 70.95 ? 1103 PRO A O     1 
ATOM   880  C  CB    . PRO A 1 126 ? 17.583  27.219  68.582  1.00 73.29 ? 1103 PRO A CB    1 
ATOM   881  C  CG    . PRO A 1 126 ? 18.627  27.685  69.534  1.00 73.95 ? 1103 PRO A CG    1 
ATOM   882  C  CD    . PRO A 1 126 ? 17.918  28.831  70.239  1.00 74.52 ? 1103 PRO A CD    1 
ATOM   883  N  N     . PRO A 1 127 ? 15.367  27.925  66.342  1.00 70.29 ? 1104 PRO A N     1 
ATOM   884  C  CA    . PRO A 1 127 ? 13.992  27.784  65.862  1.00 68.59 ? 1104 PRO A CA    1 
ATOM   885  C  C     . PRO A 1 127 ? 13.151  26.926  66.803  1.00 67.08 ? 1104 PRO A C     1 
ATOM   886  O  O     . PRO A 1 127 ? 13.670  26.073  67.531  1.00 66.47 ? 1104 PRO A O     1 
ATOM   887  C  CB    . PRO A 1 127 ? 14.168  27.154  64.482  1.00 69.48 ? 1104 PRO A CB    1 
ATOM   888  C  CG    . PRO A 1 127 ? 15.446  26.373  64.628  1.00 70.05 ? 1104 PRO A CG    1 
ATOM   889  C  CD    . PRO A 1 127 ? 16.321  27.340  65.383  1.00 69.84 ? 1104 PRO A CD    1 
ATOM   890  N  N     . THR A 1 128 ? 11.846  27.166  66.784  1.00 65.24 ? 1105 THR A N     1 
ATOM   891  C  CA    . THR A 1 128 ? 10.926  26.424  67.629  1.00 62.98 ? 1105 THR A CA    1 
ATOM   892  C  C     . THR A 1 128 ? 10.432  25.232  66.852  1.00 61.37 ? 1105 THR A C     1 
ATOM   893  O  O     . THR A 1 128 ? 10.489  25.212  65.628  1.00 61.37 ? 1105 THR A O     1 
ATOM   894  C  CB    . THR A 1 128 ? 9.687   27.253  68.008  1.00 63.06 ? 1105 THR A CB    1 
ATOM   895  O  OG1   . THR A 1 128 ? 8.817   27.345  66.876  1.00 61.96 ? 1105 THR A OG1   1 
ATOM   896  C  CG2   . THR A 1 128 ? 10.088  28.655  68.433  1.00 63.24 ? 1105 THR A CG2   1 
ATOM   897  N  N     . LEU A 1 129 ? 9.950   24.235  67.575  1.00 60.77 ? 1106 LEU A N     1 
ATOM   898  C  CA    . LEU A 1 129 ? 9.401   23.042  66.952  1.00 60.37 ? 1106 LEU A CA    1 
ATOM   899  C  C     . LEU A 1 129 ? 8.452   23.535  65.860  1.00 59.82 ? 1106 LEU A C     1 
ATOM   900  O  O     . LEU A 1 129 ? 8.493   23.077  64.721  1.00 59.84 ? 1106 LEU A O     1 
ATOM   901  C  CB    . LEU A 1 129 ? 8.657   22.238  68.018  1.00 60.12 ? 1106 LEU A CB    1 
ATOM   902  C  CG    . LEU A 1 129 ? 7.782   21.022  67.709  1.00 61.24 ? 1106 LEU A CG    1 
ATOM   903  C  CD1   . LEU A 1 129 ? 6.420   21.469  67.199  1.00 61.13 ? 1106 LEU A CD1   1 
ATOM   904  C  CD2   . LEU A 1 129 ? 8.500   20.122  66.723  1.00 62.45 ? 1106 LEU A CD2   1 
ATOM   905  N  N     . GLN A 1 130 ? 7.608   24.488  66.229  1.00 59.50 ? 1107 GLN A N     1 
ATOM   906  C  CA    . GLN A 1 130 ? 6.646   25.087  65.317  1.00 59.82 ? 1107 GLN A CA    1 
ATOM   907  C  C     . GLN A 1 130 ? 7.348   25.708  64.108  1.00 59.63 ? 1107 GLN A C     1 
ATOM   908  O  O     . GLN A 1 130 ? 7.002   25.435  62.962  1.00 59.29 ? 1107 GLN A O     1 
ATOM   909  C  CB    . GLN A 1 130 ? 5.855   26.168  66.058  1.00 61.77 ? 1107 GLN A CB    1 
ATOM   910  C  CG    . GLN A 1 130 ? 4.921   26.976  65.187  1.00 63.50 ? 1107 GLN A CG    1 
ATOM   911  C  CD    . GLN A 1 130 ? 3.921   26.098  64.475  1.00 66.73 ? 1107 GLN A CD    1 
ATOM   912  O  OE1   . GLN A 1 130 ? 3.214   25.306  65.107  1.00 68.07 ? 1107 GLN A OE1   1 
ATOM   913  N  NE2   . GLN A 1 130 ? 3.851   26.228  63.149  1.00 67.18 ? 1107 GLN A NE2   1 
ATOM   914  N  N     . GLU A 1 131 ? 8.334   26.553  64.370  1.00 58.44 ? 1108 GLU A N     1 
ATOM   915  C  CA    . GLU A 1 131 ? 9.071   27.199  63.305  1.00 57.62 ? 1108 GLU A CA    1 
ATOM   916  C  C     . GLU A 1 131 ? 9.725   26.193  62.376  1.00 57.97 ? 1108 GLU A C     1 
ATOM   917  O  O     . GLU A 1 131 ? 9.834   26.422  61.166  1.00 59.10 ? 1108 GLU A O     1 
ATOM   918  C  CB    . GLU A 1 131 ? 10.128  28.109  63.901  1.00 58.49 ? 1108 GLU A CB    1 
ATOM   919  C  CG    . GLU A 1 131 ? 9.550   29.400  64.415  1.00 60.53 ? 1108 GLU A CG    1 
ATOM   920  C  CD    . GLU A 1 131 ? 10.481  30.112  65.355  1.00 63.82 ? 1108 GLU A CD    1 
ATOM   921  O  OE1   . GLU A 1 131 ? 10.185  31.276  65.687  1.00 66.28 ? 1108 GLU A OE1   1 
ATOM   922  O  OE2   . GLU A 1 131 ? 11.500  29.509  65.768  1.00 65.80 ? 1108 GLU A OE2   1 
ATOM   923  N  N     . MET A 1 132 ? 10.160  25.075  62.941  1.00 56.32 ? 1109 MET A N     1 
ATOM   924  C  CA    . MET A 1 132 ? 10.805  24.060  62.144  1.00 54.64 ? 1109 MET A CA    1 
ATOM   925  C  C     . MET A 1 132 ? 9.780   23.380  61.248  1.00 53.20 ? 1109 MET A C     1 
ATOM   926  O  O     . MET A 1 132 ? 10.036  23.165  60.063  1.00 52.20 ? 1109 MET A O     1 
ATOM   927  C  CB    . MET A 1 132 ? 11.525  23.066  63.060  1.00 57.87 ? 1109 MET A CB    1 
ATOM   928  C  CG    . MET A 1 132 ? 12.589  23.739  63.950  1.00 59.79 ? 1109 MET A CG    1 
ATOM   929  S  SD    . MET A 1 132 ? 13.474  22.596  65.047  1.00 63.53 ? 1109 MET A SD    1 
ATOM   930  C  CE    . MET A 1 132 ? 15.183  23.138  64.827  1.00 62.02 ? 1109 MET A CE    1 
ATOM   931  N  N     . ILE A 1 133 ? 8.613   23.053  61.793  1.00 51.21 ? 1110 ILE A N     1 
ATOM   932  C  CA    . ILE A 1 133 ? 7.597   22.409  60.974  1.00 50.69 ? 1110 ILE A CA    1 
ATOM   933  C  C     . ILE A 1 133 ? 7.204   23.318  59.798  1.00 49.35 ? 1110 ILE A C     1 
ATOM   934  O  O     . ILE A 1 133 ? 6.921   22.846  58.694  1.00 48.47 ? 1110 ILE A O     1 
ATOM   935  C  CB    . ILE A 1 133 ? 6.339   22.040  61.807  1.00 52.88 ? 1110 ILE A CB    1 
ATOM   936  C  CG1   . ILE A 1 133 ? 5.374   21.222  60.946  1.00 53.56 ? 1110 ILE A CG1   1 
ATOM   937  C  CG2   . ILE A 1 133 ? 5.621   23.295  62.280  1.00 54.04 ? 1110 ILE A CG2   1 
ATOM   938  C  CD1   . ILE A 1 133 ? 4.188   20.676  61.701  1.00 54.25 ? 1110 ILE A CD1   1 
ATOM   939  N  N     . GLN A 1 134 ? 7.192   24.625  60.042  1.00 47.72 ? 1111 GLN A N     1 
ATOM   940  C  CA    . GLN A 1 134 ? 6.844   25.593  59.008  1.00 45.48 ? 1111 GLN A CA    1 
ATOM   941  C  C     . GLN A 1 134 ? 7.887   25.511  57.893  1.00 43.99 ? 1111 GLN A C     1 
ATOM   942  O  O     . GLN A 1 134 ? 7.547   25.411  56.715  1.00 43.75 ? 1111 GLN A O     1 
ATOM   943  C  CB    . GLN A 1 134 ? 6.815   27.006  59.601  1.00 45.23 ? 1111 GLN A CB    1 
ATOM   944  C  CG    . GLN A 1 134 ? 6.261   28.079  58.671  1.00 45.00 ? 1111 GLN A CG    1 
ATOM   945  C  CD    . GLN A 1 134 ? 4.803   27.861  58.318  1.00 46.15 ? 1111 GLN A CD    1 
ATOM   946  O  OE1   . GLN A 1 134 ? 3.968   27.604  59.185  1.00 48.29 ? 1111 GLN A OE1   1 
ATOM   947  N  NE2   . GLN A 1 134 ? 4.486   27.979  57.042  1.00 46.98 ? 1111 GLN A NE2   1 
ATOM   948  N  N     . MET A 1 135 ? 9.158   25.556  58.273  1.00 42.49 ? 1112 MET A N     1 
ATOM   949  C  CA    . MET A 1 135 ? 10.234  25.467  57.300  1.00 41.72 ? 1112 MET A CA    1 
ATOM   950  C  C     . MET A 1 135 ? 10.115  24.159  56.518  1.00 42.04 ? 1112 MET A C     1 
ATOM   951  O  O     . MET A 1 135 ? 10.174  24.145  55.287  1.00 43.66 ? 1112 MET A O     1 
ATOM   952  C  CB    . MET A 1 135 ? 11.583  25.497  57.997  1.00 42.33 ? 1112 MET A CB    1 
ATOM   953  C  CG    . MET A 1 135 ? 11.900  26.783  58.712  1.00 43.76 ? 1112 MET A CG    1 
ATOM   954  S  SD    . MET A 1 135 ? 13.524  26.615  59.494  1.00 49.12 ? 1112 MET A SD    1 
ATOM   955  C  CE    . MET A 1 135 ? 13.938  28.329  59.806  1.00 48.47 ? 1112 MET A CE    1 
ATOM   956  N  N     . ALA A 1 136 ? 9.940   23.061  57.244  1.00 41.12 ? 1113 ALA A N     1 
ATOM   957  C  CA    . ALA A 1 136 ? 9.825   21.741  56.634  1.00 40.31 ? 1113 ALA A CA    1 
ATOM   958  C  C     . ALA A 1 136 ? 8.708   21.655  55.603  1.00 39.99 ? 1113 ALA A C     1 
ATOM   959  O  O     . ALA A 1 136 ? 8.911   21.154  54.491  1.00 40.62 ? 1113 ALA A O     1 
ATOM   960  C  CB    . ALA A 1 136 ? 9.612   20.687  57.708  1.00 40.31 ? 1113 ALA A CB    1 
ATOM   961  N  N     . ALA A 1 137 ? 7.527   22.136  55.967  1.00 39.30 ? 1114 ALA A N     1 
ATOM   962  C  CA    . ALA A 1 137 ? 6.402   22.083  55.045  1.00 38.33 ? 1114 ALA A CA    1 
ATOM   963  C  C     . ALA A 1 137 ? 6.676   22.988  53.845  1.00 38.08 ? 1114 ALA A C     1 
ATOM   964  O  O     . ALA A 1 137 ? 6.366   22.628  52.707  1.00 36.82 ? 1114 ALA A O     1 
ATOM   965  C  CB    . ALA A 1 137 ? 5.133   22.501  55.747  1.00 37.45 ? 1114 ALA A CB    1 
ATOM   966  N  N     . GLU A 1 138 ? 7.264   24.155  54.101  1.00 36.99 ? 1115 GLU A N     1 
ATOM   967  C  CA    . GLU A 1 138 ? 7.572   25.095  53.030  1.00 37.15 ? 1115 GLU A CA    1 
ATOM   968  C  C     . GLU A 1 138 ? 8.557   24.479  52.044  1.00 36.03 ? 1115 GLU A C     1 
ATOM   969  O  O     . GLU A 1 138 ? 8.392   24.573  50.828  1.00 34.97 ? 1115 GLU A O     1 
ATOM   970  C  CB    . GLU A 1 138 ? 8.110   26.400  53.624  1.00 38.26 ? 1115 GLU A CB    1 
ATOM   971  C  CG    . GLU A 1 138 ? 6.988   27.222  54.285  1.00 42.81 ? 1115 GLU A CG    1 
ATOM   972  C  CD    . GLU A 1 138 ? 7.463   28.491  54.964  1.00 43.28 ? 1115 GLU A CD    1 
ATOM   973  O  OE1   . GLU A 1 138 ? 6.609   29.357  55.263  1.00 41.59 ? 1115 GLU A OE1   1 
ATOM   974  O  OE2   . GLU A 1 138 ? 8.685   28.621  55.201  1.00 45.58 ? 1115 GLU A OE2   1 
ATOM   975  N  N     . ILE A 1 139 ? 9.581   23.831  52.568  1.00 35.03 ? 1116 ILE A N     1 
ATOM   976  C  CA    . ILE A 1 139 ? 10.556  23.189  51.708  1.00 32.89 ? 1116 ILE A CA    1 
ATOM   977  C  C     . ILE A 1 139 ? 9.903   22.027  50.973  1.00 32.70 ? 1116 ILE A C     1 
ATOM   978  O  O     . ILE A 1 139 ? 10.068  21.874  49.767  1.00 32.85 ? 1116 ILE A O     1 
ATOM   979  C  CB    . ILE A 1 139 ? 11.740  22.650  52.522  1.00 33.14 ? 1116 ILE A CB    1 
ATOM   980  C  CG1   . ILE A 1 139 ? 12.547  23.811  53.088  1.00 31.26 ? 1116 ILE A CG1   1 
ATOM   981  C  CG2   . ILE A 1 139 ? 12.614  21.761  51.652  1.00 31.27 ? 1116 ILE A CG2   1 
ATOM   982  C  CD1   . ILE A 1 139 ? 13.580  23.381  54.097  1.00 28.80 ? 1116 ILE A CD1   1 
ATOM   983  N  N     . ALA A 1 140 ? 9.159   21.204  51.699  1.00 33.19 ? 1117 ALA A N     1 
ATOM   984  C  CA    . ALA A 1 140 ? 8.507   20.051  51.079  1.00 32.85 ? 1117 ALA A CA    1 
ATOM   985  C  C     . ALA A 1 140 ? 7.530   20.485  50.004  1.00 31.41 ? 1117 ALA A C     1 
ATOM   986  O  O     . ALA A 1 140 ? 7.409   19.828  48.968  1.00 29.38 ? 1117 ALA A O     1 
ATOM   987  C  CB    . ALA A 1 140 ? 7.789   19.211  52.134  1.00 32.33 ? 1117 ALA A CB    1 
ATOM   988  N  N     . ASP A 1 141 ? 6.830   21.591  50.249  1.00 31.57 ? 1118 ASP A N     1 
ATOM   989  C  CA    . ASP A 1 141 ? 5.877   22.082  49.260  1.00 31.53 ? 1118 ASP A CA    1 
ATOM   990  C  C     . ASP A 1 141 ? 6.610   22.482  47.985  1.00 29.69 ? 1118 ASP A C     1 
ATOM   991  O  O     . ASP A 1 141 ? 6.152   22.175  46.887  1.00 29.65 ? 1118 ASP A O     1 
ATOM   992  C  CB    . ASP A 1 141 ? 5.081   23.285  49.778  1.00 33.79 ? 1118 ASP A CB    1 
ATOM   993  C  CG    . ASP A 1 141 ? 4.031   23.761  48.769  1.00 38.13 ? 1118 ASP A CG    1 
ATOM   994  O  OD1   . ASP A 1 141 ? 3.131   22.965  48.434  1.00 40.39 ? 1118 ASP A OD1   1 
ATOM   995  O  OD2   . ASP A 1 141 ? 4.099   24.920  48.299  1.00 40.18 ? 1118 ASP A OD2   1 
ATOM   996  N  N     . GLY A 1 142 ? 7.747   23.168  48.136  1.00 28.52 ? 1119 GLY A N     1 
ATOM   997  C  CA    . GLY A 1 142 ? 8.511   23.598  46.982  1.00 26.34 ? 1119 GLY A CA    1 
ATOM   998  C  C     . GLY A 1 142 ? 8.999   22.423  46.151  1.00 27.92 ? 1119 GLY A C     1 
ATOM   999  O  O     . GLY A 1 142 ? 9.005   22.471  44.911  1.00 26.33 ? 1119 GLY A O     1 
ATOM   1000 N  N     . MET A 1 143 ? 9.397   21.355  46.837  1.00 27.40 ? 1120 MET A N     1 
ATOM   1001 C  CA    . MET A 1 143 ? 9.903   20.170  46.176  1.00 27.25 ? 1120 MET A CA    1 
ATOM   1002 C  C     . MET A 1 143 ? 8.806   19.426  45.467  1.00 29.14 ? 1120 MET A C     1 
ATOM   1003 O  O     . MET A 1 143 ? 9.016   18.871  44.383  1.00 28.45 ? 1120 MET A O     1 
ATOM   1004 C  CB    . MET A 1 143 ? 10.563  19.244  47.185  1.00 27.53 ? 1120 MET A CB    1 
ATOM   1005 C  CG    . MET A 1 143 ? 11.838  19.805  47.776  1.00 28.79 ? 1120 MET A CG    1 
ATOM   1006 S  SD    . MET A 1 143 ? 12.981  20.273  46.473  1.00 32.56 ? 1120 MET A SD    1 
ATOM   1007 C  CE    . MET A 1 143 ? 13.663  18.659  46.031  1.00 30.31 ? 1120 MET A CE    1 
ATOM   1008 N  N     . ALA A 1 144 ? 7.628   19.410  46.081  1.00 30.73 ? 1121 ALA A N     1 
ATOM   1009 C  CA    . ALA A 1 144 ? 6.483   18.713  45.507  1.00 30.57 ? 1121 ALA A CA    1 
ATOM   1010 C  C     . ALA A 1 144 ? 6.159   19.355  44.164  1.00 31.31 ? 1121 ALA A C     1 
ATOM   1011 O  O     . ALA A 1 144 ? 5.882   18.659  43.185  1.00 31.92 ? 1121 ALA A O     1 
ATOM   1012 C  CB    . ALA A 1 144 ? 5.283   18.798  46.453  1.00 29.98 ? 1121 ALA A CB    1 
ATOM   1013 N  N     . TYR A 1 145 ? 6.191   20.684  44.120  1.00 31.01 ? 1122 TYR A N     1 
ATOM   1014 C  CA    . TYR A 1 145 ? 5.936   21.400  42.874  1.00 31.65 ? 1122 TYR A CA    1 
ATOM   1015 C  C     . TYR A 1 145 ? 6.980   20.908  41.855  1.00 32.10 ? 1122 TYR A C     1 
ATOM   1016 O  O     . TYR A 1 145 ? 6.649   20.475  40.747  1.00 31.42 ? 1122 TYR A O     1 
ATOM   1017 C  CB    . TYR A 1 145 ? 6.095   22.905  43.097  1.00 30.85 ? 1122 TYR A CB    1 
ATOM   1018 C  CG    . TYR A 1 145 ? 5.943   23.741  41.838  1.00 30.33 ? 1122 TYR A CG    1 
ATOM   1019 C  CD1   . TYR A 1 145 ? 4.687   23.992  41.286  1.00 30.06 ? 1122 TYR A CD1   1 
ATOM   1020 C  CD2   . TYR A 1 145 ? 7.064   24.260  41.186  1.00 30.37 ? 1122 TYR A CD2   1 
ATOM   1021 C  CE1   . TYR A 1 145 ? 4.546   24.735  40.118  1.00 30.70 ? 1122 TYR A CE1   1 
ATOM   1022 C  CE2   . TYR A 1 145 ? 6.941   25.003  40.019  1.00 31.28 ? 1122 TYR A CE2   1 
ATOM   1023 C  CZ    . TYR A 1 145 ? 5.680   25.238  39.485  1.00 33.57 ? 1122 TYR A CZ    1 
ATOM   1024 O  OH    . TYR A 1 145 ? 5.562   25.965  38.311  1.00 35.83 ? 1122 TYR A OH    1 
ATOM   1025 N  N     . LEU A 1 146 ? 8.246   20.977  42.243  1.00 31.40 ? 1123 LEU A N     1 
ATOM   1026 C  CA    . LEU A 1 146 ? 9.324   20.516  41.382  1.00 33.35 ? 1123 LEU A CA    1 
ATOM   1027 C  C     . LEU A 1 146 ? 9.023   19.140  40.808  1.00 33.88 ? 1123 LEU A C     1 
ATOM   1028 O  O     . LEU A 1 146 ? 9.068   18.942  39.591  1.00 34.97 ? 1123 LEU A O     1 
ATOM   1029 C  CB    . LEU A 1 146 ? 10.630  20.450  42.165  1.00 32.53 ? 1123 LEU A CB    1 
ATOM   1030 C  CG    . LEU A 1 146 ? 11.685  21.451  41.716  1.00 35.93 ? 1123 LEU A CG    1 
ATOM   1031 C  CD1   . LEU A 1 146 ? 11.171  22.873  41.919  1.00 35.48 ? 1123 LEU A CD1   1 
ATOM   1032 C  CD2   . LEU A 1 146 ? 12.972  21.219  42.503  1.00 38.54 ? 1123 LEU A CD2   1 
ATOM   1033 N  N     . ASN A 1 147 ? 8.721   18.192  41.692  1.00 34.36 ? 1124 ASN A N     1 
ATOM   1034 C  CA    . ASN A 1 147 ? 8.410   16.827  41.279  1.00 34.43 ? 1124 ASN A CA    1 
ATOM   1035 C  C     . ASN A 1 147 ? 7.215   16.824  40.338  1.00 35.38 ? 1124 ASN A C     1 
ATOM   1036 O  O     . ASN A 1 147 ? 7.238   16.174  39.284  1.00 36.24 ? 1124 ASN A O     1 
ATOM   1037 C  CB    . ASN A 1 147 ? 8.102   15.965  42.493  1.00 35.06 ? 1124 ASN A CB    1 
ATOM   1038 C  CG    . ASN A 1 147 ? 7.771   14.538  42.122  1.00 38.52 ? 1124 ASN A CG    1 
ATOM   1039 O  OD1   . ASN A 1 147 ? 6.669   14.049  42.404  1.00 37.59 ? 1124 ASN A OD1   1 
ATOM   1040 N  ND2   . ASN A 1 147 ? 8.727   13.849  41.489  1.00 39.45 ? 1124 ASN A ND2   1 
ATOM   1041 N  N     . ALA A 1 148 ? 6.166   17.552  40.711  1.00 34.77 ? 1125 ALA A N     1 
ATOM   1042 C  CA    . ALA A 1 148 ? 4.980   17.614  39.873  1.00 35.06 ? 1125 ALA A CA    1 
ATOM   1043 C  C     . ALA A 1 148 ? 5.356   18.054  38.450  1.00 36.31 ? 1125 ALA A C     1 
ATOM   1044 O  O     . ALA A 1 148 ? 4.785   17.560  37.465  1.00 35.89 ? 1125 ALA A O     1 
ATOM   1045 C  CB    . ALA A 1 148 ? 3.965   18.574  40.468  1.00 31.43 ? 1125 ALA A CB    1 
ATOM   1046 N  N     . LYS A 1 149 ? 6.316   18.973  38.341  1.00 35.15 ? 1126 LYS A N     1 
ATOM   1047 C  CA    . LYS A 1 149 ? 6.745   19.472  37.037  1.00 35.26 ? 1126 LYS A CA    1 
ATOM   1048 C  C     . LYS A 1 149 ? 7.708   18.510  36.373  1.00 35.33 ? 1126 LYS A C     1 
ATOM   1049 O  O     . LYS A 1 149 ? 8.232   18.796  35.298  1.00 34.74 ? 1126 LYS A O     1 
ATOM   1050 C  CB    . LYS A 1 149 ? 7.442   20.831  37.171  1.00 38.42 ? 1126 LYS A CB    1 
ATOM   1051 C  CG    . LYS A 1 149 ? 6.568   21.942  37.736  1.00 41.31 ? 1126 LYS A CG    1 
ATOM   1052 C  CD    . LYS A 1 149 ? 5.529   22.427  36.735  1.00 42.75 ? 1126 LYS A CD    1 
ATOM   1053 C  CE    . LYS A 1 149 ? 6.168   23.293  35.651  1.00 46.06 ? 1126 LYS A CE    1 
ATOM   1054 N  NZ    . LYS A 1 149 ? 5.155   24.035  34.821  1.00 46.61 ? 1126 LYS A NZ    1 
ATOM   1055 N  N     . LYS A 1 150 ? 7.951   17.374  37.020  1.00 35.95 ? 1127 LYS A N     1 
ATOM   1056 C  CA    . LYS A 1 150 ? 8.847   16.352  36.487  1.00 35.38 ? 1127 LYS A CA    1 
ATOM   1057 C  C     . LYS A 1 150 ? 10.307  16.774  36.425  1.00 34.52 ? 1127 LYS A C     1 
ATOM   1058 O  O     . LYS A 1 150 ? 10.976  16.628  35.403  1.00 33.22 ? 1127 LYS A O     1 
ATOM   1059 C  CB    . LYS A 1 150 ? 8.390   15.905  35.098  1.00 36.54 ? 1127 LYS A CB    1 
ATOM   1060 C  CG    . LYS A 1 150 ? 6.954   15.377  35.043  1.00 39.50 ? 1127 LYS A CG    1 
ATOM   1061 C  CD    . LYS A 1 150 ? 6.828   13.907  35.457  1.00 39.06 ? 1127 LYS A CD    1 
ATOM   1062 C  CE    . LYS A 1 150 ? 7.021   13.687  36.953  1.00 39.66 ? 1127 LYS A CE    1 
ATOM   1063 N  NZ    . LYS A 1 150 ? 6.881   12.240  37.350  1.00 37.23 ? 1127 LYS A NZ    1 
ATOM   1064 N  N     . PHE A 1 151 ? 10.794  17.300  37.539  1.00 34.52 ? 1128 PHE A N     1 
ATOM   1065 C  CA    . PHE A 1 151 ? 12.193  17.692  37.660  1.00 33.64 ? 1128 PHE A CA    1 
ATOM   1066 C  C     . PHE A 1 151 ? 12.701  17.095  38.959  1.00 33.31 ? 1128 PHE A C     1 
ATOM   1067 O  O     . PHE A 1 151 ? 11.958  17.000  39.936  1.00 36.38 ? 1128 PHE A O     1 
ATOM   1068 C  CB    . PHE A 1 151 ? 12.348  19.212  37.721  1.00 31.54 ? 1128 PHE A CB    1 
ATOM   1069 C  CG    . PHE A 1 151 ? 12.370  19.880  36.380  1.00 30.57 ? 1128 PHE A CG    1 
ATOM   1070 C  CD1   . PHE A 1 151 ? 13.536  19.907  35.625  1.00 31.05 ? 1128 PHE A CD1   1 
ATOM   1071 C  CD2   . PHE A 1 151 ? 11.222  20.496  35.870  1.00 31.01 ? 1128 PHE A CD2   1 
ATOM   1072 C  CE1   . PHE A 1 151 ? 13.569  20.539  34.387  1.00 27.29 ? 1128 PHE A CE1   1 
ATOM   1073 C  CE2   . PHE A 1 151 ? 11.243  21.130  34.632  1.00 28.87 ? 1128 PHE A CE2   1 
ATOM   1074 C  CZ    . PHE A 1 151 ? 12.422  21.153  33.887  1.00 28.10 ? 1128 PHE A CZ    1 
ATOM   1075 N  N     . VAL A 1 152 ? 13.960  16.681  38.964  1.00 31.57 ? 1129 VAL A N     1 
ATOM   1076 C  CA    . VAL A 1 152 ? 14.578  16.149  40.171  1.00 30.75 ? 1129 VAL A CA    1 
ATOM   1077 C  C     . VAL A 1 152 ? 15.661  17.191  40.495  1.00 30.74 ? 1129 VAL A C     1 
ATOM   1078 O  O     . VAL A 1 152 ? 16.441  17.565  39.629  1.00 31.58 ? 1129 VAL A O     1 
ATOM   1079 C  CB    . VAL A 1 152 ? 15.157  14.711  39.923  1.00 31.23 ? 1129 VAL A CB    1 
ATOM   1080 C  CG1   . VAL A 1 152 ? 16.183  14.742  38.804  1.00 28.66 ? 1129 VAL A CG1   1 
ATOM   1081 C  CG2   . VAL A 1 152 ? 15.725  14.119  41.233  1.00 24.70 ? 1129 VAL A CG2   1 
ATOM   1082 N  N     . HIS A 1 153 ? 15.695  17.669  41.734  1.00 30.07 ? 1130 HIS A N     1 
ATOM   1083 C  CA    . HIS A 1 153 ? 16.645  18.708  42.119  1.00 30.76 ? 1130 HIS A CA    1 
ATOM   1084 C  C     . HIS A 1 153 ? 18.092  18.263  42.204  1.00 31.54 ? 1130 HIS A C     1 
ATOM   1085 O  O     . HIS A 1 153 ? 18.988  18.972  41.757  1.00 32.87 ? 1130 HIS A O     1 
ATOM   1086 C  CB    . HIS A 1 153 ? 16.234  19.319  43.451  1.00 29.70 ? 1130 HIS A CB    1 
ATOM   1087 C  CG    . HIS A 1 153 ? 17.048  20.509  43.853  1.00 25.60 ? 1130 HIS A CG    1 
ATOM   1088 N  ND1   . HIS A 1 153 ? 16.575  21.798  43.752  1.00 26.12 ? 1130 HIS A ND1   1 
ATOM   1089 C  CD2   . HIS A 1 153 ? 18.274  20.601  44.416  1.00 23.09 ? 1130 HIS A CD2   1 
ATOM   1090 C  CE1   . HIS A 1 153 ? 17.469  22.635  44.246  1.00 22.15 ? 1130 HIS A CE1   1 
ATOM   1091 N  NE2   . HIS A 1 153 ? 18.509  21.935  44.658  1.00 24.37 ? 1130 HIS A NE2   1 
ATOM   1092 N  N     . ARG A 1 154 ? 18.311  17.095  42.791  1.00 31.94 ? 1131 ARG A N     1 
ATOM   1093 C  CA    . ARG A 1 154 ? 19.640  16.515  42.936  1.00 32.61 ? 1131 ARG A CA    1 
ATOM   1094 C  C     . ARG A 1 154 ? 20.576  17.196  43.907  1.00 32.96 ? 1131 ARG A C     1 
ATOM   1095 O  O     . ARG A 1 154 ? 21.618  16.637  44.233  1.00 34.42 ? 1131 ARG A O     1 
ATOM   1096 C  CB    . ARG A 1 154 ? 20.338  16.404  41.582  1.00 32.98 ? 1131 ARG A CB    1 
ATOM   1097 C  CG    . ARG A 1 154 ? 19.659  15.429  40.643  1.00 36.20 ? 1131 ARG A CG    1 
ATOM   1098 C  CD    . ARG A 1 154 ? 20.402  15.323  39.319  1.00 37.50 ? 1131 ARG A CD    1 
ATOM   1099 N  NE    . ARG A 1 154 ? 21.758  14.785  39.435  1.00 35.76 ? 1131 ARG A NE    1 
ATOM   1100 C  CZ    . ARG A 1 154 ? 22.827  15.380  38.909  1.00 39.68 ? 1131 ARG A CZ    1 
ATOM   1101 N  NH1   . ARG A 1 154 ? 22.683  16.528  38.250  1.00 39.83 ? 1131 ARG A NH1   1 
ATOM   1102 N  NH2   . ARG A 1 154 ? 24.031  14.828  39.012  1.00 38.58 ? 1131 ARG A NH2   1 
ATOM   1103 N  N     . ASP A 1 155 ? 20.231  18.390  44.377  1.00 32.72 ? 1132 ASP A N     1 
ATOM   1104 C  CA    . ASP A 1 155 ? 21.106  19.058  45.323  1.00 30.05 ? 1132 ASP A CA    1 
ATOM   1105 C  C     . ASP A 1 155 ? 20.365  19.786  46.445  1.00 30.03 ? 1132 ASP A C     1 
ATOM   1106 O  O     . ASP A 1 155 ? 20.679  20.930  46.789  1.00 27.71 ? 1132 ASP A O     1 
ATOM   1107 C  CB    . ASP A 1 155 ? 22.034  20.014  44.582  1.00 29.78 ? 1132 ASP A CB    1 
ATOM   1108 C  CG    . ASP A 1 155 ? 23.216  20.443  45.428  1.00 30.29 ? 1132 ASP A CG    1 
ATOM   1109 O  OD1   . ASP A 1 155 ? 23.500  19.759  46.438  1.00 30.96 ? 1132 ASP A OD1   1 
ATOM   1110 O  OD2   . ASP A 1 155 ? 23.866  21.452  45.078  1.00 30.69 ? 1132 ASP A OD2   1 
ATOM   1111 N  N     . LEU A 1 156 ? 19.372  19.119  47.024  1.00 30.58 ? 1133 LEU A N     1 
ATOM   1112 C  CA    . LEU A 1 156 ? 18.630  19.736  48.109  1.00 30.41 ? 1133 LEU A CA    1 
ATOM   1113 C  C     . LEU A 1 156 ? 19.510  19.707  49.348  1.00 32.57 ? 1133 LEU A C     1 
ATOM   1114 O  O     . LEU A 1 156 ? 20.028  18.657  49.740  1.00 34.08 ? 1133 LEU A O     1 
ATOM   1115 C  CB    . LEU A 1 156 ? 17.325  18.996  48.368  1.00 29.50 ? 1133 LEU A CB    1 
ATOM   1116 C  CG    . LEU A 1 156 ? 16.518  19.429  49.603  1.00 28.91 ? 1133 LEU A CG    1 
ATOM   1117 C  CD1   . LEU A 1 156 ? 16.254  20.911  49.560  1.00 27.02 ? 1133 LEU A CD1   1 
ATOM   1118 C  CD2   . LEU A 1 156 ? 15.195  18.656  49.660  1.00 27.95 ? 1133 LEU A CD2   1 
ATOM   1119 N  N     . ALA A 1 157 ? 19.684  20.874  49.956  1.00 32.44 ? 1134 ALA A N     1 
ATOM   1120 C  CA    . ALA A 1 157 ? 20.508  21.010  51.143  1.00 32.68 ? 1134 ALA A CA    1 
ATOM   1121 C  C     . ALA A 1 157 ? 20.246  22.398  51.715  1.00 34.65 ? 1134 ALA A C     1 
ATOM   1122 O  O     . ALA A 1 157 ? 19.784  23.296  50.995  1.00 34.63 ? 1134 ALA A O     1 
ATOM   1123 C  CB    . ALA A 1 157 ? 21.971  20.863  50.775  1.00 30.53 ? 1134 ALA A CB    1 
ATOM   1124 N  N     . ALA A 1 158 ? 20.545  22.579  53.000  1.00 34.13 ? 1135 ALA A N     1 
ATOM   1125 C  CA    . ALA A 1 158 ? 20.318  23.855  53.652  1.00 34.30 ? 1135 ALA A CA    1 
ATOM   1126 C  C     . ALA A 1 158 ? 20.996  25.037  52.949  1.00 34.28 ? 1135 ALA A C     1 
ATOM   1127 O  O     . ALA A 1 158 ? 20.447  26.138  52.917  1.00 35.41 ? 1135 ALA A O     1 
ATOM   1128 C  CB    . ALA A 1 158 ? 20.760  23.778  55.113  1.00 34.42 ? 1135 ALA A CB    1 
ATOM   1129 N  N     . ARG A 1 159 ? 22.177  24.824  52.383  1.00 33.71 ? 1136 ARG A N     1 
ATOM   1130 C  CA    . ARG A 1 159 ? 22.865  25.922  51.709  1.00 35.03 ? 1136 ARG A CA    1 
ATOM   1131 C  C     . ARG A 1 159 ? 22.100  26.354  50.465  1.00 35.14 ? 1136 ARG A C     1 
ATOM   1132 O  O     . ARG A 1 159 ? 22.252  27.480  50.006  1.00 35.17 ? 1136 ARG A O     1 
ATOM   1133 C  CB    . ARG A 1 159 ? 24.304  25.533  51.332  1.00 34.81 ? 1136 ARG A CB    1 
ATOM   1134 C  CG    . ARG A 1 159 ? 24.389  24.250  50.551  1.00 37.64 ? 1136 ARG A CG    1 
ATOM   1135 C  CD    . ARG A 1 159 ? 25.751  24.003  49.917  1.00 39.81 ? 1136 ARG A CD    1 
ATOM   1136 N  NE    . ARG A 1 159 ? 25.621  22.871  49.004  1.00 43.38 ? 1136 ARG A NE    1 
ATOM   1137 C  CZ    . ARG A 1 159 ? 25.517  21.615  49.412  1.00 44.54 ? 1136 ARG A CZ    1 
ATOM   1138 N  NH1   . ARG A 1 159 ? 25.553  21.347  50.704  1.00 47.70 ? 1136 ARG A NH1   1 
ATOM   1139 N  NH2   . ARG A 1 159 ? 25.321  20.633  48.548  1.00 45.92 ? 1136 ARG A NH2   1 
ATOM   1140 N  N     . ASN A 1 160 ? 21.276  25.461  49.923  1.00 34.65 ? 1137 ASN A N     1 
ATOM   1141 C  CA    . ASN A 1 160 ? 20.503  25.785  48.733  1.00 34.15 ? 1137 ASN A CA    1 
ATOM   1142 C  C     . ASN A 1 160 ? 19.050  26.170  49.013  1.00 34.50 ? 1137 ASN A C     1 
ATOM   1143 O  O     . ASN A 1 160 ? 18.253  26.329  48.089  1.00 33.64 ? 1137 ASN A O     1 
ATOM   1144 C  CB    . ASN A 1 160 ? 20.565  24.627  47.740  1.00 32.78 ? 1137 ASN A CB    1 
ATOM   1145 C  CG    . ASN A 1 160 ? 21.940  24.478  47.106  1.00 31.58 ? 1137 ASN A CG    1 
ATOM   1146 O  OD1   . ASN A 1 160 ? 22.766  25.387  47.165  1.00 30.72 ? 1137 ASN A OD1   1 
ATOM   1147 N  ND2   . ASN A 1 160 ? 22.180  23.338  46.482  1.00 30.67 ? 1137 ASN A ND2   1 
ATOM   1148 N  N     . CYS A 1 161 ? 18.711  26.306  50.290  1.00 35.02 ? 1138 CYS A N     1 
ATOM   1149 C  CA    . CYS A 1 161 ? 17.379  26.729  50.686  1.00 36.25 ? 1138 CYS A CA    1 
ATOM   1150 C  C     . CYS A 1 161 ? 17.550  28.203  51.041  1.00 38.33 ? 1138 CYS A C     1 
ATOM   1151 O  O     . CYS A 1 161 ? 18.529  28.582  51.692  1.00 40.04 ? 1138 CYS A O     1 
ATOM   1152 C  CB    . CYS A 1 161 ? 16.898  25.921  51.887  1.00 37.64 ? 1138 CYS A CB    1 
ATOM   1153 S  SG    . CYS A 1 161 ? 16.307  24.261  51.436  1.00 33.76 ? 1138 CYS A SG    1 
ATOM   1154 N  N     . MET A 1 162 ? 16.622  29.045  50.611  1.00 36.69 ? 1139 MET A N     1 
ATOM   1155 C  CA    . MET A 1 162 ? 16.774  30.460  50.891  1.00 36.53 ? 1139 MET A CA    1 
ATOM   1156 C  C     . MET A 1 162 ? 15.693  30.980  51.816  1.00 37.96 ? 1139 MET A C     1 
ATOM   1157 O  O     . MET A 1 162 ? 14.590  30.431  51.879  1.00 38.71 ? 1139 MET A O     1 
ATOM   1158 C  CB    . MET A 1 162 ? 16.775  31.255  49.582  1.00 35.30 ? 1139 MET A CB    1 
ATOM   1159 C  CG    . MET A 1 162 ? 17.764  30.757  48.553  1.00 32.92 ? 1139 MET A CG    1 
ATOM   1160 S  SD    . MET A 1 162 ? 19.500  30.943  49.047  1.00 35.41 ? 1139 MET A SD    1 
ATOM   1161 C  CE    . MET A 1 162 ? 19.647  32.717  49.053  1.00 32.83 ? 1139 MET A CE    1 
ATOM   1162 N  N     . VAL A 1 163 ? 16.018  32.049  52.533  1.00 39.20 ? 1140 VAL A N     1 
ATOM   1163 C  CA    . VAL A 1 163 ? 15.078  32.642  53.468  1.00 38.64 ? 1140 VAL A CA    1 
ATOM   1164 C  C     . VAL A 1 163 ? 14.671  34.049  53.073  1.00 39.67 ? 1140 VAL A C     1 
ATOM   1165 O  O     . VAL A 1 163 ? 15.516  34.930  52.877  1.00 38.96 ? 1140 VAL A O     1 
ATOM   1166 C  CB    . VAL A 1 163 ? 15.667  32.676  54.870  1.00 38.27 ? 1140 VAL A CB    1 
ATOM   1167 C  CG1   . VAL A 1 163 ? 14.600  33.084  55.871  1.00 36.58 ? 1140 VAL A CG1   1 
ATOM   1168 C  CG2   . VAL A 1 163 ? 16.259  31.313  55.198  1.00 34.92 ? 1140 VAL A CG2   1 
ATOM   1169 N  N     . ALA A 1 164 ? 13.359  34.236  52.961  1.00 40.82 ? 1141 ALA A N     1 
ATOM   1170 C  CA    . ALA A 1 164 ? 12.764  35.507  52.594  1.00 43.09 ? 1141 ALA A CA    1 
ATOM   1171 C  C     . ALA A 1 164 ? 12.789  36.501  53.754  1.00 45.41 ? 1141 ALA A C     1 
ATOM   1172 O  O     . ALA A 1 164 ? 13.064  36.128  54.890  1.00 46.14 ? 1141 ALA A O     1 
ATOM   1173 C  CB    . ALA A 1 164 ? 11.343  35.273  52.134  1.00 42.00 ? 1141 ALA A CB    1 
ATOM   1174 N  N     . HIS A 1 165 ? 12.498  37.766  53.459  1.00 48.01 ? 1142 HIS A N     1 
ATOM   1175 C  CA    . HIS A 1 165 ? 12.497  38.814  54.477  1.00 50.17 ? 1142 HIS A CA    1 
ATOM   1176 C  C     . HIS A 1 165 ? 11.535  38.480  55.610  1.00 50.59 ? 1142 HIS A C     1 
ATOM   1177 O  O     . HIS A 1 165 ? 11.721  38.940  56.734  1.00 50.72 ? 1142 HIS A O     1 
ATOM   1178 C  CB    . HIS A 1 165 ? 12.087  40.148  53.872  1.00 53.31 ? 1142 HIS A CB    1 
ATOM   1179 C  CG    . HIS A 1 165 ? 10.631  40.223  53.553  1.00 59.57 ? 1142 HIS A CG    1 
ATOM   1180 N  ND1   . HIS A 1 165 ? 10.009  39.318  52.717  1.00 61.62 ? 1142 HIS A ND1   1 
ATOM   1181 C  CD2   . HIS A 1 165 ? 9.661   41.062  53.989  1.00 62.07 ? 1142 HIS A CD2   1 
ATOM   1182 C  CE1   . HIS A 1 165 ? 8.720   39.596  52.653  1.00 63.28 ? 1142 HIS A CE1   1 
ATOM   1183 N  NE2   . HIS A 1 165 ? 8.481   40.650  53.416  1.00 64.25 ? 1142 HIS A NE2   1 
ATOM   1184 N  N     . ASP A 1 166 ? 10.511  37.682  55.306  1.00 51.13 ? 1143 ASP A N     1 
ATOM   1185 C  CA    . ASP A 1 166 ? 9.514   37.278  56.297  1.00 51.15 ? 1143 ASP A CA    1 
ATOM   1186 C  C     . ASP A 1 166 ? 9.821   35.898  56.850  1.00 49.95 ? 1143 ASP A C     1 
ATOM   1187 O  O     . ASP A 1 166 ? 9.017   35.318  57.580  1.00 48.99 ? 1143 ASP A O     1 
ATOM   1188 C  CB    . ASP A 1 166 ? 8.120   37.255  55.678  1.00 53.01 ? 1143 ASP A CB    1 
ATOM   1189 C  CG    . ASP A 1 166 ? 8.033   36.327  54.483  1.00 55.93 ? 1143 ASP A CG    1 
ATOM   1190 O  OD1   . ASP A 1 166 ? 8.531   35.182  54.564  1.00 54.35 ? 1143 ASP A OD1   1 
ATOM   1191 O  OD2   . ASP A 1 166 ? 7.461   36.745  53.458  1.00 58.65 ? 1143 ASP A OD2   1 
ATOM   1192 N  N     . PHE A 1 167 ? 10.986  35.380  56.478  1.00 49.11 ? 1144 PHE A N     1 
ATOM   1193 C  CA    . PHE A 1 167 ? 11.457  34.067  56.919  1.00 48.65 ? 1144 PHE A CA    1 
ATOM   1194 C  C     . PHE A 1 167 ? 10.811  32.857  56.249  1.00 47.38 ? 1144 PHE A C     1 
ATOM   1195 O  O     . PHE A 1 167 ? 10.920  31.729  56.741  1.00 48.46 ? 1144 PHE A O     1 
ATOM   1196 C  CB    . PHE A 1 167 ? 11.341  33.968  58.441  1.00 49.23 ? 1144 PHE A CB    1 
ATOM   1197 C  CG    . PHE A 1 167 ? 12.136  35.015  59.155  1.00 50.02 ? 1144 PHE A CG    1 
ATOM   1198 C  CD1   . PHE A 1 167 ? 13.527  34.942  59.189  1.00 49.79 ? 1144 PHE A CD1   1 
ATOM   1199 C  CD2   . PHE A 1 167 ? 11.506  36.124  59.720  1.00 50.03 ? 1144 PHE A CD2   1 
ATOM   1200 C  CE1   . PHE A 1 167 ? 14.286  35.959  59.769  1.00 49.57 ? 1144 PHE A CE1   1 
ATOM   1201 C  CE2   . PHE A 1 167 ? 12.249  37.145  60.302  1.00 49.24 ? 1144 PHE A CE2   1 
ATOM   1202 C  CZ    . PHE A 1 167 ? 13.649  37.062  60.326  1.00 50.23 ? 1144 PHE A CZ    1 
ATOM   1203 N  N     . THR A 1 168 ? 10.138  33.089  55.126  1.00 45.98 ? 1145 THR A N     1 
ATOM   1204 C  CA    . THR A 1 168 ? 9.535   31.992  54.364  1.00 44.53 ? 1145 THR A CA    1 
ATOM   1205 C  C     . THR A 1 168 ? 10.726  31.303  53.698  1.00 42.52 ? 1145 THR A C     1 
ATOM   1206 O  O     . THR A 1 168 ? 11.603  31.969  53.137  1.00 41.63 ? 1145 THR A O     1 
ATOM   1207 C  CB    . THR A 1 168 ? 8.591   32.513  53.244  1.00 44.93 ? 1145 THR A CB    1 
ATOM   1208 O  OG1   . THR A 1 168 ? 7.363   32.983  53.816  1.00 46.41 ? 1145 THR A OG1   1 
ATOM   1209 C  CG2   . THR A 1 168 ? 8.284   31.416  52.254  1.00 45.74 ? 1145 THR A CG2   1 
ATOM   1210 N  N     . VAL A 1 169 ? 10.776  29.980  53.763  1.00 39.89 ? 1146 VAL A N     1 
ATOM   1211 C  CA    . VAL A 1 169 ? 11.880  29.278  53.137  1.00 36.76 ? 1146 VAL A CA    1 
ATOM   1212 C  C     . VAL A 1 169 ? 11.491  28.828  51.741  1.00 35.56 ? 1146 VAL A C     1 
ATOM   1213 O  O     . VAL A 1 169 ? 10.362  28.392  51.512  1.00 33.93 ? 1146 VAL A O     1 
ATOM   1214 C  CB    . VAL A 1 169 ? 12.313  28.069  53.970  1.00 36.82 ? 1146 VAL A CB    1 
ATOM   1215 C  CG1   . VAL A 1 169 ? 13.457  27.336  53.271  1.00 33.59 ? 1146 VAL A CG1   1 
ATOM   1216 C  CG2   . VAL A 1 169 ? 12.746  28.547  55.360  1.00 35.71 ? 1146 VAL A CG2   1 
ATOM   1217 N  N     . LYS A 1 170 ? 12.428  28.941  50.803  1.00 34.40 ? 1147 LYS A N     1 
ATOM   1218 C  CA    . LYS A 1 170 ? 12.163  28.542  49.427  1.00 33.36 ? 1147 LYS A CA    1 
ATOM   1219 C  C     . LYS A 1 170 ? 13.342  27.769  48.847  1.00 33.21 ? 1147 LYS A C     1 
ATOM   1220 O  O     . LYS A 1 170 ? 14.493  27.939  49.268  1.00 33.26 ? 1147 LYS A O     1 
ATOM   1221 C  CB    . LYS A 1 170 ? 11.892  29.769  48.552  1.00 32.78 ? 1147 LYS A CB    1 
ATOM   1222 C  CG    . LYS A 1 170 ? 10.887  30.751  49.103  1.00 30.51 ? 1147 LYS A CG    1 
ATOM   1223 C  CD    . LYS A 1 170 ? 10.777  31.951  48.182  1.00 31.45 ? 1147 LYS A CD    1 
ATOM   1224 C  CE    . LYS A 1 170 ? 9.546   32.774  48.513  1.00 31.51 ? 1147 LYS A CE    1 
ATOM   1225 N  NZ    . LYS A 1 170 ? 9.142   33.670  47.383  1.00 32.30 ? 1147 LYS A NZ    1 
ATOM   1226 N  N     . ILE A 1 171 ? 13.030  26.925  47.872  1.00 32.07 ? 1148 ILE A N     1 
ATOM   1227 C  CA    . ILE A 1 171 ? 14.012  26.098  47.191  1.00 32.21 ? 1148 ILE A CA    1 
ATOM   1228 C  C     . ILE A 1 171 ? 14.781  26.950  46.179  1.00 32.57 ? 1148 ILE A C     1 
ATOM   1229 O  O     . ILE A 1 171 ? 14.177  27.723  45.432  1.00 32.64 ? 1148 ILE A O     1 
ATOM   1230 C  CB    . ILE A 1 171 ? 13.317  24.937  46.406  1.00 31.81 ? 1148 ILE A CB    1 
ATOM   1231 C  CG1   . ILE A 1 171 ? 12.326  24.193  47.304  1.00 30.53 ? 1148 ILE A CG1   1 
ATOM   1232 C  CG2   . ILE A 1 171 ? 14.365  23.995  45.846  1.00 30.90 ? 1148 ILE A CG2   1 
ATOM   1233 C  CD1   . ILE A 1 171 ? 12.932  23.617  48.566  1.00 33.73 ? 1148 ILE A CD1   1 
ATOM   1234 N  N     . GLY A 1 172 ? 16.104  26.798  46.151  1.00 32.24 ? 1149 GLY A N     1 
ATOM   1235 C  CA    . GLY A 1 172 ? 16.919  27.555  45.216  1.00 32.76 ? 1149 GLY A CA    1 
ATOM   1236 C  C     . GLY A 1 172 ? 18.029  26.710  44.607  1.00 33.19 ? 1149 GLY A C     1 
ATOM   1237 O  O     . GLY A 1 172 ? 18.073  25.500  44.813  1.00 34.58 ? 1149 GLY A O     1 
ATOM   1238 N  N     . ASP A 1 173 ? 18.926  27.352  43.863  1.00 32.48 ? 1150 ASP A N     1 
ATOM   1239 C  CA    . ASP A 1 173 ? 20.056  26.695  43.208  1.00 32.18 ? 1150 ASP A CA    1 
ATOM   1240 C  C     . ASP A 1 173 ? 19.675  25.472  42.381  1.00 31.85 ? 1150 ASP A C     1 
ATOM   1241 O  O     . ASP A 1 173 ? 19.698  24.344  42.876  1.00 31.92 ? 1150 ASP A O     1 
ATOM   1242 C  CB    . ASP A 1 173 ? 21.128  26.296  44.237  1.00 31.95 ? 1150 ASP A CB    1 
ATOM   1243 C  CG    . ASP A 1 173 ? 22.455  25.913  43.577  1.00 35.67 ? 1150 ASP A CG    1 
ATOM   1244 O  OD1   . ASP A 1 173 ? 22.422  25.458  42.407  1.00 36.08 ? 1150 ASP A OD1   1 
ATOM   1245 O  OD2   . ASP A 1 173 ? 23.527  26.050  44.219  1.00 36.90 ? 1150 ASP A OD2   1 
ATOM   1246 N  N     . PHE A 1 174 ? 19.339  25.703  41.113  1.00 30.56 ? 1151 PHE A N     1 
ATOM   1247 C  CA    . PHE A 1 174 ? 18.947  24.621  40.216  1.00 30.32 ? 1151 PHE A CA    1 
ATOM   1248 C  C     . PHE A 1 174 ? 20.030  24.180  39.229  1.00 31.35 ? 1151 PHE A C     1 
ATOM   1249 O  O     . PHE A 1 174 ? 19.730  23.648  38.163  1.00 31.60 ? 1151 PHE A O     1 
ATOM   1250 C  CB    . PHE A 1 174 ? 17.678  25.020  39.488  1.00 25.30 ? 1151 PHE A CB    1 
ATOM   1251 C  CG    . PHE A 1 174 ? 16.592  25.437  40.418  1.00 27.10 ? 1151 PHE A CG    1 
ATOM   1252 C  CD1   . PHE A 1 174 ? 15.743  24.496  40.980  1.00 25.30 ? 1151 PHE A CD1   1 
ATOM   1253 C  CD2   . PHE A 1 174 ? 16.488  26.772  40.832  1.00 25.59 ? 1151 PHE A CD2   1 
ATOM   1254 C  CE1   . PHE A 1 174 ? 14.808  24.873  41.949  1.00 26.36 ? 1151 PHE A CE1   1 
ATOM   1255 C  CE2   . PHE A 1 174 ? 15.571  27.152  41.793  1.00 25.05 ? 1151 PHE A CE2   1 
ATOM   1256 C  CZ    . PHE A 1 174 ? 14.726  26.202  42.358  1.00 26.00 ? 1151 PHE A CZ    1 
ATOM   1257 N  N     . GLY A 1 175 ? 21.290  24.392  39.602  1.00 32.05 ? 1152 GLY A N     1 
ATOM   1258 C  CA    . GLY A 1 175 ? 22.397  24.001  38.745  1.00 33.21 ? 1152 GLY A CA    1 
ATOM   1259 C  C     . GLY A 1 175 ? 22.405  22.527  38.385  1.00 35.23 ? 1152 GLY A C     1 
ATOM   1260 O  O     . GLY A 1 175 ? 22.620  22.172  37.224  1.00 36.57 ? 1152 GLY A O     1 
ATOM   1261 N  N     . MET A 1 176 ? 22.155  21.662  39.366  1.00 34.88 ? 1153 MET A N     1 
ATOM   1262 C  CA    . MET A 1 176 ? 22.148  20.224  39.126  1.00 33.96 ? 1153 MET A CA    1 
ATOM   1263 C  C     . MET A 1 176 ? 20.780  19.639  38.793  1.00 34.98 ? 1153 MET A C     1 
ATOM   1264 O  O     . MET A 1 176 ? 20.653  18.433  38.576  1.00 36.58 ? 1153 MET A O     1 
ATOM   1265 C  CB    . MET A 1 176 ? 22.721  19.495  40.344  1.00 33.85 ? 1153 MET A CB    1 
ATOM   1266 C  CG    . MET A 1 176 ? 24.173  19.831  40.638  1.00 34.19 ? 1153 MET A CG    1 
ATOM   1267 S  SD    . MET A 1 176 ? 24.908  18.810  41.951  1.00 38.49 ? 1153 MET A SD    1 
ATOM   1268 C  CE    . MET A 1 176 ? 24.600  17.128  41.306  1.00 34.25 ? 1153 MET A CE    1 
ATOM   1269 N  N     . THR A 1 177 ? 19.756  20.484  38.750  1.00 34.21 ? 1154 THR A N     1 
ATOM   1270 C  CA    . THR A 1 177 ? 18.408  20.014  38.474  1.00 32.49 ? 1154 THR A CA    1 
ATOM   1271 C  C     . THR A 1 177 ? 18.291  19.396  37.077  1.00 33.39 ? 1154 THR A C     1 
ATOM   1272 O  O     . THR A 1 177 ? 18.932  19.853  36.129  1.00 32.31 ? 1154 THR A O     1 
ATOM   1273 C  CB    . THR A 1 177 ? 17.406  21.174  38.663  1.00 31.44 ? 1154 THR A CB    1 
ATOM   1274 O  OG1   . THR A 1 177 ? 17.476  21.622  40.021  1.00 32.23 ? 1154 THR A OG1   1 
ATOM   1275 C  CG2   . THR A 1 177 ? 15.975  20.738  38.348  1.00 26.45 ? 1154 THR A CG2   1 
ATOM   1276 N  N     . ARG A 1 178 ? 17.473  18.349  36.958  1.00 32.54 ? 1155 ARG A N     1 
ATOM   1277 C  CA    . ARG A 1 178 ? 17.284  17.678  35.674  1.00 32.45 ? 1155 ARG A CA    1 
ATOM   1278 C  C     . ARG A 1 178 ? 15.816  17.364  35.372  1.00 32.41 ? 1155 ARG A C     1 
ATOM   1279 O  O     . ARG A 1 178 ? 15.018  17.091  36.266  1.00 32.93 ? 1155 ARG A O     1 
ATOM   1280 C  CB    . ARG A 1 178 ? 18.118  16.385  35.615  1.00 29.16 ? 1155 ARG A CB    1 
ATOM   1281 C  CG    . ARG A 1 178 ? 19.631  16.592  35.771  1.00 29.96 ? 1155 ARG A CG    1 
ATOM   1282 C  CD    . ARG A 1 178 ? 20.275  17.262  34.557  1.00 29.77 ? 1155 ARG A CD    1 
ATOM   1283 N  NE    . ARG A 1 178 ? 21.730  17.393  34.672  1.00 29.82 ? 1155 ARG A NE    1 
ATOM   1284 C  CZ    . ARG A 1 178 ? 22.361  18.428  35.230  1.00 30.39 ? 1155 ARG A CZ    1 
ATOM   1285 N  NH1   . ARG A 1 178 ? 21.678  19.445  35.733  1.00 27.16 ? 1155 ARG A NH1   1 
ATOM   1286 N  NH2   . ARG A 1 178 ? 23.687  18.448  35.283  1.00 31.40 ? 1155 ARG A NH2   1 
ATOM   1287 N  N     . ASP A 1 179 ? 15.485  17.416  34.089  1.00 32.45 ? 1156 ASP A N     1 
ATOM   1288 C  CA    . ASP A 1 179 ? 14.147  17.128  33.597  1.00 32.68 ? 1156 ASP A CA    1 
ATOM   1289 C  C     . ASP A 1 179 ? 14.048  15.610  33.551  1.00 32.42 ? 1156 ASP A C     1 
ATOM   1290 O  O     . ASP A 1 179 ? 14.877  14.960  32.912  1.00 31.00 ? 1156 ASP A O     1 
ATOM   1291 C  CB    . ASP A 1 179 ? 14.001  17.692  32.174  1.00 31.91 ? 1156 ASP A CB    1 
ATOM   1292 C  CG    . ASP A 1 179 ? 12.590  17.540  31.614  1.00 32.04 ? 1156 ASP A CG    1 
ATOM   1293 O  OD1   . ASP A 1 179 ? 11.679  17.084  32.337  1.00 31.55 ? 1156 ASP A OD1   1 
ATOM   1294 O  OD2   . ASP A 1 179 ? 12.392  17.898  30.436  1.00 33.82 ? 1156 ASP A OD2   1 
ATOM   1295 N  N     . ILE A 1 180 ? 13.054  15.038  34.222  1.00 32.11 ? 1157 ILE A N     1 
ATOM   1296 C  CA    . ILE A 1 180 ? 12.898  13.582  34.221  1.00 32.65 ? 1157 ILE A CA    1 
ATOM   1297 C  C     . ILE A 1 180 ? 11.521  13.198  33.703  1.00 33.00 ? 1157 ILE A C     1 
ATOM   1298 O  O     . ILE A 1 180 ? 10.958  12.176  34.101  1.00 33.74 ? 1157 ILE A O     1 
ATOM   1299 C  CB    . ILE A 1 180 ? 13.048  12.972  35.647  1.00 31.86 ? 1157 ILE A CB    1 
ATOM   1300 C  CG1   . ILE A 1 180 ? 12.047  13.621  36.605  1.00 33.59 ? 1157 ILE A CG1   1 
ATOM   1301 C  CG2   . ILE A 1 180 ? 14.438  13.158  36.159  1.00 29.79 ? 1157 ILE A CG2   1 
ATOM   1302 C  CD1   . ILE A 1 180 ? 11.996  12.946  37.985  1.00 34.79 ? 1157 ILE A CD1   1 
HETATM 1303 N  N     . PTR A 1 181 ? 10.981  14.023  32.817  1.00 33.77 ? 1158 PTR A N     1 
HETATM 1304 C  CA    . PTR A 1 181 ? 9.664   13.773  32.258  1.00 35.51 ? 1158 PTR A CA    1 
HETATM 1305 C  C     . PTR A 1 181 ? 9.599   12.436  31.523  1.00 35.70 ? 1158 PTR A C     1 
HETATM 1306 O  O     . PTR A 1 181 ? 8.602   11.722  31.614  1.00 36.13 ? 1158 PTR A O     1 
HETATM 1307 C  CB    . PTR A 1 181 ? 9.280   14.914  31.301  1.00 34.10 ? 1158 PTR A CB    1 
HETATM 1308 C  CG    . PTR A 1 181 ? 7.813   14.941  30.932  1.00 32.08 ? 1158 PTR A CG    1 
HETATM 1309 C  CD1   . PTR A 1 181 ? 7.269   13.977  30.098  1.00 32.23 ? 1158 PTR A CD1   1 
HETATM 1310 C  CD2   . PTR A 1 181 ? 6.957   15.907  31.466  1.00 32.52 ? 1158 PTR A CD2   1 
HETATM 1311 C  CE1   . PTR A 1 181 ? 5.899   13.968  29.802  1.00 33.61 ? 1158 PTR A CE1   1 
HETATM 1312 C  CE2   . PTR A 1 181 ? 5.582   15.904  31.182  1.00 32.14 ? 1158 PTR A CE2   1 
HETATM 1313 C  CZ    . PTR A 1 181 ? 5.064   14.931  30.349  1.00 32.68 ? 1158 PTR A CZ    1 
HETATM 1314 O  OH    . PTR A 1 181 ? 3.723   14.914  30.051  1.00 34.44 ? 1158 PTR A OH    1 
HETATM 1315 P  P     . PTR A 1 181 ? 2.676   14.275  31.065  1.00 39.86 ? 1158 PTR A P     1 
HETATM 1316 O  O1P   . PTR A 1 181 ? 1.403   14.189  30.348  1.00 37.49 ? 1158 PTR A O1P   1 
HETATM 1317 O  O2P   . PTR A 1 181 ? 2.631   15.278  32.156  1.00 40.22 ? 1158 PTR A O2P   1 
HETATM 1318 O  O3P   . PTR A 1 181 ? 3.341   12.994  31.425  1.00 35.90 ? 1158 PTR A O3P   1 
ATOM   1319 N  N     . GLU A 1 182 ? 10.668  12.102  30.810  1.00 35.44 ? 1159 GLU A N     1 
ATOM   1320 C  CA    . GLU A 1 182 ? 10.706  10.880  30.023  1.00 37.97 ? 1159 GLU A CA    1 
ATOM   1321 C  C     . GLU A 1 182 ? 10.832  9.562   30.779  1.00 39.18 ? 1159 GLU A C     1 
ATOM   1322 O  O     . GLU A 1 182 ? 10.227  8.569   30.380  1.00 39.90 ? 1159 GLU A O     1 
ATOM   1323 C  CB    . GLU A 1 182 ? 11.811  11.009  28.970  1.00 37.40 ? 1159 GLU A CB    1 
ATOM   1324 C  CG    . GLU A 1 182 ? 11.920  12.444  28.448  1.00 40.88 ? 1159 GLU A CG    1 
ATOM   1325 C  CD    . GLU A 1 182 ? 12.683  12.568  27.147  1.00 42.42 ? 1159 GLU A CD    1 
ATOM   1326 O  OE1   . GLU A 1 182 ? 13.755  11.943  27.019  1.00 44.80 ? 1159 GLU A OE1   1 
ATOM   1327 O  OE2   . GLU A 1 182 ? 12.216  13.311  26.253  1.00 44.09 ? 1159 GLU A OE2   1 
ATOM   1328 N  N     . THR A 1 183 ? 11.591  9.541   31.870  1.00 40.33 ? 1160 THR A N     1 
ATOM   1329 C  CA    . THR A 1 183 ? 11.773  8.294   32.599  1.00 41.17 ? 1160 THR A CA    1 
ATOM   1330 C  C     . THR A 1 183 ? 11.502  8.311   34.101  1.00 42.58 ? 1160 THR A C     1 
ATOM   1331 O  O     . THR A 1 183 ? 11.450  7.254   34.726  1.00 44.70 ? 1160 THR A O     1 
ATOM   1332 C  CB    . THR A 1 183 ? 13.194  7.768   32.414  1.00 40.78 ? 1160 THR A CB    1 
ATOM   1333 O  OG1   . THR A 1 183 ? 14.108  8.662   33.058  1.00 42.01 ? 1160 THR A OG1   1 
ATOM   1334 C  CG2   . THR A 1 183 ? 13.537  7.668   30.937  1.00 40.37 ? 1160 THR A CG2   1 
ATOM   1335 N  N     . ASP A 1 184 ? 11.335  9.493   34.684  1.00 43.31 ? 1161 ASP A N     1 
ATOM   1336 C  CA    . ASP A 1 184 ? 11.097  9.619   36.121  1.00 41.58 ? 1161 ASP A CA    1 
ATOM   1337 C  C     . ASP A 1 184 ? 12.400  9.478   36.903  1.00 40.74 ? 1161 ASP A C     1 
ATOM   1338 O  O     . ASP A 1 184 ? 12.388  9.421   38.128  1.00 41.14 ? 1161 ASP A O     1 
ATOM   1339 C  CB    . ASP A 1 184 ? 10.078  8.576   36.602  1.00 42.65 ? 1161 ASP A CB    1 
ATOM   1340 C  CG    . ASP A 1 184 ? 8.626   9.041   36.454  1.00 44.49 ? 1161 ASP A CG    1 
ATOM   1341 O  OD1   . ASP A 1 184 ? 8.337   9.979   35.678  1.00 48.80 ? 1161 ASP A OD1   1 
ATOM   1342 O  OD2   . ASP A 1 184 ? 7.755   8.447   37.113  1.00 44.36 ? 1161 ASP A OD2   1 
HETATM 1343 N  N     . PTR A 1 185 ? 13.523  9.423   36.195  1.00 39.20 ? 1162 PTR A N     1 
HETATM 1344 C  CA    . PTR A 1 185 ? 14.815  9.316   36.855  1.00 39.18 ? 1162 PTR A CA    1 
HETATM 1345 C  C     . PTR A 1 185 ? 15.902  9.866   35.949  1.00 38.77 ? 1162 PTR A C     1 
HETATM 1346 O  O     . PTR A 1 185 ? 15.705  10.015  34.747  1.00 38.69 ? 1162 PTR A O     1 
HETATM 1347 C  CB    . PTR A 1 185 ? 15.119  7.853   37.195  1.00 39.99 ? 1162 PTR A CB    1 
HETATM 1348 C  CG    . PTR A 1 185 ? 15.475  7.002   35.993  1.00 41.70 ? 1162 PTR A CG    1 
HETATM 1349 C  CD1   . PTR A 1 185 ? 16.746  7.070   35.410  1.00 41.68 ? 1162 PTR A CD1   1 
HETATM 1350 C  CD2   . PTR A 1 185 ? 14.521  6.182   35.393  1.00 42.77 ? 1162 PTR A CD2   1 
HETATM 1351 C  CE1   . PTR A 1 185 ? 17.049  6.345   34.261  1.00 43.33 ? 1162 PTR A CE1   1 
HETATM 1352 C  CE2   . PTR A 1 185 ? 14.820  5.451   34.238  1.00 43.66 ? 1162 PTR A CE2   1 
HETATM 1353 C  CZ    . PTR A 1 185 ? 16.077  5.544   33.682  1.00 43.32 ? 1162 PTR A CZ    1 
HETATM 1354 O  OH    . PTR A 1 185 ? 16.347  4.853   32.537  1.00 45.63 ? 1162 PTR A OH    1 
HETATM 1355 P  P     . PTR A 1 185 ? 17.236  3.535   32.486  1.00 50.67 ? 1162 PTR A P     1 
HETATM 1356 O  O1P   . PTR A 1 185 ? 18.624  4.053   32.390  1.00 47.84 ? 1162 PTR A O1P   1 
HETATM 1357 O  O2P   . PTR A 1 185 ? 16.702  2.869   31.252  1.00 51.57 ? 1162 PTR A O2P   1 
HETATM 1358 O  O3P   . PTR A 1 185 ? 16.893  2.815   33.746  1.00 51.64 ? 1162 PTR A O3P   1 
HETATM 1359 N  N     . PTR A 1 186 ? 17.048  10.173  36.536  1.00 38.70 ? 1163 PTR A N     1 
HETATM 1360 C  CA    . PTR A 1 186 ? 18.187  10.661  35.778  1.00 38.94 ? 1163 PTR A CA    1 
HETATM 1361 C  C     . PTR A 1 186 ? 19.385  9.832   36.210  1.00 40.16 ? 1163 PTR A C     1 
HETATM 1362 O  O     . PTR A 1 186 ? 19.585  9.582   37.402  1.00 41.95 ? 1163 PTR A O     1 
HETATM 1363 C  CB    . PTR A 1 186 ? 18.413  12.145  36.044  1.00 36.97 ? 1163 PTR A CB    1 
HETATM 1364 C  CG    . PTR A 1 186 ? 19.787  12.636  35.672  1.00 35.44 ? 1163 PTR A CG    1 
HETATM 1365 C  CD1   . PTR A 1 186 ? 20.765  12.782  36.639  1.00 34.33 ? 1163 PTR A CD1   1 
HETATM 1366 C  CD2   . PTR A 1 186 ? 20.111  12.948  34.349  1.00 34.80 ? 1163 PTR A CD2   1 
HETATM 1367 C  CE1   . PTR A 1 186 ? 22.028  13.223  36.316  1.00 38.38 ? 1163 PTR A CE1   1 
HETATM 1368 C  CE2   . PTR A 1 186 ? 21.392  13.393  34.008  1.00 36.99 ? 1163 PTR A CE2   1 
HETATM 1369 C  CZ    . PTR A 1 186 ? 22.346  13.527  35.005  1.00 39.57 ? 1163 PTR A CZ    1 
HETATM 1370 O  OH    . PTR A 1 186 ? 23.632  13.958  34.734  1.00 44.57 ? 1163 PTR A OH    1 
HETATM 1371 P  P     . PTR A 1 186 ? 24.268  14.619  33.395  1.00 46.97 ? 1163 PTR A P     1 
HETATM 1372 O  O1P   . PTR A 1 186 ? 24.422  13.446  32.503  1.00 48.79 ? 1163 PTR A O1P   1 
HETATM 1373 O  O2P   . PTR A 1 186 ? 25.492  15.174  33.991  1.00 45.97 ? 1163 PTR A O2P   1 
HETATM 1374 O  O3P   . PTR A 1 186 ? 23.250  15.606  32.942  1.00 48.35 ? 1163 PTR A O3P   1 
ATOM   1375 N  N     . ARG A 1 187 ? 20.182  9.400   35.243  1.00 41.36 ? 1164 ARG A N     1 
ATOM   1376 C  CA    . ARG A 1 187 ? 21.339  8.570   35.541  1.00 42.64 ? 1164 ARG A CA    1 
ATOM   1377 C  C     . ARG A 1 187 ? 22.623  9.199   35.059  1.00 42.83 ? 1164 ARG A C     1 
ATOM   1378 O  O     . ARG A 1 187 ? 22.802  9.401   33.870  1.00 43.15 ? 1164 ARG A O     1 
ATOM   1379 C  CB    . ARG A 1 187 ? 21.153  7.194   34.888  1.00 42.47 ? 1164 ARG A CB    1 
ATOM   1380 C  CG    . ARG A 1 187 ? 22.280  6.186   35.144  1.00 43.19 ? 1164 ARG A CG    1 
ATOM   1381 C  CD    . ARG A 1 187 ? 22.169  4.988   34.204  1.00 39.74 ? 1164 ARG A CD    1 
ATOM   1382 N  NE    . ARG A 1 187 ? 20.844  4.372   34.266  1.00 40.43 ? 1164 ARG A NE    1 
ATOM   1383 C  CZ    . ARG A 1 187 ? 20.449  3.545   35.229  1.00 39.90 ? 1164 ARG A CZ    1 
ATOM   1384 N  NH1   . ARG A 1 187 ? 21.286  3.226   36.212  1.00 41.27 ? 1164 ARG A NH1   1 
ATOM   1385 N  NH2   . ARG A 1 187 ? 19.215  3.053   35.223  1.00 37.94 ? 1164 ARG A NH2   1 
ATOM   1386 N  N     . LYS A 1 188 ? 23.517  9.515   35.985  1.00 45.67 ? 1165 LYS A N     1 
ATOM   1387 C  CA    . LYS A 1 188 ? 24.786  10.105  35.604  1.00 48.74 ? 1165 LYS A CA    1 
ATOM   1388 C  C     . LYS A 1 188 ? 25.803  8.988   35.556  1.00 52.26 ? 1165 LYS A C     1 
ATOM   1389 O  O     . LYS A 1 188 ? 25.979  8.260   36.536  1.00 54.21 ? 1165 LYS A O     1 
ATOM   1390 C  CB    . LYS A 1 188 ? 25.230  11.162  36.602  1.00 47.94 ? 1165 LYS A CB    1 
ATOM   1391 C  CG    . LYS A 1 188 ? 26.452  11.903  36.122  1.00 48.26 ? 1165 LYS A CG    1 
ATOM   1392 C  CD    . LYS A 1 188 ? 26.891  12.991  37.078  1.00 47.10 ? 1165 LYS A CD    1 
ATOM   1393 C  CE    . LYS A 1 188 ? 28.141  13.645  36.539  1.00 45.90 ? 1165 LYS A CE    1 
ATOM   1394 N  NZ    . LYS A 1 188 ? 27.995  13.918  35.080  1.00 42.78 ? 1165 LYS A NZ    1 
ATOM   1395 N  N     . GLY A 1 189 ? 26.474  8.847   34.415  1.00 55.11 ? 1166 GLY A N     1 
ATOM   1396 C  CA    . GLY A 1 189 ? 27.463  7.790   34.266  1.00 56.61 ? 1166 GLY A CA    1 
ATOM   1397 C  C     . GLY A 1 189 ? 28.913  8.197   34.474  1.00 58.17 ? 1166 GLY A C     1 
ATOM   1398 O  O     . GLY A 1 189 ? 29.684  7.463   35.102  1.00 58.63 ? 1166 GLY A O     1 
ATOM   1399 N  N     . GLY A 1 190 ? 29.292  9.359   33.947  1.00 58.37 ? 1167 GLY A N     1 
ATOM   1400 C  CA    . GLY A 1 190 ? 30.660  9.813   34.090  1.00 58.50 ? 1167 GLY A CA    1 
ATOM   1401 C  C     . GLY A 1 190 ? 30.933  10.436  35.440  1.00 59.03 ? 1167 GLY A C     1 
ATOM   1402 O  O     . GLY A 1 190 ? 30.056  10.495  36.298  1.00 60.10 ? 1167 GLY A O     1 
ATOM   1403 N  N     . LYS A 1 191 ? 32.163  10.900  35.629  1.00 59.02 ? 1168 LYS A N     1 
ATOM   1404 C  CA    . LYS A 1 191 ? 32.562  11.531  36.874  1.00 57.85 ? 1168 LYS A CA    1 
ATOM   1405 C  C     . LYS A 1 191 ? 31.915  12.914  36.947  1.00 57.75 ? 1168 LYS A C     1 
ATOM   1406 O  O     . LYS A 1 191 ? 31.429  13.429  35.941  1.00 58.02 ? 1168 LYS A O     1 
ATOM   1407 C  CB    . LYS A 1 191 ? 34.090  11.652  36.931  1.00 57.68 ? 1168 LYS A CB    1 
ATOM   1408 N  N     . GLY A 1 192 ? 31.909  13.503  38.141  1.00 56.99 ? 1169 GLY A N     1 
ATOM   1409 C  CA    . GLY A 1 192 ? 31.329  14.821  38.328  1.00 53.86 ? 1169 GLY A CA    1 
ATOM   1410 C  C     . GLY A 1 192 ? 31.300  15.192  39.797  1.00 52.60 ? 1169 GLY A C     1 
ATOM   1411 O  O     . GLY A 1 192 ? 31.416  14.324  40.668  1.00 53.23 ? 1169 GLY A O     1 
ATOM   1412 N  N     . LEU A 1 193 ? 31.151  16.479  40.082  1.00 50.22 ? 1170 LEU A N     1 
ATOM   1413 C  CA    . LEU A 1 193 ? 31.103  16.946  41.456  1.00 48.37 ? 1170 LEU A CA    1 
ATOM   1414 C  C     . LEU A 1 193 ? 29.717  16.692  42.034  1.00 47.28 ? 1170 LEU A C     1 
ATOM   1415 O  O     . LEU A 1 193 ? 28.732  17.285  41.597  1.00 48.32 ? 1170 LEU A O     1 
ATOM   1416 C  CB    . LEU A 1 193 ? 31.449  18.432  41.503  1.00 49.66 ? 1170 LEU A CB    1 
ATOM   1417 C  CG    . LEU A 1 193 ? 32.898  18.739  41.101  1.00 50.56 ? 1170 LEU A CG    1 
ATOM   1418 C  CD1   . LEU A 1 193 ? 33.102  20.236  41.057  1.00 49.22 ? 1170 LEU A CD1   1 
ATOM   1419 C  CD2   . LEU A 1 193 ? 33.860  18.099  42.099  1.00 49.67 ? 1170 LEU A CD2   1 
ATOM   1420 N  N     . LEU A 1 194 ? 29.647  15.804  43.020  1.00 45.22 ? 1171 LEU A N     1 
ATOM   1421 C  CA    . LEU A 1 194 ? 28.382  15.458  43.644  1.00 43.24 ? 1171 LEU A CA    1 
ATOM   1422 C  C     . LEU A 1 194 ? 28.363  15.765  45.133  1.00 43.14 ? 1171 LEU A C     1 
ATOM   1423 O  O     . LEU A 1 194 ? 29.379  15.639  45.813  1.00 41.68 ? 1171 LEU A O     1 
ATOM   1424 C  CB    . LEU A 1 194 ? 28.106  13.972  43.436  1.00 41.96 ? 1171 LEU A CB    1 
ATOM   1425 C  CG    . LEU A 1 194 ? 28.175  13.486  41.985  1.00 41.56 ? 1171 LEU A CG    1 
ATOM   1426 C  CD1   . LEU A 1 194 ? 27.798  12.018  41.909  1.00 40.54 ? 1171 LEU A CD1   1 
ATOM   1427 C  CD2   . LEU A 1 194 ? 27.230  14.309  41.126  1.00 40.93 ? 1171 LEU A CD2   1 
ATOM   1428 N  N     . PRO A 1 195 ? 27.198  16.182  45.654  1.00 42.80 ? 1172 PRO A N     1 
ATOM   1429 C  CA    . PRO A 1 195 ? 26.984  16.519  47.067  1.00 42.85 ? 1172 PRO A CA    1 
ATOM   1430 C  C     . PRO A 1 195 ? 26.753  15.237  47.877  1.00 43.65 ? 1172 PRO A C     1 
ATOM   1431 O  O     . PRO A 1 195 ? 25.684  15.009  48.446  1.00 43.35 ? 1172 PRO A O     1 
ATOM   1432 C  CB    . PRO A 1 195 ? 25.757  17.414  47.013  1.00 42.75 ? 1172 PRO A CB    1 
ATOM   1433 C  CG    . PRO A 1 195 ? 24.960  16.777  45.896  1.00 43.74 ? 1172 PRO A CG    1 
ATOM   1434 C  CD    . PRO A 1 195 ? 26.009  16.505  44.845  1.00 42.00 ? 1172 PRO A CD    1 
ATOM   1435 N  N     . VAL A 1 196 ? 27.787  14.408  47.903  1.00 43.57 ? 1173 VAL A N     1 
ATOM   1436 C  CA    . VAL A 1 196 ? 27.806  13.124  48.590  1.00 42.90 ? 1173 VAL A CA    1 
ATOM   1437 C  C     . VAL A 1 196 ? 27.130  13.013  49.963  1.00 41.60 ? 1173 VAL A C     1 
ATOM   1438 O  O     . VAL A 1 196 ? 26.356  12.084  50.205  1.00 42.38 ? 1173 VAL A O     1 
ATOM   1439 C  CB    . VAL A 1 196 ? 29.276  12.658  48.719  1.00 44.40 ? 1173 VAL A CB    1 
ATOM   1440 C  CG1   . VAL A 1 196 ? 29.400  11.538  49.732  1.00 45.94 ? 1173 VAL A CG1   1 
ATOM   1441 C  CG2   . VAL A 1 196 ? 29.780  12.208  47.361  1.00 44.49 ? 1173 VAL A CG2   1 
ATOM   1442 N  N     . ARG A 1 197 ? 27.421  13.942  50.864  1.00 39.70 ? 1174 ARG A N     1 
ATOM   1443 C  CA    . ARG A 1 197 ? 26.841  13.869  52.200  1.00 40.18 ? 1174 ARG A CA    1 
ATOM   1444 C  C     . ARG A 1 197 ? 25.316  13.961  52.219  1.00 38.95 ? 1174 ARG A C     1 
ATOM   1445 O  O     . ARG A 1 197 ? 24.681  13.636  53.229  1.00 38.97 ? 1174 ARG A O     1 
ATOM   1446 C  CB    . ARG A 1 197 ? 27.425  14.967  53.100  1.00 42.17 ? 1174 ARG A CB    1 
ATOM   1447 C  CG    . ARG A 1 197 ? 28.935  14.888  53.356  1.00 44.44 ? 1174 ARG A CG    1 
ATOM   1448 C  CD    . ARG A 1 197 ? 29.368  16.043  54.260  1.00 47.37 ? 1174 ARG A CD    1 
ATOM   1449 N  NE    . ARG A 1 197 ? 30.819  16.181  54.368  1.00 52.77 ? 1174 ARG A NE    1 
ATOM   1450 C  CZ    . ARG A 1 197 ? 31.634  15.281  54.918  1.00 55.72 ? 1174 ARG A CZ    1 
ATOM   1451 N  NH1   . ARG A 1 197 ? 31.157  14.151  55.425  1.00 58.37 ? 1174 ARG A NH1   1 
ATOM   1452 N  NH2   . ARG A 1 197 ? 32.939  15.513  54.969  1.00 58.07 ? 1174 ARG A NH2   1 
ATOM   1453 N  N     . TRP A 1 198 ? 24.728  14.400  51.108  1.00 37.31 ? 1175 TRP A N     1 
ATOM   1454 C  CA    . TRP A 1 198 ? 23.273  14.546  51.007  1.00 35.35 ? 1175 TRP A CA    1 
ATOM   1455 C  C     . TRP A 1 198 ? 22.661  13.527  50.078  1.00 35.63 ? 1175 TRP A C     1 
ATOM   1456 O  O     . TRP A 1 198 ? 21.443  13.504  49.898  1.00 33.20 ? 1175 TRP A O     1 
ATOM   1457 C  CB    . TRP A 1 198 ? 22.907  15.926  50.471  1.00 33.39 ? 1175 TRP A CB    1 
ATOM   1458 C  CG    . TRP A 1 198 ? 23.159  17.014  51.419  1.00 31.96 ? 1175 TRP A CG    1 
ATOM   1459 C  CD1   . TRP A 1 198 ? 22.237  17.657  52.178  1.00 31.12 ? 1175 TRP A CD1   1 
ATOM   1460 C  CD2   . TRP A 1 198 ? 24.430  17.599  51.732  1.00 32.37 ? 1175 TRP A CD2   1 
ATOM   1461 N  NE1   . TRP A 1 198 ? 22.851  18.613  52.954  1.00 32.61 ? 1175 TRP A NE1   1 
ATOM   1462 C  CE2   . TRP A 1 198 ? 24.199  18.596  52.704  1.00 31.60 ? 1175 TRP A CE2   1 
ATOM   1463 C  CE3   . TRP A 1 198 ? 25.748  17.368  51.290  1.00 32.77 ? 1175 TRP A CE3   1 
ATOM   1464 C  CZ2   . TRP A 1 198 ? 25.238  19.384  53.242  1.00 31.08 ? 1175 TRP A CZ2   1 
ATOM   1465 C  CZ3   . TRP A 1 198 ? 26.783  18.150  51.823  1.00 32.92 ? 1175 TRP A CZ3   1 
ATOM   1466 C  CH2   . TRP A 1 198 ? 26.519  19.142  52.796  1.00 30.99 ? 1175 TRP A CH2   1 
ATOM   1467 N  N     . MET A 1 199 ? 23.506  12.690  49.486  1.00 35.58 ? 1176 MET A N     1 
ATOM   1468 C  CA    . MET A 1 199 ? 23.041  11.702  48.533  1.00 37.58 ? 1176 MET A CA    1 
ATOM   1469 C  C     . MET A 1 199 ? 22.519  10.397  49.099  1.00 39.16 ? 1176 MET A C     1 
ATOM   1470 O  O     . MET A 1 199 ? 23.014  9.884   50.107  1.00 39.53 ? 1176 MET A O     1 
ATOM   1471 C  CB    . MET A 1 199 ? 24.154  11.409  47.523  1.00 39.49 ? 1176 MET A CB    1 
ATOM   1472 C  CG    . MET A 1 199 ? 24.300  12.492  46.466  1.00 41.03 ? 1176 MET A CG    1 
ATOM   1473 S  SD    . MET A 1 199 ? 25.804  12.358  45.502  1.00 43.37 ? 1176 MET A SD    1 
ATOM   1474 C  CE    . MET A 1 199 ? 25.510  10.887  44.565  1.00 39.43 ? 1176 MET A CE    1 
ATOM   1475 N  N     . ALA A 1 200 ? 21.504  9.862   48.431  1.00 40.66 ? 1177 ALA A N     1 
ATOM   1476 C  CA    . ALA A 1 200 ? 20.916  8.599   48.832  1.00 41.56 ? 1177 ALA A CA    1 
ATOM   1477 C  C     . ALA A 1 200 ? 21.872  7.491   48.411  1.00 42.52 ? 1177 ALA A C     1 
ATOM   1478 O  O     . ALA A 1 200 ? 22.757  7.700   47.570  1.00 42.30 ? 1177 ALA A O     1 
ATOM   1479 C  CB    . ALA A 1 200 ? 19.556  8.415   48.160  1.00 41.88 ? 1177 ALA A CB    1 
ATOM   1480 N  N     . PRO A 1 201 ? 21.715  6.299   49.001  1.00 43.81 ? 1178 PRO A N     1 
ATOM   1481 C  CA    . PRO A 1 201 ? 22.583  5.162   48.672  1.00 43.66 ? 1178 PRO A CA    1 
ATOM   1482 C  C     . PRO A 1 201 ? 22.575  4.775   47.192  1.00 42.56 ? 1178 PRO A C     1 
ATOM   1483 O  O     . PRO A 1 201 ? 23.636  4.664   46.576  1.00 41.84 ? 1178 PRO A O     1 
ATOM   1484 C  CB    . PRO A 1 201 ? 22.081  4.050   49.607  1.00 45.02 ? 1178 PRO A CB    1 
ATOM   1485 C  CG    . PRO A 1 201 ? 20.675  4.479   49.975  1.00 47.30 ? 1178 PRO A CG    1 
ATOM   1486 C  CD    . PRO A 1 201 ? 20.793  5.968   50.102  1.00 45.67 ? 1178 PRO A CD    1 
ATOM   1487 N  N     . GLU A 1 202 ? 21.391  4.581   46.616  1.00 41.66 ? 1179 GLU A N     1 
ATOM   1488 C  CA    . GLU A 1 202 ? 21.304  4.205   45.211  1.00 42.76 ? 1179 GLU A CA    1 
ATOM   1489 C  C     . GLU A 1 202 ? 21.955  5.230   44.286  1.00 44.14 ? 1179 GLU A C     1 
ATOM   1490 O  O     . GLU A 1 202 ? 22.410  4.887   43.204  1.00 46.59 ? 1179 GLU A O     1 
ATOM   1491 C  CB    . GLU A 1 202 ? 19.850  3.994   44.794  1.00 43.07 ? 1179 GLU A CB    1 
ATOM   1492 C  CG    . GLU A 1 202 ? 18.987  5.241   44.835  1.00 46.88 ? 1179 GLU A CG    1 
ATOM   1493 C  CD    . GLU A 1 202 ? 18.346  5.492   46.188  1.00 47.29 ? 1179 GLU A CD    1 
ATOM   1494 O  OE1   . GLU A 1 202 ? 18.809  4.903   47.199  1.00 48.24 ? 1179 GLU A OE1   1 
ATOM   1495 O  OE2   . GLU A 1 202 ? 17.386  6.298   46.229  1.00 45.42 ? 1179 GLU A OE2   1 
ATOM   1496 N  N     . SER A 1 203 ? 22.001  6.489   44.704  1.00 44.37 ? 1180 SER A N     1 
ATOM   1497 C  CA    . SER A 1 203 ? 22.618  7.510   43.874  1.00 44.80 ? 1180 SER A CA    1 
ATOM   1498 C  C     . SER A 1 203 ? 24.133  7.378   43.941  1.00 44.44 ? 1180 SER A C     1 
ATOM   1499 O  O     . SER A 1 203 ? 24.822  7.536   42.939  1.00 45.07 ? 1180 SER A O     1 
ATOM   1500 C  CB    . SER A 1 203 ? 22.189  8.903   44.335  1.00 45.80 ? 1180 SER A CB    1 
ATOM   1501 O  OG    . SER A 1 203 ? 20.777  9.019   44.317  1.00 48.36 ? 1180 SER A OG    1 
ATOM   1502 N  N     . LEU A 1 204 ? 24.652  7.090   45.126  1.00 44.60 ? 1181 LEU A N     1 
ATOM   1503 C  CA    . LEU A 1 204 ? 26.091  6.929   45.298  1.00 44.61 ? 1181 LEU A CA    1 
ATOM   1504 C  C     . LEU A 1 204 ? 26.566  5.685   44.554  1.00 45.76 ? 1181 LEU A C     1 
ATOM   1505 O  O     . LEU A 1 204 ? 27.638  5.670   43.946  1.00 45.55 ? 1181 LEU A O     1 
ATOM   1506 C  CB    . LEU A 1 204 ? 26.432  6.785   46.777  1.00 43.44 ? 1181 LEU A CB    1 
ATOM   1507 C  CG    . LEU A 1 204 ? 26.116  7.951   47.718  1.00 44.05 ? 1181 LEU A CG    1 
ATOM   1508 C  CD1   . LEU A 1 204 ? 26.454  7.548   49.151  1.00 41.86 ? 1181 LEU A CD1   1 
ATOM   1509 C  CD2   . LEU A 1 204 ? 26.909  9.179   47.316  1.00 43.13 ? 1181 LEU A CD2   1 
ATOM   1510 N  N     . LYS A 1 205 ? 25.750  4.642   44.604  1.00 46.82 ? 1182 LYS A N     1 
ATOM   1511 C  CA    . LYS A 1 205 ? 26.082  3.382   43.963  1.00 49.80 ? 1182 LYS A CA    1 
ATOM   1512 C  C     . LYS A 1 205 ? 25.880  3.367   42.454  1.00 50.27 ? 1182 LYS A C     1 
ATOM   1513 O  O     . LYS A 1 205 ? 26.811  3.063   41.703  1.00 51.33 ? 1182 LYS A O     1 
ATOM   1514 C  CB    . LYS A 1 205 ? 25.259  2.255   44.606  1.00 51.59 ? 1182 LYS A CB    1 
ATOM   1515 C  CG    . LYS A 1 205 ? 25.281  0.913   43.883  1.00 53.29 ? 1182 LYS A CG    1 
ATOM   1516 C  CD    . LYS A 1 205 ? 24.246  -0.031  44.507  1.00 54.91 ? 1182 LYS A CD    1 
ATOM   1517 C  CE    . LYS A 1 205 ? 23.804  -1.116  43.542  1.00 56.16 ? 1182 LYS A CE    1 
ATOM   1518 N  NZ    . LYS A 1 205 ? 24.950  -1.974  43.117  1.00 59.98 ? 1182 LYS A NZ    1 
ATOM   1519 N  N     . ASP A 1 206 ? 24.672  3.695   42.011  1.00 49.59 ? 1183 ASP A N     1 
ATOM   1520 C  CA    . ASP A 1 206 ? 24.356  3.664   40.588  1.00 49.83 ? 1183 ASP A CA    1 
ATOM   1521 C  C     . ASP A 1 206 ? 24.281  4.991   39.848  1.00 48.00 ? 1183 ASP A C     1 
ATOM   1522 O  O     . ASP A 1 206 ? 24.157  5.007   38.630  1.00 48.10 ? 1183 ASP A O     1 
ATOM   1523 C  CB    . ASP A 1 206 ? 23.055  2.911   40.389  1.00 53.00 ? 1183 ASP A CB    1 
ATOM   1524 C  CG    . ASP A 1 206 ? 23.093  1.543   41.014  1.00 56.21 ? 1183 ASP A CG    1 
ATOM   1525 O  OD1   . ASP A 1 206 ? 23.983  0.747   40.638  1.00 59.59 ? 1183 ASP A OD1   1 
ATOM   1526 O  OD2   . ASP A 1 206 ? 22.240  1.266   41.882  1.00 57.37 ? 1183 ASP A OD2   1 
ATOM   1527 N  N     . GLY A 1 207 ? 24.359  6.100   40.573  1.00 46.61 ? 1184 GLY A N     1 
ATOM   1528 C  CA    . GLY A 1 207 ? 24.290  7.398   39.926  1.00 43.91 ? 1184 GLY A CA    1 
ATOM   1529 C  C     . GLY A 1 207 ? 22.878  7.693   39.453  1.00 43.13 ? 1184 GLY A C     1 
ATOM   1530 O  O     . GLY A 1 207 ? 22.671  8.473   38.524  1.00 43.97 ? 1184 GLY A O     1 
ATOM   1531 N  N     . VAL A 1 208 ? 21.899  7.068   40.096  1.00 41.24 ? 1185 VAL A N     1 
ATOM   1532 C  CA    . VAL A 1 208 ? 20.501  7.263   39.739  1.00 40.70 ? 1185 VAL A CA    1 
ATOM   1533 C  C     . VAL A 1 208 ? 19.817  8.232   40.709  1.00 40.28 ? 1185 VAL A C     1 
ATOM   1534 O  O     . VAL A 1 208 ? 19.878  8.051   41.933  1.00 39.78 ? 1185 VAL A O     1 
ATOM   1535 C  CB    . VAL A 1 208 ? 19.738  5.900   39.757  1.00 40.85 ? 1185 VAL A CB    1 
ATOM   1536 C  CG1   . VAL A 1 208 ? 18.254  6.117   39.570  1.00 40.43 ? 1185 VAL A CG1   1 
ATOM   1537 C  CG2   . VAL A 1 208 ? 20.259  4.995   38.644  1.00 42.03 ? 1185 VAL A CG2   1 
ATOM   1538 N  N     . PHE A 1 209 ? 19.164  9.257   40.158  1.00 38.69 ? 1186 PHE A N     1 
ATOM   1539 C  CA    . PHE A 1 209 ? 18.471  10.251  40.974  1.00 35.11 ? 1186 PHE A CA    1 
ATOM   1540 C  C     . PHE A 1 209 ? 16.992  10.266  40.650  1.00 33.36 ? 1186 PHE A C     1 
ATOM   1541 O  O     . PHE A 1 209 ? 16.587  10.192  39.489  1.00 35.17 ? 1186 PHE A O     1 
ATOM   1542 C  CB    . PHE A 1 209 ? 19.084  11.635  40.752  1.00 32.90 ? 1186 PHE A CB    1 
ATOM   1543 C  CG    . PHE A 1 209 ? 20.586  11.662  40.921  1.00 32.67 ? 1186 PHE A CG    1 
ATOM   1544 C  CD1   . PHE A 1 209 ? 21.417  10.994  40.019  1.00 32.86 ? 1186 PHE A CD1   1 
ATOM   1545 C  CD2   . PHE A 1 209 ? 21.169  12.361  41.971  1.00 30.84 ? 1186 PHE A CD2   1 
ATOM   1546 C  CE1   . PHE A 1 209 ? 22.806  11.026  40.158  1.00 32.51 ? 1186 PHE A CE1   1 
ATOM   1547 C  CE2   . PHE A 1 209 ? 22.544  12.402  42.121  1.00 32.62 ? 1186 PHE A CE2   1 
ATOM   1548 C  CZ    . PHE A 1 209 ? 23.374  11.726  41.203  1.00 32.66 ? 1186 PHE A CZ    1 
ATOM   1549 N  N     . THR A 1 210 ? 16.185  10.357  41.691  1.00 31.10 ? 1187 THR A N     1 
ATOM   1550 C  CA    . THR A 1 210 ? 14.743  10.362  41.536  1.00 31.46 ? 1187 THR A CA    1 
ATOM   1551 C  C     . THR A 1 210 ? 14.155  11.283  42.592  1.00 31.65 ? 1187 THR A C     1 
ATOM   1552 O  O     . THR A 1 210 ? 14.886  11.882  43.382  1.00 30.52 ? 1187 THR A O     1 
ATOM   1553 C  CB    . THR A 1 210 ? 14.156  8.971   41.784  1.00 32.14 ? 1187 THR A CB    1 
ATOM   1554 O  OG1   . THR A 1 210 ? 14.524  8.550   43.102  1.00 35.11 ? 1187 THR A OG1   1 
ATOM   1555 C  CG2   . THR A 1 210 ? 14.674  7.974   40.773  1.00 27.49 ? 1187 THR A CG2   1 
ATOM   1556 N  N     . THR A 1 211 ? 12.837  11.402  42.611  1.00 31.90 ? 1188 THR A N     1 
ATOM   1557 C  CA    . THR A 1 211 ? 12.255  12.244  43.624  1.00 34.98 ? 1188 THR A CA    1 
ATOM   1558 C  C     . THR A 1 211 ? 12.572  11.582  44.973  1.00 35.60 ? 1188 THR A C     1 
ATOM   1559 O  O     . THR A 1 211 ? 12.661  12.255  46.001  1.00 36.48 ? 1188 THR A O     1 
ATOM   1560 C  CB    . THR A 1 211 ? 10.745  12.417  43.427  1.00 35.58 ? 1188 THR A CB    1 
ATOM   1561 O  OG1   . THR A 1 211 ? 10.236  13.236  44.489  1.00 40.12 ? 1188 THR A OG1   1 
ATOM   1562 C  CG2   . THR A 1 211 ? 10.041  11.080  43.410  1.00 35.40 ? 1188 THR A CG2   1 
ATOM   1563 N  N     . SER A 1 212 ? 12.766  10.262  44.962  1.00 35.49 ? 1189 SER A N     1 
ATOM   1564 C  CA    . SER A 1 212 ? 13.097  9.537   46.197  1.00 34.75 ? 1189 SER A CA    1 
ATOM   1565 C  C     . SER A 1 212 ? 14.482  9.891   46.730  1.00 32.76 ? 1189 SER A C     1 
ATOM   1566 O  O     . SER A 1 212 ? 14.675  9.977   47.940  1.00 32.74 ? 1189 SER A O     1 
ATOM   1567 C  CB    . SER A 1 212 ? 12.995  8.024   45.990  1.00 35.02 ? 1189 SER A CB    1 
ATOM   1568 O  OG    . SER A 1 212 ? 11.632  7.637   45.899  1.00 37.18 ? 1189 SER A OG    1 
ATOM   1569 N  N     . SER A 1 213 ? 15.449  10.093  45.842  1.00 31.90 ? 1190 SER A N     1 
ATOM   1570 C  CA    . SER A 1 213 ? 16.774  10.479  46.306  1.00 30.95 ? 1190 SER A CA    1 
ATOM   1571 C  C     . SER A 1 213 ? 16.675  11.922  46.845  1.00 29.73 ? 1190 SER A C     1 
ATOM   1572 O  O     . SER A 1 213 ? 17.357  12.268  47.800  1.00 28.62 ? 1190 SER A O     1 
ATOM   1573 C  CB    . SER A 1 213 ? 17.813  10.355  45.177  1.00 29.40 ? 1190 SER A CB    1 
ATOM   1574 O  OG    . SER A 1 213 ? 17.429  11.066  44.017  1.00 32.13 ? 1190 SER A OG    1 
ATOM   1575 N  N     . ASP A 1 214 ? 15.824  12.757  46.239  1.00 29.52 ? 1191 ASP A N     1 
ATOM   1576 C  CA    . ASP A 1 214 ? 15.627  14.129  46.737  1.00 32.66 ? 1191 ASP A CA    1 
ATOM   1577 C  C     . ASP A 1 214 ? 15.057  14.065  48.168  1.00 33.96 ? 1191 ASP A C     1 
ATOM   1578 O  O     . ASP A 1 214 ? 15.385  14.893  49.024  1.00 34.48 ? 1191 ASP A O     1 
ATOM   1579 C  CB    . ASP A 1 214 ? 14.614  14.919  45.884  1.00 31.14 ? 1191 ASP A CB    1 
ATOM   1580 C  CG    . ASP A 1 214 ? 15.242  15.592  44.665  1.00 32.19 ? 1191 ASP A CG    1 
ATOM   1581 O  OD1   . ASP A 1 214 ? 16.462  15.868  44.666  1.00 32.71 ? 1191 ASP A OD1   1 
ATOM   1582 O  OD2   . ASP A 1 214 ? 14.494  15.864  43.702  1.00 31.80 ? 1191 ASP A OD2   1 
ATOM   1583 N  N     . MET A 1 215 ? 14.192  13.082  48.407  1.00 32.99 ? 1192 MET A N     1 
ATOM   1584 C  CA    . MET A 1 215 ? 13.578  12.901  49.713  1.00 34.23 ? 1192 MET A CA    1 
ATOM   1585 C  C     . MET A 1 215 ? 14.625  12.556  50.765  1.00 34.82 ? 1192 MET A C     1 
ATOM   1586 O  O     . MET A 1 215 ? 14.521  12.969  51.921  1.00 34.54 ? 1192 MET A O     1 
ATOM   1587 C  CB    . MET A 1 215 ? 12.535  11.791  49.647  1.00 35.40 ? 1192 MET A CB    1 
ATOM   1588 C  CG    . MET A 1 215 ? 11.855  11.518  50.977  1.00 35.01 ? 1192 MET A CG    1 
ATOM   1589 S  SD    . MET A 1 215 ? 11.061  12.971  51.699  1.00 36.99 ? 1192 MET A SD    1 
ATOM   1590 C  CE    . MET A 1 215 ? 9.809   13.352  50.468  1.00 32.00 ? 1192 MET A CE    1 
ATOM   1591 N  N     . TRP A 1 216 ? 15.631  11.788  50.366  1.00 34.32 ? 1193 TRP A N     1 
ATOM   1592 C  CA    . TRP A 1 216 ? 16.705  11.429  51.280  1.00 34.55 ? 1193 TRP A CA    1 
ATOM   1593 C  C     . TRP A 1 216 ? 17.411  12.723  51.652  1.00 35.19 ? 1193 TRP A C     1 
ATOM   1594 O  O     . TRP A 1 216 ? 17.691  12.976  52.832  1.00 35.44 ? 1193 TRP A O     1 
ATOM   1595 C  CB    . TRP A 1 216 ? 17.689  10.466  50.602  1.00 35.33 ? 1193 TRP A CB    1 
ATOM   1596 C  CG    . TRP A 1 216 ? 18.933  10.207  51.384  1.00 35.51 ? 1193 TRP A CG    1 
ATOM   1597 C  CD1   . TRP A 1 216 ? 19.984  11.058  51.563  1.00 35.08 ? 1193 TRP A CD1   1 
ATOM   1598 C  CD2   . TRP A 1 216 ? 19.258  9.015   52.106  1.00 36.73 ? 1193 TRP A CD2   1 
ATOM   1599 N  NE1   . TRP A 1 216 ? 20.945  10.472  52.349  1.00 34.24 ? 1193 TRP A NE1   1 
ATOM   1600 C  CE2   . TRP A 1 216 ? 20.524  9.216   52.698  1.00 35.83 ? 1193 TRP A CE2   1 
ATOM   1601 C  CE3   . TRP A 1 216 ? 18.600  7.791   52.312  1.00 38.26 ? 1193 TRP A CE3   1 
ATOM   1602 C  CZ2   . TRP A 1 216 ? 21.147  8.240   53.482  1.00 35.05 ? 1193 TRP A CZ2   1 
ATOM   1603 C  CZ3   . TRP A 1 216 ? 19.223  6.821   53.093  1.00 35.80 ? 1193 TRP A CZ3   1 
ATOM   1604 C  CH2   . TRP A 1 216 ? 20.483  7.055   53.666  1.00 34.64 ? 1193 TRP A CH2   1 
ATOM   1605 N  N     . SER A 1 217 ? 17.703  13.541  50.642  1.00 33.40 ? 1194 SER A N     1 
ATOM   1606 C  CA    . SER A 1 217 ? 18.362  14.817  50.881  1.00 34.98 ? 1194 SER A CA    1 
ATOM   1607 C  C     . SER A 1 217 ? 17.525  15.672  51.834  1.00 34.65 ? 1194 SER A C     1 
ATOM   1608 O  O     . SER A 1 217 ? 18.061  16.368  52.700  1.00 35.41 ? 1194 SER A O     1 
ATOM   1609 C  CB    . SER A 1 217 ? 18.579  15.545  49.558  1.00 36.72 ? 1194 SER A CB    1 
ATOM   1610 O  OG    . SER A 1 217 ? 19.426  14.783  48.713  1.00 40.06 ? 1194 SER A OG    1 
ATOM   1611 N  N     . PHE A 1 218 ? 16.207  15.609  51.668  1.00 34.67 ? 1195 PHE A N     1 
ATOM   1612 C  CA    . PHE A 1 218 ? 15.277  16.352  52.514  1.00 35.49 ? 1195 PHE A CA    1 
ATOM   1613 C  C     . PHE A 1 218 ? 15.462  15.934  53.976  1.00 36.27 ? 1195 PHE A C     1 
ATOM   1614 O  O     . PHE A 1 218 ? 15.467  16.774  54.891  1.00 34.87 ? 1195 PHE A O     1 
ATOM   1615 C  CB    . PHE A 1 218 ? 13.841  16.060  52.089  1.00 36.28 ? 1195 PHE A CB    1 
ATOM   1616 C  CG    . PHE A 1 218 ? 12.810  16.745  52.930  1.00 36.25 ? 1195 PHE A CG    1 
ATOM   1617 C  CD1   . PHE A 1 218 ? 12.587  18.114  52.800  1.00 36.18 ? 1195 PHE A CD1   1 
ATOM   1618 C  CD2   . PHE A 1 218 ? 12.060  16.025  53.857  1.00 36.01 ? 1195 PHE A CD2   1 
ATOM   1619 C  CE1   . PHE A 1 218 ? 11.628  18.756  53.586  1.00 36.92 ? 1195 PHE A CE1   1 
ATOM   1620 C  CE2   . PHE A 1 218 ? 11.098  16.656  54.649  1.00 34.44 ? 1195 PHE A CE2   1 
ATOM   1621 C  CZ    . PHE A 1 218 ? 10.880  18.024  54.513  1.00 36.49 ? 1195 PHE A CZ    1 
ATOM   1622 N  N     . GLY A 1 219 ? 15.608  14.629  54.188  1.00 35.19 ? 1196 GLY A N     1 
ATOM   1623 C  CA    . GLY A 1 219 ? 15.810  14.138  55.534  1.00 35.40 ? 1196 GLY A CA    1 
ATOM   1624 C  C     . GLY A 1 219 ? 17.066  14.755  56.111  1.00 35.13 ? 1196 GLY A C     1 
ATOM   1625 O  O     . GLY A 1 219 ? 17.114  15.124  57.289  1.00 36.46 ? 1196 GLY A O     1 
ATOM   1626 N  N     . VAL A 1 220 ? 18.085  14.886  55.270  1.00 34.47 ? 1197 VAL A N     1 
ATOM   1627 C  CA    . VAL A 1 220 ? 19.359  15.446  55.697  1.00 32.76 ? 1197 VAL A CA    1 
ATOM   1628 C  C     . VAL A 1 220 ? 19.212  16.923  56.015  1.00 34.33 ? 1197 VAL A C     1 
ATOM   1629 O  O     . VAL A 1 220 ? 19.901  17.450  56.901  1.00 34.67 ? 1197 VAL A O     1 
ATOM   1630 C  CB    . VAL A 1 220 ? 20.421  15.229  54.614  1.00 31.92 ? 1197 VAL A CB    1 
ATOM   1631 C  CG1   . VAL A 1 220 ? 21.752  15.710  55.083  1.00 29.91 ? 1197 VAL A CG1   1 
ATOM   1632 C  CG2   . VAL A 1 220 ? 20.495  13.747  54.272  1.00 32.78 ? 1197 VAL A CG2   1 
ATOM   1633 N  N     . VAL A 1 221 ? 18.313  17.599  55.302  1.00 34.30 ? 1198 VAL A N     1 
ATOM   1634 C  CA    . VAL A 1 221 ? 18.106  19.014  55.578  1.00 35.85 ? 1198 VAL A CA    1 
ATOM   1635 C  C     . VAL A 1 221 ? 17.450  19.157  56.950  1.00 35.75 ? 1198 VAL A C     1 
ATOM   1636 O  O     . VAL A 1 221 ? 17.812  20.035  57.726  1.00 36.14 ? 1198 VAL A O     1 
ATOM   1637 C  CB    . VAL A 1 221 ? 17.221  19.691  54.512  1.00 35.34 ? 1198 VAL A CB    1 
ATOM   1638 C  CG1   . VAL A 1 221 ? 16.979  21.123  54.890  1.00 35.00 ? 1198 VAL A CG1   1 
ATOM   1639 C  CG2   . VAL A 1 221 ? 17.902  19.643  53.161  1.00 34.77 ? 1198 VAL A CG2   1 
ATOM   1640 N  N     . LEU A 1 222 ? 16.485  18.289  57.242  1.00 37.22 ? 1199 LEU A N     1 
ATOM   1641 C  CA    . LEU A 1 222 ? 15.794  18.313  58.522  1.00 38.43 ? 1199 LEU A CA    1 
ATOM   1642 C  C     . LEU A 1 222 ? 16.835  18.200  59.626  1.00 39.43 ? 1199 LEU A C     1 
ATOM   1643 O  O     . LEU A 1 222 ? 16.793  18.910  60.634  1.00 38.63 ? 1199 LEU A O     1 
ATOM   1644 C  CB    . LEU A 1 222 ? 14.830  17.135  58.622  1.00 39.88 ? 1199 LEU A CB    1 
ATOM   1645 C  CG    . LEU A 1 222 ? 13.639  17.125  57.662  1.00 41.12 ? 1199 LEU A CG    1 
ATOM   1646 C  CD1   . LEU A 1 222 ? 12.793  15.876  57.882  1.00 39.80 ? 1199 LEU A CD1   1 
ATOM   1647 C  CD2   . LEU A 1 222 ? 12.804  18.367  57.897  1.00 41.70 ? 1199 LEU A CD2   1 
ATOM   1648 N  N     . TRP A 1 223 ? 17.770  17.288  59.418  1.00 40.11 ? 1200 TRP A N     1 
ATOM   1649 C  CA    . TRP A 1 223 ? 18.840  17.072  60.367  1.00 41.46 ? 1200 TRP A CA    1 
ATOM   1650 C  C     . TRP A 1 223 ? 19.652  18.367  60.451  1.00 42.02 ? 1200 TRP A C     1 
ATOM   1651 O  O     . TRP A 1 223 ? 20.058  18.799  61.531  1.00 42.21 ? 1200 TRP A O     1 
ATOM   1652 C  CB    . TRP A 1 223 ? 19.721  15.924  59.884  1.00 42.42 ? 1200 TRP A CB    1 
ATOM   1653 C  CG    . TRP A 1 223 ? 20.876  15.625  60.778  1.00 45.40 ? 1200 TRP A CG    1 
ATOM   1654 C  CD1   . TRP A 1 223 ? 20.932  14.667  61.750  1.00 46.45 ? 1200 TRP A CD1   1 
ATOM   1655 C  CD2   . TRP A 1 223 ? 22.158  16.267  60.772  1.00 45.71 ? 1200 TRP A CD2   1 
ATOM   1656 N  NE1   . TRP A 1 223 ? 22.169  14.669  62.345  1.00 46.28 ? 1200 TRP A NE1   1 
ATOM   1657 C  CE2   . TRP A 1 223 ? 22.941  15.643  61.768  1.00 46.94 ? 1200 TRP A CE2   1 
ATOM   1658 C  CE3   . TRP A 1 223 ? 22.719  17.311  60.028  1.00 46.95 ? 1200 TRP A CE3   1 
ATOM   1659 C  CZ2   . TRP A 1 223 ? 24.266  16.022  62.032  1.00 46.67 ? 1200 TRP A CZ2   1 
ATOM   1660 C  CZ3   . TRP A 1 223 ? 24.036  17.691  60.292  1.00 47.62 ? 1200 TRP A CZ3   1 
ATOM   1661 C  CH2   . TRP A 1 223 ? 24.792  17.046  61.290  1.00 48.64 ? 1200 TRP A CH2   1 
ATOM   1662 N  N     . GLU A 1 224 ? 19.891  18.989  59.304  1.00 42.17 ? 1201 GLU A N     1 
ATOM   1663 C  CA    . GLU A 1 224 ? 20.645  20.227  59.302  1.00 42.58 ? 1201 GLU A CA    1 
ATOM   1664 C  C     . GLU A 1 224 ? 19.917  21.234  60.183  1.00 41.91 ? 1201 GLU A C     1 
ATOM   1665 O  O     . GLU A 1 224 ? 20.516  21.905  61.024  1.00 42.05 ? 1201 GLU A O     1 
ATOM   1666 C  CB    . GLU A 1 224 ? 20.789  20.763  57.871  1.00 43.38 ? 1201 GLU A CB    1 
ATOM   1667 C  CG    . GLU A 1 224 ? 21.882  20.060  57.070  1.00 44.18 ? 1201 GLU A CG    1 
ATOM   1668 C  CD    . GLU A 1 224 ? 22.154  20.704  55.704  1.00 44.48 ? 1201 GLU A CD    1 
ATOM   1669 O  OE1   . GLU A 1 224 ? 21.382  20.438  54.755  1.00 44.11 ? 1201 GLU A OE1   1 
ATOM   1670 O  OE2   . GLU A 1 224 ? 23.141  21.472  55.586  1.00 40.82 ? 1201 GLU A OE2   1 
ATOM   1671 N  N     . ILE A 1 225 ? 18.614  21.327  59.984  1.00 41.69 ? 1202 ILE A N     1 
ATOM   1672 C  CA    . ILE A 1 225 ? 17.808  22.249  60.750  1.00 43.92 ? 1202 ILE A CA    1 
ATOM   1673 C  C     . ILE A 1 225 ? 17.878  21.988  62.257  1.00 44.28 ? 1202 ILE A C     1 
ATOM   1674 O  O     . ILE A 1 225 ? 18.152  22.900  63.038  1.00 43.49 ? 1202 ILE A O     1 
ATOM   1675 C  CB    . ILE A 1 225 ? 16.343  22.188  60.284  1.00 43.83 ? 1202 ILE A CB    1 
ATOM   1676 C  CG1   . ILE A 1 225 ? 16.202  22.939  58.969  1.00 42.56 ? 1202 ILE A CG1   1 
ATOM   1677 C  CG2   . ILE A 1 225 ? 15.423  22.819  61.323  1.00 45.71 ? 1202 ILE A CG2   1 
ATOM   1678 C  CD1   . ILE A 1 225 ? 14.793  22.939  58.430  1.00 45.24 ? 1202 ILE A CD1   1 
ATOM   1679 N  N     . THR A 1 226 ? 17.633  20.745  62.659  1.00 44.12 ? 1203 THR A N     1 
ATOM   1680 C  CA    . THR A 1 226 ? 17.646  20.389  64.071  1.00 45.09 ? 1203 THR A CA    1 
ATOM   1681 C  C     . THR A 1 226 ? 19.027  20.312  64.711  1.00 45.96 ? 1203 THR A C     1 
ATOM   1682 O  O     . THR A 1 226 ? 19.134  20.034  65.904  1.00 47.68 ? 1203 THR A O     1 
ATOM   1683 C  CB    . THR A 1 226 ? 16.937  19.051  64.300  1.00 46.30 ? 1203 THR A CB    1 
ATOM   1684 O  OG1   . THR A 1 226 ? 17.545  18.055  63.471  1.00 47.38 ? 1203 THR A OG1   1 
ATOM   1685 C  CG2   . THR A 1 226 ? 15.446  19.165  63.962  1.00 46.00 ? 1203 THR A CG2   1 
ATOM   1686 N  N     . SER A 1 227 ? 20.083  20.550  63.942  1.00 46.07 ? 1204 SER A N     1 
ATOM   1687 C  CA    . SER A 1 227 ? 21.432  20.504  64.500  1.00 46.23 ? 1204 SER A CA    1 
ATOM   1688 C  C     . SER A 1 227 ? 22.084  21.843  64.245  1.00 47.88 ? 1204 SER A C     1 
ATOM   1689 O  O     . SER A 1 227 ? 23.274  22.033  64.490  1.00 47.21 ? 1204 SER A O     1 
ATOM   1690 C  CB    . SER A 1 227 ? 22.255  19.415  63.829  1.00 47.15 ? 1204 SER A CB    1 
ATOM   1691 O  OG    . SER A 1 227 ? 22.511  19.757  62.476  1.00 49.94 ? 1204 SER A OG    1 
ATOM   1692 N  N     . LEU A 1 228 ? 21.277  22.770  63.741  1.00 50.32 ? 1205 LEU A N     1 
ATOM   1693 C  CA    . LEU A 1 228 ? 21.723  24.115  63.409  1.00 51.12 ? 1205 LEU A CA    1 
ATOM   1694 C  C     . LEU A 1 228 ? 22.896  24.114  62.436  1.00 52.01 ? 1205 LEU A C     1 
ATOM   1695 O  O     . LEU A 1 228 ? 23.959  24.677  62.698  1.00 52.27 ? 1205 LEU A O     1 
ATOM   1696 C  CB    . LEU A 1 228 ? 22.049  24.897  64.681  1.00 52.28 ? 1205 LEU A CB    1 
ATOM   1697 C  CG    . LEU A 1 228 ? 20.870  25.034  65.666  1.00 53.28 ? 1205 LEU A CG    1 
ATOM   1698 C  CD1   . LEU A 1 228 ? 21.121  26.231  66.577  1.00 54.82 ? 1205 LEU A CD1   1 
ATOM   1699 C  CD2   . LEU A 1 228 ? 19.549  25.229  64.921  1.00 52.03 ? 1205 LEU A CD2   1 
ATOM   1700 N  N     . ALA A 1 229 ? 22.673  23.463  61.299  1.00 53.22 ? 1206 ALA A N     1 
ATOM   1701 C  CA    . ALA A 1 229 ? 23.654  23.389  60.229  1.00 55.49 ? 1206 ALA A CA    1 
ATOM   1702 C  C     . ALA A 1 229 ? 24.983  22.787  60.646  1.00 57.15 ? 1206 ALA A C     1 
ATOM   1703 O  O     . ALA A 1 229 ? 26.051  23.274  60.269  1.00 56.24 ? 1206 ALA A O     1 
ATOM   1704 C  CB    . ALA A 1 229 ? 23.875  24.780  59.632  1.00 56.31 ? 1206 ALA A CB    1 
ATOM   1705 N  N     . GLU A 1 230 ? 24.924  21.727  61.431  1.00 59.11 ? 1207 GLU A N     1 
ATOM   1706 C  CA    . GLU A 1 230 ? 26.151  21.077  61.823  1.00 61.81 ? 1207 GLU A CA    1 
ATOM   1707 C  C     . GLU A 1 230 ? 26.585  20.356  60.550  1.00 61.94 ? 1207 GLU A C     1 
ATOM   1708 O  O     . GLU A 1 230 ? 25.742  20.028  59.716  1.00 62.09 ? 1207 GLU A O     1 
ATOM   1709 C  CB    . GLU A 1 230 ? 25.867  20.089  62.941  1.00 65.45 ? 1207 GLU A CB    1 
ATOM   1710 C  CG    . GLU A 1 230 ? 27.101  19.525  63.574  1.00 70.69 ? 1207 GLU A CG    1 
ATOM   1711 C  CD    . GLU A 1 230 ? 26.771  18.673  64.773  1.00 74.23 ? 1207 GLU A CD    1 
ATOM   1712 O  OE1   . GLU A 1 230 ? 26.083  17.640  64.597  1.00 75.01 ? 1207 GLU A OE1   1 
ATOM   1713 O  OE2   . GLU A 1 230 ? 27.197  19.043  65.891  1.00 76.90 ? 1207 GLU A OE2   1 
ATOM   1714 N  N     . GLN A 1 231 ? 27.880  20.117  60.375  1.00 62.83 ? 1208 GLN A N     1 
ATOM   1715 C  CA    . GLN A 1 231 ? 28.321  19.416  59.175  1.00 62.79 ? 1208 GLN A CA    1 
ATOM   1716 C  C     . GLN A 1 231 ? 27.972  17.932  59.257  1.00 61.74 ? 1208 GLN A C     1 
ATOM   1717 O  O     . GLN A 1 231 ? 28.408  17.225  60.165  1.00 61.51 ? 1208 GLN A O     1 
ATOM   1718 C  CB    . GLN A 1 231 ? 29.823  19.558  58.942  1.00 65.29 ? 1208 GLN A CB    1 
ATOM   1719 C  CG    . GLN A 1 231 ? 30.345  18.516  57.950  1.00 69.57 ? 1208 GLN A CG    1 
ATOM   1720 C  CD    . GLN A 1 231 ? 31.821  18.672  57.639  1.00 72.76 ? 1208 GLN A CD    1 
ATOM   1721 O  OE1   . GLN A 1 231 ? 32.650  18.840  58.543  1.00 74.43 ? 1208 GLN A OE1   1 
ATOM   1722 N  NE2   . GLN A 1 231 ? 32.162  18.604  56.355  1.00 72.97 ? 1208 GLN A NE2   1 
ATOM   1723 N  N     . PRO A 1 232 ? 27.172  17.441  58.302  1.00 61.28 ? 1209 PRO A N     1 
ATOM   1724 C  CA    . PRO A 1 232 ? 26.801  16.024  58.322  1.00 60.33 ? 1209 PRO A CA    1 
ATOM   1725 C  C     . PRO A 1 232 ? 27.996  15.090  58.237  1.00 59.99 ? 1209 PRO A C     1 
ATOM   1726 O  O     . PRO A 1 232 ? 29.018  15.419  57.628  1.00 60.83 ? 1209 PRO A O     1 
ATOM   1727 C  CB    . PRO A 1 232 ? 25.848  15.889  57.129  1.00 60.42 ? 1209 PRO A CB    1 
ATOM   1728 C  CG    . PRO A 1 232 ? 26.215  17.048  56.246  1.00 61.12 ? 1209 PRO A CG    1 
ATOM   1729 C  CD    . PRO A 1 232 ? 26.475  18.155  57.218  1.00 61.05 ? 1209 PRO A CD    1 
ATOM   1730 N  N     . TYR A 1 233 ? 27.847  13.923  58.859  1.00 59.45 ? 1210 TYR A N     1 
ATOM   1731 C  CA    . TYR A 1 233 ? 28.888  12.903  58.895  1.00 59.24 ? 1210 TYR A CA    1 
ATOM   1732 C  C     . TYR A 1 233 ? 30.226  13.498  59.315  1.00 60.14 ? 1210 TYR A C     1 
ATOM   1733 O  O     . TYR A 1 233 ? 31.275  13.120  58.806  1.00 60.01 ? 1210 TYR A O     1 
ATOM   1734 C  CB    . TYR A 1 233 ? 28.998  12.228  57.530  1.00 57.43 ? 1210 TYR A CB    1 
ATOM   1735 C  CG    . TYR A 1 233 ? 27.693  11.624  57.071  1.00 55.69 ? 1210 TYR A CG    1 
ATOM   1736 C  CD1   . TYR A 1 233 ? 27.169  10.486  57.685  1.00 53.72 ? 1210 TYR A CD1   1 
ATOM   1737 C  CD2   . TYR A 1 233 ? 26.962  12.209  56.036  1.00 55.60 ? 1210 TYR A CD2   1 
ATOM   1738 C  CE1   . TYR A 1 233 ? 25.944  9.947   57.279  1.00 53.10 ? 1210 TYR A CE1   1 
ATOM   1739 C  CE2   . TYR A 1 233 ? 25.736  11.680  55.623  1.00 53.64 ? 1210 TYR A CE2   1 
ATOM   1740 C  CZ    . TYR A 1 233 ? 25.232  10.553  56.247  1.00 53.65 ? 1210 TYR A CZ    1 
ATOM   1741 O  OH    . TYR A 1 233 ? 24.011  10.052  55.843  1.00 52.40 ? 1210 TYR A OH    1 
ATOM   1742 N  N     . GLN A 1 234 ? 30.172  14.437  60.253  1.00 63.15 ? 1211 GLN A N     1 
ATOM   1743 C  CA    . GLN A 1 234 ? 31.378  15.078  60.764  1.00 66.99 ? 1211 GLN A CA    1 
ATOM   1744 C  C     . GLN A 1 234 ? 32.392  14.008  61.159  1.00 68.18 ? 1211 GLN A C     1 
ATOM   1745 O  O     . GLN A 1 234 ? 32.047  13.024  61.825  1.00 69.20 ? 1211 GLN A O     1 
ATOM   1746 C  CB    . GLN A 1 234 ? 31.048  15.937  61.988  1.00 69.65 ? 1211 GLN A CB    1 
ATOM   1747 C  CG    . GLN A 1 234 ? 32.238  16.710  62.502  1.00 74.13 ? 1211 GLN A CG    1 
ATOM   1748 C  CD    . GLN A 1 234 ? 32.874  17.557  61.410  1.00 78.61 ? 1211 GLN A CD    1 
ATOM   1749 O  OE1   . GLN A 1 234 ? 33.241  17.044  60.338  1.00 79.86 ? 1211 GLN A OE1   1 
ATOM   1750 N  NE2   . GLN A 1 234 ? 33.009  18.858  61.670  1.00 79.05 ? 1211 GLN A NE2   1 
ATOM   1751 N  N     . GLY A 1 235 ? 33.642  14.198  60.747  1.00 68.15 ? 1212 GLY A N     1 
ATOM   1752 C  CA    . GLY A 1 235 ? 34.666  13.221  61.067  1.00 66.94 ? 1212 GLY A CA    1 
ATOM   1753 C  C     . GLY A 1 235 ? 35.025  12.378  59.862  1.00 66.69 ? 1212 GLY A C     1 
ATOM   1754 O  O     . GLY A 1 235 ? 36.171  12.398  59.413  1.00 67.52 ? 1212 GLY A O     1 
ATOM   1755 N  N     . LEU A 1 236 ? 34.047  11.643  59.337  1.00 66.02 ? 1213 LEU A N     1 
ATOM   1756 C  CA    . LEU A 1 236 ? 34.265  10.789  58.172  1.00 65.47 ? 1213 LEU A CA    1 
ATOM   1757 C  C     . LEU A 1 236 ? 34.724  11.606  56.974  1.00 64.95 ? 1213 LEU A C     1 
ATOM   1758 O  O     . LEU A 1 236 ? 34.449  12.803  56.882  1.00 64.13 ? 1213 LEU A O     1 
ATOM   1759 C  CB    . LEU A 1 236 ? 32.978  10.063  57.783  1.00 65.42 ? 1213 LEU A CB    1 
ATOM   1760 C  CG    . LEU A 1 236 ? 32.235  9.245   58.835  1.00 66.06 ? 1213 LEU A CG    1 
ATOM   1761 C  CD1   . LEU A 1 236 ? 31.628  10.182  59.873  1.00 67.78 ? 1213 LEU A CD1   1 
ATOM   1762 C  CD2   . LEU A 1 236 ? 31.145  8.422   58.161  1.00 65.21 ? 1213 LEU A CD2   1 
ATOM   1763 N  N     . SER A 1 237 ? 35.430  10.957  56.055  1.00 65.50 ? 1214 SER A N     1 
ATOM   1764 C  CA    . SER A 1 237 ? 35.877  11.639  54.845  1.00 65.90 ? 1214 SER A CA    1 
ATOM   1765 C  C     . SER A 1 237 ? 34.922  11.157  53.769  1.00 64.95 ? 1214 SER A C     1 
ATOM   1766 O  O     . SER A 1 237 ? 34.296  10.100  53.908  1.00 64.53 ? 1214 SER A O     1 
ATOM   1767 C  CB    . SER A 1 237 ? 37.297  11.250  54.456  1.00 66.13 ? 1214 SER A CB    1 
ATOM   1768 O  OG    . SER A 1 237 ? 37.292  9.962   53.867  1.00 68.54 ? 1214 SER A OG    1 
ATOM   1769 N  N     . ASN A 1 238 ? 34.817  11.928  52.698  1.00 64.05 ? 1215 ASN A N     1 
ATOM   1770 C  CA    . ASN A 1 238 ? 33.915  11.588  51.610  1.00 62.69 ? 1215 ASN A CA    1 
ATOM   1771 C  C     . ASN A 1 238 ? 33.857  10.104  51.291  1.00 63.31 ? 1215 ASN A C     1 
ATOM   1772 O  O     . ASN A 1 238 ? 32.769  9.519   51.241  1.00 63.13 ? 1215 ASN A O     1 
ATOM   1773 C  CB    . ASN A 1 238 ? 34.288  12.367  50.356  1.00 60.81 ? 1215 ASN A CB    1 
ATOM   1774 C  CG    . ASN A 1 238 ? 34.055  13.853  50.508  1.00 57.52 ? 1215 ASN A CG    1 
ATOM   1775 O  OD1   . ASN A 1 238 ? 33.485  14.307  51.498  1.00 54.78 ? 1215 ASN A OD1   1 
ATOM   1776 N  ND2   . ASN A 1 238 ? 34.491  14.619  49.518  1.00 56.41 ? 1215 ASN A ND2   1 
ATOM   1777 N  N     . GLU A 1 239 ? 35.019  9.495   51.081  1.00 63.45 ? 1216 GLU A N     1 
ATOM   1778 C  CA    . GLU A 1 239 ? 35.065  8.074   50.750  1.00 65.04 ? 1216 GLU A CA    1 
ATOM   1779 C  C     . GLU A 1 239 ? 34.456  7.235   51.864  1.00 64.93 ? 1216 GLU A C     1 
ATOM   1780 O  O     . GLU A 1 239 ? 33.805  6.217   51.602  1.00 64.86 ? 1216 GLU A O     1 
ATOM   1781 C  CB    . GLU A 1 239 ? 36.504  7.616   50.497  1.00 67.58 ? 1216 GLU A CB    1 
ATOM   1782 C  CG    . GLU A 1 239 ? 37.293  8.467   49.505  1.00 71.08 ? 1216 GLU A CG    1 
ATOM   1783 C  CD    . GLU A 1 239 ? 37.542  9.882   50.009  1.00 73.11 ? 1216 GLU A CD    1 
ATOM   1784 O  OE1   . GLU A 1 239 ? 37.700  10.063  51.236  1.00 74.97 ? 1216 GLU A OE1   1 
ATOM   1785 O  OE2   . GLU A 1 239 ? 37.594  10.814  49.179  1.00 75.39 ? 1216 GLU A OE2   1 
ATOM   1786 N  N     . GLN A 1 240 ? 34.665  7.662   53.107  1.00 64.45 ? 1217 GLN A N     1 
ATOM   1787 C  CA    . GLN A 1 240 ? 34.131  6.936   54.251  1.00 64.21 ? 1217 GLN A CA    1 
ATOM   1788 C  C     . GLN A 1 240 ? 32.613  7.061   54.251  1.00 62.67 ? 1217 GLN A C     1 
ATOM   1789 O  O     . GLN A 1 240 ? 31.895  6.089   54.494  1.00 62.07 ? 1217 GLN A O     1 
ATOM   1790 C  CB    . GLN A 1 240 ? 34.682  7.518   55.545  1.00 67.12 ? 1217 GLN A CB    1 
ATOM   1791 C  CG    . GLN A 1 240 ? 36.102  8.036   55.450  1.00 68.54 ? 1217 GLN A CG    1 
ATOM   1792 C  CD    . GLN A 1 240 ? 36.671  8.374   56.818  1.00 70.92 ? 1217 GLN A CD    1 
ATOM   1793 O  OE1   . GLN A 1 240 ? 37.631  9.146   56.937  1.00 71.14 ? 1217 GLN A OE1   1 
ATOM   1794 N  NE2   . GLN A 1 240 ? 36.087  7.786   57.862  1.00 71.12 ? 1217 GLN A NE2   1 
ATOM   1795 N  N     . VAL A 1 241 ? 32.144  8.275   53.975  1.00 61.19 ? 1218 VAL A N     1 
ATOM   1796 C  CA    . VAL A 1 241 ? 30.717  8.587   53.919  1.00 59.86 ? 1218 VAL A CA    1 
ATOM   1797 C  C     . VAL A 1 241 ? 30.069  7.704   52.865  1.00 59.97 ? 1218 VAL A C     1 
ATOM   1798 O  O     . VAL A 1 241 ? 29.024  7.084   53.084  1.00 58.79 ? 1218 VAL A O     1 
ATOM   1799 C  CB    . VAL A 1 241 ? 30.498  10.064  53.507  1.00 60.76 ? 1218 VAL A CB    1 
ATOM   1800 C  CG1   . VAL A 1 241 ? 29.016  10.422  53.552  1.00 59.41 ? 1218 VAL A CG1   1 
ATOM   1801 C  CG2   . VAL A 1 241 ? 31.308  10.979  54.411  1.00 60.95 ? 1218 VAL A CG2   1 
ATOM   1802 N  N     . LEU A 1 242 ? 30.720  7.670   51.711  1.00 60.03 ? 1219 LEU A N     1 
ATOM   1803 C  CA    . LEU A 1 242 ? 30.290  6.883   50.568  1.00 60.64 ? 1219 LEU A CA    1 
ATOM   1804 C  C     . LEU A 1 242 ? 29.984  5.459   51.037  1.00 61.00 ? 1219 LEU A C     1 
ATOM   1805 O  O     . LEU A 1 242 ? 28.859  4.966   50.919  1.00 62.01 ? 1219 LEU A O     1 
ATOM   1806 C  CB    . LEU A 1 242 ? 31.436  6.882   49.549  1.00 61.20 ? 1219 LEU A CB    1 
ATOM   1807 C  CG    . LEU A 1 242 ? 31.184  6.827   48.044  1.00 61.32 ? 1219 LEU A CG    1 
ATOM   1808 C  CD1   . LEU A 1 242 ? 30.586  5.486   47.659  1.00 61.42 ? 1219 LEU A CD1   1 
ATOM   1809 C  CD2   . LEU A 1 242 ? 30.269  7.970   47.655  1.00 61.89 ? 1219 LEU A CD2   1 
ATOM   1810 N  N     . LYS A 1 243 ? 31.011  4.816   51.581  1.00 61.32 ? 1220 LYS A N     1 
ATOM   1811 C  CA    . LYS A 1 243 ? 30.922  3.451   52.080  1.00 60.35 ? 1220 LYS A CA    1 
ATOM   1812 C  C     . LYS A 1 243 ? 29.877  3.338   53.189  1.00 58.40 ? 1220 LYS A C     1 
ATOM   1813 O  O     . LYS A 1 243 ? 28.970  2.510   53.127  1.00 57.48 ? 1220 LYS A O     1 
ATOM   1814 C  CB    . LYS A 1 243 ? 32.301  3.031   52.600  1.00 63.14 ? 1220 LYS A CB    1 
ATOM   1815 C  CG    . LYS A 1 243 ? 32.410  1.577   53.003  1.00 66.43 ? 1220 LYS A CG    1 
ATOM   1816 C  CD    . LYS A 1 243 ? 33.836  1.222   53.431  1.00 68.05 ? 1220 LYS A CD    1 
ATOM   1817 C  CE    . LYS A 1 243 ? 33.941  -0.261  53.786  1.00 68.36 ? 1220 LYS A CE    1 
ATOM   1818 N  NZ    . LYS A 1 243 ? 33.436  -1.127  52.671  1.00 68.63 ? 1220 LYS A NZ    1 
ATOM   1819 N  N     . PHE A 1 244 ? 30.019  4.182   54.201  1.00 57.41 ? 1221 PHE A N     1 
ATOM   1820 C  CA    . PHE A 1 244 ? 29.104  4.201   55.335  1.00 57.68 ? 1221 PHE A CA    1 
ATOM   1821 C  C     . PHE A 1 244 ? 27.652  4.131   54.888  1.00 57.14 ? 1221 PHE A C     1 
ATOM   1822 O  O     . PHE A 1 244 ? 26.922  3.204   55.241  1.00 57.86 ? 1221 PHE A O     1 
ATOM   1823 C  CB    . PHE A 1 244 ? 29.328  5.486   56.134  1.00 59.58 ? 1221 PHE A CB    1 
ATOM   1824 C  CG    . PHE A 1 244 ? 28.493  5.588   57.380  1.00 64.69 ? 1221 PHE A CG    1 
ATOM   1825 C  CD1   . PHE A 1 244 ? 28.775  4.798   58.495  1.00 66.23 ? 1221 PHE A CD1   1 
ATOM   1826 C  CD2   . PHE A 1 244 ? 27.422  6.482   57.448  1.00 67.05 ? 1221 PHE A CD2   1 
ATOM   1827 C  CE1   . PHE A 1 244 ? 28.003  4.898   59.661  1.00 67.14 ? 1221 PHE A CE1   1 
ATOM   1828 C  CE2   . PHE A 1 244 ? 26.641  6.591   58.610  1.00 67.57 ? 1221 PHE A CE2   1 
ATOM   1829 C  CZ    . PHE A 1 244 ? 26.933  5.798   59.716  1.00 68.34 ? 1221 PHE A CZ    1 
ATOM   1830 N  N     . VAL A 1 245 ? 27.240  5.124   54.104  1.00 57.11 ? 1222 VAL A N     1 
ATOM   1831 C  CA    . VAL A 1 245 ? 25.867  5.204   53.618  1.00 55.89 ? 1222 VAL A CA    1 
ATOM   1832 C  C     . VAL A 1 245 ? 25.512  4.043   52.696  1.00 55.63 ? 1222 VAL A C     1 
ATOM   1833 O  O     . VAL A 1 245 ? 24.454  3.427   52.841  1.00 54.26 ? 1222 VAL A O     1 
ATOM   1834 C  CB    . VAL A 1 245 ? 25.617  6.543   52.879  1.00 56.06 ? 1222 VAL A CB    1 
ATOM   1835 C  CG1   . VAL A 1 245 ? 24.129  6.730   52.624  1.00 53.34 ? 1222 VAL A CG1   1 
ATOM   1836 C  CG2   . VAL A 1 245 ? 26.167  7.708   53.703  1.00 55.30 ? 1222 VAL A CG2   1 
ATOM   1837 N  N     . MET A 1 246 ? 26.390  3.736   51.750  1.00 56.11 ? 1223 MET A N     1 
ATOM   1838 C  CA    . MET A 1 246 ? 26.115  2.634   50.841  1.00 58.46 ? 1223 MET A CA    1 
ATOM   1839 C  C     . MET A 1 246 ? 25.892  1.315   51.572  1.00 59.35 ? 1223 MET A C     1 
ATOM   1840 O  O     . MET A 1 246 ? 25.228  0.421   51.044  1.00 59.41 ? 1223 MET A O     1 
ATOM   1841 C  CB    . MET A 1 246 ? 27.251  2.477   49.836  1.00 58.33 ? 1223 MET A CB    1 
ATOM   1842 C  CG    . MET A 1 246 ? 27.223  3.512   48.730  1.00 59.35 ? 1223 MET A CG    1 
ATOM   1843 S  SD    . MET A 1 246 ? 28.434  3.167   47.457  1.00 59.85 ? 1223 MET A SD    1 
ATOM   1844 C  CE    . MET A 1 246 ? 27.648  1.779   46.657  1.00 59.98 ? 1223 MET A CE    1 
ATOM   1845 N  N     . ASP A 1 247 ? 26.439  1.196   52.783  1.00 60.41 ? 1224 ASP A N     1 
ATOM   1846 C  CA    . ASP A 1 247 ? 26.292  -0.034  53.564  1.00 61.66 ? 1224 ASP A CA    1 
ATOM   1847 C  C     . ASP A 1 247 ? 25.147  -0.029  54.577  1.00 61.54 ? 1224 ASP A C     1 
ATOM   1848 O  O     . ASP A 1 247 ? 25.099  -0.881  55.468  1.00 61.16 ? 1224 ASP A O     1 
ATOM   1849 C  CB    . ASP A 1 247 ? 27.607  -0.384  54.280  1.00 62.73 ? 1224 ASP A CB    1 
ATOM   1850 C  CG    . ASP A 1 247 ? 28.713  -0.810  53.313  1.00 63.27 ? 1224 ASP A CG    1 
ATOM   1851 O  OD1   . ASP A 1 247 ? 28.427  -1.604  52.385  1.00 62.55 ? 1224 ASP A OD1   1 
ATOM   1852 O  OD2   . ASP A 1 247 ? 29.868  -0.356  53.488  1.00 64.37 ? 1224 ASP A OD2   1 
ATOM   1853 N  N     . GLY A 1 248 ? 24.228  0.924   54.438  1.00 61.29 ? 1225 GLY A N     1 
ATOM   1854 C  CA    . GLY A 1 248 ? 23.083  0.984   55.330  1.00 59.19 ? 1225 GLY A CA    1 
ATOM   1855 C  C     . GLY A 1 248 ? 23.155  2.018   56.435  1.00 57.42 ? 1225 GLY A C     1 
ATOM   1856 O  O     . GLY A 1 248 ? 22.214  2.156   57.218  1.00 57.27 ? 1225 GLY A O     1 
ATOM   1857 N  N     . GLY A 1 249 ? 24.260  2.750   56.506  1.00 56.45 ? 1226 GLY A N     1 
ATOM   1858 C  CA    . GLY A 1 249 ? 24.399  3.758   57.545  1.00 57.00 ? 1226 GLY A CA    1 
ATOM   1859 C  C     . GLY A 1 249 ? 23.587  5.026   57.337  1.00 57.46 ? 1226 GLY A C     1 
ATOM   1860 O  O     . GLY A 1 249 ? 23.025  5.259   56.254  1.00 57.60 ? 1226 GLY A O     1 
ATOM   1861 N  N     . TYR A 1 250 ? 23.526  5.846   58.384  1.00 57.66 ? 1227 TYR A N     1 
ATOM   1862 C  CA    . TYR A 1 250 ? 22.800  7.112   58.345  1.00 58.61 ? 1227 TYR A CA    1 
ATOM   1863 C  C     . TYR A 1 250 ? 23.058  7.928   59.612  1.00 57.62 ? 1227 TYR A C     1 
ATOM   1864 O  O     . TYR A 1 250 ? 23.410  7.380   60.653  1.00 57.64 ? 1227 TYR A O     1 
ATOM   1865 C  CB    . TYR A 1 250 ? 21.302  6.855   58.157  1.00 60.64 ? 1227 TYR A CB    1 
ATOM   1866 C  CG    . TYR A 1 250 ? 20.686  6.004   59.232  1.00 63.16 ? 1227 TYR A CG    1 
ATOM   1867 C  CD1   . TYR A 1 250 ? 20.391  6.544   60.486  1.00 64.54 ? 1227 TYR A CD1   1 
ATOM   1868 C  CD2   . TYR A 1 250 ? 20.416  4.653   59.010  1.00 64.37 ? 1227 TYR A CD2   1 
ATOM   1869 C  CE1   . TYR A 1 250 ? 19.841  5.763   61.496  1.00 66.04 ? 1227 TYR A CE1   1 
ATOM   1870 C  CE2   . TYR A 1 250 ? 19.865  3.854   60.017  1.00 66.24 ? 1227 TYR A CE2   1 
ATOM   1871 C  CZ    . TYR A 1 250 ? 19.583  4.419   61.260  1.00 66.77 ? 1227 TYR A CZ    1 
ATOM   1872 O  OH    . TYR A 1 250 ? 19.056  3.645   62.271  1.00 68.71 ? 1227 TYR A OH    1 
ATOM   1873 N  N     . LEU A 1 251 ? 22.879  9.241   59.505  1.00 56.92 ? 1228 LEU A N     1 
ATOM   1874 C  CA    . LEU A 1 251 ? 23.108  10.170  60.606  1.00 56.92 ? 1228 LEU A CA    1 
ATOM   1875 C  C     . LEU A 1 251 ? 22.366  9.875   61.908  1.00 58.84 ? 1228 LEU A C     1 
ATOM   1876 O  O     . LEU A 1 251 ? 21.321  9.218   61.920  1.00 58.44 ? 1228 LEU A O     1 
ATOM   1877 C  CB    . LEU A 1 251 ? 22.759  11.583  60.157  1.00 56.44 ? 1228 LEU A CB    1 
ATOM   1878 C  CG    . LEU A 1 251 ? 23.622  12.188  59.059  1.00 55.12 ? 1228 LEU A CG    1 
ATOM   1879 C  CD1   . LEU A 1 251 ? 22.903  13.397  58.495  1.00 55.61 ? 1228 LEU A CD1   1 
ATOM   1880 C  CD2   . LEU A 1 251 ? 24.989  12.568  59.611  1.00 54.01 ? 1228 LEU A CD2   1 
ATOM   1881 N  N     . ASP A 1 252 ? 22.924  10.378  63.007  1.00 61.15 ? 1229 ASP A N     1 
ATOM   1882 C  CA    . ASP A 1 252 ? 22.333  10.202  64.328  1.00 63.13 ? 1229 ASP A CA    1 
ATOM   1883 C  C     . ASP A 1 252 ? 21.362  11.340  64.565  1.00 63.33 ? 1229 ASP A C     1 
ATOM   1884 O  O     . ASP A 1 252 ? 21.412  12.352  63.875  1.00 64.23 ? 1229 ASP A O     1 
ATOM   1885 C  CB    . ASP A 1 252 ? 23.413  10.234  65.417  1.00 67.06 ? 1229 ASP A CB    1 
ATOM   1886 C  CG    . ASP A 1 252 ? 24.395  9.072   65.317  1.00 71.02 ? 1229 ASP A CG    1 
ATOM   1887 O  OD1   . ASP A 1 252 ? 25.252  9.083   64.404  1.00 73.68 ? 1229 ASP A OD1   1 
ATOM   1888 O  OD2   . ASP A 1 252 ? 24.303  8.141   66.151  1.00 72.77 ? 1229 ASP A OD2   1 
ATOM   1889 N  N     . GLN A 1 253 ? 20.476  11.177  65.539  1.00 64.46 ? 1230 GLN A N     1 
ATOM   1890 C  CA    . GLN A 1 253 ? 19.522  12.229  65.867  1.00 66.04 ? 1230 GLN A CA    1 
ATOM   1891 C  C     . GLN A 1 253 ? 20.283  13.311  66.618  1.00 66.83 ? 1230 GLN A C     1 
ATOM   1892 O  O     . GLN A 1 253 ? 21.059  13.014  67.527  1.00 66.75 ? 1230 GLN A O     1 
ATOM   1893 C  CB    . GLN A 1 253 ? 18.407  11.688  66.763  1.00 68.80 ? 1230 GLN A CB    1 
ATOM   1894 C  CG    . GLN A 1 253 ? 17.622  10.560  66.136  1.00 72.01 ? 1230 GLN A CG    1 
ATOM   1895 C  CD    . GLN A 1 253 ? 16.906  10.999  64.876  1.00 75.20 ? 1230 GLN A CD    1 
ATOM   1896 O  OE1   . GLN A 1 253 ? 16.636  10.187  63.986  1.00 75.94 ? 1230 GLN A OE1   1 
ATOM   1897 N  NE2   . GLN A 1 253 ? 16.582  12.291  64.795  1.00 76.01 ? 1230 GLN A NE2   1 
ATOM   1898 N  N     . PRO A 1 254 ? 20.079  14.585  66.243  1.00 68.06 ? 1231 PRO A N     1 
ATOM   1899 C  CA    . PRO A 1 254 ? 20.775  15.684  66.920  1.00 68.47 ? 1231 PRO A CA    1 
ATOM   1900 C  C     . PRO A 1 254 ? 20.246  15.814  68.346  1.00 68.84 ? 1231 PRO A C     1 
ATOM   1901 O  O     . PRO A 1 254 ? 19.265  15.167  68.721  1.00 68.65 ? 1231 PRO A O     1 
ATOM   1902 C  CB    . PRO A 1 254 ? 20.410  16.913  66.080  1.00 68.91 ? 1231 PRO A CB    1 
ATOM   1903 C  CG    . PRO A 1 254 ? 19.900  16.341  64.775  1.00 69.95 ? 1231 PRO A CG    1 
ATOM   1904 C  CD    . PRO A 1 254 ? 19.171  15.106  65.209  1.00 68.60 ? 1231 PRO A CD    1 
ATOM   1905 N  N     . ASP A 1 255 ? 20.887  16.659  69.138  1.00 69.50 ? 1232 ASP A N     1 
ATOM   1906 C  CA    . ASP A 1 255 ? 20.452  16.827  70.510  1.00 70.01 ? 1232 ASP A CA    1 
ATOM   1907 C  C     . ASP A 1 255 ? 19.061  17.438  70.662  1.00 69.23 ? 1232 ASP A C     1 
ATOM   1908 O  O     . ASP A 1 255 ? 18.726  18.438  70.025  1.00 69.16 ? 1232 ASP A O     1 
ATOM   1909 C  CB    . ASP A 1 255 ? 21.491  17.635  71.291  1.00 71.61 ? 1232 ASP A CB    1 
ATOM   1910 C  CG    . ASP A 1 255 ? 22.752  16.827  71.576  1.00 72.94 ? 1232 ASP A CG    1 
ATOM   1911 O  OD1   . ASP A 1 255 ? 22.618  15.692  72.084  1.00 72.71 ? 1232 ASP A OD1   1 
ATOM   1912 O  OD2   . ASP A 1 255 ? 23.869  17.321  71.299  1.00 73.28 ? 1232 ASP A OD2   1 
ATOM   1913 N  N     . ASN A 1 256 ? 18.251  16.808  71.511  1.00 68.95 ? 1233 ASN A N     1 
ATOM   1914 C  CA    . ASN A 1 256 ? 16.888  17.271  71.795  1.00 68.71 ? 1233 ASN A CA    1 
ATOM   1915 C  C     . ASN A 1 256 ? 15.983  17.309  70.581  1.00 67.15 ? 1233 ASN A C     1 
ATOM   1916 O  O     . ASN A 1 256 ? 14.910  17.905  70.626  1.00 67.17 ? 1233 ASN A O     1 
ATOM   1917 C  CB    . ASN A 1 256 ? 16.913  18.678  72.396  1.00 70.19 ? 1233 ASN A CB    1 
ATOM   1918 C  CG    . ASN A 1 256 ? 17.704  18.748  73.679  1.00 71.98 ? 1233 ASN A CG    1 
ATOM   1919 O  OD1   . ASN A 1 256 ? 17.332  18.139  74.686  1.00 73.12 ? 1233 ASN A OD1   1 
ATOM   1920 N  ND2   . ASN A 1 256 ? 18.811  19.494  73.654  1.00 72.73 ? 1233 ASN A ND2   1 
ATOM   1921 N  N     . CYS A 1 257 ? 16.410  16.683  69.494  1.00 65.45 ? 1234 CYS A N     1 
ATOM   1922 C  CA    . CYS A 1 257 ? 15.613  16.687  68.287  1.00 63.03 ? 1234 CYS A CA    1 
ATOM   1923 C  C     . CYS A 1 257 ? 14.197  16.213  68.559  1.00 62.49 ? 1234 CYS A C     1 
ATOM   1924 O  O     . CYS A 1 257 ? 13.995  15.124  69.085  1.00 62.32 ? 1234 CYS A O     1 
ATOM   1925 C  CB    . CYS A 1 257 ? 16.244  15.782  67.233  1.00 62.99 ? 1234 CYS A CB    1 
ATOM   1926 S  SG    . CYS A 1 257 ? 15.179  15.541  65.796  1.00 60.14 ? 1234 CYS A SG    1 
ATOM   1927 N  N     . PRO A 1 258 ? 13.193  17.033  68.223  1.00 61.96 ? 1235 PRO A N     1 
ATOM   1928 C  CA    . PRO A 1 258 ? 11.806  16.613  68.457  1.00 61.88 ? 1235 PRO A CA    1 
ATOM   1929 C  C     . PRO A 1 258 ? 11.592  15.250  67.796  1.00 62.58 ? 1235 PRO A C     1 
ATOM   1930 O  O     . PRO A 1 258 ? 12.019  15.027  66.661  1.00 63.66 ? 1235 PRO A O     1 
ATOM   1931 C  CB    . PRO A 1 258 ? 10.994  17.715  67.784  1.00 62.23 ? 1235 PRO A CB    1 
ATOM   1932 C  CG    . PRO A 1 258 ? 11.863  18.928  67.990  1.00 62.81 ? 1235 PRO A CG    1 
ATOM   1933 C  CD    . PRO A 1 258 ? 13.251  18.403  67.683  1.00 61.26 ? 1235 PRO A CD    1 
ATOM   1934 N  N     . GLU A 1 259 ? 10.937  14.337  68.502  1.00 63.04 ? 1236 GLU A N     1 
ATOM   1935 C  CA    . GLU A 1 259 ? 10.704  12.992  67.977  1.00 62.95 ? 1236 GLU A CA    1 
ATOM   1936 C  C     . GLU A 1 259 ? 9.869   12.983  66.710  1.00 62.54 ? 1236 GLU A C     1 
ATOM   1937 O  O     . GLU A 1 259 ? 10.040  12.125  65.846  1.00 61.93 ? 1236 GLU A O     1 
ATOM   1938 C  CB    . GLU A 1 259 ? 10.002  12.127  69.028  1.00 62.86 ? 1236 GLU A CB    1 
ATOM   1939 N  N     . ARG A 1 260 ? 8.955   13.935  66.601  1.00 61.87 ? 1237 ARG A N     1 
ATOM   1940 C  CA    . ARG A 1 260 ? 8.112   13.985  65.424  1.00 59.97 ? 1237 ARG A CA    1 
ATOM   1941 C  C     . ARG A 1 260 ? 8.988   14.177  64.191  1.00 58.99 ? 1237 ARG A C     1 
ATOM   1942 O  O     . ARG A 1 260 ? 8.755   13.561  63.155  1.00 58.63 ? 1237 ARG A O     1 
ATOM   1943 C  CB    . ARG A 1 260 ? 7.102   15.118  65.550  1.00 60.88 ? 1237 ARG A CB    1 
ATOM   1944 C  CG    . ARG A 1 260 ? 6.054   15.105  64.468  1.00 62.11 ? 1237 ARG A CG    1 
ATOM   1945 C  CD    . ARG A 1 260 ? 5.009   16.177  64.707  1.00 62.31 ? 1237 ARG A CD    1 
ATOM   1946 N  NE    . ARG A 1 260 ? 4.022   16.194  63.636  1.00 62.55 ? 1237 ARG A NE    1 
ATOM   1947 C  CZ    . ARG A 1 260 ? 3.009   17.051  63.560  1.00 62.80 ? 1237 ARG A CZ    1 
ATOM   1948 N  NH1   . ARG A 1 260 ? 2.834   17.976  64.501  1.00 60.80 ? 1237 ARG A NH1   1 
ATOM   1949 N  NH2   . ARG A 1 260 ? 2.173   16.983  62.530  1.00 63.56 ? 1237 ARG A NH2   1 
ATOM   1950 N  N     . VAL A 1 261 ? 10.001  15.030  64.315  1.00 56.75 ? 1238 VAL A N     1 
ATOM   1951 C  CA    . VAL A 1 261 ? 10.923  15.292  63.224  1.00 54.08 ? 1238 VAL A CA    1 
ATOM   1952 C  C     . VAL A 1 261 ? 11.810  14.074  63.061  1.00 53.52 ? 1238 VAL A C     1 
ATOM   1953 O  O     . VAL A 1 261 ? 12.212  13.718  61.956  1.00 53.47 ? 1238 VAL A O     1 
ATOM   1954 C  CB    . VAL A 1 261 ? 11.800  16.507  63.520  1.00 52.92 ? 1238 VAL A CB    1 
ATOM   1955 C  CG1   . VAL A 1 261 ? 12.791  16.719  62.393  1.00 51.67 ? 1238 VAL A CG1   1 
ATOM   1956 C  CG2   . VAL A 1 261 ? 10.929  17.728  63.706  1.00 51.32 ? 1238 VAL A CG2   1 
ATOM   1957 N  N     . THR A 1 262 ? 12.119  13.434  64.175  1.00 52.91 ? 1239 THR A N     1 
ATOM   1958 C  CA    . THR A 1 262 ? 12.942  12.241  64.127  1.00 52.06 ? 1239 THR A CA    1 
ATOM   1959 C  C     . THR A 1 262 ? 12.215  11.190  63.294  1.00 51.49 ? 1239 THR A C     1 
ATOM   1960 O  O     . THR A 1 262 ? 12.849  10.384  62.614  1.00 50.61 ? 1239 THR A O     1 
ATOM   1961 C  CB    . THR A 1 262 ? 13.191  11.678  65.533  1.00 52.01 ? 1239 THR A CB    1 
ATOM   1962 O  OG1   . THR A 1 262 ? 14.063  12.559  66.250  1.00 52.63 ? 1239 THR A OG1   1 
ATOM   1963 C  CG2   . THR A 1 262 ? 13.819  10.301  65.452  1.00 51.28 ? 1239 THR A CG2   1 
ATOM   1964 N  N     . ASP A 1 263 ? 10.883  11.199  63.350  1.00 50.57 ? 1240 ASP A N     1 
ATOM   1965 C  CA    . ASP A 1 263 ? 10.102  10.239  62.577  1.00 50.34 ? 1240 ASP A CA    1 
ATOM   1966 C  C     . ASP A 1 263 ? 10.256  10.509  61.083  1.00 50.19 ? 1240 ASP A C     1 
ATOM   1967 O  O     . ASP A 1 263 ? 10.456  9.576   60.302  1.00 49.92 ? 1240 ASP A O     1 
ATOM   1968 C  CB    . ASP A 1 263 ? 8.616   10.274  62.962  1.00 52.31 ? 1240 ASP A CB    1 
ATOM   1969 C  CG    . ASP A 1 263 ? 8.341   9.629   64.326  1.00 56.20 ? 1240 ASP A CG    1 
ATOM   1970 O  OD1   . ASP A 1 263 ? 9.108   8.713   64.732  1.00 52.83 ? 1240 ASP A OD1   1 
ATOM   1971 O  OD2   . ASP A 1 263 ? 7.343   10.034  64.982  1.00 55.65 ? 1240 ASP A OD2   1 
ATOM   1972 N  N     . LEU A 1 264 ? 10.166  11.781  60.687  1.00 49.22 ? 1241 LEU A N     1 
ATOM   1973 C  CA    . LEU A 1 264 ? 10.327  12.155  59.283  1.00 47.07 ? 1241 LEU A CA    1 
ATOM   1974 C  C     . LEU A 1 264 ? 11.675  11.689  58.756  1.00 45.71 ? 1241 LEU A C     1 
ATOM   1975 O  O     . LEU A 1 264 ? 11.749  11.042  57.718  1.00 43.64 ? 1241 LEU A O     1 
ATOM   1976 C  CB    . LEU A 1 264 ? 10.248  13.660  59.110  1.00 47.01 ? 1241 LEU A CB    1 
ATOM   1977 C  CG    . LEU A 1 264 ? 8.853   14.258  59.202  1.00 49.17 ? 1241 LEU A CG    1 
ATOM   1978 C  CD1   . LEU A 1 264 ? 8.950   15.753  59.001  1.00 47.39 ? 1241 LEU A CD1   1 
ATOM   1979 C  CD2   . LEU A 1 264 ? 7.957   13.628  58.146  1.00 50.33 ? 1241 LEU A CD2   1 
ATOM   1980 N  N     . MET A 1 265 ? 12.741  12.025  59.474  1.00 44.77 ? 1242 MET A N     1 
ATOM   1981 C  CA    . MET A 1 265 ? 14.074  11.623  59.059  1.00 46.20 ? 1242 MET A CA    1 
ATOM   1982 C  C     . MET A 1 265 ? 14.137  10.124  58.826  1.00 48.20 ? 1242 MET A C     1 
ATOM   1983 O  O     . MET A 1 265 ? 14.713  9.665   57.833  1.00 49.03 ? 1242 MET A O     1 
ATOM   1984 C  CB    . MET A 1 265 ? 15.112  12.025  60.103  1.00 44.72 ? 1242 MET A CB    1 
ATOM   1985 C  CG    . MET A 1 265 ? 15.475  13.484  60.042  1.00 46.95 ? 1242 MET A CG    1 
ATOM   1986 S  SD    . MET A 1 265 ? 16.768  14.026  61.193  1.00 47.21 ? 1242 MET A SD    1 
ATOM   1987 C  CE    . MET A 1 265 ? 15.785  15.034  62.330  1.00 46.63 ? 1242 MET A CE    1 
ATOM   1988 N  N     . ARG A 1 266 ? 13.542  9.361   59.738  1.00 48.93 ? 1243 ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 266 ? 13.548  7.913   59.616  1.00 48.46 ? 1243 ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 266 ? 12.853  7.489   58.327  1.00 47.49 ? 1243 ARG A C     1 
ATOM   1991 O  O     . ARG A 1 266 ? 13.320  6.594   57.634  1.00 46.74 ? 1243 ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 266 ? 12.864  7.273   60.834  1.00 50.85 ? 1243 ARG A CB    1 
ATOM   1993 N  N     . MET A 1 267 ? 11.741  8.128   58.000  1.00 46.98 ? 1244 MET A N     1 
ATOM   1994 C  CA    . MET A 1 267 ? 11.048  7.772   56.782  1.00 47.51 ? 1244 MET A CA    1 
ATOM   1995 C  C     . MET A 1 267 ? 11.877  8.177   55.558  1.00 47.17 ? 1244 MET A C     1 
ATOM   1996 O  O     . MET A 1 267 ? 11.858  7.502   54.529  1.00 46.63 ? 1244 MET A O     1 
ATOM   1997 C  CB    . MET A 1 267 ? 9.660   8.411   56.784  1.00 49.20 ? 1244 MET A CB    1 
ATOM   1998 C  CG    . MET A 1 267 ? 8.740   7.815   57.864  1.00 51.62 ? 1244 MET A CG    1 
ATOM   1999 S  SD    . MET A 1 267 ? 8.615   5.964   57.828  1.00 56.79 ? 1244 MET A SD    1 
ATOM   2000 C  CE    . MET A 1 267 ? 9.932   5.487   58.964  1.00 51.83 ? 1244 MET A CE    1 
ATOM   2001 N  N     . CYS A 1 268 ? 12.617  9.272   55.690  1.00 46.17 ? 1245 CYS A N     1 
ATOM   2002 C  CA    . CYS A 1 268 ? 13.457  9.779   54.609  1.00 46.07 ? 1245 CYS A CA    1 
ATOM   2003 C  C     . CYS A 1 268 ? 14.669  8.909   54.348  1.00 45.58 ? 1245 CYS A C     1 
ATOM   2004 O  O     . CYS A 1 268 ? 15.193  8.881   53.228  1.00 45.34 ? 1245 CYS A O     1 
ATOM   2005 C  CB    . CYS A 1 268 ? 13.960  11.199  54.924  1.00 45.08 ? 1245 CYS A CB    1 
ATOM   2006 S  SG    . CYS A 1 268 ? 12.683  12.461  54.938  1.00 44.92 ? 1245 CYS A SG    1 
ATOM   2007 N  N     . TRP A 1 269 ? 15.126  8.201   55.371  1.00 45.00 ? 1246 TRP A N     1 
ATOM   2008 C  CA    . TRP A 1 269 ? 16.308  7.389   55.182  1.00 45.04 ? 1246 TRP A CA    1 
ATOM   2009 C  C     . TRP A 1 269 ? 16.097  5.883   55.030  1.00 44.59 ? 1246 TRP A C     1 
ATOM   2010 O  O     . TRP A 1 269 ? 17.004  5.091   55.299  1.00 42.87 ? 1246 TRP A O     1 
ATOM   2011 C  CB    . TRP A 1 269 ? 17.321  7.707   56.281  1.00 47.16 ? 1246 TRP A CB    1 
ATOM   2012 C  CG    . TRP A 1 269 ? 17.789  9.135   56.227  1.00 49.57 ? 1246 TRP A CG    1 
ATOM   2013 C  CD1   . TRP A 1 269 ? 17.908  9.918   55.111  1.00 52.06 ? 1246 TRP A CD1   1 
ATOM   2014 C  CD2   . TRP A 1 269 ? 18.209  9.950   57.330  1.00 50.70 ? 1246 TRP A CD2   1 
ATOM   2015 N  NE1   . TRP A 1 269 ? 18.375  11.171  55.450  1.00 52.64 ? 1246 TRP A NE1   1 
ATOM   2016 C  CE2   . TRP A 1 269 ? 18.567  11.218  56.804  1.00 51.56 ? 1246 TRP A CE2   1 
ATOM   2017 C  CE3   . TRP A 1 269 ? 18.318  9.735   58.710  1.00 50.31 ? 1246 TRP A CE3   1 
ATOM   2018 C  CZ2   . TRP A 1 269 ? 19.026  12.264  57.611  1.00 50.63 ? 1246 TRP A CZ2   1 
ATOM   2019 C  CZ3   . TRP A 1 269 ? 18.776  10.780  59.516  1.00 52.21 ? 1246 TRP A CZ3   1 
ATOM   2020 C  CH2   . TRP A 1 269 ? 19.124  12.030  58.959  1.00 52.01 ? 1246 TRP A CH2   1 
ATOM   2021 N  N     . GLN A 1 270 ? 14.903  5.482   54.594  1.00 43.95 ? 1247 GLN A N     1 
ATOM   2022 C  CA    . GLN A 1 270 ? 14.651  4.066   54.368  1.00 44.81 ? 1247 GLN A CA    1 
ATOM   2023 C  C     . GLN A 1 270 ? 15.632  3.694   53.271  1.00 45.13 ? 1247 GLN A C     1 
ATOM   2024 O  O     . GLN A 1 270 ? 15.835  4.463   52.337  1.00 47.32 ? 1247 GLN A O     1 
ATOM   2025 C  CB    . GLN A 1 270 ? 13.227  3.817   53.881  1.00 45.75 ? 1247 GLN A CB    1 
ATOM   2026 C  CG    . GLN A 1 270 ? 12.187  3.982   54.950  1.00 48.69 ? 1247 GLN A CG    1 
ATOM   2027 C  CD    . GLN A 1 270 ? 12.451  3.080   56.141  1.00 52.03 ? 1247 GLN A CD    1 
ATOM   2028 O  OE1   . GLN A 1 270 ? 12.353  1.850   56.040  1.00 53.86 ? 1247 GLN A OE1   1 
ATOM   2029 N  NE2   . GLN A 1 270 ? 12.794  3.684   57.278  1.00 50.45 ? 1247 GLN A NE2   1 
ATOM   2030 N  N     . PHE A 1 271 ? 16.243  2.524   53.373  1.00 43.75 ? 1248 PHE A N     1 
ATOM   2031 C  CA    . PHE A 1 271 ? 17.210  2.126   52.368  1.00 42.33 ? 1248 PHE A CA    1 
ATOM   2032 C  C     . PHE A 1 271 ? 16.607  1.948   50.984  1.00 43.31 ? 1248 PHE A C     1 
ATOM   2033 O  O     . PHE A 1 271 ? 17.235  2.287   49.979  1.00 43.80 ? 1248 PHE A O     1 
ATOM   2034 C  CB    . PHE A 1 271 ? 17.892  0.825   52.758  1.00 39.66 ? 1248 PHE A CB    1 
ATOM   2035 C  CG    . PHE A 1 271 ? 19.148  0.583   52.007  1.00 33.40 ? 1248 PHE A CG    1 
ATOM   2036 C  CD1   . PHE A 1 271 ? 20.317  1.245   52.368  1.00 32.63 ? 1248 PHE A CD1   1 
ATOM   2037 C  CD2   . PHE A 1 271 ? 19.163  -0.274  50.912  1.00 31.33 ? 1248 PHE A CD2   1 
ATOM   2038 C  CE1   . PHE A 1 271 ? 21.498  1.058   51.646  1.00 31.30 ? 1248 PHE A CE1   1 
ATOM   2039 C  CE2   . PHE A 1 271 ? 20.330  -0.470  50.185  1.00 29.13 ? 1248 PHE A CE2   1 
ATOM   2040 C  CZ    . PHE A 1 271 ? 21.503  0.196   50.551  1.00 28.49 ? 1248 PHE A CZ    1 
ATOM   2041 N  N     . ASN A 1 272 ? 15.399  1.406   50.927  1.00 44.16 ? 1249 ASN A N     1 
ATOM   2042 C  CA    . ASN A 1 272 ? 14.760  1.204   49.642  1.00 46.13 ? 1249 ASN A CA    1 
ATOM   2043 C  C     . ASN A 1 272 ? 13.992  2.461   49.292  1.00 48.41 ? 1249 ASN A C     1 
ATOM   2044 O  O     . ASN A 1 272 ? 13.047  2.856   49.996  1.00 49.11 ? 1249 ASN A O     1 
ATOM   2045 C  CB    . ASN A 1 272 ? 13.807  0.018   49.663  1.00 46.55 ? 1249 ASN A CB    1 
ATOM   2046 C  CG    . ASN A 1 272 ? 13.379  -0.395  48.271  1.00 49.15 ? 1249 ASN A CG    1 
ATOM   2047 O  OD1   . ASN A 1 272 ? 13.145  0.457   47.406  1.00 50.29 ? 1249 ASN A OD1   1 
ATOM   2048 N  ND2   . ASN A 1 272 ? 13.265  -1.699  48.042  1.00 51.20 ? 1249 ASN A ND2   1 
ATOM   2049 N  N     . PRO A 1 273 ? 14.380  3.108   48.184  1.00 48.84 ? 1250 PRO A N     1 
ATOM   2050 C  CA    . PRO A 1 273 ? 13.728  4.339   47.732  1.00 48.57 ? 1250 PRO A CA    1 
ATOM   2051 C  C     . PRO A 1 273 ? 12.204  4.316   47.695  1.00 48.47 ? 1250 PRO A C     1 
ATOM   2052 O  O     . PRO A 1 273 ? 11.569  5.347   47.905  1.00 48.04 ? 1250 PRO A O     1 
ATOM   2053 C  CB    . PRO A 1 273 ? 14.341  4.569   46.352  1.00 48.01 ? 1250 PRO A CB    1 
ATOM   2054 C  CG    . PRO A 1 273 ? 14.712  3.187   45.901  1.00 47.02 ? 1250 PRO A CG    1 
ATOM   2055 C  CD    . PRO A 1 273 ? 15.310  2.610   47.156  1.00 48.41 ? 1250 PRO A CD    1 
ATOM   2056 N  N     . ASN A 1 274 ? 11.609  3.155   47.437  1.00 49.89 ? 1251 ASN A N     1 
ATOM   2057 C  CA    . ASN A 1 274 ? 10.153  3.085   47.369  1.00 51.77 ? 1251 ASN A CA    1 
ATOM   2058 C  C     . ASN A 1 274 ? 9.528   3.012   48.755  1.00 51.09 ? 1251 ASN A C     1 
ATOM   2059 O  O     . ASN A 1 274 ? 8.304   3.008   48.901  1.00 51.13 ? 1251 ASN A O     1 
ATOM   2060 C  CB    . ASN A 1 274 ? 9.723   1.901   46.503  1.00 54.68 ? 1251 ASN A CB    1 
ATOM   2061 C  CG    . ASN A 1 274 ? 10.450  0.637   46.864  1.00 58.45 ? 1251 ASN A CG    1 
ATOM   2062 O  OD1   . ASN A 1 274 ? 10.603  -0.263  46.042  1.00 60.33 ? 1251 ASN A OD1   1 
ATOM   2063 N  ND2   . ASN A 1 274 ? 10.899  0.555   48.112  1.00 60.83 ? 1251 ASN A ND2   1 
ATOM   2064 N  N     . MET A 1 275 ? 10.381  2.961   49.771  1.00 50.75 ? 1252 MET A N     1 
ATOM   2065 C  CA    . MET A 1 275 ? 9.924   2.925   51.153  1.00 50.72 ? 1252 MET A CA    1 
ATOM   2066 C  C     . MET A 1 275 ? 9.801   4.352   51.716  1.00 49.45 ? 1252 MET A C     1 
ATOM   2067 O  O     . MET A 1 275 ? 9.079   4.589   52.681  1.00 50.18 ? 1252 MET A O     1 
ATOM   2068 C  CB    . MET A 1 275 ? 10.901  2.106   52.002  1.00 53.66 ? 1252 MET A CB    1 
ATOM   2069 C  CG    . MET A 1 275 ? 10.827  0.601   51.772  1.00 55.83 ? 1252 MET A CG    1 
ATOM   2070 S  SD    . MET A 1 275 ? 9.159   -0.027  52.107  1.00 61.19 ? 1252 MET A SD    1 
ATOM   2071 C  CE    . MET A 1 275 ? 9.210   -0.192  53.882  1.00 58.69 ? 1252 MET A CE    1 
ATOM   2072 N  N     . ARG A 1 276 ? 10.509  5.296   51.105  1.00 47.33 ? 1253 ARG A N     1 
ATOM   2073 C  CA    . ARG A 1 276 ? 10.479  6.688   51.529  1.00 43.66 ? 1253 ARG A CA    1 
ATOM   2074 C  C     . ARG A 1 276 ? 9.177   7.359   51.122  1.00 42.50 ? 1253 ARG A C     1 
ATOM   2075 O  O     . ARG A 1 276 ? 8.518   6.946   50.163  1.00 42.61 ? 1253 ARG A O     1 
ATOM   2076 C  CB    . ARG A 1 276 ? 11.648  7.450   50.913  1.00 42.11 ? 1253 ARG A CB    1 
ATOM   2077 C  CG    . ARG A 1 276 ? 13.000  6.884   51.260  1.00 40.59 ? 1253 ARG A CG    1 
ATOM   2078 C  CD    . ARG A 1 276 ? 14.038  7.383   50.295  1.00 43.35 ? 1253 ARG A CD    1 
ATOM   2079 N  NE    . ARG A 1 276 ? 15.328  6.726   50.490  1.00 47.13 ? 1253 ARG A NE    1 
ATOM   2080 C  CZ    . ARG A 1 276 ? 16.230  6.566   49.526  1.00 47.61 ? 1253 ARG A CZ    1 
ATOM   2081 N  NH1   . ARG A 1 276 ? 15.968  7.013   48.306  1.00 47.77 ? 1253 ARG A NH1   1 
ATOM   2082 N  NH2   . ARG A 1 276 ? 17.393  5.973   49.780  1.00 48.46 ? 1253 ARG A NH2   1 
ATOM   2083 N  N     . PRO A 1 277 ? 8.790   8.409   51.849  1.00 41.40 ? 1254 PRO A N     1 
ATOM   2084 C  CA    . PRO A 1 277 ? 7.557   9.151   51.565  1.00 41.63 ? 1254 PRO A CA    1 
ATOM   2085 C  C     . PRO A 1 277 ? 7.725   10.149  50.401  1.00 42.75 ? 1254 PRO A C     1 
ATOM   2086 O  O     . PRO A 1 277 ? 8.845   10.418  49.940  1.00 42.76 ? 1254 PRO A O     1 
ATOM   2087 C  CB    . PRO A 1 277 ? 7.283   9.849   52.889  1.00 41.83 ? 1254 PRO A CB    1 
ATOM   2088 C  CG    . PRO A 1 277 ? 8.686   10.175  53.369  1.00 41.29 ? 1254 PRO A CG    1 
ATOM   2089 C  CD    . PRO A 1 277 ? 9.453   8.911   53.068  1.00 40.75 ? 1254 PRO A CD    1 
ATOM   2090 N  N     . THR A 1 278 ? 6.610   10.691  49.928  1.00 41.15 ? 1255 THR A N     1 
ATOM   2091 C  CA    . THR A 1 278 ? 6.645   11.658  48.850  1.00 40.11 ? 1255 THR A CA    1 
ATOM   2092 C  C     . THR A 1 278 ? 6.476   13.028  49.482  1.00 38.72 ? 1255 THR A C     1 
ATOM   2093 O  O     . THR A 1 278 ? 5.932   13.150  50.585  1.00 37.83 ? 1255 THR A O     1 
ATOM   2094 C  CB    . THR A 1 278 ? 5.491   11.449  47.892  1.00 41.32 ? 1255 THR A CB    1 
ATOM   2095 O  OG1   . THR A 1 278 ? 4.267   11.819  48.548  1.00 43.87 ? 1255 THR A OG1   1 
ATOM   2096 C  CG2   . THR A 1 278 ? 5.426   9.993   47.465  1.00 38.51 ? 1255 THR A CG2   1 
ATOM   2097 N  N     . PHE A 1 279 ? 6.935   14.056  48.778  1.00 36.53 ? 1256 PHE A N     1 
ATOM   2098 C  CA    . PHE A 1 279 ? 6.828   15.410  49.275  1.00 33.50 ? 1256 PHE A CA    1 
ATOM   2099 C  C     . PHE A 1 279 ? 5.386   15.795  49.548  1.00 34.27 ? 1256 PHE A C     1 
ATOM   2100 O  O     . PHE A 1 279 ? 5.102   16.474  50.530  1.00 34.90 ? 1256 PHE A O     1 
ATOM   2101 C  CB    . PHE A 1 279 ? 7.510   16.361  48.295  1.00 30.75 ? 1256 PHE A CB    1 
ATOM   2102 C  CG    . PHE A 1 279 ? 9.014   16.265  48.342  1.00 28.24 ? 1256 PHE A CG    1 
ATOM   2103 C  CD1   . PHE A 1 279 ? 9.718   16.746  49.454  1.00 27.62 ? 1256 PHE A CD1   1 
ATOM   2104 C  CD2   . PHE A 1 279 ? 9.715   15.618  47.335  1.00 23.51 ? 1256 PHE A CD2   1 
ATOM   2105 C  CE1   . PHE A 1 279 ? 11.105  16.571  49.560  1.00 26.93 ? 1256 PHE A CE1   1 
ATOM   2106 C  CE2   . PHE A 1 279 ? 11.089  15.440  47.431  1.00 25.09 ? 1256 PHE A CE2   1 
ATOM   2107 C  CZ    . PHE A 1 279 ? 11.791  15.918  48.548  1.00 27.63 ? 1256 PHE A CZ    1 
ATOM   2108 N  N     . LEU A 1 280 ? 4.470   15.361  48.695  1.00 35.55 ? 1257 LEU A N     1 
ATOM   2109 C  CA    . LEU A 1 280 ? 3.067   15.666  48.931  1.00 38.19 ? 1257 LEU A CA    1 
ATOM   2110 C  C     . LEU A 1 280 ? 2.672   15.036  50.264  1.00 39.14 ? 1257 LEU A C     1 
ATOM   2111 O  O     . LEU A 1 280 ? 2.022   15.668  51.094  1.00 41.57 ? 1257 LEU A O     1 
ATOM   2112 C  CB    . LEU A 1 280 ? 2.204   15.115  47.798  1.00 37.97 ? 1257 LEU A CB    1 
ATOM   2113 C  CG    . LEU A 1 280 ? 2.313   15.880  46.476  1.00 38.31 ? 1257 LEU A CG    1 
ATOM   2114 C  CD1   . LEU A 1 280 ? 1.573   15.130  45.396  1.00 38.16 ? 1257 LEU A CD1   1 
ATOM   2115 C  CD2   . LEU A 1 280 ? 1.739   17.282  46.644  1.00 37.60 ? 1257 LEU A CD2   1 
ATOM   2116 N  N     . GLU A 1 281 ? 3.074   13.790  50.476  1.00 39.65 ? 1258 GLU A N     1 
ATOM   2117 C  CA    . GLU A 1 281 ? 2.752   13.120  51.731  1.00 40.33 ? 1258 GLU A CA    1 
ATOM   2118 C  C     . GLU A 1 281 ? 3.314   13.875  52.914  1.00 40.47 ? 1258 GLU A C     1 
ATOM   2119 O  O     . GLU A 1 281 ? 2.683   13.945  53.969  1.00 41.64 ? 1258 GLU A O     1 
ATOM   2120 C  CB    . GLU A 1 281 ? 3.296   11.694  51.742  1.00 40.24 ? 1258 GLU A CB    1 
ATOM   2121 C  CG    . GLU A 1 281 ? 2.331   10.684  51.174  1.00 42.70 ? 1258 GLU A CG    1 
ATOM   2122 C  CD    . GLU A 1 281 ? 3.037   9.524   50.515  1.00 45.67 ? 1258 GLU A CD    1 
ATOM   2123 O  OE1   . GLU A 1 281 ? 4.159   9.181   50.965  1.00 45.28 ? 1258 GLU A OE1   1 
ATOM   2124 O  OE2   . GLU A 1 281 ? 2.460   8.955   49.556  1.00 47.10 ? 1258 GLU A OE2   1 
ATOM   2125 N  N     . ILE A 1 282 ? 4.503   14.444  52.753  1.00 40.41 ? 1259 ILE A N     1 
ATOM   2126 C  CA    . ILE A 1 282 ? 5.095   15.177  53.857  1.00 40.50 ? 1259 ILE A CA    1 
ATOM   2127 C  C     . ILE A 1 282 ? 4.247   16.384  54.210  1.00 42.34 ? 1259 ILE A C     1 
ATOM   2128 O  O     . ILE A 1 282 ? 3.956   16.637  55.378  1.00 43.65 ? 1259 ILE A O     1 
ATOM   2129 C  CB    . ILE A 1 282 ? 6.519   15.620  53.541  1.00 38.70 ? 1259 ILE A CB    1 
ATOM   2130 C  CG1   . ILE A 1 282 ? 7.402   14.371  53.405  1.00 39.35 ? 1259 ILE A CG1   1 
ATOM   2131 C  CG2   . ILE A 1 282 ? 7.017   16.576  54.616  1.00 34.54 ? 1259 ILE A CG2   1 
ATOM   2132 C  CD1   . ILE A 1 282 ? 8.879   14.573  53.732  1.00 38.20 ? 1259 ILE A CD1   1 
ATOM   2133 N  N     . VAL A 1 283 ? 3.842   17.132  53.199  1.00 43.38 ? 1260 VAL A N     1 
ATOM   2134 C  CA    . VAL A 1 283 ? 3.023   18.293  53.452  1.00 45.12 ? 1260 VAL A CA    1 
ATOM   2135 C  C     . VAL A 1 283 ? 1.717   17.838  54.083  1.00 46.69 ? 1260 VAL A C     1 
ATOM   2136 O  O     . VAL A 1 283 ? 1.275   18.411  55.082  1.00 47.44 ? 1260 VAL A O     1 
ATOM   2137 C  CB    . VAL A 1 283 ? 2.729   19.071  52.151  1.00 45.21 ? 1260 VAL A CB    1 
ATOM   2138 C  CG1   . VAL A 1 283 ? 1.896   20.304  52.457  1.00 43.63 ? 1260 VAL A CG1   1 
ATOM   2139 C  CG2   . VAL A 1 283 ? 4.040   19.471  51.482  1.00 43.42 ? 1260 VAL A CG2   1 
ATOM   2140 N  N     . ASN A 1 284 ? 1.101   16.805  53.513  1.00 48.63 ? 1261 ASN A N     1 
ATOM   2141 C  CA    . ASN A 1 284 ? -0.169  16.305  54.048  1.00 50.46 ? 1261 ASN A CA    1 
ATOM   2142 C  C     . ASN A 1 284 ? -0.070  15.967  55.529  1.00 50.07 ? 1261 ASN A C     1 
ATOM   2143 O  O     . ASN A 1 284 ? -1.021  16.158  56.284  1.00 51.61 ? 1261 ASN A O     1 
ATOM   2144 C  CB    . ASN A 1 284 ? -0.651  15.072  53.282  1.00 51.83 ? 1261 ASN A CB    1 
ATOM   2145 C  CG    . ASN A 1 284 ? -2.068  14.658  53.683  1.00 54.55 ? 1261 ASN A CG    1 
ATOM   2146 O  OD1   . ASN A 1 284 ? -3.005  15.463  53.605  1.00 54.66 ? 1261 ASN A OD1   1 
ATOM   2147 N  ND2   . ASN A 1 284 ? -2.230  13.402  54.112  1.00 52.52 ? 1261 ASN A ND2   1 
ATOM   2148 N  N     . LEU A 1 285 ? 1.087   15.467  55.938  1.00 49.51 ? 1262 LEU A N     1 
ATOM   2149 C  CA    . LEU A 1 285 ? 1.333   15.119  57.328  1.00 49.02 ? 1262 LEU A CA    1 
ATOM   2150 C  C     . LEU A 1 285 ? 1.497   16.358  58.221  1.00 49.74 ? 1262 LEU A C     1 
ATOM   2151 O  O     . LEU A 1 285 ? 1.425   16.252  59.448  1.00 51.48 ? 1262 LEU A O     1 
ATOM   2152 C  CB    . LEU A 1 285 ? 2.603   14.261  57.412  1.00 48.29 ? 1262 LEU A CB    1 
ATOM   2153 C  CG    . LEU A 1 285 ? 3.132   13.887  58.802  1.00 48.39 ? 1262 LEU A CG    1 
ATOM   2154 C  CD1   . LEU A 1 285 ? 2.120   12.986  59.515  1.00 46.86 ? 1262 LEU A CD1   1 
ATOM   2155 C  CD2   . LEU A 1 285 ? 4.468   13.176  58.673  1.00 46.85 ? 1262 LEU A CD2   1 
ATOM   2156 N  N     . LEU A 1 286 ? 1.715   17.527  57.620  1.00 49.31 ? 1263 LEU A N     1 
ATOM   2157 C  CA    . LEU A 1 286 ? 1.925   18.744  58.402  1.00 50.12 ? 1263 LEU A CA    1 
ATOM   2158 C  C     . LEU A 1 286 ? 0.915   19.859  58.136  1.00 50.70 ? 1263 LEU A C     1 
ATOM   2159 O  O     . LEU A 1 286 ? 0.928   20.884  58.816  1.00 50.92 ? 1263 LEU A O     1 
ATOM   2160 C  CB    . LEU A 1 286 ? 3.340   19.281  58.143  1.00 49.22 ? 1263 LEU A CB    1 
ATOM   2161 C  CG    . LEU A 1 286 ? 4.457   18.245  58.059  1.00 48.87 ? 1263 LEU A CG    1 
ATOM   2162 C  CD1   . LEU A 1 286 ? 5.804   18.928  57.926  1.00 47.82 ? 1263 LEU A CD1   1 
ATOM   2163 C  CD2   . LEU A 1 286 ? 4.419   17.378  59.310  1.00 51.08 ? 1263 LEU A CD2   1 
ATOM   2164 N  N     . LYS A 1 287 ? 0.044   19.653  57.155  1.00 52.68 ? 1264 LYS A N     1 
ATOM   2165 C  CA    . LYS A 1 287 ? -0.954  20.659  56.784  1.00 55.83 ? 1264 LYS A CA    1 
ATOM   2166 C  C     . LYS A 1 287 ? -1.723  21.324  57.924  1.00 57.33 ? 1264 LYS A C     1 
ATOM   2167 O  O     . LYS A 1 287 ? -2.010  22.521  57.862  1.00 57.74 ? 1264 LYS A O     1 
ATOM   2168 C  CB    . LYS A 1 287 ? -1.968  20.069  55.794  1.00 56.54 ? 1264 LYS A CB    1 
ATOM   2169 C  CG    . LYS A 1 287 ? -2.788  18.894  56.327  1.00 57.40 ? 1264 LYS A CG    1 
ATOM   2170 C  CD    . LYS A 1 287 ? -3.875  18.506  55.330  1.00 58.35 ? 1264 LYS A CD    1 
ATOM   2171 C  CE    . LYS A 1 287 ? -4.635  17.278  55.788  1.00 59.06 ? 1264 LYS A CE    1 
ATOM   2172 N  NZ    . LYS A 1 287 ? -5.229  17.472  57.143  1.00 62.32 ? 1264 LYS A NZ    1 
ATOM   2173 N  N     . ASP A 1 288 ? -2.056  20.567  58.961  1.00 58.98 ? 1265 ASP A N     1 
ATOM   2174 C  CA    . ASP A 1 288 ? -2.825  21.130  60.063  1.00 61.65 ? 1265 ASP A CA    1 
ATOM   2175 C  C     . ASP A 1 288 ? -2.076  22.117  60.950  1.00 62.50 ? 1265 ASP A C     1 
ATOM   2176 O  O     . ASP A 1 288 ? -2.605  23.184  61.267  1.00 64.23 ? 1265 ASP A O     1 
ATOM   2177 C  CB    . ASP A 1 288 ? -3.410  20.011  60.928  1.00 63.01 ? 1265 ASP A CB    1 
ATOM   2178 C  CG    . ASP A 1 288 ? -4.251  19.029  60.122  1.00 65.75 ? 1265 ASP A CG    1 
ATOM   2179 O  OD1   . ASP A 1 288 ? -5.216  19.469  59.447  1.00 63.47 ? 1265 ASP A OD1   1 
ATOM   2180 O  OD2   . ASP A 1 288 ? -3.939  17.813  60.167  1.00 67.68 ? 1265 ASP A OD2   1 
ATOM   2181 N  N     . ASP A 1 289 ? -0.853  21.770  61.342  1.00 61.84 ? 1266 ASP A N     1 
ATOM   2182 C  CA    . ASP A 1 289 ? -0.066  22.632  62.220  1.00 61.81 ? 1266 ASP A CA    1 
ATOM   2183 C  C     . ASP A 1 289 ? 0.773   23.674  61.487  1.00 60.99 ? 1266 ASP A C     1 
ATOM   2184 O  O     . ASP A 1 289 ? 1.962   23.829  61.772  1.00 61.19 ? 1266 ASP A O     1 
ATOM   2185 C  CB    . ASP A 1 289 ? 0.861   21.783  63.096  1.00 64.43 ? 1266 ASP A CB    1 
ATOM   2186 C  CG    . ASP A 1 289 ? 0.399   20.339  63.213  1.00 67.43 ? 1266 ASP A CG    1 
ATOM   2187 O  OD1   . ASP A 1 289 ? -0.749  20.094  63.652  1.00 68.44 ? 1266 ASP A OD1   1 
ATOM   2188 O  OD2   . ASP A 1 289 ? 1.193   19.443  62.860  1.00 68.88 ? 1266 ASP A OD2   1 
ATOM   2189 N  N     . LEU A 1 290 ? 0.161   24.394  60.552  1.00 59.34 ? 1267 LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 290 ? 0.885   25.411  59.795  1.00 57.68 ? 1267 LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 290 ? 0.230   26.783  59.849  1.00 57.79 ? 1267 LEU A C     1 
ATOM   2192 O  O     . LEU A 1 290 ? -0.963  26.919  60.135  1.00 57.87 ? 1267 LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 290 ? 1.032   24.992  58.325  1.00 56.56 ? 1267 LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 290 ? 2.005   23.844  58.037  1.00 55.50 ? 1267 LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 290 ? 1.997   23.526  56.556  1.00 54.49 ? 1267 LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 290 ? 3.402   24.228  58.483  1.00 54.63 ? 1267 LEU A CD2   1 
ATOM   2197 N  N     . HIS A 1 291 ? 1.031   27.800  59.566  1.00 57.14 ? 1268 HIS A N     1 
ATOM   2198 C  CA    . HIS A 1 291 ? 0.545   29.162  59.558  1.00 56.51 ? 1268 HIS A CA    1 
ATOM   2199 C  C     . HIS A 1 291 ? -0.696  29.247  58.648  1.00 55.64 ? 1268 HIS A C     1 
ATOM   2200 O  O     . HIS A 1 291 ? -0.743  28.637  57.577  1.00 55.23 ? 1268 HIS A O     1 
ATOM   2201 C  CB    . HIS A 1 291 ? 1.658   30.087  59.085  1.00 57.41 ? 1268 HIS A CB    1 
ATOM   2202 C  CG    . HIS A 1 291 ? 1.281   31.529  59.104  1.00 59.91 ? 1268 HIS A CG    1 
ATOM   2203 N  ND1   . HIS A 1 291 ? 0.397   32.074  58.199  1.00 61.47 ? 1268 HIS A ND1   1 
ATOM   2204 C  CD2   . HIS A 1 291 ? 1.629   32.530  59.945  1.00 61.64 ? 1268 HIS A CD2   1 
ATOM   2205 C  CE1   . HIS A 1 291 ? 0.215   33.352  58.483  1.00 62.43 ? 1268 HIS A CE1   1 
ATOM   2206 N  NE2   . HIS A 1 291 ? 0.951   33.654  59.538  1.00 63.38 ? 1268 HIS A NE2   1 
ATOM   2207 N  N     . PRO A 1 292 ? -1.723  30.002  59.077  1.00 55.06 ? 1269 PRO A N     1 
ATOM   2208 C  CA    . PRO A 1 292 ? -2.974  30.173  58.330  1.00 54.27 ? 1269 PRO A CA    1 
ATOM   2209 C  C     . PRO A 1 292 ? -2.851  30.573  56.866  1.00 52.92 ? 1269 PRO A C     1 
ATOM   2210 O  O     . PRO A 1 292 ? -3.706  30.239  56.049  1.00 52.46 ? 1269 PRO A O     1 
ATOM   2211 C  CB    . PRO A 1 292 ? -3.737  31.205  59.162  1.00 54.25 ? 1269 PRO A CB    1 
ATOM   2212 C  CG    . PRO A 1 292 ? -2.651  31.979  59.828  1.00 55.13 ? 1269 PRO A CG    1 
ATOM   2213 C  CD    . PRO A 1 292 ? -1.714  30.884  60.257  1.00 55.30 ? 1269 PRO A CD    1 
ATOM   2214 N  N     . SER A 1 293 ? -1.786  31.283  56.536  1.00 51.93 ? 1270 SER A N     1 
ATOM   2215 C  CA    . SER A 1 293 ? -1.558  31.725  55.171  1.00 52.80 ? 1270 SER A CA    1 
ATOM   2216 C  C     . SER A 1 293 ? -1.132  30.598  54.228  1.00 52.34 ? 1270 SER A C     1 
ATOM   2217 O  O     . SER A 1 293 ? -1.317  30.694  53.004  1.00 52.19 ? 1270 SER A O     1 
ATOM   2218 C  CB    . SER A 1 293 ? -0.472  32.797  55.175  1.00 55.02 ? 1270 SER A CB    1 
ATOM   2219 O  OG    . SER A 1 293 ? 0.023   33.013  53.866  1.00 59.48 ? 1270 SER A OG    1 
ATOM   2220 N  N     . PHE A 1 294 ? -0.565  29.535  54.794  1.00 50.05 ? 1271 PHE A N     1 
ATOM   2221 C  CA    . PHE A 1 294 ? -0.080  28.427  53.989  1.00 49.55 ? 1271 PHE A CA    1 
ATOM   2222 C  C     . PHE A 1 294 ? -0.996  27.984  52.856  1.00 49.97 ? 1271 PHE A C     1 
ATOM   2223 O  O     . PHE A 1 294 ? -0.563  27.884  51.709  1.00 49.81 ? 1271 PHE A O     1 
ATOM   2224 C  CB    . PHE A 1 294 ? 0.232   27.217  54.860  1.00 48.76 ? 1271 PHE A CB    1 
ATOM   2225 C  CG    . PHE A 1 294 ? 1.089   26.209  54.176  1.00 46.27 ? 1271 PHE A CG    1 
ATOM   2226 C  CD1   . PHE A 1 294 ? 2.418   26.503  53.879  1.00 45.92 ? 1271 PHE A CD1   1 
ATOM   2227 C  CD2   . PHE A 1 294 ? 0.576   24.978  53.803  1.00 46.43 ? 1271 PHE A CD2   1 
ATOM   2228 C  CE1   . PHE A 1 294 ? 3.233   25.578  53.219  1.00 45.59 ? 1271 PHE A CE1   1 
ATOM   2229 C  CE2   . PHE A 1 294 ? 1.382   24.039  53.141  1.00 47.72 ? 1271 PHE A CE2   1 
ATOM   2230 C  CZ    . PHE A 1 294 ? 2.714   24.343  52.848  1.00 46.04 ? 1271 PHE A CZ    1 
ATOM   2231 N  N     . PRO A 1 295 ? -2.275  27.711  53.160  1.00 50.51 ? 1272 PRO A N     1 
ATOM   2232 C  CA    . PRO A 1 295 ? -3.249  27.272  52.157  1.00 51.09 ? 1272 PRO A CA    1 
ATOM   2233 C  C     . PRO A 1 295 ? -3.428  28.249  51.003  1.00 51.82 ? 1272 PRO A C     1 
ATOM   2234 O  O     . PRO A 1 295 ? -3.829  27.856  49.904  1.00 52.02 ? 1272 PRO A O     1 
ATOM   2235 C  CB    . PRO A 1 295 ? -4.533  27.122  52.970  1.00 50.17 ? 1272 PRO A CB    1 
ATOM   2236 C  CG    . PRO A 1 295 ? -4.046  26.806  54.333  1.00 49.09 ? 1272 PRO A CG    1 
ATOM   2237 C  CD    . PRO A 1 295 ? -2.903  27.764  54.492  1.00 50.32 ? 1272 PRO A CD    1 
ATOM   2238 N  N     . GLU A 1 296 ? -3.135  29.521  51.259  1.00 52.11 ? 1273 GLU A N     1 
ATOM   2239 C  CA    . GLU A 1 296 ? -3.279  30.554  50.235  1.00 53.60 ? 1273 GLU A CA    1 
ATOM   2240 C  C     . GLU A 1 296 ? -2.111  30.588  49.261  1.00 51.72 ? 1273 GLU A C     1 
ATOM   2241 O  O     . GLU A 1 296 ? -2.238  31.115  48.162  1.00 50.22 ? 1273 GLU A O     1 
ATOM   2242 C  CB    . GLU A 1 296 ? -3.365  31.949  50.862  1.00 56.58 ? 1273 GLU A CB    1 
ATOM   2243 C  CG    . GLU A 1 296 ? -4.387  32.155  51.958  1.00 60.96 ? 1273 GLU A CG    1 
ATOM   2244 C  CD    . GLU A 1 296 ? -4.353  33.589  52.467  1.00 64.13 ? 1273 GLU A CD    1 
ATOM   2245 O  OE1   . GLU A 1 296 ? -3.235  34.097  52.724  1.00 64.16 ? 1273 GLU A OE1   1 
ATOM   2246 O  OE2   . GLU A 1 296 ? -5.435  34.209  52.610  1.00 66.41 ? 1273 GLU A OE2   1 
ATOM   2247 N  N     . VAL A 1 297 ? -0.975  30.029  49.668  1.00 50.79 ? 1274 VAL A N     1 
ATOM   2248 C  CA    . VAL A 1 297 ? 0.227   30.056  48.837  1.00 49.40 ? 1274 VAL A CA    1 
ATOM   2249 C  C     . VAL A 1 297 ? 0.815   28.716  48.411  1.00 49.36 ? 1274 VAL A C     1 
ATOM   2250 O  O     . VAL A 1 297 ? 1.444   28.618  47.355  1.00 49.48 ? 1274 VAL A O     1 
ATOM   2251 C  CB    . VAL A 1 297 ? 1.352   30.837  49.548  1.00 49.44 ? 1274 VAL A CB    1 
ATOM   2252 C  CG1   . VAL A 1 297 ? 0.878   32.239  49.876  1.00 46.83 ? 1274 VAL A CG1   1 
ATOM   2253 C  CG2   . VAL A 1 297 ? 1.772   30.112  50.813  1.00 47.67 ? 1274 VAL A CG2   1 
ATOM   2254 N  N     . SER A 1 298 ? 0.618   27.687  49.226  1.00 48.79 ? 1275 SER A N     1 
ATOM   2255 C  CA    . SER A 1 298 ? 1.172   26.370  48.932  1.00 48.12 ? 1275 SER A CA    1 
ATOM   2256 C  C     . SER A 1 298 ? 0.779   25.806  47.578  1.00 48.02 ? 1275 SER A C     1 
ATOM   2257 O  O     . SER A 1 298 ? -0.255  26.157  47.021  1.00 49.55 ? 1275 SER A O     1 
ATOM   2258 C  CB    . SER A 1 298 ? 0.723   25.379  49.987  1.00 48.50 ? 1275 SER A CB    1 
ATOM   2259 O  OG    . SER A 1 298 ? -0.637  25.064  49.775  1.00 51.47 ? 1275 SER A OG    1 
ATOM   2260 N  N     . PHE A 1 299 ? 1.616   24.924  47.050  1.00 46.69 ? 1276 PHE A N     1 
ATOM   2261 C  CA    . PHE A 1 299 ? 1.322   24.266  45.790  1.00 45.21 ? 1276 PHE A CA    1 
ATOM   2262 C  C     . PHE A 1 299 ? 0.293   23.206  46.154  1.00 45.52 ? 1276 PHE A C     1 
ATOM   2263 O  O     . PHE A 1 299 ? -0.643  22.917  45.403  1.00 45.87 ? 1276 PHE A O     1 
ATOM   2264 C  CB    . PHE A 1 299 ? 2.582   23.580  45.253  1.00 43.86 ? 1276 PHE A CB    1 
ATOM   2265 C  CG    . PHE A 1 299 ? 2.297   22.465  44.288  1.00 40.06 ? 1276 PHE A CG    1 
ATOM   2266 C  CD1   . PHE A 1 299 ? 1.672   22.721  43.073  1.00 38.88 ? 1276 PHE A CD1   1 
ATOM   2267 C  CD2   . PHE A 1 299 ? 2.642   21.155  44.603  1.00 38.71 ? 1276 PHE A CD2   1 
ATOM   2268 C  CE1   . PHE A 1 299 ? 1.395   21.687  42.174  1.00 37.17 ? 1276 PHE A CE1   1 
ATOM   2269 C  CE2   . PHE A 1 299 ? 2.370   20.112  43.719  1.00 38.17 ? 1276 PHE A CE2   1 
ATOM   2270 C  CZ    . PHE A 1 299 ? 1.742   20.380  42.497  1.00 37.25 ? 1276 PHE A CZ    1 
ATOM   2271 N  N     . PHE A 1 300 ? 0.497   22.637  47.334  1.00 45.87 ? 1277 PHE A N     1 
ATOM   2272 C  CA    . PHE A 1 300 ? -0.352  21.588  47.862  1.00 48.20 ? 1277 PHE A CA    1 
ATOM   2273 C  C     . PHE A 1 300 ? -1.840  21.913  47.803  1.00 49.04 ? 1277 PHE A C     1 
ATOM   2274 O  O     . PHE A 1 300 ? -2.626  21.121  47.287  1.00 48.84 ? 1277 PHE A O     1 
ATOM   2275 C  CB    . PHE A 1 300 ? 0.063   21.277  49.299  1.00 49.69 ? 1277 PHE A CB    1 
ATOM   2276 C  CG    . PHE A 1 300 ? -0.651  20.103  49.894  1.00 50.63 ? 1277 PHE A CG    1 
ATOM   2277 C  CD1   . PHE A 1 300 ? -1.750  20.284  50.724  1.00 50.37 ? 1277 PHE A CD1   1 
ATOM   2278 C  CD2   . PHE A 1 300 ? -0.225  18.810  49.623  1.00 52.00 ? 1277 PHE A CD2   1 
ATOM   2279 C  CE1   . PHE A 1 300 ? -2.413  19.196  51.279  1.00 49.01 ? 1277 PHE A CE1   1 
ATOM   2280 C  CE2   . PHE A 1 300 ? -0.892  17.705  50.178  1.00 51.49 ? 1277 PHE A CE2   1 
ATOM   2281 C  CZ    . PHE A 1 300 ? -1.984  17.906  51.006  1.00 50.59 ? 1277 PHE A CZ    1 
ATOM   2282 N  N     . HIS A 1 301 ? -2.223  23.076  48.326  1.00 49.49 ? 1278 HIS A N     1 
ATOM   2283 C  CA    . HIS A 1 301 ? -3.627  23.470  48.334  1.00 49.48 ? 1278 HIS A CA    1 
ATOM   2284 C  C     . HIS A 1 301 ? -4.037  24.169  47.049  1.00 50.15 ? 1278 HIS A C     1 
ATOM   2285 O  O     . HIS A 1 301 ? -5.116  24.752  46.969  1.00 49.75 ? 1278 HIS A O     1 
ATOM   2286 C  CB    . HIS A 1 301 ? -3.913  24.392  49.519  1.00 50.85 ? 1278 HIS A CB    1 
ATOM   2287 C  CG    . HIS A 1 301 ? -3.673  23.759  50.855  1.00 52.61 ? 1278 HIS A CG    1 
ATOM   2288 N  ND1   . HIS A 1 301 ? -2.455  23.813  51.499  1.00 53.49 ? 1278 HIS A ND1   1 
ATOM   2289 C  CD2   . HIS A 1 301 ? -4.495  23.053  51.667  1.00 52.21 ? 1278 HIS A CD2   1 
ATOM   2290 C  CE1   . HIS A 1 301 ? -2.537  23.169  52.652  1.00 52.26 ? 1278 HIS A CE1   1 
ATOM   2291 N  NE2   . HIS A 1 301 ? -3.763  22.698  52.778  1.00 51.99 ? 1278 HIS A NE2   1 
ATOM   2292 N  N     . SER A 1 302 ? -3.176  24.102  46.042  1.00 50.92 ? 1279 SER A N     1 
ATOM   2293 C  CA    . SER A 1 302 ? -3.419  24.748  44.759  1.00 51.04 ? 1279 SER A CA    1 
ATOM   2294 C  C     . SER A 1 302 ? -4.331  23.939  43.830  1.00 52.17 ? 1279 SER A C     1 
ATOM   2295 O  O     . SER A 1 302 ? -4.487  22.735  43.996  1.00 52.97 ? 1279 SER A O     1 
ATOM   2296 C  CB    . SER A 1 302 ? -2.051  25.004  44.104  1.00 50.54 ? 1279 SER A CB    1 
ATOM   2297 O  OG    . SER A 1 302 ? -2.100  25.046  42.695  1.00 52.55 ? 1279 SER A OG    1 
ATOM   2298 N  N     . GLU A 1 303 ? -4.936  24.609  42.853  1.00 54.17 ? 1280 GLU A N     1 
ATOM   2299 C  CA    . GLU A 1 303 ? -5.796  23.932  41.893  1.00 56.25 ? 1280 GLU A CA    1 
ATOM   2300 C  C     . GLU A 1 303 ? -4.891  23.089  40.999  1.00 58.27 ? 1280 GLU A C     1 
ATOM   2301 O  O     . GLU A 1 303 ? -5.309  22.050  40.474  1.00 60.17 ? 1280 GLU A O     1 
ATOM   2302 C  CB    . GLU A 1 303 ? -6.573  24.943  41.046  1.00 55.54 ? 1280 GLU A CB    1 
ATOM   2303 N  N     . GLU A 1 304 ? -3.649  23.538  40.838  1.00 58.84 ? 1281 GLU A N     1 
ATOM   2304 C  CA    . GLU A 1 304 ? -2.681  22.830  40.011  1.00 59.80 ? 1281 GLU A CA    1 
ATOM   2305 C  C     . GLU A 1 304 ? -2.432  21.426  40.546  1.00 59.98 ? 1281 GLU A C     1 
ATOM   2306 O  O     . GLU A 1 304 ? -2.142  20.510  39.782  1.00 60.11 ? 1281 GLU A O     1 
ATOM   2307 C  CB    . GLU A 1 304 ? -1.364  23.608  39.956  1.00 61.42 ? 1281 GLU A CB    1 
ATOM   2308 C  CG    . GLU A 1 304 ? -0.663  23.546  38.608  1.00 62.81 ? 1281 GLU A CG    1 
ATOM   2309 C  CD    . GLU A 1 304 ? 0.726   24.155  38.641  1.00 64.06 ? 1281 GLU A CD    1 
ATOM   2310 O  OE1   . GLU A 1 304 ? 0.897   25.217  39.279  1.00 63.76 ? 1281 GLU A OE1   1 
ATOM   2311 O  OE2   . GLU A 1 304 ? 1.645   23.572  38.020  1.00 64.71 ? 1281 GLU A OE2   1 
ATOM   2312 N  N     . ASN A 1 305 ? -2.547  21.256  41.857  1.00 59.82 ? 1282 ASN A N     1 
ATOM   2313 C  CA    . ASN A 1 305 ? -2.334  19.945  42.450  1.00 61.46 ? 1282 ASN A CA    1 
ATOM   2314 C  C     . ASN A 1 305 ? -3.575  19.051  42.271  1.00 64.56 ? 1282 ASN A C     1 
ATOM   2315 O  O     . ASN A 1 305 ? -4.336  18.814  43.220  1.00 64.65 ? 1282 ASN A O     1 
ATOM   2316 C  CB    . ASN A 1 305 ? -1.979  20.093  43.930  1.00 57.27 ? 1282 ASN A CB    1 
ATOM   2317 C  CG    . ASN A 1 305 ? -1.519  18.796  44.538  1.00 53.62 ? 1282 ASN A CG    1 
ATOM   2318 O  OD1   . ASN A 1 305 ? -0.823  18.017  43.889  1.00 52.46 ? 1282 ASN A OD1   1 
ATOM   2319 N  ND2   . ASN A 1 305 ? -1.891  18.555  45.786  1.00 50.95 ? 1282 ASN A ND2   1 
ATOM   2320 N  N     . LYS A 1 306 ? -3.762  18.563  41.041  1.00 67.42 ? 1283 LYS A N     1 
ATOM   2321 C  CA    . LYS A 1 306 ? -4.898  17.708  40.680  1.00 69.49 ? 1283 LYS A CA    1 
ATOM   2322 C  C     . LYS A 1 306 ? -4.528  16.224  40.613  1.00 70.12 ? 1283 LYS A C     1 
ATOM   2323 O  O     . LYS A 1 306 ? -3.339  15.932  40.351  1.00 70.74 ? 1283 LYS A O     1 
ATOM   2324 C  CB    . LYS A 1 306 ? -5.470  18.147  39.324  1.00 68.69 ? 1283 LYS A CB    1 
ATOM   2325 N  N     . ASP B 1 10  ? 5.056   35.805  14.562  1.00 68.99 ? 987  ASP B N     1 
ATOM   2326 C  CA    . ASP B 1 10  ? 5.000   36.907  15.568  1.00 69.93 ? 987  ASP B CA    1 
ATOM   2327 C  C     . ASP B 1 10  ? 6.173   37.871  15.426  1.00 69.34 ? 987  ASP B C     1 
ATOM   2328 O  O     . ASP B 1 10  ? 6.038   39.063  15.711  1.00 69.50 ? 987  ASP B O     1 
ATOM   2329 C  CB    . ASP B 1 10  ? 4.935   36.330  16.979  1.00 70.83 ? 987  ASP B CB    1 
ATOM   2330 C  CG    . ASP B 1 10  ? 3.561   35.768  17.307  1.00 73.26 ? 987  ASP B CG    1 
ATOM   2331 O  OD1   . ASP B 1 10  ? 3.072   34.902  16.550  1.00 75.08 ? 987  ASP B OD1   1 
ATOM   2332 O  OD2   . ASP B 1 10  ? 2.962   36.195  18.317  1.00 74.63 ? 987  ASP B OD2   1 
ATOM   2333 N  N     . GLU B 1 11  ? 7.326   37.361  14.998  1.00 67.79 ? 988  GLU B N     1 
ATOM   2334 C  CA    . GLU B 1 11  ? 8.472   38.224  14.744  1.00 66.60 ? 988  GLU B CA    1 
ATOM   2335 C  C     . GLU B 1 11  ? 8.062   39.107  13.546  1.00 66.03 ? 988  GLU B C     1 
ATOM   2336 O  O     . GLU B 1 11  ? 8.766   40.049  13.172  1.00 65.54 ? 988  GLU B O     1 
ATOM   2337 C  CB    . GLU B 1 11  ? 9.702   37.385  14.386  1.00 67.10 ? 988  GLU B CB    1 
ATOM   2338 N  N     . TRP B 1 12  ? 6.908   38.783  12.956  1.00 64.64 ? 989  TRP B N     1 
ATOM   2339 C  CA    . TRP B 1 12  ? 6.361   39.513  11.808  1.00 62.70 ? 989  TRP B CA    1 
ATOM   2340 C  C     . TRP B 1 12  ? 5.286   40.515  12.222  1.00 61.82 ? 989  TRP B C     1 
ATOM   2341 O  O     . TRP B 1 12  ? 4.792   41.282  11.399  1.00 60.59 ? 989  TRP B O     1 
ATOM   2342 C  CB    . TRP B 1 12  ? 5.748   38.536  10.798  1.00 61.93 ? 989  TRP B CB    1 
ATOM   2343 C  CG    . TRP B 1 12  ? 6.734   37.634  10.139  1.00 61.45 ? 989  TRP B CG    1 
ATOM   2344 C  CD1   . TRP B 1 12  ? 7.171   36.424  10.592  1.00 61.62 ? 989  TRP B CD1   1 
ATOM   2345 C  CD2   . TRP B 1 12  ? 7.438   37.885  8.916   1.00 61.92 ? 989  TRP B CD2   1 
ATOM   2346 N  NE1   . TRP B 1 12  ? 8.105   35.903  9.728   1.00 60.71 ? 989  TRP B NE1   1 
ATOM   2347 C  CE2   . TRP B 1 12  ? 8.288   36.779  8.690   1.00 61.27 ? 989  TRP B CE2   1 
ATOM   2348 C  CE3   . TRP B 1 12  ? 7.434   38.937  7.988   1.00 60.92 ? 989  TRP B CE3   1 
ATOM   2349 C  CZ2   . TRP B 1 12  ? 9.126   36.694  7.572   1.00 61.82 ? 989  TRP B CZ2   1 
ATOM   2350 C  CZ3   . TRP B 1 12  ? 8.269   38.851  6.875   1.00 61.02 ? 989  TRP B CZ3   1 
ATOM   2351 C  CH2   . TRP B 1 12  ? 9.102   37.738  6.680   1.00 61.65 ? 989  TRP B CH2   1 
ATOM   2352 N  N     . GLU B 1 13  ? 4.924   40.495  13.498  1.00 61.84 ? 990  GLU B N     1 
ATOM   2353 C  CA    . GLU B 1 13  ? 3.909   41.395  14.026  1.00 62.09 ? 990  GLU B CA    1 
ATOM   2354 C  C     . GLU B 1 13  ? 4.314   42.847  13.850  1.00 62.03 ? 990  GLU B C     1 
ATOM   2355 O  O     . GLU B 1 13  ? 5.484   43.203  14.002  1.00 61.43 ? 990  GLU B O     1 
ATOM   2356 C  CB    . GLU B 1 13  ? 3.700   41.124  15.512  1.00 62.57 ? 990  GLU B CB    1 
ATOM   2357 C  CG    . GLU B 1 13  ? 2.490   41.814  16.095  1.00 63.10 ? 990  GLU B CG    1 
ATOM   2358 C  CD    . GLU B 1 13  ? 1.202   41.275  15.527  1.00 63.91 ? 990  GLU B CD    1 
ATOM   2359 O  OE1   . GLU B 1 13  ? 1.105   40.043  15.375  1.00 65.00 ? 990  GLU B OE1   1 
ATOM   2360 O  OE2   . GLU B 1 13  ? 0.280   42.071  15.243  1.00 66.01 ? 990  GLU B OE2   1 
ATOM   2361 N  N     . VAL B 1 14  ? 3.338   43.685  13.528  1.00 62.59 ? 991  VAL B N     1 
ATOM   2362 C  CA    . VAL B 1 14  ? 3.589   45.109  13.356  1.00 63.76 ? 991  VAL B CA    1 
ATOM   2363 C  C     . VAL B 1 14  ? 2.474   45.901  14.029  1.00 64.17 ? 991  VAL B C     1 
ATOM   2364 O  O     . VAL B 1 14  ? 1.301   45.525  13.953  1.00 64.08 ? 991  VAL B O     1 
ATOM   2365 C  CB    . VAL B 1 14  ? 3.664   45.495  11.861  1.00 64.22 ? 991  VAL B CB    1 
ATOM   2366 C  CG1   . VAL B 1 14  ? 4.907   44.880  11.222  1.00 63.89 ? 991  VAL B CG1   1 
ATOM   2367 C  CG2   . VAL B 1 14  ? 2.411   45.024  11.144  1.00 64.91 ? 991  VAL B CG2   1 
ATOM   2368 N  N     . SER B 1 15  ? 2.848   46.995  14.689  1.00 64.82 ? 992  SER B N     1 
ATOM   2369 C  CA    . SER B 1 15  ? 1.888   47.850  15.386  1.00 64.54 ? 992  SER B CA    1 
ATOM   2370 C  C     . SER B 1 15  ? 0.876   48.431  14.400  1.00 63.47 ? 992  SER B C     1 
ATOM   2371 O  O     . SER B 1 15  ? 1.259   49.027  13.394  1.00 63.13 ? 992  SER B O     1 
ATOM   2372 C  CB    . SER B 1 15  ? 2.632   48.989  16.088  1.00 64.61 ? 992  SER B CB    1 
ATOM   2373 O  OG    . SER B 1 15  ? 3.815   48.516  16.714  1.00 64.41 ? 992  SER B OG    1 
ATOM   2374 N  N     . ARG B 1 16  ? -0.410  48.260  14.689  1.00 63.36 ? 993  ARG B N     1 
ATOM   2375 C  CA    . ARG B 1 16  ? -1.460  48.771  13.811  1.00 63.95 ? 993  ARG B CA    1 
ATOM   2376 C  C     . ARG B 1 16  ? -1.354  50.284  13.610  1.00 65.55 ? 993  ARG B C     1 
ATOM   2377 O  O     . ARG B 1 16  ? -2.005  50.857  12.728  1.00 65.86 ? 993  ARG B O     1 
ATOM   2378 C  CB    . ARG B 1 16  ? -2.836  48.430  14.372  1.00 63.12 ? 993  ARG B CB    1 
ATOM   2379 C  CG    . ARG B 1 16  ? -3.983  48.937  13.524  1.00 62.99 ? 993  ARG B CG    1 
ATOM   2380 C  CD    . ARG B 1 16  ? -5.301  48.638  14.194  1.00 63.66 ? 993  ARG B CD    1 
ATOM   2381 N  NE    . ARG B 1 16  ? -5.480  47.207  14.406  1.00 63.98 ? 993  ARG B NE    1 
ATOM   2382 C  CZ    . ARG B 1 16  ? -5.693  46.332  13.431  1.00 64.73 ? 993  ARG B CZ    1 
ATOM   2383 N  NH1   . ARG B 1 16  ? -5.756  46.747  12.173  1.00 65.25 ? 993  ARG B NH1   1 
ATOM   2384 N  NH2   . ARG B 1 16  ? -5.842  45.045  13.712  1.00 65.21 ? 993  ARG B NH2   1 
ATOM   2385 N  N     . GLU B 1 17  ? -0.529  50.925  14.434  1.00 67.15 ? 994  GLU B N     1 
ATOM   2386 C  CA    . GLU B 1 17  ? -0.328  52.372  14.355  1.00 68.52 ? 994  GLU B CA    1 
ATOM   2387 C  C     . GLU B 1 17  ? 0.664   52.729  13.245  1.00 67.25 ? 994  GLU B C     1 
ATOM   2388 O  O     . GLU B 1 17  ? 0.612   53.828  12.681  1.00 66.70 ? 994  GLU B O     1 
ATOM   2389 C  CB    . GLU B 1 17  ? 0.186   52.926  15.695  1.00 71.28 ? 994  GLU B CB    1 
ATOM   2390 C  CG    . GLU B 1 17  ? -0.744  52.689  16.887  1.00 75.45 ? 994  GLU B CG    1 
ATOM   2391 C  CD    . GLU B 1 17  ? -0.669  51.263  17.422  1.00 79.16 ? 994  GLU B CD    1 
ATOM   2392 O  OE1   . GLU B 1 17  ? 0.438   50.848  17.838  1.00 81.30 ? 994  GLU B OE1   1 
ATOM   2393 O  OE2   . GLU B 1 17  ? -1.709  50.559  17.428  1.00 79.71 ? 994  GLU B OE2   1 
ATOM   2394 N  N     . LYS B 1 18  ? 1.567   51.798  12.938  1.00 64.92 ? 995  LYS B N     1 
ATOM   2395 C  CA    . LYS B 1 18  ? 2.553   52.025  11.889  1.00 63.24 ? 995  LYS B CA    1 
ATOM   2396 C  C     . LYS B 1 18  ? 1.901   51.899  10.521  1.00 62.00 ? 995  LYS B C     1 
ATOM   2397 O  O     . LYS B 1 18  ? 2.536   52.168  9.501   1.00 61.89 ? 995  LYS B O     1 
ATOM   2398 C  CB    . LYS B 1 18  ? 3.713   51.022  11.986  1.00 64.87 ? 995  LYS B CB    1 
ATOM   2399 C  CG    . LYS B 1 18  ? 4.739   51.309  13.078  1.00 66.10 ? 995  LYS B CG    1 
ATOM   2400 C  CD    . LYS B 1 18  ? 4.082   51.300  14.452  1.00 71.38 ? 995  LYS B CD    1 
ATOM   2401 C  CE    . LYS B 1 18  ? 5.065   51.620  15.589  1.00 73.72 ? 995  LYS B CE    1 
ATOM   2402 N  NZ    . LYS B 1 18  ? 4.380   51.734  16.924  1.00 73.89 ? 995  LYS B NZ    1 
ATOM   2403 N  N     . ILE B 1 19  ? 0.631   51.494  10.502  1.00 60.81 ? 996  ILE B N     1 
ATOM   2404 C  CA    . ILE B 1 19  ? -0.093  51.317  9.249   1.00 59.26 ? 996  ILE B CA    1 
ATOM   2405 C  C     . ILE B 1 19  ? -1.157  52.381  8.988   1.00 59.79 ? 996  ILE B C     1 
ATOM   2406 O  O     . ILE B 1 19  ? -1.885  52.798  9.895   1.00 60.45 ? 996  ILE B O     1 
ATOM   2407 C  CB    . ILE B 1 19  ? -0.759  49.928  9.190   1.00 58.39 ? 996  ILE B CB    1 
ATOM   2408 C  CG1   . ILE B 1 19  ? 0.239   48.849  9.631   1.00 58.41 ? 996  ILE B CG1   1 
ATOM   2409 C  CG2   . ILE B 1 19  ? -1.243  49.645  7.777   1.00 56.97 ? 996  ILE B CG2   1 
ATOM   2410 C  CD1   . ILE B 1 19  ? 1.547   48.827  8.854   1.00 55.95 ? 996  ILE B CD1   1 
ATOM   2411 N  N     . THR B 1 20  ? -1.231  52.807  7.731   1.00 59.89 ? 997  THR B N     1 
ATOM   2412 C  CA    . THR B 1 20  ? -2.182  53.813  7.289   1.00 60.93 ? 997  THR B CA    1 
ATOM   2413 C  C     . THR B 1 20  ? -2.718  53.436  5.911   1.00 61.08 ? 997  THR B C     1 
ATOM   2414 O  O     . THR B 1 20  ? -1.951  53.290  4.958   1.00 61.27 ? 997  THR B O     1 
ATOM   2415 C  CB    . THR B 1 20  ? -1.511  55.202  7.178   1.00 63.29 ? 997  THR B CB    1 
ATOM   2416 O  OG1   . THR B 1 20  ? -0.366  55.118  6.313   1.00 63.94 ? 997  THR B OG1   1 
ATOM   2417 C  CG2   . THR B 1 20  ? -1.082  55.701  8.557   1.00 63.49 ? 997  THR B CG2   1 
ATOM   2418 N  N     . LEU B 1 21  ? -4.031  53.282  5.805   1.00 60.72 ? 998  LEU B N     1 
ATOM   2419 C  CA    . LEU B 1 21  ? -4.648  52.937  4.534   1.00 60.58 ? 998  LEU B CA    1 
ATOM   2420 C  C     . LEU B 1 21  ? -4.892  54.184  3.690   1.00 62.12 ? 998  LEU B C     1 
ATOM   2421 O  O     . LEU B 1 21  ? -5.468  55.162  4.166   1.00 62.30 ? 998  LEU B O     1 
ATOM   2422 C  CB    . LEU B 1 21  ? -5.977  52.228  4.770   1.00 59.57 ? 998  LEU B CB    1 
ATOM   2423 C  CG    . LEU B 1 21  ? -5.952  51.030  5.719   1.00 58.33 ? 998  LEU B CG    1 
ATOM   2424 C  CD1   . LEU B 1 21  ? -7.307  50.333  5.682   1.00 57.72 ? 998  LEU B CD1   1 
ATOM   2425 C  CD2   . LEU B 1 21  ? -4.847  50.069  5.311   1.00 58.28 ? 998  LEU B CD2   1 
ATOM   2426 N  N     . LEU B 1 22  ? -4.454  54.140  2.433   1.00 63.56 ? 999  LEU B N     1 
ATOM   2427 C  CA    . LEU B 1 22  ? -4.620  55.258  1.499   1.00 63.70 ? 999  LEU B CA    1 
ATOM   2428 C  C     . LEU B 1 22  ? -5.914  55.142  0.704   1.00 63.93 ? 999  LEU B C     1 
ATOM   2429 O  O     . LEU B 1 22  ? -6.825  55.955  0.849   1.00 64.48 ? 999  LEU B O     1 
ATOM   2430 C  CB    . LEU B 1 22  ? -3.447  55.305  0.522   1.00 65.68 ? 999  LEU B CB    1 
ATOM   2431 C  CG    . LEU B 1 22  ? -2.286  56.248  0.837   1.00 68.17 ? 999  LEU B CG    1 
ATOM   2432 C  CD1   . LEU B 1 22  ? -2.736  57.679  0.572   1.00 68.48 ? 999  LEU B CD1   1 
ATOM   2433 C  CD2   . LEU B 1 22  ? -1.825  56.072  2.284   1.00 69.22 ? 999  LEU B CD2   1 
ATOM   2434 N  N     . ARG B 1 23  ? -5.987  54.122  -0.141  1.00 63.56 ? 1000 ARG B N     1 
ATOM   2435 C  CA    . ARG B 1 23  ? -7.160  53.902  -0.968  1.00 63.22 ? 1000 ARG B CA    1 
ATOM   2436 C  C     . ARG B 1 23  ? -7.472  52.421  -1.017  1.00 62.28 ? 1000 ARG B C     1 
ATOM   2437 O  O     . ARG B 1 23  ? -6.847  51.620  -0.341  1.00 62.16 ? 1000 ARG B O     1 
ATOM   2438 C  CB    . ARG B 1 23  ? -6.893  54.402  -2.392  1.00 64.09 ? 1000 ARG B CB    1 
ATOM   2439 C  CG    . ARG B 1 23  ? -5.709  53.710  -3.080  1.00 66.91 ? 1000 ARG B CG    1 
ATOM   2440 C  CD    . ARG B 1 23  ? -5.441  54.261  -4.476  1.00 69.06 ? 1000 ARG B CD    1 
ATOM   2441 N  NE    . ARG B 1 23  ? -6.621  54.175  -5.337  1.00 73.69 ? 1000 ARG B NE    1 
ATOM   2442 C  CZ    . ARG B 1 23  ? -7.239  55.226  -5.882  1.00 75.30 ? 1000 ARG B CZ    1 
ATOM   2443 N  NH1   . ARG B 1 23  ? -6.791  56.455  -5.663  1.00 76.29 ? 1000 ARG B NH1   1 
ATOM   2444 N  NH2   . ARG B 1 23  ? -8.315  55.056  -6.644  1.00 74.95 ? 1000 ARG B NH2   1 
ATOM   2445 N  N     . GLU B 1 24  ? -8.452  52.068  -1.829  1.00 62.01 ? 1001 GLU B N     1 
ATOM   2446 C  CA    . GLU B 1 24  ? -8.823  50.681  -2.006  1.00 61.57 ? 1001 GLU B CA    1 
ATOM   2447 C  C     . GLU B 1 24  ? -8.247  50.275  -3.351  1.00 61.39 ? 1001 GLU B C     1 
ATOM   2448 O  O     . GLU B 1 24  ? -8.445  50.968  -4.344  1.00 61.78 ? 1001 GLU B O     1 
ATOM   2449 C  CB    . GLU B 1 24  ? -10.341 50.542  -2.002  1.00 61.55 ? 1001 GLU B CB    1 
ATOM   2450 C  CG    . GLU B 1 24  ? -10.959 50.828  -0.646  1.00 63.34 ? 1001 GLU B CG    1 
ATOM   2451 C  CD    . GLU B 1 24  ? -12.472 50.686  -0.635  1.00 65.28 ? 1001 GLU B CD    1 
ATOM   2452 O  OE1   . GLU B 1 24  ? -13.051 50.662  0.474   1.00 66.31 ? 1001 GLU B OE1   1 
ATOM   2453 O  OE2   . GLU B 1 24  ? -13.087 50.605  -1.722  1.00 65.43 ? 1001 GLU B OE2   1 
ATOM   2454 N  N     . LEU B 1 25  ? -7.527  49.161  -3.383  1.00 60.68 ? 1002 LEU B N     1 
ATOM   2455 C  CA    . LEU B 1 25  ? -6.927  48.699  -4.623  1.00 59.93 ? 1002 LEU B CA    1 
ATOM   2456 C  C     . LEU B 1 25  ? -7.874  47.794  -5.389  1.00 59.95 ? 1002 LEU B C     1 
ATOM   2457 O  O     . LEU B 1 25  ? -7.981  47.869  -6.615  1.00 61.12 ? 1002 LEU B O     1 
ATOM   2458 C  CB    . LEU B 1 25  ? -5.621  47.952  -4.342  1.00 58.64 ? 1002 LEU B CB    1 
ATOM   2459 C  CG    . LEU B 1 25  ? -4.395  48.811  -4.042  1.00 57.94 ? 1002 LEU B CG    1 
ATOM   2460 C  CD1   . LEU B 1 25  ? -3.185  47.928  -3.845  1.00 56.86 ? 1002 LEU B CD1   1 
ATOM   2461 C  CD2   . LEU B 1 25  ? -4.166  49.778  -5.191  1.00 57.86 ? 1002 LEU B CD2   1 
ATOM   2462 N  N     . GLY B 1 26  ? -8.564  46.935  -4.660  1.00 58.60 ? 1003 GLY B N     1 
ATOM   2463 C  CA    . GLY B 1 26  ? -9.475  46.019  -5.304  1.00 57.58 ? 1003 GLY B CA    1 
ATOM   2464 C  C     . GLY B 1 26  ? -10.129 45.099  -4.302  1.00 57.85 ? 1003 GLY B C     1 
ATOM   2465 O  O     . GLY B 1 26  ? -9.637  44.874  -3.200  1.00 58.63 ? 1003 GLY B O     1 
ATOM   2466 N  N     . GLN B 1 27  ? -11.260 44.559  -4.705  1.00 57.57 ? 1004 GLN B N     1 
ATOM   2467 C  CA    . GLN B 1 27  ? -12.018 43.670  -3.868  1.00 58.04 ? 1004 GLN B CA    1 
ATOM   2468 C  C     . GLN B 1 27  ? -11.560 42.228  -4.071  1.00 58.05 ? 1004 GLN B C     1 
ATOM   2469 O  O     . GLN B 1 27  ? -11.348 41.782  -5.204  1.00 57.87 ? 1004 GLN B O     1 
ATOM   2470 C  CB    . GLN B 1 27  ? -13.482 43.820  -4.239  1.00 59.74 ? 1004 GLN B CB    1 
ATOM   2471 C  CG    . GLN B 1 27  ? -14.455 43.183  -3.304  1.00 63.67 ? 1004 GLN B CG    1 
ATOM   2472 C  CD    . GLN B 1 27  ? -15.861 43.627  -3.619  1.00 66.07 ? 1004 GLN B CD    1 
ATOM   2473 O  OE1   . GLN B 1 27  ? -16.354 43.425  -4.734  1.00 66.69 ? 1004 GLN B OE1   1 
ATOM   2474 N  NE2   . GLN B 1 27  ? -16.515 44.256  -2.644  1.00 68.01 ? 1004 GLN B NE2   1 
ATOM   2475 N  N     . GLY B 1 28  ? -11.398 41.512  -2.966  1.00 57.03 ? 1005 GLY B N     1 
ATOM   2476 C  CA    . GLY B 1 28  ? -11.000 40.123  -3.033  1.00 56.93 ? 1005 GLY B CA    1 
ATOM   2477 C  C     . GLY B 1 28  ? -12.258 39.333  -2.753  1.00 56.92 ? 1005 GLY B C     1 
ATOM   2478 O  O     . GLY B 1 28  ? -13.260 39.903  -2.324  1.00 57.51 ? 1005 GLY B O     1 
ATOM   2479 N  N     . SER B 1 29  ? -12.215 38.029  -2.984  1.00 57.08 ? 1006 SER B N     1 
ATOM   2480 C  CA    . SER B 1 29  ? -13.379 37.178  -2.771  1.00 58.02 ? 1006 SER B CA    1 
ATOM   2481 C  C     . SER B 1 29  ? -14.003 37.270  -1.369  1.00 57.46 ? 1006 SER B C     1 
ATOM   2482 O  O     . SER B 1 29  ? -15.227 37.141  -1.207  1.00 57.66 ? 1006 SER B O     1 
ATOM   2483 C  CB    . SER B 1 29  ? -12.992 35.727  -3.094  1.00 59.10 ? 1006 SER B CB    1 
ATOM   2484 O  OG    . SER B 1 29  ? -11.725 35.415  -2.549  1.00 59.42 ? 1006 SER B OG    1 
ATOM   2485 N  N     . PHE B 1 30  ? -13.174 37.496  -0.356  1.00 56.23 ? 1007 PHE B N     1 
ATOM   2486 C  CA    . PHE B 1 30  ? -13.690 37.577  1.003   1.00 55.22 ? 1007 PHE B CA    1 
ATOM   2487 C  C     . PHE B 1 30  ? -12.942 38.608  1.824   1.00 53.28 ? 1007 PHE B C     1 
ATOM   2488 O  O     . PHE B 1 30  ? -12.837 38.506  3.044   1.00 52.88 ? 1007 PHE B O     1 
ATOM   2489 C  CB    . PHE B 1 30  ? -13.603 36.204  1.667   1.00 57.44 ? 1007 PHE B CB    1 
ATOM   2490 C  CG    . PHE B 1 30  ? -12.252 35.563  1.558   1.00 59.59 ? 1007 PHE B CG    1 
ATOM   2491 C  CD1   . PHE B 1 30  ? -11.160 36.085  2.249   1.00 59.81 ? 1007 PHE B CD1   1 
ATOM   2492 C  CD2   . PHE B 1 30  ? -12.076 34.411  0.784   1.00 61.55 ? 1007 PHE B CD2   1 
ATOM   2493 C  CE1   . PHE B 1 30  ? -9.908  35.466  2.178   1.00 62.15 ? 1007 PHE B CE1   1 
ATOM   2494 C  CE2   . PHE B 1 30  ? -10.821 33.777  0.702   1.00 62.76 ? 1007 PHE B CE2   1 
ATOM   2495 C  CZ    . PHE B 1 30  ? -9.734  34.306  1.402   1.00 62.16 ? 1007 PHE B CZ    1 
ATOM   2496 N  N     . GLY B 1 31  ? -12.420 39.609  1.138   1.00 52.01 ? 1008 GLY B N     1 
ATOM   2497 C  CA    . GLY B 1 31  ? -11.694 40.653  1.819   1.00 52.15 ? 1008 GLY B CA    1 
ATOM   2498 C  C     . GLY B 1 31  ? -11.490 41.802  0.864   1.00 52.41 ? 1008 GLY B C     1 
ATOM   2499 O  O     . GLY B 1 31  ? -11.891 41.730  -0.295  1.00 52.29 ? 1008 GLY B O     1 
ATOM   2500 N  N     . MET B 1 32  ? -10.868 42.868  1.345   1.00 51.98 ? 1009 MET B N     1 
ATOM   2501 C  CA    . MET B 1 32  ? -10.621 44.026  0.514   1.00 50.66 ? 1009 MET B CA    1 
ATOM   2502 C  C     . MET B 1 32  ? -9.128  44.285  0.565   1.00 50.25 ? 1009 MET B C     1 
ATOM   2503 O  O     . MET B 1 32  ? -8.510  44.144  1.614   1.00 50.46 ? 1009 MET B O     1 
ATOM   2504 C  CB    . MET B 1 32  ? -11.413 45.219  1.054   1.00 51.87 ? 1009 MET B CB    1 
ATOM   2505 C  CG    . MET B 1 32  ? -11.188 46.550  0.344   1.00 55.61 ? 1009 MET B CG    1 
ATOM   2506 S  SD    . MET B 1 32  ? -11.956 46.712  -1.283  1.00 58.80 ? 1009 MET B SD    1 
ATOM   2507 C  CE    . MET B 1 32  ? -13.672 46.502  -0.866  1.00 58.88 ? 1009 MET B CE    1 
ATOM   2508 N  N     . VAL B 1 33  ? -8.549  44.650  -0.572  1.00 50.17 ? 1010 VAL B N     1 
ATOM   2509 C  CA    . VAL B 1 33  ? -7.124  44.937  -0.641  1.00 50.10 ? 1010 VAL B CA    1 
ATOM   2510 C  C     . VAL B 1 33  ? -6.952  46.447  -0.759  1.00 51.50 ? 1010 VAL B C     1 
ATOM   2511 O  O     . VAL B 1 33  ? -7.490  47.088  -1.666  1.00 52.38 ? 1010 VAL B O     1 
ATOM   2512 C  CB    . VAL B 1 33  ? -6.472  44.225  -1.845  1.00 49.87 ? 1010 VAL B CB    1 
ATOM   2513 C  CG1   . VAL B 1 33  ? -4.988  44.547  -1.913  1.00 46.48 ? 1010 VAL B CG1   1 
ATOM   2514 C  CG2   . VAL B 1 33  ? -6.686  42.724  -1.717  1.00 49.72 ? 1010 VAL B CG2   1 
ATOM   2515 N  N     . TYR B 1 34  ? -6.198  47.012  0.173   1.00 51.88 ? 1011 TYR B N     1 
ATOM   2516 C  CA    . TYR B 1 34  ? -5.983  48.441  0.193   1.00 51.82 ? 1011 TYR B CA    1 
ATOM   2517 C  C     . TYR B 1 34  ? -4.533  48.786  -0.055  1.00 51.36 ? 1011 TYR B C     1 
ATOM   2518 O  O     . TYR B 1 34  ? -3.649  47.956  0.148   1.00 52.22 ? 1011 TYR B O     1 
ATOM   2519 C  CB    . TYR B 1 34  ? -6.365  49.020  1.563   1.00 54.53 ? 1011 TYR B CB    1 
ATOM   2520 C  CG    . TYR B 1 34  ? -7.748  48.687  2.081   1.00 56.20 ? 1011 TYR B CG    1 
ATOM   2521 C  CD1   . TYR B 1 34  ? -8.056  47.410  2.555   1.00 56.60 ? 1011 TYR B CD1   1 
ATOM   2522 C  CD2   . TYR B 1 34  ? -8.746  49.659  2.113   1.00 56.58 ? 1011 TYR B CD2   1 
ATOM   2523 C  CE1   . TYR B 1 34  ? -9.331  47.114  3.048   1.00 57.27 ? 1011 TYR B CE1   1 
ATOM   2524 C  CE2   . TYR B 1 34  ? -10.017 49.374  2.601   1.00 58.24 ? 1011 TYR B CE2   1 
ATOM   2525 C  CZ    . TYR B 1 34  ? -10.304 48.102  3.064   1.00 58.53 ? 1011 TYR B CZ    1 
ATOM   2526 O  OH    . TYR B 1 34  ? -11.577 47.826  3.513   1.00 59.23 ? 1011 TYR B OH    1 
ATOM   2527 N  N     . GLU B 1 35  ? -4.297  50.017  -0.501  1.00 50.14 ? 1012 GLU B N     1 
ATOM   2528 C  CA    . GLU B 1 35  ? -2.938  50.491  -0.677  1.00 49.54 ? 1012 GLU B CA    1 
ATOM   2529 C  C     . GLU B 1 35  ? -2.746  51.357  0.567   1.00 48.97 ? 1012 GLU B C     1 
ATOM   2530 O  O     . GLU B 1 35  ? -3.715  51.904  1.095   1.00 48.09 ? 1012 GLU B O     1 
ATOM   2531 C  CB    . GLU B 1 35  ? -2.777  51.338  -1.936  1.00 49.03 ? 1012 GLU B CB    1 
ATOM   2532 C  CG    . GLU B 1 35  ? -1.377  51.921  -2.050  1.00 49.23 ? 1012 GLU B CG    1 
ATOM   2533 C  CD    . GLU B 1 35  ? -1.208  52.863  -3.225  1.00 51.23 ? 1012 GLU B CD    1 
ATOM   2534 O  OE1   . GLU B 1 35  ? -0.134  53.499  -3.311  1.00 51.59 ? 1012 GLU B OE1   1 
ATOM   2535 O  OE2   . GLU B 1 35  ? -2.136  52.971  -4.064  1.00 51.96 ? 1012 GLU B OE2   1 
ATOM   2536 N  N     . GLY B 1 36  ? -1.516  51.478  1.044   1.00 48.05 ? 1013 GLY B N     1 
ATOM   2537 C  CA    . GLY B 1 36  ? -1.294  52.283  2.219   1.00 48.72 ? 1013 GLY B CA    1 
ATOM   2538 C  C     . GLY B 1 36  ? 0.171   52.498  2.479   1.00 50.55 ? 1013 GLY B C     1 
ATOM   2539 O  O     . GLY B 1 36  ? 1.013   52.185  1.635   1.00 50.80 ? 1013 GLY B O     1 
ATOM   2540 N  N     . ASN B 1 37  ? 0.479   53.059  3.642   1.00 51.94 ? 1014 ASN B N     1 
ATOM   2541 C  CA    . ASN B 1 37  ? 1.863   53.288  4.002   1.00 53.49 ? 1014 ASN B CA    1 
ATOM   2542 C  C     . ASN B 1 37  ? 2.197   52.555  5.274   1.00 53.93 ? 1014 ASN B C     1 
ATOM   2543 O  O     . ASN B 1 37  ? 1.321   52.290  6.095   1.00 54.50 ? 1014 ASN B O     1 
ATOM   2544 C  CB    . ASN B 1 37  ? 2.158   54.769  4.161   1.00 55.29 ? 1014 ASN B CB    1 
ATOM   2545 C  CG    . ASN B 1 37  ? 2.558   55.400  2.862   1.00 57.90 ? 1014 ASN B CG    1 
ATOM   2546 O  OD1   . ASN B 1 37  ? 1.707   55.771  2.056   1.00 58.40 ? 1014 ASN B OD1   1 
ATOM   2547 N  ND2   . ASN B 1 37  ? 3.867   55.501  2.631   1.00 59.61 ? 1014 ASN B ND2   1 
ATOM   2548 N  N     . ALA B 1 38  ? 3.470   52.219  5.427   1.00 54.07 ? 1015 ALA B N     1 
ATOM   2549 C  CA    . ALA B 1 38  ? 3.928   51.506  6.605   1.00 55.90 ? 1015 ALA B CA    1 
ATOM   2550 C  C     . ALA B 1 38  ? 5.199   52.159  7.097   1.00 57.14 ? 1015 ALA B C     1 
ATOM   2551 O  O     . ALA B 1 38  ? 6.177   52.260  6.358   1.00 57.03 ? 1015 ALA B O     1 
ATOM   2552 C  CB    . ALA B 1 38  ? 4.191   50.046  6.272   1.00 55.65 ? 1015 ALA B CB    1 
ATOM   2553 N  N     . ARG B 1 39  ? 5.177   52.604  8.351   1.00 59.39 ? 1016 ARG B N     1 
ATOM   2554 C  CA    . ARG B 1 39  ? 6.331   53.257  8.957   1.00 61.40 ? 1016 ARG B CA    1 
ATOM   2555 C  C     . ARG B 1 39  ? 7.281   52.220  9.556   1.00 62.59 ? 1016 ARG B C     1 
ATOM   2556 O  O     . ARG B 1 39  ? 6.871   51.349  10.328  1.00 62.38 ? 1016 ARG B O     1 
ATOM   2557 C  CB    . ARG B 1 39  ? 5.872   54.243  10.042  1.00 60.48 ? 1016 ARG B CB    1 
ATOM   2558 N  N     . ASP B 1 40  ? 8.551   52.334  9.184   1.00 64.57 ? 1017 ASP B N     1 
ATOM   2559 C  CA    . ASP B 1 40  ? 9.607   51.441  9.634   1.00 67.59 ? 1017 ASP B CA    1 
ATOM   2560 C  C     . ASP B 1 40  ? 9.267   49.953  9.583   1.00 68.35 ? 1017 ASP B C     1 
ATOM   2561 O  O     . ASP B 1 40  ? 9.430   49.228  10.576  1.00 67.42 ? 1017 ASP B O     1 
ATOM   2562 C  CB    . ASP B 1 40  ? 10.073  51.810  11.040  1.00 71.04 ? 1017 ASP B CB    1 
ATOM   2563 C  CG    . ASP B 1 40  ? 11.460  51.259  11.345  1.00 74.47 ? 1017 ASP B CG    1 
ATOM   2564 O  OD1   . ASP B 1 40  ? 12.012  50.521  10.490  1.00 75.41 ? 1017 ASP B OD1   1 
ATOM   2565 O  OD2   . ASP B 1 40  ? 12.001  51.562  12.431  1.00 76.56 ? 1017 ASP B OD2   1 
ATOM   2566 N  N     . ILE B 1 41  ? 8.789   49.497  8.424   1.00 68.59 ? 1018 ILE B N     1 
ATOM   2567 C  CA    . ILE B 1 41  ? 8.492   48.075  8.259   1.00 68.18 ? 1018 ILE B CA    1 
ATOM   2568 C  C     . ILE B 1 41  ? 9.708   47.416  7.627   1.00 68.29 ? 1018 ILE B C     1 
ATOM   2569 O  O     . ILE B 1 41  ? 9.899   46.205  7.737   1.00 67.85 ? 1018 ILE B O     1 
ATOM   2570 C  CB    . ILE B 1 41  ? 7.248   47.786  7.373   1.00 68.79 ? 1018 ILE B CB    1 
ATOM   2571 C  CG1   . ILE B 1 41  ? 7.179   48.768  6.204   1.00 69.30 ? 1018 ILE B CG1   1 
ATOM   2572 C  CG2   . ILE B 1 41  ? 5.997   47.769  8.232   1.00 69.12 ? 1018 ILE B CG2   1 
ATOM   2573 C  CD1   . ILE B 1 41  ? 8.201   48.519  5.135   1.00 68.73 ? 1018 ILE B CD1   1 
ATOM   2574 N  N     . ILE B 1 42  ? 10.527  48.226  6.962   1.00 68.65 ? 1019 ILE B N     1 
ATOM   2575 C  CA    . ILE B 1 42  ? 11.757  47.748  6.334   1.00 69.81 ? 1019 ILE B CA    1 
ATOM   2576 C  C     . ILE B 1 42  ? 12.887  48.602  6.869   1.00 70.30 ? 1019 ILE B C     1 
ATOM   2577 O  O     . ILE B 1 42  ? 12.923  49.811  6.613   1.00 70.82 ? 1019 ILE B O     1 
ATOM   2578 C  CB    . ILE B 1 42  ? 11.768  47.936  4.802   1.00 71.25 ? 1019 ILE B CB    1 
ATOM   2579 C  CG1   . ILE B 1 42  ? 10.780  46.981  4.135   1.00 71.48 ? 1019 ILE B CG1   1 
ATOM   2580 C  CG2   . ILE B 1 42  ? 13.181  47.699  4.272   1.00 71.04 ? 1019 ILE B CG2   1 
ATOM   2581 C  CD1   . ILE B 1 42  ? 10.604  47.235  2.641   1.00 70.99 ? 1019 ILE B CD1   1 
ATOM   2582 N  N     . LYS B 1 43  ? 13.807  47.983  7.602   1.00 70.70 ? 1020 LYS B N     1 
ATOM   2583 C  CA    . LYS B 1 43  ? 14.946  48.711  8.155   1.00 70.86 ? 1020 LYS B CA    1 
ATOM   2584 C  C     . LYS B 1 43  ? 15.615  49.524  7.043   1.00 71.03 ? 1020 LYS B C     1 
ATOM   2585 O  O     . LYS B 1 43  ? 15.976  48.980  5.995   1.00 70.71 ? 1020 LYS B O     1 
ATOM   2586 C  CB    . LYS B 1 43  ? 15.959  47.734  8.761   1.00 71.89 ? 1020 LYS B CB    1 
ATOM   2587 N  N     . GLY B 1 44  ? 15.770  50.825  7.275   1.00 71.23 ? 1021 GLY B N     1 
ATOM   2588 C  CA    . GLY B 1 44  ? 16.389  51.683  6.281   1.00 70.92 ? 1021 GLY B CA    1 
ATOM   2589 C  C     . GLY B 1 44  ? 15.367  52.560  5.579   1.00 72.06 ? 1021 GLY B C     1 
ATOM   2590 O  O     . GLY B 1 44  ? 15.731  53.457  4.804   1.00 71.15 ? 1021 GLY B O     1 
ATOM   2591 N  N     . GLU B 1 45  ? 14.086  52.300  5.848   1.00 71.81 ? 1022 GLU B N     1 
ATOM   2592 C  CA    . GLU B 1 45  ? 12.994  53.067  5.249   1.00 71.49 ? 1022 GLU B CA    1 
ATOM   2593 C  C     . GLU B 1 45  ? 12.056  53.662  6.290   1.00 70.69 ? 1022 GLU B C     1 
ATOM   2594 O  O     . GLU B 1 45  ? 11.570  52.949  7.177   1.00 71.18 ? 1022 GLU B O     1 
ATOM   2595 C  CB    . GLU B 1 45  ? 12.160  52.192  4.313   1.00 74.51 ? 1022 GLU B CB    1 
ATOM   2596 C  CG    . GLU B 1 45  ? 12.647  52.118  2.881   1.00 78.25 ? 1022 GLU B CG    1 
ATOM   2597 C  CD    . GLU B 1 45  ? 11.532  51.702  1.929   1.00 80.52 ? 1022 GLU B CD    1 
ATOM   2598 O  OE1   . GLU B 1 45  ? 10.571  52.489  1.765   1.00 81.88 ? 1022 GLU B OE1   1 
ATOM   2599 O  OE2   . GLU B 1 45  ? 11.605  50.593  1.352   1.00 80.45 ? 1022 GLU B OE2   1 
ATOM   2600 N  N     . ALA B 1 46  ? 11.804  54.966  6.172   1.00 69.01 ? 1023 ALA B N     1 
ATOM   2601 C  CA    . ALA B 1 46  ? 10.906  55.675  7.083   1.00 67.50 ? 1023 ALA B CA    1 
ATOM   2602 C  C     . ALA B 1 46  ? 9.503   55.118  6.878   1.00 67.12 ? 1023 ALA B C     1 
ATOM   2603 O  O     . ALA B 1 46  ? 8.913   54.520  7.786   1.00 66.52 ? 1023 ALA B O     1 
ATOM   2604 C  CB    . ALA B 1 46  ? 10.921  57.175  6.778   1.00 67.89 ? 1023 ALA B CB    1 
ATOM   2605 N  N     . GLU B 1 47  ? 8.981   55.328  5.670   1.00 66.21 ? 1024 GLU B N     1 
ATOM   2606 C  CA    . GLU B 1 47  ? 7.655   54.856  5.284   1.00 65.26 ? 1024 GLU B CA    1 
ATOM   2607 C  C     . GLU B 1 47  ? 7.781   54.088  3.964   1.00 64.92 ? 1024 GLU B C     1 
ATOM   2608 O  O     . GLU B 1 47  ? 8.552   54.479  3.084   1.00 65.51 ? 1024 GLU B O     1 
ATOM   2609 C  CB    . GLU B 1 47  ? 6.710   56.050  5.088   1.00 65.23 ? 1024 GLU B CB    1 
ATOM   2610 N  N     . THR B 1 48  ? 7.029   52.999  3.830   1.00 63.07 ? 1025 THR B N     1 
ATOM   2611 C  CA    . THR B 1 48  ? 7.057   52.192  2.613   1.00 60.03 ? 1025 THR B CA    1 
ATOM   2612 C  C     . THR B 1 48  ? 5.638   52.004  2.088   1.00 58.28 ? 1025 THR B C     1 
ATOM   2613 O  O     . THR B 1 48  ? 4.737   51.632  2.848   1.00 57.71 ? 1025 THR B O     1 
ATOM   2614 C  CB    . THR B 1 48  ? 7.660   50.802  2.890   1.00 61.92 ? 1025 THR B CB    1 
ATOM   2615 O  OG1   . THR B 1 48  ? 8.999   50.949  3.387   1.00 62.90 ? 1025 THR B OG1   1 
ATOM   2616 C  CG2   . THR B 1 48  ? 7.667   49.957  1.615   1.00 61.17 ? 1025 THR B CG2   1 
ATOM   2617 N  N     . ARG B 1 49  ? 5.427   52.259  0.801   1.00 56.58 ? 1026 ARG B N     1 
ATOM   2618 C  CA    . ARG B 1 49  ? 4.089   52.072  0.253   1.00 55.56 ? 1026 ARG B CA    1 
ATOM   2619 C  C     . ARG B 1 49  ? 3.868   50.574  0.137   1.00 52.50 ? 1026 ARG B C     1 
ATOM   2620 O  O     . ARG B 1 49  ? 4.711   49.849  -0.383  1.00 52.16 ? 1026 ARG B O     1 
ATOM   2621 C  CB    . ARG B 1 49  ? 3.935   52.769  -1.099  1.00 57.76 ? 1026 ARG B CB    1 
ATOM   2622 C  CG    . ARG B 1 49  ? 5.120   52.649  -2.017  1.00 62.79 ? 1026 ARG B CG    1 
ATOM   2623 C  CD    . ARG B 1 49  ? 4.940   53.604  -3.183  1.00 67.29 ? 1026 ARG B CD    1 
ATOM   2624 N  NE    . ARG B 1 49  ? 3.663   53.387  -3.865  1.00 70.51 ? 1026 ARG B NE    1 
ATOM   2625 C  CZ    . ARG B 1 49  ? 3.192   54.164  -4.837  1.00 72.43 ? 1026 ARG B CZ    1 
ATOM   2626 N  NH1   . ARG B 1 49  ? 3.889   55.217  -5.248  1.00 73.03 ? 1026 ARG B NH1   1 
ATOM   2627 N  NH2   . ARG B 1 49  ? 2.023   53.889  -5.401  1.00 73.62 ? 1026 ARG B NH2   1 
ATOM   2628 N  N     . VAL B 1 50  ? 2.732   50.110  0.637   1.00 49.27 ? 1027 VAL B N     1 
ATOM   2629 C  CA    . VAL B 1 50  ? 2.443   48.688  0.614   1.00 46.67 ? 1027 VAL B CA    1 
ATOM   2630 C  C     . VAL B 1 50  ? 1.010   48.377  0.236   1.00 46.27 ? 1027 VAL B C     1 
ATOM   2631 O  O     . VAL B 1 50  ? 0.198   49.274  0.021   1.00 46.73 ? 1027 VAL B O     1 
ATOM   2632 C  CB    . VAL B 1 50  ? 2.672   48.053  1.997   1.00 46.63 ? 1027 VAL B CB    1 
ATOM   2633 C  CG1   . VAL B 1 50  ? 4.095   48.312  2.475   1.00 44.69 ? 1027 VAL B CG1   1 
ATOM   2634 C  CG2   . VAL B 1 50  ? 1.658   48.610  2.985   1.00 43.26 ? 1027 VAL B CG2   1 
ATOM   2635 N  N     . ALA B 1 51  ? 0.717   47.083  0.155   1.00 45.50 ? 1028 ALA B N     1 
ATOM   2636 C  CA    . ALA B 1 51  ? -0.624  46.604  -0.135  1.00 44.36 ? 1028 ALA B CA    1 
ATOM   2637 C  C     . ALA B 1 51  ? -1.042  45.989  1.189   1.00 44.50 ? 1028 ALA B C     1 
ATOM   2638 O  O     . ALA B 1 51  ? -0.197  45.467  1.923   1.00 45.14 ? 1028 ALA B O     1 
ATOM   2639 C  CB    . ALA B 1 51  ? -0.600  45.545  -1.217  1.00 44.15 ? 1028 ALA B CB    1 
ATOM   2640 N  N     . VAL B 1 52  ? -2.328  46.051  1.506   1.00 44.02 ? 1029 VAL B N     1 
ATOM   2641 C  CA    . VAL B 1 52  ? -2.809  45.488  2.762   1.00 46.10 ? 1029 VAL B CA    1 
ATOM   2642 C  C     . VAL B 1 52  ? -4.064  44.658  2.550   1.00 46.43 ? 1029 VAL B C     1 
ATOM   2643 O  O     . VAL B 1 52  ? -5.099  45.175  2.117   1.00 45.40 ? 1029 VAL B O     1 
ATOM   2644 C  CB    . VAL B 1 52  ? -3.104  46.597  3.793   1.00 46.50 ? 1029 VAL B CB    1 
ATOM   2645 C  CG1   . VAL B 1 52  ? -1.810  47.140  4.361   1.00 45.20 ? 1029 VAL B CG1   1 
ATOM   2646 C  CG2   . VAL B 1 52  ? -3.864  47.725  3.118   1.00 49.64 ? 1029 VAL B CG2   1 
ATOM   2647 N  N     . LYS B 1 53  ? -3.966  43.364  2.848   1.00 46.75 ? 1030 LYS B N     1 
ATOM   2648 C  CA    . LYS B 1 53  ? -5.107  42.471  2.684   1.00 47.84 ? 1030 LYS B CA    1 
ATOM   2649 C  C     . LYS B 1 53  ? -5.888  42.379  3.978   1.00 48.18 ? 1030 LYS B C     1 
ATOM   2650 O  O     . LYS B 1 53  ? -5.310  42.403  5.063   1.00 48.64 ? 1030 LYS B O     1 
ATOM   2651 C  CB    . LYS B 1 53  ? -4.668  41.060  2.254   1.00 48.60 ? 1030 LYS B CB    1 
ATOM   2652 C  CG    . LYS B 1 53  ? -4.337  40.921  0.778   1.00 50.06 ? 1030 LYS B CG    1 
ATOM   2653 C  CD    . LYS B 1 53  ? -4.273  39.453  0.328   1.00 51.81 ? 1030 LYS B CD    1 
ATOM   2654 C  CE    . LYS B 1 53  ? -3.984  39.362  -1.172  1.00 53.92 ? 1030 LYS B CE    1 
ATOM   2655 N  NZ    . LYS B 1 53  ? -3.886  37.971  -1.717  1.00 55.62 ? 1030 LYS B NZ    1 
ATOM   2656 N  N     . THR B 1 54  ? -7.206  42.276  3.851   1.00 49.30 ? 1031 THR B N     1 
ATOM   2657 C  CA    . THR B 1 54  ? -8.089  42.166  5.005   1.00 51.17 ? 1031 THR B CA    1 
ATOM   2658 C  C     . THR B 1 54  ? -9.198  41.151  4.743   1.00 53.29 ? 1031 THR B C     1 
ATOM   2659 O  O     . THR B 1 54  ? -9.382  40.676  3.612   1.00 52.19 ? 1031 THR B O     1 
ATOM   2660 C  CB    . THR B 1 54  ? -8.784  43.524  5.348   1.00 51.45 ? 1031 THR B CB    1 
ATOM   2661 O  OG1   . THR B 1 54  ? -9.785  43.830  4.358   1.00 50.46 ? 1031 THR B OG1   1 
ATOM   2662 C  CG2   . THR B 1 54  ? -7.761  44.653  5.411   1.00 50.57 ? 1031 THR B CG2   1 
ATOM   2663 N  N     . VAL B 1 55  ? -9.936  40.826  5.800   1.00 55.47 ? 1032 VAL B N     1 
ATOM   2664 C  CA    . VAL B 1 55  ? -11.062 39.899  5.701   1.00 57.88 ? 1032 VAL B CA    1 
ATOM   2665 C  C     . VAL B 1 55  ? -12.341 40.614  6.122   1.00 59.57 ? 1032 VAL B C     1 
ATOM   2666 O  O     . VAL B 1 55  ? -12.346 41.371  7.099   1.00 60.09 ? 1032 VAL B O     1 
ATOM   2667 C  CB    . VAL B 1 55  ? -10.889 38.658  6.610   1.00 57.75 ? 1032 VAL B CB    1 
ATOM   2668 C  CG1   . VAL B 1 55  ? -9.804  37.764  6.059   1.00 58.59 ? 1032 VAL B CG1   1 
ATOM   2669 C  CG2   . VAL B 1 55  ? -10.554 39.091  8.025   1.00 58.60 ? 1032 VAL B CG2   1 
ATOM   2670 N  N     . ASN B 1 56  ? -13.426 40.386  5.387   1.00 61.00 ? 1033 ASN B N     1 
ATOM   2671 C  CA    . ASN B 1 56  ? -14.681 41.024  5.747   1.00 62.95 ? 1033 ASN B CA    1 
ATOM   2672 C  C     . ASN B 1 56  ? -15.197 40.376  7.039   1.00 62.27 ? 1033 ASN B C     1 
ATOM   2673 O  O     . ASN B 1 56  ? -14.958 39.197  7.289   1.00 62.19 ? 1033 ASN B O     1 
ATOM   2674 C  CB    . ASN B 1 56  ? -15.691 40.922  4.589   1.00 66.08 ? 1033 ASN B CB    1 
ATOM   2675 C  CG    . ASN B 1 56  ? -15.952 39.496  4.151   1.00 70.39 ? 1033 ASN B CG    1 
ATOM   2676 O  OD1   . ASN B 1 56  ? -15.031 38.682  4.072   1.00 73.50 ? 1033 ASN B OD1   1 
ATOM   2677 N  ND2   . ASN B 1 56  ? -17.211 39.190  3.843   1.00 71.34 ? 1033 ASN B ND2   1 
ATOM   2678 N  N     . GLU B 1 57  ? -15.886 41.154  7.867   1.00 62.19 ? 1034 GLU B N     1 
ATOM   2679 C  CA    . GLU B 1 57  ? -16.403 40.630  9.125   1.00 62.84 ? 1034 GLU B CA    1 
ATOM   2680 C  C     . GLU B 1 57  ? -17.248 39.384  8.870   1.00 63.33 ? 1034 GLU B C     1 
ATOM   2681 O  O     . GLU B 1 57  ? -17.197 38.409  9.621   1.00 63.73 ? 1034 GLU B O     1 
ATOM   2682 C  CB    . GLU B 1 57  ? -17.246 41.695  9.837   1.00 61.19 ? 1034 GLU B CB    1 
ATOM   2683 N  N     . SER B 1 58  ? -18.019 39.421  7.793   1.00 64.60 ? 1035 SER B N     1 
ATOM   2684 C  CA    . SER B 1 58  ? -18.895 38.314  7.434   1.00 65.76 ? 1035 SER B CA    1 
ATOM   2685 C  C     . SER B 1 58  ? -18.161 37.110  6.846   1.00 66.53 ? 1035 SER B C     1 
ATOM   2686 O  O     . SER B 1 58  ? -18.797 36.155  6.403   1.00 67.27 ? 1035 SER B O     1 
ATOM   2687 C  CB    . SER B 1 58  ? -19.959 38.799  6.436   1.00 66.10 ? 1035 SER B CB    1 
ATOM   2688 O  OG    . SER B 1 58  ? -19.369 39.329  5.256   1.00 65.90 ? 1035 SER B OG    1 
ATOM   2689 N  N     . ALA B 1 59  ? -16.832 37.150  6.839   1.00 67.08 ? 1036 ALA B N     1 
ATOM   2690 C  CA    . ALA B 1 59  ? -16.045 36.050  6.283   1.00 66.79 ? 1036 ALA B CA    1 
ATOM   2691 C  C     . ALA B 1 59  ? -16.126 34.810  7.168   1.00 66.92 ? 1036 ALA B C     1 
ATOM   2692 O  O     . ALA B 1 59  ? -16.059 34.903  8.397   1.00 66.56 ? 1036 ALA B O     1 
ATOM   2693 C  CB    . ALA B 1 59  ? -14.586 36.482  6.103   1.00 66.65 ? 1036 ALA B CB    1 
ATOM   2694 N  N     . SER B 1 60  ? -16.270 33.647  6.538   1.00 67.36 ? 1037 SER B N     1 
ATOM   2695 C  CA    . SER B 1 60  ? -16.371 32.390  7.277   1.00 68.57 ? 1037 SER B CA    1 
ATOM   2696 C  C     . SER B 1 60  ? -15.019 31.958  7.843   1.00 68.40 ? 1037 SER B C     1 
ATOM   2697 O  O     . SER B 1 60  ? -13.962 32.413  7.387   1.00 68.11 ? 1037 SER B O     1 
ATOM   2698 C  CB    . SER B 1 60  ? -16.951 31.282  6.380   1.00 69.37 ? 1037 SER B CB    1 
ATOM   2699 O  OG    . SER B 1 60  ? -16.108 31.007  5.273   1.00 69.88 ? 1037 SER B OG    1 
ATOM   2700 N  N     . LEU B 1 61  ? -15.051 31.078  8.840   1.00 67.78 ? 1038 LEU B N     1 
ATOM   2701 C  CA    . LEU B 1 61  ? -13.804 30.633  9.435   1.00 68.10 ? 1038 LEU B CA    1 
ATOM   2702 C  C     . LEU B 1 61  ? -12.930 29.895  8.417   1.00 67.94 ? 1038 LEU B C     1 
ATOM   2703 O  O     . LEU B 1 61  ? -11.707 30.037  8.443   1.00 67.35 ? 1038 LEU B O     1 
ATOM   2704 C  CB    . LEU B 1 61  ? -14.048 29.770  10.676  1.00 69.47 ? 1038 LEU B CB    1 
ATOM   2705 C  CG    . LEU B 1 61  ? -12.786 29.602  11.540  1.00 70.21 ? 1038 LEU B CG    1 
ATOM   2706 C  CD1   . LEU B 1 61  ? -12.312 30.965  12.075  1.00 68.93 ? 1038 LEU B CD1   1 
ATOM   2707 C  CD2   . LEU B 1 61  ? -13.087 28.655  12.689  1.00 70.04 ? 1038 LEU B CD2   1 
ATOM   2708 N  N     . ARG B 1 62  ? -13.547 29.123  7.520   1.00 67.84 ? 1039 ARG B N     1 
ATOM   2709 C  CA    . ARG B 1 62  ? -12.792 28.398  6.496   1.00 68.15 ? 1039 ARG B CA    1 
ATOM   2710 C  C     . ARG B 1 62  ? -12.011 29.392  5.634   1.00 68.76 ? 1039 ARG B C     1 
ATOM   2711 O  O     . ARG B 1 62  ? -10.914 29.085  5.149   1.00 69.22 ? 1039 ARG B O     1 
ATOM   2712 C  CB    . ARG B 1 62  ? -13.734 27.573  5.614   1.00 69.38 ? 1039 ARG B CB    1 
ATOM   2713 N  N     . GLU B 1 63  ? -12.583 30.580  5.452   1.00 68.43 ? 1040 GLU B N     1 
ATOM   2714 C  CA    . GLU B 1 63  ? -11.941 31.623  4.668   1.00 68.19 ? 1040 GLU B CA    1 
ATOM   2715 C  C     . GLU B 1 63  ? -10.886 32.339  5.518   1.00 67.78 ? 1040 GLU B C     1 
ATOM   2716 O  O     . GLU B 1 63  ? -9.862  32.797  4.989   1.00 66.98 ? 1040 GLU B O     1 
ATOM   2717 C  CB    . GLU B 1 63  ? -12.983 32.626  4.167   1.00 70.25 ? 1040 GLU B CB    1 
ATOM   2718 C  CG    . GLU B 1 63  ? -14.072 32.019  3.292   1.00 71.40 ? 1040 GLU B CG    1 
ATOM   2719 C  CD    . GLU B 1 63  ? -15.061 33.061  2.801   1.00 72.71 ? 1040 GLU B CD    1 
ATOM   2720 O  OE1   . GLU B 1 63  ? -15.566 33.842  3.641   1.00 73.26 ? 1040 GLU B OE1   1 
ATOM   2721 O  OE2   . GLU B 1 63  ? -15.338 33.096  1.579   1.00 72.88 ? 1040 GLU B OE2   1 
ATOM   2722 N  N     . ARG B 1 64  ? -11.135 32.434  6.827   1.00 66.66 ? 1041 ARG B N     1 
ATOM   2723 C  CA    . ARG B 1 64  ? -10.194 33.088  7.741   1.00 66.65 ? 1041 ARG B CA    1 
ATOM   2724 C  C     . ARG B 1 64  ? -8.922  32.245  7.803   1.00 66.52 ? 1041 ARG B C     1 
ATOM   2725 O  O     . ARG B 1 64  ? -7.799  32.768  7.790   1.00 66.86 ? 1041 ARG B O     1 
ATOM   2726 C  CB    . ARG B 1 64  ? -10.776 33.199  9.157   1.00 67.97 ? 1041 ARG B CB    1 
ATOM   2727 C  CG    . ARG B 1 64  ? -12.159 33.834  9.264   1.00 72.06 ? 1041 ARG B CG    1 
ATOM   2728 C  CD    . ARG B 1 64  ? -12.543 34.032  10.735  1.00 74.39 ? 1041 ARG B CD    1 
ATOM   2729 N  NE    . ARG B 1 64  ? -13.991 34.068  10.958  1.00 77.15 ? 1041 ARG B NE    1 
ATOM   2730 C  CZ    . ARG B 1 64  ? -14.767 35.135  10.780  1.00 78.24 ? 1041 ARG B CZ    1 
ATOM   2731 N  NH1   . ARG B 1 64  ? -14.246 36.286  10.373  1.00 78.58 ? 1041 ARG B NH1   1 
ATOM   2732 N  NH2   . ARG B 1 64  ? -16.073 35.047  11.007  1.00 78.25 ? 1041 ARG B NH2   1 
ATOM   2733 N  N     . ILE B 1 65  ? -9.111  30.931  7.874   1.00 65.09 ? 1042 ILE B N     1 
ATOM   2734 C  CA    . ILE B 1 65  ? -7.995  30.003  7.941   1.00 64.03 ? 1042 ILE B CA    1 
ATOM   2735 C  C     . ILE B 1 65  ? -7.159  30.086  6.667   1.00 62.89 ? 1042 ILE B C     1 
ATOM   2736 O  O     . ILE B 1 65  ? -5.927  30.079  6.722   1.00 62.74 ? 1042 ILE B O     1 
ATOM   2737 C  CB    . ILE B 1 65  ? -8.506  28.550  8.173   1.00 64.94 ? 1042 ILE B CB    1 
ATOM   2738 C  CG1   . ILE B 1 65  ? -9.068  28.426  9.597   1.00 65.03 ? 1042 ILE B CG1   1 
ATOM   2739 C  CG2   . ILE B 1 65  ? -7.389  27.548  7.947   1.00 65.99 ? 1042 ILE B CG2   1 
ATOM   2740 C  CD1   . ILE B 1 65  ? -8.167  29.016  10.696  1.00 64.00 ? 1042 ILE B CD1   1 
ATOM   2741 N  N     . GLU B 1 66  ? -7.830  30.170  5.524   1.00 62.61 ? 1043 GLU B N     1 
ATOM   2742 C  CA    . GLU B 1 66  ? -7.133  30.271  4.242   1.00 62.77 ? 1043 GLU B CA    1 
ATOM   2743 C  C     . GLU B 1 66  ? -6.311  31.563  4.227   1.00 60.86 ? 1043 GLU B C     1 
ATOM   2744 O  O     . GLU B 1 66  ? -5.136  31.570  3.837   1.00 60.60 ? 1043 GLU B O     1 
ATOM   2745 C  CB    . GLU B 1 66  ? -8.142  30.280  3.080   1.00 65.55 ? 1043 GLU B CB    1 
ATOM   2746 C  CG    . GLU B 1 66  ? -7.563  29.784  1.752   1.00 68.73 ? 1043 GLU B CG    1 
ATOM   2747 C  CD    . GLU B 1 66  ? -7.070  28.327  1.832   1.00 70.97 ? 1043 GLU B CD    1 
ATOM   2748 O  OE1   . GLU B 1 66  ? -6.209  28.028  2.697   1.00 69.21 ? 1043 GLU B OE1   1 
ATOM   2749 O  OE2   . GLU B 1 66  ? -7.541  27.483  1.028   1.00 71.15 ? 1043 GLU B OE2   1 
ATOM   2750 N  N     . PHE B 1 67  ? -6.949  32.650  4.658   1.00 58.39 ? 1044 PHE B N     1 
ATOM   2751 C  CA    . PHE B 1 67  ? -6.325  33.967  4.725   1.00 56.74 ? 1044 PHE B CA    1 
ATOM   2752 C  C     . PHE B 1 67  ? -5.064  33.890  5.589   1.00 56.23 ? 1044 PHE B C     1 
ATOM   2753 O  O     . PHE B 1 67  ? -4.015  34.415  5.218   1.00 55.04 ? 1044 PHE B O     1 
ATOM   2754 C  CB    . PHE B 1 67  ? -7.322  34.969  5.326   1.00 57.11 ? 1044 PHE B CB    1 
ATOM   2755 C  CG    . PHE B 1 67  ? -6.809  36.380  5.394   1.00 57.09 ? 1044 PHE B CG    1 
ATOM   2756 C  CD1   . PHE B 1 67  ? -6.612  37.124  4.231   1.00 57.97 ? 1044 PHE B CD1   1 
ATOM   2757 C  CD2   . PHE B 1 67  ? -6.526  36.971  6.622   1.00 56.58 ? 1044 PHE B CD2   1 
ATOM   2758 C  CE1   . PHE B 1 67  ? -6.141  38.439  4.290   1.00 57.13 ? 1044 PHE B CE1   1 
ATOM   2759 C  CE2   . PHE B 1 67  ? -6.054  38.282  6.693   1.00 56.46 ? 1044 PHE B CE2   1 
ATOM   2760 C  CZ    . PHE B 1 67  ? -5.862  39.018  5.525   1.00 57.05 ? 1044 PHE B CZ    1 
ATOM   2761 N  N     . LEU B 1 68  ? -5.179  33.228  6.738   1.00 55.46 ? 1045 LEU B N     1 
ATOM   2762 C  CA    . LEU B 1 68  ? -4.057  33.074  7.648   1.00 55.64 ? 1045 LEU B CA    1 
ATOM   2763 C  C     . LEU B 1 68  ? -3.011  32.112  7.084   1.00 55.01 ? 1045 LEU B C     1 
ATOM   2764 O  O     . LEU B 1 68  ? -1.835  32.177  7.459   1.00 54.98 ? 1045 LEU B O     1 
ATOM   2765 C  CB    . LEU B 1 68  ? -4.577  32.590  8.997   1.00 57.56 ? 1045 LEU B CB    1 
ATOM   2766 C  CG    . LEU B 1 68  ? -5.528  33.624  9.612   1.00 59.11 ? 1045 LEU B CG    1 
ATOM   2767 C  CD1   . LEU B 1 68  ? -6.385  32.984  10.705  1.00 60.25 ? 1045 LEU B CD1   1 
ATOM   2768 C  CD2   . LEU B 1 68  ? -4.711  34.792  10.148  1.00 57.42 ? 1045 LEU B CD2   1 
ATOM   2769 N  N     . ASN B 1 69  ? -3.438  31.226  6.182   1.00 53.79 ? 1046 ASN B N     1 
ATOM   2770 C  CA    . ASN B 1 69  ? -2.525  30.274  5.555   1.00 53.59 ? 1046 ASN B CA    1 
ATOM   2771 C  C     . ASN B 1 69  ? -1.579  31.009  4.626   1.00 52.75 ? 1046 ASN B C     1 
ATOM   2772 O  O     . ASN B 1 69  ? -0.363  30.809  4.671   1.00 53.04 ? 1046 ASN B O     1 
ATOM   2773 C  CB    . ASN B 1 69  ? -3.269  29.242  4.706   1.00 56.29 ? 1046 ASN B CB    1 
ATOM   2774 C  CG    . ASN B 1 69  ? -2.311  28.387  3.864   1.00 59.74 ? 1046 ASN B CG    1 
ATOM   2775 O  OD1   . ASN B 1 69  ? -1.561  27.569  4.404   1.00 61.28 ? 1046 ASN B OD1   1 
ATOM   2776 N  ND2   . ASN B 1 69  ? -2.321  28.587  2.542   1.00 59.18 ? 1046 ASN B ND2   1 
ATOM   2777 N  N     . GLU B 1 70  ? -2.149  31.855  3.774   1.00 51.14 ? 1047 GLU B N     1 
ATOM   2778 C  CA    . GLU B 1 70  ? -1.342  32.605  2.824   1.00 50.82 ? 1047 GLU B CA    1 
ATOM   2779 C  C     . GLU B 1 70  ? -0.241  33.357  3.543   1.00 49.73 ? 1047 GLU B C     1 
ATOM   2780 O  O     . GLU B 1 70  ? 0.922   33.309  3.134   1.00 50.32 ? 1047 GLU B O     1 
ATOM   2781 C  CB    . GLU B 1 70  ? -2.179  33.619  2.025   1.00 52.11 ? 1047 GLU B CB    1 
ATOM   2782 C  CG    . GLU B 1 70  ? -1.313  34.414  1.040   1.00 53.85 ? 1047 GLU B CG    1 
ATOM   2783 C  CD    . GLU B 1 70  ? -2.070  35.469  0.259   1.00 56.95 ? 1047 GLU B CD    1 
ATOM   2784 O  OE1   . GLU B 1 70  ? -1.628  35.790  -0.871  1.00 57.64 ? 1047 GLU B OE1   1 
ATOM   2785 O  OE2   . GLU B 1 70  ? -3.087  35.987  0.775   1.00 58.59 ? 1047 GLU B OE2   1 
ATOM   2786 N  N     . ALA B 1 71  ? -0.611  34.054  4.613   1.00 48.12 ? 1048 ALA B N     1 
ATOM   2787 C  CA    . ALA B 1 71  ? 0.359   34.824  5.374   1.00 47.33 ? 1048 ALA B CA    1 
ATOM   2788 C  C     . ALA B 1 71  ? 1.421   33.887  5.900   1.00 46.06 ? 1048 ALA B C     1 
ATOM   2789 O  O     . ALA B 1 71  ? 2.612   34.114  5.717   1.00 45.23 ? 1048 ALA B O     1 
ATOM   2790 C  CB    . ALA B 1 71  ? -0.321  35.534  6.530   1.00 48.23 ? 1048 ALA B CB    1 
ATOM   2791 N  N     . SER B 1 72  ? 0.965   32.826  6.552   1.00 46.62 ? 1049 SER B N     1 
ATOM   2792 C  CA    . SER B 1 72  ? 1.851   31.832  7.129   1.00 46.67 ? 1049 SER B CA    1 
ATOM   2793 C  C     . SER B 1 72  ? 2.930   31.356  6.159   1.00 45.56 ? 1049 SER B C     1 
ATOM   2794 O  O     . SER B 1 72  ? 4.125   31.445  6.461   1.00 44.93 ? 1049 SER B O     1 
ATOM   2795 C  CB    . SER B 1 72  ? 1.033   30.634  7.601   1.00 48.26 ? 1049 SER B CB    1 
ATOM   2796 O  OG    . SER B 1 72  ? 1.882   29.635  8.141   1.00 51.49 ? 1049 SER B OG    1 
ATOM   2797 N  N     . VAL B 1 73  ? 2.513   30.857  4.997   1.00 43.89 ? 1050 VAL B N     1 
ATOM   2798 C  CA    . VAL B 1 73  ? 3.471   30.349  4.017   1.00 43.58 ? 1050 VAL B CA    1 
ATOM   2799 C  C     . VAL B 1 73  ? 4.410   31.405  3.438   1.00 43.51 ? 1050 VAL B C     1 
ATOM   2800 O  O     . VAL B 1 73  ? 5.561   31.103  3.131   1.00 44.26 ? 1050 VAL B O     1 
ATOM   2801 C  CB    . VAL B 1 73  ? 2.769   29.626  2.827   1.00 43.83 ? 1050 VAL B CB    1 
ATOM   2802 C  CG1   . VAL B 1 73  ? 1.713   28.657  3.345   1.00 43.89 ? 1050 VAL B CG1   1 
ATOM   2803 C  CG2   . VAL B 1 73  ? 2.156   30.633  1.884   1.00 44.68 ? 1050 VAL B CG2   1 
ATOM   2804 N  N     . MET B 1 74  ? 3.945   32.637  3.279   1.00 42.37 ? 1051 MET B N     1 
ATOM   2805 C  CA    . MET B 1 74  ? 4.825   33.661  2.718   1.00 43.07 ? 1051 MET B CA    1 
ATOM   2806 C  C     . MET B 1 74  ? 5.984   33.972  3.653   1.00 43.69 ? 1051 MET B C     1 
ATOM   2807 O  O     . MET B 1 74  ? 7.037   34.426  3.216   1.00 43.21 ? 1051 MET B O     1 
ATOM   2808 C  CB    . MET B 1 74  ? 4.059   34.948  2.430   1.00 42.78 ? 1051 MET B CB    1 
ATOM   2809 C  CG    . MET B 1 74  ? 3.037   34.830  1.312   1.00 45.22 ? 1051 MET B CG    1 
ATOM   2810 S  SD    . MET B 1 74  ? 2.065   36.346  1.121   1.00 47.73 ? 1051 MET B SD    1 
ATOM   2811 C  CE    . MET B 1 74  ? 3.222   37.387  0.143   1.00 46.09 ? 1051 MET B CE    1 
ATOM   2812 N  N     . LYS B 1 75  ? 5.789   33.725  4.941   1.00 43.21 ? 1052 LYS B N     1 
ATOM   2813 C  CA    . LYS B 1 75  ? 6.824   34.004  5.919   1.00 43.95 ? 1052 LYS B CA    1 
ATOM   2814 C  C     . LYS B 1 75  ? 8.157   33.355  5.573   1.00 43.48 ? 1052 LYS B C     1 
ATOM   2815 O  O     . LYS B 1 75  ? 9.210   33.941  5.805   1.00 44.04 ? 1052 LYS B O     1 
ATOM   2816 C  CB    . LYS B 1 75  ? 6.367   33.544  7.295   1.00 45.32 ? 1052 LYS B CB    1 
ATOM   2817 C  CG    . LYS B 1 75  ? 5.167   34.306  7.831   1.00 46.18 ? 1052 LYS B CG    1 
ATOM   2818 C  CD    . LYS B 1 75  ? 4.764   33.739  9.188   1.00 48.38 ? 1052 LYS B CD    1 
ATOM   2819 C  CE    . LYS B 1 75  ? 3.830   34.679  9.937   1.00 48.84 ? 1052 LYS B CE    1 
ATOM   2820 N  NZ    . LYS B 1 75  ? 3.593   34.227  11.335  1.00 47.82 ? 1052 LYS B NZ    1 
ATOM   2821 N  N     . GLY B 1 76  ? 8.110   32.149  5.014   1.00 43.16 ? 1053 GLY B N     1 
ATOM   2822 C  CA    . GLY B 1 76  ? 9.334   31.455  4.666   1.00 41.04 ? 1053 GLY B CA    1 
ATOM   2823 C  C     . GLY B 1 76  ? 9.879   31.738  3.276   1.00 42.68 ? 1053 GLY B C     1 
ATOM   2824 O  O     . GLY B 1 76  ? 10.849  31.090  2.860   1.00 44.22 ? 1053 GLY B O     1 
ATOM   2825 N  N     . PHE B 1 77  ? 9.296   32.696  2.554   1.00 41.53 ? 1054 PHE B N     1 
ATOM   2826 C  CA    . PHE B 1 77  ? 9.777   32.989  1.203   1.00 40.09 ? 1054 PHE B CA    1 
ATOM   2827 C  C     . PHE B 1 77  ? 10.591  34.236  1.055   1.00 39.74 ? 1054 PHE B C     1 
ATOM   2828 O  O     . PHE B 1 77  ? 10.317  35.261  1.672   1.00 39.88 ? 1054 PHE B O     1 
ATOM   2829 C  CB    . PHE B 1 77  ? 8.625   33.077  0.193   1.00 40.25 ? 1054 PHE B CB    1 
ATOM   2830 C  CG    . PHE B 1 77  ? 7.822   31.817  0.078   1.00 42.18 ? 1054 PHE B CG    1 
ATOM   2831 C  CD1   . PHE B 1 77  ? 8.374   30.583  0.437   1.00 41.26 ? 1054 PHE B CD1   1 
ATOM   2832 C  CD2   . PHE B 1 77  ? 6.517   31.857  -0.392  1.00 41.83 ? 1054 PHE B CD2   1 
ATOM   2833 C  CE1   . PHE B 1 77  ? 7.639   29.416  0.329   1.00 41.62 ? 1054 PHE B CE1   1 
ATOM   2834 C  CE2   . PHE B 1 77  ? 5.771   30.691  -0.502  1.00 44.16 ? 1054 PHE B CE2   1 
ATOM   2835 C  CZ    . PHE B 1 77  ? 6.334   29.464  -0.140  1.00 42.51 ? 1054 PHE B CZ    1 
ATOM   2836 N  N     . THR B 1 78  ? 11.603  34.132  0.207   1.00 40.90 ? 1055 THR B N     1 
ATOM   2837 C  CA    . THR B 1 78  ? 12.474  35.244  -0.094  1.00 40.51 ? 1055 THR B CA    1 
ATOM   2838 C  C     . THR B 1 78  ? 12.886  35.069  -1.532  1.00 40.68 ? 1055 THR B C     1 
ATOM   2839 O  O     . THR B 1 78  ? 13.937  34.499  -1.812  1.00 42.88 ? 1055 THR B O     1 
ATOM   2840 C  CB    . THR B 1 78  ? 13.747  35.247  0.771   1.00 41.27 ? 1055 THR B CB    1 
ATOM   2841 O  OG1   . THR B 1 78  ? 13.390  35.312  2.161   1.00 39.46 ? 1055 THR B OG1   1 
ATOM   2842 C  CG2   . THR B 1 78  ? 14.620  36.458  0.402   1.00 39.18 ? 1055 THR B CG2   1 
ATOM   2843 N  N     . CYS B 1 79  ? 12.051  35.552  -2.446  1.00 39.71 ? 1056 CYS B N     1 
ATOM   2844 C  CA    . CYS B 1 79  ? 12.359  35.448  -3.863  1.00 36.89 ? 1056 CYS B CA    1 
ATOM   2845 C  C     . CYS B 1 79  ? 11.900  36.689  -4.602  1.00 37.26 ? 1056 CYS B C     1 
ATOM   2846 O  O     . CYS B 1 79  ? 10.803  37.203  -4.375  1.00 38.11 ? 1056 CYS B O     1 
ATOM   2847 C  CB    . CYS B 1 79  ? 11.703  34.220  -4.477  1.00 34.50 ? 1056 CYS B CB    1 
ATOM   2848 S  SG    . CYS B 1 79  ? 12.223  33.966  -6.180  1.00 35.98 ? 1056 CYS B SG    1 
ATOM   2849 N  N     . HIS B 1 80  ? 12.753  37.162  -5.494  1.00 36.35 ? 1057 HIS B N     1 
ATOM   2850 C  CA    . HIS B 1 80  ? 12.477  38.348  -6.275  1.00 36.22 ? 1057 HIS B CA    1 
ATOM   2851 C  C     . HIS B 1 80  ? 11.252  38.177  -7.170  1.00 36.92 ? 1057 HIS B C     1 
ATOM   2852 O  O     . HIS B 1 80  ? 10.651  39.161  -7.605  1.00 38.42 ? 1057 HIS B O     1 
ATOM   2853 C  CB    . HIS B 1 80  ? 13.708  38.658  -7.133  1.00 37.12 ? 1057 HIS B CB    1 
ATOM   2854 C  CG    . HIS B 1 80  ? 13.678  40.005  -7.775  1.00 36.07 ? 1057 HIS B CG    1 
ATOM   2855 N  ND1   . HIS B 1 80  ? 13.845  41.171  -7.060  1.00 35.48 ? 1057 HIS B ND1   1 
ATOM   2856 C  CD2   . HIS B 1 80  ? 13.482  40.373  -9.063  1.00 35.46 ? 1057 HIS B CD2   1 
ATOM   2857 C  CE1   . HIS B 1 80  ? 13.752  42.202  -7.883  1.00 36.34 ? 1057 HIS B CE1   1 
ATOM   2858 N  NE2   . HIS B 1 80  ? 13.532  41.745  -9.105  1.00 33.33 ? 1057 HIS B NE2   1 
ATOM   2859 N  N     . HIS B 1 81  ? 10.878  36.933  -7.447  1.00 36.12 ? 1058 HIS B N     1 
ATOM   2860 C  CA    . HIS B 1 81  ? 9.752   36.693  -8.336  1.00 34.21 ? 1058 HIS B CA    1 
ATOM   2861 C  C     . HIS B 1 81  ? 8.538   36.104  -7.624  1.00 33.66 ? 1058 HIS B C     1 
ATOM   2862 O  O     . HIS B 1 81  ? 7.687   35.438  -8.222  1.00 34.13 ? 1058 HIS B O     1 
ATOM   2863 C  CB    . HIS B 1 81  ? 10.238  35.832  -9.497  1.00 33.07 ? 1058 HIS B CB    1 
ATOM   2864 C  CG    . HIS B 1 81  ? 11.312  36.492  -10.311 1.00 34.15 ? 1058 HIS B CG    1 
ATOM   2865 N  ND1   . HIS B 1 81  ? 12.558  35.931  -10.510 1.00 34.44 ? 1058 HIS B ND1   1 
ATOM   2866 C  CD2   . HIS B 1 81  ? 11.312  37.654  -11.011 1.00 35.12 ? 1058 HIS B CD2   1 
ATOM   2867 C  CE1   . HIS B 1 81  ? 13.271  36.714  -11.301 1.00 32.75 ? 1058 HIS B CE1   1 
ATOM   2868 N  NE2   . HIS B 1 81  ? 12.537  37.766  -11.620 1.00 31.97 ? 1058 HIS B NE2   1 
ATOM   2869 N  N     . VAL B 1 82  ? 8.480   36.384  -6.330  1.00 31.54 ? 1059 VAL B N     1 
ATOM   2870 C  CA    . VAL B 1 82  ? 7.384   35.971  -5.475  1.00 30.14 ? 1059 VAL B CA    1 
ATOM   2871 C  C     . VAL B 1 82  ? 7.006   37.207  -4.665  1.00 30.79 ? 1059 VAL B C     1 
ATOM   2872 O  O     . VAL B 1 82  ? 7.859   37.784  -3.978  1.00 29.82 ? 1059 VAL B O     1 
ATOM   2873 C  CB    . VAL B 1 82  ? 7.813   34.878  -4.495  1.00 29.83 ? 1059 VAL B CB    1 
ATOM   2874 C  CG1   . VAL B 1 82  ? 6.713   34.615  -3.512  1.00 29.19 ? 1059 VAL B CG1   1 
ATOM   2875 C  CG2   . VAL B 1 82  ? 8.151   33.604  -5.253  1.00 31.44 ? 1059 VAL B CG2   1 
ATOM   2876 N  N     . VAL B 1 83  ? 5.743   37.624  -4.744  1.00 31.38 ? 1060 VAL B N     1 
ATOM   2877 C  CA    . VAL B 1 83  ? 5.314   38.787  -3.987  1.00 30.36 ? 1060 VAL B CA    1 
ATOM   2878 C  C     . VAL B 1 83  ? 5.767   38.562  -2.550  1.00 33.99 ? 1060 VAL B C     1 
ATOM   2879 O  O     . VAL B 1 83  ? 5.558   37.489  -1.966  1.00 34.79 ? 1060 VAL B O     1 
ATOM   2880 C  CB    . VAL B 1 83  ? 3.802   38.973  -4.072  1.00 29.39 ? 1060 VAL B CB    1 
ATOM   2881 C  CG1   . VAL B 1 83  ? 3.346   40.051  -3.103  1.00 25.39 ? 1060 VAL B CG1   1 
ATOM   2882 C  CG2   . VAL B 1 83  ? 3.433   39.330  -5.497  1.00 25.77 ? 1060 VAL B CG2   1 
ATOM   2883 N  N     . ARG B 1 84  ? 6.399   39.583  -1.984  1.00 37.97 ? 1061 ARG B N     1 
ATOM   2884 C  CA    . ARG B 1 84  ? 6.940   39.480  -0.638  1.00 41.50 ? 1061 ARG B CA    1 
ATOM   2885 C  C     . ARG B 1 84  ? 6.034   39.895  0.501   1.00 42.19 ? 1061 ARG B C     1 
ATOM   2886 O  O     . ARG B 1 84  ? 5.277   40.868  0.399   1.00 41.74 ? 1061 ARG B O     1 
ATOM   2887 C  CB    . ARG B 1 84  ? 8.250   40.271  -0.519  1.00 44.89 ? 1061 ARG B CB    1 
ATOM   2888 C  CG    . ARG B 1 84  ? 8.930   40.017  0.820   1.00 53.46 ? 1061 ARG B CG    1 
ATOM   2889 C  CD    . ARG B 1 84  ? 10.343  40.574  0.934   1.00 59.34 ? 1061 ARG B CD    1 
ATOM   2890 N  NE    . ARG B 1 84  ? 10.404  42.032  0.847   1.00 64.25 ? 1061 ARG B NE    1 
ATOM   2891 C  CZ    . ARG B 1 84  ? 11.272  42.790  1.520   1.00 66.23 ? 1061 ARG B CZ    1 
ATOM   2892 N  NH1   . ARG B 1 84  ? 12.154  42.236  2.346   1.00 66.33 ? 1061 ARG B NH1   1 
ATOM   2893 N  NH2   . ARG B 1 84  ? 11.273  44.105  1.351   1.00 67.77 ? 1061 ARG B NH2   1 
ATOM   2894 N  N     . LEU B 1 85  ? 6.124   39.137  1.593   1.00 42.88 ? 1062 LEU B N     1 
ATOM   2895 C  CA    . LEU B 1 85  ? 5.364   39.423  2.806   1.00 44.23 ? 1062 LEU B CA    1 
ATOM   2896 C  C     . LEU B 1 85  ? 6.163   40.475  3.581   1.00 44.99 ? 1062 LEU B C     1 
ATOM   2897 O  O     . LEU B 1 85  ? 7.382   40.346  3.737   1.00 44.76 ? 1062 LEU B O     1 
ATOM   2898 C  CB    . LEU B 1 85  ? 5.218   38.168  3.664   1.00 44.18 ? 1062 LEU B CB    1 
ATOM   2899 C  CG    . LEU B 1 85  ? 4.655   38.429  5.064   1.00 44.80 ? 1062 LEU B CG    1 
ATOM   2900 C  CD1   . LEU B 1 85  ? 3.278   39.092  4.936   1.00 43.96 ? 1062 LEU B CD1   1 
ATOM   2901 C  CD2   . LEU B 1 85  ? 4.570   37.117  5.855   1.00 42.48 ? 1062 LEU B CD2   1 
ATOM   2902 N  N     . LEU B 1 86  ? 5.482   41.509  4.064   1.00 46.22 ? 1063 LEU B N     1 
ATOM   2903 C  CA    . LEU B 1 86  ? 6.145   42.582  4.799   1.00 46.13 ? 1063 LEU B CA    1 
ATOM   2904 C  C     . LEU B 1 86  ? 5.857   42.568  6.288   1.00 46.32 ? 1063 LEU B C     1 
ATOM   2905 O  O     . LEU B 1 86  ? 6.728   42.890  7.094   1.00 46.55 ? 1063 LEU B O     1 
ATOM   2906 C  CB    . LEU B 1 86  ? 5.736   43.935  4.219   1.00 46.74 ? 1063 LEU B CB    1 
ATOM   2907 C  CG    . LEU B 1 86  ? 6.338   44.201  2.837   1.00 49.06 ? 1063 LEU B CG    1 
ATOM   2908 C  CD1   . LEU B 1 86  ? 5.811   45.513  2.281   1.00 47.94 ? 1063 LEU B CD1   1 
ATOM   2909 C  CD2   . LEU B 1 86  ? 7.870   44.234  2.950   1.00 48.75 ? 1063 LEU B CD2   1 
ATOM   2910 N  N     . GLY B 1 87  ? 4.636   42.197  6.653   1.00 46.52 ? 1064 GLY B N     1 
ATOM   2911 C  CA    . GLY B 1 87  ? 4.285   42.163  8.054   1.00 46.58 ? 1064 GLY B CA    1 
ATOM   2912 C  C     . GLY B 1 87  ? 2.844   41.776  8.309   1.00 47.88 ? 1064 GLY B C     1 
ATOM   2913 O  O     . GLY B 1 87  ? 2.043   41.649  7.377   1.00 45.17 ? 1064 GLY B O     1 
ATOM   2914 N  N     . VAL B 1 88  ? 2.517   41.601  9.587   1.00 49.69 ? 1065 VAL B N     1 
ATOM   2915 C  CA    . VAL B 1 88  ? 1.175   41.223  9.989   1.00 52.51 ? 1065 VAL B CA    1 
ATOM   2916 C  C     . VAL B 1 88  ? 0.716   41.946  11.246  1.00 54.05 ? 1065 VAL B C     1 
ATOM   2917 O  O     . VAL B 1 88  ? 1.512   42.295  12.119  1.00 53.72 ? 1065 VAL B O     1 
ATOM   2918 C  CB    . VAL B 1 88  ? 1.081   39.714  10.273  1.00 52.91 ? 1065 VAL B CB    1 
ATOM   2919 C  CG1   . VAL B 1 88  ? -0.371  39.312  10.487  1.00 51.43 ? 1065 VAL B CG1   1 
ATOM   2920 C  CG2   . VAL B 1 88  ? 1.694   38.934  9.123   1.00 53.50 ? 1065 VAL B CG2   1 
ATOM   2921 N  N     . VAL B 1 89  ? -0.588  42.161  11.318  1.00 55.73 ? 1066 VAL B N     1 
ATOM   2922 C  CA    . VAL B 1 89  ? -1.202  42.805  12.456  1.00 59.00 ? 1066 VAL B CA    1 
ATOM   2923 C  C     . VAL B 1 89  ? -2.291  41.851  12.906  1.00 60.81 ? 1066 VAL B C     1 
ATOM   2924 O  O     . VAL B 1 89  ? -3.361  41.782  12.294  1.00 60.51 ? 1066 VAL B O     1 
ATOM   2925 C  CB    . VAL B 1 89  ? -1.836  44.154  12.076  1.00 59.82 ? 1066 VAL B CB    1 
ATOM   2926 C  CG1   . VAL B 1 89  ? -2.596  44.728  13.266  1.00 59.32 ? 1066 VAL B CG1   1 
ATOM   2927 C  CG2   . VAL B 1 89  ? -0.755  45.124  11.629  1.00 60.19 ? 1066 VAL B CG2   1 
ATOM   2928 N  N     . SER B 1 90  ? -2.016  41.109  13.976  1.00 63.31 ? 1067 SER B N     1 
ATOM   2929 C  CA    . SER B 1 90  ? -2.990  40.154  14.490  1.00 65.84 ? 1067 SER B CA    1 
ATOM   2930 C  C     . SER B 1 90  ? -3.629  40.646  15.778  1.00 66.98 ? 1067 SER B C     1 
ATOM   2931 O  O     . SER B 1 90  ? -4.738  40.227  16.122  1.00 67.16 ? 1067 SER B O     1 
ATOM   2932 C  CB    . SER B 1 90  ? -2.336  38.788  14.721  1.00 66.35 ? 1067 SER B CB    1 
ATOM   2933 O  OG    . SER B 1 90  ? -1.225  38.893  15.594  1.00 67.80 ? 1067 SER B OG    1 
ATOM   2934 N  N     . LYS B 1 91  ? -2.926  41.536  16.480  1.00 67.57 ? 1068 LYS B N     1 
ATOM   2935 C  CA    . LYS B 1 91  ? -3.417  42.108  17.735  1.00 67.61 ? 1068 LYS B CA    1 
ATOM   2936 C  C     . LYS B 1 91  ? -4.734  42.861  17.503  1.00 68.36 ? 1068 LYS B C     1 
ATOM   2937 O  O     . LYS B 1 91  ? -4.742  43.965  16.954  1.00 68.39 ? 1068 LYS B O     1 
ATOM   2938 C  CB    . LYS B 1 91  ? -2.361  43.059  18.318  1.00 65.68 ? 1068 LYS B CB    1 
ATOM   2939 N  N     . GLY B 1 92  ? -5.842  42.257  17.922  1.00 69.65 ? 1069 GLY B N     1 
ATOM   2940 C  CA    . GLY B 1 92  ? -7.141  42.881  17.748  1.00 70.23 ? 1069 GLY B CA    1 
ATOM   2941 C  C     . GLY B 1 92  ? -7.514  42.967  16.282  1.00 70.81 ? 1069 GLY B C     1 
ATOM   2942 O  O     . GLY B 1 92  ? -6.664  43.244  15.440  1.00 70.83 ? 1069 GLY B O     1 
ATOM   2943 N  N     . GLN B 1 93  ? -8.783  42.724  15.969  1.00 71.67 ? 1070 GLN B N     1 
ATOM   2944 C  CA    . GLN B 1 93  ? -9.240  42.772  14.582  1.00 71.67 ? 1070 GLN B CA    1 
ATOM   2945 C  C     . GLN B 1 93  ? -9.467  44.221  14.129  1.00 71.66 ? 1070 GLN B C     1 
ATOM   2946 O  O     . GLN B 1 93  ? -9.539  45.134  14.956  1.00 72.54 ? 1070 GLN B O     1 
ATOM   2947 C  CB    . GLN B 1 93  ? -10.530 41.952  14.421  1.00 71.13 ? 1070 GLN B CB    1 
ATOM   2948 N  N     . PRO B 1 94  ? -9.540  44.453  12.803  1.00 70.55 ? 1071 PRO B N     1 
ATOM   2949 C  CA    . PRO B 1 94  ? -9.412  43.424  11.760  1.00 68.73 ? 1071 PRO B CA    1 
ATOM   2950 C  C     . PRO B 1 94  ? -7.946  43.044  11.552  1.00 66.28 ? 1071 PRO B C     1 
ATOM   2951 O  O     . PRO B 1 94  ? -7.046  43.849  11.799  1.00 66.15 ? 1071 PRO B O     1 
ATOM   2952 C  CB    . PRO B 1 94  ? -10.033 44.088  10.534  1.00 68.98 ? 1071 PRO B CB    1 
ATOM   2953 C  CG    . PRO B 1 94  ? -9.686  45.524  10.738  1.00 70.80 ? 1071 PRO B CG    1 
ATOM   2954 C  CD    . PRO B 1 94  ? -9.959  45.738  12.216  1.00 70.60 ? 1071 PRO B CD    1 
ATOM   2955 N  N     . THR B 1 95  ? -7.712  41.816  11.104  1.00 63.59 ? 1072 THR B N     1 
ATOM   2956 C  CA    . THR B 1 95  ? -6.351  41.345  10.886  1.00 60.46 ? 1072 THR B CA    1 
ATOM   2957 C  C     . THR B 1 95  ? -5.815  41.916  9.585   1.00 58.24 ? 1072 THR B C     1 
ATOM   2958 O  O     . THR B 1 95  ? -6.535  41.981  8.585   1.00 56.95 ? 1072 THR B O     1 
ATOM   2959 C  CB    . THR B 1 95  ? -6.297  39.816  10.786  1.00 61.81 ? 1072 THR B CB    1 
ATOM   2960 O  OG1   . THR B 1 95  ? -7.117  39.229  11.808  1.00 61.96 ? 1072 THR B OG1   1 
ATOM   2961 C  CG2   . THR B 1 95  ? -4.865  39.338  10.956  1.00 62.69 ? 1072 THR B CG2   1 
ATOM   2962 N  N     . LEU B 1 96  ? -4.550  42.318  9.598   1.00 55.40 ? 1073 LEU B N     1 
ATOM   2963 C  CA    . LEU B 1 96  ? -3.933  42.902  8.415   1.00 53.70 ? 1073 LEU B CA    1 
ATOM   2964 C  C     . LEU B 1 96  ? -2.701  42.162  7.908   1.00 52.31 ? 1073 LEU B C     1 
ATOM   2965 O  O     . LEU B 1 96  ? -1.776  41.868  8.673   1.00 53.78 ? 1073 LEU B O     1 
ATOM   2966 C  CB    . LEU B 1 96  ? -3.527  44.353  8.692   1.00 53.75 ? 1073 LEU B CB    1 
ATOM   2967 C  CG    . LEU B 1 96  ? -4.580  45.337  9.211   1.00 54.16 ? 1073 LEU B CG    1 
ATOM   2968 C  CD1   . LEU B 1 96  ? -4.015  46.743  9.150   1.00 52.77 ? 1073 LEU B CD1   1 
ATOM   2969 C  CD2   . LEU B 1 96  ? -5.833  45.247  8.376   1.00 54.00 ? 1073 LEU B CD2   1 
ATOM   2970 N  N     . VAL B 1 97  ? -2.686  41.864  6.616   1.00 48.21 ? 1074 VAL B N     1 
ATOM   2971 C  CA    . VAL B 1 97  ? -1.536  41.214  6.023   1.00 46.60 ? 1074 VAL B CA    1 
ATOM   2972 C  C     . VAL B 1 97  ? -0.897  42.256  5.118   1.00 45.72 ? 1074 VAL B C     1 
ATOM   2973 O  O     . VAL B 1 97  ? -1.490  42.695  4.128   1.00 44.42 ? 1074 VAL B O     1 
ATOM   2974 C  CB    . VAL B 1 97  ? -1.946  39.969  5.213   1.00 47.39 ? 1074 VAL B CB    1 
ATOM   2975 C  CG1   . VAL B 1 97  ? -0.723  39.336  4.571   1.00 46.21 ? 1074 VAL B CG1   1 
ATOM   2976 C  CG2   . VAL B 1 97  ? -2.628  38.965  6.134   1.00 46.57 ? 1074 VAL B CG2   1 
ATOM   2977 N  N     . VAL B 1 98  ? 0.316   42.658  5.473   1.00 45.40 ? 1075 VAL B N     1 
ATOM   2978 C  CA    . VAL B 1 98  ? 1.044   43.664  4.717   1.00 43.96 ? 1075 VAL B CA    1 
ATOM   2979 C  C     . VAL B 1 98  ? 2.069   43.026  3.787   1.00 44.14 ? 1075 VAL B C     1 
ATOM   2980 O  O     . VAL B 1 98  ? 2.936   42.270  4.223   1.00 44.59 ? 1075 VAL B O     1 
ATOM   2981 C  CB    . VAL B 1 98  ? 1.745   44.613  5.680   1.00 43.17 ? 1075 VAL B CB    1 
ATOM   2982 C  CG1   . VAL B 1 98  ? 2.504   45.679  4.914   1.00 42.61 ? 1075 VAL B CG1   1 
ATOM   2983 C  CG2   . VAL B 1 98  ? 0.711   45.224  6.610   1.00 43.22 ? 1075 VAL B CG2   1 
ATOM   2984 N  N     . MET B 1 99  ? 1.969   43.332  2.500   1.00 43.72 ? 1076 MET B N     1 
ATOM   2985 C  CA    . MET B 1 99  ? 2.896   42.770  1.543   1.00 43.79 ? 1076 MET B CA    1 
ATOM   2986 C  C     . MET B 1 99  ? 3.345   43.826  0.578   1.00 43.58 ? 1076 MET B C     1 
ATOM   2987 O  O     . MET B 1 99  ? 2.869   44.963  0.606   1.00 42.93 ? 1076 MET B O     1 
ATOM   2988 C  CB    . MET B 1 99  ? 2.247   41.616  0.795   1.00 46.58 ? 1076 MET B CB    1 
ATOM   2989 C  CG    . MET B 1 99  ? 0.904   41.965  0.194   1.00 48.93 ? 1076 MET B CG    1 
ATOM   2990 S  SD    . MET B 1 99  ? -0.038  40.477  -0.139  1.00 51.97 ? 1076 MET B SD    1 
ATOM   2991 C  CE    . MET B 1 99  ? -0.171  40.550  -1.925  1.00 52.82 ? 1076 MET B CE    1 
ATOM   2992 N  N     . GLU B 1 100 ? 4.267   43.455  -0.290  1.00 43.37 ? 1077 GLU B N     1 
ATOM   2993 C  CA    . GLU B 1 100 ? 4.755   44.448  -1.209  1.00 42.47 ? 1077 GLU B CA    1 
ATOM   2994 C  C     . GLU B 1 100 ? 3.669   44.861  -2.170  1.00 41.67 ? 1077 GLU B C     1 
ATOM   2995 O  O     . GLU B 1 100 ? 2.802   44.078  -2.551  1.00 41.49 ? 1077 GLU B O     1 
ATOM   2996 C  CB    . GLU B 1 100 ? 6.021   43.984  -1.950  1.00 41.49 ? 1077 GLU B CB    1 
ATOM   2997 C  CG    . GLU B 1 100 ? 5.863   42.876  -2.960  1.00 43.85 ? 1077 GLU B CG    1 
ATOM   2998 C  CD    . GLU B 1 100 ? 7.178   42.558  -3.679  1.00 44.03 ? 1077 GLU B CD    1 
ATOM   2999 O  OE1   . GLU B 1 100 ? 7.633   43.373  -4.512  1.00 43.78 ? 1077 GLU B OE1   1 
ATOM   3000 O  OE2   . GLU B 1 100 ? 7.767   41.493  -3.407  1.00 44.41 ? 1077 GLU B OE2   1 
ATOM   3001 N  N     . LEU B 1 101 ? 3.726   46.126  -2.547  1.00 41.62 ? 1078 LEU B N     1 
ATOM   3002 C  CA    . LEU B 1 101 ? 2.756   46.691  -3.453  1.00 40.41 ? 1078 LEU B CA    1 
ATOM   3003 C  C     . LEU B 1 101 ? 3.167   46.412  -4.885  1.00 39.36 ? 1078 LEU B C     1 
ATOM   3004 O  O     . LEU B 1 101 ? 4.264   46.772  -5.298  1.00 40.62 ? 1078 LEU B O     1 
ATOM   3005 C  CB    . LEU B 1 101 ? 2.662   48.199  -3.224  1.00 40.96 ? 1078 LEU B CB    1 
ATOM   3006 C  CG    . LEU B 1 101 ? 1.704   48.961  -4.134  1.00 41.79 ? 1078 LEU B CG    1 
ATOM   3007 C  CD1   . LEU B 1 101 ? 0.298   48.437  -3.914  1.00 41.52 ? 1078 LEU B CD1   1 
ATOM   3008 C  CD2   . LEU B 1 101 ? 1.781   50.450  -3.835  1.00 41.43 ? 1078 LEU B CD2   1 
ATOM   3009 N  N     . MET B 1 102 ? 2.289   45.762  -5.641  1.00 38.59 ? 1079 MET B N     1 
ATOM   3010 C  CA    . MET B 1 102 ? 2.559   45.482  -7.044  1.00 37.69 ? 1079 MET B CA    1 
ATOM   3011 C  C     . MET B 1 102 ? 1.891   46.613  -7.816  1.00 39.09 ? 1079 MET B C     1 
ATOM   3012 O  O     . MET B 1 102 ? 0.715   46.548  -8.181  1.00 39.96 ? 1079 MET B O     1 
ATOM   3013 C  CB    . MET B 1 102 ? 1.997   44.112  -7.439  1.00 35.15 ? 1079 MET B CB    1 
ATOM   3014 C  CG    . MET B 1 102 ? 2.643   42.964  -6.654  1.00 34.40 ? 1079 MET B CG    1 
ATOM   3015 S  SD    . MET B 1 102 ? 4.486   43.079  -6.580  1.00 32.30 ? 1079 MET B SD    1 
ATOM   3016 C  CE    . MET B 1 102 ? 4.933   42.351  -8.176  1.00 30.31 ? 1079 MET B CE    1 
ATOM   3017 N  N     . ALA B 1 103 ? 2.677   47.659  -8.047  1.00 40.70 ? 1080 ALA B N     1 
ATOM   3018 C  CA    . ALA B 1 103 ? 2.244   48.880  -8.725  1.00 42.61 ? 1080 ALA B CA    1 
ATOM   3019 C  C     . ALA B 1 103 ? 1.342   48.734  -9.938  1.00 43.74 ? 1080 ALA B C     1 
ATOM   3020 O  O     . ALA B 1 103 ? 0.443   49.551  -10.129 1.00 45.11 ? 1080 ALA B O     1 
ATOM   3021 C  CB    . ALA B 1 103 ? 3.461   49.714  -9.099  1.00 41.74 ? 1080 ALA B CB    1 
ATOM   3022 N  N     . HIS B 1 104 ? 1.568   47.715  -10.760 1.00 43.89 ? 1081 HIS B N     1 
ATOM   3023 C  CA    . HIS B 1 104 ? 0.732   47.543  -11.945 1.00 44.77 ? 1081 HIS B CA    1 
ATOM   3024 C  C     . HIS B 1 104 ? -0.318  46.448  -11.836 1.00 43.70 ? 1081 HIS B C     1 
ATOM   3025 O  O     . HIS B 1 104 ? -0.772  45.912  -12.856 1.00 43.84 ? 1081 HIS B O     1 
ATOM   3026 C  CB    . HIS B 1 104 ? 1.600   47.314  -13.181 1.00 47.72 ? 1081 HIS B CB    1 
ATOM   3027 C  CG    . HIS B 1 104 ? 2.386   48.521  -13.586 1.00 51.97 ? 1081 HIS B CG    1 
ATOM   3028 N  ND1   . HIS B 1 104 ? 1.789   49.682  -14.026 1.00 53.81 ? 1081 HIS B ND1   1 
ATOM   3029 C  CD2   . HIS B 1 104 ? 3.719   48.761  -13.580 1.00 53.72 ? 1081 HIS B CD2   1 
ATOM   3030 C  CE1   . HIS B 1 104 ? 2.722   50.587  -14.273 1.00 53.35 ? 1081 HIS B CE1   1 
ATOM   3031 N  NE2   . HIS B 1 104 ? 3.900   50.053  -14.010 1.00 53.46 ? 1081 HIS B NE2   1 
ATOM   3032 N  N     . GLY B 1 105 ? -0.703  46.123  -10.603 1.00 41.54 ? 1082 GLY B N     1 
ATOM   3033 C  CA    . GLY B 1 105 ? -1.719  45.108  -10.376 1.00 40.66 ? 1082 GLY B CA    1 
ATOM   3034 C  C     . GLY B 1 105 ? -1.438  43.732  -10.951 1.00 41.00 ? 1082 GLY B C     1 
ATOM   3035 O  O     . GLY B 1 105 ? -0.280  43.337  -11.137 1.00 42.61 ? 1082 GLY B O     1 
ATOM   3036 N  N     . ASP B 1 106 ? -2.505  42.999  -11.248 1.00 39.13 ? 1083 ASP B N     1 
ATOM   3037 C  CA    . ASP B 1 106 ? -2.362  41.652  -11.767 1.00 37.69 ? 1083 ASP B CA    1 
ATOM   3038 C  C     . ASP B 1 106 ? -2.093  41.613  -13.256 1.00 36.69 ? 1083 ASP B C     1 
ATOM   3039 O  O     . ASP B 1 106 ? -2.509  42.488  -14.007 1.00 36.57 ? 1083 ASP B O     1 
ATOM   3040 C  CB    . ASP B 1 106 ? -3.612  40.833  -11.468 1.00 39.18 ? 1083 ASP B CB    1 
ATOM   3041 C  CG    . ASP B 1 106 ? -4.778  41.237  -12.329 1.00 40.27 ? 1083 ASP B CG    1 
ATOM   3042 O  OD1   . ASP B 1 106 ? -5.404  42.271  -12.012 1.00 41.24 ? 1083 ASP B OD1   1 
ATOM   3043 O  OD2   . ASP B 1 106 ? -5.051  40.535  -13.336 1.00 39.26 ? 1083 ASP B OD2   1 
ATOM   3044 N  N     . LEU B 1 107 ? -1.394  40.568  -13.670 1.00 36.57 ? 1084 LEU B N     1 
ATOM   3045 C  CA    . LEU B 1 107 ? -1.033  40.373  -15.064 1.00 35.89 ? 1084 LEU B CA    1 
ATOM   3046 C  C     . LEU B 1 107 ? -2.230  40.264  -16.011 1.00 36.02 ? 1084 LEU B C     1 
ATOM   3047 O  O     . LEU B 1 107 ? -2.207  40.841  -17.092 1.00 36.07 ? 1084 LEU B O     1 
ATOM   3048 C  CB    . LEU B 1 107 ? -0.160  39.129  -15.182 1.00 33.46 ? 1084 LEU B CB    1 
ATOM   3049 C  CG    . LEU B 1 107 ? 0.345   38.755  -16.571 1.00 31.71 ? 1084 LEU B CG    1 
ATOM   3050 C  CD1   . LEU B 1 107 ? 1.161   39.883  -17.170 1.00 26.67 ? 1084 LEU B CD1   1 
ATOM   3051 C  CD2   . LEU B 1 107 ? 1.180   37.491  -16.451 1.00 32.54 ? 1084 LEU B CD2   1 
ATOM   3052 N  N     . LYS B 1 108 ? -3.269  39.531  -15.617 1.00 36.57 ? 1085 LYS B N     1 
ATOM   3053 C  CA    . LYS B 1 108 ? -4.445  39.377  -16.474 1.00 38.33 ? 1085 LYS B CA    1 
ATOM   3054 C  C     . LYS B 1 108 ? -4.968  40.740  -16.862 1.00 38.44 ? 1085 LYS B C     1 
ATOM   3055 O  O     . LYS B 1 108 ? -5.069  41.079  -18.043 1.00 37.60 ? 1085 LYS B O     1 
ATOM   3056 C  CB    . LYS B 1 108 ? -5.569  38.620  -15.753 1.00 39.76 ? 1085 LYS B CB    1 
ATOM   3057 C  CG    . LYS B 1 108 ? -6.825  38.429  -16.602 1.00 40.68 ? 1085 LYS B CG    1 
ATOM   3058 C  CD    . LYS B 1 108 ? -7.955  37.803  -15.804 1.00 46.64 ? 1085 LYS B CD    1 
ATOM   3059 C  CE    . LYS B 1 108 ? -8.824  36.870  -16.669 1.00 47.82 ? 1085 LYS B CE    1 
ATOM   3060 N  NZ    . LYS B 1 108 ? -9.226  35.620  -15.919 1.00 46.81 ? 1085 LYS B NZ    1 
ATOM   3061 N  N     . SER B 1 109 ? -5.302  41.511  -15.839 1.00 38.53 ? 1086 SER B N     1 
ATOM   3062 C  CA    . SER B 1 109 ? -5.813  42.844  -16.015 1.00 40.53 ? 1086 SER B CA    1 
ATOM   3063 C  C     . SER B 1 109 ? -4.854  43.681  -16.858 1.00 41.78 ? 1086 SER B C     1 
ATOM   3064 O  O     . SER B 1 109 ? -5.283  44.445  -17.715 1.00 41.99 ? 1086 SER B O     1 
ATOM   3065 C  CB    . SER B 1 109 ? -6.029  43.459  -14.650 1.00 39.95 ? 1086 SER B CB    1 
ATOM   3066 O  OG    . SER B 1 109 ? -6.273  44.829  -14.800 1.00 49.08 ? 1086 SER B OG    1 
ATOM   3067 N  N     . TYR B 1 110 ? -3.554  43.532  -16.630 1.00 44.37 ? 1087 TYR B N     1 
ATOM   3068 C  CA    . TYR B 1 110 ? -2.576  44.289  -17.407 1.00 46.66 ? 1087 TYR B CA    1 
ATOM   3069 C  C     . TYR B 1 110 ? -2.585  43.854  -18.877 1.00 47.52 ? 1087 TYR B C     1 
ATOM   3070 O  O     . TYR B 1 110 ? -2.534  44.696  -19.783 1.00 46.69 ? 1087 TYR B O     1 
ATOM   3071 C  CB    . TYR B 1 110 ? -1.171  44.124  -16.822 1.00 48.70 ? 1087 TYR B CB    1 
ATOM   3072 C  CG    . TYR B 1 110 ? -0.075  44.716  -17.693 1.00 51.56 ? 1087 TYR B CG    1 
ATOM   3073 C  CD1   . TYR B 1 110 ? 0.096   46.101  -17.802 1.00 53.49 ? 1087 TYR B CD1   1 
ATOM   3074 C  CD2   . TYR B 1 110 ? 0.768   43.890  -18.440 1.00 50.95 ? 1087 TYR B CD2   1 
ATOM   3075 C  CE1   . TYR B 1 110 ? 1.084   46.645  -18.638 1.00 54.21 ? 1087 TYR B CE1   1 
ATOM   3076 C  CE2   . TYR B 1 110 ? 1.748   44.419  -19.270 1.00 53.18 ? 1087 TYR B CE2   1 
ATOM   3077 C  CZ    . TYR B 1 110 ? 1.904   45.798  -19.370 1.00 55.04 ? 1087 TYR B CZ    1 
ATOM   3078 O  OH    . TYR B 1 110 ? 2.876   46.319  -20.210 1.00 56.87 ? 1087 TYR B OH    1 
ATOM   3079 N  N     . LEU B 1 111 ? -2.648  42.544  -19.111 1.00 47.68 ? 1088 LEU B N     1 
ATOM   3080 C  CA    . LEU B 1 111 ? -2.681  42.010  -20.472 1.00 49.13 ? 1088 LEU B CA    1 
ATOM   3081 C  C     . LEU B 1 111 ? -3.894  42.523  -21.252 1.00 51.32 ? 1088 LEU B C     1 
ATOM   3082 O  O     . LEU B 1 111 ? -3.798  42.825  -22.444 1.00 51.70 ? 1088 LEU B O     1 
ATOM   3083 C  CB    . LEU B 1 111 ? -2.717  40.480  -20.443 1.00 45.61 ? 1088 LEU B CB    1 
ATOM   3084 C  CG    . LEU B 1 111 ? -1.413  39.764  -20.103 1.00 43.71 ? 1088 LEU B CG    1 
ATOM   3085 C  CD1   . LEU B 1 111 ? -1.682  38.289  -19.850 1.00 42.55 ? 1088 LEU B CD1   1 
ATOM   3086 C  CD2   . LEU B 1 111 ? -0.426  39.953  -21.234 1.00 40.34 ? 1088 LEU B CD2   1 
ATOM   3087 N  N     . ARG B 1 112 ? -5.036  42.613  -20.578 1.00 52.55 ? 1089 ARG B N     1 
ATOM   3088 C  CA    . ARG B 1 112 ? -6.249  43.090  -21.224 1.00 54.44 ? 1089 ARG B CA    1 
ATOM   3089 C  C     . ARG B 1 112 ? -6.148  44.571  -21.585 1.00 54.69 ? 1089 ARG B C     1 
ATOM   3090 O  O     . ARG B 1 112 ? -6.733  45.019  -22.568 1.00 53.82 ? 1089 ARG B O     1 
ATOM   3091 C  CB    . ARG B 1 112 ? -7.461  42.827  -20.326 1.00 55.63 ? 1089 ARG B CB    1 
ATOM   3092 C  CG    . ARG B 1 112 ? -7.781  41.348  -20.186 1.00 58.45 ? 1089 ARG B CG    1 
ATOM   3093 C  CD    . ARG B 1 112 ? -9.231  41.128  -19.812 1.00 62.63 ? 1089 ARG B CD    1 
ATOM   3094 N  NE    . ARG B 1 112 ? -9.619  39.717  -19.852 1.00 66.91 ? 1089 ARG B NE    1 
ATOM   3095 C  CZ    . ARG B 1 112 ? -10.851 39.266  -19.597 1.00 68.21 ? 1089 ARG B CZ    1 
ATOM   3096 N  NH1   . ARG B 1 112 ? -11.822 40.121  -19.284 1.00 68.11 ? 1089 ARG B NH1   1 
ATOM   3097 N  NH2   . ARG B 1 112 ? -11.114 37.962  -19.652 1.00 66.88 ? 1089 ARG B NH2   1 
ATOM   3098 N  N     . SER B 1 113 ? -5.403  45.322  -20.785 1.00 55.68 ? 1090 SER B N     1 
ATOM   3099 C  CA    . SER B 1 113 ? -5.191  46.737  -21.045 1.00 57.40 ? 1090 SER B CA    1 
ATOM   3100 C  C     . SER B 1 113 ? -4.548  46.884  -22.411 1.00 57.98 ? 1090 SER B C     1 
ATOM   3101 O  O     . SER B 1 113 ? -4.809  47.846  -23.122 1.00 58.73 ? 1090 SER B O     1 
ATOM   3102 C  CB    . SER B 1 113 ? -4.216  47.338  -20.034 1.00 58.22 ? 1090 SER B CB    1 
ATOM   3103 O  OG    . SER B 1 113 ? -4.607  47.075  -18.705 1.00 64.03 ? 1090 SER B OG    1 
ATOM   3104 N  N     . LEU B 1 114 ? -3.698  45.924  -22.766 1.00 58.16 ? 1091 LEU B N     1 
ATOM   3105 C  CA    . LEU B 1 114 ? -2.986  45.970  -24.034 1.00 59.61 ? 1091 LEU B CA    1 
ATOM   3106 C  C     . LEU B 1 114 ? -3.811  45.648  -25.266 1.00 61.94 ? 1091 LEU B C     1 
ATOM   3107 O  O     . LEU B 1 114 ? -3.343  45.829  -26.392 1.00 62.68 ? 1091 LEU B O     1 
ATOM   3108 C  CB    . LEU B 1 114 ? -1.752  45.066  -23.976 1.00 57.36 ? 1091 LEU B CB    1 
ATOM   3109 C  CG    . LEU B 1 114 ? -0.790  45.472  -22.852 1.00 56.93 ? 1091 LEU B CG    1 
ATOM   3110 C  CD1   . LEU B 1 114 ? 0.466   44.615  -22.870 1.00 54.28 ? 1091 LEU B CD1   1 
ATOM   3111 C  CD2   . LEU B 1 114 ? -0.434  46.939  -23.013 1.00 54.14 ? 1091 LEU B CD2   1 
ATOM   3112 N  N     . ARG B 1 115 ? -5.033  45.165  -25.071 1.00 64.84 ? 1092 ARG B N     1 
ATOM   3113 C  CA    . ARG B 1 115 ? -5.890  44.882  -26.219 1.00 66.78 ? 1092 ARG B CA    1 
ATOM   3114 C  C     . ARG B 1 115 ? -6.077  46.231  -26.892 1.00 68.32 ? 1092 ARG B C     1 
ATOM   3115 O  O     . ARG B 1 115 ? -6.304  47.233  -26.217 1.00 68.76 ? 1092 ARG B O     1 
ATOM   3116 C  CB    . ARG B 1 115 ? -7.247  44.330  -25.773 1.00 65.63 ? 1092 ARG B CB    1 
ATOM   3117 C  CG    . ARG B 1 115 ? -7.165  42.909  -25.281 1.00 66.51 ? 1092 ARG B CG    1 
ATOM   3118 C  CD    . ARG B 1 115 ? -8.504  42.349  -24.856 1.00 66.39 ? 1092 ARG B CD    1 
ATOM   3119 N  NE    . ARG B 1 115 ? -8.371  40.927  -24.537 1.00 68.34 ? 1092 ARG B NE    1 
ATOM   3120 C  CZ    . ARG B 1 115 ? -9.285  40.195  -23.902 1.00 68.24 ? 1092 ARG B CZ    1 
ATOM   3121 N  NH1   . ARG B 1 115 ? -10.428 40.737  -23.502 1.00 67.35 ? 1092 ARG B NH1   1 
ATOM   3122 N  NH2   . ARG B 1 115 ? -9.046  38.914  -23.658 1.00 67.93 ? 1092 ARG B NH2   1 
ATOM   3123 N  N     . PRO B 1 116 ? -5.963  46.287  -28.226 1.00 70.15 ? 1093 PRO B N     1 
ATOM   3124 C  CA    . PRO B 1 116 ? -6.139  47.576  -28.901 1.00 71.65 ? 1093 PRO B CA    1 
ATOM   3125 C  C     . PRO B 1 116 ? -7.468  48.258  -28.560 1.00 72.93 ? 1093 PRO B C     1 
ATOM   3126 O  O     . PRO B 1 116 ? -7.516  49.465  -28.316 1.00 72.90 ? 1093 PRO B O     1 
ATOM   3127 C  CB    . PRO B 1 116 ? -6.016  47.210  -30.380 1.00 70.81 ? 1093 PRO B CB    1 
ATOM   3128 C  CG    . PRO B 1 116 ? -6.461  45.776  -30.416 1.00 71.02 ? 1093 PRO B CG    1 
ATOM   3129 C  CD    . PRO B 1 116 ? -5.782  45.205  -29.207 1.00 70.78 ? 1093 PRO B CD    1 
ATOM   3130 N  N     . GLU B 1 117 ? -8.541  47.475  -28.531 1.00 74.47 ? 1094 GLU B N     1 
ATOM   3131 C  CA    . GLU B 1 117 ? -9.866  48.001  -28.218 1.00 76.39 ? 1094 GLU B CA    1 
ATOM   3132 C  C     . GLU B 1 117 ? -10.030 48.422  -26.752 1.00 77.39 ? 1094 GLU B C     1 
ATOM   3133 O  O     . GLU B 1 117 ? -10.941 49.180  -26.416 1.00 77.14 ? 1094 GLU B O     1 
ATOM   3134 C  CB    . GLU B 1 117 ? -10.931 46.957  -28.569 1.00 76.24 ? 1094 GLU B CB    1 
ATOM   3135 N  N     . ALA B 1 118 ? -9.148  47.931  -25.886 1.00 78.96 ? 1095 ALA B N     1 
ATOM   3136 C  CA    . ALA B 1 118 ? -9.213  48.229  -24.455 1.00 80.10 ? 1095 ALA B CA    1 
ATOM   3137 C  C     . ALA B 1 118 ? -9.461  49.699  -24.130 1.00 80.33 ? 1095 ALA B C     1 
ATOM   3138 O  O     . ALA B 1 118 ? -8.673  50.573  -24.494 1.00 80.42 ? 1095 ALA B O     1 
ATOM   3139 C  CB    . ALA B 1 118 ? -7.939  47.754  -23.769 1.00 80.62 ? 1095 ALA B CB    1 
ATOM   3140 N  N     . GLU B 1 119 ? -10.563 49.961  -23.435 1.00 79.87 ? 1096 GLU B N     1 
ATOM   3141 C  CA    . GLU B 1 119 ? -10.910 51.323  -23.056 1.00 79.94 ? 1096 GLU B CA    1 
ATOM   3142 C  C     . GLU B 1 119 ? -9.813  51.939  -22.185 1.00 79.72 ? 1096 GLU B C     1 
ATOM   3143 O  O     . GLU B 1 119 ? -9.577  53.143  -22.231 1.00 79.94 ? 1096 GLU B O     1 
ATOM   3144 C  CB    . GLU B 1 119 ? -12.245 51.334  -22.306 1.00 80.20 ? 1096 GLU B CB    1 
ATOM   3145 N  N     . ASN B 1 120 ? -9.143  51.103  -21.396 1.00 79.45 ? 1097 ASN B N     1 
ATOM   3146 C  CA    . ASN B 1 120 ? -8.076  51.554  -20.505 1.00 78.87 ? 1097 ASN B CA    1 
ATOM   3147 C  C     . ASN B 1 120 ? -6.702  51.340  -21.119 1.00 78.37 ? 1097 ASN B C     1 
ATOM   3148 O  O     . ASN B 1 120 ? -5.699  51.333  -20.411 1.00 77.74 ? 1097 ASN B O     1 
ATOM   3149 C  CB    . ASN B 1 120 ? -8.135  50.793  -19.182 1.00 78.41 ? 1097 ASN B CB    1 
ATOM   3150 C  CG    . ASN B 1 120 ? -8.056  49.289  -19.378 1.00 78.35 ? 1097 ASN B CG    1 
ATOM   3151 O  OD1   . ASN B 1 120 ? -7.200  48.786  -20.104 1.00 78.77 ? 1097 ASN B OD1   1 
ATOM   3152 N  ND2   . ASN B 1 120 ? -8.953  48.564  -18.729 1.00 78.89 ? 1097 ASN B ND2   1 
ATOM   3153 N  N     . ASN B 1 121 ? -6.661  51.158  -22.433 1.00 78.04 ? 1098 ASN B N     1 
ATOM   3154 C  CA    . ASN B 1 121 ? -5.402  50.941  -23.125 1.00 77.64 ? 1098 ASN B CA    1 
ATOM   3155 C  C     . ASN B 1 121 ? -4.419  52.007  -22.670 1.00 78.28 ? 1098 ASN B C     1 
ATOM   3156 O  O     . ASN B 1 121 ? -4.715  53.193  -22.730 1.00 78.15 ? 1098 ASN B O     1 
ATOM   3157 C  CB    . ASN B 1 121 ? -5.615  51.046  -24.634 1.00 76.55 ? 1098 ASN B CB    1 
ATOM   3158 C  CG    . ASN B 1 121 ? -4.418  50.566  -25.428 1.00 75.93 ? 1098 ASN B CG    1 
ATOM   3159 O  OD1   . ASN B 1 121 ? -3.285  50.968  -25.164 1.00 76.03 ? 1098 ASN B OD1   1 
ATOM   3160 N  ND2   . ASN B 1 121 ? -4.663  49.708  -26.411 1.00 74.87 ? 1098 ASN B ND2   1 
ATOM   3161 N  N     . PRO B 1 122 ? -3.240  51.593  -22.183 1.00 79.23 ? 1099 PRO B N     1 
ATOM   3162 C  CA    . PRO B 1 122 ? -2.229  52.549  -21.722 1.00 79.51 ? 1099 PRO B CA    1 
ATOM   3163 C  C     . PRO B 1 122 ? -1.778  53.435  -22.879 1.00 80.01 ? 1099 PRO B C     1 
ATOM   3164 O  O     . PRO B 1 122 ? -2.401  54.453  -23.170 1.00 81.41 ? 1099 PRO B O     1 
ATOM   3165 C  CB    . PRO B 1 122 ? -1.105  51.648  -21.218 1.00 79.44 ? 1099 PRO B CB    1 
ATOM   3166 C  CG    . PRO B 1 122 ? -1.819  50.390  -20.824 1.00 79.56 ? 1099 PRO B CG    1 
ATOM   3167 C  CD    . PRO B 1 122 ? -2.794  50.210  -21.950 1.00 78.71 ? 1099 PRO B CD    1 
ATOM   3168 N  N     . GLY B 1 123 ? -0.694  53.035  -23.536 1.00 79.73 ? 1100 GLY B N     1 
ATOM   3169 C  CA    . GLY B 1 123 ? -0.181  53.797  -24.658 1.00 79.05 ? 1100 GLY B CA    1 
ATOM   3170 C  C     . GLY B 1 123 ? 0.882   53.026  -25.414 1.00 78.49 ? 1100 GLY B C     1 
ATOM   3171 O  O     . GLY B 1 123 ? 1.749   53.616  -26.066 1.00 79.21 ? 1100 GLY B O     1 
ATOM   3172 N  N     . ARG B 1 124 ? 0.819   51.702  -25.325 1.00 76.62 ? 1101 ARG B N     1 
ATOM   3173 C  CA    . ARG B 1 124 ? 1.785   50.852  -26.006 1.00 74.16 ? 1101 ARG B CA    1 
ATOM   3174 C  C     . ARG B 1 124 ? 1.085   49.684  -26.672 1.00 72.78 ? 1101 ARG B C     1 
ATOM   3175 O  O     . ARG B 1 124 ? -0.097  49.433  -26.429 1.00 73.09 ? 1101 ARG B O     1 
ATOM   3176 C  CB    . ARG B 1 124 ? 2.827   50.323  -25.021 1.00 72.61 ? 1101 ARG B CB    1 
ATOM   3177 C  CG    . ARG B 1 124 ? 2.242   49.596  -23.825 1.00 70.63 ? 1101 ARG B CG    1 
ATOM   3178 C  CD    . ARG B 1 124 ? 3.219   48.554  -23.319 1.00 68.98 ? 1101 ARG B CD    1 
ATOM   3179 N  NE    . ARG B 1 124 ? 3.365   47.473  -24.289 1.00 67.00 ? 1101 ARG B NE    1 
ATOM   3180 C  CZ    . ARG B 1 124 ? 4.354   46.589  -24.284 1.00 66.11 ? 1101 ARG B CZ    1 
ATOM   3181 N  NH1   . ARG B 1 124 ? 5.300   46.651  -23.358 1.00 64.01 ? 1101 ARG B NH1   1 
ATOM   3182 N  NH2   . ARG B 1 124 ? 4.392   45.642  -25.207 1.00 66.16 ? 1101 ARG B NH2   1 
ATOM   3183 N  N     . PRO B 1 125 ? 1.809   48.957  -27.536 1.00 71.07 ? 1102 PRO B N     1 
ATOM   3184 C  CA    . PRO B 1 125 ? 1.235   47.806  -28.234 1.00 70.02 ? 1102 PRO B CA    1 
ATOM   3185 C  C     . PRO B 1 125 ? 1.299   46.561  -27.358 1.00 69.01 ? 1102 PRO B C     1 
ATOM   3186 O  O     . PRO B 1 125 ? 1.735   46.620  -26.206 1.00 68.08 ? 1102 PRO B O     1 
ATOM   3187 C  CB    . PRO B 1 125 ? 2.115   47.692  -29.474 1.00 68.96 ? 1102 PRO B CB    1 
ATOM   3188 C  CG    . PRO B 1 125 ? 3.449   48.079  -28.949 1.00 69.16 ? 1102 PRO B CG    1 
ATOM   3189 C  CD    . PRO B 1 125 ? 3.145   49.279  -28.074 1.00 69.94 ? 1102 PRO B CD    1 
ATOM   3190 N  N     . PRO B 1 126 ? 0.834   45.421  -27.886 1.00 68.57 ? 1103 PRO B N     1 
ATOM   3191 C  CA    . PRO B 1 126 ? 0.876   44.190  -27.099 1.00 67.82 ? 1103 PRO B CA    1 
ATOM   3192 C  C     . PRO B 1 126 ? 2.325   43.818  -26.793 1.00 67.06 ? 1103 PRO B C     1 
ATOM   3193 O  O     . PRO B 1 126 ? 3.256   44.305  -27.441 1.00 67.27 ? 1103 PRO B O     1 
ATOM   3194 C  CB    . PRO B 1 126 ? 0.188   43.182  -28.010 1.00 67.54 ? 1103 PRO B CB    1 
ATOM   3195 C  CG    . PRO B 1 126 ? -0.822  44.032  -28.722 1.00 66.75 ? 1103 PRO B CG    1 
ATOM   3196 C  CD    . PRO B 1 126 ? -0.007  45.245  -29.083 1.00 67.37 ? 1103 PRO B CD    1 
ATOM   3197 N  N     . PRO B 1 127 ? 2.531   42.953  -25.798 1.00 65.76 ? 1104 PRO B N     1 
ATOM   3198 C  CA    . PRO B 1 127 ? 3.873   42.522  -25.408 1.00 64.45 ? 1104 PRO B CA    1 
ATOM   3199 C  C     . PRO B 1 127 ? 4.663   42.007  -26.593 1.00 62.84 ? 1104 PRO B C     1 
ATOM   3200 O  O     . PRO B 1 127 ? 4.094   41.488  -27.546 1.00 62.34 ? 1104 PRO B O     1 
ATOM   3201 C  CB    . PRO B 1 127 ? 3.592   41.416  -24.398 1.00 65.19 ? 1104 PRO B CB    1 
ATOM   3202 C  CG    . PRO B 1 127 ? 2.279   41.822  -23.809 1.00 64.71 ? 1104 PRO B CG    1 
ATOM   3203 C  CD    . PRO B 1 127 ? 1.507   42.237  -25.019 1.00 65.08 ? 1104 PRO B CD    1 
ATOM   3204 N  N     . THR B 1 128 ? 5.977   42.153  -26.517 1.00 62.01 ? 1105 THR B N     1 
ATOM   3205 C  CA    . THR B 1 128 ? 6.879   41.695  -27.565 1.00 61.09 ? 1105 THR B CA    1 
ATOM   3206 C  C     . THR B 1 128 ? 7.276   40.266  -27.259 1.00 60.65 ? 1105 THR B C     1 
ATOM   3207 O  O     . THR B 1 128 ? 7.214   39.845  -26.107 1.00 60.76 ? 1105 THR B O     1 
ATOM   3208 C  CB    . THR B 1 128 ? 8.173   42.502  -27.562 1.00 59.62 ? 1105 THR B CB    1 
ATOM   3209 O  OG1   . THR B 1 128 ? 7.862   43.895  -27.586 1.00 58.76 ? 1105 THR B OG1   1 
ATOM   3210 C  CG2   . THR B 1 128 ? 9.022   42.146  -28.767 1.00 61.90 ? 1105 THR B CG2   1 
ATOM   3211 N  N     . LEU B 1 129 ? 7.685   39.527  -28.285 1.00 60.04 ? 1106 LEU B N     1 
ATOM   3212 C  CA    . LEU B 1 129 ? 8.137   38.159  -28.092 1.00 58.83 ? 1106 LEU B CA    1 
ATOM   3213 C  C     . LEU B 1 129 ? 9.123   38.229  -26.934 1.00 58.59 ? 1106 LEU B C     1 
ATOM   3214 O  O     . LEU B 1 129 ? 9.062   37.431  -26.001 1.00 58.82 ? 1106 LEU B O     1 
ATOM   3215 C  CB    . LEU B 1 129 ? 8.855   37.652  -29.345 1.00 59.25 ? 1106 LEU B CB    1 
ATOM   3216 C  CG    . LEU B 1 129 ? 9.272   36.176  -29.428 1.00 61.25 ? 1106 LEU B CG    1 
ATOM   3217 C  CD1   . LEU B 1 129 ? 9.938   35.906  -30.765 1.00 61.13 ? 1106 LEU B CD1   1 
ATOM   3218 C  CD2   . LEU B 1 129 ? 10.226  35.826  -28.307 1.00 63.03 ? 1106 LEU B CD2   1 
ATOM   3219 N  N     . GLN B 1 130 ? 10.028  39.201  -27.005 1.00 58.35 ? 1107 GLN B N     1 
ATOM   3220 C  CA    . GLN B 1 130 ? 11.040  39.391  -25.973 1.00 58.14 ? 1107 GLN B CA    1 
ATOM   3221 C  C     . GLN B 1 130 ? 10.398  39.633  -24.615 1.00 57.01 ? 1107 GLN B C     1 
ATOM   3222 O  O     . GLN B 1 130 ? 10.745  38.975  -23.634 1.00 56.92 ? 1107 GLN B O     1 
ATOM   3223 C  CB    . GLN B 1 130 ? 11.954  40.575  -26.324 1.00 59.27 ? 1107 GLN B CB    1 
ATOM   3224 C  CG    . GLN B 1 130 ? 13.176  40.682  -25.421 1.00 60.81 ? 1107 GLN B CG    1 
ATOM   3225 C  CD    . GLN B 1 130 ? 13.972  39.378  -25.384 1.00 65.73 ? 1107 GLN B CD    1 
ATOM   3226 O  OE1   . GLN B 1 130 ? 14.314  38.810  -26.434 1.00 67.63 ? 1107 GLN B OE1   1 
ATOM   3227 N  NE2   . GLN B 1 130 ? 14.271  38.896  -24.174 1.00 64.66 ? 1107 GLN B NE2   1 
ATOM   3228 N  N     . GLU B 1 131 ? 9.465   40.578  -24.561 1.00 55.50 ? 1108 GLU B N     1 
ATOM   3229 C  CA    . GLU B 1 131 ? 8.776   40.894  -23.317 1.00 54.31 ? 1108 GLU B CA    1 
ATOM   3230 C  C     . GLU B 1 131 ? 8.065   39.673  -22.746 1.00 53.22 ? 1108 GLU B C     1 
ATOM   3231 O  O     . GLU B 1 131 ? 7.982   39.505  -21.533 1.00 53.17 ? 1108 GLU B O     1 
ATOM   3232 C  CB    . GLU B 1 131 ? 7.751   42.001  -23.539 1.00 53.72 ? 1108 GLU B CB    1 
ATOM   3233 C  CG    . GLU B 1 131 ? 8.339   43.267  -24.103 1.00 54.44 ? 1108 GLU B CG    1 
ATOM   3234 C  CD    . GLU B 1 131 ? 7.353   44.410  -24.112 1.00 54.44 ? 1108 GLU B CD    1 
ATOM   3235 O  OE1   . GLU B 1 131 ? 6.207   44.206  -24.568 1.00 54.20 ? 1108 GLU B OE1   1 
ATOM   3236 O  OE2   . GLU B 1 131 ? 7.727   45.514  -23.668 1.00 55.88 ? 1108 GLU B OE2   1 
ATOM   3237 N  N     . MET B 1 132 ? 7.554   38.823  -23.627 1.00 51.87 ? 1109 MET B N     1 
ATOM   3238 C  CA    . MET B 1 132 ? 6.852   37.624  -23.201 1.00 50.38 ? 1109 MET B CA    1 
ATOM   3239 C  C     . MET B 1 132 ? 7.834   36.644  -22.578 1.00 49.41 ? 1109 MET B C     1 
ATOM   3240 O  O     . MET B 1 132 ? 7.569   36.078  -21.518 1.00 49.74 ? 1109 MET B O     1 
ATOM   3241 C  CB    . MET B 1 132 ? 6.127   36.981  -24.391 1.00 50.24 ? 1109 MET B CB    1 
ATOM   3242 C  CG    . MET B 1 132 ? 4.976   37.821  -24.936 1.00 51.63 ? 1109 MET B CG    1 
ATOM   3243 S  SD    . MET B 1 132 ? 4.120   37.098  -26.357 1.00 53.98 ? 1109 MET B SD    1 
ATOM   3244 C  CE    . MET B 1 132 ? 4.603   38.187  -27.688 1.00 53.75 ? 1109 MET B CE    1 
ATOM   3245 N  N     . ILE B 1 133 ? 8.971   36.444  -23.231 1.00 47.74 ? 1110 ILE B N     1 
ATOM   3246 C  CA    . ILE B 1 133 ? 9.998   35.540  -22.714 1.00 47.09 ? 1110 ILE B CA    1 
ATOM   3247 C  C     . ILE B 1 133 ? 10.426  35.967  -21.310 1.00 45.18 ? 1110 ILE B C     1 
ATOM   3248 O  O     . ILE B 1 133 ? 10.648  35.136  -20.430 1.00 44.18 ? 1110 ILE B O     1 
ATOM   3249 C  CB    . ILE B 1 133 ? 11.255  35.559  -23.602 1.00 49.28 ? 1110 ILE B CB    1 
ATOM   3250 C  CG1   . ILE B 1 133 ? 10.887  35.186  -25.042 1.00 50.99 ? 1110 ILE B CG1   1 
ATOM   3251 C  CG2   . ILE B 1 133 ? 12.305  34.612  -23.044 1.00 50.40 ? 1110 ILE B CG2   1 
ATOM   3252 C  CD1   . ILE B 1 133 ? 10.244  33.830  -25.178 1.00 52.70 ? 1110 ILE B CD1   1 
ATOM   3253 N  N     . GLN B 1 134 ? 10.546  37.277  -21.117 1.00 43.33 ? 1111 GLN B N     1 
ATOM   3254 C  CA    . GLN B 1 134 ? 10.936  37.840  -19.833 1.00 39.32 ? 1111 GLN B CA    1 
ATOM   3255 C  C     . GLN B 1 134 ? 9.896   37.454  -18.778 1.00 38.56 ? 1111 GLN B C     1 
ATOM   3256 O  O     . GLN B 1 134 ? 10.243  36.940  -17.716 1.00 37.51 ? 1111 GLN B O     1 
ATOM   3257 C  CB    . GLN B 1 134 ? 11.034  39.365  -19.955 1.00 38.06 ? 1111 GLN B CB    1 
ATOM   3258 C  CG    . GLN B 1 134 ? 11.694  40.060  -18.763 1.00 36.36 ? 1111 GLN B CG    1 
ATOM   3259 C  CD    . GLN B 1 134 ? 13.153  39.676  -18.619 1.00 37.01 ? 1111 GLN B CD    1 
ATOM   3260 O  OE1   . GLN B 1 134 ? 13.881  39.605  -19.614 1.00 37.75 ? 1111 GLN B OE1   1 
ATOM   3261 N  NE2   . GLN B 1 134 ? 13.593  39.434  -17.386 1.00 33.10 ? 1111 GLN B NE2   1 
ATOM   3262 N  N     . MET B 1 135 ? 8.624   37.707  -19.082 1.00 36.32 ? 1112 MET B N     1 
ATOM   3263 C  CA    . MET B 1 135 ? 7.535   37.368  -18.180 1.00 36.27 ? 1112 MET B CA    1 
ATOM   3264 C  C     . MET B 1 135 ? 7.583   35.891  -17.841 1.00 35.61 ? 1112 MET B C     1 
ATOM   3265 O  O     . MET B 1 135 ? 7.539   35.509  -16.671 1.00 34.91 ? 1112 MET B O     1 
ATOM   3266 C  CB    . MET B 1 135 ? 6.183   37.643  -18.831 1.00 36.60 ? 1112 MET B CB    1 
ATOM   3267 C  CG    . MET B 1 135 ? 5.783   39.081  -18.844 1.00 38.32 ? 1112 MET B CG    1 
ATOM   3268 S  SD    . MET B 1 135 ? 4.152   39.337  -19.556 1.00 42.72 ? 1112 MET B SD    1 
ATOM   3269 C  CE    . MET B 1 135 ? 4.529   39.455  -21.307 1.00 41.68 ? 1112 MET B CE    1 
ATOM   3270 N  N     . ALA B 1 136 ? 7.671   35.070  -18.886 1.00 34.13 ? 1113 ALA B N     1 
ATOM   3271 C  CA    . ALA B 1 136 ? 7.692   33.622  -18.732 1.00 33.81 ? 1113 ALA B CA    1 
ATOM   3272 C  C     . ALA B 1 136 ? 8.821   33.144  -17.830 1.00 34.11 ? 1113 ALA B C     1 
ATOM   3273 O  O     . ALA B 1 136 ? 8.603   32.317  -16.937 1.00 34.76 ? 1113 ALA B O     1 
ATOM   3274 C  CB    . ALA B 1 136 ? 7.778   32.949  -20.092 1.00 29.59 ? 1113 ALA B CB    1 
ATOM   3275 N  N     . ALA B 1 137 ? 10.021  33.664  -18.052 1.00 33.39 ? 1114 ALA B N     1 
ATOM   3276 C  CA    . ALA B 1 137 ? 11.162  33.265  -17.245 1.00 32.74 ? 1114 ALA B CA    1 
ATOM   3277 C  C     . ALA B 1 137 ? 10.963  33.724  -15.808 1.00 33.16 ? 1114 ALA B C     1 
ATOM   3278 O  O     . ALA B 1 137 ? 11.241  32.982  -14.861 1.00 33.04 ? 1114 ALA B O     1 
ATOM   3279 C  CB    . ALA B 1 137 ? 12.429  33.860  -17.817 1.00 30.76 ? 1114 ALA B CB    1 
ATOM   3280 N  N     . GLU B 1 138 ? 10.482  34.951  -15.651 1.00 33.17 ? 1115 GLU B N     1 
ATOM   3281 C  CA    . GLU B 1 138 ? 10.242  35.495  -14.323 1.00 35.04 ? 1115 GLU B CA    1 
ATOM   3282 C  C     . GLU B 1 138 ? 9.209   34.650  -13.565 1.00 33.82 ? 1115 GLU B C     1 
ATOM   3283 O  O     . GLU B 1 138 ? 9.376   34.350  -12.382 1.00 32.11 ? 1115 GLU B O     1 
ATOM   3284 C  CB    . GLU B 1 138 ? 9.778   36.957  -14.427 1.00 38.04 ? 1115 GLU B CB    1 
ATOM   3285 C  CG    . GLU B 1 138 ? 10.769  37.854  -15.161 1.00 39.16 ? 1115 GLU B CG    1 
ATOM   3286 C  CD    . GLU B 1 138 ? 10.389  39.331  -15.145 1.00 42.26 ? 1115 GLU B CD    1 
ATOM   3287 O  OE1   . GLU B 1 138 ? 9.193   39.657  -15.339 1.00 40.19 ? 1115 GLU B OE1   1 
ATOM   3288 O  OE2   . GLU B 1 138 ? 11.305  40.172  -14.956 1.00 44.37 ? 1115 GLU B OE2   1 
ATOM   3289 N  N     . ILE B 1 139 ? 8.140   34.262  -14.249 1.00 33.04 ? 1116 ILE B N     1 
ATOM   3290 C  CA    . ILE B 1 139 ? 7.118   33.447  -13.618 1.00 31.52 ? 1116 ILE B CA    1 
ATOM   3291 C  C     . ILE B 1 139 ? 7.681   32.058  -13.301 1.00 32.53 ? 1116 ILE B C     1 
ATOM   3292 O  O     . ILE B 1 139 ? 7.522   31.544  -12.185 1.00 31.76 ? 1116 ILE B O     1 
ATOM   3293 C  CB    . ILE B 1 139 ? 5.907   33.318  -14.533 1.00 29.75 ? 1116 ILE B CB    1 
ATOM   3294 C  CG1   . ILE B 1 139 ? 5.230   34.683  -14.662 1.00 27.93 ? 1116 ILE B CG1   1 
ATOM   3295 C  CG2   . ILE B 1 139 ? 4.960   32.261  -13.986 1.00 26.75 ? 1116 ILE B CG2   1 
ATOM   3296 C  CD1   . ILE B 1 139 ? 4.198   34.785  -15.769 1.00 23.94 ? 1116 ILE B CD1   1 
ATOM   3297 N  N     . ALA B 1 140 ? 8.349   31.452  -14.278 1.00 30.63 ? 1117 ALA B N     1 
ATOM   3298 C  CA    . ALA B 1 140 ? 8.912   30.129  -14.057 1.00 30.20 ? 1117 ALA B CA    1 
ATOM   3299 C  C     . ALA B 1 140 ? 9.935   30.135  -12.932 1.00 31.79 ? 1117 ALA B C     1 
ATOM   3300 O  O     . ALA B 1 140 ? 10.024  29.166  -12.164 1.00 31.49 ? 1117 ALA B O     1 
ATOM   3301 C  CB    . ALA B 1 140 ? 9.533   29.600  -15.328 1.00 29.70 ? 1117 ALA B CB    1 
ATOM   3302 N  N     . ASP B 1 141 ? 10.706  31.220  -12.832 1.00 31.85 ? 1118 ASP B N     1 
ATOM   3303 C  CA    . ASP B 1 141 ? 11.711  31.330  -11.780 1.00 32.23 ? 1118 ASP B CA    1 
ATOM   3304 C  C     . ASP B 1 141 ? 11.029  31.333  -10.416 1.00 31.26 ? 1118 ASP B C     1 
ATOM   3305 O  O     . ASP B 1 141 ? 11.469  30.646  -9.488  1.00 30.72 ? 1118 ASP B O     1 
ATOM   3306 C  CB    . ASP B 1 141 ? 12.538  32.616  -11.942 1.00 33.70 ? 1118 ASP B CB    1 
ATOM   3307 C  CG    . ASP B 1 141 ? 13.712  32.677  -10.962 1.00 36.35 ? 1118 ASP B CG    1 
ATOM   3308 O  OD1   . ASP B 1 141 ? 14.618  31.812  -11.056 1.00 39.26 ? 1118 ASP B OD1   1 
ATOM   3309 O  OD2   . ASP B 1 141 ? 13.733  33.576  -10.087 1.00 34.55 ? 1118 ASP B OD2   1 
ATOM   3310 N  N     . GLY B 1 142 ? 9.949   32.108  -10.300 1.00 30.38 ? 1119 GLY B N     1 
ATOM   3311 C  CA    . GLY B 1 142 ? 9.217   32.183  -9.047  1.00 26.44 ? 1119 GLY B CA    1 
ATOM   3312 C  C     . GLY B 1 142 ? 8.645   30.841  -8.633  1.00 25.15 ? 1119 GLY B C     1 
ATOM   3313 O  O     . GLY B 1 142 ? 8.661   30.486  -7.447  1.00 21.83 ? 1119 GLY B O     1 
ATOM   3314 N  N     . MET B 1 143 ? 8.150   30.092  -9.617  1.00 25.48 ? 1120 MET B N     1 
ATOM   3315 C  CA    . MET B 1 143 ? 7.564   28.782  -9.347  1.00 27.36 ? 1120 MET B CA    1 
ATOM   3316 C  C     . MET B 1 143 ? 8.617   27.772  -8.943  1.00 27.73 ? 1120 MET B C     1 
ATOM   3317 O  O     . MET B 1 143 ? 8.365   26.934  -8.065  1.00 27.04 ? 1120 MET B O     1 
ATOM   3318 C  CB    . MET B 1 143 ? 6.805   28.262  -10.569 1.00 27.22 ? 1120 MET B CB    1 
ATOM   3319 C  CG    . MET B 1 143 ? 5.594   29.084  -10.946 1.00 25.98 ? 1120 MET B CG    1 
ATOM   3320 S  SD    . MET B 1 143 ? 4.419   29.250  -9.594  1.00 28.59 ? 1120 MET B SD    1 
ATOM   3321 C  CE    . MET B 1 143 ? 4.078   27.558  -9.183  1.00 24.42 ? 1120 MET B CE    1 
ATOM   3322 N  N     . ALA B 1 144 ? 9.788   27.856  -9.580  1.00 28.10 ? 1121 ALA B N     1 
ATOM   3323 C  CA    . ALA B 1 144 ? 10.907  26.951  -9.282  1.00 29.13 ? 1121 ALA B CA    1 
ATOM   3324 C  C     . ALA B 1 144 ? 11.301  27.091  -7.819  1.00 29.87 ? 1121 ALA B C     1 
ATOM   3325 O  O     . ALA B 1 144 ? 11.567  26.095  -7.131  1.00 29.98 ? 1121 ALA B O     1 
ATOM   3326 C  CB    . ALA B 1 144 ? 12.100  27.276  -10.164 1.00 30.10 ? 1121 ALA B CB    1 
ATOM   3327 N  N     . TYR B 1 145 ? 11.346  28.331  -7.341  1.00 29.70 ? 1122 TYR B N     1 
ATOM   3328 C  CA    . TYR B 1 145 ? 11.668  28.558  -5.951  1.00 31.36 ? 1122 TYR B CA    1 
ATOM   3329 C  C     . TYR B 1 145 ? 10.591  27.846  -5.130  1.00 32.07 ? 1122 TYR B C     1 
ATOM   3330 O  O     . TYR B 1 145 ? 10.908  27.054  -4.243  1.00 33.00 ? 1122 TYR B O     1 
ATOM   3331 C  CB    . TYR B 1 145 ? 11.670  30.053  -5.647  1.00 34.96 ? 1122 TYR B CB    1 
ATOM   3332 C  CG    . TYR B 1 145 ? 11.894  30.387  -4.187  1.00 37.03 ? 1122 TYR B CG    1 
ATOM   3333 C  CD1   . TYR B 1 145 ? 13.182  30.397  -3.633  1.00 37.79 ? 1122 TYR B CD1   1 
ATOM   3334 C  CD2   . TYR B 1 145 ? 10.815  30.693  -3.359  1.00 36.98 ? 1122 TYR B CD2   1 
ATOM   3335 C  CE1   . TYR B 1 145 ? 13.384  30.712  -2.282  1.00 39.52 ? 1122 TYR B CE1   1 
ATOM   3336 C  CE2   . TYR B 1 145 ? 11.000  31.003  -2.012  1.00 40.08 ? 1122 TYR B CE2   1 
ATOM   3337 C  CZ    . TYR B 1 145 ? 12.284  31.010  -1.478  1.00 41.22 ? 1122 TYR B CZ    1 
ATOM   3338 O  OH    . TYR B 1 145 ? 12.444  31.298  -0.145  1.00 41.13 ? 1122 TYR B OH    1 
ATOM   3339 N  N     . LEU B 1 146 ? 9.320   28.117  -5.424  1.00 32.14 ? 1123 LEU B N     1 
ATOM   3340 C  CA    . LEU B 1 146 ? 8.235   27.471  -4.685  1.00 33.26 ? 1123 LEU B CA    1 
ATOM   3341 C  C     . LEU B 1 146 ? 8.432   25.973  -4.627  1.00 33.78 ? 1123 LEU B C     1 
ATOM   3342 O  O     . LEU B 1 146 ? 8.378   25.373  -3.556  1.00 32.61 ? 1123 LEU B O     1 
ATOM   3343 C  CB    . LEU B 1 146 ? 6.877   27.739  -5.320  1.00 35.60 ? 1123 LEU B CB    1 
ATOM   3344 C  CG    . LEU B 1 146 ? 6.291   29.138  -5.160  1.00 37.28 ? 1123 LEU B CG    1 
ATOM   3345 C  CD1   . LEU B 1 146 ? 4.787   29.006  -5.088  1.00 36.43 ? 1123 LEU B CD1   1 
ATOM   3346 C  CD2   . LEU B 1 146 ? 6.821   29.798  -3.892  1.00 36.90 ? 1123 LEU B CD2   1 
ATOM   3347 N  N     . ASN B 1 147 ? 8.652   25.368  -5.790  1.00 33.98 ? 1124 ASN B N     1 
ATOM   3348 C  CA    . ASN B 1 147 ? 8.870   23.932  -5.863  1.00 33.40 ? 1124 ASN B CA    1 
ATOM   3349 C  C     . ASN B 1 147 ? 10.076  23.531  -5.014  1.00 32.53 ? 1124 ASN B C     1 
ATOM   3350 O  O     . ASN B 1 147 ? 10.027  22.557  -4.264  1.00 28.78 ? 1124 ASN B O     1 
ATOM   3351 C  CB    . ASN B 1 147 ? 9.111   23.503  -7.306  1.00 35.11 ? 1124 ASN B CB    1 
ATOM   3352 C  CG    . ASN B 1 147 ? 9.669   22.078  -7.409  1.00 42.08 ? 1124 ASN B CG    1 
ATOM   3353 O  OD1   . ASN B 1 147 ? 10.301  21.716  -8.409  1.00 45.11 ? 1124 ASN B OD1   1 
ATOM   3354 N  ND2   . ASN B 1 147 ? 9.431   21.262  -6.377  1.00 41.93 ? 1124 ASN B ND2   1 
ATOM   3355 N  N     . ALA B 1 148 ? 11.162  24.286  -5.140  1.00 33.04 ? 1125 ALA B N     1 
ATOM   3356 C  CA    . ALA B 1 148 ? 12.360  23.983  -4.372  1.00 33.79 ? 1125 ALA B CA    1 
ATOM   3357 C  C     . ALA B 1 148 ? 12.039  23.981  -2.873  1.00 34.42 ? 1125 ALA B C     1 
ATOM   3358 O  O     . ALA B 1 148 ? 12.584  23.174  -2.121  1.00 35.70 ? 1125 ALA B O     1 
ATOM   3359 C  CB    . ALA B 1 148 ? 13.456  24.994  -4.693  1.00 32.65 ? 1125 ALA B CB    1 
ATOM   3360 N  N     . LYS B 1 149 ? 11.154  24.872  -2.436  1.00 33.80 ? 1126 LYS B N     1 
ATOM   3361 C  CA    . LYS B 1 149 ? 10.798  24.909  -1.027  1.00 34.92 ? 1126 LYS B CA    1 
ATOM   3362 C  C     . LYS B 1 149 ? 9.731   23.877  -0.682  1.00 35.42 ? 1126 LYS B C     1 
ATOM   3363 O  O     . LYS B 1 149 ? 9.210   23.841  0.430   1.00 35.36 ? 1126 LYS B O     1 
ATOM   3364 C  CB    . LYS B 1 149 ? 10.362  26.320  -0.615  1.00 37.14 ? 1126 LYS B CB    1 
ATOM   3365 C  CG    . LYS B 1 149 ? 11.555  27.236  -0.339  1.00 39.12 ? 1126 LYS B CG    1 
ATOM   3366 C  CD    . LYS B 1 149 ? 11.278  28.126  0.857   1.00 44.75 ? 1126 LYS B CD    1 
ATOM   3367 C  CE    . LYS B 1 149 ? 12.551  28.444  1.652   1.00 48.91 ? 1126 LYS B CE    1 
ATOM   3368 N  NZ    . LYS B 1 149 ? 13.620  29.117  0.843   1.00 54.25 ? 1126 LYS B NZ    1 
ATOM   3369 N  N     . LYS B 1 150 ? 9.418   23.029  -1.650  1.00 35.69 ? 1127 LYS B N     1 
ATOM   3370 C  CA    . LYS B 1 150 ? 8.436   21.972  -1.466  1.00 37.26 ? 1127 LYS B CA    1 
ATOM   3371 C  C     . LYS B 1 150 ? 7.005   22.432  -1.225  1.00 36.80 ? 1127 LYS B C     1 
ATOM   3372 O  O     . LYS B 1 150 ? 6.318   21.986  -0.300  1.00 35.91 ? 1127 LYS B O     1 
ATOM   3373 C  CB    . LYS B 1 150 ? 8.876   21.030  -0.349  1.00 39.88 ? 1127 LYS B CB    1 
ATOM   3374 C  CG    . LYS B 1 150 ? 10.034  20.118  -0.743  1.00 43.08 ? 1127 LYS B CG    1 
ATOM   3375 C  CD    . LYS B 1 150 ? 9.704   19.208  -1.924  1.00 44.00 ? 1127 LYS B CD    1 
ATOM   3376 C  CE    . LYS B 1 150 ? 10.819  18.174  -2.133  1.00 46.09 ? 1127 LYS B CE    1 
ATOM   3377 N  NZ    . LYS B 1 150 ? 10.589  17.292  -3.319  1.00 45.98 ? 1127 LYS B NZ    1 
ATOM   3378 N  N     . PHE B 1 151 ? 6.569   23.333  -2.087  1.00 35.43 ? 1128 PHE B N     1 
ATOM   3379 C  CA    . PHE B 1 151 ? 5.218   23.846  -2.053  1.00 34.60 ? 1128 PHE B CA    1 
ATOM   3380 C  C     . PHE B 1 151 ? 4.639   23.725  -3.465  1.00 35.09 ? 1128 PHE B C     1 
ATOM   3381 O  O     . PHE B 1 151 ? 5.354   23.892  -4.459  1.00 34.47 ? 1128 PHE B O     1 
ATOM   3382 C  CB    . PHE B 1 151 ? 5.239   25.302  -1.639  1.00 32.27 ? 1128 PHE B CB    1 
ATOM   3383 C  CG    . PHE B 1 151 ? 5.457   25.503  -0.187  1.00 33.87 ? 1128 PHE B CG    1 
ATOM   3384 C  CD1   . PHE B 1 151 ? 4.406   25.350  0.707   1.00 33.55 ? 1128 PHE B CD1   1 
ATOM   3385 C  CD2   . PHE B 1 151 ? 6.716   25.845  0.304   1.00 32.74 ? 1128 PHE B CD2   1 
ATOM   3386 C  CE1   . PHE B 1 151 ? 4.611   25.537  2.076   1.00 32.66 ? 1128 PHE B CE1   1 
ATOM   3387 C  CE2   . PHE B 1 151 ? 6.923   26.030  1.670   1.00 29.75 ? 1128 PHE B CE2   1 
ATOM   3388 C  CZ    . PHE B 1 151 ? 5.870   25.877  2.553   1.00 29.28 ? 1128 PHE B CZ    1 
ATOM   3389 N  N     . VAL B 1 152 ? 3.351   23.419  -3.550  1.00 35.09 ? 1129 VAL B N     1 
ATOM   3390 C  CA    . VAL B 1 152 ? 2.667   23.334  -4.835  1.00 33.83 ? 1129 VAL B CA    1 
ATOM   3391 C  C     . VAL B 1 152 ? 1.671   24.503  -4.765  1.00 33.54 ? 1129 VAL B C     1 
ATOM   3392 O  O     . VAL B 1 152 ? 0.936   24.633  -3.783  1.00 33.02 ? 1129 VAL B O     1 
ATOM   3393 C  CB    . VAL B 1 152 ? 1.962   21.963  -4.980  1.00 33.84 ? 1129 VAL B CB    1 
ATOM   3394 C  CG1   . VAL B 1 152 ? 0.906   21.811  -3.902  1.00 36.26 ? 1129 VAL B CG1   1 
ATOM   3395 C  CG2   . VAL B 1 152 ? 1.387   21.801  -6.382  1.00 32.54 ? 1129 VAL B CG2   1 
ATOM   3396 N  N     . HIS B 1 153 ? 1.665   25.355  -5.794  1.00 33.48 ? 1130 HIS B N     1 
ATOM   3397 C  CA    . HIS B 1 153 ? 0.802   26.543  -5.830  1.00 33.99 ? 1130 HIS B CA    1 
ATOM   3398 C  C     . HIS B 1 153 ? -0.679  26.237  -6.000  1.00 34.18 ? 1130 HIS B C     1 
ATOM   3399 O  O     . HIS B 1 153 ? -1.517  26.822  -5.325  1.00 34.80 ? 1130 HIS B O     1 
ATOM   3400 C  CB    . HIS B 1 153 ? 1.259   27.494  -6.944  1.00 31.32 ? 1130 HIS B CB    1 
ATOM   3401 C  CG    . HIS B 1 153 ? 0.566   28.823  -6.930  1.00 30.74 ? 1130 HIS B CG    1 
ATOM   3402 N  ND1   . HIS B 1 153 ? -0.689  29.020  -7.463  1.00 30.35 ? 1130 HIS B ND1   1 
ATOM   3403 C  CD2   . HIS B 1 153 ? 0.944   30.017  -6.412  1.00 30.97 ? 1130 HIS B CD2   1 
ATOM   3404 C  CE1   . HIS B 1 153 ? -1.055  30.277  -7.275  1.00 31.99 ? 1130 HIS B CE1   1 
ATOM   3405 N  NE2   . HIS B 1 153 ? -0.081  30.903  -6.639  1.00 30.57 ? 1130 HIS B NE2   1 
ATOM   3406 N  N     . ARG B 1 154 ? -0.982  25.327  -6.915  1.00 34.90 ? 1131 ARG B N     1 
ATOM   3407 C  CA    . ARG B 1 154 ? -2.347  24.903  -7.170  1.00 35.90 ? 1131 ARG B CA    1 
ATOM   3408 C  C     . ARG B 1 154 ? -3.255  25.923  -7.840  1.00 36.40 ? 1131 ARG B C     1 
ATOM   3409 O  O     . ARG B 1 154 ? -4.343  25.562  -8.307  1.00 38.59 ? 1131 ARG B O     1 
ATOM   3410 C  CB    . ARG B 1 154 ? -2.992  24.427  -5.872  1.00 37.65 ? 1131 ARG B CB    1 
ATOM   3411 C  CG    . ARG B 1 154 ? -2.290  23.260  -5.213  1.00 36.65 ? 1131 ARG B CG    1 
ATOM   3412 C  CD    . ARG B 1 154 ? -3.322  22.417  -4.523  1.00 37.59 ? 1131 ARG B CD    1 
ATOM   3413 N  NE    . ARG B 1 154 ? -4.155  23.249  -3.664  1.00 41.49 ? 1131 ARG B NE    1 
ATOM   3414 C  CZ    . ARG B 1 154 ? -5.458  23.068  -3.485  1.00 40.61 ? 1131 ARG B CZ    1 
ATOM   3415 N  NH1   . ARG B 1 154 ? -6.084  22.080  -4.110  1.00 40.03 ? 1131 ARG B NH1   1 
ATOM   3416 N  NH2   . ARG B 1 154 ? -6.132  23.879  -2.685  1.00 41.24 ? 1131 ARG B NH2   1 
ATOM   3417 N  N     . ASP B 1 155 ? -2.841  27.187  -7.898  1.00 34.47 ? 1132 ASP B N     1 
ATOM   3418 C  CA    . ASP B 1 155 ? -3.677  28.175  -8.573  1.00 31.34 ? 1132 ASP B CA    1 
ATOM   3419 C  C     . ASP B 1 155 ? -2.886  29.153  -9.440  1.00 31.46 ? 1132 ASP B C     1 
ATOM   3420 O  O     . ASP B 1 155 ? -3.111  30.366  -9.410  1.00 28.39 ? 1132 ASP B O     1 
ATOM   3421 C  CB    . ASP B 1 155 ? -4.508  28.967  -7.570  1.00 28.68 ? 1132 ASP B CB    1 
ATOM   3422 C  CG    . ASP B 1 155 ? -5.689  29.678  -8.231  1.00 29.11 ? 1132 ASP B CG    1 
ATOM   3423 O  OD1   . ASP B 1 155 ? -6.190  30.636  -7.621  1.00 26.56 ? 1132 ASP B OD1   1 
ATOM   3424 O  OD2   . ASP B 1 155 ? -6.120  29.266  -9.349  1.00 26.58 ? 1132 ASP B OD2   1 
ATOM   3425 N  N     . LEU B 1 156 ? -1.951  28.631  -10.220 1.00 31.09 ? 1133 LEU B N     1 
ATOM   3426 C  CA    . LEU B 1 156 ? -1.174  29.506  -11.081 1.00 31.84 ? 1133 LEU B CA    1 
ATOM   3427 C  C     . LEU B 1 156 ? -2.062  29.967  -12.233 1.00 32.03 ? 1133 LEU B C     1 
ATOM   3428 O  O     . LEU B 1 156 ? -2.644  29.152  -12.949 1.00 33.55 ? 1133 LEU B O     1 
ATOM   3429 C  CB    . LEU B 1 156 ? 0.052   28.775  -11.624 1.00 29.57 ? 1133 LEU B CB    1 
ATOM   3430 C  CG    . LEU B 1 156 ? 0.969   29.589  -12.538 1.00 30.22 ? 1133 LEU B CG    1 
ATOM   3431 C  CD1   . LEU B 1 156 ? 1.401   30.902  -11.842 1.00 27.93 ? 1133 LEU B CD1   1 
ATOM   3432 C  CD2   . LEU B 1 156 ? 2.184   28.733  -12.897 1.00 31.62 ? 1133 LEU B CD2   1 
ATOM   3433 N  N     . ALA B 1 157 ? -2.163  31.277  -12.405 1.00 31.63 ? 1134 ALA B N     1 
ATOM   3434 C  CA    . ALA B 1 157 ? -2.972  31.846  -13.467 1.00 32.10 ? 1134 ALA B CA    1 
ATOM   3435 C  C     . ALA B 1 157 ? -2.615  33.320  -13.588 1.00 32.30 ? 1134 ALA B C     1 
ATOM   3436 O  O     . ALA B 1 157 ? -2.094  33.914  -12.639 1.00 29.98 ? 1134 ALA B O     1 
ATOM   3437 C  CB    . ALA B 1 157 ? -4.448  31.685  -13.130 1.00 32.23 ? 1134 ALA B CB    1 
ATOM   3438 N  N     . ALA B 1 158 ? -2.904  33.913  -14.743 1.00 32.07 ? 1135 ALA B N     1 
ATOM   3439 C  CA    . ALA B 1 158 ? -2.587  35.322  -14.945 1.00 33.83 ? 1135 ALA B CA    1 
ATOM   3440 C  C     . ALA B 1 158 ? -3.174  36.251  -13.877 1.00 34.39 ? 1135 ALA B C     1 
ATOM   3441 O  O     . ALA B 1 158 ? -2.548  37.238  -13.502 1.00 37.90 ? 1135 ALA B O     1 
ATOM   3442 C  CB    . ALA B 1 158 ? -3.034  35.759  -16.323 1.00 33.17 ? 1135 ALA B CB    1 
ATOM   3443 N  N     . ARG B 1 159 ? -4.367  35.944  -13.383 1.00 35.51 ? 1136 ARG B N     1 
ATOM   3444 C  CA    . ARG B 1 159 ? -4.999  36.777  -12.361 1.00 35.83 ? 1136 ARG B CA    1 
ATOM   3445 C  C     . ARG B 1 159 ? -4.171  36.766  -11.075 1.00 35.57 ? 1136 ARG B C     1 
ATOM   3446 O  O     . ARG B 1 159 ? -4.226  37.710  -10.289 1.00 35.97 ? 1136 ARG B O     1 
ATOM   3447 C  CB    . ARG B 1 159 ? -6.418  36.268  -12.070 1.00 33.66 ? 1136 ARG B CB    1 
ATOM   3448 C  CG    . ARG B 1 159 ? -6.471  34.755  -11.825 1.00 36.10 ? 1136 ARG B CG    1 
ATOM   3449 C  CD    . ARG B 1 159 ? -7.852  34.235  -11.420 1.00 33.27 ? 1136 ARG B CD    1 
ATOM   3450 N  NE    . ARG B 1 159 ? -7.750  32.875  -10.888 1.00 36.90 ? 1136 ARG B NE    1 
ATOM   3451 C  CZ    . ARG B 1 159 ? -7.762  31.767  -11.623 1.00 36.06 ? 1136 ARG B CZ    1 
ATOM   3452 N  NH1   . ARG B 1 159 ? -7.877  31.828  -12.938 1.00 36.70 ? 1136 ARG B NH1   1 
ATOM   3453 N  NH2   . ARG B 1 159 ? -7.664  30.589  -11.039 1.00 40.28 ? 1136 ARG B NH2   1 
ATOM   3454 N  N     . ASN B 1 160 ? -3.404  35.697  -10.862 1.00 36.10 ? 1137 ASN B N     1 
ATOM   3455 C  CA    . ASN B 1 160 ? -2.582  35.592  -9.656  1.00 34.92 ? 1137 ASN B CA    1 
ATOM   3456 C  C     . ASN B 1 160 ? -1.118  35.966  -9.841  1.00 35.76 ? 1137 ASN B C     1 
ATOM   3457 O  O     . ASN B 1 160 ? -0.304  35.811  -8.928  1.00 36.03 ? 1137 ASN B O     1 
ATOM   3458 C  CB    . ASN B 1 160 ? -2.686  34.200  -9.051  1.00 32.97 ? 1137 ASN B CB    1 
ATOM   3459 C  CG    . ASN B 1 160 ? -3.991  34.000  -8.341  1.00 33.10 ? 1137 ASN B CG    1 
ATOM   3460 O  OD1   . ASN B 1 160 ? -4.573  34.964  -7.853  1.00 35.28 ? 1137 ASN B OD1   1 
ATOM   3461 N  ND2   . ASN B 1 160 ? -4.460  32.761  -8.264  1.00 30.50 ? 1137 ASN B ND2   1 
ATOM   3462 N  N     . CYS B 1 161 ? -0.790  36.458  -11.027 1.00 35.55 ? 1138 CYS B N     1 
ATOM   3463 C  CA    . CYS B 1 161 ? 0.556   36.906  -11.321 1.00 37.00 ? 1138 CYS B CA    1 
ATOM   3464 C  C     . CYS B 1 161 ? 0.485   38.415  -11.165 1.00 38.51 ? 1138 CYS B C     1 
ATOM   3465 O  O     . CYS B 1 161 ? -0.460  39.043  -11.642 1.00 41.68 ? 1138 CYS B O     1 
ATOM   3466 C  CB    . CYS B 1 161 ? 0.943   36.534  -12.746 1.00 35.50 ? 1138 CYS B CB    1 
ATOM   3467 S  SG    . CYS B 1 161 ? 1.333   34.792  -12.921 1.00 36.23 ? 1138 CYS B SG    1 
ATOM   3468 N  N     . MET B 1 162 ? 1.469   39.004  -10.502 1.00 37.86 ? 1139 MET B N     1 
ATOM   3469 C  CA    . MET B 1 162 ? 1.441   40.434  -10.275 1.00 37.39 ? 1139 MET B CA    1 
ATOM   3470 C  C     . MET B 1 162 ? 2.537   41.170  -11.029 1.00 38.49 ? 1139 MET B C     1 
ATOM   3471 O  O     . MET B 1 162 ? 3.598   40.615  -11.311 1.00 37.02 ? 1139 MET B O     1 
ATOM   3472 C  CB    . MET B 1 162 ? 1.549   40.688  -8.779  1.00 38.74 ? 1139 MET B CB    1 
ATOM   3473 C  CG    . MET B 1 162 ? 0.547   39.893  -7.973  1.00 37.90 ? 1139 MET B CG    1 
ATOM   3474 S  SD    . MET B 1 162 ? -1.162  40.243  -8.488  1.00 44.65 ? 1139 MET B SD    1 
ATOM   3475 C  CE    . MET B 1 162 ? -1.373  41.911  -7.830  1.00 36.07 ? 1139 MET B CE    1 
ATOM   3476 N  N     . VAL B 1 163 ? 2.267   42.429  -11.353 1.00 40.03 ? 1140 VAL B N     1 
ATOM   3477 C  CA    . VAL B 1 163 ? 3.212   43.245  -12.099 1.00 40.35 ? 1140 VAL B CA    1 
ATOM   3478 C  C     . VAL B 1 163 ? 3.760   44.408  -11.293 1.00 41.02 ? 1140 VAL B C     1 
ATOM   3479 O  O     . VAL B 1 163 ? 3.000   45.250  -10.817 1.00 40.78 ? 1140 VAL B O     1 
ATOM   3480 C  CB    . VAL B 1 163 ? 2.549   43.805  -13.346 1.00 40.46 ? 1140 VAL B CB    1 
ATOM   3481 C  CG1   . VAL B 1 163 ? 3.584   44.489  -14.220 1.00 41.59 ? 1140 VAL B CG1   1 
ATOM   3482 C  CG2   . VAL B 1 163 ? 1.862   42.688  -14.096 1.00 39.40 ? 1140 VAL B CG2   1 
ATOM   3483 N  N     . ALA B 1 164 ? 5.082   44.449  -11.149 1.00 42.39 ? 1141 ALA B N     1 
ATOM   3484 C  CA    . ALA B 1 164 ? 5.754   45.513  -10.406 1.00 44.04 ? 1141 ALA B CA    1 
ATOM   3485 C  C     . ALA B 1 164 ? 5.800   46.823  -11.197 1.00 45.65 ? 1141 ALA B C     1 
ATOM   3486 O  O     . ALA B 1 164 ? 5.503   46.859  -12.393 1.00 43.63 ? 1141 ALA B O     1 
ATOM   3487 C  CB    . ALA B 1 164 ? 7.167   45.083  -10.049 1.00 43.00 ? 1141 ALA B CB    1 
ATOM   3488 N  N     . HIS B 1 165 ? 6.183   47.894  -10.509 1.00 48.57 ? 1142 HIS B N     1 
ATOM   3489 C  CA    . HIS B 1 165 ? 6.292   49.231  -11.098 1.00 50.18 ? 1142 HIS B CA    1 
ATOM   3490 C  C     . HIS B 1 165 ? 7.195   49.212  -12.324 1.00 49.00 ? 1142 HIS B C     1 
ATOM   3491 O  O     . HIS B 1 165 ? 7.024   50.011  -13.245 1.00 48.63 ? 1142 HIS B O     1 
ATOM   3492 C  CB    . HIS B 1 165 ? 6.895   50.192  -10.069 1.00 53.54 ? 1142 HIS B CB    1 
ATOM   3493 C  CG    . HIS B 1 165 ? 8.327   49.890  -9.742  1.00 58.03 ? 1142 HIS B CG    1 
ATOM   3494 N  ND1   . HIS B 1 165 ? 9.379   50.344  -10.512 1.00 59.74 ? 1142 HIS B ND1   1 
ATOM   3495 C  CD2   . HIS B 1 165 ? 8.876   49.104  -8.784  1.00 59.40 ? 1142 HIS B CD2   1 
ATOM   3496 C  CE1   . HIS B 1 165 ? 10.511  49.848  -10.043 1.00 59.94 ? 1142 HIS B CE1   1 
ATOM   3497 N  NE2   . HIS B 1 165 ? 10.234  49.092  -8.995  1.00 60.47 ? 1142 HIS B NE2   1 
ATOM   3498 N  N     . ASP B 1 166 ? 8.164   48.300  -12.323 1.00 48.51 ? 1143 ASP B N     1 
ATOM   3499 C  CA    . ASP B 1 166 ? 9.100   48.181  -13.437 1.00 49.69 ? 1143 ASP B CA    1 
ATOM   3500 C  C     . ASP B 1 166 ? 8.707   47.053  -14.380 1.00 49.80 ? 1143 ASP B C     1 
ATOM   3501 O  O     . ASP B 1 166 ? 9.473   46.676  -15.273 1.00 49.46 ? 1143 ASP B O     1 
ATOM   3502 C  CB    . ASP B 1 166 ? 10.515  47.951  -12.920 1.00 50.78 ? 1143 ASP B CB    1 
ATOM   3503 C  CG    . ASP B 1 166 ? 10.705  46.572  -12.359 1.00 52.03 ? 1143 ASP B CG    1 
ATOM   3504 O  OD1   . ASP B 1 166 ? 9.818   46.107  -11.612 1.00 54.99 ? 1143 ASP B OD1   1 
ATOM   3505 O  OD2   . ASP B 1 166 ? 11.750  45.958  -12.656 1.00 51.63 ? 1143 ASP B OD2   1 
ATOM   3506 N  N     . PHE B 1 167 ? 7.506   46.522  -14.160 1.00 49.12 ? 1144 PHE B N     1 
ATOM   3507 C  CA    . PHE B 1 167 ? 6.946   45.461  -14.980 1.00 47.51 ? 1144 PHE B CA    1 
ATOM   3508 C  C     . PHE B 1 167 ? 7.503   44.070  -14.758 1.00 45.58 ? 1144 PHE B C     1 
ATOM   3509 O  O     . PHE B 1 167 ? 7.323   43.182  -15.595 1.00 45.26 ? 1144 PHE B O     1 
ATOM   3510 C  CB    . PHE B 1 167 ? 7.060   45.854  -16.449 1.00 47.90 ? 1144 PHE B CB    1 
ATOM   3511 C  CG    . PHE B 1 167 ? 6.284   47.085  -16.788 1.00 49.91 ? 1144 PHE B CG    1 
ATOM   3512 C  CD1   . PHE B 1 167 ? 4.897   47.047  -16.848 1.00 49.33 ? 1144 PHE B CD1   1 
ATOM   3513 C  CD2   . PHE B 1 167 ? 6.934   48.296  -17.009 1.00 51.65 ? 1144 PHE B CD2   1 
ATOM   3514 C  CE1   . PHE B 1 167 ? 4.165   48.195  -17.123 1.00 51.18 ? 1144 PHE B CE1   1 
ATOM   3515 C  CE2   . PHE B 1 167 ? 6.208   49.456  -17.286 1.00 51.76 ? 1144 PHE B CE2   1 
ATOM   3516 C  CZ    . PHE B 1 167 ? 4.822   49.404  -17.343 1.00 50.75 ? 1144 PHE B CZ    1 
ATOM   3517 N  N     . THR B 1 168 ? 8.181   43.878  -13.634 1.00 43.82 ? 1145 THR B N     1 
ATOM   3518 C  CA    . THR B 1 168 ? 8.710   42.565  -13.313 1.00 42.93 ? 1145 THR B CA    1 
ATOM   3519 C  C     . THR B 1 168 ? 7.490   41.779  -12.854 1.00 42.91 ? 1145 THR B C     1 
ATOM   3520 O  O     . THR B 1 168 ? 6.687   42.279  -12.057 1.00 43.19 ? 1145 THR B O     1 
ATOM   3521 C  CB    . THR B 1 168 ? 9.732   42.621  -12.156 1.00 44.47 ? 1145 THR B CB    1 
ATOM   3522 O  OG1   . THR B 1 168 ? 10.903  43.318  -12.591 1.00 44.12 ? 1145 THR B OG1   1 
ATOM   3523 C  CG2   . THR B 1 168 ? 10.121  41.202  -11.697 1.00 41.71 ? 1145 THR B CG2   1 
ATOM   3524 N  N     . VAL B 1 169 ? 7.332   40.560  -13.355 1.00 40.77 ? 1146 VAL B N     1 
ATOM   3525 C  CA    . VAL B 1 169 ? 6.192   39.755  -12.941 1.00 38.71 ? 1146 VAL B CA    1 
ATOM   3526 C  C     . VAL B 1 169 ? 6.571   38.850  -11.772 1.00 36.92 ? 1146 VAL B C     1 
ATOM   3527 O  O     . VAL B 1 169 ? 7.670   38.287  -11.738 1.00 36.09 ? 1146 VAL B O     1 
ATOM   3528 C  CB    . VAL B 1 169 ? 5.665   38.891  -14.099 1.00 39.32 ? 1146 VAL B CB    1 
ATOM   3529 C  CG1   . VAL B 1 169 ? 4.461   38.094  -13.635 1.00 36.41 ? 1146 VAL B CG1   1 
ATOM   3530 C  CG2   . VAL B 1 169 ? 5.300   39.783  -15.289 1.00 37.60 ? 1146 VAL B CG2   1 
ATOM   3531 N  N     . LYS B 1 170 ? 5.661   38.718  -10.813 1.00 35.45 ? 1147 LYS B N     1 
ATOM   3532 C  CA    . LYS B 1 170 ? 5.894   37.876  -9.645  1.00 32.95 ? 1147 LYS B CA    1 
ATOM   3533 C  C     . LYS B 1 170 ? 4.668   37.034  -9.315  1.00 32.42 ? 1147 LYS B C     1 
ATOM   3534 O  O     . LYS B 1 170 ? 3.531   37.405  -9.621  1.00 30.03 ? 1147 LYS B O     1 
ATOM   3535 C  CB    . LYS B 1 170 ? 6.252   38.727  -8.433  1.00 32.03 ? 1147 LYS B CB    1 
ATOM   3536 C  CG    . LYS B 1 170 ? 7.407   39.651  -8.667  1.00 33.79 ? 1147 LYS B CG    1 
ATOM   3537 C  CD    . LYS B 1 170 ? 7.734   40.473  -7.434  1.00 33.00 ? 1147 LYS B CD    1 
ATOM   3538 C  CE    . LYS B 1 170 ? 8.829   41.498  -7.750  1.00 33.11 ? 1147 LYS B CE    1 
ATOM   3539 N  NZ    . LYS B 1 170 ? 9.266   42.255  -6.536  1.00 31.03 ? 1147 LYS B NZ    1 
ATOM   3540 N  N     . ILE B 1 171 ? 4.922   35.895  -8.680  1.00 32.59 ? 1148 ILE B N     1 
ATOM   3541 C  CA    . ILE B 1 171 ? 3.873   34.966  -8.292  1.00 32.35 ? 1148 ILE B CA    1 
ATOM   3542 C  C     . ILE B 1 171 ? 3.197   35.485  -7.034  1.00 32.40 ? 1148 ILE B C     1 
ATOM   3543 O  O     . ILE B 1 171 ? 3.880   35.919  -6.110  1.00 32.52 ? 1148 ILE B O     1 
ATOM   3544 C  CB    . ILE B 1 171 ? 4.459   33.536  -8.021  1.00 31.72 ? 1148 ILE B CB    1 
ATOM   3545 C  CG1   . ILE B 1 171 ? 4.772   32.825  -9.335  1.00 33.04 ? 1148 ILE B CG1   1 
ATOM   3546 C  CG2   . ILE B 1 171 ? 3.442   32.671  -7.307  1.00 29.03 ? 1148 ILE B CG2   1 
ATOM   3547 C  CD1   . ILE B 1 171 ? 5.641   33.567  -10.271 1.00 36.87 ? 1148 ILE B CD1   1 
ATOM   3548 N  N     . GLY B 1 172 ? 1.863   35.444  -7.006  1.00 31.39 ? 1149 GLY B N     1 
ATOM   3549 C  CA    . GLY B 1 172 ? 1.130   35.893  -5.836  1.00 31.97 ? 1149 GLY B CA    1 
ATOM   3550 C  C     . GLY B 1 172 ? -0.015  34.956  -5.499  1.00 33.33 ? 1149 GLY B C     1 
ATOM   3551 O  O     . GLY B 1 172 ? -0.107  33.871  -6.076  1.00 34.99 ? 1149 GLY B O     1 
ATOM   3552 N  N     . ASP B 1 173 ? -0.888  35.383  -4.582  1.00 33.30 ? 1150 ASP B N     1 
ATOM   3553 C  CA    . ASP B 1 173 ? -2.062  34.617  -4.141  1.00 32.12 ? 1150 ASP B CA    1 
ATOM   3554 C  C     . ASP B 1 173 ? -1.756  33.169  -3.757  1.00 33.03 ? 1150 ASP B C     1 
ATOM   3555 O  O     . ASP B 1 173 ? -1.853  32.248  -4.586  1.00 33.95 ? 1150 ASP B O     1 
ATOM   3556 C  CB    . ASP B 1 173 ? -3.158  34.635  -5.214  1.00 30.92 ? 1150 ASP B CB    1 
ATOM   3557 C  CG    . ASP B 1 173 ? -4.525  34.192  -4.672  1.00 34.10 ? 1150 ASP B CG    1 
ATOM   3558 O  OD1   . ASP B 1 173 ? -4.556  33.507  -3.626  1.00 31.54 ? 1150 ASP B OD1   1 
ATOM   3559 O  OD2   . ASP B 1 173 ? -5.573  34.519  -5.288  1.00 33.51 ? 1150 ASP B OD2   1 
ATOM   3560 N  N     . PHE B 1 174 ? -1.400  32.974  -2.489  1.00 32.04 ? 1151 PHE B N     1 
ATOM   3561 C  CA    . PHE B 1 174 ? -1.069  31.655  -1.962  1.00 32.67 ? 1151 PHE B CA    1 
ATOM   3562 C  C     . PHE B 1 174 ? -2.183  30.988  -1.173  1.00 33.30 ? 1151 PHE B C     1 
ATOM   3563 O  O     . PHE B 1 174 ? -1.921  30.128  -0.341  1.00 35.10 ? 1151 PHE B O     1 
ATOM   3564 C  CB    . PHE B 1 174 ? 0.195   31.760  -1.099  1.00 31.95 ? 1151 PHE B CB    1 
ATOM   3565 C  CG    . PHE B 1 174 ? 1.366   32.336  -1.846  1.00 33.75 ? 1151 PHE B CG    1 
ATOM   3566 C  CD1   . PHE B 1 174 ? 2.080   31.549  -2.756  1.00 33.46 ? 1151 PHE B CD1   1 
ATOM   3567 C  CD2   . PHE B 1 174 ? 1.651   33.704  -1.770  1.00 32.54 ? 1151 PHE B CD2   1 
ATOM   3568 C  CE1   . PHE B 1 174 ? 3.048   32.121  -3.598  1.00 34.52 ? 1151 PHE B CE1   1 
ATOM   3569 C  CE2   . PHE B 1 174 ? 2.612   34.288  -2.603  1.00 35.80 ? 1151 PHE B CE2   1 
ATOM   3570 C  CZ    . PHE B 1 174 ? 3.313   33.492  -3.525  1.00 35.80 ? 1151 PHE B CZ    1 
ATOM   3571 N  N     . GLY B 1 175 ? -3.427  31.374  -1.438  1.00 35.09 ? 1152 GLY B N     1 
ATOM   3572 C  CA    . GLY B 1 175 ? -4.556  30.784  -0.733  1.00 35.76 ? 1152 GLY B CA    1 
ATOM   3573 C  C     . GLY B 1 175 ? -4.647  29.272  -0.866  1.00 36.39 ? 1152 GLY B C     1 
ATOM   3574 O  O     . GLY B 1 175 ? -4.848  28.572  0.120   1.00 36.68 ? 1152 GLY B O     1 
ATOM   3575 N  N     . MET B 1 176 ? -4.470  28.759  -2.078  1.00 37.76 ? 1153 MET B N     1 
ATOM   3576 C  CA    . MET B 1 176 ? -4.547  27.323  -2.324  1.00 38.25 ? 1153 MET B CA    1 
ATOM   3577 C  C     . MET B 1 176 ? -3.224  26.571  -2.215  1.00 38.84 ? 1153 MET B C     1 
ATOM   3578 O  O     . MET B 1 176 ? -3.178  25.348  -2.368  1.00 38.57 ? 1153 MET B O     1 
ATOM   3579 C  CB    . MET B 1 176 ? -5.139  27.083  -3.705  1.00 40.38 ? 1153 MET B CB    1 
ATOM   3580 C  CG    . MET B 1 176 ? -6.613  27.430  -3.775  1.00 42.81 ? 1153 MET B CG    1 
ATOM   3581 S  SD    . MET B 1 176 ? -7.299  27.082  -5.382  1.00 46.36 ? 1153 MET B SD    1 
ATOM   3582 C  CE    . MET B 1 176 ? -7.446  28.704  -5.953  1.00 50.67 ? 1153 MET B CE    1 
ATOM   3583 N  N     . THR B 1 177 ? -2.148  27.302  -1.955  1.00 37.43 ? 1154 THR B N     1 
ATOM   3584 C  CA    . THR B 1 177 ? -0.828  26.702  -1.847  1.00 37.10 ? 1154 THR B CA    1 
ATOM   3585 C  C     . THR B 1 177 ? -0.754  25.645  -0.749  1.00 37.20 ? 1154 THR B C     1 
ATOM   3586 O  O     . THR B 1 177 ? -1.360  25.795  0.307   1.00 40.33 ? 1154 THR B O     1 
ATOM   3587 C  CB    . THR B 1 177 ? 0.218   27.780  -1.558  1.00 36.87 ? 1154 THR B CB    1 
ATOM   3588 O  OG1   . THR B 1 177 ? 0.180   28.763  -2.597  1.00 39.30 ? 1154 THR B OG1   1 
ATOM   3589 C  CG2   . THR B 1 177 ? 1.604   27.180  -1.498  1.00 35.83 ? 1154 THR B CG2   1 
ATOM   3590 N  N     . ARG B 1 178 ? -0.011  24.572  -0.993  1.00 36.20 ? 1155 ARG B N     1 
ATOM   3591 C  CA    . ARG B 1 178 ? 0.125   23.521  0.007   1.00 36.23 ? 1155 ARG B CA    1 
ATOM   3592 C  C     . ARG B 1 178 ? 1.560   23.015  0.144   1.00 35.58 ? 1155 ARG B C     1 
ATOM   3593 O  O     . ARG B 1 178 ? 2.325   22.963  -0.825  1.00 35.01 ? 1155 ARG B O     1 
ATOM   3594 C  CB    . ARG B 1 178 ? -0.807  22.353  -0.324  1.00 37.39 ? 1155 ARG B CB    1 
ATOM   3595 C  CG    . ARG B 1 178 ? -2.283  22.729  -0.335  1.00 37.05 ? 1155 ARG B CG    1 
ATOM   3596 C  CD    . ARG B 1 178 ? -2.831  22.968  1.059   1.00 36.60 ? 1155 ARG B CD    1 
ATOM   3597 N  NE    . ARG B 1 178 ? -4.251  23.293  0.996   1.00 41.99 ? 1155 ARG B NE    1 
ATOM   3598 C  CZ    . ARG B 1 178 ? -4.742  24.524  0.846   1.00 41.91 ? 1155 ARG B CZ    1 
ATOM   3599 N  NH1   . ARG B 1 178 ? -3.918  25.563  0.755   1.00 41.27 ? 1155 ARG B NH1   1 
ATOM   3600 N  NH2   . ARG B 1 178 ? -6.058  24.712  0.763   1.00 38.56 ? 1155 ARG B NH2   1 
ATOM   3601 N  N     . ASP B 1 179 ? 1.913   22.647  1.367   1.00 34.86 ? 1156 ASP B N     1 
ATOM   3602 C  CA    . ASP B 1 179 ? 3.240   22.126  1.678   1.00 34.20 ? 1156 ASP B CA    1 
ATOM   3603 C  C     . ASP B 1 179 ? 3.218   20.661  1.261   1.00 32.30 ? 1156 ASP B C     1 
ATOM   3604 O  O     . ASP B 1 179 ? 2.351   19.908  1.697   1.00 31.26 ? 1156 ASP B O     1 
ATOM   3605 C  CB    . ASP B 1 179 ? 3.486   22.247  3.183   1.00 34.72 ? 1156 ASP B CB    1 
ATOM   3606 C  CG    . ASP B 1 179 ? 4.905   21.903  3.587   1.00 35.71 ? 1156 ASP B CG    1 
ATOM   3607 O  OD1   . ASP B 1 179 ? 5.632   21.293  2.779   1.00 34.08 ? 1156 ASP B OD1   1 
ATOM   3608 O  OD2   . ASP B 1 179 ? 5.284   22.242  4.739   1.00 36.94 ? 1156 ASP B OD2   1 
ATOM   3609 N  N     . ILE B 1 180 ? 4.156   20.256  0.417   1.00 32.00 ? 1157 ILE B N     1 
ATOM   3610 C  CA    . ILE B 1 180 ? 4.187   18.862  -0.009  1.00 33.13 ? 1157 ILE B CA    1 
ATOM   3611 C  C     . ILE B 1 180 ? 5.543   18.240  0.275   1.00 33.06 ? 1157 ILE B C     1 
ATOM   3612 O  O     . ILE B 1 180 ? 6.016   17.376  -0.465  1.00 32.02 ? 1157 ILE B O     1 
ATOM   3613 C  CB    . ILE B 1 180 ? 3.853   18.722  -1.512  1.00 34.60 ? 1157 ILE B CB    1 
ATOM   3614 C  CG1   . ILE B 1 180 ? 4.825   19.558  -2.344  1.00 33.36 ? 1157 ILE B CG1   1 
ATOM   3615 C  CG2   . ILE B 1 180 ? 2.411   19.159  -1.772  1.00 32.71 ? 1157 ILE B CG2   1 
ATOM   3616 C  CD1   . ILE B 1 180 ? 4.715   19.267  -3.821  1.00 36.26 ? 1157 ILE B CD1   1 
HETATM 3617 N  N     . PTR B 1 181 ? 6.164   18.686  1.362   1.00 34.42 ? 1158 PTR B N     1 
HETATM 3618 C  CA    . PTR B 1 181 ? 7.468   18.171  1.752   1.00 35.60 ? 1158 PTR B CA    1 
HETATM 3619 C  C     . PTR B 1 181 ? 7.410   16.671  1.999   1.00 35.40 ? 1158 PTR B C     1 
HETATM 3620 O  O     . PTR B 1 181 ? 8.314   15.933  1.619   1.00 34.77 ? 1158 PTR B O     1 
HETATM 3621 C  CB    . PTR B 1 181 ? 7.977   18.826  3.038   1.00 33.69 ? 1158 PTR B CB    1 
HETATM 3622 C  CG    . PTR B 1 181 ? 9.393   18.403  3.376   1.00 33.69 ? 1158 PTR B CG    1 
HETATM 3623 C  CD1   . PTR B 1 181 ? 10.485  19.193  3.005   1.00 34.55 ? 1158 PTR B CD1   1 
HETATM 3624 C  CD2   . PTR B 1 181 ? 9.649   17.185  4.011   1.00 34.78 ? 1158 PTR B CD2   1 
HETATM 3625 C  CE1   . PTR B 1 181 ? 11.800  18.782  3.257   1.00 35.38 ? 1158 PTR B CE1   1 
HETATM 3626 C  CE2   . PTR B 1 181 ? 10.962  16.755  4.264   1.00 36.93 ? 1158 PTR B CE2   1 
HETATM 3627 C  CZ    . PTR B 1 181 ? 12.033  17.561  3.880   1.00 37.67 ? 1158 PTR B CZ    1 
HETATM 3628 O  OH    . PTR B 1 181 ? 13.328  17.142  4.090   1.00 38.78 ? 1158 PTR B OH    1 
HETATM 3629 P  P     . PTR B 1 181 ? 14.299  16.670  2.874   1.00 40.71 ? 1158 PTR B P     1 
HETATM 3630 O  O1P   . PTR B 1 181 ? 14.511  17.891  2.074   1.00 40.21 ? 1158 PTR B O1P   1 
HETATM 3631 O  O2P   . PTR B 1 181 ? 13.526  15.587  2.265   1.00 37.91 ? 1158 PTR B O2P   1 
HETATM 3632 O  O3P   . PTR B 1 181 ? 15.491  16.203  3.611   1.00 41.97 ? 1158 PTR B O3P   1 
ATOM   3633 N  N     . GLU B 1 182 ? 6.338   16.227  2.639   1.00 36.82 ? 1159 GLU B N     1 
ATOM   3634 C  CA    . GLU B 1 182 ? 6.186   14.817  2.969   1.00 39.86 ? 1159 GLU B CA    1 
ATOM   3635 C  C     . GLU B 1 182 ? 5.975   13.825  1.837   1.00 41.15 ? 1159 GLU B C     1 
ATOM   3636 O  O     . GLU B 1 182 ? 6.498   12.703  1.893   1.00 41.16 ? 1159 GLU B O     1 
ATOM   3637 C  CB    . GLU B 1 182 ? 5.041   14.626  3.960   1.00 39.68 ? 1159 GLU B CB    1 
ATOM   3638 C  CG    . GLU B 1 182 ? 5.291   15.274  5.292   1.00 45.87 ? 1159 GLU B CG    1 
ATOM   3639 C  CD    . GLU B 1 182 ? 4.354   16.417  5.556   1.00 49.59 ? 1159 GLU B CD    1 
ATOM   3640 O  OE1   . GLU B 1 182 ? 4.218   17.293  4.657   1.00 53.47 ? 1159 GLU B OE1   1 
ATOM   3641 O  OE2   . GLU B 1 182 ? 3.764   16.431  6.661   1.00 49.05 ? 1159 GLU B OE2   1 
ATOM   3642 N  N     . THR B 1 183 ? 5.222   14.224  0.814   1.00 39.79 ? 1160 THR B N     1 
ATOM   3643 C  CA    . THR B 1 183 ? 4.910   13.297  -0.258  1.00 40.00 ? 1160 THR B CA    1 
ATOM   3644 C  C     . THR B 1 183 ? 5.182   13.758  -1.683  1.00 41.79 ? 1160 THR B C     1 
ATOM   3645 O  O     . THR B 1 183 ? 5.139   12.946  -2.601  1.00 43.39 ? 1160 THR B O     1 
ATOM   3646 C  CB    . THR B 1 183 ? 3.426   12.905  -0.167  1.00 40.69 ? 1160 THR B CB    1 
ATOM   3647 O  OG1   . THR B 1 183 ? 2.624   14.040  -0.504  1.00 43.23 ? 1160 THR B OG1   1 
ATOM   3648 C  CG2   . THR B 1 183 ? 3.056   12.496  1.255   1.00 39.03 ? 1160 THR B CG2   1 
ATOM   3649 N  N     . ASP B 1 184 ? 5.459   15.043  -1.882  1.00 43.31 ? 1161 ASP B N     1 
ATOM   3650 C  CA    . ASP B 1 184 ? 5.695   15.556  -3.234  1.00 42.63 ? 1161 ASP B CA    1 
ATOM   3651 C  C     . ASP B 1 184 ? 4.370   15.806  -3.952  1.00 41.83 ? 1161 ASP B C     1 
ATOM   3652 O  O     . ASP B 1 184 ? 4.357   16.214  -5.117  1.00 42.02 ? 1161 ASP B O     1 
ATOM   3653 C  CB    . ASP B 1 184 ? 6.503   14.561  -4.076  1.00 43.64 ? 1161 ASP B CB    1 
ATOM   3654 C  CG    . ASP B 1 184 ? 7.992   14.692  -3.876  1.00 45.31 ? 1161 ASP B CG    1 
ATOM   3655 O  OD1   . ASP B 1 184 ? 8.741   13.915  -4.508  1.00 47.68 ? 1161 ASP B OD1   1 
ATOM   3656 O  OD2   . ASP B 1 184 ? 8.415   15.574  -3.104  1.00 46.65 ? 1161 ASP B OD2   1 
HETATM 3657 N  N     . PTR B 1 185 ? 3.257   15.549  -3.274  1.00 39.48 ? 1162 PTR B N     1 
HETATM 3658 C  CA    . PTR B 1 185 ? 1.950   15.777  -3.883  1.00 39.96 ? 1162 PTR B CA    1 
HETATM 3659 C  C     . PTR B 1 185 ? 0.926   16.105  -2.817  1.00 40.61 ? 1162 PTR B C     1 
HETATM 3660 O  O     . PTR B 1 185 ? 1.139   15.852  -1.631  1.00 40.55 ? 1162 PTR B O     1 
HETATM 3661 C  CB    . PTR B 1 185 ? 1.466   14.545  -4.676  1.00 38.39 ? 1162 PTR B CB    1 
HETATM 3662 C  CG    . PTR B 1 185 ? 0.981   13.383  -3.822  1.00 41.79 ? 1162 PTR B CG    1 
HETATM 3663 C  CD1   . PTR B 1 185 ? -0.240  13.446  -3.128  1.00 42.33 ? 1162 PTR B CD1   1 
HETATM 3664 C  CD2   . PTR B 1 185 ? 1.771   12.247  -3.647  1.00 42.08 ? 1162 PTR B CD2   1 
HETATM 3665 C  CE1   . PTR B 1 185 ? -0.649  12.414  -2.282  1.00 41.65 ? 1162 PTR B CE1   1 
HETATM 3666 C  CE2   . PTR B 1 185 ? 1.370   11.212  -2.797  1.00 43.00 ? 1162 PTR B CE2   1 
HETATM 3667 C  CZ    . PTR B 1 185 ? 0.167   11.306  -2.118  1.00 44.48 ? 1162 PTR B CZ    1 
HETATM 3668 O  OH    . PTR B 1 185 ? -0.185  10.305  -1.245  1.00 46.48 ? 1162 PTR B OH    1 
HETATM 3669 P  P     . PTR B 1 185 ? -1.362  9.217   -1.351  1.00 49.66 ? 1162 PTR B P     1 
HETATM 3670 O  O1P   . PTR B 1 185 ? -2.561  10.026  -1.084  1.00 44.96 ? 1162 PTR B O1P   1 
HETATM 3671 O  O2P   . PTR B 1 185 ? -1.019  8.230   -0.256  1.00 48.75 ? 1162 PTR B O2P   1 
HETATM 3672 O  O3P   . PTR B 1 185 ? -1.198  8.702   -2.753  1.00 47.52 ? 1162 PTR B O3P   1 
HETATM 3673 N  N     . PTR B 1 186 ? -0.190  16.675  -3.253  1.00 40.17 ? 1163 PTR B N     1 
HETATM 3674 C  CA    . PTR B 1 186 ? -1.293  17.018  -2.361  1.00 41.31 ? 1163 PTR B CA    1 
HETATM 3675 C  C     . PTR B 1 186 ? -2.563  16.430  -2.976  1.00 41.99 ? 1163 PTR B C     1 
HETATM 3676 O  O     . PTR B 1 186 ? -2.807  16.591  -4.179  1.00 42.56 ? 1163 PTR B O     1 
HETATM 3677 C  CB    . PTR B 1 186 ? -1.401  18.543  -2.218  1.00 41.59 ? 1163 PTR B CB    1 
HETATM 3678 C  CG    . PTR B 1 186 ? -2.732  19.042  -1.703  1.00 43.84 ? 1163 PTR B CG    1 
HETATM 3679 C  CD1   . PTR B 1 186 ? -3.799  19.279  -2.586  1.00 45.78 ? 1163 PTR B CD1   1 
HETATM 3680 C  CD2   . PTR B 1 186 ? -2.938  19.273  -0.341  1.00 42.98 ? 1163 PTR B CD2   1 
HETATM 3681 C  CE1   . PTR B 1 186 ? -5.040  19.736  -2.124  1.00 46.21 ? 1163 PTR B CE1   1 
HETATM 3682 C  CE2   . PTR B 1 186 ? -4.175  19.726  0.137   1.00 45.71 ? 1163 PTR B CE2   1 
HETATM 3683 C  CZ    . PTR B 1 186 ? -5.222  19.960  -0.763  1.00 48.72 ? 1163 PTR B CZ    1 
HETATM 3684 O  OH    . PTR B 1 186 ? -6.445  20.435  -0.329  1.00 51.94 ? 1163 PTR B OH    1 
HETATM 3685 P  P     . PTR B 1 186 ? -7.084  20.669  1.179   1.00 55.90 ? 1163 PTR B P     1 
HETATM 3686 O  O1P   . PTR B 1 186 ? -7.507  19.279  1.544   1.00 54.49 ? 1163 PTR B O1P   1 
HETATM 3687 O  O2P   . PTR B 1 186 ? -8.172  21.623  0.861   1.00 52.94 ? 1163 PTR B O2P   1 
HETATM 3688 O  O3P   . PTR B 1 186 ? -5.981  21.226  2.036   1.00 53.64 ? 1163 PTR B O3P   1 
ATOM   3689 N  N     . ARG B 1 187 ? -3.366  15.746  -2.163  1.00 41.44 ? 1164 ARG B N     1 
ATOM   3690 C  CA    . ARG B 1 187 ? -4.591  15.132  -2.669  1.00 43.46 ? 1164 ARG B CA    1 
ATOM   3691 C  C     . ARG B 1 187 ? -5.828  15.659  -1.980  1.00 44.98 ? 1164 ARG B C     1 
ATOM   3692 O  O     . ARG B 1 187 ? -6.005  15.477  -0.784  1.00 46.35 ? 1164 ARG B O     1 
ATOM   3693 C  CB    . ARG B 1 187 ? -4.556  13.613  -2.497  1.00 41.43 ? 1164 ARG B CB    1 
ATOM   3694 C  CG    . ARG B 1 187 ? -5.791  12.898  -3.026  1.00 38.98 ? 1164 ARG B CG    1 
ATOM   3695 C  CD    . ARG B 1 187 ? -5.851  11.485  -2.476  1.00 35.65 ? 1164 ARG B CD    1 
ATOM   3696 N  NE    . ARG B 1 187 ? -4.629  10.759  -2.768  1.00 34.69 ? 1164 ARG B NE    1 
ATOM   3697 C  CZ    . ARG B 1 187 ? -4.345  10.211  -3.943  1.00 38.47 ? 1164 ARG B CZ    1 
ATOM   3698 N  NH1   . ARG B 1 187 ? -5.212  10.297  -4.947  1.00 38.23 ? 1164 ARG B NH1   1 
ATOM   3699 N  NH2   . ARG B 1 187 ? -3.178  9.598   -4.124  1.00 40.47 ? 1164 ARG B NH2   1 
ATOM   3700 N  N     . LYS B 1 188 ? -6.687  16.313  -2.744  1.00 47.79 ? 1165 LYS B N     1 
ATOM   3701 C  CA    . LYS B 1 188 ? -7.928  16.862  -2.209  1.00 52.03 ? 1165 LYS B CA    1 
ATOM   3702 C  C     . LYS B 1 188 ? -9.026  15.825  -2.457  1.00 54.39 ? 1165 LYS B C     1 
ATOM   3703 O  O     . LYS B 1 188 ? -9.280  15.447  -3.606  1.00 55.34 ? 1165 LYS B O     1 
ATOM   3704 C  CB    . LYS B 1 188 ? -8.262  18.159  -2.951  1.00 53.81 ? 1165 LYS B CB    1 
ATOM   3705 C  CG    . LYS B 1 188 ? -9.490  18.907  -2.471  1.00 55.76 ? 1165 LYS B CG    1 
ATOM   3706 C  CD    . LYS B 1 188 ? -9.243  19.553  -1.119  1.00 58.04 ? 1165 LYS B CD    1 
ATOM   3707 C  CE    . LYS B 1 188 ? -10.472 20.294  -0.631  1.00 57.95 ? 1165 LYS B CE    1 
ATOM   3708 N  NZ    . LYS B 1 188 ? -10.406 20.493  0.844   1.00 59.92 ? 1165 LYS B NZ    1 
ATOM   3709 N  N     . GLY B 1 189 ? -9.676  15.365  -1.392  1.00 56.15 ? 1166 GLY B N     1 
ATOM   3710 C  CA    . GLY B 1 189 ? -10.722 14.365  -1.559  1.00 57.25 ? 1166 GLY B CA    1 
ATOM   3711 C  C     . GLY B 1 189 ? -12.145 14.902  -1.591  1.00 57.73 ? 1166 GLY B C     1 
ATOM   3712 O  O     . GLY B 1 189 ? -12.969 14.467  -2.407  1.00 58.27 ? 1166 GLY B O     1 
ATOM   3713 N  N     . GLY B 1 190 ? -12.441 15.843  -0.702  1.00 57.16 ? 1167 GLY B N     1 
ATOM   3714 C  CA    . GLY B 1 190 ? -13.774 16.405  -0.656  1.00 58.37 ? 1167 GLY B CA    1 
ATOM   3715 C  C     . GLY B 1 190 ? -14.011 17.448  -1.729  1.00 59.01 ? 1167 GLY B C     1 
ATOM   3716 O  O     . GLY B 1 190 ? -13.138 17.716  -2.555  1.00 60.02 ? 1167 GLY B O     1 
ATOM   3717 N  N     . LYS B 1 191 ? -15.202 18.039  -1.718  1.00 58.71 ? 1168 LYS B N     1 
ATOM   3718 C  CA    . LYS B 1 191 ? -15.556 19.071  -2.686  1.00 57.35 ? 1168 LYS B CA    1 
ATOM   3719 C  C     . LYS B 1 191 ? -14.829 20.366  -2.327  1.00 55.83 ? 1168 LYS B C     1 
ATOM   3720 O  O     . LYS B 1 191 ? -14.317 20.519  -1.215  1.00 55.93 ? 1168 LYS B O     1 
ATOM   3721 C  CB    . LYS B 1 191 ? -17.077 19.309  -2.692  1.00 57.97 ? 1168 LYS B CB    1 
ATOM   3722 N  N     . GLY B 1 192 ? -14.782 21.295  -3.274  1.00 53.84 ? 1169 GLY B N     1 
ATOM   3723 C  CA    . GLY B 1 192 ? -14.125 22.567  -3.034  1.00 50.89 ? 1169 GLY B CA    1 
ATOM   3724 C  C     . GLY B 1 192 ? -14.070 23.395  -4.302  1.00 49.04 ? 1169 GLY B C     1 
ATOM   3725 O  O     . GLY B 1 192 ? -14.244 22.869  -5.401  1.00 49.47 ? 1169 GLY B O     1 
ATOM   3726 N  N     . LEU B 1 193 ? -13.839 24.694  -4.155  1.00 47.06 ? 1170 LEU B N     1 
ATOM   3727 C  CA    . LEU B 1 193 ? -13.753 25.583  -5.311  1.00 45.91 ? 1170 LEU B CA    1 
ATOM   3728 C  C     . LEU B 1 193 ? -12.398 25.440  -5.998  1.00 45.02 ? 1170 LEU B C     1 
ATOM   3729 O  O     . LEU B 1 193 ? -11.370 25.809  -5.438  1.00 44.69 ? 1170 LEU B O     1 
ATOM   3730 C  CB    . LEU B 1 193 ? -13.951 27.031  -4.871  1.00 44.39 ? 1170 LEU B CB    1 
ATOM   3731 C  CG    . LEU B 1 193 ? -15.259 27.279  -4.113  1.00 45.51 ? 1170 LEU B CG    1 
ATOM   3732 C  CD1   . LEU B 1 193 ? -15.378 28.748  -3.781  1.00 42.58 ? 1170 LEU B CD1   1 
ATOM   3733 C  CD2   . LEU B 1 193 ? -16.455 26.811  -4.943  1.00 44.14 ? 1170 LEU B CD2   1 
ATOM   3734 N  N     . LEU B 1 194 ? -12.393 24.907  -7.212  1.00 43.78 ? 1171 LEU B N     1 
ATOM   3735 C  CA    . LEU B 1 194 ? -11.143 24.724  -7.928  1.00 43.91 ? 1171 LEU B CA    1 
ATOM   3736 C  C     . LEU B 1 194 ? -11.118 25.474  -9.261  1.00 43.62 ? 1171 LEU B C     1 
ATOM   3737 O  O     . LEU B 1 194 ? -12.153 25.617  -9.922  1.00 44.46 ? 1171 LEU B O     1 
ATOM   3738 C  CB    . LEU B 1 194 ? -10.890 23.230  -8.141  1.00 43.23 ? 1171 LEU B CB    1 
ATOM   3739 C  CG    . LEU B 1 194 ? -11.008 22.386  -6.859  1.00 43.81 ? 1171 LEU B CG    1 
ATOM   3740 C  CD1   . LEU B 1 194 ? -10.689 20.940  -7.180  1.00 42.76 ? 1171 LEU B CD1   1 
ATOM   3741 C  CD2   . LEU B 1 194 ? -10.063 22.899  -5.771  1.00 42.68 ? 1171 LEU B CD2   1 
ATOM   3742 N  N     . PRO B 1 195 ? -9.932  25.973  -9.664  1.00 41.68 ? 1172 PRO B N     1 
ATOM   3743 C  CA    . PRO B 1 195 ? -9.733  26.717  -10.912 1.00 40.81 ? 1172 PRO B CA    1 
ATOM   3744 C  C     . PRO B 1 195 ? -9.607  25.751  -12.079 1.00 41.57 ? 1172 PRO B C     1 
ATOM   3745 O  O     . PRO B 1 195 ? -8.554  25.675  -12.725 1.00 42.32 ? 1172 PRO B O     1 
ATOM   3746 C  CB    . PRO B 1 195 ? -8.439  27.467  -10.652 1.00 39.51 ? 1172 PRO B CB    1 
ATOM   3747 C  CG    . PRO B 1 195 ? -7.654  26.454  -9.895  1.00 39.13 ? 1172 PRO B CG    1 
ATOM   3748 C  CD    . PRO B 1 195 ? -8.663  25.881  -8.915  1.00 41.14 ? 1172 PRO B CD    1 
ATOM   3749 N  N     . VAL B 1 196 ? -10.692 25.027  -12.344 1.00 39.08 ? 1173 VAL B N     1 
ATOM   3750 C  CA    . VAL B 1 196 ? -10.732 24.011  -13.393 1.00 38.63 ? 1173 VAL B CA    1 
ATOM   3751 C  C     . VAL B 1 196 ? -10.131 24.313  -14.759 1.00 38.70 ? 1173 VAL B C     1 
ATOM   3752 O  O     . VAL B 1 196 ? -9.449  23.454  -15.330 1.00 38.64 ? 1173 VAL B O     1 
ATOM   3753 C  CB    . VAL B 1 196 ? -12.184 23.465  -13.615 1.00 39.86 ? 1173 VAL B CB    1 
ATOM   3754 C  CG1   . VAL B 1 196 ? -12.678 22.803  -12.343 1.00 39.39 ? 1173 VAL B CG1   1 
ATOM   3755 C  CG2   . VAL B 1 196 ? -13.128 24.579  -14.060 1.00 38.87 ? 1173 VAL B CG2   1 
ATOM   3756 N  N     . ARG B 1 197 ? -10.364 25.503  -15.303 1.00 38.29 ? 1174 ARG B N     1 
ATOM   3757 C  CA    . ARG B 1 197 ? -9.805  25.803  -16.622 1.00 39.04 ? 1174 ARG B CA    1 
ATOM   3758 C  C     . ARG B 1 197 ? -8.274  25.835  -16.644 1.00 37.88 ? 1174 ARG B C     1 
ATOM   3759 O  O     . ARG B 1 197 ? -7.664  25.827  -17.715 1.00 33.81 ? 1174 ARG B O     1 
ATOM   3760 C  CB    . ARG B 1 197 ? -10.385 27.122  -17.159 1.00 41.73 ? 1174 ARG B CB    1 
ATOM   3761 C  CG    . ARG B 1 197 ? -11.840 26.981  -17.601 1.00 42.42 ? 1174 ARG B CG    1 
ATOM   3762 C  CD    . ARG B 1 197 ? -12.612 28.285  -17.514 1.00 44.31 ? 1174 ARG B CD    1 
ATOM   3763 N  NE    . ARG B 1 197 ? -14.056 28.037  -17.517 1.00 45.85 ? 1174 ARG B NE    1 
ATOM   3764 C  CZ    . ARG B 1 197 ? -14.764 27.648  -18.576 1.00 45.01 ? 1174 ARG B CZ    1 
ATOM   3765 N  NH1   . ARG B 1 197 ? -14.172 27.471  -19.751 1.00 45.54 ? 1174 ARG B NH1   1 
ATOM   3766 N  NH2   . ARG B 1 197 ? -16.063 27.395  -18.446 1.00 44.60 ? 1174 ARG B NH2   1 
ATOM   3767 N  N     . TRP B 1 198 ? -7.663  25.854  -15.458 1.00 36.98 ? 1175 TRP B N     1 
ATOM   3768 C  CA    . TRP B 1 198 ? -6.212  25.896  -15.337 1.00 36.50 ? 1175 TRP B CA    1 
ATOM   3769 C  C     . TRP B 1 198 ? -5.656  24.581  -14.810 1.00 36.50 ? 1175 TRP B C     1 
ATOM   3770 O  O     . TRP B 1 198 ? -4.439  24.418  -14.665 1.00 34.34 ? 1175 TRP B O     1 
ATOM   3771 C  CB    . TRP B 1 198 ? -5.820  27.040  -14.393 1.00 36.50 ? 1175 TRP B CB    1 
ATOM   3772 C  CG    . TRP B 1 198 ? -5.897  28.399  -15.023 1.00 36.02 ? 1175 TRP B CG    1 
ATOM   3773 C  CD1   . TRP B 1 198 ? -4.876  29.079  -15.617 1.00 37.39 ? 1175 TRP B CD1   1 
ATOM   3774 C  CD2   . TRP B 1 198 ? -7.061  29.221  -15.167 1.00 36.98 ? 1175 TRP B CD2   1 
ATOM   3775 N  NE1   . TRP B 1 198 ? -5.327  30.272  -16.126 1.00 36.12 ? 1175 TRP B NE1   1 
ATOM   3776 C  CE2   . TRP B 1 198 ? -6.665  30.386  -15.865 1.00 37.39 ? 1175 TRP B CE2   1 
ATOM   3777 C  CE3   . TRP B 1 198 ? -8.402  29.086  -14.777 1.00 38.60 ? 1175 TRP B CE3   1 
ATOM   3778 C  CZ2   . TRP B 1 198 ? -7.566  31.418  -16.186 1.00 37.71 ? 1175 TRP B CZ2   1 
ATOM   3779 C  CZ3   . TRP B 1 198 ? -9.301  30.112  -15.098 1.00 37.93 ? 1175 TRP B CZ3   1 
ATOM   3780 C  CH2   . TRP B 1 198 ? -8.875  31.262  -15.796 1.00 38.70 ? 1175 TRP B CH2   1 
ATOM   3781 N  N     . MET B 1 199 ? -6.548  23.639  -14.529 1.00 35.58 ? 1176 MET B N     1 
ATOM   3782 C  CA    . MET B 1 199 ? -6.116  22.381  -13.952 1.00 36.60 ? 1176 MET B CA    1 
ATOM   3783 C  C     . MET B 1 199 ? -5.699  21.293  -14.904 1.00 37.18 ? 1176 MET B C     1 
ATOM   3784 O  O     . MET B 1 199 ? -6.224  21.163  -16.008 1.00 38.79 ? 1176 MET B O     1 
ATOM   3785 C  CB    . MET B 1 199 ? -7.193  21.861  -13.009 1.00 37.83 ? 1176 MET B CB    1 
ATOM   3786 C  CG    . MET B 1 199 ? -7.478  22.821  -11.878 1.00 37.45 ? 1176 MET B CG    1 
ATOM   3787 S  SD    . MET B 1 199 ? -8.771  22.228  -10.821 1.00 42.27 ? 1176 MET B SD    1 
ATOM   3788 C  CE    . MET B 1 199 ? -7.934  22.095  -9.323  1.00 47.89 ? 1176 MET B CE    1 
ATOM   3789 N  N     . ALA B 1 200 ? -4.731  20.502  -14.462 1.00 38.00 ? 1177 ALA B N     1 
ATOM   3790 C  CA    . ALA B 1 200 ? -4.247  19.394  -15.273 1.00 38.20 ? 1177 ALA B CA    1 
ATOM   3791 C  C     . ALA B 1 200 ? -5.279  18.266  -15.202 1.00 38.14 ? 1177 ALA B C     1 
ATOM   3792 O  O     . ALA B 1 200 ? -6.148  18.241  -14.319 1.00 33.84 ? 1177 ALA B O     1 
ATOM   3793 C  CB    . ALA B 1 200 ? -2.885  18.907  -14.759 1.00 35.33 ? 1177 ALA B CB    1 
ATOM   3794 N  N     . PRO B 1 201 ? -5.202  17.324  -16.148 1.00 38.96 ? 1178 PRO B N     1 
ATOM   3795 C  CA    . PRO B 1 201 ? -6.111  16.176  -16.218 1.00 39.77 ? 1178 PRO B CA    1 
ATOM   3796 C  C     . PRO B 1 201 ? -6.149  15.364  -14.912 1.00 41.13 ? 1178 PRO B C     1 
ATOM   3797 O  O     . PRO B 1 201 ? -7.218  15.161  -14.332 1.00 42.59 ? 1178 PRO B O     1 
ATOM   3798 C  CB    . PRO B 1 201 ? -5.538  15.354  -17.370 1.00 39.00 ? 1178 PRO B CB    1 
ATOM   3799 C  CG    . PRO B 1 201 ? -4.827  16.366  -18.206 1.00 37.98 ? 1178 PRO B CG    1 
ATOM   3800 C  CD    . PRO B 1 201 ? -4.188  17.264  -17.216 1.00 37.28 ? 1178 PRO B CD    1 
ATOM   3801 N  N     . GLU B 1 202 ? -4.985  14.903  -14.458 1.00 41.06 ? 1179 GLU B N     1 
ATOM   3802 C  CA    . GLU B 1 202 ? -4.896  14.110  -13.230 1.00 41.46 ? 1179 GLU B CA    1 
ATOM   3803 C  C     . GLU B 1 202 ? -5.490  14.821  -12.028 1.00 42.88 ? 1179 GLU B C     1 
ATOM   3804 O  O     . GLU B 1 202 ? -5.990  14.178  -11.112 1.00 45.71 ? 1179 GLU B O     1 
ATOM   3805 C  CB    . GLU B 1 202 ? -3.440  13.754  -12.900 1.00 41.35 ? 1179 GLU B CB    1 
ATOM   3806 C  CG    . GLU B 1 202 ? -2.553  14.961  -12.604 1.00 43.85 ? 1179 GLU B CG    1 
ATOM   3807 C  CD    . GLU B 1 202 ? -1.785  15.453  -13.831 1.00 43.81 ? 1179 GLU B CD    1 
ATOM   3808 O  OE1   . GLU B 1 202 ? -2.289  15.318  -14.975 1.00 42.89 ? 1179 GLU B OE1   1 
ATOM   3809 O  OE2   . GLU B 1 202 ? -0.673  15.989  -13.642 1.00 43.70 ? 1179 GLU B OE2   1 
ATOM   3810 N  N     . SER B 1 203 ? -5.433  16.146  -12.014 1.00 43.03 ? 1180 SER B N     1 
ATOM   3811 C  CA    . SER B 1 203 ? -5.978  16.895  -10.892 1.00 43.74 ? 1180 SER B CA    1 
ATOM   3812 C  C     . SER B 1 203 ? -7.498  16.879  -10.946 1.00 44.31 ? 1180 SER B C     1 
ATOM   3813 O  O     . SER B 1 203 ? -8.178  16.754  -9.926  1.00 44.93 ? 1180 SER B O     1 
ATOM   3814 C  CB    . SER B 1 203 ? -5.494  18.343  -10.932 1.00 44.22 ? 1180 SER B CB    1 
ATOM   3815 O  OG    . SER B 1 203 ? -4.086  18.404  -10.988 1.00 45.50 ? 1180 SER B OG    1 
ATOM   3816 N  N     . LEU B 1 204 ? -8.033  17.014  -12.150 1.00 43.82 ? 1181 LEU B N     1 
ATOM   3817 C  CA    . LEU B 1 204 ? -9.470  17.017  -12.323 1.00 44.36 ? 1181 LEU B CA    1 
ATOM   3818 C  C     . LEU B 1 204 ? -10.023 15.626  -12.002 1.00 46.23 ? 1181 LEU B C     1 
ATOM   3819 O  O     . LEU B 1 204 ? -11.082 15.485  -11.380 1.00 44.64 ? 1181 LEU B O     1 
ATOM   3820 C  CB    . LEU B 1 204 ? -9.804  17.396  -13.765 1.00 42.42 ? 1181 LEU B CB    1 
ATOM   3821 C  CG    . LEU B 1 204 ? -9.328  18.770  -14.239 1.00 42.07 ? 1181 LEU B CG    1 
ATOM   3822 C  CD1   . LEU B 1 204 ? -9.534  18.876  -15.749 1.00 39.95 ? 1181 LEU B CD1   1 
ATOM   3823 C  CD2   . LEU B 1 204 ? -10.074 19.877  -13.492 1.00 39.40 ? 1181 LEU B CD2   1 
ATOM   3824 N  N     . LYS B 1 205 ? -9.292  14.600  -12.427 1.00 46.40 ? 1182 LYS B N     1 
ATOM   3825 C  CA    . LYS B 1 205 ? -9.723  13.235  -12.209 1.00 48.07 ? 1182 LYS B CA    1 
ATOM   3826 C  C     . LYS B 1 205 ? -9.513  12.724  -10.792 1.00 48.58 ? 1182 LYS B C     1 
ATOM   3827 O  O     . LYS B 1 205 ? -10.459 12.260  -10.156 1.00 49.20 ? 1182 LYS B O     1 
ATOM   3828 C  CB    . LYS B 1 205 ? -9.025  12.288  -13.193 1.00 49.25 ? 1182 LYS B CB    1 
ATOM   3829 C  CG    . LYS B 1 205 ? -9.554  10.854  -13.107 1.00 51.47 ? 1182 LYS B CG    1 
ATOM   3830 C  CD    . LYS B 1 205 ? -8.957  9.924   -14.154 1.00 50.86 ? 1182 LYS B CD    1 
ATOM   3831 C  CE    . LYS B 1 205 ? -7.581  9.432   -13.747 1.00 55.66 ? 1182 LYS B CE    1 
ATOM   3832 N  NZ    . LYS B 1 205 ? -7.008  8.438   -14.711 1.00 58.03 ? 1182 LYS B NZ    1 
ATOM   3833 N  N     . ASP B 1 206 ? -8.281  12.814  -10.299 1.00 48.34 ? 1183 ASP B N     1 
ATOM   3834 C  CA    . ASP B 1 206 ? -7.947  12.302  -8.970  1.00 47.42 ? 1183 ASP B CA    1 
ATOM   3835 C  C     . ASP B 1 206 ? -7.798  13.307  -7.844  1.00 46.25 ? 1183 ASP B C     1 
ATOM   3836 O  O     . ASP B 1 206 ? -7.682  12.922  -6.687  1.00 48.00 ? 1183 ASP B O     1 
ATOM   3837 C  CB    . ASP B 1 206 ? -6.666  11.489  -9.060  1.00 49.50 ? 1183 ASP B CB    1 
ATOM   3838 C  CG    . ASP B 1 206 ? -6.764  10.375  -10.073 1.00 50.80 ? 1183 ASP B CG    1 
ATOM   3839 O  OD1   . ASP B 1 206 ? -7.486  9.390   -9.802  1.00 54.07 ? 1183 ASP B OD1   1 
ATOM   3840 O  OD2   . ASP B 1 206 ? -6.127  10.489  -11.140 1.00 50.41 ? 1183 ASP B OD2   1 
ATOM   3841 N  N     . GLY B 1 207 ? -7.798  14.590  -8.171  1.00 44.42 ? 1184 GLY B N     1 
ATOM   3842 C  CA    . GLY B 1 207 ? -7.640  15.591  -7.139  1.00 40.36 ? 1184 GLY B CA    1 
ATOM   3843 C  C     . GLY B 1 207 ? -6.211  15.640  -6.648  1.00 39.66 ? 1184 GLY B C     1 
ATOM   3844 O  O     . GLY B 1 207 ? -5.962  16.074  -5.525  1.00 39.07 ? 1184 GLY B O     1 
ATOM   3845 N  N     . VAL B 1 208 ? -5.264  15.193  -7.472  1.00 39.52 ? 1185 VAL B N     1 
ATOM   3846 C  CA    . VAL B 1 208 ? -3.868  15.224  -7.051  1.00 40.18 ? 1185 VAL B CA    1 
ATOM   3847 C  C     . VAL B 1 208 ? -3.119  16.377  -7.716  1.00 39.07 ? 1185 VAL B C     1 
ATOM   3848 O  O     . VAL B 1 208 ? -3.191  16.583  -8.930  1.00 38.68 ? 1185 VAL B O     1 
ATOM   3849 C  CB    . VAL B 1 208 ? -3.139  13.860  -7.303  1.00 41.42 ? 1185 VAL B CB    1 
ATOM   3850 C  CG1   . VAL B 1 208 ? -4.148  12.718  -7.227  1.00 43.16 ? 1185 VAL B CG1   1 
ATOM   3851 C  CG2   . VAL B 1 208 ? -2.398  13.867  -8.623  1.00 42.94 ? 1185 VAL B CG2   1 
ATOM   3852 N  N     . PHE B 1 209 ? -2.402  17.131  -6.890  1.00 37.62 ? 1186 PHE B N     1 
ATOM   3853 C  CA    . PHE B 1 209 ? -1.642  18.286  -7.341  1.00 35.69 ? 1186 PHE B CA    1 
ATOM   3854 C  C     . PHE B 1 209 ? -0.147  18.080  -7.107  1.00 34.73 ? 1186 PHE B C     1 
ATOM   3855 O  O     . PHE B 1 209 ? 0.263   17.590  -6.049  1.00 35.50 ? 1186 PHE B O     1 
ATOM   3856 C  CB    . PHE B 1 209 ? -2.127  19.532  -6.589  1.00 35.11 ? 1186 PHE B CB    1 
ATOM   3857 C  CG    . PHE B 1 209 ? -3.606  19.790  -6.733  1.00 34.78 ? 1186 PHE B CG    1 
ATOM   3858 C  CD1   . PHE B 1 209 ? -4.539  18.947  -6.134  1.00 36.08 ? 1186 PHE B CD1   1 
ATOM   3859 C  CD2   . PHE B 1 209 ? -4.065  20.855  -7.497  1.00 36.18 ? 1186 PHE B CD2   1 
ATOM   3860 C  CE1   . PHE B 1 209 ? -5.918  19.162  -6.293  1.00 35.15 ? 1186 PHE B CE1   1 
ATOM   3861 C  CE2   . PHE B 1 209 ? -5.440  21.083  -7.664  1.00 37.56 ? 1186 PHE B CE2   1 
ATOM   3862 C  CZ    . PHE B 1 209 ? -6.367  20.229  -7.058  1.00 36.58 ? 1186 PHE B CZ    1 
ATOM   3863 N  N     . THR B 1 210 ? 0.659   18.458  -8.093  1.00 31.90 ? 1187 THR B N     1 
ATOM   3864 C  CA    . THR B 1 210 ? 2.095   18.307  -8.004  1.00 30.85 ? 1187 THR B CA    1 
ATOM   3865 C  C     . THR B 1 210 ? 2.761   19.489  -8.707  1.00 33.58 ? 1187 THR B C     1 
ATOM   3866 O  O     . THR B 1 210 ? 2.073   20.391  -9.208  1.00 34.96 ? 1187 THR B O     1 
ATOM   3867 C  CB    . THR B 1 210 ? 2.534   17.017  -8.710  1.00 29.52 ? 1187 THR B CB    1 
ATOM   3868 O  OG1   . THR B 1 210 ? 2.273   17.135  -10.115 1.00 30.30 ? 1187 THR B OG1   1 
ATOM   3869 C  CG2   . THR B 1 210 ? 1.771   15.827  -8.165  1.00 24.83 ? 1187 THR B CG2   1 
ATOM   3870 N  N     . THR B 1 211 ? 4.095   19.503  -8.746  1.00 32.57 ? 1188 THR B N     1 
ATOM   3871 C  CA    . THR B 1 211 ? 4.782   20.581  -9.450  1.00 33.04 ? 1188 THR B CA    1 
ATOM   3872 C  C     . THR B 1 211 ? 4.332   20.434  -10.902 1.00 31.83 ? 1188 THR B C     1 
ATOM   3873 O  O     . THR B 1 211 ? 4.241   21.407  -11.642 1.00 32.43 ? 1188 THR B O     1 
ATOM   3874 C  CB    . THR B 1 211 ? 6.348   20.433  -9.447  1.00 33.95 ? 1188 THR B CB    1 
ATOM   3875 O  OG1   . THR B 1 211 ? 6.836   20.286  -8.113  1.00 35.87 ? 1188 THR B OG1   1 
ATOM   3876 C  CG2   . THR B 1 211 ? 7.002   21.690  -10.051 1.00 37.26 ? 1188 THR B CG2   1 
ATOM   3877 N  N     . SER B 1 212 ? 4.060   19.197  -11.303 1.00 30.61 ? 1189 SER B N     1 
ATOM   3878 C  CA    . SER B 1 212 ? 3.637   18.929  -12.665 1.00 31.99 ? 1189 SER B CA    1 
ATOM   3879 C  C     . SER B 1 212 ? 2.284   19.533  -13.016 1.00 31.80 ? 1189 SER B C     1 
ATOM   3880 O  O     . SER B 1 212 ? 2.094   20.017  -14.134 1.00 32.37 ? 1189 SER B O     1 
ATOM   3881 C  CB    . SER B 1 212 ? 3.626   17.430  -12.917 1.00 33.57 ? 1189 SER B CB    1 
ATOM   3882 O  OG    . SER B 1 212 ? 4.961   16.965  -12.986 1.00 40.26 ? 1189 SER B OG    1 
ATOM   3883 N  N     . SER B 1 213 ? 1.336   19.512  -12.082 1.00 29.41 ? 1190 SER B N     1 
ATOM   3884 C  CA    . SER B 1 213 ? 0.049   20.105  -12.395 1.00 29.47 ? 1190 SER B CA    1 
ATOM   3885 C  C     . SER B 1 213 ? 0.234   21.627  -12.462 1.00 28.63 ? 1190 SER B C     1 
ATOM   3886 O  O     . SER B 1 213 ? -0.427  22.298  -13.259 1.00 26.90 ? 1190 SER B O     1 
ATOM   3887 C  CB    . SER B 1 213 ? -1.036  19.688  -11.381 1.00 29.87 ? 1190 SER B CB    1 
ATOM   3888 O  OG    . SER B 1 213 ? -0.703  19.991  -10.046 1.00 27.04 ? 1190 SER B OG    1 
ATOM   3889 N  N     . ASP B 1 214 ? 1.137   22.167  -11.644 1.00 27.93 ? 1191 ASP B N     1 
ATOM   3890 C  CA    . ASP B 1 214 ? 1.416   23.609  -11.687 1.00 29.68 ? 1191 ASP B CA    1 
ATOM   3891 C  C     . ASP B 1 214 ? 1.984   23.979  -13.061 1.00 28.54 ? 1191 ASP B C     1 
ATOM   3892 O  O     . ASP B 1 214 ? 1.704   25.052  -13.597 1.00 26.10 ? 1191 ASP B O     1 
ATOM   3893 C  CB    . ASP B 1 214 ? 2.426   24.018  -10.610 1.00 29.56 ? 1191 ASP B CB    1 
ATOM   3894 C  CG    . ASP B 1 214 ? 1.778   24.245  -9.260  1.00 32.01 ? 1191 ASP B CG    1 
ATOM   3895 O  OD1   . ASP B 1 214 ? 0.530   24.342  -9.200  1.00 33.84 ? 1191 ASP B OD1   1 
ATOM   3896 O  OD2   . ASP B 1 214 ? 2.521   24.342  -8.257  1.00 31.84 ? 1191 ASP B OD2   1 
ATOM   3897 N  N     . MET B 1 215 ? 2.783   23.079  -13.619 1.00 28.89 ? 1192 MET B N     1 
ATOM   3898 C  CA    . MET B 1 215 ? 3.394   23.297  -14.926 1.00 31.10 ? 1192 MET B CA    1 
ATOM   3899 C  C     . MET B 1 215 ? 2.316   23.358  -16.010 1.00 32.01 ? 1192 MET B C     1 
ATOM   3900 O  O     . MET B 1 215 ? 2.447   24.084  -16.997 1.00 32.65 ? 1192 MET B O     1 
ATOM   3901 C  CB    . MET B 1 215 ? 4.396   22.178  -15.223 1.00 28.46 ? 1192 MET B CB    1 
ATOM   3902 C  CG    . MET B 1 215 ? 5.096   22.323  -16.555 1.00 32.55 ? 1192 MET B CG    1 
ATOM   3903 S  SD    . MET B 1 215 ? 5.914   23.920  -16.794 1.00 33.64 ? 1192 MET B SD    1 
ATOM   3904 C  CE    . MET B 1 215 ? 7.292   23.731  -15.646 1.00 31.82 ? 1192 MET B CE    1 
ATOM   3905 N  N     . TRP B 1 216 ? 1.252   22.588  -15.822 1.00 30.66 ? 1193 TRP B N     1 
ATOM   3906 C  CA    . TRP B 1 216 ? 0.158   22.599  -16.767 1.00 31.60 ? 1193 TRP B CA    1 
ATOM   3907 C  C     . TRP B 1 216 ? -0.462  23.996  -16.701 1.00 32.16 ? 1193 TRP B C     1 
ATOM   3908 O  O     . TRP B 1 216 ? -0.734  24.627  -17.723 1.00 32.56 ? 1193 TRP B O     1 
ATOM   3909 C  CB    . TRP B 1 216 ? -0.870  21.537  -16.373 1.00 32.61 ? 1193 TRP B CB    1 
ATOM   3910 C  CG    . TRP B 1 216 ? -2.096  21.565  -17.193 1.00 32.39 ? 1193 TRP B CG    1 
ATOM   3911 C  CD1   . TRP B 1 216 ? -3.121  22.458  -17.094 1.00 33.05 ? 1193 TRP B CD1   1 
ATOM   3912 C  CD2   . TRP B 1 216 ? -2.418  20.699  -18.289 1.00 33.57 ? 1193 TRP B CD2   1 
ATOM   3913 N  NE1   . TRP B 1 216 ? -4.063  22.205  -18.064 1.00 36.29 ? 1193 TRP B NE1   1 
ATOM   3914 C  CE2   . TRP B 1 216 ? -3.658  21.131  -18.811 1.00 33.77 ? 1193 TRP B CE2   1 
ATOM   3915 C  CE3   . TRP B 1 216 ? -1.779  19.600  -18.884 1.00 34.53 ? 1193 TRP B CE3   1 
ATOM   3916 C  CZ2   . TRP B 1 216 ? -4.276  20.502  -19.907 1.00 34.18 ? 1193 TRP B CZ2   1 
ATOM   3917 C  CZ3   . TRP B 1 216 ? -2.395  18.970  -19.978 1.00 32.77 ? 1193 TRP B CZ3   1 
ATOM   3918 C  CH2   . TRP B 1 216 ? -3.627  19.425  -20.474 1.00 30.97 ? 1193 TRP B CH2   1 
ATOM   3919 N  N     . SER B 1 217 ? -0.682  24.476  -15.482 1.00 31.35 ? 1194 SER B N     1 
ATOM   3920 C  CA    . SER B 1 217 ? -1.258  25.797  -15.282 1.00 30.81 ? 1194 SER B CA    1 
ATOM   3921 C  C     . SER B 1 217 ? -0.370  26.849  -15.923 1.00 31.47 ? 1194 SER B C     1 
ATOM   3922 O  O     . SER B 1 217 ? -0.869  27.836  -16.477 1.00 31.01 ? 1194 SER B O     1 
ATOM   3923 C  CB    . SER B 1 217 ? -1.402  26.100  -13.793 1.00 30.02 ? 1194 SER B CB    1 
ATOM   3924 O  OG    . SER B 1 217 ? -2.163  25.093  -13.148 1.00 34.02 ? 1194 SER B OG    1 
ATOM   3925 N  N     . PHE B 1 218 ? 0.943   26.636  -15.843 1.00 29.68 ? 1195 PHE B N     1 
ATOM   3926 C  CA    . PHE B 1 218 ? 1.901   27.558  -16.427 1.00 30.09 ? 1195 PHE B CA    1 
ATOM   3927 C  C     . PHE B 1 218 ? 1.679   27.638  -17.941 1.00 32.16 ? 1195 PHE B C     1 
ATOM   3928 O  O     . PHE B 1 218 ? 1.724   28.722  -18.548 1.00 30.38 ? 1195 PHE B O     1 
ATOM   3929 C  CB    . PHE B 1 218 ? 3.323   27.094  -16.150 1.00 31.23 ? 1195 PHE B CB    1 
ATOM   3930 C  CG    . PHE B 1 218 ? 4.370   27.950  -16.797 1.00 31.45 ? 1195 PHE B CG    1 
ATOM   3931 C  CD1   . PHE B 1 218 ? 4.538   29.282  -16.411 1.00 32.29 ? 1195 PHE B CD1   1 
ATOM   3932 C  CD2   . PHE B 1 218 ? 5.179   27.434  -17.798 1.00 30.33 ? 1195 PHE B CD2   1 
ATOM   3933 C  CE1   . PHE B 1 218 ? 5.493   30.087  -17.008 1.00 29.91 ? 1195 PHE B CE1   1 
ATOM   3934 C  CE2   . PHE B 1 218 ? 6.145   28.234  -18.411 1.00 32.36 ? 1195 PHE B CE2   1 
ATOM   3935 C  CZ    . PHE B 1 218 ? 6.301   29.567  -18.011 1.00 32.36 ? 1195 PHE B CZ    1 
ATOM   3936 N  N     . GLY B 1 219 ? 1.439   26.483  -18.554 1.00 31.21 ? 1196 GLY B N     1 
ATOM   3937 C  CA    . GLY B 1 219 ? 1.194   26.477  -19.978 1.00 31.63 ? 1196 GLY B CA    1 
ATOM   3938 C  C     . GLY B 1 219 ? -0.026  27.335  -20.291 1.00 31.30 ? 1196 GLY B C     1 
ATOM   3939 O  O     . GLY B 1 219 ? -0.074  28.049  -21.293 1.00 31.57 ? 1196 GLY B O     1 
ATOM   3940 N  N     . VAL B 1 220 ? -1.019  27.276  -19.415 1.00 30.79 ? 1197 VAL B N     1 
ATOM   3941 C  CA    . VAL B 1 220 ? -2.251  28.025  -19.606 1.00 30.60 ? 1197 VAL B CA    1 
ATOM   3942 C  C     . VAL B 1 220 ? -1.987  29.505  -19.463 1.00 32.97 ? 1197 VAL B C     1 
ATOM   3943 O  O     . VAL B 1 220 ? -2.611  30.330  -20.140 1.00 32.84 ? 1197 VAL B O     1 
ATOM   3944 C  CB    . VAL B 1 220 ? -3.349  27.618  -18.576 1.00 28.95 ? 1197 VAL B CB    1 
ATOM   3945 C  CG1   . VAL B 1 220 ? -4.636  28.377  -18.857 1.00 25.82 ? 1197 VAL B CG1   1 
ATOM   3946 C  CG2   . VAL B 1 220 ? -3.603  26.130  -18.650 1.00 27.33 ? 1197 VAL B CG2   1 
ATOM   3947 N  N     . VAL B 1 221 ? -1.061  29.851  -18.575 1.00 33.76 ? 1198 VAL B N     1 
ATOM   3948 C  CA    . VAL B 1 221 ? -0.750  31.252  -18.374 1.00 32.71 ? 1198 VAL B CA    1 
ATOM   3949 C  C     . VAL B 1 221 ? -0.084  31.786  -19.644 1.00 31.64 ? 1198 VAL B C     1 
ATOM   3950 O  O     . VAL B 1 221 ? -0.375  32.898  -20.079 1.00 30.01 ? 1198 VAL B O     1 
ATOM   3951 C  CB    . VAL B 1 221 ? 0.160   31.457  -17.119 1.00 33.45 ? 1198 VAL B CB    1 
ATOM   3952 C  CG1   . VAL B 1 221 ? 0.510   32.931  -16.950 1.00 33.22 ? 1198 VAL B CG1   1 
ATOM   3953 C  CG2   . VAL B 1 221 ? -0.560  30.974  -15.869 1.00 29.52 ? 1198 VAL B CG2   1 
ATOM   3954 N  N     . LEU B 1 222 ? 0.802   30.990  -20.234 1.00 31.12 ? 1199 LEU B N     1 
ATOM   3955 C  CA    . LEU B 1 222 ? 1.485   31.391  -21.453 1.00 32.25 ? 1199 LEU B CA    1 
ATOM   3956 C  C     . LEU B 1 222 ? 0.441   31.700  -22.514 1.00 34.53 ? 1199 LEU B C     1 
ATOM   3957 O  O     . LEU B 1 222 ? 0.540   32.680  -23.258 1.00 33.74 ? 1199 LEU B O     1 
ATOM   3958 C  CB    . LEU B 1 222 ? 2.405   30.267  -21.941 1.00 29.92 ? 1199 LEU B CB    1 
ATOM   3959 C  CG    . LEU B 1 222 ? 3.605   30.014  -21.027 1.00 29.87 ? 1199 LEU B CG    1 
ATOM   3960 C  CD1   . LEU B 1 222 ? 4.604   29.103  -21.720 1.00 26.11 ? 1199 LEU B CD1   1 
ATOM   3961 C  CD2   . LEU B 1 222 ? 4.256   31.339  -20.667 1.00 25.67 ? 1199 LEU B CD2   1 
ATOM   3962 N  N     . TRP B 1 223 ? -0.566  30.840  -22.569 1.00 35.94 ? 1200 TRP B N     1 
ATOM   3963 C  CA    . TRP B 1 223 ? -1.659  30.992  -23.503 1.00 35.99 ? 1200 TRP B CA    1 
ATOM   3964 C  C     . TRP B 1 223 ? -2.388  32.288  -23.148 1.00 36.53 ? 1200 TRP B C     1 
ATOM   3965 O  O     . TRP B 1 223 ? -2.785  33.052  -24.023 1.00 38.88 ? 1200 TRP B O     1 
ATOM   3966 C  CB    . TRP B 1 223 ? -2.590  29.787  -23.374 1.00 35.31 ? 1200 TRP B CB    1 
ATOM   3967 C  CG    . TRP B 1 223 ? -3.818  29.856  -24.217 1.00 35.00 ? 1200 TRP B CG    1 
ATOM   3968 C  CD1   . TRP B 1 223 ? -3.971  29.397  -25.505 1.00 35.51 ? 1200 TRP B CD1   1 
ATOM   3969 C  CD2   . TRP B 1 223 ? -5.069  30.442  -23.844 1.00 33.38 ? 1200 TRP B CD2   1 
ATOM   3970 N  NE1   . TRP B 1 223 ? -5.245  29.670  -25.952 1.00 35.68 ? 1200 TRP B NE1   1 
ATOM   3971 C  CE2   . TRP B 1 223 ? -5.939  30.311  -24.955 1.00 34.12 ? 1200 TRP B CE2   1 
ATOM   3972 C  CE3   . TRP B 1 223 ? -5.541  31.071  -22.678 1.00 33.61 ? 1200 TRP B CE3   1 
ATOM   3973 C  CZ2   . TRP B 1 223 ? -7.257  30.789  -24.936 1.00 32.90 ? 1200 TRP B CZ2   1 
ATOM   3974 C  CZ3   . TRP B 1 223 ? -6.854  31.551  -22.657 1.00 34.59 ? 1200 TRP B CZ3   1 
ATOM   3975 C  CH2   . TRP B 1 223 ? -7.697  31.405  -23.784 1.00 33.09 ? 1200 TRP B CH2   1 
ATOM   3976 N  N     . GLU B 1 224 ? -2.564  32.538  -21.860 1.00 36.18 ? 1201 GLU B N     1 
ATOM   3977 C  CA    . GLU B 1 224 ? -3.232  33.760  -21.447 1.00 38.03 ? 1201 GLU B CA    1 
ATOM   3978 C  C     . GLU B 1 224 ? -2.437  34.957  -21.968 1.00 38.68 ? 1201 GLU B C     1 
ATOM   3979 O  O     . GLU B 1 224 ? -2.996  35.923  -22.500 1.00 38.04 ? 1201 GLU B O     1 
ATOM   3980 C  CB    . GLU B 1 224 ? -3.331  33.846  -19.916 1.00 37.11 ? 1201 GLU B CB    1 
ATOM   3981 C  CG    . GLU B 1 224 ? -4.498  33.077  -19.302 1.00 36.89 ? 1201 GLU B CG    1 
ATOM   3982 C  CD    . GLU B 1 224 ? -4.578  33.243  -17.785 1.00 38.07 ? 1201 GLU B CD    1 
ATOM   3983 O  OE1   . GLU B 1 224 ? -3.825  32.547  -17.065 1.00 37.72 ? 1201 GLU B OE1   1 
ATOM   3984 O  OE2   . GLU B 1 224 ? -5.384  34.077  -17.309 1.00 35.45 ? 1201 GLU B OE2   1 
ATOM   3985 N  N     . ILE B 1 225 ? -1.122  34.883  -21.816 1.00 38.70 ? 1202 ILE B N     1 
ATOM   3986 C  CA    . ILE B 1 225 ? -0.254  35.962  -22.259 1.00 38.21 ? 1202 ILE B CA    1 
ATOM   3987 C  C     . ILE B 1 225 ? -0.349  36.190  -23.767 1.00 40.14 ? 1202 ILE B C     1 
ATOM   3988 O  O     . ILE B 1 225 ? -0.562  37.320  -24.210 1.00 39.61 ? 1202 ILE B O     1 
ATOM   3989 C  CB    . ILE B 1 225 ? 1.205   35.675  -21.883 1.00 35.00 ? 1202 ILE B CB    1 
ATOM   3990 C  CG1   . ILE B 1 225 ? 1.364   35.745  -20.364 1.00 32.08 ? 1202 ILE B CG1   1 
ATOM   3991 C  CG2   . ILE B 1 225 ? 2.127   36.651  -22.594 1.00 34.35 ? 1202 ILE B CG2   1 
ATOM   3992 C  CD1   . ILE B 1 225 ? 2.667   35.143  -19.870 1.00 30.87 ? 1202 ILE B CD1   1 
ATOM   3993 N  N     . THR B 1 226 ? -0.198  35.124  -24.552 1.00 39.63 ? 1203 THR B N     1 
ATOM   3994 C  CA    . THR B 1 226 ? -0.251  35.248  -26.003 1.00 40.53 ? 1203 THR B CA    1 
ATOM   3995 C  C     . THR B 1 226 ? -1.648  35.464  -26.577 1.00 42.58 ? 1203 THR B C     1 
ATOM   3996 O  O     . THR B 1 226 ? -1.804  35.598  -27.796 1.00 44.17 ? 1203 THR B O     1 
ATOM   3997 C  CB    . THR B 1 226 ? 0.332   34.025  -26.704 1.00 38.11 ? 1203 THR B CB    1 
ATOM   3998 O  OG1   . THR B 1 226 ? -0.448  32.885  -26.358 1.00 36.53 ? 1203 THR B OG1   1 
ATOM   3999 C  CG2   . THR B 1 226 ? 1.786   33.809  -26.304 1.00 36.48 ? 1203 THR B CG2   1 
ATOM   4000 N  N     . SER B 1 227 ? -2.662  35.494  -25.720 1.00 42.06 ? 1204 SER B N     1 
ATOM   4001 C  CA    . SER B 1 227 ? -4.022  35.704  -26.195 1.00 43.27 ? 1204 SER B CA    1 
ATOM   4002 C  C     . SER B 1 227 ? -4.574  36.956  -25.537 1.00 44.50 ? 1204 SER B C     1 
ATOM   4003 O  O     . SER B 1 227 ? -5.745  37.301  -25.703 1.00 45.06 ? 1204 SER B O     1 
ATOM   4004 C  CB    . SER B 1 227 ? -4.905  34.510  -25.830 1.00 42.63 ? 1204 SER B CB    1 
ATOM   4005 O  OG    . SER B 1 227 ? -5.135  34.463  -24.433 1.00 43.30 ? 1204 SER B OG    1 
ATOM   4006 N  N     . LEU B 1 228 ? -3.713  37.629  -24.786 1.00 45.48 ? 1205 LEU B N     1 
ATOM   4007 C  CA    . LEU B 1 228 ? -4.086  38.838  -24.061 1.00 46.19 ? 1205 LEU B CA    1 
ATOM   4008 C  C     . LEU B 1 228 ? -5.221  38.584  -23.083 1.00 46.34 ? 1205 LEU B C     1 
ATOM   4009 O  O     . LEU B 1 228 ? -6.233  39.280  -23.091 1.00 45.25 ? 1205 LEU B O     1 
ATOM   4010 C  CB    . LEU B 1 228 ? -4.479  39.961  -25.025 1.00 45.39 ? 1205 LEU B CB    1 
ATOM   4011 C  CG    . LEU B 1 228 ? -3.371  40.531  -25.912 1.00 45.51 ? 1205 LEU B CG    1 
ATOM   4012 C  CD1   . LEU B 1 228 ? -3.949  41.702  -26.700 1.00 44.96 ? 1205 LEU B CD1   1 
ATOM   4013 C  CD2   . LEU B 1 228 ? -2.177  40.980  -25.071 1.00 43.34 ? 1205 LEU B CD2   1 
ATOM   4014 N  N     . ALA B 1 229 ? -5.036  37.576  -22.241 1.00 48.69 ? 1206 ALA B N     1 
ATOM   4015 C  CA    . ALA B 1 229 ? -6.012  37.214  -21.216 1.00 51.10 ? 1206 ALA B CA    1 
ATOM   4016 C  C     . ALA B 1 229 ? -7.381  36.859  -21.768 1.00 52.37 ? 1206 ALA B C     1 
ATOM   4017 O  O     . ALA B 1 229 ? -8.409  37.256  -21.229 1.00 51.72 ? 1206 ALA B O     1 
ATOM   4018 C  CB    . ALA B 1 229 ? -6.142  38.332  -20.190 1.00 48.96 ? 1206 ALA B CB    1 
ATOM   4019 N  N     . GLU B 1 230 ? -7.392  36.115  -22.857 1.00 54.42 ? 1207 GLU B N     1 
ATOM   4020 C  CA    . GLU B 1 230 ? -8.645  35.669  -23.432 1.00 57.21 ? 1207 GLU B CA    1 
ATOM   4021 C  C     . GLU B 1 230 ? -9.134  34.631  -22.417 1.00 58.66 ? 1207 GLU B C     1 
ATOM   4022 O  O     . GLU B 1 230 ? -8.325  34.010  -21.716 1.00 57.86 ? 1207 GLU B O     1 
ATOM   4023 C  CB    . GLU B 1 230 ? -8.369  34.972  -24.766 1.00 59.15 ? 1207 GLU B CB    1 
ATOM   4024 C  CG    . GLU B 1 230 ? -9.549  34.839  -25.697 1.00 60.06 ? 1207 GLU B CG    1 
ATOM   4025 C  CD    . GLU B 1 230 ? -9.864  36.148  -26.393 1.00 63.50 ? 1207 GLU B CD    1 
ATOM   4026 O  OE1   . GLU B 1 230 ? -10.716 36.914  -25.881 1.00 62.40 ? 1207 GLU B OE1   1 
ATOM   4027 O  OE2   . GLU B 1 230 ? -9.241  36.418  -27.448 1.00 64.94 ? 1207 GLU B OE2   1 
ATOM   4028 N  N     . GLN B 1 231 ? -10.443 34.435  -22.329 1.00 59.09 ? 1208 GLN B N     1 
ATOM   4029 C  CA    . GLN B 1 231 ? -10.998 33.447  -21.409 1.00 58.27 ? 1208 GLN B CA    1 
ATOM   4030 C  C     . GLN B 1 231 ? -10.713 32.045  -21.933 1.00 56.60 ? 1208 GLN B C     1 
ATOM   4031 O  O     . GLN B 1 231 ? -11.175 31.683  -23.008 1.00 57.07 ? 1208 GLN B O     1 
ATOM   4032 C  CB    . GLN B 1 231 ? -12.505 33.650  -21.301 1.00 60.43 ? 1208 GLN B CB    1 
ATOM   4033 C  CG    . GLN B 1 231 ? -13.292 32.403  -20.936 1.00 64.41 ? 1208 GLN B CG    1 
ATOM   4034 C  CD    . GLN B 1 231 ? -13.081 31.977  -19.504 1.00 66.60 ? 1208 GLN B CD    1 
ATOM   4035 O  OE1   . GLN B 1 231 ? -13.727 31.047  -19.019 1.00 68.53 ? 1208 GLN B OE1   1 
ATOM   4036 N  NE2   . GLN B 1 231 ? -12.172 32.660  -18.810 1.00 68.40 ? 1208 GLN B NE2   1 
ATOM   4037 N  N     . PRO B 1 232 ? -9.949  31.237  -21.186 1.00 55.31 ? 1209 PRO B N     1 
ATOM   4038 C  CA    . PRO B 1 232 ? -9.659  29.882  -21.670 1.00 54.86 ? 1209 PRO B CA    1 
ATOM   4039 C  C     . PRO B 1 232 ? -10.921 29.027  -21.875 1.00 55.00 ? 1209 PRO B C     1 
ATOM   4040 O  O     . PRO B 1 232 ? -11.924 29.195  -21.172 1.00 53.76 ? 1209 PRO B O     1 
ATOM   4041 C  CB    . PRO B 1 232 ? -8.704  29.331  -20.604 1.00 53.33 ? 1209 PRO B CB    1 
ATOM   4042 C  CG    . PRO B 1 232 ? -9.042  30.112  -19.384 1.00 52.61 ? 1209 PRO B CG    1 
ATOM   4043 C  CD    . PRO B 1 232 ? -9.277  31.497  -19.902 1.00 53.66 ? 1209 PRO B CD    1 
ATOM   4044 N  N     . TYR B 1 233 ? -10.852 28.119  -22.847 1.00 54.81 ? 1210 TYR B N     1 
ATOM   4045 C  CA    . TYR B 1 233 ? -11.964 27.230  -23.192 1.00 55.46 ? 1210 TYR B CA    1 
ATOM   4046 C  C     . TYR B 1 233 ? -13.253 28.018  -23.361 1.00 57.60 ? 1210 TYR B C     1 
ATOM   4047 O  O     . TYR B 1 233 ? -14.329 27.565  -22.972 1.00 56.58 ? 1210 TYR B O     1 
ATOM   4048 C  CB    . TYR B 1 233 ? -12.154 26.136  -22.130 1.00 50.45 ? 1210 TYR B CB    1 
ATOM   4049 C  CG    . TYR B 1 233 ? -10.916 25.299  -21.919 1.00 47.31 ? 1210 TYR B CG    1 
ATOM   4050 C  CD1   . TYR B 1 233 ? -10.498 24.367  -22.868 1.00 46.18 ? 1210 TYR B CD1   1 
ATOM   4051 C  CD2   . TYR B 1 233 ? -10.113 25.499  -20.800 1.00 45.42 ? 1210 TYR B CD2   1 
ATOM   4052 C  CE1   . TYR B 1 233 ? -9.289  23.661  -22.702 1.00 45.58 ? 1210 TYR B CE1   1 
ATOM   4053 C  CE2   . TYR B 1 233 ? -8.921  24.812  -20.629 1.00 42.10 ? 1210 TYR B CE2   1 
ATOM   4054 C  CZ    . TYR B 1 233 ? -8.512  23.898  -21.571 1.00 42.76 ? 1210 TYR B CZ    1 
ATOM   4055 O  OH    . TYR B 1 233 ? -7.326  23.232  -21.357 1.00 41.34 ? 1210 TYR B OH    1 
ATOM   4056 N  N     . GLN B 1 234 ? -13.134 29.204  -23.945 1.00 60.98 ? 1211 GLN B N     1 
ATOM   4057 C  CA    . GLN B 1 234 ? -14.296 30.049  -24.182 1.00 62.94 ? 1211 GLN B CA    1 
ATOM   4058 C  C     . GLN B 1 234 ? -15.374 29.231  -24.875 1.00 63.81 ? 1211 GLN B C     1 
ATOM   4059 O  O     . GLN B 1 234 ? -15.100 28.522  -25.843 1.00 63.98 ? 1211 GLN B O     1 
ATOM   4060 C  CB    . GLN B 1 234 ? -13.923 31.239  -25.068 1.00 63.35 ? 1211 GLN B CB    1 
ATOM   4061 C  CG    . GLN B 1 234 ? -15.127 32.057  -25.511 1.00 65.28 ? 1211 GLN B CG    1 
ATOM   4062 C  CD    . GLN B 1 234 ? -15.971 32.530  -24.340 1.00 65.82 ? 1211 GLN B CD    1 
ATOM   4063 O  OE1   . GLN B 1 234 ? -15.539 33.365  -23.547 1.00 66.52 ? 1211 GLN B OE1   1 
ATOM   4064 N  NE2   . GLN B 1 234 ? -17.178 31.990  -24.222 1.00 66.15 ? 1211 GLN B NE2   1 
ATOM   4065 N  N     . GLY B 1 235 ? -16.598 29.333  -24.377 1.00 63.89 ? 1212 GLY B N     1 
ATOM   4066 C  CA    . GLY B 1 235 ? -17.685 28.585  -24.975 1.00 64.95 ? 1212 GLY B CA    1 
ATOM   4067 C  C     . GLY B 1 235 ? -18.105 27.425  -24.096 1.00 65.71 ? 1212 GLY B C     1 
ATOM   4068 O  O     . GLY B 1 235 ? -19.245 27.374  -23.625 1.00 67.51 ? 1212 GLY B O     1 
ATOM   4069 N  N     . LEU B 1 236 ? -17.186 26.492  -23.868 1.00 64.18 ? 1213 LEU B N     1 
ATOM   4070 C  CA    . LEU B 1 236 ? -17.471 25.333  -23.035 1.00 62.53 ? 1213 LEU B CA    1 
ATOM   4071 C  C     . LEU B 1 236 ? -17.859 25.744  -21.624 1.00 62.22 ? 1213 LEU B C     1 
ATOM   4072 O  O     . LEU B 1 236 ? -17.500 26.824  -21.150 1.00 62.91 ? 1213 LEU B O     1 
ATOM   4073 C  CB    . LEU B 1 236 ? -16.257 24.405  -22.962 1.00 61.92 ? 1213 LEU B CB    1 
ATOM   4074 C  CG    . LEU B 1 236 ? -15.826 23.655  -24.222 1.00 62.39 ? 1213 LEU B CG    1 
ATOM   4075 C  CD1   . LEU B 1 236 ? -16.950 22.735  -24.677 1.00 64.40 ? 1213 LEU B CD1   1 
ATOM   4076 C  CD2   . LEU B 1 236 ? -15.478 24.639  -25.312 1.00 62.70 ? 1213 LEU B CD2   1 
ATOM   4077 N  N     . SER B 1 237 ? -18.603 24.870  -20.961 1.00 61.27 ? 1214 SER B N     1 
ATOM   4078 C  CA    . SER B 1 237 ? -19.034 25.091  -19.590 1.00 59.46 ? 1214 SER B CA    1 
ATOM   4079 C  C     . SER B 1 237 ? -18.075 24.274  -18.742 1.00 58.70 ? 1214 SER B C     1 
ATOM   4080 O  O     . SER B 1 237 ? -17.481 23.312  -19.225 1.00 57.10 ? 1214 SER B O     1 
ATOM   4081 C  CB    . SER B 1 237 ? -20.456 24.563  -19.398 1.00 58.12 ? 1214 SER B CB    1 
ATOM   4082 O  OG    . SER B 1 237 ? -20.531 23.184  -19.732 1.00 54.85 ? 1214 SER B OG    1 
ATOM   4083 N  N     . ASN B 1 238 ? -17.930 24.656  -17.484 1.00 58.08 ? 1215 ASN B N     1 
ATOM   4084 C  CA    . ASN B 1 238 ? -17.041 23.960  -16.573 1.00 57.63 ? 1215 ASN B CA    1 
ATOM   4085 C  C     . ASN B 1 238 ? -17.053 22.447  -16.778 1.00 58.64 ? 1215 ASN B C     1 
ATOM   4086 O  O     . ASN B 1 238 ? -16.011 21.817  -16.963 1.00 57.59 ? 1215 ASN B O     1 
ATOM   4087 C  CB    . ASN B 1 238 ? -17.456 24.313  -15.152 1.00 54.19 ? 1215 ASN B CB    1 
ATOM   4088 C  CG    . ASN B 1 238 ? -17.366 25.797  -14.890 1.00 52.90 ? 1215 ASN B CG    1 
ATOM   4089 O  OD1   . ASN B 1 238 ? -17.870 26.299  -13.885 1.00 51.39 ? 1215 ASN B OD1   1 
ATOM   4090 N  ND2   . ASN B 1 238 ? -16.706 26.515  -15.798 1.00 51.03 ? 1215 ASN B ND2   1 
ATOM   4091 N  N     . GLU B 1 239 ? -18.248 21.876  -16.748 1.00 59.86 ? 1216 GLU B N     1 
ATOM   4092 C  CA    . GLU B 1 239 ? -18.431 20.441  -16.904 1.00 61.66 ? 1216 GLU B CA    1 
ATOM   4093 C  C     . GLU B 1 239 ? -17.867 19.952  -18.225 1.00 60.56 ? 1216 GLU B C     1 
ATOM   4094 O  O     . GLU B 1 239 ? -17.272 18.881  -18.309 1.00 58.82 ? 1216 GLU B O     1 
ATOM   4095 C  CB    . GLU B 1 239 ? -19.920 20.139  -16.822 1.00 65.10 ? 1216 GLU B CB    1 
ATOM   4096 C  CG    . GLU B 1 239 ? -20.604 20.999  -15.768 1.00 70.99 ? 1216 GLU B CG    1 
ATOM   4097 C  CD    . GLU B 1 239 ? -22.101 20.790  -15.710 1.00 75.03 ? 1216 GLU B CD    1 
ATOM   4098 O  OE1   . GLU B 1 239 ? -22.783 21.075  -16.727 1.00 76.83 ? 1216 GLU B OE1   1 
ATOM   4099 O  OE2   . GLU B 1 239 ? -22.592 20.340  -14.645 1.00 76.85 ? 1216 GLU B OE2   1 
ATOM   4100 N  N     . GLN B 1 240 ? -18.064 20.752  -19.260 1.00 60.92 ? 1217 GLN B N     1 
ATOM   4101 C  CA    . GLN B 1 240 ? -17.570 20.417  -20.584 1.00 60.89 ? 1217 GLN B CA    1 
ATOM   4102 C  C     . GLN B 1 240 ? -16.051 20.461  -20.598 1.00 59.68 ? 1217 GLN B C     1 
ATOM   4103 O  O     . GLN B 1 240 ? -15.395 19.611  -21.202 1.00 58.67 ? 1217 GLN B O     1 
ATOM   4104 C  CB    . GLN B 1 240 ? -18.113 21.405  -21.612 1.00 63.01 ? 1217 GLN B CB    1 
ATOM   4105 C  CG    . GLN B 1 240 ? -19.590 21.240  -21.937 1.00 66.30 ? 1217 GLN B CG    1 
ATOM   4106 C  CD    . GLN B 1 240 ? -20.125 22.380  -22.791 1.00 67.35 ? 1217 GLN B CD    1 
ATOM   4107 O  OE1   . GLN B 1 240 ? -20.269 23.507  -22.316 1.00 67.56 ? 1217 GLN B OE1   1 
ATOM   4108 N  NE2   . GLN B 1 240 ? -20.407 22.093  -24.058 1.00 65.84 ? 1217 GLN B NE2   1 
ATOM   4109 N  N     . VAL B 1 241 ? -15.498 21.468  -19.930 1.00 58.47 ? 1218 VAL B N     1 
ATOM   4110 C  CA    . VAL B 1 241 ? -14.057 21.622  -19.864 1.00 57.06 ? 1218 VAL B CA    1 
ATOM   4111 C  C     . VAL B 1 241 ? -13.471 20.425  -19.135 1.00 56.99 ? 1218 VAL B C     1 
ATOM   4112 O  O     . VAL B 1 241 ? -12.475 19.841  -19.570 1.00 54.95 ? 1218 VAL B O     1 
ATOM   4113 C  CB    . VAL B 1 241 ? -13.681 22.912  -19.140 1.00 55.79 ? 1218 VAL B CB    1 
ATOM   4114 C  CG1   . VAL B 1 241 ? -12.172 22.963  -18.921 1.00 55.05 ? 1218 VAL B CG1   1 
ATOM   4115 C  CG2   . VAL B 1 241 ? -14.146 24.108  -19.965 1.00 54.37 ? 1218 VAL B CG2   1 
ATOM   4116 N  N     . LEU B 1 242 ? -14.105 20.058  -18.025 1.00 58.08 ? 1219 LEU B N     1 
ATOM   4117 C  CA    . LEU B 1 242 ? -13.655 18.917  -17.235 1.00 58.88 ? 1219 LEU B CA    1 
ATOM   4118 C  C     . LEU B 1 242 ? -13.494 17.710  -18.135 1.00 58.33 ? 1219 LEU B C     1 
ATOM   4119 O  O     . LEU B 1 242 ? -12.422 17.105  -18.204 1.00 58.45 ? 1219 LEU B O     1 
ATOM   4120 C  CB    . LEU B 1 242 ? -14.655 18.567  -16.131 1.00 58.55 ? 1219 LEU B CB    1 
ATOM   4121 C  CG    . LEU B 1 242 ? -14.840 19.526  -14.962 1.00 60.04 ? 1219 LEU B CG    1 
ATOM   4122 C  CD1   . LEU B 1 242 ? -15.147 18.693  -13.725 1.00 60.75 ? 1219 LEU B CD1   1 
ATOM   4123 C  CD2   . LEU B 1 242 ? -13.589 20.353  -14.725 1.00 60.77 ? 1219 LEU B CD2   1 
ATOM   4124 N  N     . LYS B 1 243 ? -14.573 17.370  -18.827 1.00 57.10 ? 1220 LYS B N     1 
ATOM   4125 C  CA    . LYS B 1 243 ? -14.569 16.231  -19.719 1.00 56.45 ? 1220 LYS B CA    1 
ATOM   4126 C  C     . LYS B 1 243 ? -13.570 16.418  -20.847 1.00 54.42 ? 1220 LYS B C     1 
ATOM   4127 O  O     . LYS B 1 243 ? -12.742 15.541  -21.098 1.00 53.26 ? 1220 LYS B O     1 
ATOM   4128 C  CB    . LYS B 1 243 ? -15.979 15.994  -20.281 1.00 58.19 ? 1220 LYS B CB    1 
ATOM   4129 C  CG    . LYS B 1 243 ? -16.103 14.707  -21.094 1.00 62.23 ? 1220 LYS B CG    1 
ATOM   4130 C  CD    . LYS B 1 243 ? -17.554 14.324  -21.398 1.00 65.26 ? 1220 LYS B CD    1 
ATOM   4131 C  CE    . LYS B 1 243 ? -17.650 12.927  -22.037 1.00 67.29 ? 1220 LYS B CE    1 
ATOM   4132 N  NZ    . LYS B 1 243 ? -17.167 11.811  -21.142 1.00 67.95 ? 1220 LYS B NZ    1 
ATOM   4133 N  N     . PHE B 1 244 ? -13.635 17.559  -21.526 1.00 53.55 ? 1221 PHE B N     1 
ATOM   4134 C  CA    . PHE B 1 244 ? -12.726 17.807  -22.640 1.00 52.74 ? 1221 PHE B CA    1 
ATOM   4135 C  C     . PHE B 1 244 ? -11.278 17.567  -22.259 1.00 53.41 ? 1221 PHE B C     1 
ATOM   4136 O  O     . PHE B 1 244 ? -10.590 16.790  -22.920 1.00 53.66 ? 1221 PHE B O     1 
ATOM   4137 C  CB    . PHE B 1 244 ? -12.871 19.230  -23.190 1.00 50.86 ? 1221 PHE B CB    1 
ATOM   4138 C  CG    . PHE B 1 244 ? -11.930 19.533  -24.335 1.00 47.61 ? 1221 PHE B CG    1 
ATOM   4139 C  CD1   . PHE B 1 244 ? -11.849 18.674  -25.434 1.00 47.18 ? 1221 PHE B CD1   1 
ATOM   4140 C  CD2   . PHE B 1 244 ? -11.127 20.672  -24.315 1.00 47.42 ? 1221 PHE B CD2   1 
ATOM   4141 C  CE1   . PHE B 1 244 ? -10.984 18.946  -26.497 1.00 45.68 ? 1221 PHE B CE1   1 
ATOM   4142 C  CE2   . PHE B 1 244 ? -10.253 20.959  -25.373 1.00 46.97 ? 1221 PHE B CE2   1 
ATOM   4143 C  CZ    . PHE B 1 244 ? -10.183 20.093  -26.468 1.00 46.97 ? 1221 PHE B CZ    1 
ATOM   4144 N  N     . VAL B 1 245 ? -10.816 18.230  -21.199 1.00 52.76 ? 1222 VAL B N     1 
ATOM   4145 C  CA    . VAL B 1 245 ? -9.432  18.062  -20.757 1.00 53.12 ? 1222 VAL B CA    1 
ATOM   4146 C  C     . VAL B 1 245 ? -9.155  16.633  -20.275 1.00 54.08 ? 1222 VAL B C     1 
ATOM   4147 O  O     . VAL B 1 245 ? -8.150  16.024  -20.665 1.00 53.72 ? 1222 VAL B O     1 
ATOM   4148 C  CB    . VAL B 1 245 ? -9.048  19.050  -19.617 1.00 50.87 ? 1222 VAL B CB    1 
ATOM   4149 C  CG1   . VAL B 1 245 ? -7.637  18.755  -19.135 1.00 47.53 ? 1222 VAL B CG1   1 
ATOM   4150 C  CG2   . VAL B 1 245 ? -9.117  20.479  -20.114 1.00 47.55 ? 1222 VAL B CG2   1 
ATOM   4151 N  N     . MET B 1 246 ? -10.034 16.095  -19.433 1.00 54.66 ? 1223 MET B N     1 
ATOM   4152 C  CA    . MET B 1 246 ? -9.822  14.737  -18.944 1.00 56.63 ? 1223 MET B CA    1 
ATOM   4153 C  C     . MET B 1 246 ? -9.697  13.726  -20.072 1.00 57.65 ? 1223 MET B C     1 
ATOM   4154 O  O     . MET B 1 246 ? -9.089  12.673  -19.883 1.00 57.03 ? 1223 MET B O     1 
ATOM   4155 C  CB    . MET B 1 246 ? -10.943 14.309  -17.999 1.00 56.47 ? 1223 MET B CB    1 
ATOM   4156 C  CG    . MET B 1 246 ? -10.585 14.450  -16.533 1.00 58.27 ? 1223 MET B CG    1 
ATOM   4157 S  SD    . MET B 1 246 ? -12.017 14.329  -15.451 1.00 59.91 ? 1223 MET B SD    1 
ATOM   4158 C  CE    . MET B 1 246 ? -11.949 12.575  -14.997 1.00 60.34 ? 1223 MET B CE    1 
ATOM   4159 N  N     . ASP B 1 247 ? -10.256 14.041  -21.243 1.00 58.57 ? 1224 ASP B N     1 
ATOM   4160 C  CA    . ASP B 1 247 ? -10.195 13.127  -22.381 1.00 59.07 ? 1224 ASP B CA    1 
ATOM   4161 C  C     . ASP B 1 247 ? -9.058  13.371  -23.358 1.00 58.05 ? 1224 ASP B C     1 
ATOM   4162 O  O     . ASP B 1 247 ? -9.058  12.836  -24.467 1.00 57.54 ? 1224 ASP B O     1 
ATOM   4163 C  CB    . ASP B 1 247 ? -11.527 13.125  -23.121 1.00 62.45 ? 1224 ASP B CB    1 
ATOM   4164 C  CG    . ASP B 1 247 ? -12.640 12.540  -22.281 1.00 66.54 ? 1224 ASP B CG    1 
ATOM   4165 O  OD1   . ASP B 1 247 ? -12.519 11.362  -21.878 1.00 69.39 ? 1224 ASP B OD1   1 
ATOM   4166 O  OD2   . ASP B 1 247 ? -13.629 13.253  -22.007 1.00 69.48 ? 1224 ASP B OD2   1 
ATOM   4167 N  N     . GLY B 1 248 ? -8.086  14.180  -22.946 1.00 57.61 ? 1225 GLY B N     1 
ATOM   4168 C  CA    . GLY B 1 248 ? -6.942  14.454  -23.800 1.00 55.42 ? 1225 GLY B CA    1 
ATOM   4169 C  C     . GLY B 1 248 ? -6.942  15.789  -24.516 1.00 54.22 ? 1225 GLY B C     1 
ATOM   4170 O  O     . GLY B 1 248 ? -5.997  16.098  -25.256 1.00 52.65 ? 1225 GLY B O     1 
ATOM   4171 N  N     . GLY B 1 249 ? -7.984  16.588  -24.298 1.00 52.89 ? 1226 GLY B N     1 
ATOM   4172 C  CA    . GLY B 1 249 ? -8.059  17.877  -24.961 1.00 54.43 ? 1226 GLY B CA    1 
ATOM   4173 C  C     . GLY B 1 249 ? -7.167  18.967  -24.380 1.00 54.61 ? 1226 GLY B C     1 
ATOM   4174 O  O     . GLY B 1 249 ? -6.599  18.817  -23.295 1.00 53.80 ? 1226 GLY B O     1 
ATOM   4175 N  N     . TYR B 1 250 ? -7.034  20.062  -25.127 1.00 54.03 ? 1227 TYR B N     1 
ATOM   4176 C  CA    . TYR B 1 250 ? -6.251  21.220  -24.708 1.00 53.04 ? 1227 TYR B CA    1 
ATOM   4177 C  C     . TYR B 1 250 ? -6.459  22.399  -25.654 1.00 52.59 ? 1227 TYR B C     1 
ATOM   4178 O  O     . TYR B 1 250 ? -6.831  22.234  -26.818 1.00 53.27 ? 1227 TYR B O     1 
ATOM   4179 C  CB    . TYR B 1 250 ? -4.753  20.891  -24.603 1.00 51.97 ? 1227 TYR B CB    1 
ATOM   4180 C  CG    . TYR B 1 250 ? -4.127  20.279  -25.840 1.00 51.11 ? 1227 TYR B CG    1 
ATOM   4181 C  CD1   . TYR B 1 250 ? -3.776  18.926  -25.870 1.00 48.99 ? 1227 TYR B CD1   1 
ATOM   4182 C  CD2   . TYR B 1 250 ? -3.876  21.051  -26.979 1.00 48.85 ? 1227 TYR B CD2   1 
ATOM   4183 C  CE1   . TYR B 1 250 ? -3.191  18.356  -27.002 1.00 48.24 ? 1227 TYR B CE1   1 
ATOM   4184 C  CE2   . TYR B 1 250 ? -3.291  20.494  -28.116 1.00 48.11 ? 1227 TYR B CE2   1 
ATOM   4185 C  CZ    . TYR B 1 250 ? -2.951  19.145  -28.121 1.00 50.10 ? 1227 TYR B CZ    1 
ATOM   4186 O  OH    . TYR B 1 250 ? -2.386  18.582  -29.249 1.00 51.55 ? 1227 TYR B OH    1 
ATOM   4187 N  N     . LEU B 1 251 ? -6.212  23.591  -25.130 1.00 51.25 ? 1228 LEU B N     1 
ATOM   4188 C  CA    . LEU B 1 251 ? -6.372  24.841  -25.854 1.00 50.03 ? 1228 LEU B CA    1 
ATOM   4189 C  C     . LEU B 1 251 ? -5.676  24.935  -27.199 1.00 50.63 ? 1228 LEU B C     1 
ATOM   4190 O  O     . LEU B 1 251 ? -4.683  24.251  -27.448 1.00 49.75 ? 1228 LEU B O     1 
ATOM   4191 C  CB    . LEU B 1 251 ? -5.877  25.979  -24.982 1.00 48.28 ? 1228 LEU B CB    1 
ATOM   4192 C  CG    . LEU B 1 251 ? -6.549  26.036  -23.619 1.00 47.57 ? 1228 LEU B CG    1 
ATOM   4193 C  CD1   . LEU B 1 251 ? -5.685  26.863  -22.691 1.00 47.26 ? 1228 LEU B CD1   1 
ATOM   4194 C  CD2   . LEU B 1 251 ? -7.963  26.612  -23.747 1.00 46.33 ? 1228 LEU B CD2   1 
ATOM   4195 N  N     . ASP B 1 252 ? -6.211  25.799  -28.059 1.00 51.79 ? 1229 ASP B N     1 
ATOM   4196 C  CA    . ASP B 1 252 ? -5.645  26.029  -29.384 1.00 54.40 ? 1229 ASP B CA    1 
ATOM   4197 C  C     . ASP B 1 252 ? -4.580  27.112  -29.258 1.00 55.05 ? 1229 ASP B C     1 
ATOM   4198 O  O     . ASP B 1 252 ? -4.538  27.843  -28.268 1.00 55.33 ? 1229 ASP B O     1 
ATOM   4199 C  CB    . ASP B 1 252 ? -6.706  26.539  -30.375 1.00 55.21 ? 1229 ASP B CB    1 
ATOM   4200 C  CG    . ASP B 1 252 ? -7.869  25.574  -30.566 1.00 56.14 ? 1229 ASP B CG    1 
ATOM   4201 O  OD1   . ASP B 1 252 ? -7.621  24.361  -30.734 1.00 56.64 ? 1229 ASP B OD1   1 
ATOM   4202 O  OD2   . ASP B 1 252 ? -9.033  26.040  -30.568 1.00 54.94 ? 1229 ASP B OD2   1 
ATOM   4203 N  N     . GLN B 1 253 ? -3.722  27.216  -30.260 1.00 55.68 ? 1230 GLN B N     1 
ATOM   4204 C  CA    . GLN B 1 253 ? -2.706  28.246  -30.241 1.00 57.73 ? 1230 GLN B CA    1 
ATOM   4205 C  C     . GLN B 1 253 ? -3.387  29.555  -30.594 1.00 59.71 ? 1230 GLN B C     1 
ATOM   4206 O  O     . GLN B 1 253 ? -4.185  29.614  -31.528 1.00 59.77 ? 1230 GLN B O     1 
ATOM   4207 C  CB    . GLN B 1 253 ? -1.604  27.946  -31.253 1.00 55.33 ? 1230 GLN B CB    1 
ATOM   4208 C  CG    . GLN B 1 253 ? -0.629  26.868  -30.794 1.00 54.10 ? 1230 GLN B CG    1 
ATOM   4209 C  CD    . GLN B 1 253 ? -0.150  27.071  -29.354 1.00 53.32 ? 1230 GLN B CD    1 
ATOM   4210 O  OE1   . GLN B 1 253 ? -0.702  26.491  -28.422 1.00 53.44 ? 1230 GLN B OE1   1 
ATOM   4211 N  NE2   . GLN B 1 253 ? 0.875   27.903  -29.174 1.00 50.94 ? 1230 GLN B NE2   1 
ATOM   4212 N  N     . PRO B 1 254 ? -3.115  30.618  -29.823 1.00 61.84 ? 1231 PRO B N     1 
ATOM   4213 C  CA    . PRO B 1 254 ? -3.751  31.895  -30.143 1.00 63.67 ? 1231 PRO B CA    1 
ATOM   4214 C  C     . PRO B 1 254 ? -3.189  32.475  -31.442 1.00 65.63 ? 1231 PRO B C     1 
ATOM   4215 O  O     . PRO B 1 254 ? -2.240  31.938  -32.021 1.00 65.91 ? 1231 PRO B O     1 
ATOM   4216 C  CB    . PRO B 1 254 ? -3.459  32.750  -28.908 1.00 62.89 ? 1231 PRO B CB    1 
ATOM   4217 C  CG    . PRO B 1 254 ? -2.211  32.168  -28.375 1.00 62.27 ? 1231 PRO B CG    1 
ATOM   4218 C  CD    . PRO B 1 254 ? -2.414  30.690  -28.532 1.00 60.98 ? 1231 PRO B CD    1 
ATOM   4219 N  N     . ASP B 1 255 ? -3.783  33.568  -31.898 1.00 67.71 ? 1232 ASP B N     1 
ATOM   4220 C  CA    . ASP B 1 255 ? -3.372  34.224  -33.133 1.00 69.27 ? 1232 ASP B CA    1 
ATOM   4221 C  C     . ASP B 1 255 ? -1.914  34.708  -33.137 1.00 68.61 ? 1232 ASP B C     1 
ATOM   4222 O  O     . ASP B 1 255 ? -1.482  35.420  -32.228 1.00 68.90 ? 1232 ASP B O     1 
ATOM   4223 C  CB    . ASP B 1 255 ? -4.296  35.415  -33.381 1.00 72.65 ? 1232 ASP B CB    1 
ATOM   4224 C  CG    . ASP B 1 255 ? -4.493  35.712  -34.849 1.00 75.65 ? 1232 ASP B CG    1 
ATOM   4225 O  OD1   . ASP B 1 255 ? -3.572  35.434  -35.646 1.00 79.20 ? 1232 ASP B OD1   1 
ATOM   4226 O  OD2   . ASP B 1 255 ? -5.569  36.239  -35.206 1.00 77.18 ? 1232 ASP B OD2   1 
ATOM   4227 N  N     . ASN B 1 256 ? -1.169  34.321  -34.171 1.00 67.87 ? 1233 ASN B N     1 
ATOM   4228 C  CA    . ASN B 1 256 ? 0.227   34.721  -34.336 1.00 67.42 ? 1233 ASN B CA    1 
ATOM   4229 C  C     . ASN B 1 256 ? 1.144   34.353  -33.190 1.00 65.99 ? 1233 ASN B C     1 
ATOM   4230 O  O     . ASN B 1 256 ? 2.245   34.888  -33.074 1.00 67.31 ? 1233 ASN B O     1 
ATOM   4231 C  CB    . ASN B 1 256 ? 0.331   36.229  -34.594 1.00 68.77 ? 1233 ASN B CB    1 
ATOM   4232 C  CG    . ASN B 1 256 ? 0.051   36.595  -36.048 1.00 69.67 ? 1233 ASN B CG    1 
ATOM   4233 O  OD1   . ASN B 1 256 ? -1.104  36.650  -36.483 1.00 68.84 ? 1233 ASN B OD1   1 
ATOM   4234 N  ND2   . ASN B 1 256 ? 1.118   36.838  -36.810 1.00 69.96 ? 1233 ASN B ND2   1 
ATOM   4235 N  N     . CYS B 1 257 ? 0.693   33.439  -32.345 1.00 63.60 ? 1234 CYS B N     1 
ATOM   4236 C  CA    . CYS B 1 257 ? 1.491   33.007  -31.213 1.00 60.98 ? 1234 CYS B CA    1 
ATOM   4237 C  C     . CYS B 1 257 ? 2.873   32.546  -31.660 1.00 60.45 ? 1234 CYS B C     1 
ATOM   4238 O  O     . CYS B 1 257 ? 3.001   31.666  -32.510 1.00 61.18 ? 1234 CYS B O     1 
ATOM   4239 C  CB    . CYS B 1 257 ? 0.781   31.864  -30.492 1.00 59.72 ? 1234 CYS B CB    1 
ATOM   4240 S  SG    . CYS B 1 257 ? 1.665   31.248  -29.069 1.00 53.66 ? 1234 CYS B SG    1 
ATOM   4241 N  N     . PRO B 1 258 ? 3.930   33.154  -31.109 1.00 59.72 ? 1235 PRO B N     1 
ATOM   4242 C  CA    . PRO B 1 258 ? 5.291   32.756  -31.487 1.00 59.60 ? 1235 PRO B CA    1 
ATOM   4243 C  C     . PRO B 1 258 ? 5.400   31.241  -31.338 1.00 60.51 ? 1235 PRO B C     1 
ATOM   4244 O  O     . PRO B 1 258 ? 4.957   30.690  -30.333 1.00 60.35 ? 1235 PRO B O     1 
ATOM   4245 C  CB    . PRO B 1 258 ? 6.147   33.510  -30.479 1.00 58.20 ? 1235 PRO B CB    1 
ATOM   4246 C  CG    . PRO B 1 258 ? 5.357   34.783  -30.271 1.00 57.06 ? 1235 PRO B CG    1 
ATOM   4247 C  CD    . PRO B 1 258 ? 3.941   34.284  -30.162 1.00 57.33 ? 1235 PRO B CD    1 
ATOM   4248 N  N     . GLU B 1 259 ? 5.978   30.557  -32.320 1.00 62.58 ? 1236 GLU B N     1 
ATOM   4249 C  CA    . GLU B 1 259 ? 6.055   29.106  -32.209 1.00 64.29 ? 1236 GLU B CA    1 
ATOM   4250 C  C     . GLU B 1 259 ? 6.958   28.638  -31.078 1.00 63.41 ? 1236 GLU B C     1 
ATOM   4251 O  O     . GLU B 1 259 ? 6.786   27.540  -30.555 1.00 63.99 ? 1236 GLU B O     1 
ATOM   4252 C  CB    . GLU B 1 259 ? 6.464   28.460  -33.536 1.00 66.39 ? 1236 GLU B CB    1 
ATOM   4253 C  CG    . GLU B 1 259 ? 7.857   28.755  -34.023 1.00 69.29 ? 1236 GLU B CG    1 
ATOM   4254 C  CD    . GLU B 1 259 ? 8.228   27.835  -35.173 1.00 72.62 ? 1236 GLU B CD    1 
ATOM   4255 O  OE1   . GLU B 1 259 ? 8.340   26.611  -34.922 1.00 72.19 ? 1236 GLU B OE1   1 
ATOM   4256 O  OE2   . GLU B 1 259 ? 8.389   28.325  -36.319 1.00 73.04 ? 1236 GLU B OE2   1 
ATOM   4257 N  N     . ARG B 1 260 ? 7.915   29.470  -30.694 1.00 61.67 ? 1237 ARG B N     1 
ATOM   4258 C  CA    . ARG B 1 260 ? 8.807   29.116  -29.603 1.00 61.00 ? 1237 ARG B CA    1 
ATOM   4259 C  C     . ARG B 1 260 ? 7.956   28.928  -28.341 1.00 60.03 ? 1237 ARG B C     1 
ATOM   4260 O  O     . ARG B 1 260 ? 8.165   28.000  -27.554 1.00 60.42 ? 1237 ARG B O     1 
ATOM   4261 C  CB    . ARG B 1 260 ? 9.824   30.236  -29.389 1.00 60.99 ? 1237 ARG B CB    1 
ATOM   4262 C  CG    . ARG B 1 260 ? 10.899  29.878  -28.405 1.00 61.94 ? 1237 ARG B CG    1 
ATOM   4263 C  CD    . ARG B 1 260 ? 11.915  30.981  -28.281 1.00 62.38 ? 1237 ARG B CD    1 
ATOM   4264 N  NE    . ARG B 1 260 ? 12.965  30.606  -27.345 1.00 62.89 ? 1237 ARG B NE    1 
ATOM   4265 C  CZ    . ARG B 1 260 ? 13.911  31.436  -26.928 1.00 63.54 ? 1237 ARG B CZ    1 
ATOM   4266 N  NH1   . ARG B 1 260 ? 13.928  32.683  -27.374 1.00 65.65 ? 1237 ARG B NH1   1 
ATOM   4267 N  NH2   . ARG B 1 260 ? 14.829  31.028  -26.061 1.00 62.53 ? 1237 ARG B NH2   1 
ATOM   4268 N  N     . VAL B 1 261 ? 6.992   29.828  -28.165 1.00 57.38 ? 1238 VAL B N     1 
ATOM   4269 C  CA    . VAL B 1 261 ? 6.084   29.785  -27.023 1.00 55.21 ? 1238 VAL B CA    1 
ATOM   4270 C  C     . VAL B 1 261 ? 5.136   28.625  -27.225 1.00 54.33 ? 1238 VAL B C     1 
ATOM   4271 O  O     . VAL B 1 261 ? 4.730   27.961  -26.278 1.00 54.80 ? 1238 VAL B O     1 
ATOM   4272 C  CB    . VAL B 1 261 ? 5.234   31.083  -26.910 1.00 54.76 ? 1238 VAL B CB    1 
ATOM   4273 C  CG1   . VAL B 1 261 ? 4.315   31.003  -25.714 1.00 52.92 ? 1238 VAL B CG1   1 
ATOM   4274 C  CG2   . VAL B 1 261 ? 6.133   32.294  -26.787 1.00 53.47 ? 1238 VAL B CG2   1 
ATOM   4275 N  N     . THR B 1 262 ? 4.783   28.389  -28.477 1.00 53.17 ? 1239 THR B N     1 
ATOM   4276 C  CA    . THR B 1 262 ? 3.885   27.301  -28.790 1.00 52.28 ? 1239 THR B CA    1 
ATOM   4277 C  C     . THR B 1 262 ? 4.539   25.994  -28.352 1.00 50.93 ? 1239 THR B C     1 
ATOM   4278 O  O     . THR B 1 262 ? 3.858   25.058  -27.944 1.00 50.99 ? 1239 THR B O     1 
ATOM   4279 C  CB    . THR B 1 262 ? 3.586   27.264  -30.297 1.00 52.05 ? 1239 THR B CB    1 
ATOM   4280 O  OG1   . THR B 1 262 ? 2.952   28.489  -30.688 1.00 51.60 ? 1239 THR B OG1   1 
ATOM   4281 C  CG2   . THR B 1 262 ? 2.677   26.096  -30.627 1.00 52.16 ? 1239 THR B CG2   1 
ATOM   4282 N  N     . ASP B 1 263 ? 5.866   25.946  -28.435 1.00 49.69 ? 1240 ASP B N     1 
ATOM   4283 C  CA    . ASP B 1 263 ? 6.615   24.755  -28.054 1.00 50.29 ? 1240 ASP B CA    1 
ATOM   4284 C  C     . ASP B 1 263 ? 6.496   24.513  -26.557 1.00 49.19 ? 1240 ASP B C     1 
ATOM   4285 O  O     . ASP B 1 263 ? 6.271   23.385  -26.109 1.00 50.44 ? 1240 ASP B O     1 
ATOM   4286 C  CB    . ASP B 1 263 ? 8.101   24.898  -28.438 1.00 50.94 ? 1240 ASP B CB    1 
ATOM   4287 C  CG    . ASP B 1 263 ? 8.317   24.998  -29.949 1.00 51.92 ? 1240 ASP B CG    1 
ATOM   4288 O  OD1   . ASP B 1 263 ? 7.476   24.480  -30.720 1.00 53.46 ? 1240 ASP B OD1   1 
ATOM   4289 O  OD2   . ASP B 1 263 ? 9.339   25.578  -30.368 1.00 51.78 ? 1240 ASP B OD2   1 
ATOM   4290 N  N     . LEU B 1 264 ? 6.650   25.578  -25.785 1.00 45.87 ? 1241 LEU B N     1 
ATOM   4291 C  CA    . LEU B 1 264 ? 6.553   25.468  -24.342 1.00 44.59 ? 1241 LEU B CA    1 
ATOM   4292 C  C     . LEU B 1 264 ? 5.165   24.961  -23.944 1.00 43.60 ? 1241 LEU B C     1 
ATOM   4293 O  O     . LEU B 1 264 ? 5.053   24.012  -23.166 1.00 42.17 ? 1241 LEU B O     1 
ATOM   4294 C  CB    . LEU B 1 264 ? 6.884   26.823  -23.705 1.00 44.75 ? 1241 LEU B CB    1 
ATOM   4295 C  CG    . LEU B 1 264 ? 8.353   27.255  -23.915 1.00 44.22 ? 1241 LEU B CG    1 
ATOM   4296 C  CD1   . LEU B 1 264 ? 8.560   28.703  -23.541 1.00 45.76 ? 1241 LEU B CD1   1 
ATOM   4297 C  CD2   . LEU B 1 264 ? 9.270   26.386  -23.076 1.00 44.64 ? 1241 LEU B CD2   1 
ATOM   4298 N  N     . MET B 1 265 ? 4.115   25.576  -24.482 1.00 43.08 ? 1242 MET B N     1 
ATOM   4299 C  CA    . MET B 1 265 ? 2.753   25.140  -24.184 1.00 44.24 ? 1242 MET B CA    1 
ATOM   4300 C  C     . MET B 1 265 ? 2.586   23.638  -24.454 1.00 45.53 ? 1242 MET B C     1 
ATOM   4301 O  O     . MET B 1 265 ? 1.965   22.915  -23.665 1.00 45.53 ? 1242 MET B O     1 
ATOM   4302 C  CB    . MET B 1 265 ? 1.736   25.928  -25.026 1.00 44.24 ? 1242 MET B CB    1 
ATOM   4303 C  CG    . MET B 1 265 ? 1.320   27.266  -24.425 1.00 43.84 ? 1242 MET B CG    1 
ATOM   4304 S  SD    . MET B 1 265 ? 0.083   28.187  -25.395 1.00 44.84 ? 1242 MET B SD    1 
ATOM   4305 C  CE    . MET B 1 265 ? 1.109   29.387  -26.199 1.00 41.98 ? 1242 MET B CE    1 
ATOM   4306 N  N     . ARG B 1 266 ? 3.145   23.169  -25.567 1.00 45.48 ? 1243 ARG B N     1 
ATOM   4307 C  CA    . ARG B 1 266 ? 3.049   21.759  -25.921 1.00 45.42 ? 1243 ARG B CA    1 
ATOM   4308 C  C     . ARG B 1 266 ? 3.720   20.903  -24.848 1.00 44.24 ? 1243 ARG B C     1 
ATOM   4309 O  O     . ARG B 1 266 ? 3.201   19.859  -24.471 1.00 45.01 ? 1243 ARG B O     1 
ATOM   4310 C  CB    . ARG B 1 266 ? 3.694   21.495  -27.293 1.00 43.59 ? 1243 ARG B CB    1 
ATOM   4311 N  N     . MET B 1 267 ? 4.873   21.342  -24.357 1.00 43.45 ? 1244 MET B N     1 
ATOM   4312 C  CA    . MET B 1 267 ? 5.574   20.598  -23.308 1.00 44.55 ? 1244 MET B CA    1 
ATOM   4313 C  C     . MET B 1 267 ? 4.744   20.600  -22.025 1.00 44.58 ? 1244 MET B C     1 
ATOM   4314 O  O     . MET B 1 267 ? 4.721   19.615  -21.281 1.00 44.28 ? 1244 MET B O     1 
ATOM   4315 C  CB    . MET B 1 267 ? 6.926   21.243  -22.960 1.00 45.12 ? 1244 MET B CB    1 
ATOM   4316 C  CG    . MET B 1 267 ? 7.921   21.407  -24.098 1.00 47.05 ? 1244 MET B CG    1 
ATOM   4317 S  SD    . MET B 1 267 ? 9.370   22.413  -23.616 1.00 51.11 ? 1244 MET B SD    1 
ATOM   4318 C  CE    . MET B 1 267 ? 10.502  21.150  -22.993 1.00 47.78 ? 1244 MET B CE    1 
ATOM   4319 N  N     . CYS B 1 268 ? 4.074   21.721  -21.771 1.00 43.51 ? 1245 CYS B N     1 
ATOM   4320 C  CA    . CYS B 1 268 ? 3.263   21.884  -20.571 1.00 42.66 ? 1245 CYS B CA    1 
ATOM   4321 C  C     . CYS B 1 268 ? 1.997   21.062  -20.573 1.00 42.78 ? 1245 CYS B C     1 
ATOM   4322 O  O     . CYS B 1 268 ? 1.482   20.692  -19.513 1.00 41.01 ? 1245 CYS B O     1 
ATOM   4323 C  CB    . CYS B 1 268 ? 2.884   23.354  -20.377 1.00 42.93 ? 1245 CYS B CB    1 
ATOM   4324 S  SG    . CYS B 1 268 ? 4.254   24.421  -19.897 1.00 41.94 ? 1245 CYS B SG    1 
ATOM   4325 N  N     . TRP B 1 269 ? 1.485   20.772  -21.762 1.00 42.59 ? 1246 TRP B N     1 
ATOM   4326 C  CA    . TRP B 1 269 ? 0.245   20.025  -21.826 1.00 42.19 ? 1246 TRP B CA    1 
ATOM   4327 C  C     . TRP B 1 269 ? 0.367   18.544  -22.169 1.00 42.25 ? 1246 TRP B C     1 
ATOM   4328 O  O     . TRP B 1 269 ? -0.574  17.940  -22.679 1.00 43.10 ? 1246 TRP B O     1 
ATOM   4329 C  CB    . TRP B 1 269 ? -0.741  20.737  -22.763 1.00 37.81 ? 1246 TRP B CB    1 
ATOM   4330 C  CG    . TRP B 1 269 ? -1.077  22.129  -22.293 1.00 36.21 ? 1246 TRP B CG    1 
ATOM   4331 C  CD1   . TRP B 1 269 ? -1.065  22.580  -21.002 1.00 37.92 ? 1246 TRP B CD1   1 
ATOM   4332 C  CD2   . TRP B 1 269 ? -1.487  23.250  -23.100 1.00 36.67 ? 1246 TRP B CD2   1 
ATOM   4333 N  NE1   . TRP B 1 269 ? -1.437  23.908  -20.954 1.00 36.68 ? 1246 TRP B NE1   1 
ATOM   4334 C  CE2   . TRP B 1 269 ? -1.704  24.340  -22.226 1.00 35.10 ? 1246 TRP B CE2   1 
ATOM   4335 C  CE3   . TRP B 1 269 ? -1.697  23.435  -24.477 1.00 36.49 ? 1246 TRP B CE3   1 
ATOM   4336 C  CZ2   . TRP B 1 269 ? -2.120  25.600  -22.683 1.00 34.15 ? 1246 TRP B CZ2   1 
ATOM   4337 C  CZ3   . TRP B 1 269 ? -2.115  24.700  -24.933 1.00 36.11 ? 1246 TRP B CZ3   1 
ATOM   4338 C  CH2   . TRP B 1 269 ? -2.322  25.758  -24.033 1.00 34.56 ? 1246 TRP B CH2   1 
ATOM   4339 N  N     . GLN B 1 270 ? 1.524   17.958  -21.891 1.00 41.51 ? 1247 GLN B N     1 
ATOM   4340 C  CA    . GLN B 1 270 ? 1.695   16.532  -22.129 1.00 42.09 ? 1247 GLN B CA    1 
ATOM   4341 C  C     . GLN B 1 270 ? 0.691   15.867  -21.200 1.00 41.18 ? 1247 GLN B C     1 
ATOM   4342 O  O     . GLN B 1 270 ? 0.520   16.298  -20.061 1.00 42.90 ? 1247 GLN B O     1 
ATOM   4343 C  CB    . GLN B 1 270 ? 3.115   16.106  -21.774 1.00 43.27 ? 1247 GLN B CB    1 
ATOM   4344 C  CG    . GLN B 1 270 ? 4.129   16.601  -22.773 1.00 46.86 ? 1247 GLN B CG    1 
ATOM   4345 C  CD    . GLN B 1 270 ? 3.978   15.920  -24.122 1.00 48.84 ? 1247 GLN B CD    1 
ATOM   4346 O  OE1   . GLN B 1 270 ? 4.327   16.493  -25.153 1.00 50.69 ? 1247 GLN B OE1   1 
ATOM   4347 N  NE2   . GLN B 1 270 ? 3.469   14.683  -24.121 1.00 47.99 ? 1247 GLN B NE2   1 
ATOM   4348 N  N     . PHE B 1 271 ? 0.022   14.825  -21.672 1.00 40.95 ? 1248 PHE B N     1 
ATOM   4349 C  CA    . PHE B 1 271 ? -0.991  14.172  -20.854 1.00 40.64 ? 1248 PHE B CA    1 
ATOM   4350 C  C     . PHE B 1 271 ? -0.420  13.536  -19.598 1.00 40.58 ? 1248 PHE B C     1 
ATOM   4351 O  O     . PHE B 1 271 ? -1.032  13.582  -18.528 1.00 39.67 ? 1248 PHE B O     1 
ATOM   4352 C  CB    . PHE B 1 271 ? -1.735  13.105  -21.666 1.00 37.10 ? 1248 PHE B CB    1 
ATOM   4353 C  CG    . PHE B 1 271 ? -2.890  12.512  -20.926 1.00 35.32 ? 1248 PHE B CG    1 
ATOM   4354 C  CD1   . PHE B 1 271 ? -4.089  13.209  -20.818 1.00 34.88 ? 1248 PHE B CD1   1 
ATOM   4355 C  CD2   . PHE B 1 271 ? -2.749  11.312  -20.241 1.00 33.00 ? 1248 PHE B CD2   1 
ATOM   4356 C  CE1   . PHE B 1 271 ? -5.136  12.725  -20.030 1.00 35.19 ? 1248 PHE B CE1   1 
ATOM   4357 C  CE2   . PHE B 1 271 ? -3.785  10.819  -19.450 1.00 34.29 ? 1248 PHE B CE2   1 
ATOM   4358 C  CZ    . PHE B 1 271 ? -4.985  11.531  -19.343 1.00 33.92 ? 1248 PHE B CZ    1 
ATOM   4359 N  N     . ASN B 1 272 ? 0.757   12.940  -19.751 1.00 42.47 ? 1249 ASN B N     1 
ATOM   4360 C  CA    . ASN B 1 272 ? 1.454   12.270  -18.663 1.00 44.00 ? 1249 ASN B CA    1 
ATOM   4361 C  C     . ASN B 1 272 ? 2.271   13.309  -17.905 1.00 45.62 ? 1249 ASN B C     1 
ATOM   4362 O  O     . ASN B 1 272 ? 3.224   13.871  -18.451 1.00 45.28 ? 1249 ASN B O     1 
ATOM   4363 C  CB    . ASN B 1 272 ? 2.377   11.204  -19.253 1.00 43.93 ? 1249 ASN B CB    1 
ATOM   4364 C  CG    . ASN B 1 272 ? 3.123   10.412  -18.197 1.00 46.29 ? 1249 ASN B CG    1 
ATOM   4365 O  OD1   . ASN B 1 272 ? 3.958   9.571   -18.527 1.00 46.95 ? 1249 ASN B OD1   1 
ATOM   4366 N  ND2   . ASN B 1 272 ? 2.828   10.673  -16.922 1.00 45.06 ? 1249 ASN B ND2   1 
ATOM   4367 N  N     . PRO B 1 273 ? 1.917   13.570  -16.636 1.00 46.20 ? 1250 PRO B N     1 
ATOM   4368 C  CA    . PRO B 1 273 ? 2.644   14.556  -15.833 1.00 46.62 ? 1250 PRO B CA    1 
ATOM   4369 C  C     . PRO B 1 273 ? 4.172   14.424  -15.823 1.00 47.59 ? 1250 PRO B C     1 
ATOM   4370 O  O     . PRO B 1 273 ? 4.877   15.419  -15.676 1.00 47.55 ? 1250 PRO B O     1 
ATOM   4371 C  CB    . PRO B 1 273 ? 2.002   14.421  -14.443 1.00 47.10 ? 1250 PRO B CB    1 
ATOM   4372 C  CG    . PRO B 1 273 ? 1.324   13.066  -14.464 1.00 46.00 ? 1250 PRO B CG    1 
ATOM   4373 C  CD    . PRO B 1 273 ? 0.819   12.958  -15.865 1.00 46.08 ? 1250 PRO B CD    1 
ATOM   4374 N  N     . ASN B 1 274 ? 4.689   13.211  -15.985 1.00 48.75 ? 1251 ASN B N     1 
ATOM   4375 C  CA    . ASN B 1 274 ? 6.140   13.009  -15.987 1.00 50.29 ? 1251 ASN B CA    1 
ATOM   4376 C  C     . ASN B 1 274 ? 6.748   13.400  -17.318 1.00 50.36 ? 1251 ASN B C     1 
ATOM   4377 O  O     . ASN B 1 274 ? 7.967   13.397  -17.478 1.00 50.67 ? 1251 ASN B O     1 
ATOM   4378 C  CB    . ASN B 1 274 ? 6.490   11.548  -15.700 1.00 51.56 ? 1251 ASN B CB    1 
ATOM   4379 C  CG    . ASN B 1 274 ? 5.868   11.045  -14.414 1.00 53.28 ? 1251 ASN B CG    1 
ATOM   4380 O  OD1   . ASN B 1 274 ? 6.009   11.664  -13.365 1.00 54.16 ? 1251 ASN B OD1   1 
ATOM   4381 N  ND2   . ASN B 1 274 ? 5.178   9.914   -14.490 1.00 54.95 ? 1251 ASN B ND2   1 
ATOM   4382 N  N     . MET B 1 275 ? 5.893   13.731  -18.276 1.00 50.40 ? 1252 MET B N     1 
ATOM   4383 C  CA    . MET B 1 275 ? 6.358   14.122  -19.598 1.00 51.10 ? 1252 MET B CA    1 
ATOM   4384 C  C     . MET B 1 275 ? 6.570   15.632  -19.665 1.00 49.05 ? 1252 MET B C     1 
ATOM   4385 O  O     . MET B 1 275 ? 7.282   16.129  -20.534 1.00 48.83 ? 1252 MET B O     1 
ATOM   4386 C  CB    . MET B 1 275 ? 5.335   13.704  -20.656 1.00 54.99 ? 1252 MET B CB    1 
ATOM   4387 C  CG    . MET B 1 275 ? 5.124   12.201  -20.772 1.00 59.16 ? 1252 MET B CG    1 
ATOM   4388 S  SD    . MET B 1 275 ? 6.449   11.391  -21.664 1.00 65.01 ? 1252 MET B SD    1 
ATOM   4389 C  CE    . MET B 1 275 ? 5.697   11.209  -23.329 1.00 61.24 ? 1252 MET B CE    1 
ATOM   4390 N  N     . ARG B 1 276 ? 5.942   16.355  -18.742 1.00 46.23 ? 1253 ARG B N     1 
ATOM   4391 C  CA    . ARG B 1 276 ? 6.047   17.806  -18.686 1.00 43.98 ? 1253 ARG B CA    1 
ATOM   4392 C  C     . ARG B 1 276 ? 7.394   18.242  -18.136 1.00 42.84 ? 1253 ARG B C     1 
ATOM   4393 O  O     . ARG B 1 276 ? 8.028   17.518  -17.374 1.00 42.52 ? 1253 ARG B O     1 
ATOM   4394 C  CB    . ARG B 1 276 ? 4.943   18.374  -17.797 1.00 43.15 ? 1253 ARG B CB    1 
ATOM   4395 C  CG    . ARG B 1 276 ? 3.554   17.975  -18.245 1.00 42.18 ? 1253 ARG B CG    1 
ATOM   4396 C  CD    . ARG B 1 276 ? 2.500   18.312  -17.224 1.00 39.97 ? 1253 ARG B CD    1 
ATOM   4397 N  NE    . ARG B 1 276 ? 1.282   17.564  -17.511 1.00 40.53 ? 1253 ARG B NE    1 
ATOM   4398 C  CZ    . ARG B 1 276 ? 0.269   17.400  -16.662 1.00 39.76 ? 1253 ARG B CZ    1 
ATOM   4399 N  NH1   . ARG B 1 276 ? 0.306   17.940  -15.447 1.00 34.82 ? 1253 ARG B NH1   1 
ATOM   4400 N  NH2   . ARG B 1 276 ? -0.769  16.653  -17.024 1.00 39.95 ? 1253 ARG B NH2   1 
ATOM   4401 N  N     . PRO B 1 277 ? 7.851   19.440  -18.517 1.00 41.34 ? 1254 PRO B N     1 
ATOM   4402 C  CA    . PRO B 1 277 ? 9.138   19.944  -18.030 1.00 40.91 ? 1254 PRO B CA    1 
ATOM   4403 C  C     . PRO B 1 277 ? 9.035   20.511  -16.612 1.00 40.23 ? 1254 PRO B C     1 
ATOM   4404 O  O     . PRO B 1 277 ? 7.941   20.670  -16.059 1.00 38.92 ? 1254 PRO B O     1 
ATOM   4405 C  CB    . PRO B 1 277 ? 9.481   21.027  -19.037 1.00 40.51 ? 1254 PRO B CB    1 
ATOM   4406 C  CG    . PRO B 1 277 ? 8.133   21.606  -19.345 1.00 41.28 ? 1254 PRO B CG    1 
ATOM   4407 C  CD    . PRO B 1 277 ? 7.266   20.366  -19.505 1.00 42.04 ? 1254 PRO B CD    1 
ATOM   4408 N  N     . THR B 1 278 ? 10.184  20.814  -16.023 1.00 38.40 ? 1255 THR B N     1 
ATOM   4409 C  CA    . THR B 1 278 ? 10.199  21.395  -14.690 1.00 36.47 ? 1255 THR B CA    1 
ATOM   4410 C  C     . THR B 1 278 ? 10.463  22.875  -14.865 1.00 36.78 ? 1255 THR B C     1 
ATOM   4411 O  O     . THR B 1 278 ? 10.987  23.311  -15.900 1.00 36.39 ? 1255 THR B O     1 
ATOM   4412 C  CB    . THR B 1 278 ? 11.325  20.848  -13.814 1.00 34.97 ? 1255 THR B CB    1 
ATOM   4413 O  OG1   . THR B 1 278 ? 12.576  21.126  -14.450 1.00 33.34 ? 1255 THR B OG1   1 
ATOM   4414 C  CG2   . THR B 1 278 ? 11.159  19.351  -13.579 1.00 29.80 ? 1255 THR B CG2   1 
ATOM   4415 N  N     . PHE B 1 279 ? 10.101  23.645  -13.849 1.00 35.61 ? 1256 PHE B N     1 
ATOM   4416 C  CA    . PHE B 1 279 ? 10.305  25.082  -13.901 1.00 34.86 ? 1256 PHE B CA    1 
ATOM   4417 C  C     . PHE B 1 279 ? 11.775  25.447  -14.081 1.00 33.47 ? 1256 PHE B C     1 
ATOM   4418 O  O     . PHE B 1 279 ? 12.087  26.383  -14.811 1.00 32.21 ? 1256 PHE B O     1 
ATOM   4419 C  CB    . PHE B 1 279 ? 9.691   25.743  -12.661 1.00 33.23 ? 1256 PHE B CB    1 
ATOM   4420 C  CG    . PHE B 1 279 ? 8.192   25.824  -12.728 1.00 31.69 ? 1256 PHE B CG    1 
ATOM   4421 C  CD1   . PHE B 1 279 ? 7.574   26.679  -13.645 1.00 29.32 ? 1256 PHE B CD1   1 
ATOM   4422 C  CD2   . PHE B 1 279 ? 7.394   24.978  -11.959 1.00 30.31 ? 1256 PHE B CD2   1 
ATOM   4423 C  CE1   . PHE B 1 279 ? 6.184   26.680  -13.799 1.00 31.78 ? 1256 PHE B CE1   1 
ATOM   4424 C  CE2   . PHE B 1 279 ? 5.997   24.973  -12.106 1.00 30.53 ? 1256 PHE B CE2   1 
ATOM   4425 C  CZ    . PHE B 1 279 ? 5.394   25.820  -13.024 1.00 29.19 ? 1256 PHE B CZ    1 
ATOM   4426 N  N     . LEU B 1 280 ? 12.675  24.715  -13.432 1.00 33.61 ? 1257 LEU B N     1 
ATOM   4427 C  CA    . LEU B 1 280 ? 14.098  24.988  -13.602 1.00 35.34 ? 1257 LEU B CA    1 
ATOM   4428 C  C     . LEU B 1 280 ? 14.440  24.797  -15.074 1.00 36.79 ? 1257 LEU B C     1 
ATOM   4429 O  O     . LEU B 1 280 ? 15.142  25.613  -15.666 1.00 38.65 ? 1257 LEU B O     1 
ATOM   4430 C  CB    . LEU B 1 280 ? 14.947  24.048  -12.745 1.00 33.12 ? 1257 LEU B CB    1 
ATOM   4431 C  CG    . LEU B 1 280 ? 15.026  24.413  -11.260 1.00 33.41 ? 1257 LEU B CG    1 
ATOM   4432 C  CD1   . LEU B 1 280 ? 15.780  23.352  -10.470 1.00 29.51 ? 1257 LEU B CD1   1 
ATOM   4433 C  CD2   . LEU B 1 280 ? 15.710  25.764  -11.134 1.00 34.16 ? 1257 LEU B CD2   1 
ATOM   4434 N  N     . GLU B 1 281 ? 13.936  23.721  -15.664 1.00 36.82 ? 1258 GLU B N     1 
ATOM   4435 C  CA    . GLU B 1 281 ? 14.179  23.449  -17.067 1.00 39.15 ? 1258 GLU B CA    1 
ATOM   4436 C  C     . GLU B 1 281 ? 13.665  24.586  -17.933 1.00 39.38 ? 1258 GLU B C     1 
ATOM   4437 O  O     . GLU B 1 281 ? 14.296  24.957  -18.924 1.00 41.03 ? 1258 GLU B O     1 
ATOM   4438 C  CB    . GLU B 1 281 ? 13.499  22.141  -17.480 1.00 41.20 ? 1258 GLU B CB    1 
ATOM   4439 C  CG    . GLU B 1 281 ? 14.205  20.904  -16.940 1.00 45.97 ? 1258 GLU B CG    1 
ATOM   4440 C  CD    . GLU B 1 281 ? 13.430  19.594  -17.155 1.00 49.26 ? 1258 GLU B CD    1 
ATOM   4441 O  OE1   . GLU B 1 281 ? 13.983  18.531  -16.781 1.00 50.19 ? 1258 GLU B OE1   1 
ATOM   4442 O  OE2   . GLU B 1 281 ? 12.288  19.622  -17.684 1.00 48.82 ? 1258 GLU B OE2   1 
ATOM   4443 N  N     . ILE B 1 282 ? 12.518  25.144  -17.568 1.00 38.24 ? 1259 ILE B N     1 
ATOM   4444 C  CA    . ILE B 1 282 ? 11.951  26.236  -18.355 1.00 37.86 ? 1259 ILE B CA    1 
ATOM   4445 C  C     . ILE B 1 282 ? 12.887  27.434  -18.350 1.00 39.13 ? 1259 ILE B C     1 
ATOM   4446 O  O     . ILE B 1 282 ? 13.174  28.022  -19.399 1.00 38.11 ? 1259 ILE B O     1 
ATOM   4447 C  CB    . ILE B 1 282 ? 10.569  26.680  -17.813 1.00 36.07 ? 1259 ILE B CB    1 
ATOM   4448 C  CG1   . ILE B 1 282 ? 9.582   25.514  -17.879 1.00 34.74 ? 1259 ILE B CG1   1 
ATOM   4449 C  CG2   . ILE B 1 282 ? 10.034  27.845  -18.637 1.00 31.13 ? 1259 ILE B CG2   1 
ATOM   4450 C  CD1   . ILE B 1 282 ? 9.230   25.093  -19.302 1.00 31.54 ? 1259 ILE B CD1   1 
ATOM   4451 N  N     . VAL B 1 283 ? 13.356  27.794  -17.161 1.00 40.49 ? 1260 VAL B N     1 
ATOM   4452 C  CA    . VAL B 1 283 ? 14.270  28.912  -17.029 1.00 42.10 ? 1260 VAL B CA    1 
ATOM   4453 C  C     . VAL B 1 283 ? 15.535  28.606  -17.825 1.00 45.05 ? 1260 VAL B C     1 
ATOM   4454 O  O     . VAL B 1 283 ? 16.003  29.434  -18.600 1.00 46.51 ? 1260 VAL B O     1 
ATOM   4455 C  CB    . VAL B 1 283 ? 14.668  29.153  -15.561 1.00 40.71 ? 1260 VAL B CB    1 
ATOM   4456 C  CG1   . VAL B 1 283 ? 15.619  30.350  -15.478 1.00 36.75 ? 1260 VAL B CG1   1 
ATOM   4457 C  CG2   . VAL B 1 283 ? 13.424  29.373  -14.707 1.00 35.96 ? 1260 VAL B CG2   1 
ATOM   4458 N  N     . ASN B 1 284 ? 16.083  27.409  -17.633 1.00 47.46 ? 1261 ASN B N     1 
ATOM   4459 C  CA    . ASN B 1 284 ? 17.301  27.023  -18.331 1.00 49.25 ? 1261 ASN B CA    1 
ATOM   4460 C  C     . ASN B 1 284 ? 17.159  27.196  -19.840 1.00 49.37 ? 1261 ASN B C     1 
ATOM   4461 O  O     . ASN B 1 284 ? 18.121  27.554  -20.524 1.00 50.59 ? 1261 ASN B O     1 
ATOM   4462 C  CB    . ASN B 1 284 ? 17.671  25.575  -17.995 1.00 50.99 ? 1261 ASN B CB    1 
ATOM   4463 C  CG    . ASN B 1 284 ? 18.987  25.148  -18.632 1.00 52.91 ? 1261 ASN B CG    1 
ATOM   4464 O  OD1   . ASN B 1 284 ? 20.029  25.769  -18.410 1.00 53.96 ? 1261 ASN B OD1   1 
ATOM   4465 N  ND2   . ASN B 1 284 ? 18.943  24.083  -19.429 1.00 51.68 ? 1261 ASN B ND2   1 
ATOM   4466 N  N     . LEU B 1 285 ? 15.959  26.950  -20.354 1.00 48.74 ? 1262 LEU B N     1 
ATOM   4467 C  CA    . LEU B 1 285 ? 15.691  27.085  -21.782 1.00 49.02 ? 1262 LEU B CA    1 
ATOM   4468 C  C     . LEU B 1 285 ? 15.618  28.548  -22.230 1.00 49.51 ? 1262 LEU B C     1 
ATOM   4469 O  O     . LEU B 1 285 ? 15.673  28.838  -23.427 1.00 49.15 ? 1262 LEU B O     1 
ATOM   4470 C  CB    . LEU B 1 285 ? 14.366  26.407  -22.143 1.00 50.30 ? 1262 LEU B CB    1 
ATOM   4471 C  CG    . LEU B 1 285 ? 14.268  24.916  -22.512 1.00 54.06 ? 1262 LEU B CG    1 
ATOM   4472 C  CD1   . LEU B 1 285 ? 14.823  24.004  -21.398 1.00 55.29 ? 1262 LEU B CD1   1 
ATOM   4473 C  CD2   . LEU B 1 285 ? 12.795  24.597  -22.787 1.00 52.43 ? 1262 LEU B CD2   1 
ATOM   4474 N  N     . LEU B 1 286 ? 15.496  29.473  -21.282 1.00 48.88 ? 1263 LEU B N     1 
ATOM   4475 C  CA    . LEU B 1 286 ? 15.376  30.887  -21.635 1.00 48.08 ? 1263 LEU B CA    1 
ATOM   4476 C  C     . LEU B 1 286 ? 16.461  31.778  -21.051 1.00 49.46 ? 1263 LEU B C     1 
ATOM   4477 O  O     . LEU B 1 286 ? 16.523  32.967  -21.371 1.00 48.43 ? 1263 LEU B O     1 
ATOM   4478 C  CB    . LEU B 1 286 ? 14.024  31.429  -21.169 1.00 45.69 ? 1263 LEU B CB    1 
ATOM   4479 C  CG    . LEU B 1 286 ? 12.764  30.635  -21.486 1.00 43.05 ? 1263 LEU B CG    1 
ATOM   4480 C  CD1   . LEU B 1 286 ? 11.619  31.153  -20.636 1.00 39.83 ? 1263 LEU B CD1   1 
ATOM   4481 C  CD2   . LEU B 1 286 ? 12.450  30.748  -22.958 1.00 42.02 ? 1263 LEU B CD2   1 
ATOM   4482 N  N     . LYS B 1 287 ? 17.310  31.209  -20.203 1.00 51.22 ? 1264 LYS B N     1 
ATOM   4483 C  CA    . LYS B 1 287 ? 18.368  31.967  -19.544 1.00 54.36 ? 1264 LYS B CA    1 
ATOM   4484 C  C     . LYS B 1 287 ? 19.180  32.918  -20.427 1.00 55.51 ? 1264 LYS B C     1 
ATOM   4485 O  O     . LYS B 1 287 ? 19.546  34.012  -19.986 1.00 54.56 ? 1264 LYS B O     1 
ATOM   4486 C  CB    . LYS B 1 287 ? 19.316  31.005  -18.814 1.00 55.74 ? 1264 LYS B CB    1 
ATOM   4487 C  CG    . LYS B 1 287 ? 20.102  30.062  -19.718 1.00 57.83 ? 1264 LYS B CG    1 
ATOM   4488 C  CD    . LYS B 1 287 ? 20.937  29.077  -18.896 1.00 58.80 ? 1264 LYS B CD    1 
ATOM   4489 C  CE    . LYS B 1 287 ? 21.791  28.183  -19.787 1.00 59.56 ? 1264 LYS B CE    1 
ATOM   4490 N  NZ    . LYS B 1 287 ? 20.990  27.547  -20.875 1.00 62.13 ? 1264 LYS B NZ    1 
ATOM   4491 N  N     . ASP B 1 288 ? 19.460  32.518  -21.663 1.00 56.84 ? 1265 ASP B N     1 
ATOM   4492 C  CA    . ASP B 1 288 ? 20.260  33.359  -22.552 1.00 59.72 ? 1265 ASP B CA    1 
ATOM   4493 C  C     . ASP B 1 288 ? 19.586  34.634  -23.035 1.00 60.99 ? 1265 ASP B C     1 
ATOM   4494 O  O     . ASP B 1 288 ? 20.184  35.708  -22.996 1.00 62.27 ? 1265 ASP B O     1 
ATOM   4495 C  CB    . ASP B 1 288 ? 20.733  32.571  -23.782 1.00 60.13 ? 1265 ASP B CB    1 
ATOM   4496 C  CG    . ASP B 1 288 ? 21.767  31.509  -23.440 1.00 61.23 ? 1265 ASP B CG    1 
ATOM   4497 O  OD1   . ASP B 1 288 ? 22.524  31.703  -22.463 1.00 61.29 ? 1265 ASP B OD1   1 
ATOM   4498 O  OD2   . ASP B 1 288 ? 21.836  30.488  -24.160 1.00 61.20 ? 1265 ASP B OD2   1 
ATOM   4499 N  N     . ASP B 1 289 ? 18.342  34.517  -23.483 1.00 61.37 ? 1266 ASP B N     1 
ATOM   4500 C  CA    . ASP B 1 289 ? 17.618  35.660  -24.013 1.00 60.66 ? 1266 ASP B CA    1 
ATOM   4501 C  C     . ASP B 1 289 ? 16.841  36.452  -22.975 1.00 58.67 ? 1266 ASP B C     1 
ATOM   4502 O  O     . ASP B 1 289 ? 15.657  36.739  -23.150 1.00 59.33 ? 1266 ASP B O     1 
ATOM   4503 C  CB    . ASP B 1 289 ? 16.706  35.153  -25.108 1.00 64.52 ? 1266 ASP B CB    1 
ATOM   4504 C  CG    . ASP B 1 289 ? 17.334  34.003  -25.858 1.00 68.78 ? 1266 ASP B CG    1 
ATOM   4505 O  OD1   . ASP B 1 289 ? 18.489  34.169  -26.323 1.00 72.08 ? 1266 ASP B OD1   1 
ATOM   4506 O  OD2   . ASP B 1 289 ? 16.696  32.934  -25.967 1.00 70.52 ? 1266 ASP B OD2   1 
ATOM   4507 N  N     . LEU B 1 290 ? 17.515  36.816  -21.892 1.00 55.27 ? 1267 LEU B N     1 
ATOM   4508 C  CA    . LEU B 1 290 ? 16.867  37.568  -20.833 1.00 54.05 ? 1267 LEU B CA    1 
ATOM   4509 C  C     . LEU B 1 290 ? 17.613  38.830  -20.445 1.00 54.63 ? 1267 LEU B C     1 
ATOM   4510 O  O     . LEU B 1 290 ? 18.802  38.978  -20.707 1.00 55.67 ? 1267 LEU B O     1 
ATOM   4511 C  CB    . LEU B 1 290 ? 16.707  36.701  -19.592 1.00 50.60 ? 1267 LEU B CB    1 
ATOM   4512 C  CG    . LEU B 1 290 ? 15.883  35.435  -19.779 1.00 49.56 ? 1267 LEU B CG    1 
ATOM   4513 C  CD1   . LEU B 1 290 ? 15.922  34.642  -18.484 1.00 45.79 ? 1267 LEU B CD1   1 
ATOM   4514 C  CD2   . LEU B 1 290 ? 14.450  35.791  -20.196 1.00 45.20 ? 1267 LEU B CD2   1 
ATOM   4515 N  N     . HIS B 1 291 ? 16.888  39.736  -19.808 1.00 53.47 ? 1268 HIS B N     1 
ATOM   4516 C  CA    . HIS B 1 291 ? 17.433  40.994  -19.348 1.00 52.90 ? 1268 HIS B CA    1 
ATOM   4517 C  C     . HIS B 1 291 ? 18.689  40.714  -18.517 1.00 54.44 ? 1268 HIS B C     1 
ATOM   4518 O  O     . HIS B 1 291 ? 18.711  39.790  -17.700 1.00 55.16 ? 1268 HIS B O     1 
ATOM   4519 C  CB    . HIS B 1 291 ? 16.368  41.699  -18.514 1.00 51.66 ? 1268 HIS B CB    1 
ATOM   4520 C  CG    . HIS B 1 291 ? 16.729  43.089  -18.108 1.00 52.67 ? 1268 HIS B CG    1 
ATOM   4521 N  ND1   . HIS B 1 291 ? 17.671  43.359  -17.141 1.00 53.17 ? 1268 HIS B ND1   1 
ATOM   4522 C  CD2   . HIS B 1 291 ? 16.249  44.287  -18.514 1.00 53.55 ? 1268 HIS B CD2   1 
ATOM   4523 C  CE1   . HIS B 1 291 ? 17.751  44.666  -16.965 1.00 53.29 ? 1268 HIS B CE1   1 
ATOM   4524 N  NE2   . HIS B 1 291 ? 16.899  45.252  -17.785 1.00 52.88 ? 1268 HIS B NE2   1 
ATOM   4525 N  N     . PRO B 1 292 ? 19.753  41.514  -18.716 1.00 54.46 ? 1269 PRO B N     1 
ATOM   4526 C  CA    . PRO B 1 292 ? 21.037  41.388  -18.015 1.00 53.53 ? 1269 PRO B CA    1 
ATOM   4527 C  C     . PRO B 1 292 ? 20.956  41.257  -16.493 1.00 52.40 ? 1269 PRO B C     1 
ATOM   4528 O  O     . PRO B 1 292 ? 21.799  40.601  -15.869 1.00 52.00 ? 1269 PRO B O     1 
ATOM   4529 C  CB    . PRO B 1 292 ? 21.780  42.657  -18.436 1.00 53.53 ? 1269 PRO B CB    1 
ATOM   4530 C  CG    . PRO B 1 292 ? 21.245  42.919  -19.809 1.00 53.65 ? 1269 PRO B CG    1 
ATOM   4531 C  CD    . PRO B 1 292 ? 19.769  42.683  -19.618 1.00 54.16 ? 1269 PRO B CD    1 
ATOM   4532 N  N     . SER B 1 293 ? 19.953  41.877  -15.890 1.00 50.51 ? 1270 SER B N     1 
ATOM   4533 C  CA    . SER B 1 293 ? 19.828  41.821  -14.437 1.00 49.49 ? 1270 SER B CA    1 
ATOM   4534 C  C     . SER B 1 293 ? 19.284  40.497  -13.913 1.00 49.60 ? 1270 SER B C     1 
ATOM   4535 O  O     . SER B 1 293 ? 19.432  40.186  -12.736 1.00 49.12 ? 1270 SER B O     1 
ATOM   4536 C  CB    . SER B 1 293 ? 18.940  42.955  -13.930 1.00 48.50 ? 1270 SER B CB    1 
ATOM   4537 O  OG    . SER B 1 293 ? 17.609  42.793  -14.379 1.00 46.17 ? 1270 SER B OG    1 
ATOM   4538 N  N     . PHE B 1 294 ? 18.659  39.717  -14.786 1.00 49.46 ? 1271 PHE B N     1 
ATOM   4539 C  CA    . PHE B 1 294 ? 18.069  38.452  -14.379 1.00 49.57 ? 1271 PHE B CA    1 
ATOM   4540 C  C     . PHE B 1 294 ? 18.956  37.601  -13.478 1.00 49.75 ? 1271 PHE B C     1 
ATOM   4541 O  O     . PHE B 1 294 ? 18.522  37.164  -12.412 1.00 48.92 ? 1271 PHE B O     1 
ATOM   4542 C  CB    . PHE B 1 294 ? 17.665  37.636  -15.613 1.00 49.78 ? 1271 PHE B CB    1 
ATOM   4543 C  CG    . PHE B 1 294 ? 16.785  36.461  -15.299 1.00 49.42 ? 1271 PHE B CG    1 
ATOM   4544 C  CD1   . PHE B 1 294 ? 15.429  36.641  -15.028 1.00 49.72 ? 1271 PHE B CD1   1 
ATOM   4545 C  CD2   . PHE B 1 294 ? 17.306  35.175  -15.267 1.00 49.47 ? 1271 PHE B CD2   1 
ATOM   4546 C  CE1   . PHE B 1 294 ? 14.603  35.553  -14.731 1.00 49.21 ? 1271 PHE B CE1   1 
ATOM   4547 C  CE2   . PHE B 1 294 ? 16.489  34.078  -14.971 1.00 49.09 ? 1271 PHE B CE2   1 
ATOM   4548 C  CZ    . PHE B 1 294 ? 15.134  34.268  -14.702 1.00 49.32 ? 1271 PHE B CZ    1 
ATOM   4549 N  N     . PRO B 1 295 ? 20.216  37.357  -13.889 1.00 51.63 ? 1272 PRO B N     1 
ATOM   4550 C  CA    . PRO B 1 295 ? 21.128  36.538  -13.082 1.00 52.17 ? 1272 PRO B CA    1 
ATOM   4551 C  C     . PRO B 1 295 ? 21.417  37.092  -11.693 1.00 53.00 ? 1272 PRO B C     1 
ATOM   4552 O  O     . PRO B 1 295 ? 21.817  36.347  -10.799 1.00 53.76 ? 1272 PRO B O     1 
ATOM   4553 C  CB    . PRO B 1 295 ? 22.384  36.457  -13.947 1.00 50.91 ? 1272 PRO B CB    1 
ATOM   4554 C  CG    . PRO B 1 295 ? 21.856  36.621  -15.334 1.00 51.26 ? 1272 PRO B CG    1 
ATOM   4555 C  CD    . PRO B 1 295 ? 20.869  37.744  -15.151 1.00 51.67 ? 1272 PRO B CD    1 
ATOM   4556 N  N     . GLU B 1 296 ? 21.210  38.392  -11.511 1.00 53.32 ? 1273 GLU B N     1 
ATOM   4557 C  CA    . GLU B 1 296 ? 21.460  39.029  -10.225 1.00 52.92 ? 1273 GLU B CA    1 
ATOM   4558 C  C     . GLU B 1 296 ? 20.293  38.851  -9.259  1.00 51.77 ? 1273 GLU B C     1 
ATOM   4559 O  O     . GLU B 1 296 ? 20.458  38.999  -8.048  1.00 49.92 ? 1273 GLU B O     1 
ATOM   4560 C  CB    . GLU B 1 296 ? 21.750  40.520  -10.443 1.00 57.16 ? 1273 GLU B CB    1 
ATOM   4561 C  CG    . GLU B 1 296 ? 22.766  40.775  -11.578 1.00 63.33 ? 1273 GLU B CG    1 
ATOM   4562 C  CD    . GLU B 1 296 ? 23.214  42.230  -11.689 1.00 67.02 ? 1273 GLU B CD    1 
ATOM   4563 O  OE1   . GLU B 1 296 ? 23.848  42.731  -10.734 1.00 69.05 ? 1273 GLU B OE1   1 
ATOM   4564 O  OE2   . GLU B 1 296 ? 22.939  42.872  -12.733 1.00 69.77 ? 1273 GLU B OE2   1 
ATOM   4565 N  N     . VAL B 1 297 ? 19.117  38.517  -9.794  1.00 50.54 ? 1274 VAL B N     1 
ATOM   4566 C  CA    . VAL B 1 297 ? 17.923  38.359  -8.963  1.00 47.45 ? 1274 VAL B CA    1 
ATOM   4567 C  C     . VAL B 1 297 ? 17.240  36.984  -8.989  1.00 47.09 ? 1274 VAL B C     1 
ATOM   4568 O  O     . VAL B 1 297 ? 16.600  36.585  -8.006  1.00 47.37 ? 1274 VAL B O     1 
ATOM   4569 C  CB    . VAL B 1 297 ? 16.885  39.434  -9.343  1.00 46.09 ? 1274 VAL B CB    1 
ATOM   4570 C  CG1   . VAL B 1 297 ? 17.499  40.805  -9.179  1.00 45.36 ? 1274 VAL B CG1   1 
ATOM   4571 C  CG2   . VAL B 1 297 ? 16.436  39.251  -10.787 1.00 44.13 ? 1274 VAL B CG2   1 
ATOM   4572 N  N     . SER B 1 298 ? 17.374  36.258  -10.094 1.00 44.40 ? 1275 SER B N     1 
ATOM   4573 C  CA    . SER B 1 298 ? 16.724  34.955  -10.216 1.00 44.74 ? 1275 SER B CA    1 
ATOM   4574 C  C     . SER B 1 298 ? 17.093  33.945  -9.133  1.00 44.28 ? 1275 SER B C     1 
ATOM   4575 O  O     . SER B 1 298 ? 18.162  34.019  -8.538  1.00 44.11 ? 1275 SER B O     1 
ATOM   4576 C  CB    . SER B 1 298 ? 17.028  34.333  -11.579 1.00 45.02 ? 1275 SER B CB    1 
ATOM   4577 O  OG    . SER B 1 298 ? 18.346  33.823  -11.613 1.00 48.36 ? 1275 SER B OG    1 
ATOM   4578 N  N     . PHE B 1 299 ? 16.192  33.001  -8.879  1.00 42.90 ? 1276 PHE B N     1 
ATOM   4579 C  CA    . PHE B 1 299 ? 16.456  31.950  -7.910  1.00 41.40 ? 1276 PHE B CA    1 
ATOM   4580 C  C     . PHE B 1 299 ? 17.393  31.003  -8.632  1.00 42.49 ? 1276 PHE B C     1 
ATOM   4581 O  O     . PHE B 1 299 ? 18.297  30.404  -8.046  1.00 40.75 ? 1276 PHE B O     1 
ATOM   4582 C  CB    . PHE B 1 299 ? 15.177  31.190  -7.570  1.00 39.01 ? 1276 PHE B CB    1 
ATOM   4583 C  CG    . PHE B 1 299 ? 15.421  29.812  -7.029  1.00 37.70 ? 1276 PHE B CG    1 
ATOM   4584 C  CD1   . PHE B 1 299 ? 16.069  29.627  -5.805  1.00 38.27 ? 1276 PHE B CD1   1 
ATOM   4585 C  CD2   . PHE B 1 299 ? 15.006  28.690  -7.744  1.00 37.84 ? 1276 PHE B CD2   1 
ATOM   4586 C  CE1   . PHE B 1 299 ? 16.302  28.338  -5.293  1.00 38.13 ? 1276 PHE B CE1   1 
ATOM   4587 C  CE2   . PHE B 1 299 ? 15.229  27.386  -7.245  1.00 37.06 ? 1276 PHE B CE2   1 
ATOM   4588 C  CZ    . PHE B 1 299 ? 15.878  27.212  -6.017  1.00 38.94 ? 1276 PHE B CZ    1 
ATOM   4589 N  N     . PHE B 1 300 ? 17.146  30.888  -9.930  1.00 43.94 ? 1277 PHE B N     1 
ATOM   4590 C  CA    . PHE B 1 300 ? 17.898  30.015  -10.808 1.00 46.00 ? 1277 PHE B CA    1 
ATOM   4591 C  C     . PHE B 1 300 ? 19.408  30.190  -10.674 1.00 47.44 ? 1277 PHE B C     1 
ATOM   4592 O  O     . PHE B 1 300 ? 20.141  29.223  -10.442 1.00 47.48 ? 1277 PHE B O     1 
ATOM   4593 C  CB    . PHE B 1 300 ? 17.443  30.270  -12.242 1.00 44.62 ? 1277 PHE B CB    1 
ATOM   4594 C  CG    . PHE B 1 300 ? 18.097  29.389  -13.260 1.00 45.79 ? 1277 PHE B CG    1 
ATOM   4595 C  CD1   . PHE B 1 300 ? 19.306  29.754  -13.842 1.00 45.39 ? 1277 PHE B CD1   1 
ATOM   4596 C  CD2   . PHE B 1 300 ? 17.492  28.198  -13.654 1.00 45.63 ? 1277 PHE B CD2   1 
ATOM   4597 C  CE1   . PHE B 1 300 ? 19.900  28.949  -14.803 1.00 45.86 ? 1277 PHE B CE1   1 
ATOM   4598 C  CE2   . PHE B 1 300 ? 18.078  27.376  -14.620 1.00 45.65 ? 1277 PHE B CE2   1 
ATOM   4599 C  CZ    . PHE B 1 300 ? 19.282  27.752  -15.196 1.00 46.46 ? 1277 PHE B CZ    1 
ATOM   4600 N  N     . HIS B 1 301 ? 19.873  31.426  -10.816 1.00 47.33 ? 1278 HIS B N     1 
ATOM   4601 C  CA    . HIS B 1 301 ? 21.297  31.702  -10.718 1.00 46.21 ? 1278 HIS B CA    1 
ATOM   4602 C  C     . HIS B 1 301 ? 21.748  31.916  -9.283  1.00 47.04 ? 1278 HIS B C     1 
ATOM   4603 O  O     . HIS B 1 301 ? 22.859  32.370  -9.054  1.00 48.48 ? 1278 HIS B O     1 
ATOM   4604 C  CB    . HIS B 1 301 ? 21.658  32.940  -11.533 1.00 42.75 ? 1278 HIS B CB    1 
ATOM   4605 C  CG    . HIS B 1 301 ? 21.327  32.833  -12.984 1.00 41.85 ? 1278 HIS B CG    1 
ATOM   4606 N  ND1   . HIS B 1 301 ? 20.214  33.427  -13.540 1.00 43.04 ? 1278 HIS B ND1   1 
ATOM   4607 C  CD2   . HIS B 1 301 ? 21.970  32.215  -14.002 1.00 41.87 ? 1278 HIS B CD2   1 
ATOM   4608 C  CE1   . HIS B 1 301 ? 20.187  33.182  -14.838 1.00 43.38 ? 1278 HIS B CE1   1 
ATOM   4609 N  NE2   . HIS B 1 301 ? 21.244  32.448  -15.145 1.00 43.02 ? 1278 HIS B NE2   1 
ATOM   4610 N  N     . SER B 1 302 ? 20.901  31.593  -8.314  1.00 47.61 ? 1279 SER B N     1 
ATOM   4611 C  CA    . SER B 1 302 ? 21.278  31.805  -6.924  1.00 47.95 ? 1279 SER B CA    1 
ATOM   4612 C  C     . SER B 1 302 ? 22.091  30.657  -6.340  1.00 50.03 ? 1279 SER B C     1 
ATOM   4613 O  O     . SER B 1 302 ? 22.146  29.556  -6.899  1.00 48.16 ? 1279 SER B O     1 
ATOM   4614 C  CB    . SER B 1 302 ? 20.044  32.032  -6.051  1.00 45.64 ? 1279 SER B CB    1 
ATOM   4615 O  OG    . SER B 1 302 ? 19.468  30.797  -5.670  1.00 45.23 ? 1279 SER B OG    1 
ATOM   4616 N  N     . GLU B 1 303 ? 22.726  30.936  -5.203  1.00 52.78 ? 1280 GLU B N     1 
ATOM   4617 C  CA    . GLU B 1 303 ? 23.527  29.942  -4.496  1.00 56.44 ? 1280 GLU B CA    1 
ATOM   4618 C  C     . GLU B 1 303 ? 22.577  28.898  -3.933  1.00 58.67 ? 1280 GLU B C     1 
ATOM   4619 O  O     . GLU B 1 303 ? 22.922  27.722  -3.808  1.00 60.12 ? 1280 GLU B O     1 
ATOM   4620 C  CB    . GLU B 1 303 ? 24.298  30.600  -3.346  1.00 56.75 ? 1280 GLU B CB    1 
ATOM   4621 N  N     . GLU B 1 304 ? 21.373  29.350  -3.594  1.00 60.87 ? 1281 GLU B N     1 
ATOM   4622 C  CA    . GLU B 1 304 ? 20.332  28.485  -3.055  1.00 61.90 ? 1281 GLU B CA    1 
ATOM   4623 C  C     . GLU B 1 304 ? 20.023  27.332  -3.987  1.00 62.31 ? 1281 GLU B C     1 
ATOM   4624 O  O     . GLU B 1 304 ? 19.690  26.232  -3.538  1.00 63.15 ? 1281 GLU B O     1 
ATOM   4625 C  CB    . GLU B 1 304 ? 19.042  29.257  -2.884  1.00 64.44 ? 1281 GLU B CB    1 
ATOM   4626 C  CG    . GLU B 1 304 ? 18.827  29.856  -1.541  1.00 69.21 ? 1281 GLU B CG    1 
ATOM   4627 C  CD    . GLU B 1 304 ? 17.483  30.533  -1.473  1.00 70.90 ? 1281 GLU B CD    1 
ATOM   4628 O  OE1   . GLU B 1 304 ? 17.290  31.521  -2.222  1.00 71.66 ? 1281 GLU B OE1   1 
ATOM   4629 O  OE2   . GLU B 1 304 ? 16.623  30.069  -0.687  1.00 71.53 ? 1281 GLU B OE2   1 
ATOM   4630 N  N     . ASN B 1 305 ? 20.117  27.588  -5.287  1.00 61.17 ? 1282 ASN B N     1 
ATOM   4631 C  CA    . ASN B 1 305 ? 19.816  26.563  -6.275  1.00 61.22 ? 1282 ASN B CA    1 
ATOM   4632 C  C     . ASN B 1 305 ? 20.982  25.590  -6.422  1.00 63.60 ? 1282 ASN B C     1 
ATOM   4633 O  O     . ASN B 1 305 ? 21.716  25.625  -7.414  1.00 63.71 ? 1282 ASN B O     1 
ATOM   4634 C  CB    . ASN B 1 305 ? 19.486  27.223  -7.618  1.00 57.34 ? 1282 ASN B CB    1 
ATOM   4635 C  CG    . ASN B 1 305 ? 19.018  26.228  -8.657  1.00 53.78 ? 1282 ASN B CG    1 
ATOM   4636 O  OD1   . ASN B 1 305 ? 18.605  25.120  -8.328  1.00 51.63 ? 1282 ASN B OD1   1 
ATOM   4637 N  ND2   . ASN B 1 305 ? 19.065  26.627  -9.920  1.00 51.98 ? 1282 ASN B ND2   1 
ATOM   4638 N  N     . LYS B 1 306 ? 21.140  24.721  -5.422  1.00 66.61 ? 1283 LYS B N     1 
ATOM   4639 C  CA    . LYS B 1 306 ? 22.217  23.724  -5.393  1.00 68.68 ? 1283 LYS B CA    1 
ATOM   4640 C  C     . LYS B 1 306 ? 21.743  22.311  -5.758  1.00 69.91 ? 1283 LYS B C     1 
ATOM   4641 O  O     . LYS B 1 306 ? 20.534  22.023  -5.593  1.00 71.31 ? 1283 LYS B O     1 
ATOM   4642 C  CB    . LYS B 1 306 ? 22.874  23.699  -4.007  1.00 68.09 ? 1283 LYS B CB    1 
ATOM   4643 N  N     . LEU C 2 6   ? 24.784  3.973   21.784  1.00 62.85 ? 402  LEU C N     1 
ATOM   4644 C  CA    . LEU C 2 6   ? 24.428  5.134   22.659  1.00 62.99 ? 402  LEU C CA    1 
ATOM   4645 C  C     . LEU C 2 6   ? 24.352  6.425   21.855  1.00 63.94 ? 402  LEU C C     1 
ATOM   4646 O  O     . LEU C 2 6   ? 24.026  7.477   22.379  1.00 64.54 ? 402  LEU C O     1 
ATOM   4647 C  CB    . LEU C 2 6   ? 25.466  5.279   23.789  1.00 62.47 ? 402  LEU C CB    1 
ATOM   4648 C  CG    . LEU C 2 6   ? 25.370  6.360   24.870  1.00 62.72 ? 402  LEU C CG    1 
ATOM   4649 C  CD1   . LEU C 2 6   ? 24.096  6.243   25.702  1.00 61.89 ? 402  LEU C CD1   1 
ATOM   4650 C  CD2   . LEU C 2 6   ? 26.580  6.216   25.779  1.00 63.22 ? 402  LEU C CD2   1 
ATOM   4651 N  N     . GLU C 2 7   ? 24.670  6.349   20.573  1.00 65.14 ? 403  GLU C N     1 
ATOM   4652 C  CA    . GLU C 2 7   ? 24.619  7.532   19.718  1.00 67.17 ? 403  GLU C CA    1 
ATOM   4653 C  C     . GLU C 2 7   ? 23.912  7.286   18.398  1.00 65.81 ? 403  GLU C C     1 
ATOM   4654 O  O     . GLU C 2 7   ? 23.962  6.185   17.855  1.00 65.87 ? 403  GLU C O     1 
ATOM   4655 C  CB    . GLU C 2 7   ? 26.029  8.061   19.464  1.00 70.02 ? 403  GLU C CB    1 
ATOM   4656 C  CG    . GLU C 2 7   ? 26.583  8.872   20.630  1.00 75.14 ? 403  GLU C CG    1 
ATOM   4657 C  CD    . GLU C 2 7   ? 28.112  8.852   20.694  1.00 78.21 ? 403  GLU C CD    1 
ATOM   4658 O  OE1   . GLU C 2 7   ? 28.775  9.174   19.673  1.00 78.35 ? 403  GLU C OE1   1 
ATOM   4659 O  OE2   . GLU C 2 7   ? 28.642  8.516   21.777  1.00 78.67 ? 403  GLU C OE2   1 
ATOM   4660 N  N     . LEU C 2 8   ? 23.251  8.323   17.899  1.00 63.76 ? 404  LEU C N     1 
ATOM   4661 C  CA    . LEU C 2 8   ? 22.501  8.258   16.649  1.00 62.46 ? 404  LEU C CA    1 
ATOM   4662 C  C     . LEU C 2 8   ? 23.242  7.461   15.580  1.00 60.71 ? 404  LEU C C     1 
ATOM   4663 O  O     . LEU C 2 8   ? 22.662  6.625   14.878  1.00 60.17 ? 404  LEU C O     1 
ATOM   4664 C  CB    . LEU C 2 8   ? 22.244  9.688   16.156  1.00 62.21 ? 404  LEU C CB    1 
ATOM   4665 C  CG    . LEU C 2 8   ? 21.240  9.936   15.031  1.00 61.16 ? 404  LEU C CG    1 
ATOM   4666 C  CD1   . LEU C 2 8   ? 19.917  9.263   15.350  1.00 59.43 ? 404  LEU C CD1   1 
ATOM   4667 C  CD2   . LEU C 2 8   ? 21.061  11.441  14.857  1.00 61.63 ? 404  LEU C CD2   1 
ATOM   4668 N  N     . SER C 2 9   ? 24.533  7.739   15.478  1.00 59.85 ? 405  SER C N     1 
ATOM   4669 C  CA    . SER C 2 9   ? 25.417  7.093   14.518  1.00 58.50 ? 405  SER C CA    1 
ATOM   4670 C  C     . SER C 2 9   ? 25.531  5.583   14.738  1.00 56.93 ? 405  SER C C     1 
ATOM   4671 O  O     . SER C 2 9   ? 25.808  4.836   13.804  1.00 56.43 ? 405  SER C O     1 
ATOM   4672 C  CB    . SER C 2 9   ? 26.798  7.738   14.632  1.00 60.00 ? 405  SER C CB    1 
ATOM   4673 O  OG    . SER C 2 9   ? 26.686  9.032   15.226  1.00 59.21 ? 405  SER C OG    1 
ATOM   4674 N  N     . ASP C 2 10  ? 25.311  5.145   15.976  1.00 54.96 ? 406  ASP C N     1 
ATOM   4675 C  CA    . ASP C 2 10  ? 25.424  3.734   16.329  1.00 52.86 ? 406  ASP C CA    1 
ATOM   4676 C  C     . ASP C 2 10  ? 24.196  2.870   16.092  1.00 51.29 ? 406  ASP C C     1 
ATOM   4677 O  O     . ASP C 2 10  ? 24.221  1.671   16.373  1.00 51.03 ? 406  ASP C O     1 
ATOM   4678 C  CB    . ASP C 2 10  ? 25.825  3.589   17.797  1.00 53.26 ? 406  ASP C CB    1 
ATOM   4679 C  CG    . ASP C 2 10  ? 27.119  4.297   18.121  1.00 54.91 ? 406  ASP C CG    1 
ATOM   4680 O  OD1   . ASP C 2 10  ? 28.093  4.141   17.350  1.00 54.67 ? 406  ASP C OD1   1 
ATOM   4681 O  OD2   . ASP C 2 10  ? 27.162  5.003   19.150  1.00 55.90 ? 406  ASP C OD2   1 
ATOM   4682 N  N     . TYR C 2 11  ? 23.120  3.457   15.588  1.00 49.51 ? 407  TYR C N     1 
ATOM   4683 C  CA    . TYR C 2 11  ? 21.917  2.676   15.353  1.00 46.95 ? 407  TYR C CA    1 
ATOM   4684 C  C     . TYR C 2 11  ? 21.785  2.265   13.900  1.00 45.24 ? 407  TYR C C     1 
ATOM   4685 O  O     . TYR C 2 11  ? 22.121  3.023   12.980  1.00 44.41 ? 407  TYR C O     1 
ATOM   4686 C  CB    . TYR C 2 11  ? 20.683  3.454   15.787  1.00 46.49 ? 407  TYR C CB    1 
ATOM   4687 C  CG    . TYR C 2 11  ? 20.600  3.647   17.276  1.00 44.63 ? 407  TYR C CG    1 
ATOM   4688 C  CD1   . TYR C 2 11  ? 20.162  2.620   18.110  1.00 44.36 ? 407  TYR C CD1   1 
ATOM   4689 C  CD2   . TYR C 2 11  ? 20.945  4.861   17.849  1.00 44.58 ? 407  TYR C CD2   1 
ATOM   4690 C  CE1   . TYR C 2 11  ? 20.062  2.807   19.488  1.00 44.33 ? 407  TYR C CE1   1 
ATOM   4691 C  CE2   . TYR C 2 11  ? 20.859  5.061   19.220  1.00 46.25 ? 407  TYR C CE2   1 
ATOM   4692 C  CZ    . TYR C 2 11  ? 20.412  4.039   20.036  1.00 45.62 ? 407  TYR C CZ    1 
ATOM   4693 O  OH    . TYR C 2 11  ? 20.281  4.279   21.387  1.00 46.00 ? 407  TYR C OH    1 
ATOM   4694 N  N     . PRO C 2 12  ? 21.286  1.045   13.676  1.00 43.35 ? 408  PRO C N     1 
ATOM   4695 C  CA    . PRO C 2 12  ? 21.084  0.461   12.347  1.00 41.91 ? 408  PRO C CA    1 
ATOM   4696 C  C     . PRO C 2 12  ? 20.024  1.176   11.506  1.00 42.80 ? 408  PRO C C     1 
ATOM   4697 O  O     . PRO C 2 12  ? 20.088  1.154   10.277  1.00 43.10 ? 408  PRO C O     1 
ATOM   4698 C  CB    . PRO C 2 12  ? 20.706  -0.979  12.667  1.00 40.51 ? 408  PRO C CB    1 
ATOM   4699 C  CG    . PRO C 2 12  ? 19.955  -0.835  13.969  1.00 40.63 ? 408  PRO C CG    1 
ATOM   4700 C  CD    . PRO C 2 12  ? 20.811  0.136   14.737  1.00 41.14 ? 408  PRO C CD    1 
ATOM   4701 N  N     . TRP C 2 13  ? 19.056  1.808   12.166  1.00 42.23 ? 409  TRP C N     1 
ATOM   4702 C  CA    . TRP C 2 13  ? 17.999  2.518   11.455  1.00 41.75 ? 409  TRP C CA    1 
ATOM   4703 C  C     . TRP C 2 13  ? 18.371  3.929   11.038  1.00 42.41 ? 409  TRP C C     1 
ATOM   4704 O  O     . TRP C 2 13  ? 17.587  4.596   10.351  1.00 43.98 ? 409  TRP C O     1 
ATOM   4705 C  CB    . TRP C 2 13  ? 16.707  2.573   12.278  1.00 40.39 ? 409  TRP C CB    1 
ATOM   4706 C  CG    . TRP C 2 13  ? 16.913  2.777   13.737  1.00 39.83 ? 409  TRP C CG    1 
ATOM   4707 C  CD1   . TRP C 2 13  ? 16.937  1.813   14.703  1.00 40.03 ? 409  TRP C CD1   1 
ATOM   4708 C  CD2   . TRP C 2 13  ? 17.144  4.018   14.403  1.00 40.26 ? 409  TRP C CD2   1 
ATOM   4709 N  NE1   . TRP C 2 13  ? 17.166  2.378   15.933  1.00 39.50 ? 409  TRP C NE1   1 
ATOM   4710 C  CE2   . TRP C 2 13  ? 17.297  3.733   15.778  1.00 41.00 ? 409  TRP C CE2   1 
ATOM   4711 C  CE3   . TRP C 2 13  ? 17.239  5.351   13.972  1.00 42.08 ? 409  TRP C CE3   1 
ATOM   4712 C  CZ2   . TRP C 2 13  ? 17.540  4.732   16.731  1.00 41.47 ? 409  TRP C CZ2   1 
ATOM   4713 C  CZ3   . TRP C 2 13  ? 17.483  6.348   14.925  1.00 40.98 ? 409  TRP C CZ3   1 
ATOM   4714 C  CH2   . TRP C 2 13  ? 17.629  6.028   16.285  1.00 41.15 ? 409  TRP C CH2   1 
ATOM   4715 N  N     . PHE C 2 14  ? 19.551  4.391   11.445  1.00 41.29 ? 410  PHE C N     1 
ATOM   4716 C  CA    . PHE C 2 14  ? 19.989  5.734   11.074  1.00 41.76 ? 410  PHE C CA    1 
ATOM   4717 C  C     . PHE C 2 14  ? 20.892  5.633   9.858   1.00 42.07 ? 410  PHE C C     1 
ATOM   4718 O  O     . PHE C 2 14  ? 21.821  4.828   9.850   1.00 42.58 ? 410  PHE C O     1 
ATOM   4719 C  CB    . PHE C 2 14  ? 20.756  6.397   12.211  1.00 40.30 ? 410  PHE C CB    1 
ATOM   4720 C  CG    . PHE C 2 14  ? 21.268  7.746   11.852  1.00 41.26 ? 410  PHE C CG    1 
ATOM   4721 C  CD1   . PHE C 2 14  ? 20.382  8.800   11.648  1.00 40.55 ? 410  PHE C CD1   1 
ATOM   4722 C  CD2   . PHE C 2 14  ? 22.628  7.958   11.653  1.00 40.37 ? 410  PHE C CD2   1 
ATOM   4723 C  CE1   . PHE C 2 14  ? 20.845  10.050  11.246  1.00 42.53 ? 410  PHE C CE1   1 
ATOM   4724 C  CE2   . PHE C 2 14  ? 23.104  9.199   11.253  1.00 40.78 ? 410  PHE C CE2   1 
ATOM   4725 C  CZ    . PHE C 2 14  ? 22.214  10.252  11.047  1.00 41.64 ? 410  PHE C CZ    1 
ATOM   4726 N  N     . HIS C 2 15  ? 20.636  6.444   8.835   1.00 41.91 ? 411  HIS C N     1 
ATOM   4727 C  CA    . HIS C 2 15  ? 21.437  6.364   7.615   1.00 43.23 ? 411  HIS C CA    1 
ATOM   4728 C  C     . HIS C 2 15  ? 22.163  7.632   7.177   1.00 44.73 ? 411  HIS C C     1 
ATOM   4729 O  O     . HIS C 2 15  ? 22.285  7.909   5.983   1.00 44.94 ? 411  HIS C O     1 
ATOM   4730 C  CB    . HIS C 2 15  ? 20.566  5.851   6.465   1.00 43.11 ? 411  HIS C CB    1 
ATOM   4731 C  CG    . HIS C 2 15  ? 20.059  4.456   6.673   1.00 42.80 ? 411  HIS C CG    1 
ATOM   4732 N  ND1   . HIS C 2 15  ? 20.435  3.398   5.872   1.00 43.17 ? 411  HIS C ND1   1 
ATOM   4733 C  CD2   . HIS C 2 15  ? 19.233  3.940   7.614   1.00 41.83 ? 411  HIS C CD2   1 
ATOM   4734 C  CE1   . HIS C 2 15  ? 19.865  2.290   6.315   1.00 43.22 ? 411  HIS C CE1   1 
ATOM   4735 N  NE2   . HIS C 2 15  ? 19.130  2.592   7.371   1.00 41.87 ? 411  HIS C NE2   1 
ATOM   4736 N  N     . GLY C 2 16  ? 22.646  8.399   8.142   1.00 45.31 ? 412  GLY C N     1 
ATOM   4737 C  CA    . GLY C 2 16  ? 23.377  9.610   7.828   1.00 46.74 ? 412  GLY C CA    1 
ATOM   4738 C  C     . GLY C 2 16  ? 22.871  10.451  6.674   1.00 47.86 ? 412  GLY C C     1 
ATOM   4739 O  O     . GLY C 2 16  ? 21.724  10.896  6.679   1.00 49.08 ? 412  GLY C O     1 
ATOM   4740 N  N     . THR C 2 17  ? 23.728  10.668  5.676   1.00 48.86 ? 413  THR C N     1 
ATOM   4741 C  CA    . THR C 2 17  ? 23.378  11.508  4.522   1.00 48.67 ? 413  THR C CA    1 
ATOM   4742 C  C     . THR C 2 17  ? 22.704  10.858  3.319   1.00 48.19 ? 413  THR C C     1 
ATOM   4743 O  O     . THR C 2 17  ? 22.814  11.356  2.197   1.00 48.46 ? 413  THR C O     1 
ATOM   4744 C  CB    . THR C 2 17  ? 24.604  12.285  3.987   1.00 47.28 ? 413  THR C CB    1 
ATOM   4745 O  OG1   . THR C 2 17  ? 25.685  11.372  3.756   1.00 45.41 ? 413  THR C OG1   1 
ATOM   4746 C  CG2   . THR C 2 17  ? 25.016  13.373  4.973   1.00 46.37 ? 413  THR C CG2   1 
ATOM   4747 N  N     . LEU C 2 18  ? 22.006  9.753   3.541   1.00 47.84 ? 414  LEU C N     1 
ATOM   4748 C  CA    . LEU C 2 18  ? 21.295  9.105   2.448   1.00 47.44 ? 414  LEU C CA    1 
ATOM   4749 C  C     . LEU C 2 18  ? 20.291  10.104  1.868   1.00 47.58 ? 414  LEU C C     1 
ATOM   4750 O  O     . LEU C 2 18  ? 19.511  10.718  2.593   1.00 47.86 ? 414  LEU C O     1 
ATOM   4751 C  CB    . LEU C 2 18  ? 20.554  7.870   2.959   1.00 47.95 ? 414  LEU C CB    1 
ATOM   4752 C  CG    . LEU C 2 18  ? 19.676  7.116   1.955   1.00 48.04 ? 414  LEU C CG    1 
ATOM   4753 C  CD1   . LEU C 2 18  ? 20.539  6.531   0.860   1.00 48.90 ? 414  LEU C CD1   1 
ATOM   4754 C  CD2   . LEU C 2 18  ? 18.909  6.016   2.668   1.00 46.10 ? 414  LEU C CD2   1 
ATOM   4755 N  N     . SER C 2 19  ? 20.324  10.266  0.553   1.00 49.03 ? 415  SER C N     1 
ATOM   4756 C  CA    . SER C 2 19  ? 19.436  11.183  -0.162  1.00 49.01 ? 415  SER C CA    1 
ATOM   4757 C  C     . SER C 2 19  ? 17.966  10.835  0.090   1.00 48.38 ? 415  SER C C     1 
ATOM   4758 O  O     . SER C 2 19  ? 17.641  9.667   0.315   1.00 48.12 ? 415  SER C O     1 
ATOM   4759 C  CB    . SER C 2 19  ? 19.742  11.085  -1.662  1.00 48.35 ? 415  SER C CB    1 
ATOM   4760 O  OG    . SER C 2 19  ? 18.806  11.797  -2.445  1.00 51.60 ? 415  SER C OG    1 
ATOM   4761 N  N     . ARG C 2 20  ? 17.084  11.836  0.054   1.00 47.05 ? 416  ARG C N     1 
ATOM   4762 C  CA    . ARG C 2 20  ? 15.666  11.568  0.253   1.00 47.62 ? 416  ARG C CA    1 
ATOM   4763 C  C     . ARG C 2 20  ? 15.204  10.653  -0.876  1.00 48.36 ? 416  ARG C C     1 
ATOM   4764 O  O     . ARG C 2 20  ? 14.407  9.730   -0.666  1.00 47.96 ? 416  ARG C O     1 
ATOM   4765 C  CB    . ARG C 2 20  ? 14.833  12.866  0.261   1.00 46.98 ? 416  ARG C CB    1 
ATOM   4766 C  CG    . ARG C 2 20  ? 14.621  13.551  -1.091  1.00 48.27 ? 416  ARG C CG    1 
ATOM   4767 C  CD    . ARG C 2 20  ? 13.146  13.997  -1.295  1.00 47.00 ? 416  ARG C CD    1 
ATOM   4768 N  NE    . ARG C 2 20  ? 12.632  14.803  -0.192  1.00 45.77 ? 416  ARG C NE    1 
ATOM   4769 C  CZ    . ARG C 2 20  ? 11.357  15.152  -0.029  1.00 45.20 ? 416  ARG C CZ    1 
ATOM   4770 N  NH1   . ARG C 2 20  ? 10.435  14.776  -0.905  1.00 43.53 ? 416  ARG C NH1   1 
ATOM   4771 N  NH2   . ARG C 2 20  ? 11.000  15.860  1.037   1.00 42.11 ? 416  ARG C NH2   1 
ATOM   4772 N  N     . VAL C 2 21  ? 15.715  10.907  -2.075  1.00 48.14 ? 417  VAL C N     1 
ATOM   4773 C  CA    . VAL C 2 21  ? 15.354  10.095  -3.221  1.00 48.50 ? 417  VAL C CA    1 
ATOM   4774 C  C     . VAL C 2 21  ? 15.789  8.652   -3.014  1.00 48.69 ? 417  VAL C C     1 
ATOM   4775 O  O     . VAL C 2 21  ? 15.023  7.726   -3.242  1.00 49.95 ? 417  VAL C O     1 
ATOM   4776 C  CB    . VAL C 2 21  ? 16.006  10.615  -4.501  1.00 49.28 ? 417  VAL C CB    1 
ATOM   4777 C  CG1   . VAL C 2 21  ? 15.633  9.704   -5.666  1.00 46.80 ? 417  VAL C CG1   1 
ATOM   4778 C  CG2   . VAL C 2 21  ? 15.565  12.050  -4.753  1.00 47.68 ? 417  VAL C CG2   1 
ATOM   4779 N  N     . LYS C 2 22  ? 17.026  8.464   -2.579  1.00 49.64 ? 418  LYS C N     1 
ATOM   4780 C  CA    . LYS C 2 22  ? 17.545  7.124   -2.341  1.00 50.27 ? 418  LYS C CA    1 
ATOM   4781 C  C     . LYS C 2 22  ? 16.806  6.446   -1.180  1.00 48.99 ? 418  LYS C C     1 
ATOM   4782 O  O     . LYS C 2 22  ? 16.539  5.243   -1.201  1.00 48.82 ? 418  LYS C O     1 
ATOM   4783 C  CB    . LYS C 2 22  ? 19.045  7.208   -2.040  1.00 49.49 ? 418  LYS C CB    1 
ATOM   4784 N  N     . ALA C 2 23  ? 16.476  7.235   -0.167  1.00 48.69 ? 419  ALA C N     1 
ATOM   4785 C  CA    . ALA C 2 23  ? 15.777  6.731   1.005   1.00 46.69 ? 419  ALA C CA    1 
ATOM   4786 C  C     . ALA C 2 23  ? 14.395  6.183   0.641   1.00 45.92 ? 419  ALA C C     1 
ATOM   4787 O  O     . ALA C 2 23  ? 13.986  5.116   1.112   1.00 44.40 ? 419  ALA C O     1 
ATOM   4788 C  CB    . ALA C 2 23  ? 15.653  7.838   2.031   1.00 46.94 ? 419  ALA C CB    1 
ATOM   4789 N  N     . ALA C 2 24  ? 13.673  6.915   -0.199  1.00 45.09 ? 420  ALA C N     1 
ATOM   4790 C  CA    . ALA C 2 24  ? 12.349  6.476   -0.621  1.00 45.78 ? 420  ALA C CA    1 
ATOM   4791 C  C     . ALA C 2 24  ? 12.469  5.126   -1.323  1.00 46.51 ? 420  ALA C C     1 
ATOM   4792 O  O     . ALA C 2 24  ? 11.693  4.199   -1.073  1.00 45.79 ? 420  ALA C O     1 
ATOM   4793 C  CB    . ALA C 2 24  ? 11.741  7.509   -1.558  1.00 44.49 ? 420  ALA C CB    1 
ATOM   4794 N  N     . GLN C 2 25  ? 13.458  5.028   -2.203  1.00 47.05 ? 421  GLN C N     1 
ATOM   4795 C  CA    . GLN C 2 25  ? 13.702  3.810   -2.951  1.00 49.10 ? 421  GLN C CA    1 
ATOM   4796 C  C     . GLN C 2 25  ? 13.892  2.639   -2.012  1.00 48.86 ? 421  GLN C C     1 
ATOM   4797 O  O     . GLN C 2 25  ? 13.307  1.566   -2.189  1.00 49.36 ? 421  GLN C O     1 
ATOM   4798 C  CB    . GLN C 2 25  ? 14.963  3.975   -3.768  1.00 51.72 ? 421  GLN C CB    1 
ATOM   4799 C  CG    . GLN C 2 25  ? 14.780  3.840   -5.242  1.00 54.22 ? 421  GLN C CG    1 
ATOM   4800 C  CD    . GLN C 2 25  ? 16.096  3.967   -5.952  1.00 57.55 ? 421  GLN C CD    1 
ATOM   4801 O  OE1   . GLN C 2 25  ? 16.159  3.901   -7.178  1.00 62.52 ? 421  GLN C OE1   1 
ATOM   4802 N  NE2   . GLN C 2 25  ? 17.165  4.149   -5.185  1.00 56.35 ? 421  GLN C NE2   1 
ATOM   4803 N  N     . LEU C 2 26  ? 14.726  2.863   -1.008  1.00 48.04 ? 422  LEU C N     1 
ATOM   4804 C  CA    . LEU C 2 26  ? 15.040  1.834   -0.049  1.00 47.27 ? 422  LEU C CA    1 
ATOM   4805 C  C     . LEU C 2 26  ? 13.816  1.320   0.694   1.00 48.80 ? 422  LEU C C     1 
ATOM   4806 O  O     . LEU C 2 26  ? 13.661  0.105   0.865   1.00 50.27 ? 422  LEU C O     1 
ATOM   4807 C  CB    . LEU C 2 26  ? 16.090  2.364   0.920   1.00 46.45 ? 422  LEU C CB    1 
ATOM   4808 C  CG    . LEU C 2 26  ? 16.857  1.367   1.785   1.00 44.63 ? 422  LEU C CG    1 
ATOM   4809 C  CD1   . LEU C 2 26  ? 18.042  2.082   2.372   1.00 44.49 ? 422  LEU C CD1   1 
ATOM   4810 C  CD2   . LEU C 2 26  ? 15.982  0.796   2.883   1.00 43.08 ? 422  LEU C CD2   1 
ATOM   4811 N  N     . VAL C 2 27  ? 12.938  2.219   1.133   1.00 48.68 ? 423  VAL C N     1 
ATOM   4812 C  CA    . VAL C 2 27  ? 11.756  1.769   1.866   1.00 48.37 ? 423  VAL C CA    1 
ATOM   4813 C  C     . VAL C 2 27  ? 10.647  1.249   0.973   1.00 48.66 ? 423  VAL C C     1 
ATOM   4814 O  O     . VAL C 2 27  ? 9.741   0.574   1.450   1.00 47.95 ? 423  VAL C O     1 
ATOM   4815 C  CB    . VAL C 2 27  ? 11.165  2.882   2.781   1.00 48.00 ? 423  VAL C CB    1 
ATOM   4816 C  CG1   . VAL C 2 27  ? 12.194  3.298   3.822   1.00 46.17 ? 423  VAL C CG1   1 
ATOM   4817 C  CG2   . VAL C 2 27  ? 10.713  4.071   1.947   1.00 46.17 ? 423  VAL C CG2   1 
ATOM   4818 N  N     . LEU C 2 28  ? 10.709  1.553   -0.321  1.00 50.25 ? 424  LEU C N     1 
ATOM   4819 C  CA    . LEU C 2 28  ? 9.664   1.086   -1.228  1.00 51.51 ? 424  LEU C CA    1 
ATOM   4820 C  C     . LEU C 2 28  ? 10.025  -0.186  -1.985  1.00 54.35 ? 424  LEU C C     1 
ATOM   4821 O  O     . LEU C 2 28  ? 9.155   -0.835  -2.571  1.00 54.72 ? 424  LEU C O     1 
ATOM   4822 C  CB    . LEU C 2 28  ? 9.273   2.194   -2.204  1.00 48.28 ? 424  LEU C CB    1 
ATOM   4823 C  CG    . LEU C 2 28  ? 8.542   3.375   -1.555  1.00 45.74 ? 424  LEU C CG    1 
ATOM   4824 C  CD1   . LEU C 2 28  ? 8.043   4.310   -2.644  1.00 44.18 ? 424  LEU C CD1   1 
ATOM   4825 C  CD2   . LEU C 2 28  ? 7.384   2.881   -0.712  1.00 42.06 ? 424  LEU C CD2   1 
ATOM   4826 N  N     . ALA C 2 29  ? 11.308  -0.539  -1.981  1.00 56.94 ? 425  ALA C N     1 
ATOM   4827 C  CA    . ALA C 2 29  ? 11.742  -1.767  -2.635  1.00 58.79 ? 425  ALA C CA    1 
ATOM   4828 C  C     . ALA C 2 29  ? 11.090  -2.852  -1.772  1.00 59.16 ? 425  ALA C C     1 
ATOM   4829 O  O     . ALA C 2 29  ? 11.530  -3.118  -0.661  1.00 60.42 ? 425  ALA C O     1 
ATOM   4830 C  CB    . ALA C 2 29  ? 13.258  -1.877  -2.589  1.00 58.16 ? 425  ALA C CB    1 
ATOM   4831 N  N     . GLY C 2 30  ? 10.031  -3.462  -2.286  1.00 59.19 ? 426  GLY C N     1 
ATOM   4832 C  CA    . GLY C 2 30  ? 9.314   -4.470  -1.528  1.00 58.18 ? 426  GLY C CA    1 
ATOM   4833 C  C     . GLY C 2 30  ? 7.842   -4.100  -1.549  1.00 58.80 ? 426  GLY C C     1 
ATOM   4834 O  O     . GLY C 2 30  ? 6.984   -4.822  -1.034  1.00 57.63 ? 426  GLY C O     1 
ATOM   4835 N  N     . GLY C 2 31  ? 7.561   -2.949  -2.156  1.00 59.37 ? 427  GLY C N     1 
ATOM   4836 C  CA    . GLY C 2 31  ? 6.199   -2.459  -2.276  1.00 59.47 ? 427  GLY C CA    1 
ATOM   4837 C  C     . GLY C 2 31  ? 5.405   -2.497  -0.990  1.00 60.34 ? 427  GLY C C     1 
ATOM   4838 O  O     . GLY C 2 31  ? 5.969   -2.390  0.097   1.00 60.92 ? 427  GLY C O     1 
ATOM   4839 N  N     . PRO C 2 32  ? 4.076   -2.647  -1.081  1.00 60.69 ? 428  PRO C N     1 
ATOM   4840 C  CA    . PRO C 2 32  ? 3.232   -2.693  0.113   1.00 60.52 ? 428  PRO C CA    1 
ATOM   4841 C  C     . PRO C 2 32  ? 3.583   -3.819  1.083   1.00 60.33 ? 428  PRO C C     1 
ATOM   4842 O  O     . PRO C 2 32  ? 3.075   -3.847  2.203   1.00 61.42 ? 428  PRO C O     1 
ATOM   4843 C  CB    . PRO C 2 32  ? 1.820   -2.822  -0.468  1.00 60.95 ? 428  PRO C CB    1 
ATOM   4844 C  CG    . PRO C 2 32  ? 2.052   -3.495  -1.787  1.00 60.78 ? 428  PRO C CG    1 
ATOM   4845 C  CD    . PRO C 2 32  ? 3.262   -2.775  -2.301  1.00 60.04 ? 428  PRO C CD    1 
ATOM   4846 N  N     . ARG C 2 33  ? 4.446   -4.744  0.663   1.00 59.57 ? 429  ARG C N     1 
ATOM   4847 C  CA    . ARG C 2 33  ? 4.856   -5.848  1.537   1.00 57.39 ? 429  ARG C CA    1 
ATOM   4848 C  C     . ARG C 2 33  ? 5.747   -5.314  2.657   1.00 56.46 ? 429  ARG C C     1 
ATOM   4849 O  O     . ARG C 2 33  ? 5.600   -5.712  3.811   1.00 56.66 ? 429  ARG C O     1 
ATOM   4850 C  CB    . ARG C 2 33  ? 5.617   -6.921  0.753   1.00 57.42 ? 429  ARG C CB    1 
ATOM   4851 N  N     . SER C 2 34  ? 6.671   -4.412  2.325   1.00 54.24 ? 430  SER C N     1 
ATOM   4852 C  CA    . SER C 2 34  ? 7.548   -3.853  3.345   1.00 52.41 ? 430  SER C CA    1 
ATOM   4853 C  C     . SER C 2 34  ? 6.935   -2.610  4.009   1.00 50.97 ? 430  SER C C     1 
ATOM   4854 O  O     . SER C 2 34  ? 7.632   -1.691  4.441   1.00 51.66 ? 430  SER C O     1 
ATOM   4855 C  CB    . SER C 2 34  ? 8.951   -3.557  2.777   1.00 52.67 ? 430  SER C CB    1 
ATOM   4856 O  OG    . SER C 2 34  ? 8.936   -2.594  1.747   1.00 53.24 ? 430  SER C OG    1 
ATOM   4857 N  N     . HIS C 2 35  ? 5.610   -2.606  4.084   1.00 47.68 ? 431  HIS C N     1 
ATOM   4858 C  CA    . HIS C 2 35  ? 4.851   -1.543  4.727   1.00 44.43 ? 431  HIS C CA    1 
ATOM   4859 C  C     . HIS C 2 35  ? 5.404   -1.421  6.146   1.00 44.65 ? 431  HIS C C     1 
ATOM   4860 O  O     . HIS C 2 35  ? 5.584   -2.427  6.836   1.00 46.60 ? 431  HIS C O     1 
ATOM   4861 C  CB    . HIS C 2 35  ? 3.374   -1.961  4.755   1.00 41.91 ? 431  HIS C CB    1 
ATOM   4862 C  CG    . HIS C 2 35  ? 2.533   -1.216  5.745   1.00 40.52 ? 431  HIS C CG    1 
ATOM   4863 N  ND1   . HIS C 2 35  ? 1.960   0.004   5.467   1.00 39.27 ? 431  HIS C ND1   1 
ATOM   4864 C  CD2   . HIS C 2 35  ? 2.150   -1.536  7.006   1.00 38.73 ? 431  HIS C CD2   1 
ATOM   4865 C  CE1   . HIS C 2 35  ? 1.254   0.403   6.514   1.00 37.81 ? 431  HIS C CE1   1 
ATOM   4866 N  NE2   . HIS C 2 35  ? 1.354   -0.512  7.458   1.00 35.75 ? 431  HIS C NE2   1 
ATOM   4867 N  N     . GLY C 2 36  ? 5.677   -0.199  6.586   1.00 42.86 ? 432  GLY C N     1 
ATOM   4868 C  CA    . GLY C 2 36  ? 6.206   -0.013  7.925   1.00 39.60 ? 432  GLY C CA    1 
ATOM   4869 C  C     . GLY C 2 36  ? 7.705   0.239   7.971   1.00 38.26 ? 432  GLY C C     1 
ATOM   4870 O  O     . GLY C 2 36  ? 8.195   0.926   8.864   1.00 38.48 ? 432  GLY C O     1 
ATOM   4871 N  N     . LEU C 2 37  ? 8.439   -0.315  7.015   1.00 38.12 ? 433  LEU C N     1 
ATOM   4872 C  CA    . LEU C 2 37  ? 9.888   -0.136  6.963   1.00 38.24 ? 433  LEU C CA    1 
ATOM   4873 C  C     . LEU C 2 37  ? 10.216  1.356   6.980   1.00 36.12 ? 433  LEU C C     1 
ATOM   4874 O  O     . LEU C 2 37  ? 9.504   2.157   6.393   1.00 38.03 ? 433  LEU C O     1 
ATOM   4875 C  CB    . LEU C 2 37  ? 10.438  -0.792  5.688   1.00 41.10 ? 433  LEU C CB    1 
ATOM   4876 C  CG    . LEU C 2 37  ? 11.945  -1.049  5.586   1.00 42.60 ? 433  LEU C CG    1 
ATOM   4877 C  CD1   . LEU C 2 37  ? 12.233  -1.925  4.373   1.00 42.69 ? 433  LEU C CD1   1 
ATOM   4878 C  CD2   . LEU C 2 37  ? 12.688  0.267   5.475   1.00 44.93 ? 433  LEU C CD2   1 
ATOM   4879 N  N     . PHE C 2 38  ? 11.293  1.737   7.645   1.00 34.64 ? 434  PHE C N     1 
ATOM   4880 C  CA    . PHE C 2 38  ? 11.645  3.155   7.703   1.00 34.71 ? 434  PHE C CA    1 
ATOM   4881 C  C     . PHE C 2 38  ? 13.139  3.344   7.915   1.00 35.33 ? 434  PHE C C     1 
ATOM   4882 O  O     . PHE C 2 38  ? 13.870  2.397   8.204   1.00 33.06 ? 434  PHE C O     1 
ATOM   4883 C  CB    . PHE C 2 38  ? 10.941  3.820   8.882   1.00 32.44 ? 434  PHE C CB    1 
ATOM   4884 C  CG    . PHE C 2 38  ? 11.627  3.567   10.204  1.00 32.00 ? 434  PHE C CG    1 
ATOM   4885 C  CD1   . PHE C 2 38  ? 12.629  4.429   10.669  1.00 30.93 ? 434  PHE C CD1   1 
ATOM   4886 C  CD2   . PHE C 2 38  ? 11.328  2.436   10.952  1.00 30.57 ? 434  PHE C CD2   1 
ATOM   4887 C  CE1   . PHE C 2 38  ? 13.313  4.162   11.852  1.00 27.30 ? 434  PHE C CE1   1 
ATOM   4888 C  CE2   . PHE C 2 38  ? 12.012  2.164   12.137  1.00 28.78 ? 434  PHE C CE2   1 
ATOM   4889 C  CZ    . PHE C 2 38  ? 13.004  3.029   12.584  1.00 27.26 ? 434  PHE C CZ    1 
ATOM   4890 N  N     . VAL C 2 39  ? 13.572  4.589   7.782   1.00 36.53 ? 435  VAL C N     1 
ATOM   4891 C  CA    . VAL C 2 39  ? 14.954  4.956   8.030   1.00 37.94 ? 435  VAL C CA    1 
ATOM   4892 C  C     . VAL C 2 39  ? 14.974  6.407   8.468   1.00 38.22 ? 435  VAL C C     1 
ATOM   4893 O  O     . VAL C 2 39  ? 14.069  7.176   8.164   1.00 36.46 ? 435  VAL C O     1 
ATOM   4894 C  CB    . VAL C 2 39  ? 15.844  4.820   6.786   1.00 38.13 ? 435  VAL C CB    1 
ATOM   4895 C  CG1   . VAL C 2 39  ? 15.772  3.412   6.269   1.00 39.32 ? 435  VAL C CG1   1 
ATOM   4896 C  CG2   . VAL C 2 39  ? 15.440  5.832   5.724   1.00 37.41 ? 435  VAL C CG2   1 
ATOM   4897 N  N     . ILE C 2 40  ? 16.009  6.781   9.196   1.00 39.28 ? 436  ILE C N     1 
ATOM   4898 C  CA    . ILE C 2 40  ? 16.125  8.154   9.623   1.00 39.72 ? 436  ILE C CA    1 
ATOM   4899 C  C     . ILE C 2 40  ? 17.377  8.676   8.959   1.00 41.31 ? 436  ILE C C     1 
ATOM   4900 O  O     . ILE C 2 40  ? 18.390  7.985   8.900   1.00 42.38 ? 436  ILE C O     1 
ATOM   4901 C  CB    . ILE C 2 40  ? 16.194  8.250   11.138  1.00 39.17 ? 436  ILE C CB    1 
ATOM   4902 C  CG1   . ILE C 2 40  ? 14.846  7.797   11.709  1.00 37.56 ? 436  ILE C CG1   1 
ATOM   4903 C  CG2   . ILE C 2 40  ? 16.547  9.671   11.557  1.00 36.80 ? 436  ILE C CG2   1 
ATOM   4904 C  CD1   . ILE C 2 40  ? 14.764  7.808   13.188  1.00 37.22 ? 436  ILE C CD1   1 
ATOM   4905 N  N     . ARG C 2 41  ? 17.295  9.895   8.449   1.00 42.33 ? 437  ARG C N     1 
ATOM   4906 C  CA    . ARG C 2 41  ? 18.398  10.502  7.733   1.00 43.51 ? 437  ARG C CA    1 
ATOM   4907 C  C     . ARG C 2 41  ? 18.526  11.972  8.085   1.00 46.38 ? 437  ARG C C     1 
ATOM   4908 O  O     . ARG C 2 41  ? 17.643  12.552  8.724   1.00 46.15 ? 437  ARG C O     1 
ATOM   4909 C  CB    . ARG C 2 41  ? 18.149  10.364  6.225   1.00 42.01 ? 437  ARG C CB    1 
ATOM   4910 C  CG    . ARG C 2 41  ? 16.859  11.057  5.729   1.00 37.37 ? 437  ARG C CG    1 
ATOM   4911 C  CD    . ARG C 2 41  ? 16.616  10.818  4.218   1.00 35.09 ? 437  ARG C CD    1 
ATOM   4912 N  NE    . ARG C 2 41  ? 15.310  11.303  3.752   1.00 33.88 ? 437  ARG C NE    1 
ATOM   4913 C  CZ    . ARG C 2 41  ? 14.997  12.583  3.529   1.00 33.49 ? 437  ARG C CZ    1 
ATOM   4914 N  NH1   . ARG C 2 41  ? 15.897  13.547  3.720   1.00 29.90 ? 437  ARG C NH1   1 
ATOM   4915 N  NH2   . ARG C 2 41  ? 13.773  12.903  3.114   1.00 28.90 ? 437  ARG C NH2   1 
ATOM   4916 N  N     . GLN C 2 42  ? 19.633  12.574  7.667   1.00 49.08 ? 438  GLN C N     1 
ATOM   4917 C  CA    . GLN C 2 42  ? 19.842  13.992  7.910   1.00 53.36 ? 438  GLN C CA    1 
ATOM   4918 C  C     . GLN C 2 42  ? 19.063  14.705  6.820   1.00 55.46 ? 438  GLN C C     1 
ATOM   4919 O  O     . GLN C 2 42  ? 19.114  14.308  5.655   1.00 56.26 ? 438  GLN C O     1 
ATOM   4920 C  CB    . GLN C 2 42  ? 21.320  14.375  7.779   1.00 53.93 ? 438  GLN C CB    1 
ATOM   4921 C  CG    . GLN C 2 42  ? 22.264  13.626  8.693   1.00 55.62 ? 438  GLN C CG    1 
ATOM   4922 C  CD    . GLN C 2 42  ? 23.546  14.410  8.993   1.00 57.31 ? 438  GLN C CD    1 
ATOM   4923 O  OE1   . GLN C 2 42  ? 24.471  13.877  9.617   1.00 56.76 ? 438  GLN C OE1   1 
ATOM   4924 N  NE2   . GLN C 2 42  ? 23.599  15.680  8.565   1.00 54.96 ? 438  GLN C NE2   1 
ATOM   4925 N  N     . SER C 2 43  ? 18.342  15.754  7.182   1.00 58.02 ? 439  SER C N     1 
ATOM   4926 C  CA    . SER C 2 43  ? 17.579  16.480  6.180   1.00 60.95 ? 439  SER C CA    1 
ATOM   4927 C  C     . SER C 2 43  ? 18.478  17.047  5.093   1.00 62.94 ? 439  SER C C     1 
ATOM   4928 O  O     . SER C 2 43  ? 19.601  17.486  5.365   1.00 63.16 ? 439  SER C O     1 
ATOM   4929 C  CB    . SER C 2 43  ? 16.806  17.633  6.812   1.00 60.29 ? 439  SER C CB    1 
ATOM   4930 O  OG    . SER C 2 43  ? 16.275  18.471  5.803   1.00 59.36 ? 439  SER C OG    1 
ATOM   4931 N  N     . GLU C 2 44  ? 17.973  17.032  3.862   1.00 64.27 ? 440  GLU C N     1 
ATOM   4932 C  CA    . GLU C 2 44  ? 18.689  17.582  2.719   1.00 65.01 ? 440  GLU C CA    1 
ATOM   4933 C  C     . GLU C 2 44  ? 18.510  19.092  2.759   1.00 66.60 ? 440  GLU C C     1 
ATOM   4934 O  O     . GLU C 2 44  ? 19.452  19.845  2.532   1.00 67.11 ? 440  GLU C O     1 
ATOM   4935 C  CB    . GLU C 2 44  ? 18.107  17.071  1.403   1.00 63.28 ? 440  GLU C CB    1 
ATOM   4936 C  CG    . GLU C 2 44  ? 18.441  15.639  1.058   1.00 62.56 ? 440  GLU C CG    1 
ATOM   4937 C  CD    . GLU C 2 44  ? 17.872  15.242  -0.288  1.00 63.04 ? 440  GLU C CD    1 
ATOM   4938 O  OE1   . GLU C 2 44  ? 18.280  14.191  -0.832  1.00 61.01 ? 440  GLU C OE1   1 
ATOM   4939 O  OE2   . GLU C 2 44  ? 17.007  15.989  -0.799  1.00 65.81 ? 440  GLU C OE2   1 
ATOM   4940 N  N     . THR C 2 45  ? 17.287  19.524  3.053   1.00 67.75 ? 441  THR C N     1 
ATOM   4941 C  CA    . THR C 2 45  ? 16.975  20.944  3.119   1.00 69.52 ? 441  THR C CA    1 
ATOM   4942 C  C     . THR C 2 45  ? 17.318  21.576  4.476   1.00 70.91 ? 441  THR C C     1 
ATOM   4943 O  O     . THR C 2 45  ? 18.302  22.299  4.575   1.00 72.63 ? 441  THR C O     1 
ATOM   4944 C  CB    . THR C 2 45  ? 15.488  21.192  2.760   1.00 69.33 ? 441  THR C CB    1 
ATOM   4945 O  OG1   . THR C 2 45  ? 14.641  20.425  3.625   1.00 70.04 ? 441  THR C OG1   1 
ATOM   4946 C  CG2   . THR C 2 45  ? 15.222  20.779  1.309   1.00 67.90 ? 441  THR C CG2   1 
ATOM   4947 N  N     . ARG C 2 46  ? 16.531  21.316  5.518   1.00 72.30 ? 442  ARG C N     1 
ATOM   4948 C  CA    . ARG C 2 46  ? 16.818  21.893  6.842   1.00 73.88 ? 442  ARG C CA    1 
ATOM   4949 C  C     . ARG C 2 46  ? 18.053  21.254  7.466   1.00 73.88 ? 442  ARG C C     1 
ATOM   4950 O  O     . ARG C 2 46  ? 18.019  20.100  7.890   1.00 74.87 ? 442  ARG C O     1 
ATOM   4951 C  CB    . ARG C 2 46  ? 15.637  21.704  7.798   1.00 75.82 ? 442  ARG C CB    1 
ATOM   4952 C  CG    . ARG C 2 46  ? 14.364  22.379  7.346   1.00 79.03 ? 442  ARG C CG    1 
ATOM   4953 C  CD    . ARG C 2 46  ? 13.170  21.963  8.190   1.00 81.77 ? 442  ARG C CD    1 
ATOM   4954 N  NE    . ARG C 2 46  ? 11.916  22.406  7.582   1.00 84.59 ? 442  ARG C NE    1 
ATOM   4955 C  CZ    . ARG C 2 46  ? 11.523  22.071  6.354   1.00 85.50 ? 442  ARG C CZ    1 
ATOM   4956 N  NH1   . ARG C 2 46  ? 12.286  21.284  5.602   1.00 85.48 ? 442  ARG C NH1   1 
ATOM   4957 N  NH2   . ARG C 2 46  ? 10.375  22.535  5.871   1.00 85.21 ? 442  ARG C NH2   1 
ATOM   4958 N  N     . PRO C 2 47  ? 19.157  22.011  7.554   1.00 73.87 ? 443  PRO C N     1 
ATOM   4959 C  CA    . PRO C 2 47  ? 20.413  21.519  8.128   1.00 72.56 ? 443  PRO C CA    1 
ATOM   4960 C  C     . PRO C 2 47  ? 20.289  21.294  9.628   1.00 71.04 ? 443  PRO C C     1 
ATOM   4961 O  O     . PRO C 2 47  ? 19.594  22.045  10.316  1.00 71.28 ? 443  PRO C O     1 
ATOM   4962 C  CB    . PRO C 2 47  ? 21.385  22.643  7.811   1.00 73.21 ? 443  PRO C CB    1 
ATOM   4963 C  CG    . PRO C 2 47  ? 20.524  23.853  8.026   1.00 73.35 ? 443  PRO C CG    1 
ATOM   4964 C  CD    . PRO C 2 47  ? 19.235  23.466  7.311   1.00 74.34 ? 443  PRO C CD    1 
ATOM   4965 N  N     . GLY C 2 48  ? 20.965  20.265  10.128  1.00 68.88 ? 444  GLY C N     1 
ATOM   4966 C  CA    . GLY C 2 48  ? 20.912  19.978  11.548  1.00 66.13 ? 444  GLY C CA    1 
ATOM   4967 C  C     . GLY C 2 48  ? 19.726  19.113  11.911  1.00 64.46 ? 444  GLY C C     1 
ATOM   4968 O  O     . GLY C 2 48  ? 19.774  18.349  12.875  1.00 64.93 ? 444  GLY C O     1 
ATOM   4969 N  N     . GLU C 2 49  ? 18.652  19.230  11.138  1.00 62.16 ? 445  GLU C N     1 
ATOM   4970 C  CA    . GLU C 2 49  ? 17.458  18.442  11.393  1.00 59.44 ? 445  GLU C CA    1 
ATOM   4971 C  C     . GLU C 2 49  ? 17.531  17.073  10.724  1.00 55.47 ? 445  GLU C C     1 
ATOM   4972 O  O     . GLU C 2 49  ? 18.371  16.821  9.859   1.00 53.62 ? 445  GLU C O     1 
ATOM   4973 C  CB    . GLU C 2 49  ? 16.220  19.200  10.914  1.00 61.29 ? 445  GLU C CB    1 
ATOM   4974 C  CG    . GLU C 2 49  ? 15.844  20.401  11.783  1.00 64.70 ? 445  GLU C CG    1 
ATOM   4975 C  CD    . GLU C 2 49  ? 14.668  21.196  11.212  1.00 67.69 ? 445  GLU C CD    1 
ATOM   4976 O  OE1   . GLU C 2 49  ? 13.573  20.612  11.041  1.00 68.69 ? 445  GLU C OE1   1 
ATOM   4977 O  OE2   . GLU C 2 49  ? 14.838  22.407  10.931  1.00 68.83 ? 445  GLU C OE2   1 
ATOM   4978 N  N     . CYS C 2 50  ? 16.639  16.190  11.143  1.00 51.83 ? 446  CYS C N     1 
ATOM   4979 C  CA    . CYS C 2 50  ? 16.574  14.849  10.591  1.00 49.11 ? 446  CYS C CA    1 
ATOM   4980 C  C     . CYS C 2 50  ? 15.207  14.618  9.967   1.00 45.78 ? 446  CYS C C     1 
ATOM   4981 O  O     . CYS C 2 50  ? 14.270  15.381  10.191  1.00 43.13 ? 446  CYS C O     1 
ATOM   4982 C  CB    . CYS C 2 50  ? 16.811  13.809  11.691  1.00 48.62 ? 446  CYS C CB    1 
ATOM   4983 S  SG    . CYS C 2 50  ? 18.541  13.481  12.017  1.00 51.23 ? 446  CYS C SG    1 
ATOM   4984 N  N     . VAL C 2 51  ? 15.102  13.556  9.178   1.00 43.68 ? 447  VAL C N     1 
ATOM   4985 C  CA    . VAL C 2 51  ? 13.844  13.211  8.548   1.00 39.93 ? 447  VAL C CA    1 
ATOM   4986 C  C     . VAL C 2 51  ? 13.605  11.715  8.679   1.00 37.08 ? 447  VAL C C     1 
ATOM   4987 O  O     . VAL C 2 51  ? 14.521  10.916  8.559   1.00 35.54 ? 447  VAL C O     1 
ATOM   4988 C  CB    . VAL C 2 51  ? 13.833  13.607  7.044   1.00 40.73 ? 447  VAL C CB    1 
ATOM   4989 C  CG1   . VAL C 2 51  ? 12.524  13.154  6.385   1.00 39.98 ? 447  VAL C CG1   1 
ATOM   4990 C  CG2   . VAL C 2 51  ? 13.996  15.118  6.903   1.00 40.36 ? 447  VAL C CG2   1 
ATOM   4991 N  N     . LEU C 2 52  ? 12.360  11.352  8.940   1.00 36.97 ? 448  LEU C N     1 
ATOM   4992 C  CA    . LEU C 2 52  ? 11.966  9.954   9.055   1.00 36.61 ? 448  LEU C CA    1 
ATOM   4993 C  C     . LEU C 2 52  ? 11.278  9.604   7.744   1.00 35.22 ? 448  LEU C C     1 
ATOM   4994 O  O     . LEU C 2 52  ? 10.202  10.116  7.450   1.00 35.60 ? 448  LEU C O     1 
ATOM   4995 C  CB    . LEU C 2 52  ? 10.976  9.760   10.209  1.00 36.92 ? 448  LEU C CB    1 
ATOM   4996 C  CG    . LEU C 2 52  ? 10.133  8.480   10.202  1.00 39.78 ? 448  LEU C CG    1 
ATOM   4997 C  CD1   . LEU C 2 52  ? 11.010  7.257   10.418  1.00 39.65 ? 448  LEU C CD1   1 
ATOM   4998 C  CD2   . LEU C 2 52  ? 9.082   8.571   11.290  1.00 40.00 ? 448  LEU C CD2   1 
ATOM   4999 N  N     . THR C 2 53  ? 11.899  8.742   6.954   1.00 33.14 ? 449  THR C N     1 
ATOM   5000 C  CA    . THR C 2 53  ? 11.308  8.343   5.694   1.00 33.81 ? 449  THR C CA    1 
ATOM   5001 C  C     . THR C 2 53  ? 10.721  6.948   5.883   1.00 34.96 ? 449  THR C C     1 
ATOM   5002 O  O     . THR C 2 53  ? 11.414  6.031   6.318   1.00 34.90 ? 449  THR C O     1 
ATOM   5003 C  CB    . THR C 2 53  ? 12.370  8.322   4.574   1.00 34.26 ? 449  THR C CB    1 
ATOM   5004 O  OG1   . THR C 2 53  ? 12.899  9.649   4.383   1.00 31.65 ? 449  THR C OG1   1 
ATOM   5005 C  CG2   . THR C 2 53  ? 11.767  7.791   3.269   1.00 31.61 ? 449  THR C CG2   1 
ATOM   5006 N  N     . PHE C 2 54  ? 9.441   6.778   5.570   1.00 35.81 ? 450  PHE C N     1 
ATOM   5007 C  CA    . PHE C 2 54  ? 8.835   5.465   5.740   1.00 35.02 ? 450  PHE C CA    1 
ATOM   5008 C  C     . PHE C 2 54  ? 7.877   5.028   4.644   1.00 36.56 ? 450  PHE C C     1 
ATOM   5009 O  O     . PHE C 2 54  ? 7.409   5.828   3.829   1.00 37.53 ? 450  PHE C O     1 
ATOM   5010 C  CB    . PHE C 2 54  ? 8.151   5.378   7.109   1.00 31.58 ? 450  PHE C CB    1 
ATOM   5011 C  CG    . PHE C 2 54  ? 6.918   6.228   7.249   1.00 30.44 ? 450  PHE C CG    1 
ATOM   5012 C  CD1   . PHE C 2 54  ? 5.647   5.649   7.187   1.00 28.70 ? 450  PHE C CD1   1 
ATOM   5013 C  CD2   . PHE C 2 54  ? 7.020   7.596   7.499   1.00 30.36 ? 450  PHE C CD2   1 
ATOM   5014 C  CE1   . PHE C 2 54  ? 4.495   6.411   7.383   1.00 28.68 ? 450  PHE C CE1   1 
ATOM   5015 C  CE2   . PHE C 2 54  ? 5.871   8.376   7.697   1.00 29.26 ? 450  PHE C CE2   1 
ATOM   5016 C  CZ    . PHE C 2 54  ? 4.606   7.778   7.639   1.00 29.25 ? 450  PHE C CZ    1 
ATOM   5017 N  N     . ASN C 2 55  ? 7.601   3.734   4.648   1.00 37.29 ? 451  ASN C N     1 
ATOM   5018 C  CA    . ASN C 2 55  ? 6.728   3.112   3.682   1.00 38.26 ? 451  ASN C CA    1 
ATOM   5019 C  C     . ASN C 2 55  ? 5.326   2.986   4.240   1.00 39.80 ? 451  ASN C C     1 
ATOM   5020 O  O     . ASN C 2 55  ? 5.118   2.286   5.228   1.00 40.27 ? 451  ASN C O     1 
ATOM   5021 C  CB    . ASN C 2 55  ? 7.255   1.710   3.373   1.00 38.82 ? 451  ASN C CB    1 
ATOM   5022 C  CG    . ASN C 2 55  ? 6.307   0.890   2.498   1.00 37.97 ? 451  ASN C CG    1 
ATOM   5023 O  OD1   . ASN C 2 55  ? 5.080   0.930   2.650   1.00 37.40 ? 451  ASN C OD1   1 
ATOM   5024 N  ND2   . ASN C 2 55  ? 6.885   0.118   1.594   1.00 36.45 ? 451  ASN C ND2   1 
ATOM   5025 N  N     . PHE C 2 56  ? 4.361   3.658   3.629   1.00 40.48 ? 452  PHE C N     1 
ATOM   5026 C  CA    . PHE C 2 56  ? 2.997   3.481   4.082   1.00 40.82 ? 452  PHE C CA    1 
ATOM   5027 C  C     . PHE C 2 56  ? 2.203   2.876   2.926   1.00 41.46 ? 452  PHE C C     1 
ATOM   5028 O  O     . PHE C 2 56  ? 1.956   3.544   1.915   1.00 39.95 ? 452  PHE C O     1 
ATOM   5029 C  CB    . PHE C 2 56  ? 2.346   4.796   4.512   1.00 39.67 ? 452  PHE C CB    1 
ATOM   5030 C  CG    . PHE C 2 56  ? 1.013   4.594   5.175   1.00 39.07 ? 452  PHE C CG    1 
ATOM   5031 C  CD1   . PHE C 2 56  ? 0.941   4.178   6.505   1.00 38.66 ? 452  PHE C CD1   1 
ATOM   5032 C  CD2   . PHE C 2 56  ? -0.166  4.681   4.437   1.00 39.23 ? 452  PHE C CD2   1 
ATOM   5033 C  CE1   . PHE C 2 56  ? -0.277  3.843   7.088   1.00 39.27 ? 452  PHE C CE1   1 
ATOM   5034 C  CE2   . PHE C 2 56  ? -1.392  4.350   5.010   1.00 39.71 ? 452  PHE C CE2   1 
ATOM   5035 C  CZ    . PHE C 2 56  ? -1.447  3.925   6.339   1.00 39.47 ? 452  PHE C CZ    1 
ATOM   5036 N  N     . GLN C 2 57  ? 1.815   1.611   3.080   1.00 43.90 ? 453  GLN C N     1 
ATOM   5037 C  CA    . GLN C 2 57  ? 1.043   0.900   2.057   1.00 44.70 ? 453  GLN C CA    1 
ATOM   5038 C  C     . GLN C 2 57  ? 1.695   1.052   0.703   1.00 45.00 ? 453  GLN C C     1 
ATOM   5039 O  O     . GLN C 2 57  ? 1.011   1.296   -0.286  1.00 45.71 ? 453  GLN C O     1 
ATOM   5040 C  CB    . GLN C 2 57  ? -0.385  1.447   1.970   1.00 44.33 ? 453  GLN C CB    1 
ATOM   5041 C  CG    . GLN C 2 57  ? -1.384  0.798   2.896   1.00 47.00 ? 453  GLN C CG    1 
ATOM   5042 C  CD    . GLN C 2 57  ? -2.752  1.502   2.876   1.00 49.09 ? 453  GLN C CD    1 
ATOM   5043 O  OE1   . GLN C 2 57  ? -3.154  2.069   1.853   1.00 47.21 ? 453  GLN C OE1   1 
ATOM   5044 N  NE2   . GLN C 2 57  ? -3.475  1.441   3.985   1.00 49.96 ? 453  GLN C NE2   1 
ATOM   5045 N  N     . GLY C 2 58  ? 3.016   0.926   0.655   1.00 45.73 ? 454  GLY C N     1 
ATOM   5046 C  CA    . GLY C 2 58  ? 3.707   1.040   -0.618  1.00 45.26 ? 454  GLY C CA    1 
ATOM   5047 C  C     . GLY C 2 58  ? 4.061   2.445   -1.048  1.00 45.93 ? 454  GLY C C     1 
ATOM   5048 O  O     . GLY C 2 58  ? 4.791   2.617   -2.020  1.00 46.95 ? 454  GLY C O     1 
ATOM   5049 N  N     . LYS C 2 59  ? 3.544   3.457   -0.355  1.00 45.94 ? 455  LYS C N     1 
ATOM   5050 C  CA    . LYS C 2 59  ? 3.880   4.833   -0.713  1.00 45.93 ? 455  LYS C CA    1 
ATOM   5051 C  C     . LYS C 2 59  ? 4.909   5.391   0.272   1.00 44.69 ? 455  LYS C C     1 
ATOM   5052 O  O     . LYS C 2 59  ? 4.868   5.113   1.476   1.00 45.28 ? 455  LYS C O     1 
ATOM   5053 C  CB    . LYS C 2 59  ? 2.630   5.725   -0.763  1.00 46.64 ? 455  LYS C CB    1 
ATOM   5054 C  CG    . LYS C 2 59  ? 1.791   5.584   -2.052  1.00 47.48 ? 455  LYS C CG    1 
ATOM   5055 C  CD    . LYS C 2 59  ? 0.609   4.647   -1.835  1.00 51.65 ? 455  LYS C CD    1 
ATOM   5056 C  CE    . LYS C 2 59  ? -0.339  5.249   -0.814  1.00 54.07 ? 455  LYS C CE    1 
ATOM   5057 N  NZ    . LYS C 2 59  ? -1.357  4.269   -0.305  1.00 52.84 ? 455  LYS C NZ    1 
ATOM   5058 N  N     . ALA C 2 60  ? 5.843   6.171   -0.251  1.00 42.52 ? 456  ALA C N     1 
ATOM   5059 C  CA    . ALA C 2 60  ? 6.898   6.755   0.565   1.00 42.73 ? 456  ALA C CA    1 
ATOM   5060 C  C     . ALA C 2 60  ? 6.461   8.070   1.200   1.00 41.97 ? 456  ALA C C     1 
ATOM   5061 O  O     . ALA C 2 60  ? 5.894   8.923   0.524   1.00 42.00 ? 456  ALA C O     1 
ATOM   5062 C  CB    . ALA C 2 60  ? 8.136   6.981   -0.290  1.00 39.77 ? 456  ALA C CB    1 
ATOM   5063 N  N     . LYS C 2 61  ? 6.736   8.223   2.495   1.00 41.11 ? 457  LYS C N     1 
ATOM   5064 C  CA    . LYS C 2 61  ? 6.382   9.428   3.233   1.00 39.96 ? 457  LYS C CA    1 
ATOM   5065 C  C     . LYS C 2 61  ? 7.597   9.963   3.978   1.00 40.59 ? 457  LYS C C     1 
ATOM   5066 O  O     . LYS C 2 61  ? 8.441   9.197   4.437   1.00 43.72 ? 457  LYS C O     1 
ATOM   5067 C  CB    . LYS C 2 61  ? 5.271   9.118   4.228   1.00 38.81 ? 457  LYS C CB    1 
ATOM   5068 C  CG    . LYS C 2 61  ? 4.085   8.368   3.652   1.00 36.57 ? 457  LYS C CG    1 
ATOM   5069 C  CD    . LYS C 2 61  ? 3.371   9.143   2.584   1.00 34.26 ? 457  LYS C CD    1 
ATOM   5070 C  CE    . LYS C 2 61  ? 2.104   8.406   2.151   1.00 35.40 ? 457  LYS C CE    1 
ATOM   5071 N  NZ    . LYS C 2 61  ? 1.345   9.137   1.100   1.00 27.55 ? 457  LYS C NZ    1 
ATOM   5072 N  N     . HIS C 2 62  ? 7.692   11.281  4.099   1.00 40.42 ? 458  HIS C N     1 
ATOM   5073 C  CA    . HIS C 2 62  ? 8.825   11.896  4.793   1.00 41.05 ? 458  HIS C CA    1 
ATOM   5074 C  C     . HIS C 2 62  ? 8.364   12.806  5.922   1.00 40.36 ? 458  HIS C C     1 
ATOM   5075 O  O     . HIS C 2 62  ? 7.632   13.763  5.704   1.00 41.05 ? 458  HIS C O     1 
ATOM   5076 C  CB    . HIS C 2 62  ? 9.701   12.698  3.822   1.00 41.04 ? 458  HIS C CB    1 
ATOM   5077 C  CG    . HIS C 2 62  ? 10.234  11.893  2.683   1.00 42.42 ? 458  HIS C CG    1 
ATOM   5078 N  ND1   . HIS C 2 62  ? 9.492   11.622  1.551   1.00 45.41 ? 458  HIS C ND1   1 
ATOM   5079 C  CD2   . HIS C 2 62  ? 11.423  11.278  2.503   1.00 44.53 ? 458  HIS C CD2   1 
ATOM   5080 C  CE1   . HIS C 2 62  ? 10.202  10.876  0.727   1.00 44.53 ? 458  HIS C CE1   1 
ATOM   5081 N  NE2   . HIS C 2 62  ? 11.380  10.651  1.280   1.00 43.57 ? 458  HIS C NE2   1 
ATOM   5082 N  N     . LEU C 2 63  ? 8.812   12.502  7.131   1.00 39.83 ? 459  LEU C N     1 
ATOM   5083 C  CA    . LEU C 2 63  ? 8.428   13.262  8.309   1.00 39.83 ? 459  LEU C CA    1 
ATOM   5084 C  C     . LEU C 2 63  ? 9.607   14.033  8.893   1.00 39.80 ? 459  LEU C C     1 
ATOM   5085 O  O     . LEU C 2 63  ? 10.614  13.436  9.262   1.00 41.15 ? 459  LEU C O     1 
ATOM   5086 C  CB    . LEU C 2 63  ? 7.858   12.284  9.342   1.00 40.29 ? 459  LEU C CB    1 
ATOM   5087 C  CG    . LEU C 2 63  ? 6.528   12.563  10.050  1.00 41.47 ? 459  LEU C CG    1 
ATOM   5088 C  CD1   . LEU C 2 63  ? 5.476   13.105  9.071   1.00 38.68 ? 459  LEU C CD1   1 
ATOM   5089 C  CD2   . LEU C 2 63  ? 6.061   11.266  10.710  1.00 40.34 ? 459  LEU C CD2   1 
ATOM   5090 N  N     . ARG C 2 64  ? 9.485   15.356  8.972   1.00 40.35 ? 460  ARG C N     1 
ATOM   5091 C  CA    . ARG C 2 64  ? 10.552  16.193  9.525   1.00 41.75 ? 460  ARG C CA    1 
ATOM   5092 C  C     . ARG C 2 64  ? 10.580  16.042  11.049  1.00 42.69 ? 460  ARG C C     1 
ATOM   5093 O  O     . ARG C 2 64  ? 9.544   16.137  11.700  1.00 42.27 ? 460  ARG C O     1 
ATOM   5094 C  CB    . ARG C 2 64  ? 10.315  17.671  9.203   1.00 40.39 ? 460  ARG C CB    1 
ATOM   5095 C  CG    . ARG C 2 64  ? 9.808   18.009  7.804   1.00 40.55 ? 460  ARG C CG    1 
ATOM   5096 C  CD    . ARG C 2 64  ? 9.677   19.523  7.733   1.00 44.26 ? 460  ARG C CD    1 
ATOM   5097 N  NE    . ARG C 2 64  ? 8.909   20.086  6.613   1.00 45.18 ? 460  ARG C NE    1 
ATOM   5098 C  CZ    . ARG C 2 64  ? 7.619   19.866  6.372   1.00 43.21 ? 460  ARG C CZ    1 
ATOM   5099 N  NH1   . ARG C 2 64  ? 6.898   19.071  7.152   1.00 42.13 ? 460  ARG C NH1   1 
ATOM   5100 N  NH2   . ARG C 2 64  ? 7.035   20.495  5.367   1.00 43.60 ? 460  ARG C NH2   1 
ATOM   5101 N  N     . LEU C 2 65  ? 11.760  15.817  11.616  1.00 45.34 ? 461  LEU C N     1 
ATOM   5102 C  CA    . LEU C 2 65  ? 11.889  15.664  13.063  1.00 47.57 ? 461  LEU C CA    1 
ATOM   5103 C  C     . LEU C 2 65  ? 12.830  16.691  13.682  1.00 52.52 ? 461  LEU C C     1 
ATOM   5104 O  O     . LEU C 2 65  ? 13.622  17.341  12.992  1.00 54.15 ? 461  LEU C O     1 
ATOM   5105 C  CB    . LEU C 2 65  ? 12.462  14.298  13.399  1.00 42.14 ? 461  LEU C CB    1 
ATOM   5106 C  CG    . LEU C 2 65  ? 11.915  13.071  12.712  1.00 38.77 ? 461  LEU C CG    1 
ATOM   5107 C  CD1   . LEU C 2 65  ? 13.025  12.035  12.663  1.00 36.35 ? 461  LEU C CD1   1 
ATOM   5108 C  CD2   . LEU C 2 65  ? 10.687  12.558  13.446  1.00 35.79 ? 461  LEU C CD2   1 
ATOM   5109 N  N     . SER C 2 66  ? 12.734  16.824  15.000  1.00 57.81 ? 462  SER C N     1 
ATOM   5110 C  CA    . SER C 2 66  ? 13.634  17.695  15.745  1.00 63.27 ? 462  SER C CA    1 
ATOM   5111 C  C     . SER C 2 66  ? 14.532  16.673  16.457  1.00 66.03 ? 462  SER C C     1 
ATOM   5112 O  O     . SER C 2 66  ? 14.218  16.211  17.553  1.00 65.77 ? 462  SER C O     1 
ATOM   5113 C  CB    . SER C 2 66  ? 12.856  18.558  16.746  1.00 63.61 ? 462  SER C CB    1 
ATOM   5114 O  OG    . SER C 2 66  ? 11.930  17.786  17.492  1.00 65.50 ? 462  SER C OG    1 
ATOM   5115 N  N     . LEU C 2 67  ? 15.646  16.312  15.819  1.00 69.16 ? 463  LEU C N     1 
ATOM   5116 C  CA    . LEU C 2 67  ? 16.541  15.307  16.389  1.00 71.67 ? 463  LEU C CA    1 
ATOM   5117 C  C     . LEU C 2 67  ? 18.034  15.677  16.406  1.00 73.91 ? 463  LEU C C     1 
ATOM   5118 O  O     . LEU C 2 67  ? 18.413  16.806  16.079  1.00 74.70 ? 463  LEU C O     1 
ATOM   5119 C  CB    . LEU C 2 67  ? 16.331  13.987  15.642  1.00 71.33 ? 463  LEU C CB    1 
ATOM   5120 C  CG    . LEU C 2 67  ? 16.761  12.680  16.309  1.00 71.52 ? 463  LEU C CG    1 
ATOM   5121 C  CD1   . LEU C 2 67  ? 16.120  12.554  17.678  1.00 70.60 ? 463  LEU C CD1   1 
ATOM   5122 C  CD2   . LEU C 2 67  ? 16.355  11.514  15.425  1.00 70.09 ? 463  LEU C CD2   1 
ATOM   5123 N  N     . ASN C 2 68  ? 18.865  14.707  16.798  1.00 75.23 ? 464  ASN C N     1 
ATOM   5124 C  CA    . ASN C 2 68  ? 20.317  14.854  16.893  1.00 76.11 ? 464  ASN C CA    1 
ATOM   5125 C  C     . ASN C 2 68  ? 20.713  15.436  18.241  1.00 77.67 ? 464  ASN C C     1 
ATOM   5126 O  O     . ASN C 2 68  ? 21.530  14.857  18.962  1.00 79.16 ? 464  ASN C O     1 
ATOM   5127 C  CB    . ASN C 2 68  ? 20.855  15.738  15.767  1.00 76.22 ? 464  ASN C CB    1 
ATOM   5128 N  N     . GLY C 2 71  ? 21.619  15.754  22.339  1.00 76.99 ? 467  GLY C N     1 
ATOM   5129 C  CA    . GLY C 2 71  ? 21.306  15.480  23.736  1.00 76.78 ? 467  GLY C CA    1 
ATOM   5130 C  C     . GLY C 2 71  ? 19.815  15.510  24.025  1.00 75.92 ? 467  GLY C C     1 
ATOM   5131 O  O     . GLY C 2 71  ? 19.069  16.209  23.336  1.00 76.65 ? 467  GLY C O     1 
ATOM   5132 N  N     . GLN C 2 72  ? 19.384  14.760  25.039  1.00 74.76 ? 468  GLN C N     1 
ATOM   5133 C  CA    . GLN C 2 72  ? 17.972  14.701  25.416  1.00 73.24 ? 468  GLN C CA    1 
ATOM   5134 C  C     . GLN C 2 72  ? 17.168  13.905  24.394  1.00 69.95 ? 468  GLN C C     1 
ATOM   5135 O  O     . GLN C 2 72  ? 15.939  13.790  24.503  1.00 70.85 ? 468  GLN C O     1 
ATOM   5136 C  CB    . GLN C 2 72  ? 17.361  16.109  25.526  1.00 76.37 ? 468  GLN C CB    1 
ATOM   5137 C  CG    . GLN C 2 72  ? 18.117  17.056  26.460  1.00 80.94 ? 468  GLN C CG    1 
ATOM   5138 C  CD    . GLN C 2 72  ? 17.377  18.369  26.700  1.00 83.73 ? 468  GLN C CD    1 
ATOM   5139 O  OE1   . GLN C 2 72  ? 17.009  19.082  25.750  1.00 84.24 ? 468  GLN C OE1   1 
ATOM   5140 N  NE2   . GLN C 2 72  ? 17.160  18.699  27.977  1.00 84.15 ? 468  GLN C NE2   1 
ATOM   5141 N  N     . CYS C 2 73  ? 17.862  13.364  23.397  1.00 65.49 ? 469  CYS C N     1 
ATOM   5142 C  CA    . CYS C 2 73  ? 17.202  12.591  22.353  1.00 60.75 ? 469  CYS C CA    1 
ATOM   5143 C  C     . CYS C 2 73  ? 17.342  11.079  22.530  1.00 56.09 ? 469  CYS C C     1 
ATOM   5144 O  O     . CYS C 2 73  ? 16.921  10.309  21.665  1.00 54.59 ? 469  CYS C O     1 
ATOM   5145 C  CB    . CYS C 2 73  ? 17.735  13.003  20.983  1.00 61.90 ? 469  CYS C CB    1 
ATOM   5146 S  SG    . CYS C 2 73  ? 17.287  14.686  20.466  1.00 66.72 ? 469  CYS C SG    1 
ATOM   5147 N  N     . HIS C 2 74  ? 17.922  10.656  23.647  1.00 51.60 ? 470  HIS C N     1 
ATOM   5148 C  CA    . HIS C 2 74  ? 18.123  9.235   23.906  1.00 48.84 ? 470  HIS C CA    1 
ATOM   5149 C  C     . HIS C 2 74  ? 16.813  8.438   23.905  1.00 48.23 ? 470  HIS C C     1 
ATOM   5150 O  O     . HIS C 2 74  ? 16.717  7.389   23.263  1.00 47.48 ? 470  HIS C O     1 
ATOM   5151 C  CB    . HIS C 2 74  ? 18.841  9.031   25.244  1.00 46.68 ? 470  HIS C CB    1 
ATOM   5152 C  CG    . HIS C 2 74  ? 19.068  7.590   25.598  1.00 45.18 ? 470  HIS C CG    1 
ATOM   5153 N  ND1   . HIS C 2 74  ? 19.965  6.784   24.925  1.00 45.95 ? 470  HIS C ND1   1 
ATOM   5154 C  CD2   . HIS C 2 74  ? 18.510  6.808   26.556  1.00 43.84 ? 470  HIS C CD2   1 
ATOM   5155 C  CE1   . HIS C 2 74  ? 19.945  5.573   25.449  1.00 44.34 ? 470  HIS C CE1   1 
ATOM   5156 N  NE2   . HIS C 2 74  ? 19.072  5.562   26.441  1.00 44.80 ? 470  HIS C NE2   1 
ATOM   5157 N  N     . VAL C 2 75  ? 15.806  8.924   24.622  1.00 45.81 ? 471  VAL C N     1 
ATOM   5158 C  CA    . VAL C 2 75  ? 14.543  8.215   24.690  1.00 42.48 ? 471  VAL C CA    1 
ATOM   5159 C  C     . VAL C 2 75  ? 13.889  8.113   23.317  1.00 42.49 ? 471  VAL C C     1 
ATOM   5160 O  O     . VAL C 2 75  ? 13.232  7.114   23.002  1.00 42.93 ? 471  VAL C O     1 
ATOM   5161 C  CB    . VAL C 2 75  ? 13.601  8.881   25.717  1.00 41.19 ? 471  VAL C CB    1 
ATOM   5162 C  CG1   . VAL C 2 75  ? 12.234  8.223   25.702  1.00 37.86 ? 471  VAL C CG1   1 
ATOM   5163 C  CG2   . VAL C 2 75  ? 14.215  8.743   27.106  1.00 39.22 ? 471  VAL C CG2   1 
ATOM   5164 N  N     . GLN C 2 76  ? 14.071  9.137   22.492  1.00 41.59 ? 472  GLN C N     1 
ATOM   5165 C  CA    . GLN C 2 76  ? 13.506  9.112   21.155  1.00 40.58 ? 472  GLN C CA    1 
ATOM   5166 C  C     . GLN C 2 76  ? 14.242  8.000   20.408  1.00 39.10 ? 472  GLN C C     1 
ATOM   5167 O  O     . GLN C 2 76  ? 13.649  7.257   19.634  1.00 39.66 ? 472  GLN C O     1 
ATOM   5168 C  CB    . GLN C 2 76  ? 13.711  10.463  20.475  1.00 43.06 ? 472  GLN C CB    1 
ATOM   5169 C  CG    . GLN C 2 76  ? 12.863  10.664  19.232  1.00 46.42 ? 472  GLN C CG    1 
ATOM   5170 C  CD    . GLN C 2 76  ? 12.976  12.072  18.664  1.00 49.00 ? 472  GLN C CD    1 
ATOM   5171 O  OE1   . GLN C 2 76  ? 12.438  12.369  17.589  1.00 50.45 ? 472  GLN C OE1   1 
ATOM   5172 N  NE2   . GLN C 2 76  ? 13.673  12.949  19.389  1.00 48.83 ? 472  GLN C NE2   1 
ATOM   5173 N  N     . HIS C 2 77  ? 15.543  7.878   20.645  1.00 37.09 ? 473  HIS C N     1 
ATOM   5174 C  CA    . HIS C 2 77  ? 16.308  6.826   19.996  1.00 36.54 ? 473  HIS C CA    1 
ATOM   5175 C  C     . HIS C 2 77  ? 15.754  5.475   20.428  1.00 36.53 ? 473  HIS C C     1 
ATOM   5176 O  O     . HIS C 2 77  ? 15.659  4.543   19.635  1.00 37.11 ? 473  HIS C O     1 
ATOM   5177 C  CB    . HIS C 2 77  ? 17.785  6.904   20.365  1.00 36.91 ? 473  HIS C CB    1 
ATOM   5178 C  CG    . HIS C 2 77  ? 18.464  8.158   19.909  1.00 38.65 ? 473  HIS C CG    1 
ATOM   5179 N  ND1   . HIS C 2 77  ? 19.778  8.437   20.204  1.00 37.06 ? 473  HIS C ND1   1 
ATOM   5180 C  CD2   . HIS C 2 77  ? 18.001  9.222   19.204  1.00 39.25 ? 473  HIS C CD2   1 
ATOM   5181 C  CE1   . HIS C 2 77  ? 20.099  9.619   19.703  1.00 39.79 ? 473  HIS C CE1   1 
ATOM   5182 N  NE2   . HIS C 2 77  ? 19.038  10.116  19.093  1.00 39.68 ? 473  HIS C NE2   1 
ATOM   5183 N  N     . LEU C 2 78  ? 15.382  5.362   21.691  1.00 35.83 ? 474  LEU C N     1 
ATOM   5184 C  CA    . LEU C 2 78  ? 14.833  4.110   22.179  1.00 37.01 ? 474  LEU C CA    1 
ATOM   5185 C  C     . LEU C 2 78  ? 13.526  3.797   21.440  1.00 37.35 ? 474  LEU C C     1 
ATOM   5186 O  O     . LEU C 2 78  ? 13.284  2.662   21.032  1.00 35.98 ? 474  LEU C O     1 
ATOM   5187 C  CB    . LEU C 2 78  ? 14.595  4.202   23.688  1.00 38.44 ? 474  LEU C CB    1 
ATOM   5188 C  CG    . LEU C 2 78  ? 15.835  4.567   24.519  1.00 40.73 ? 474  LEU C CG    1 
ATOM   5189 C  CD1   . LEU C 2 78  ? 15.469  4.541   26.003  1.00 41.35 ? 474  LEU C CD1   1 
ATOM   5190 C  CD2   . LEU C 2 78  ? 16.987  3.590   24.229  1.00 38.32 ? 474  LEU C CD2   1 
ATOM   5191 N  N     . TRP C 2 79  ? 12.687  4.817   21.269  1.00 36.92 ? 475  TRP C N     1 
ATOM   5192 C  CA    . TRP C 2 79  ? 11.428  4.644   20.572  1.00 34.80 ? 475  TRP C CA    1 
ATOM   5193 C  C     . TRP C 2 79  ? 11.691  4.045   19.195  1.00 35.03 ? 475  TRP C C     1 
ATOM   5194 O  O     . TRP C 2 79  ? 11.129  3.012   18.835  1.00 35.42 ? 475  TRP C O     1 
ATOM   5195 C  CB    . TRP C 2 79  ? 10.731  5.990   20.429  1.00 36.17 ? 475  TRP C CB    1 
ATOM   5196 C  CG    . TRP C 2 79  ? 9.638   5.990   19.402  1.00 37.93 ? 475  TRP C CG    1 
ATOM   5197 C  CD1   . TRP C 2 79  ? 9.538   6.799   18.301  1.00 38.26 ? 475  TRP C CD1   1 
ATOM   5198 C  CD2   . TRP C 2 79  ? 8.494   5.136   19.377  1.00 37.10 ? 475  TRP C CD2   1 
ATOM   5199 N  NE1   . TRP C 2 79  ? 8.398   6.499   17.592  1.00 37.86 ? 475  TRP C NE1   1 
ATOM   5200 C  CE2   . TRP C 2 79  ? 7.736   5.484   18.232  1.00 38.03 ? 475  TRP C CE2   1 
ATOM   5201 C  CE3   . TRP C 2 79  ? 8.030   4.112   20.212  1.00 35.91 ? 475  TRP C CE3   1 
ATOM   5202 C  CZ2   . TRP C 2 79  ? 6.544   4.838   17.899  1.00 38.37 ? 475  TRP C CZ2   1 
ATOM   5203 C  CZ3   . TRP C 2 79  ? 6.850   3.470   19.880  1.00 38.96 ? 475  TRP C CZ3   1 
ATOM   5204 C  CH2   . TRP C 2 79  ? 6.115   3.840   18.730  1.00 37.53 ? 475  TRP C CH2   1 
ATOM   5205 N  N     . PHE C 2 80  ? 12.556  4.685   18.420  1.00 33.94 ? 476  PHE C N     1 
ATOM   5206 C  CA    . PHE C 2 80  ? 12.846  4.179   17.093  1.00 34.28 ? 476  PHE C CA    1 
ATOM   5207 C  C     . PHE C 2 80  ? 13.482  2.791   17.091  1.00 33.88 ? 476  PHE C C     1 
ATOM   5208 O  O     . PHE C 2 80  ? 13.247  1.990   16.181  1.00 32.90 ? 476  PHE C O     1 
ATOM   5209 C  CB    . PHE C 2 80  ? 13.715  5.186   16.333  1.00 34.92 ? 476  PHE C CB    1 
ATOM   5210 C  CG    . PHE C 2 80  ? 12.974  6.443   15.933  1.00 34.49 ? 476  PHE C CG    1 
ATOM   5211 C  CD1   . PHE C 2 80  ? 11.885  6.376   15.069  1.00 32.15 ? 476  PHE C CD1   1 
ATOM   5212 C  CD2   . PHE C 2 80  ? 13.347  7.685   16.448  1.00 33.30 ? 476  PHE C CD2   1 
ATOM   5213 C  CE1   . PHE C 2 80  ? 11.174  7.519   14.725  1.00 31.57 ? 476  PHE C CE1   1 
ATOM   5214 C  CE2   . PHE C 2 80  ? 12.649  8.827   16.112  1.00 33.06 ? 476  PHE C CE2   1 
ATOM   5215 C  CZ    . PHE C 2 80  ? 11.555  8.744   15.247  1.00 33.39 ? 476  PHE C CZ    1 
ATOM   5216 N  N     . GLN C 2 81  ? 14.284  2.501   18.102  1.00 33.99 ? 477  GLN C N     1 
ATOM   5217 C  CA    . GLN C 2 81  ? 14.919  1.194   18.190  1.00 35.53 ? 477  GLN C CA    1 
ATOM   5218 C  C     . GLN C 2 81  ? 13.837  0.130   18.361  1.00 36.41 ? 477  GLN C C     1 
ATOM   5219 O  O     . GLN C 2 81  ? 13.867  -0.922  17.719  1.00 36.63 ? 477  GLN C O     1 
ATOM   5220 C  CB    . GLN C 2 81  ? 15.867  1.155   19.386  1.00 38.23 ? 477  GLN C CB    1 
ATOM   5221 C  CG    . GLN C 2 81  ? 16.616  -0.161  19.559  1.00 39.09 ? 477  GLN C CG    1 
ATOM   5222 C  CD    . GLN C 2 81  ? 17.279  -0.627  18.271  1.00 41.28 ? 477  GLN C CD    1 
ATOM   5223 O  OE1   . GLN C 2 81  ? 17.943  0.151   17.577  1.00 42.33 ? 477  GLN C OE1   1 
ATOM   5224 N  NE2   . GLN C 2 81  ? 17.109  -1.903  17.951  1.00 39.18 ? 477  GLN C NE2   1 
ATOM   5225 N  N     . SER C 2 82  ? 12.873  0.415   19.228  1.00 35.60 ? 478  SER C N     1 
ATOM   5226 C  CA    . SER C 2 82  ? 11.805  -0.524  19.479  1.00 35.32 ? 478  SER C CA    1 
ATOM   5227 C  C     . SER C 2 82  ? 10.975  -0.777  18.225  1.00 36.99 ? 478  SER C C     1 
ATOM   5228 O  O     . SER C 2 82  ? 10.521  -1.901  17.992  1.00 38.47 ? 478  SER C O     1 
ATOM   5229 C  CB    . SER C 2 82  ? 10.899  -0.013  20.600  1.00 35.61 ? 478  SER C CB    1 
ATOM   5230 O  OG    . SER C 2 82  ? 9.868   0.829   20.097  1.00 36.52 ? 478  SER C OG    1 
ATOM   5231 N  N     . VAL C 2 83  ? 10.760  0.255   17.414  1.00 36.51 ? 479  VAL C N     1 
ATOM   5232 C  CA    . VAL C 2 83  ? 9.975   0.064   16.201  1.00 38.01 ? 479  VAL C CA    1 
ATOM   5233 C  C     . VAL C 2 83  ? 10.800  -0.812  15.280  1.00 40.55 ? 479  VAL C C     1 
ATOM   5234 O  O     . VAL C 2 83  ? 10.300  -1.772  14.691  1.00 40.49 ? 479  VAL C O     1 
ATOM   5235 C  CB    . VAL C 2 83  ? 9.656   1.404   15.506  1.00 36.93 ? 479  VAL C CB    1 
ATOM   5236 C  CG1   . VAL C 2 83  ? 9.109   1.155   14.100  1.00 31.93 ? 479  VAL C CG1   1 
ATOM   5237 C  CG2   . VAL C 2 83  ? 8.638   2.176   16.337  1.00 34.05 ? 479  VAL C CG2   1 
ATOM   5238 N  N     . PHE C 2 84  ? 12.075  -0.468  15.168  1.00 43.14 ? 480  PHE C N     1 
ATOM   5239 C  CA    . PHE C 2 84  ? 13.000  -1.238  14.351  1.00 46.50 ? 480  PHE C CA    1 
ATOM   5240 C  C     . PHE C 2 84  ? 13.021  -2.687  14.836  1.00 47.96 ? 480  PHE C C     1 
ATOM   5241 O  O     . PHE C 2 84  ? 13.141  -3.615  14.039  1.00 46.75 ? 480  PHE C O     1 
ATOM   5242 C  CB    . PHE C 2 84  ? 14.411  -0.669  14.462  1.00 47.32 ? 480  PHE C CB    1 
ATOM   5243 C  CG    . PHE C 2 84  ? 15.438  -1.470  13.727  1.00 46.98 ? 480  PHE C CG    1 
ATOM   5244 C  CD1   . PHE C 2 84  ? 15.623  -1.298  12.363  1.00 47.43 ? 480  PHE C CD1   1 
ATOM   5245 C  CD2   . PHE C 2 84  ? 16.225  -2.399  14.401  1.00 47.88 ? 480  PHE C CD2   1 
ATOM   5246 C  CE1   . PHE C 2 84  ? 16.588  -2.040  11.676  1.00 48.10 ? 480  PHE C CE1   1 
ATOM   5247 C  CE2   . PHE C 2 84  ? 17.195  -3.150  13.729  1.00 46.39 ? 480  PHE C CE2   1 
ATOM   5248 C  CZ    . PHE C 2 84  ? 17.377  -2.969  12.364  1.00 47.24 ? 480  PHE C CZ    1 
ATOM   5249 N  N     . ASP C 2 85  ? 12.912  -2.876  16.146  1.00 49.70 ? 481  ASP C N     1 
ATOM   5250 C  CA    . ASP C 2 85  ? 12.914  -4.218  16.699  1.00 53.74 ? 481  ASP C CA    1 
ATOM   5251 C  C     . ASP C 2 85  ? 11.727  -5.009  16.180  1.00 57.23 ? 481  ASP C C     1 
ATOM   5252 O  O     . ASP C 2 85  ? 11.869  -6.170  15.808  1.00 58.74 ? 481  ASP C O     1 
ATOM   5253 C  CB    . ASP C 2 85  ? 12.848  -4.195  18.226  1.00 52.98 ? 481  ASP C CB    1 
ATOM   5254 C  CG    . ASP C 2 85  ? 14.159  -3.798  18.863  1.00 53.38 ? 481  ASP C CG    1 
ATOM   5255 O  OD1   . ASP C 2 85  ? 15.211  -3.960  18.201  1.00 53.12 ? 481  ASP C OD1   1 
ATOM   5256 O  OD2   . ASP C 2 85  ? 14.137  -3.343  20.032  1.00 51.59 ? 481  ASP C OD2   1 
ATOM   5257 N  N     . MET C 2 86  ? 10.553  -4.390  16.161  1.00 60.29 ? 482  MET C N     1 
ATOM   5258 C  CA    . MET C 2 86  ? 9.364   -5.079  15.679  1.00 63.13 ? 482  MET C CA    1 
ATOM   5259 C  C     . MET C 2 86  ? 9.535   -5.408  14.208  1.00 64.85 ? 482  MET C C     1 
ATOM   5260 O  O     . MET C 2 86  ? 9.102   -6.458  13.745  1.00 65.45 ? 482  MET C O     1 
ATOM   5261 C  CB    . MET C 2 86  ? 8.122   -4.214  15.906  1.00 64.52 ? 482  MET C CB    1 
ATOM   5262 C  CG    . MET C 2 86  ? 7.840   -3.973  17.389  1.00 66.55 ? 482  MET C CG    1 
ATOM   5263 S  SD    . MET C 2 86  ? 6.416   -2.913  17.737  1.00 71.18 ? 482  MET C SD    1 
ATOM   5264 C  CE    . MET C 2 86  ? 7.248   -1.359  18.186  1.00 68.01 ? 482  MET C CE    1 
ATOM   5265 N  N     . LEU C 2 87  ? 10.181  -4.505  13.478  1.00 66.96 ? 483  LEU C N     1 
ATOM   5266 C  CA    . LEU C 2 87  ? 10.424  -4.704  12.060  1.00 69.52 ? 483  LEU C CA    1 
ATOM   5267 C  C     . LEU C 2 87  ? 11.288  -5.929  11.819  1.00 72.93 ? 483  LEU C C     1 
ATOM   5268 O  O     . LEU C 2 87  ? 10.880  -6.841  11.103  1.00 73.53 ? 483  LEU C O     1 
ATOM   5269 C  CB    . LEU C 2 87  ? 11.110  -3.478  11.470  1.00 68.39 ? 483  LEU C CB    1 
ATOM   5270 C  CG    . LEU C 2 87  ? 10.229  -2.245  11.311  1.00 67.49 ? 483  LEU C CG    1 
ATOM   5271 C  CD1   . LEU C 2 87  ? 11.093  -1.039  11.034  1.00 67.43 ? 483  LEU C CD1   1 
ATOM   5272 C  CD2   . LEU C 2 87  ? 9.242   -2.478  10.180  1.00 66.58 ? 483  LEU C CD2   1 
ATOM   5273 N  N     . ARG C 2 88  ? 12.476  -5.942  12.423  1.00 77.12 ? 484  ARG C N     1 
ATOM   5274 C  CA    . ARG C 2 88  ? 13.420  -7.047  12.266  1.00 80.71 ? 484  ARG C CA    1 
ATOM   5275 C  C     . ARG C 2 88  ? 12.747  -8.415  12.430  1.00 82.46 ? 484  ARG C C     1 
ATOM   5276 O  O     . ARG C 2 88  ? 13.284  -9.431  11.988  1.00 82.46 ? 484  ARG C O     1 
ATOM   5277 C  CB    . ARG C 2 88  ? 14.578  -6.910  13.261  1.00 82.52 ? 484  ARG C CB    1 
ATOM   5278 C  CG    . ARG C 2 88  ? 14.179  -7.221  14.685  1.00 87.18 ? 484  ARG C CG    1 
ATOM   5279 C  CD    . ARG C 2 88  ? 15.305  -7.036  15.694  1.00 89.36 ? 484  ARG C CD    1 
ATOM   5280 N  NE    . ARG C 2 88  ? 14.817  -7.350  17.036  1.00 91.61 ? 484  ARG C NE    1 
ATOM   5281 C  CZ    . ARG C 2 88  ? 15.521  -7.213  18.155  1.00 92.48 ? 484  ARG C CZ    1 
ATOM   5282 N  NH1   . ARG C 2 88  ? 16.766  -6.761  18.104  1.00 93.40 ? 484  ARG C NH1   1 
ATOM   5283 N  NH2   . ARG C 2 88  ? 14.975  -7.524  19.327  1.00 92.55 ? 484  ARG C NH2   1 
ATOM   5284 N  N     . HIS C 2 89  ? 11.572  -8.437  13.057  1.00 84.12 ? 485  HIS C N     1 
ATOM   5285 C  CA    . HIS C 2 89  ? 10.834  -9.684  13.259  1.00 85.81 ? 485  HIS C CA    1 
ATOM   5286 C  C     . HIS C 2 89  ? 9.823   -9.953  12.138  1.00 87.35 ? 485  HIS C C     1 
ATOM   5287 O  O     . HIS C 2 89  ? 8.714   -10.427 12.399  1.00 87.76 ? 485  HIS C O     1 
ATOM   5288 C  CB    . HIS C 2 89  ? 10.098  -9.653  14.604  1.00 84.69 ? 485  HIS C CB    1 
ATOM   5289 N  N     . PHE C 2 90  ? 10.206  -9.650  10.897  1.00 88.48 ? 486  PHE C N     1 
ATOM   5290 C  CA    . PHE C 2 90  ? 9.340   -9.865  9.734   1.00 89.11 ? 486  PHE C CA    1 
ATOM   5291 C  C     . PHE C 2 90  ? 10.118  -10.443 8.552   1.00 89.41 ? 486  PHE C C     1 
ATOM   5292 O  O     . PHE C 2 90  ? 11.363  -10.500 8.651   1.00 89.86 ? 486  PHE C O     1 
ATOM   5293 C  CB    . PHE C 2 90  ? 8.670   -8.550  9.307   1.00 89.39 ? 486  PHE C CB    1 
ATOM   5294 C  CG    . PHE C 2 90  ? 7.377   -8.260  10.026  1.00 90.07 ? 486  PHE C CG    1 
ATOM   5295 C  CD1   . PHE C 2 90  ? 7.347   -8.098  11.410  1.00 90.58 ? 486  PHE C CD1   1 
ATOM   5296 C  CD2   . PHE C 2 90  ? 6.180   -8.166  9.319   1.00 90.78 ? 486  PHE C CD2   1 
ATOM   5297 C  CE1   . PHE C 2 90  ? 6.144   -7.848  12.083  1.00 90.13 ? 486  PHE C CE1   1 
ATOM   5298 C  CE2   . PHE C 2 90  ? 4.968   -7.915  9.982   1.00 90.93 ? 486  PHE C CE2   1 
ATOM   5299 C  CZ    . PHE C 2 90  ? 4.954   -7.758  11.367  1.00 90.37 ? 486  PHE C CZ    1 
ATOM   5300 N  N     . LEU D 2 6   ? -9.671  9.219   10.162  1.00 72.08 ? 402  LEU D N     1 
ATOM   5301 C  CA    . LEU D 2 6   ? -9.244  10.500  9.514   1.00 72.48 ? 402  LEU D CA    1 
ATOM   5302 C  C     . LEU D 2 6   ? -8.621  11.430  10.563  1.00 71.99 ? 402  LEU D C     1 
ATOM   5303 O  O     . LEU D 2 6   ? -7.551  12.010  10.347  1.00 72.64 ? 402  LEU D O     1 
ATOM   5304 C  CB    . LEU D 2 6   ? -10.461 11.182  8.854   1.00 72.76 ? 402  LEU D CB    1 
ATOM   5305 C  CG    . LEU D 2 6   ? -10.262 12.312  7.834   1.00 73.36 ? 402  LEU D CG    1 
ATOM   5306 C  CD1   . LEU D 2 6   ? -9.398  11.849  6.710   1.00 73.61 ? 402  LEU D CD1   1 
ATOM   5307 C  CD2   . LEU D 2 6   ? -11.590 12.760  7.310   1.00 73.30 ? 402  LEU D CD2   1 
ATOM   5308 N  N     . GLU D 2 7   ? -9.288  11.558  11.703  1.00 71.05 ? 403  GLU D N     1 
ATOM   5309 C  CA    . GLU D 2 7   ? -8.782  12.406  12.767  1.00 69.98 ? 403  GLU D CA    1 
ATOM   5310 C  C     . GLU D 2 7   ? -8.310  11.662  14.014  1.00 68.36 ? 403  GLU D C     1 
ATOM   5311 O  O     . GLU D 2 7   ? -8.849  10.617  14.380  1.00 68.69 ? 403  GLU D O     1 
ATOM   5312 C  CB    . GLU D 2 7   ? -9.828  13.461  13.131  1.00 71.53 ? 403  GLU D CB    1 
ATOM   5313 C  CG    . GLU D 2 7   ? -9.964  14.516  12.046  1.00 75.68 ? 403  GLU D CG    1 
ATOM   5314 C  CD    . GLU D 2 7   ? -10.959 15.615  12.386  1.00 78.08 ? 403  GLU D CD    1 
ATOM   5315 O  OE1   . GLU D 2 7   ? -11.173 15.867  13.595  1.00 79.09 ? 403  GLU D OE1   1 
ATOM   5316 O  OE2   . GLU D 2 7   ? -11.511 16.236  11.442  1.00 78.28 ? 403  GLU D OE2   1 
ATOM   5317 N  N     . LEU D 2 8   ? -7.294  12.233  14.652  1.00 65.81 ? 404  LEU D N     1 
ATOM   5318 C  CA    . LEU D 2 8   ? -6.655  11.700  15.857  1.00 63.74 ? 404  LEU D CA    1 
ATOM   5319 C  C     . LEU D 2 8   ? -7.591  10.866  16.723  1.00 62.58 ? 404  LEU D C     1 
ATOM   5320 O  O     . LEU D 2 8   ? -7.230  9.783   17.203  1.00 61.94 ? 404  LEU D O     1 
ATOM   5321 C  CB    . LEU D 2 8   ? -6.081  12.876  16.656  1.00 62.57 ? 404  LEU D CB    1 
ATOM   5322 C  CG    . LEU D 2 8   ? -4.991  12.666  17.710  1.00 63.00 ? 404  LEU D CG    1 
ATOM   5323 C  CD1   . LEU D 2 8   ? -3.970  11.659  17.228  1.00 62.38 ? 404  LEU D CD1   1 
ATOM   5324 C  CD2   . LEU D 2 8   ? -4.317  14.002  18.000  1.00 61.86 ? 404  LEU D CD2   1 
ATOM   5325 N  N     . SER D 2 9   ? -8.799  11.385  16.906  1.00 61.83 ? 405  SER D N     1 
ATOM   5326 C  CA    . SER D 2 9   ? -9.832  10.737  17.705  1.00 60.35 ? 405  SER D CA    1 
ATOM   5327 C  C     . SER D 2 9   ? -10.257 9.393   17.130  1.00 58.62 ? 405  SER D C     1 
ATOM   5328 O  O     . SER D 2 9   ? -10.708 8.515   17.860  1.00 58.85 ? 405  SER D O     1 
ATOM   5329 C  CB    . SER D 2 9   ? -11.071 11.642  17.783  1.00 60.97 ? 405  SER D CB    1 
ATOM   5330 O  OG    . SER D 2 9   ? -10.718 13.017  17.804  1.00 62.06 ? 405  SER D OG    1 
ATOM   5331 N  N     . ASP D 2 10  ? -10.107 9.240   15.820  1.00 56.67 ? 406  ASP D N     1 
ATOM   5332 C  CA    . ASP D 2 10  ? -10.524 8.022   15.142  1.00 56.40 ? 406  ASP D CA    1 
ATOM   5333 C  C     . ASP D 2 10  ? -9.513  6.866   15.102  1.00 55.55 ? 406  ASP D C     1 
ATOM   5334 O  O     . ASP D 2 10  ? -9.791  5.818   14.511  1.00 56.77 ? 406  ASP D O     1 
ATOM   5335 C  CB    . ASP D 2 10  ? -10.978 8.379   13.723  1.00 58.17 ? 406  ASP D CB    1 
ATOM   5336 C  CG    . ASP D 2 10  ? -11.923 9.582   13.695  1.00 59.93 ? 406  ASP D CG    1 
ATOM   5337 O  OD1   . ASP D 2 10  ? -12.940 9.572   14.428  1.00 61.09 ? 406  ASP D OD1   1 
ATOM   5338 O  OD2   . ASP D 2 10  ? -11.653 10.540  12.942  1.00 60.30 ? 406  ASP D OD2   1 
ATOM   5339 N  N     . TYR D 2 11  ? -8.351  7.042   15.725  1.00 52.72 ? 407  TYR D N     1 
ATOM   5340 C  CA    . TYR D 2 11  ? -7.340  5.992   15.738  1.00 50.04 ? 407  TYR D CA    1 
ATOM   5341 C  C     . TYR D 2 11  ? -7.346  5.221   17.044  1.00 48.19 ? 407  TYR D C     1 
ATOM   5342 O  O     . TYR D 2 11  ? -7.484  5.802   18.117  1.00 49.48 ? 407  TYR D O     1 
ATOM   5343 C  CB    . TYR D 2 11  ? -5.951  6.583   15.515  1.00 50.21 ? 407  TYR D CB    1 
ATOM   5344 C  CG    . TYR D 2 11  ? -5.756  7.163   14.140  1.00 49.05 ? 407  TYR D CG    1 
ATOM   5345 C  CD1   . TYR D 2 11  ? -5.542  6.339   13.039  1.00 48.71 ? 407  TYR D CD1   1 
ATOM   5346 C  CD2   . TYR D 2 11  ? -5.804  8.539   13.934  1.00 49.50 ? 407  TYR D CD2   1 
ATOM   5347 C  CE1   . TYR D 2 11  ? -5.379  6.872   11.760  1.00 49.86 ? 407  TYR D CE1   1 
ATOM   5348 C  CE2   . TYR D 2 11  ? -5.644  9.083   12.660  1.00 49.83 ? 407  TYR D CE2   1 
ATOM   5349 C  CZ    . TYR D 2 11  ? -5.433  8.245   11.581  1.00 49.15 ? 407  TYR D CZ    1 
ATOM   5350 O  OH    . TYR D 2 11  ? -5.277  8.786   10.329  1.00 52.06 ? 407  TYR D OH    1 
ATOM   5351 N  N     . PRO D 2 12  ? -7.185  3.894   16.964  1.00 45.27 ? 408  PRO D N     1 
ATOM   5352 C  CA    . PRO D 2 12  ? -7.170  2.999   18.121  1.00 44.12 ? 408  PRO D CA    1 
ATOM   5353 C  C     . PRO D 2 12  ? -6.001  3.214   19.073  1.00 44.08 ? 408  PRO D C     1 
ATOM   5354 O  O     . PRO D 2 12  ? -6.099  2.887   20.257  1.00 44.02 ? 408  PRO D O     1 
ATOM   5355 C  CB    . PRO D 2 12  ? -7.156  1.613   17.480  1.00 44.38 ? 408  PRO D CB    1 
ATOM   5356 C  CG    . PRO D 2 12  ? -6.405  1.843   16.212  1.00 44.89 ? 408  PRO D CG    1 
ATOM   5357 C  CD    . PRO D 2 12  ? -7.013  3.135   15.715  1.00 45.27 ? 408  PRO D CD    1 
ATOM   5358 N  N     . TRP D 2 13  ? -4.900  3.764   18.561  1.00 42.33 ? 409  TRP D N     1 
ATOM   5359 C  CA    . TRP D 2 13  ? -3.726  4.010   19.384  1.00 39.97 ? 409  TRP D CA    1 
ATOM   5360 C  C     . TRP D 2 13  ? -3.771  5.338   20.135  1.00 40.42 ? 409  TRP D C     1 
ATOM   5361 O  O     . TRP D 2 13  ? -2.878  5.634   20.931  1.00 41.71 ? 409  TRP D O     1 
ATOM   5362 C  CB    . TRP D 2 13  ? -2.466  3.939   18.526  1.00 38.13 ? 409  TRP D CB    1 
ATOM   5363 C  CG    . TRP D 2 13  ? -2.601  4.580   17.186  1.00 36.65 ? 409  TRP D CG    1 
ATOM   5364 C  CD1   . TRP D 2 13  ? -2.847  3.955   16.004  1.00 36.27 ? 409  TRP D CD1   1 
ATOM   5365 C  CD2   . TRP D 2 13  ? -2.477  5.974   16.885  1.00 37.56 ? 409  TRP D CD2   1 
ATOM   5366 N  NE1   . TRP D 2 13  ? -2.877  4.867   14.978  1.00 37.42 ? 409  TRP D NE1   1 
ATOM   5367 C  CE2   . TRP D 2 13  ? -2.652  6.117   15.492  1.00 37.74 ? 409  TRP D CE2   1 
ATOM   5368 C  CE3   . TRP D 2 13  ? -2.233  7.122   17.660  1.00 36.90 ? 409  TRP D CE3   1 
ATOM   5369 C  CZ2   . TRP D 2 13  ? -2.592  7.360   14.850  1.00 38.44 ? 409  TRP D CZ2   1 
ATOM   5370 C  CZ3   . TRP D 2 13  ? -2.175  8.359   17.025  1.00 36.31 ? 409  TRP D CZ3   1 
ATOM   5371 C  CH2   . TRP D 2 13  ? -2.354  8.466   15.631  1.00 38.19 ? 409  TRP D CH2   1 
ATOM   5372 N  N     . PHE D 2 14  ? -4.803  6.138   19.883  1.00 40.73 ? 410  PHE D N     1 
ATOM   5373 C  CA    . PHE D 2 14  ? -4.961  7.424   20.565  1.00 41.50 ? 410  PHE D CA    1 
ATOM   5374 C  C     . PHE D 2 14  ? -5.901  7.238   21.745  1.00 41.27 ? 410  PHE D C     1 
ATOM   5375 O  O     . PHE D 2 14  ? -6.994  6.717   21.578  1.00 41.19 ? 410  PHE D O     1 
ATOM   5376 C  CB    . PHE D 2 14  ? -5.547  8.475   19.620  1.00 42.28 ? 410  PHE D CB    1 
ATOM   5377 C  CG    . PHE D 2 14  ? -5.803  9.800   20.283  1.00 45.12 ? 410  PHE D CG    1 
ATOM   5378 C  CD1   . PHE D 2 14  ? -7.105  10.211  20.572  1.00 45.34 ? 410  PHE D CD1   1 
ATOM   5379 C  CD2   . PHE D 2 14  ? -4.736  10.623  20.666  1.00 46.13 ? 410  PHE D CD2   1 
ATOM   5380 C  CE1   . PHE D 2 14  ? -7.344  11.415  21.233  1.00 45.63 ? 410  PHE D CE1   1 
ATOM   5381 C  CE2   . PHE D 2 14  ? -4.958  11.834  21.332  1.00 45.53 ? 410  PHE D CE2   1 
ATOM   5382 C  CZ    . PHE D 2 14  ? -6.266  12.231  21.618  1.00 47.52 ? 410  PHE D CZ    1 
ATOM   5383 N  N     . HIS D 2 15  ? -5.487  7.665   22.932  1.00 42.18 ? 411  HIS D N     1 
ATOM   5384 C  CA    . HIS D 2 15  ? -6.319  7.490   24.111  1.00 43.50 ? 411  HIS D CA    1 
ATOM   5385 C  C     . HIS D 2 15  ? -6.728  8.756   24.867  1.00 44.68 ? 411  HIS D C     1 
ATOM   5386 O  O     . HIS D 2 15  ? -6.781  8.760   26.099  1.00 44.95 ? 411  HIS D O     1 
ATOM   5387 C  CB    . HIS D 2 15  ? -5.641  6.511   25.069  1.00 43.46 ? 411  HIS D CB    1 
ATOM   5388 C  CG    . HIS D 2 15  ? -5.515  5.126   24.519  1.00 43.43 ? 411  HIS D CG    1 
ATOM   5389 N  ND1   . HIS D 2 15  ? -5.898  4.007   25.227  1.00 43.78 ? 411  HIS D ND1   1 
ATOM   5390 C  CD2   . HIS D 2 15  ? -5.066  4.680   23.323  1.00 43.19 ? 411  HIS D CD2   1 
ATOM   5391 C  CE1   . HIS D 2 15  ? -5.695  2.930   24.488  1.00 42.21 ? 411  HIS D CE1   1 
ATOM   5392 N  NE2   . HIS D 2 15  ? -5.191  3.312   23.327  1.00 43.01 ? 411  HIS D NE2   1 
ATOM   5393 N  N     . GLY D 2 16  ? -7.021  9.818   24.124  1.00 45.42 ? 412  GLY D N     1 
ATOM   5394 C  CA    . GLY D 2 16  ? -7.456  11.064  24.728  1.00 46.64 ? 412  GLY D CA    1 
ATOM   5395 C  C     . GLY D 2 16  ? -6.817  11.467  26.041  1.00 48.16 ? 412  GLY D C     1 
ATOM   5396 O  O     . GLY D 2 16  ? -5.600  11.618  26.127  1.00 49.71 ? 412  GLY D O     1 
ATOM   5397 N  N     . THR D 2 17  ? -7.648  11.611  27.070  1.00 49.05 ? 413  THR D N     1 
ATOM   5398 C  CA    . THR D 2 17  ? -7.220  12.053  28.399  1.00 49.61 ? 413  THR D CA    1 
ATOM   5399 C  C     . THR D 2 17  ? -6.701  11.011  29.395  1.00 49.09 ? 413  THR D C     1 
ATOM   5400 O  O     . THR D 2 17  ? -6.700  11.254  30.604  1.00 50.62 ? 413  THR D O     1 
ATOM   5401 C  CB    . THR D 2 17  ? -8.372  12.810  29.071  1.00 50.28 ? 413  THR D CB    1 
ATOM   5402 O  OG1   . THR D 2 17  ? -9.436  11.893  29.356  1.00 51.16 ? 413  THR D OG1   1 
ATOM   5403 C  CG2   . THR D 2 17  ? -8.908  13.881  28.137  1.00 49.13 ? 413  THR D CG2   1 
ATOM   5404 N  N     . LEU D 2 18  ? -6.266  9.861   28.904  1.00 47.86 ? 414  LEU D N     1 
ATOM   5405 C  CA    . LEU D 2 18  ? -5.732  8.827   29.778  1.00 47.26 ? 414  LEU D CA    1 
ATOM   5406 C  C     . LEU D 2 18  ? -4.540  9.406   30.567  1.00 47.63 ? 414  LEU D C     1 
ATOM   5407 O  O     . LEU D 2 18  ? -3.619  9.980   29.987  1.00 47.17 ? 414  LEU D O     1 
ATOM   5408 C  CB    . LEU D 2 18  ? -5.281  7.647   28.923  1.00 46.42 ? 414  LEU D CB    1 
ATOM   5409 C  CG    . LEU D 2 18  ? -4.639  6.456   29.622  1.00 47.50 ? 414  LEU D CG    1 
ATOM   5410 C  CD1   . LEU D 2 18  ? -5.716  5.627   30.287  1.00 46.13 ? 414  LEU D CD1   1 
ATOM   5411 C  CD2   . LEU D 2 18  ? -3.883  5.621   28.608  1.00 45.86 ? 414  LEU D CD2   1 
ATOM   5412 N  N     . SER D 2 19  ? -4.563  9.254   31.887  1.00 48.00 ? 415  SER D N     1 
ATOM   5413 C  CA    . SER D 2 19  ? -3.490  9.767   32.742  1.00 48.33 ? 415  SER D CA    1 
ATOM   5414 C  C     . SER D 2 19  ? -2.137  9.148   32.397  1.00 48.69 ? 415  SER D C     1 
ATOM   5415 O  O     . SER D 2 19  ? -2.078  8.016   31.909  1.00 48.51 ? 415  SER D O     1 
ATOM   5416 C  CB    . SER D 2 19  ? -3.805  9.474   34.206  1.00 48.54 ? 415  SER D CB    1 
ATOM   5417 O  OG    . SER D 2 19  ? -3.625  8.095   34.486  1.00 52.23 ? 415  SER D OG    1 
ATOM   5418 N  N     . ARG D 2 20  ? -1.047  9.879   32.648  1.00 48.88 ? 416  ARG D N     1 
ATOM   5419 C  CA    . ARG D 2 20  ? 0.279   9.337   32.350  1.00 48.83 ? 416  ARG D CA    1 
ATOM   5420 C  C     . ARG D 2 20  ? 0.489   8.123   33.233  1.00 50.15 ? 416  ARG D C     1 
ATOM   5421 O  O     . ARG D 2 20  ? 1.082   7.131   32.811  1.00 51.25 ? 416  ARG D O     1 
ATOM   5422 C  CB    . ARG D 2 20  ? 1.407   10.359  32.590  1.00 46.83 ? 416  ARG D CB    1 
ATOM   5423 C  CG    . ARG D 2 20  ? 1.881   10.524  34.031  1.00 47.21 ? 416  ARG D CG    1 
ATOM   5424 C  CD    . ARG D 2 20  ? 3.410   10.381  34.203  1.00 46.29 ? 416  ARG D CD    1 
ATOM   5425 N  NE    . ARG D 2 20  ? 4.164   11.249  33.304  1.00 48.01 ? 416  ARG D NE    1 
ATOM   5426 C  CZ    . ARG D 2 20  ? 5.494   11.297  33.216  1.00 48.29 ? 416  ARG D CZ    1 
ATOM   5427 N  NH1   . ARG D 2 20  ? 6.262   10.532  33.987  1.00 46.40 ? 416  ARG D NH1   1 
ATOM   5428 N  NH2   . ARG D 2 20  ? 6.059   12.090  32.315  1.00 47.52 ? 416  ARG D NH2   1 
ATOM   5429 N  N     . VAL D 2 21  ? -0.006  8.197   34.462  1.00 51.10 ? 417  VAL D N     1 
ATOM   5430 C  CA    . VAL D 2 21  ? 0.136   7.084   35.384  1.00 51.50 ? 417  VAL D CA    1 
ATOM   5431 C  C     . VAL D 2 21  ? -0.602  5.862   34.853  1.00 51.61 ? 417  VAL D C     1 
ATOM   5432 O  O     . VAL D 2 21  ? -0.050  4.766   34.824  1.00 52.08 ? 417  VAL D O     1 
ATOM   5433 C  CB    . VAL D 2 21  ? -0.408  7.442   36.781  1.00 52.23 ? 417  VAL D CB    1 
ATOM   5434 C  CG1   . VAL D 2 21  ? -0.310  6.232   37.700  1.00 50.05 ? 417  VAL D CG1   1 
ATOM   5435 C  CG2   . VAL D 2 21  ? 0.380   8.611   37.352  1.00 50.83 ? 417  VAL D CG2   1 
ATOM   5436 N  N     . LYS D 2 22  ? -1.846  6.046   34.432  1.00 51.35 ? 418  LYS D N     1 
ATOM   5437 C  CA    . LYS D 2 22  ? -2.602  4.923   33.903  1.00 52.49 ? 418  LYS D CA    1 
ATOM   5438 C  C     . LYS D 2 22  ? -2.025  4.432   32.573  1.00 52.42 ? 418  LYS D C     1 
ATOM   5439 O  O     . LYS D 2 22  ? -2.061  3.235   32.285  1.00 52.23 ? 418  LYS D O     1 
ATOM   5440 C  CB    . LYS D 2 22  ? -4.086  5.287   33.749  1.00 53.65 ? 418  LYS D CB    1 
ATOM   5441 C  CG    . LYS D 2 22  ? -4.833  5.264   35.073  1.00 55.92 ? 418  LYS D CG    1 
ATOM   5442 C  CD    . LYS D 2 22  ? -6.341  5.144   34.892  1.00 58.52 ? 418  LYS D CD    1 
ATOM   5443 C  CE    . LYS D 2 22  ? -7.021  4.856   36.237  1.00 61.15 ? 418  LYS D CE    1 
ATOM   5444 N  NZ    . LYS D 2 22  ? -8.491  4.569   36.126  1.00 62.08 ? 418  LYS D NZ    1 
ATOM   5445 N  N     . ALA D 2 23  ? -1.487  5.351   31.771  1.00 50.92 ? 419  ALA D N     1 
ATOM   5446 C  CA    . ALA D 2 23  ? -0.905  4.987   30.483  1.00 48.11 ? 419  ALA D CA    1 
ATOM   5447 C  C     . ALA D 2 23  ? 0.305   4.091   30.677  1.00 46.20 ? 419  ALA D C     1 
ATOM   5448 O  O     . ALA D 2 23  ? 0.487   3.127   29.949  1.00 44.95 ? 419  ALA D O     1 
ATOM   5449 C  CB    . ALA D 2 23  ? -0.506  6.231   29.710  1.00 48.23 ? 419  ALA D CB    1 
ATOM   5450 N  N     . ALA D 2 24  ? 1.138   4.408   31.657  1.00 46.37 ? 420  ALA D N     1 
ATOM   5451 C  CA    . ALA D 2 24  ? 2.319   3.588   31.908  1.00 48.24 ? 420  ALA D CA    1 
ATOM   5452 C  C     . ALA D 2 24  ? 1.873   2.182   32.290  1.00 48.87 ? 420  ALA D C     1 
ATOM   5453 O  O     . ALA D 2 24  ? 2.431   1.191   31.820  1.00 49.67 ? 420  ALA D O     1 
ATOM   5454 C  CB    . ALA D 2 24  ? 3.178   4.193   33.027  1.00 46.95 ? 420  ALA D CB    1 
ATOM   5455 N  N     . GLN D 2 25  ? 0.859   2.098   33.143  1.00 49.76 ? 421  GLN D N     1 
ATOM   5456 C  CA    . GLN D 2 25  ? 0.350   0.804   33.577  1.00 51.46 ? 421  GLN D CA    1 
ATOM   5457 C  C     . GLN D 2 25  ? -0.086  -0.022  32.382  1.00 51.17 ? 421  GLN D C     1 
ATOM   5458 O  O     . GLN D 2 25  ? 0.221   -1.211  32.279  1.00 51.02 ? 421  GLN D O     1 
ATOM   5459 C  CB    . GLN D 2 25  ? -0.850  0.974   34.499  1.00 53.57 ? 421  GLN D CB    1 
ATOM   5460 C  CG    . GLN D 2 25  ? -0.590  1.773   35.749  1.00 57.87 ? 421  GLN D CG    1 
ATOM   5461 C  CD    . GLN D 2 25  ? -1.845  1.884   36.598  1.00 61.74 ? 421  GLN D CD    1 
ATOM   5462 O  OE1   . GLN D 2 25  ? -2.956  1.588   36.124  1.00 62.33 ? 421  GLN D OE1   1 
ATOM   5463 N  NE2   . GLN D 2 25  ? -1.683  2.315   37.853  1.00 61.15 ? 421  GLN D NE2   1 
ATOM   5464 N  N     . LEU D 2 26  ? -0.812  0.625   31.481  1.00 50.08 ? 422  LEU D N     1 
ATOM   5465 C  CA    . LEU D 2 26  ? -1.312  -0.038  30.299  1.00 49.36 ? 422  LEU D CA    1 
ATOM   5466 C  C     . LEU D 2 26  ? -0.207  -0.633  29.447  1.00 50.22 ? 422  LEU D C     1 
ATOM   5467 O  O     . LEU D 2 26  ? -0.319  -1.776  29.006  1.00 51.75 ? 422  LEU D O     1 
ATOM   5468 C  CB    . LEU D 2 26  ? -2.136  0.934   29.459  1.00 48.09 ? 422  LEU D CB    1 
ATOM   5469 C  CG    . LEU D 2 26  ? -2.815  0.343   28.220  1.00 47.62 ? 422  LEU D CG    1 
ATOM   5470 C  CD1   . LEU D 2 26  ? -3.822  1.328   27.668  1.00 45.15 ? 422  LEU D CD1   1 
ATOM   5471 C  CD2   . LEU D 2 26  ? -1.771  0.001   27.167  1.00 47.20 ? 422  LEU D CD2   1 
ATOM   5472 N  N     . VAL D 2 27  ? 0.858   0.128   29.207  1.00 49.61 ? 423  VAL D N     1 
ATOM   5473 C  CA    . VAL D 2 27  ? 1.936   -0.378  28.366  1.00 49.09 ? 423  VAL D CA    1 
ATOM   5474 C  C     . VAL D 2 27  ? 2.871   -1.327  29.090  1.00 50.13 ? 423  VAL D C     1 
ATOM   5475 O  O     . VAL D 2 27  ? 3.641   -2.048  28.455  1.00 50.54 ? 423  VAL D O     1 
ATOM   5476 C  CB    . VAL D 2 27  ? 2.790   0.767   27.736  1.00 47.77 ? 423  VAL D CB    1 
ATOM   5477 C  CG1   . VAL D 2 27  ? 1.908   1.726   26.975  1.00 45.84 ? 423  VAL D CG1   1 
ATOM   5478 C  CG2   . VAL D 2 27  ? 3.575   1.488   28.797  1.00 47.94 ? 423  VAL D CG2   1 
ATOM   5479 N  N     . LEU D 2 28  ? 2.818   -1.341  30.416  1.00 51.68 ? 424  LEU D N     1 
ATOM   5480 C  CA    . LEU D 2 28  ? 3.705   -2.231  31.159  1.00 53.82 ? 424  LEU D CA    1 
ATOM   5481 C  C     . LEU D 2 28  ? 3.050   -3.539  31.592  1.00 55.05 ? 424  LEU D C     1 
ATOM   5482 O  O     . LEU D 2 28  ? 3.742   -4.488  31.975  1.00 55.39 ? 424  LEU D O     1 
ATOM   5483 C  CB    . LEU D 2 28  ? 4.301   -1.509  32.371  1.00 52.35 ? 424  LEU D CB    1 
ATOM   5484 C  CG    . LEU D 2 28  ? 5.323   -0.428  32.005  1.00 52.48 ? 424  LEU D CG    1 
ATOM   5485 C  CD1   . LEU D 2 28  ? 5.996   0.080   33.266  1.00 49.97 ? 424  LEU D CD1   1 
ATOM   5486 C  CD2   . LEU D 2 28  ? 6.367   -1.002  31.045  1.00 52.10 ? 424  LEU D CD2   1 
ATOM   5487 N  N     . ALA D 2 29  ? 1.720   -3.586  31.535  1.00 56.09 ? 425  ALA D N     1 
ATOM   5488 C  CA    . ALA D 2 29  ? 1.000   -4.801  31.886  1.00 57.36 ? 425  ALA D CA    1 
ATOM   5489 C  C     . ALA D 2 29  ? 1.417   -5.768  30.782  1.00 58.96 ? 425  ALA D C     1 
ATOM   5490 O  O     . ALA D 2 29  ? 0.969   -5.643  29.640  1.00 60.36 ? 425  ALA D O     1 
ATOM   5491 C  CB    . ALA D 2 29  ? -0.493  -4.552  31.845  1.00 55.89 ? 425  ALA D CB    1 
ATOM   5492 N  N     . GLY D 2 30  ? 2.284   -6.717  31.125  1.00 58.85 ? 426  GLY D N     1 
ATOM   5493 C  CA    . GLY D 2 30  ? 2.785   -7.663  30.145  1.00 59.69 ? 426  GLY D CA    1 
ATOM   5494 C  C     . GLY D 2 30  ? 4.304   -7.645  30.202  1.00 61.34 ? 426  GLY D C     1 
ATOM   5495 O  O     . GLY D 2 30  ? 4.992   -8.395  29.495  1.00 60.90 ? 426  GLY D O     1 
ATOM   5496 N  N     . GLY D 2 31  ? 4.823   -6.770  31.062  1.00 61.50 ? 427  GLY D N     1 
ATOM   5497 C  CA    . GLY D 2 31  ? 6.257   -6.639  31.241  1.00 61.47 ? 427  GLY D CA    1 
ATOM   5498 C  C     . GLY D 2 31  ? 7.056   -6.540  29.956  1.00 61.38 ? 427  GLY D C     1 
ATOM   5499 O  O     . GLY D 2 31  ? 6.559   -6.053  28.941  1.00 61.76 ? 427  GLY D O     1 
ATOM   5500 N  N     . PRO D 2 32  ? 8.313   -6.999  29.973  1.00 61.19 ? 428  PRO D N     1 
ATOM   5501 C  CA    . PRO D 2 32  ? 9.173   -6.947  28.785  1.00 61.03 ? 428  PRO D CA    1 
ATOM   5502 C  C     . PRO D 2 32  ? 8.597   -7.687  27.579  1.00 61.10 ? 428  PRO D C     1 
ATOM   5503 O  O     . PRO D 2 32  ? 9.112   -7.547  26.468  1.00 62.23 ? 428  PRO D O     1 
ATOM   5504 C  CB    . PRO D 2 32  ? 10.482  -7.572  29.273  1.00 60.68 ? 428  PRO D CB    1 
ATOM   5505 C  CG    . PRO D 2 32  ? 10.495  -7.243  30.747  1.00 60.66 ? 428  PRO D CG    1 
ATOM   5506 C  CD    . PRO D 2 32  ? 9.056   -7.500  31.145  1.00 60.45 ? 428  PRO D CD    1 
ATOM   5507 N  N     . ARG D 2 33  ? 7.541   -8.476  27.793  1.00 60.61 ? 429  ARG D N     1 
ATOM   5508 C  CA    . ARG D 2 33  ? 6.919   -9.223  26.696  1.00 59.20 ? 429  ARG D CA    1 
ATOM   5509 C  C     . ARG D 2 33  ? 6.209   -8.255  25.752  1.00 58.05 ? 429  ARG D C     1 
ATOM   5510 O  O     . ARG D 2 33  ? 6.291   -8.399  24.535  1.00 58.86 ? 429  ARG D O     1 
ATOM   5511 C  CB    . ARG D 2 33  ? 5.918   -10.253 27.238  1.00 58.66 ? 429  ARG D CB    1 
ATOM   5512 N  N     . SER D 2 34  ? 5.518   -7.266  26.318  1.00 56.24 ? 430  SER D N     1 
ATOM   5513 C  CA    . SER D 2 34  ? 4.798   -6.270  25.527  1.00 54.36 ? 430  SER D CA    1 
ATOM   5514 C  C     . SER D 2 34  ? 5.703   -5.103  25.116  1.00 52.41 ? 430  SER D C     1 
ATOM   5515 O  O     . SER D 2 34  ? 5.243   -3.982  24.894  1.00 53.50 ? 430  SER D O     1 
ATOM   5516 C  CB    . SER D 2 34  ? 3.603   -5.752  26.323  1.00 54.36 ? 430  SER D CB    1 
ATOM   5517 O  OG    . SER D 2 34  ? 4.020   -5.369  27.616  1.00 57.29 ? 430  SER D OG    1 
ATOM   5518 N  N     . HIS D 2 35  ? 6.996   -5.383  25.026  1.00 49.06 ? 431  HIS D N     1 
ATOM   5519 C  CA    . HIS D 2 35  ? 7.982   -4.399  24.606  1.00 47.13 ? 431  HIS D CA    1 
ATOM   5520 C  C     . HIS D 2 35  ? 7.497   -3.810  23.282  1.00 47.67 ? 431  HIS D C     1 
ATOM   5521 O  O     . HIS D 2 35  ? 7.100   -4.551  22.380  1.00 49.19 ? 431  HIS D O     1 
ATOM   5522 C  CB    . HIS D 2 35  ? 9.322   -5.109  24.391  1.00 44.72 ? 431  HIS D CB    1 
ATOM   5523 C  CG    . HIS D 2 35  ? 10.352  -4.295  23.668  1.00 40.83 ? 431  HIS D CG    1 
ATOM   5524 N  ND1   . HIS D 2 35  ? 11.047  -3.267  24.266  1.00 41.00 ? 431  HIS D ND1   1 
ATOM   5525 C  CD2   . HIS D 2 35  ? 10.850  -4.403  22.413  1.00 39.79 ? 431  HIS D CD2   1 
ATOM   5526 C  CE1   . HIS D 2 35  ? 11.933  -2.780  23.415  1.00 38.71 ? 431  HIS D CE1   1 
ATOM   5527 N  NE2   . HIS D 2 35  ? 11.834  -3.453  22.282  1.00 39.53 ? 431  HIS D NE2   1 
ATOM   5528 N  N     . GLY D 2 36  ? 7.522   -2.487  23.163  1.00 46.51 ? 432  GLY D N     1 
ATOM   5529 C  CA    . GLY D 2 36  ? 7.094   -1.862  21.925  1.00 42.75 ? 432  GLY D CA    1 
ATOM   5530 C  C     . GLY D 2 36  ? 5.684   -1.312  21.972  1.00 41.57 ? 432  GLY D C     1 
ATOM   5531 O  O     . GLY D 2 36  ? 5.360   -0.382  21.245  1.00 41.64 ? 432  GLY D O     1 
ATOM   5532 N  N     . LEU D 2 37  ? 4.832   -1.887  22.812  1.00 40.23 ? 433  LEU D N     1 
ATOM   5533 C  CA    . LEU D 2 37  ? 3.456   -1.408  22.924  1.00 39.30 ? 433  LEU D CA    1 
ATOM   5534 C  C     . LEU D 2 37  ? 3.470   0.090   23.259  1.00 37.88 ? 433  LEU D C     1 
ATOM   5535 O  O     . LEU D 2 37  ? 4.326   0.563   24.000  1.00 39.25 ? 433  LEU D O     1 
ATOM   5536 C  CB    . LEU D 2 37  ? 2.729   -2.166  24.032  1.00 39.87 ? 433  LEU D CB    1 
ATOM   5537 C  CG    . LEU D 2 37  ? 1.216   -2.393  23.920  1.00 41.15 ? 433  LEU D CG    1 
ATOM   5538 C  CD1   . LEU D 2 37  ? 0.670   -2.490  25.332  1.00 42.19 ? 433  LEU D CD1   1 
ATOM   5539 C  CD2   . LEU D 2 37  ? 0.512   -1.269  23.183  1.00 41.69 ? 433  LEU D CD2   1 
ATOM   5540 N  N     . PHE D 2 38  ? 2.523   0.844   22.730  1.00 36.27 ? 434  PHE D N     1 
ATOM   5541 C  CA    . PHE D 2 38  ? 2.509   2.273   23.014  1.00 36.56 ? 434  PHE D CA    1 
ATOM   5542 C  C     . PHE D 2 38  ? 1.113   2.851   22.889  1.00 35.91 ? 434  PHE D C     1 
ATOM   5543 O  O     . PHE D 2 38  ? 0.199   2.202   22.392  1.00 34.77 ? 434  PHE D O     1 
ATOM   5544 C  CB    . PHE D 2 38  ? 3.411   2.988   22.021  1.00 34.40 ? 434  PHE D CB    1 
ATOM   5545 C  CG    . PHE D 2 38  ? 2.805   3.108   20.652  1.00 33.44 ? 434  PHE D CG    1 
ATOM   5546 C  CD1   . PHE D 2 38  ? 2.001   4.193   20.325  1.00 33.02 ? 434  PHE D CD1   1 
ATOM   5547 C  CD2   . PHE D 2 38  ? 3.003   2.115   19.705  1.00 31.91 ? 434  PHE D CD2   1 
ATOM   5548 C  CE1   . PHE D 2 38  ? 1.399   4.285   19.078  1.00 34.53 ? 434  PHE D CE1   1 
ATOM   5549 C  CE2   . PHE D 2 38  ? 2.404   2.195   18.453  1.00 32.12 ? 434  PHE D CE2   1 
ATOM   5550 C  CZ    . PHE D 2 38  ? 1.602   3.280   18.137  1.00 33.97 ? 434  PHE D CZ    1 
ATOM   5551 N  N     . VAL D 2 39  ? 0.966   4.087   23.343  1.00 36.70 ? 435  VAL D N     1 
ATOM   5552 C  CA    . VAL D 2 39  ? -0.297  4.809   23.235  1.00 39.08 ? 435  VAL D CA    1 
ATOM   5553 C  C     . VAL D 2 39  ? 0.022   6.290   23.134  1.00 39.34 ? 435  VAL D C     1 
ATOM   5554 O  O     . VAL D 2 39  ? 1.073   6.741   23.568  1.00 37.78 ? 435  VAL D O     1 
ATOM   5555 C  CB    . VAL D 2 39  ? -1.210  4.604   24.456  1.00 39.09 ? 435  VAL D CB    1 
ATOM   5556 C  CG1   . VAL D 2 39  ? -1.745  3.187   24.474  1.00 41.31 ? 435  VAL D CG1   1 
ATOM   5557 C  CG2   . VAL D 2 39  ? -0.447  4.899   25.724  1.00 40.77 ? 435  VAL D CG2   1 
ATOM   5558 N  N     . ILE D 2 40  ? -0.889  7.045   22.547  1.00 41.70 ? 436  ILE D N     1 
ATOM   5559 C  CA    . ILE D 2 40  ? -0.699  8.476   22.426  1.00 42.87 ? 436  ILE D CA    1 
ATOM   5560 C  C     . ILE D 2 40  ? -1.793  9.089   23.280  1.00 43.69 ? 436  ILE D C     1 
ATOM   5561 O  O     . ILE D 2 40  ? -2.933  8.648   23.235  1.00 44.62 ? 436  ILE D O     1 
ATOM   5562 C  CB    . ILE D 2 40  ? -0.873  8.950   20.974  1.00 43.29 ? 436  ILE D CB    1 
ATOM   5563 C  CG1   . ILE D 2 40  ? 0.224   8.352   20.080  1.00 43.93 ? 436  ILE D CG1   1 
ATOM   5564 C  CG2   . ILE D 2 40  ? -0.874  10.471  20.927  1.00 43.26 ? 436  ILE D CG2   1 
ATOM   5565 C  CD1   . ILE D 2 40  ? 1.632   8.596   20.546  1.00 43.68 ? 436  ILE D CD1   1 
ATOM   5566 N  N     . ARG D 2 41  ? -1.445  10.099  24.061  1.00 44.75 ? 437  ARG D N     1 
ATOM   5567 C  CA    . ARG D 2 41  ? -2.415  10.752  24.919  1.00 45.93 ? 437  ARG D CA    1 
ATOM   5568 C  C     . ARG D 2 41  ? -2.186  12.253  24.932  1.00 49.28 ? 437  ARG D C     1 
ATOM   5569 O  O     . ARG D 2 41  ? -1.172  12.751  24.434  1.00 49.13 ? 437  ARG D O     1 
ATOM   5570 C  CB    . ARG D 2 41  ? -2.297  10.207  26.338  1.00 42.51 ? 437  ARG D CB    1 
ATOM   5571 C  CG    . ARG D 2 41  ? -0.929  10.382  26.951  1.00 38.01 ? 437  ARG D CG    1 
ATOM   5572 C  CD    . ARG D 2 41  ? -0.812  9.629   28.265  1.00 34.40 ? 437  ARG D CD    1 
ATOM   5573 N  NE    . ARG D 2 41  ? 0.548   9.652   28.783  1.00 34.56 ? 437  ARG D NE    1 
ATOM   5574 C  CZ    . ARG D 2 41  ? 1.151   10.741  29.255  1.00 35.99 ? 437  ARG D CZ    1 
ATOM   5575 N  NH1   . ARG D 2 41  ? 0.502   11.902  29.282  1.00 35.39 ? 437  ARG D NH1   1 
ATOM   5576 N  NH2   . ARG D 2 41  ? 2.409   10.670  29.684  1.00 33.29 ? 437  ARG D NH2   1 
ATOM   5577 N  N     . GLN D 2 42  ? -3.140  12.976  25.501  1.00 52.78 ? 438  GLN D N     1 
ATOM   5578 C  CA    . GLN D 2 42  ? -3.026  14.420  25.601  1.00 56.16 ? 438  GLN D CA    1 
ATOM   5579 C  C     . GLN D 2 42  ? -2.168  14.661  26.830  1.00 57.32 ? 438  GLN D C     1 
ATOM   5580 O  O     . GLN D 2 42  ? -2.372  14.031  27.870  1.00 57.44 ? 438  GLN D O     1 
ATOM   5581 C  CB    . GLN D 2 42  ? -4.411  15.031  25.769  1.00 57.76 ? 438  GLN D CB    1 
ATOM   5582 C  CG    . GLN D 2 42  ? -5.443  14.331  24.910  1.00 63.01 ? 438  GLN D CG    1 
ATOM   5583 C  CD    . GLN D 2 42  ? -6.809  14.984  24.958  1.00 66.69 ? 438  GLN D CD    1 
ATOM   5584 O  OE1   . GLN D 2 42  ? -7.281  15.400  26.021  1.00 68.15 ? 438  GLN D OE1   1 
ATOM   5585 N  NE2   . GLN D 2 42  ? -7.467  15.060  23.798  1.00 68.85 ? 438  GLN D NE2   1 
ATOM   5586 N  N     . SER D 2 43  ? -1.199  15.558  26.714  1.00 59.83 ? 439  SER D N     1 
ATOM   5587 C  CA    . SER D 2 43  ? -0.323  15.841  27.839  1.00 61.82 ? 439  SER D CA    1 
ATOM   5588 C  C     . SER D 2 43  ? -1.101  16.320  29.044  1.00 63.71 ? 439  SER D C     1 
ATOM   5589 O  O     . SER D 2 43  ? -2.083  17.054  28.910  1.00 64.72 ? 439  SER D O     1 
ATOM   5590 C  CB    . SER D 2 43  ? 0.698   16.905  27.467  1.00 62.08 ? 439  SER D CB    1 
ATOM   5591 O  OG    . SER D 2 43  ? 1.456   17.287  28.601  1.00 63.26 ? 439  SER D OG    1 
ATOM   5592 N  N     . GLU D 2 44  ? -0.659  15.894  30.222  1.00 65.61 ? 440  GLU D N     1 
ATOM   5593 C  CA    . GLU D 2 44  ? -1.287  16.314  31.464  1.00 67.41 ? 440  GLU D CA    1 
ATOM   5594 C  C     . GLU D 2 44  ? -0.752  17.705  31.800  1.00 68.53 ? 440  GLU D C     1 
ATOM   5595 O  O     . GLU D 2 44  ? -1.511  18.574  32.231  1.00 68.97 ? 440  GLU D O     1 
ATOM   5596 C  CB    . GLU D 2 44  ? -0.964  15.339  32.599  1.00 67.47 ? 440  GLU D CB    1 
ATOM   5597 C  CG    . GLU D 2 44  ? -1.559  13.954  32.409  1.00 70.14 ? 440  GLU D CG    1 
ATOM   5598 C  CD    . GLU D 2 44  ? -1.333  13.052  33.614  1.00 70.75 ? 440  GLU D CD    1 
ATOM   5599 O  OE1   . GLU D 2 44  ? -0.183  12.998  34.097  1.00 72.08 ? 440  GLU D OE1   1 
ATOM   5600 O  OE2   . GLU D 2 44  ? -2.296  12.395  34.072  1.00 70.56 ? 440  GLU D OE2   1 
ATOM   5601 N  N     . THR D 2 45  ? 0.551   17.909  31.592  1.00 68.94 ? 441  THR D N     1 
ATOM   5602 C  CA    . THR D 2 45  ? 1.181   19.199  31.860  1.00 69.88 ? 441  THR D CA    1 
ATOM   5603 C  C     . THR D 2 45  ? 1.009   20.197  30.708  1.00 70.07 ? 441  THR D C     1 
ATOM   5604 O  O     . THR D 2 45  ? 0.196   21.111  30.801  1.00 69.99 ? 441  THR D O     1 
ATOM   5605 C  CB    . THR D 2 45  ? 2.685   19.045  32.162  1.00 70.29 ? 441  THR D CB    1 
ATOM   5606 O  OG1   . THR D 2 45  ? 3.344   18.453  31.036  1.00 72.03 ? 441  THR D OG1   1 
ATOM   5607 C  CG2   . THR D 2 45  ? 2.893   18.174  33.392  1.00 70.87 ? 441  THR D CG2   1 
ATOM   5608 N  N     . ARG D 2 46  ? 1.764   20.029  29.626  1.00 70.41 ? 442  ARG D N     1 
ATOM   5609 C  CA    . ARG D 2 46  ? 1.660   20.945  28.492  1.00 71.22 ? 442  ARG D CA    1 
ATOM   5610 C  C     . ARG D 2 46  ? 0.332   20.766  27.754  1.00 71.94 ? 442  ARG D C     1 
ATOM   5611 O  O     . ARG D 2 46  ? 0.122   19.771  27.060  1.00 73.33 ? 442  ARG D O     1 
ATOM   5612 C  CB    . ARG D 2 46  ? 2.834   20.730  27.531  1.00 70.90 ? 442  ARG D CB    1 
ATOM   5613 N  N     . PRO D 2 47  ? -0.584  21.737  27.892  1.00 72.08 ? 443  PRO D N     1 
ATOM   5614 C  CA    . PRO D 2 47  ? -1.889  21.662  27.231  1.00 71.14 ? 443  PRO D CA    1 
ATOM   5615 C  C     . PRO D 2 47  ? -1.769  21.817  25.721  1.00 69.88 ? 443  PRO D C     1 
ATOM   5616 O  O     . PRO D 2 47  ? -0.907  22.552  25.228  1.00 69.72 ? 443  PRO D O     1 
ATOM   5617 C  CB    . PRO D 2 47  ? -2.662  22.805  27.875  1.00 72.22 ? 443  PRO D CB    1 
ATOM   5618 C  CG    . PRO D 2 47  ? -1.592  23.832  28.074  1.00 72.86 ? 443  PRO D CG    1 
ATOM   5619 C  CD    . PRO D 2 47  ? -0.447  23.006  28.629  1.00 72.58 ? 443  PRO D CD    1 
ATOM   5620 N  N     . GLY D 2 48  ? -2.638  21.117  24.997  1.00 68.11 ? 444  GLY D N     1 
ATOM   5621 C  CA    . GLY D 2 48  ? -2.614  21.180  23.549  1.00 66.08 ? 444  GLY D CA    1 
ATOM   5622 C  C     . GLY D 2 48  ? -1.639  20.182  22.948  1.00 64.80 ? 444  GLY D C     1 
ATOM   5623 O  O     . GLY D 2 48  ? -1.818  19.721  21.816  1.00 64.51 ? 444  GLY D O     1 
ATOM   5624 N  N     . GLU D 2 49  ? -0.601  19.846  23.705  1.00 62.87 ? 445  GLU D N     1 
ATOM   5625 C  CA    . GLU D 2 49  ? 0.397   18.895  23.238  1.00 61.29 ? 445  GLU D CA    1 
ATOM   5626 C  C     . GLU D 2 49  ? -0.019  17.460  23.554  1.00 58.13 ? 445  GLU D C     1 
ATOM   5627 O  O     . GLU D 2 49  ? -0.934  17.211  24.349  1.00 56.04 ? 445  GLU D O     1 
ATOM   5628 C  CB    . GLU D 2 49  ? 1.751   19.148  23.912  1.00 64.58 ? 445  GLU D CB    1 
ATOM   5629 C  CG    . GLU D 2 49  ? 2.509   20.382  23.466  1.00 67.45 ? 445  GLU D CG    1 
ATOM   5630 C  CD    . GLU D 2 49  ? 3.863   20.495  24.165  1.00 70.66 ? 445  GLU D CD    1 
ATOM   5631 O  OE1   . GLU D 2 49  ? 4.726   19.608  23.942  1.00 72.01 ? 445  GLU D OE1   1 
ATOM   5632 O  OE2   . GLU D 2 49  ? 4.062   21.461  24.940  1.00 70.85 ? 445  GLU D OE2   1 
ATOM   5633 N  N     . CYS D 2 50  ? 0.662   16.514  22.924  1.00 53.65 ? 446  CYS D N     1 
ATOM   5634 C  CA    . CYS D 2 50  ? 0.389   15.112  23.176  1.00 50.23 ? 446  CYS D CA    1 
ATOM   5635 C  C     . CYS D 2 50  ? 1.656   14.448  23.658  1.00 48.47 ? 446  CYS D C     1 
ATOM   5636 O  O     . CYS D 2 50  ? 2.746   15.020  23.576  1.00 48.99 ? 446  CYS D O     1 
ATOM   5637 C  CB    . CYS D 2 50  ? -0.111  14.406  21.918  1.00 49.53 ? 446  CYS D CB    1 
ATOM   5638 S  SG    . CYS D 2 50  ? -1.833  14.727  21.540  1.00 51.43 ? 446  CYS D SG    1 
ATOM   5639 N  N     . VAL D 2 51  ? 1.504   13.233  24.166  1.00 45.78 ? 447  VAL D N     1 
ATOM   5640 C  CA    . VAL D 2 51  ? 2.631   12.472  24.661  1.00 42.10 ? 447  VAL D CA    1 
ATOM   5641 C  C     . VAL D 2 51  ? 2.534   11.039  24.159  1.00 40.99 ? 447  VAL D C     1 
ATOM   5642 O  O     . VAL D 2 51  ? 1.445   10.463  24.078  1.00 38.76 ? 447  VAL D O     1 
ATOM   5643 C  CB    . VAL D 2 51  ? 2.656   12.450  26.199  1.00 42.42 ? 447  VAL D CB    1 
ATOM   5644 C  CG1   . VAL D 2 51  ? 3.860   11.640  26.687  1.00 40.48 ? 447  VAL D CG1   1 
ATOM   5645 C  CG2   . VAL D 2 51  ? 2.697   13.872  26.732  1.00 40.85 ? 447  VAL D CG2   1 
ATOM   5646 N  N     . LEU D 2 52  ? 3.685   10.477  23.817  1.00 38.58 ? 448  LEU D N     1 
ATOM   5647 C  CA    . LEU D 2 52  ? 3.755   9.109   23.356  1.00 36.41 ? 448  LEU D CA    1 
ATOM   5648 C  C     . LEU D 2 52  ? 4.332   8.307   24.508  1.00 35.81 ? 448  LEU D C     1 
ATOM   5649 O  O     . LEU D 2 52  ? 5.493   8.484   24.881  1.00 35.42 ? 448  LEU D O     1 
ATOM   5650 C  CB    . LEU D 2 52  ? 4.669   9.003   22.140  1.00 37.95 ? 448  LEU D CB    1 
ATOM   5651 C  CG    . LEU D 2 52  ? 5.283   7.614   21.909  1.00 39.28 ? 448  LEU D CG    1 
ATOM   5652 C  CD1   . LEU D 2 52  ? 4.218   6.595   21.516  1.00 35.50 ? 448  LEU D CD1   1 
ATOM   5653 C  CD2   . LEU D 2 52  ? 6.327   7.733   20.832  1.00 39.09 ? 448  LEU D CD2   1 
ATOM   5654 N  N     . THR D 2 53  ? 3.520   7.430   25.079  1.00 35.00 ? 449  THR D N     1 
ATOM   5655 C  CA    . THR D 2 53  ? 3.975   6.616   26.191  1.00 35.51 ? 449  THR D CA    1 
ATOM   5656 C  C     . THR D 2 53  ? 4.222   5.212   25.672  1.00 36.85 ? 449  THR D C     1 
ATOM   5657 O  O     . THR D 2 53  ? 3.351   4.601   25.045  1.00 37.90 ? 449  THR D O     1 
ATOM   5658 C  CB    . THR D 2 53  ? 2.926   6.591   27.303  1.00 35.18 ? 449  THR D CB    1 
ATOM   5659 O  OG1   . THR D 2 53  ? 2.833   7.900   27.886  1.00 34.65 ? 449  THR D OG1   1 
ATOM   5660 C  CG2   . THR D 2 53  ? 3.284   5.554   28.362  1.00 30.69 ? 449  THR D CG2   1 
ATOM   5661 N  N     . PHE D 2 54  ? 5.413   4.691   25.921  1.00 37.53 ? 450  PHE D N     1 
ATOM   5662 C  CA    . PHE D 2 54  ? 5.716   3.361   25.423  1.00 38.01 ? 450  PHE D CA    1 
ATOM   5663 C  C     . PHE D 2 54  ? 6.521   2.477   26.357  1.00 39.32 ? 450  PHE D C     1 
ATOM   5664 O  O     . PHE D 2 54  ? 7.145   2.938   27.318  1.00 40.35 ? 450  PHE D O     1 
ATOM   5665 C  CB    . PHE D 2 54  ? 6.422   3.457   24.070  1.00 37.27 ? 450  PHE D CB    1 
ATOM   5666 C  CG    . PHE D 2 54  ? 7.786   4.078   24.128  1.00 35.98 ? 450  PHE D CG    1 
ATOM   5667 C  CD1   . PHE D 2 54  ? 8.925   3.296   23.983  1.00 37.08 ? 450  PHE D CD1   1 
ATOM   5668 C  CD2   . PHE D 2 54  ? 7.933   5.456   24.254  1.00 36.74 ? 450  PHE D CD2   1 
ATOM   5669 C  CE1   . PHE D 2 54  ? 10.195  3.878   23.952  1.00 37.60 ? 450  PHE D CE1   1 
ATOM   5670 C  CE2   . PHE D 2 54  ? 9.200   6.053   24.225  1.00 35.83 ? 450  PHE D CE2   1 
ATOM   5671 C  CZ    . PHE D 2 54  ? 10.334  5.263   24.071  1.00 35.28 ? 450  PHE D CZ    1 
ATOM   5672 N  N     . ASN D 2 55  ? 6.497   1.189   26.047  1.00 40.33 ? 451  ASN D N     1 
ATOM   5673 C  CA    . ASN D 2 55  ? 7.182   0.177   26.827  1.00 39.63 ? 451  ASN D CA    1 
ATOM   5674 C  C     . ASN D 2 55  ? 8.519   -0.148  26.201  1.00 39.76 ? 451  ASN D C     1 
ATOM   5675 O  O     . ASN D 2 55  ? 8.578   -0.638  25.080  1.00 40.45 ? 451  ASN D O     1 
ATOM   5676 C  CB    . ASN D 2 55  ? 6.312   -1.089  26.864  1.00 40.46 ? 451  ASN D CB    1 
ATOM   5677 C  CG    . ASN D 2 55  ? 6.965   -2.262  27.607  1.00 43.07 ? 451  ASN D CG    1 
ATOM   5678 O  OD1   . ASN D 2 55  ? 8.194   -2.440  27.606  1.00 41.95 ? 451  ASN D OD1   1 
ATOM   5679 N  ND2   . ASN D 2 55  ? 6.122   -3.091  28.222  1.00 41.57 ? 451  ASN D ND2   1 
ATOM   5680 N  N     . PHE D 2 56  ? 9.602   0.132   26.905  1.00 41.04 ? 452  PHE D N     1 
ATOM   5681 C  CA    . PHE D 2 56  ? 10.889  -0.258  26.370  1.00 41.92 ? 452  PHE D CA    1 
ATOM   5682 C  C     . PHE D 2 56  ? 11.505  -1.264  27.332  1.00 44.14 ? 452  PHE D C     1 
ATOM   5683 O  O     . PHE D 2 56  ? 11.887  -0.922  28.458  1.00 44.29 ? 452  PHE D O     1 
ATOM   5684 C  CB    . PHE D 2 56  ? 11.845  0.907   26.190  1.00 39.48 ? 452  PHE D CB    1 
ATOM   5685 C  CG    . PHE D 2 56  ? 13.091  0.524   25.434  1.00 39.44 ? 452  PHE D CG    1 
ATOM   5686 C  CD1   . PHE D 2 56  ? 13.094  0.490   24.034  1.00 37.72 ? 452  PHE D CD1   1 
ATOM   5687 C  CD2   . PHE D 2 56  ? 14.248  0.138   26.114  1.00 37.70 ? 452  PHE D CD2   1 
ATOM   5688 C  CE1   . PHE D 2 56  ? 14.231  0.080   23.326  1.00 36.67 ? 452  PHE D CE1   1 
ATOM   5689 C  CE2   . PHE D 2 56  ? 15.387  -0.275  25.413  1.00 36.08 ? 452  PHE D CE2   1 
ATOM   5690 C  CZ    . PHE D 2 56  ? 15.376  -0.303  24.017  1.00 35.77 ? 452  PHE D CZ    1 
ATOM   5691 N  N     . GLN D 2 57  ? 11.592  -2.509  26.882  1.00 46.39 ? 453  GLN D N     1 
ATOM   5692 C  CA    . GLN D 2 57  ? 12.158  -3.574  27.697  1.00 48.70 ? 453  GLN D CA    1 
ATOM   5693 C  C     . GLN D 2 57  ? 11.515  -3.610  29.068  1.00 49.23 ? 453  GLN D C     1 
ATOM   5694 O  O     . GLN D 2 57  ? 12.204  -3.768  30.070  1.00 49.58 ? 453  GLN D O     1 
ATOM   5695 C  CB    . GLN D 2 57  ? 13.657  -3.376  27.865  1.00 49.10 ? 453  GLN D CB    1 
ATOM   5696 C  CG    . GLN D 2 57  ? 14.443  -3.567  26.590  1.00 53.45 ? 453  GLN D CG    1 
ATOM   5697 C  CD    . GLN D 2 57  ? 15.944  -3.496  26.826  1.00 54.84 ? 453  GLN D CD    1 
ATOM   5698 O  OE1   . GLN D 2 57  ? 16.731  -3.903  25.971  1.00 55.88 ? 453  GLN D OE1   1 
ATOM   5699 N  NE2   . GLN D 2 57  ? 16.349  -2.972  27.987  1.00 54.39 ? 453  GLN D NE2   1 
ATOM   5700 N  N     . GLY D 2 58  ? 10.196  -3.451  29.111  1.00 50.34 ? 454  GLY D N     1 
ATOM   5701 C  CA    . GLY D 2 58  ? 9.500   -3.483  30.386  1.00 50.57 ? 454  GLY D CA    1 
ATOM   5702 C  C     . GLY D 2 58  ? 9.482   -2.182  31.173  1.00 50.96 ? 454  GLY D C     1 
ATOM   5703 O  O     . GLY D 2 58  ? 8.793   -2.088  32.190  1.00 51.37 ? 454  GLY D O     1 
ATOM   5704 N  N     . LYS D 2 59  ? 10.238  -1.182  30.726  1.00 51.47 ? 455  LYS D N     1 
ATOM   5705 C  CA    . LYS D 2 59  ? 10.261  0.119   31.399  1.00 51.15 ? 455  LYS D CA    1 
ATOM   5706 C  C     . LYS D 2 59  ? 9.374   1.097   30.611  1.00 49.84 ? 455  LYS D C     1 
ATOM   5707 O  O     . LYS D 2 59  ? 9.382   1.095   29.372  1.00 50.00 ? 455  LYS D O     1 
ATOM   5708 C  CB    . LYS D 2 59  ? 11.699  0.661   31.463  1.00 53.59 ? 455  LYS D CB    1 
ATOM   5709 C  CG    . LYS D 2 59  ? 12.718  -0.232  32.188  1.00 55.10 ? 455  LYS D CG    1 
ATOM   5710 C  CD    . LYS D 2 59  ? 14.156  0.082   31.716  1.00 57.71 ? 455  LYS D CD    1 
ATOM   5711 C  CE    . LYS D 2 59  ? 15.236  -0.736  32.455  1.00 56.96 ? 455  LYS D CE    1 
ATOM   5712 N  NZ    . LYS D 2 59  ? 15.606  -0.191  33.810  1.00 55.16 ? 455  LYS D NZ    1 
ATOM   5713 N  N     . ALA D 2 60  ? 8.611   1.924   31.322  1.00 47.29 ? 456  ALA D N     1 
ATOM   5714 C  CA    . ALA D 2 60  ? 7.740   2.901   30.667  1.00 45.83 ? 456  ALA D CA    1 
ATOM   5715 C  C     . ALA D 2 60  ? 8.487   4.196   30.346  1.00 45.35 ? 456  ALA D C     1 
ATOM   5716 O  O     . ALA D 2 60  ? 9.232   4.710   31.182  1.00 45.21 ? 456  ALA D O     1 
ATOM   5717 C  CB    . ALA D 2 60  ? 6.550   3.200   31.541  1.00 45.06 ? 456  ALA D CB    1 
ATOM   5718 N  N     . LYS D 2 61  ? 8.278   4.713   29.134  1.00 44.28 ? 457  LYS D N     1 
ATOM   5719 C  CA    . LYS D 2 61  ? 8.914   5.950   28.664  1.00 42.70 ? 457  LYS D CA    1 
ATOM   5720 C  C     . LYS D 2 61  ? 7.860   6.914   28.139  1.00 42.47 ? 457  LYS D C     1 
ATOM   5721 O  O     . LYS D 2 61  ? 6.846   6.490   27.566  1.00 42.20 ? 457  LYS D O     1 
ATOM   5722 C  CB    . LYS D 2 61  ? 9.881   5.660   27.519  1.00 42.59 ? 457  LYS D CB    1 
ATOM   5723 C  CG    . LYS D 2 61  ? 10.851  4.536   27.770  1.00 43.62 ? 457  LYS D CG    1 
ATOM   5724 C  CD    . LYS D 2 61  ? 11.871  4.863   28.850  1.00 43.91 ? 457  LYS D CD    1 
ATOM   5725 C  CE    . LYS D 2 61  ? 12.804  3.678   29.091  1.00 44.69 ? 457  LYS D CE    1 
ATOM   5726 N  NZ    . LYS D 2 61  ? 13.755  3.894   30.225  1.00 45.60 ? 457  LYS D NZ    1 
ATOM   5727 N  N     . HIS D 2 62  ? 8.101   8.209   28.320  1.00 40.92 ? 458  HIS D N     1 
ATOM   5728 C  CA    . HIS D 2 62  ? 7.158   9.228   27.870  1.00 41.05 ? 458  HIS D CA    1 
ATOM   5729 C  C     . HIS D 2 62  ? 7.830   10.239  26.963  1.00 41.45 ? 458  HIS D C     1 
ATOM   5730 O  O     . HIS D 2 62  ? 8.778   10.921  27.378  1.00 42.08 ? 458  HIS D O     1 
ATOM   5731 C  CB    . HIS D 2 62  ? 6.582   9.949   29.071  1.00 40.50 ? 458  HIS D CB    1 
ATOM   5732 C  CG    . HIS D 2 62  ? 6.007   9.027   30.085  1.00 41.06 ? 458  HIS D CG    1 
ATOM   5733 N  ND1   . HIS D 2 62  ? 4.713   8.563   30.012  1.00 41.28 ? 458  HIS D ND1   1 
ATOM   5734 C  CD2   . HIS D 2 62  ? 6.557   8.452   31.181  1.00 41.90 ? 458  HIS D CD2   1 
ATOM   5735 C  CE1   . HIS D 2 62  ? 4.489   7.744   31.025  1.00 44.11 ? 458  HIS D CE1   1 
ATOM   5736 N  NE2   . HIS D 2 62  ? 5.591   7.659   31.749  1.00 42.33 ? 458  HIS D NE2   1 
ATOM   5737 N  N     . LEU D 2 63  ? 7.333   10.345  25.732  1.00 39.07 ? 459  LEU D N     1 
ATOM   5738 C  CA    . LEU D 2 63  ? 7.912   11.265  24.764  1.00 38.69 ? 459  LEU D CA    1 
ATOM   5739 C  C     . LEU D 2 63  ? 6.957   12.393  24.419  1.00 38.90 ? 459  LEU D C     1 
ATOM   5740 O  O     . LEU D 2 63  ? 5.850   12.152  23.952  1.00 39.23 ? 459  LEU D O     1 
ATOM   5741 C  CB    . LEU D 2 63  ? 8.284   10.496  23.500  1.00 39.35 ? 459  LEU D CB    1 
ATOM   5742 C  CG    . LEU D 2 63  ? 9.626   10.779  22.819  1.00 41.72 ? 459  LEU D CG    1 
ATOM   5743 C  CD1   . LEU D 2 63  ? 10.728  10.975  23.850  1.00 40.49 ? 459  LEU D CD1   1 
ATOM   5744 C  CD2   . LEU D 2 63  ? 9.967   9.611   21.902  1.00 41.67 ? 459  LEU D CD2   1 
ATOM   5745 N  N     . ARG D 2 64  ? 7.379   13.629  24.653  1.00 40.45 ? 460  ARG D N     1 
ATOM   5746 C  CA    . ARG D 2 64  ? 6.531   14.774  24.334  1.00 43.26 ? 460  ARG D CA    1 
ATOM   5747 C  C     . ARG D 2 64  ? 6.542   15.009  22.816  1.00 44.05 ? 460  ARG D C     1 
ATOM   5748 O  O     . ARG D 2 64  ? 7.599   15.009  22.176  1.00 42.67 ? 460  ARG D O     1 
ATOM   5749 C  CB    . ARG D 2 64  ? 7.006   16.028  25.075  1.00 43.49 ? 460  ARG D CB    1 
ATOM   5750 C  CG    . ARG D 2 64  ? 7.083   15.869  26.588  1.00 46.02 ? 460  ARG D CG    1 
ATOM   5751 C  CD    . ARG D 2 64  ? 7.452   17.199  27.250  1.00 48.56 ? 460  ARG D CD    1 
ATOM   5752 N  NE    . ARG D 2 64  ? 8.621   17.132  28.138  1.00 51.26 ? 460  ARG D NE    1 
ATOM   5753 C  CZ    . ARG D 2 64  ? 9.821   16.673  27.779  1.00 52.73 ? 460  ARG D CZ    1 
ATOM   5754 N  NH1   . ARG D 2 64  ? 10.030  16.219  26.544  1.00 54.97 ? 460  ARG D NH1   1 
ATOM   5755 N  NH2   . ARG D 2 64  ? 10.827  16.692  28.645  1.00 50.09 ? 460  ARG D NH2   1 
ATOM   5756 N  N     . LEU D 2 65  ? 5.354   15.205  22.253  1.00 46.53 ? 461  LEU D N     1 
ATOM   5757 C  CA    . LEU D 2 65  ? 5.188   15.411  20.822  1.00 49.88 ? 461  LEU D CA    1 
ATOM   5758 C  C     . LEU D 2 65  ? 4.547   16.754  20.484  1.00 54.12 ? 461  LEU D C     1 
ATOM   5759 O  O     . LEU D 2 65  ? 3.918   17.397  21.324  1.00 55.04 ? 461  LEU D O     1 
ATOM   5760 C  CB    . LEU D 2 65  ? 4.277   14.318  20.248  1.00 46.61 ? 461  LEU D CB    1 
ATOM   5761 C  CG    . LEU D 2 65  ? 4.479   12.836  20.576  1.00 44.75 ? 461  LEU D CG    1 
ATOM   5762 C  CD1   . LEU D 2 65  ? 3.193   12.056  20.281  1.00 42.14 ? 461  LEU D CD1   1 
ATOM   5763 C  CD2   . LEU D 2 65  ? 5.638   12.285  19.782  1.00 42.93 ? 461  LEU D CD2   1 
ATOM   5764 N  N     . SER D 2 66  ? 4.709   17.164  19.233  1.00 59.59 ? 462  SER D N     1 
ATOM   5765 C  CA    . SER D 2 66  ? 4.088   18.380  18.723  1.00 64.41 ? 462  SER D CA    1 
ATOM   5766 C  C     . SER D 2 66  ? 2.988   17.782  17.840  1.00 67.12 ? 462  SER D C     1 
ATOM   5767 O  O     . SER D 2 66  ? 3.215   17.549  16.651  1.00 68.68 ? 462  SER D O     1 
ATOM   5768 C  CB    . SER D 2 66  ? 5.063   19.169  17.843  1.00 65.08 ? 462  SER D CB    1 
ATOM   5769 O  OG    . SER D 2 66  ? 6.303   19.384  18.493  1.00 67.23 ? 462  SER D OG    1 
ATOM   5770 N  N     . LEU D 2 67  ? 1.810   17.526  18.410  1.00 69.61 ? 463  LEU D N     1 
ATOM   5771 C  CA    . LEU D 2 67  ? 0.725   16.911  17.644  1.00 71.98 ? 463  LEU D CA    1 
ATOM   5772 C  C     . LEU D 2 67  ? -0.631  17.628  17.734  1.00 74.10 ? 463  LEU D C     1 
ATOM   5773 O  O     . LEU D 2 67  ? -0.734  18.713  18.306  1.00 74.79 ? 463  LEU D O     1 
ATOM   5774 C  CB    . LEU D 2 67  ? 0.562   15.453  18.088  1.00 71.84 ? 463  LEU D CB    1 
ATOM   5775 C  CG    . LEU D 2 67  ? -0.072  14.469  17.102  1.00 71.55 ? 463  LEU D CG    1 
ATOM   5776 C  CD1   . LEU D 2 67  ? 1.001   13.892  16.197  1.00 70.42 ? 463  LEU D CD1   1 
ATOM   5777 C  CD2   . LEU D 2 67  ? -0.751  13.356  17.864  1.00 70.43 ? 463  LEU D CD2   1 
ATOM   5778 N  N     . ASN D 2 68  ? -1.661  16.997  17.161  1.00 76.45 ? 464  ASN D N     1 
ATOM   5779 C  CA    . ASN D 2 68  ? -3.037  17.517  17.124  1.00 77.81 ? 464  ASN D CA    1 
ATOM   5780 C  C     . ASN D 2 68  ? -3.233  18.448  15.933  1.00 78.16 ? 464  ASN D C     1 
ATOM   5781 O  O     . ASN D 2 68  ? -4.144  18.258  15.129  1.00 78.98 ? 464  ASN D O     1 
ATOM   5782 C  CB    . ASN D 2 68  ? -3.397  18.281  18.411  1.00 79.18 ? 464  ASN D CB    1 
ATOM   5783 C  CG    . ASN D 2 68  ? -4.035  17.393  19.474  1.00 80.67 ? 464  ASN D CG    1 
ATOM   5784 O  OD1   . ASN D 2 68  ? -5.088  16.785  19.255  1.00 80.83 ? 464  ASN D OD1   1 
ATOM   5785 N  ND2   . ASN D 2 68  ? -3.402  17.328  20.642  1.00 81.88 ? 464  ASN D ND2   1 
ATOM   5786 N  N     . GLY D 2 71  ? -4.190  20.284  11.707  1.00 73.81 ? 467  GLY D N     1 
ATOM   5787 C  CA    . GLY D 2 71  ? -3.820  19.928  10.349  1.00 73.59 ? 467  GLY D CA    1 
ATOM   5788 C  C     . GLY D 2 71  ? -2.324  19.779  10.140  1.00 73.21 ? 467  GLY D C     1 
ATOM   5789 O  O     . GLY D 2 71  ? -1.527  20.278  10.938  1.00 74.40 ? 467  GLY D O     1 
ATOM   5790 N  N     . GLN D 2 72  ? -1.945  19.074  9.078   1.00 71.66 ? 468  GLN D N     1 
ATOM   5791 C  CA    . GLN D 2 72  ? -0.538  18.845  8.742   1.00 69.32 ? 468  GLN D CA    1 
ATOM   5792 C  C     . GLN D 2 72  ? 0.046   17.671  9.532   1.00 66.62 ? 468  GLN D C     1 
ATOM   5793 O  O     . GLN D 2 72  ? 1.212   17.313  9.369   1.00 67.02 ? 468  GLN D O     1 
ATOM   5794 N  N     . CYS D 2 73  ? -0.785  17.078  10.384  1.00 63.32 ? 469  CYS D N     1 
ATOM   5795 C  CA    . CYS D 2 73  ? -0.377  15.957  11.221  1.00 60.01 ? 469  CYS D CA    1 
ATOM   5796 C  C     . CYS D 2 73  ? -0.834  14.605  10.682  1.00 55.14 ? 469  CYS D C     1 
ATOM   5797 O  O     . CYS D 2 73  ? -0.644  13.588  11.332  1.00 52.84 ? 469  CYS D O     1 
ATOM   5798 C  CB    . CYS D 2 73  ? -0.928  16.134  12.647  1.00 62.25 ? 469  CYS D CB    1 
ATOM   5799 S  SG    . CYS D 2 73  ? -0.245  17.541  13.570  1.00 65.36 ? 469  CYS D SG    1 
ATOM   5800 N  N     . HIS D 2 74  ? -1.439  14.602  9.498   1.00 51.10 ? 470  HIS D N     1 
ATOM   5801 C  CA    . HIS D 2 74  ? -1.935  13.370  8.891   1.00 48.09 ? 470  HIS D CA    1 
ATOM   5802 C  C     . HIS D 2 74  ? -0.843  12.317  8.680   1.00 46.41 ? 470  HIS D C     1 
ATOM   5803 O  O     . HIS D 2 74  ? -1.010  11.158  9.056   1.00 46.69 ? 470  HIS D O     1 
ATOM   5804 C  CB    . HIS D 2 74  ? -2.610  13.674  7.548   1.00 45.82 ? 470  HIS D CB    1 
ATOM   5805 C  CG    . HIS D 2 74  ? -3.147  12.451  6.868   1.00 43.93 ? 470  HIS D CG    1 
ATOM   5806 N  ND1   . HIS D 2 74  ? -4.115  11.652  7.436   1.00 45.19 ? 470  HIS D ND1   1 
ATOM   5807 C  CD2   . HIS D 2 74  ? -2.800  11.856  5.701   1.00 42.81 ? 470  HIS D CD2   1 
ATOM   5808 C  CE1   . HIS D 2 74  ? -4.335  10.610  6.649   1.00 44.14 ? 470  HIS D CE1   1 
ATOM   5809 N  NE2   . HIS D 2 74  ? -3.553  10.712  5.594   1.00 40.93 ? 470  HIS D NE2   1 
ATOM   5810 N  N     . VAL D 2 75  ? 0.272   12.718  8.083   1.00 43.19 ? 471  VAL D N     1 
ATOM   5811 C  CA    . VAL D 2 75  ? 1.352   11.776  7.834   1.00 41.72 ? 471  VAL D CA    1 
ATOM   5812 C  C     . VAL D 2 75  ? 1.915   11.203  9.127   1.00 40.71 ? 471  VAL D C     1 
ATOM   5813 O  O     . VAL D 2 75  ? 2.305   10.044  9.188   1.00 41.40 ? 471  VAL D O     1 
ATOM   5814 C  CB    . VAL D 2 75  ? 2.475   12.428  7.017   1.00 40.52 ? 471  VAL D CB    1 
ATOM   5815 C  CG1   . VAL D 2 75  ? 3.674   11.509  6.938   1.00 37.69 ? 471  VAL D CG1   1 
ATOM   5816 C  CG2   . VAL D 2 75  ? 1.963   12.728  5.622   1.00 40.63 ? 471  VAL D CG2   1 
ATOM   5817 N  N     . GLN D 2 76  ? 1.958   12.019  10.164  1.00 40.30 ? 472  GLN D N     1 
ATOM   5818 C  CA    . GLN D 2 76  ? 2.446   11.556  11.447  1.00 40.12 ? 472  GLN D CA    1 
ATOM   5819 C  C     . GLN D 2 76  ? 1.467   10.488  11.923  1.00 39.00 ? 472  GLN D C     1 
ATOM   5820 O  O     . GLN D 2 76  ? 1.870   9.476   12.492  1.00 39.20 ? 472  GLN D O     1 
ATOM   5821 C  CB    . GLN D 2 76  ? 2.504   12.725  12.424  1.00 42.62 ? 472  GLN D CB    1 
ATOM   5822 C  CG    . GLN D 2 76  ? 3.251   12.441  13.712  1.00 48.41 ? 472  GLN D CG    1 
ATOM   5823 C  CD    . GLN D 2 76  ? 3.579   13.721  14.474  1.00 53.08 ? 472  GLN D CD    1 
ATOM   5824 O  OE1   . GLN D 2 76  ? 4.195   13.685  15.549  1.00 54.69 ? 472  GLN D OE1   1 
ATOM   5825 N  NE2   . GLN D 2 76  ? 3.169   14.866  13.915  1.00 53.92 ? 472  GLN D NE2   1 
ATOM   5826 N  N     . HIS D 2 77  ? 0.179   10.718  11.677  1.00 37.38 ? 473  HIS D N     1 
ATOM   5827 C  CA    . HIS D 2 77  ? -0.865  9.770   12.046  1.00 37.11 ? 473  HIS D CA    1 
ATOM   5828 C  C     . HIS D 2 77  ? -0.602  8.460   11.321  1.00 35.72 ? 473  HIS D C     1 
ATOM   5829 O  O     . HIS D 2 77  ? -0.731  7.386   11.894  1.00 36.24 ? 473  HIS D O     1 
ATOM   5830 C  CB    . HIS D 2 77  ? -2.238  10.304  11.634  1.00 38.81 ? 473  HIS D CB    1 
ATOM   5831 C  CG    . HIS D 2 77  ? -2.670  11.524  12.390  1.00 41.72 ? 473  HIS D CG    1 
ATOM   5832 N  ND1   . HIS D 2 77  ? -3.768  12.272  12.027  1.00 42.45 ? 473  HIS D ND1   1 
ATOM   5833 C  CD2   . HIS D 2 77  ? -2.158  12.112  13.499  1.00 42.54 ? 473  HIS D CD2   1 
ATOM   5834 C  CE1   . HIS D 2 77  ? -3.916  13.274  12.881  1.00 42.08 ? 473  HIS D CE1   1 
ATOM   5835 N  NE2   . HIS D 2 77  ? -2.953  13.198  13.781  1.00 43.20 ? 473  HIS D NE2   1 
ATOM   5836 N  N     . LEU D 2 78  ? -0.229  8.558   10.051  1.00 34.27 ? 474  LEU D N     1 
ATOM   5837 C  CA    . LEU D 2 78  ? 0.059   7.368   9.273   1.00 34.48 ? 474  LEU D CA    1 
ATOM   5838 C  C     . LEU D 2 78  ? 1.229   6.612   9.899   1.00 35.39 ? 474  LEU D C     1 
ATOM   5839 O  O     . LEU D 2 78  ? 1.179   5.383   10.055  1.00 37.57 ? 474  LEU D O     1 
ATOM   5840 C  CB    . LEU D 2 78  ? 0.374   7.739   7.818   1.00 32.53 ? 474  LEU D CB    1 
ATOM   5841 C  CG    . LEU D 2 78  ? -0.763  8.426   7.038   1.00 33.32 ? 474  LEU D CG    1 
ATOM   5842 C  CD1   . LEU D 2 78  ? -0.391  8.552   5.571   1.00 27.07 ? 474  LEU D CD1   1 
ATOM   5843 C  CD2   . LEU D 2 78  ? -2.053  7.611   7.183   1.00 31.21 ? 474  LEU D CD2   1 
ATOM   5844 N  N     . TRP D 2 79  ? 2.278   7.342   10.260  1.00 33.41 ? 475  TRP D N     1 
ATOM   5845 C  CA    . TRP D 2 79  ? 3.438   6.733   10.878  1.00 33.74 ? 475  TRP D CA    1 
ATOM   5846 C  C     . TRP D 2 79  ? 3.018   5.886   12.088  1.00 32.98 ? 475  TRP D C     1 
ATOM   5847 O  O     . TRP D 2 79  ? 3.341   4.694   12.180  1.00 31.85 ? 475  TRP D O     1 
ATOM   5848 C  CB    . TRP D 2 79  ? 4.421   7.825   11.299  1.00 35.44 ? 475  TRP D CB    1 
ATOM   5849 C  CG    . TRP D 2 79  ? 5.467   7.357   12.244  1.00 35.00 ? 475  TRP D CG    1 
ATOM   5850 C  CD1   . TRP D 2 79  ? 5.726   7.866   13.476  1.00 36.41 ? 475  TRP D CD1   1 
ATOM   5851 C  CD2   . TRP D 2 79  ? 6.384   6.278   12.051  1.00 34.58 ? 475  TRP D CD2   1 
ATOM   5852 N  NE1   . TRP D 2 79  ? 6.750   7.173   14.071  1.00 37.68 ? 475  TRP D NE1   1 
ATOM   5853 C  CE2   . TRP D 2 79  ? 7.174   6.190   13.218  1.00 35.49 ? 475  TRP D CE2   1 
ATOM   5854 C  CE3   . TRP D 2 79  ? 6.613   5.377   11.010  1.00 34.18 ? 475  TRP D CE3   1 
ATOM   5855 C  CZ2   . TRP D 2 79  ? 8.183   5.234   13.376  1.00 35.73 ? 475  TRP D CZ2   1 
ATOM   5856 C  CZ3   . TRP D 2 79  ? 7.619   4.423   11.163  1.00 37.20 ? 475  TRP D CZ3   1 
ATOM   5857 C  CH2   . TRP D 2 79  ? 8.392   4.361   12.343  1.00 36.49 ? 475  TRP D CH2   1 
ATOM   5858 N  N     . PHE D 2 80  ? 2.294   6.495   13.015  1.00 32.17 ? 476  PHE D N     1 
ATOM   5859 C  CA    . PHE D 2 80  ? 1.845   5.762   14.188  1.00 33.65 ? 476  PHE D CA    1 
ATOM   5860 C  C     . PHE D 2 80  ? 0.914   4.604   13.875  1.00 33.68 ? 476  PHE D C     1 
ATOM   5861 O  O     . PHE D 2 80  ? 0.956   3.581   14.555  1.00 33.12 ? 476  PHE D O     1 
ATOM   5862 C  CB    . PHE D 2 80  ? 1.176   6.702   15.173  1.00 34.89 ? 476  PHE D CB    1 
ATOM   5863 C  CG    . PHE D 2 80  ? 2.125   7.688   15.776  1.00 36.95 ? 476  PHE D CG    1 
ATOM   5864 C  CD1   . PHE D 2 80  ? 3.323   7.254   16.330  1.00 36.02 ? 476  PHE D CD1   1 
ATOM   5865 C  CD2   . PHE D 2 80  ? 1.844   9.045   15.767  1.00 35.88 ? 476  PHE D CD2   1 
ATOM   5866 C  CE1   . PHE D 2 80  ? 4.226   8.152   16.859  1.00 36.02 ? 476  PHE D CE1   1 
ATOM   5867 C  CE2   . PHE D 2 80  ? 2.746   9.954   16.296  1.00 37.54 ? 476  PHE D CE2   1 
ATOM   5868 C  CZ    . PHE D 2 80  ? 3.940   9.507   16.843  1.00 36.28 ? 476  PHE D CZ    1 
ATOM   5869 N  N     . GLN D 2 81  ? 0.076   4.752   12.858  1.00 33.20 ? 477  GLN D N     1 
ATOM   5870 C  CA    . GLN D 2 81  ? -0.824  3.674   12.496  1.00 34.97 ? 477  GLN D CA    1 
ATOM   5871 C  C     . GLN D 2 81  ? -0.003  2.472   12.031  1.00 35.88 ? 477  GLN D C     1 
ATOM   5872 O  O     . GLN D 2 81  ? -0.297  1.327   12.397  1.00 34.39 ? 477  GLN D O     1 
ATOM   5873 C  CB    . GLN D 2 81  ? -1.768  4.113   11.381  1.00 38.44 ? 477  GLN D CB    1 
ATOM   5874 C  CG    . GLN D 2 81  ? -2.730  3.020   10.913  1.00 39.64 ? 477  GLN D CG    1 
ATOM   5875 C  CD    . GLN D 2 81  ? -3.636  2.524   12.027  1.00 41.82 ? 477  GLN D CD    1 
ATOM   5876 O  OE1   . GLN D 2 81  ? -4.275  3.317   12.720  1.00 43.54 ? 477  GLN D OE1   1 
ATOM   5877 N  NE2   . GLN D 2 81  ? -3.700  1.206   12.201  1.00 41.62 ? 477  GLN D NE2   1 
ATOM   5878 N  N     . SER D 2 82  ? 1.031   2.733   11.230  1.00 36.21 ? 478  SER D N     1 
ATOM   5879 C  CA    . SER D 2 82  ? 1.879   1.661   10.724  1.00 37.08 ? 478  SER D CA    1 
ATOM   5880 C  C     . SER D 2 82  ? 2.587   0.918   11.851  1.00 38.46 ? 478  SER D C     1 
ATOM   5881 O  O     . SER D 2 82  ? 2.746   -0.302  11.786  1.00 40.41 ? 478  SER D O     1 
ATOM   5882 C  CB    . SER D 2 82  ? 2.921   2.201   9.738   1.00 36.74 ? 478  SER D CB    1 
ATOM   5883 O  OG    . SER D 2 82  ? 3.907   2.982   10.380  1.00 37.45 ? 478  SER D OG    1 
ATOM   5884 N  N     . VAL D 2 83  ? 3.015   1.639   12.883  1.00 37.97 ? 479  VAL D N     1 
ATOM   5885 C  CA    . VAL D 2 83  ? 3.703   0.974   13.974  1.00 37.06 ? 479  VAL D CA    1 
ATOM   5886 C  C     . VAL D 2 83  ? 2.670   0.134   14.703  1.00 40.31 ? 479  VAL D C     1 
ATOM   5887 O  O     . VAL D 2 83  ? 2.916   -1.020  15.050  1.00 40.89 ? 479  VAL D O     1 
ATOM   5888 C  CB    . VAL D 2 83  ? 4.353   1.982   14.923  1.00 34.41 ? 479  VAL D CB    1 
ATOM   5889 C  CG1   . VAL D 2 83  ? 4.938   1.259   16.104  1.00 28.18 ? 479  VAL D CG1   1 
ATOM   5890 C  CG2   . VAL D 2 83  ? 5.432   2.758   14.181  1.00 31.05 ? 479  VAL D CG2   1 
ATOM   5891 N  N     . PHE D 2 84  ? 1.508   0.726   14.923  1.00 42.91 ? 480  PHE D N     1 
ATOM   5892 C  CA    . PHE D 2 84  ? 0.399   0.047   15.562  1.00 46.45 ? 480  PHE D CA    1 
ATOM   5893 C  C     . PHE D 2 84  ? 0.056   -1.206  14.743  1.00 49.43 ? 480  PHE D C     1 
ATOM   5894 O  O     . PHE D 2 84  ? -0.316  -2.243  15.301  1.00 48.37 ? 480  PHE D O     1 
ATOM   5895 C  CB    . PHE D 2 84  ? -0.802  0.989   15.591  1.00 47.08 ? 480  PHE D CB    1 
ATOM   5896 C  CG    . PHE D 2 84  ? -2.076  0.335   16.009  1.00 47.91 ? 480  PHE D CG    1 
ATOM   5897 C  CD1   . PHE D 2 84  ? -2.407  0.225   17.355  1.00 48.65 ? 480  PHE D CD1   1 
ATOM   5898 C  CD2   . PHE D 2 84  ? -2.951  -0.186  15.053  1.00 49.86 ? 480  PHE D CD2   1 
ATOM   5899 C  CE1   . PHE D 2 84  ? -3.601  -0.398  17.752  1.00 50.36 ? 480  PHE D CE1   1 
ATOM   5900 C  CE2   . PHE D 2 84  ? -4.150  -0.815  15.434  1.00 50.68 ? 480  PHE D CE2   1 
ATOM   5901 C  CZ    . PHE D 2 84  ? -4.475  -0.920  16.787  1.00 50.23 ? 480  PHE D CZ    1 
ATOM   5902 N  N     . ASP D 2 85  ? 0.174   -1.106  13.418  1.00 51.80 ? 481  ASP D N     1 
ATOM   5903 C  CA    . ASP D 2 85  ? -0.120  -2.248  12.562  1.00 54.65 ? 481  ASP D CA    1 
ATOM   5904 C  C     . ASP D 2 85  ? 0.844   -3.384  12.840  1.00 57.90 ? 481  ASP D C     1 
ATOM   5905 O  O     . ASP D 2 85  ? 0.431   -4.536  12.923  1.00 59.78 ? 481  ASP D O     1 
ATOM   5906 C  CB    . ASP D 2 85  ? -0.048  -1.876  11.079  1.00 53.50 ? 481  ASP D CB    1 
ATOM   5907 C  CG    . ASP D 2 85  ? -1.285  -1.124  10.595  1.00 52.03 ? 481  ASP D CG    1 
ATOM   5908 O  OD1   . ASP D 2 85  ? -2.391  -1.378  11.128  1.00 49.96 ? 481  ASP D OD1   1 
ATOM   5909 O  OD2   . ASP D 2 85  ? -1.150  -0.290  9.667   1.00 50.94 ? 481  ASP D OD2   1 
ATOM   5910 N  N     . MET D 2 86  ? 2.128   -3.071  12.984  1.00 60.69 ? 482  MET D N     1 
ATOM   5911 C  CA    . MET D 2 86  ? 3.110   -4.108  13.273  1.00 64.03 ? 482  MET D CA    1 
ATOM   5912 C  C     . MET D 2 86  ? 2.806   -4.733  14.615  1.00 65.78 ? 482  MET D C     1 
ATOM   5913 O  O     . MET D 2 86  ? 2.975   -5.931  14.796  1.00 66.06 ? 482  MET D O     1 
ATOM   5914 C  CB    . MET D 2 86  ? 4.525   -3.540  13.300  1.00 65.73 ? 482  MET D CB    1 
ATOM   5915 C  CG    . MET D 2 86  ? 5.125   -3.374  11.932  1.00 70.67 ? 482  MET D CG    1 
ATOM   5916 S  SD    . MET D 2 86  ? 6.676   -2.473  11.972  1.00 78.58 ? 482  MET D SD    1 
ATOM   5917 C  CE    . MET D 2 86  ? 6.164   -0.848  11.293  1.00 76.35 ? 482  MET D CE    1 
ATOM   5918 N  N     . LEU D 2 87  ? 2.358   -3.909  15.554  1.00 67.69 ? 483  LEU D N     1 
ATOM   5919 C  CA    . LEU D 2 87  ? 2.026   -4.380  16.888  1.00 70.44 ? 483  LEU D CA    1 
ATOM   5920 C  C     . LEU D 2 87  ? 0.924   -5.408  16.836  1.00 73.70 ? 483  LEU D C     1 
ATOM   5921 O  O     . LEU D 2 87  ? 1.086   -6.534  17.306  1.00 74.81 ? 483  LEU D O     1 
ATOM   5922 C  CB    . LEU D 2 87  ? 1.548   -3.231  17.775  1.00 68.86 ? 483  LEU D CB    1 
ATOM   5923 C  CG    . LEU D 2 87  ? 2.565   -2.474  18.622  1.00 67.46 ? 483  LEU D CG    1 
ATOM   5924 C  CD1   . LEU D 2 87  ? 1.803   -1.561  19.565  1.00 66.66 ? 483  LEU D CD1   1 
ATOM   5925 C  CD2   . LEU D 2 87  ? 3.434   -3.442  19.409  1.00 65.12 ? 483  LEU D CD2   1 
ATOM   5926 N  N     . ARG D 2 88  ? -0.203  -4.998  16.264  1.00 77.63 ? 484  ARG D N     1 
ATOM   5927 C  CA    . ARG D 2 88  ? -1.385  -5.842  16.139  1.00 81.52 ? 484  ARG D CA    1 
ATOM   5928 C  C     . ARG D 2 88  ? -1.039  -7.260  15.680  1.00 83.67 ? 484  ARG D C     1 
ATOM   5929 O  O     . ARG D 2 88  ? -1.809  -8.198  15.900  1.00 83.36 ? 484  ARG D O     1 
ATOM   5930 C  CB    . ARG D 2 88  ? -2.370  -5.185  15.163  1.00 82.58 ? 484  ARG D CB    1 
ATOM   5931 C  CG    . ARG D 2 88  ? -3.715  -5.874  15.053  1.00 85.45 ? 484  ARG D CG    1 
ATOM   5932 C  CD    . ARG D 2 88  ? -4.615  -5.152  14.063  1.00 88.69 ? 484  ARG D CD    1 
ATOM   5933 N  NE    . ARG D 2 88  ? -5.796  -5.943  13.719  1.00 91.42 ? 484  ARG D NE    1 
ATOM   5934 C  CZ    . ARG D 2 88  ? -6.702  -5.589  12.808  1.00 92.25 ? 484  ARG D CZ    1 
ATOM   5935 N  NH1   . ARG D 2 88  ? -6.569  -4.448  12.143  1.00 92.28 ? 484  ARG D NH1   1 
ATOM   5936 N  NH2   . ARG D 2 88  ? -7.739  -6.382  12.556  1.00 91.66 ? 484  ARG D NH2   1 
ATOM   5937 N  N     . HIS D 2 89  ? 0.121   -7.411  15.044  1.00 86.13 ? 485  HIS D N     1 
ATOM   5938 C  CA    . HIS D 2 89  ? 0.561   -8.715  14.558  1.00 87.79 ? 485  HIS D CA    1 
ATOM   5939 C  C     . HIS D 2 89  ? 1.457   -9.455  15.545  1.00 88.15 ? 485  HIS D C     1 
ATOM   5940 O  O     . HIS D 2 89  ? 2.446   -10.069 15.147  1.00 88.67 ? 485  HIS D O     1 
ATOM   5941 C  CB    . HIS D 2 89  ? 1.288   -8.559  13.224  1.00 89.42 ? 485  HIS D CB    1 
ATOM   5942 C  CG    . HIS D 2 89  ? 0.421   -8.025  12.129  1.00 92.15 ? 485  HIS D CG    1 
ATOM   5943 N  ND1   . HIS D 2 89  ? 0.902   -7.739  10.868  1.00 93.49 ? 485  HIS D ND1   1 
ATOM   5944 C  CD2   . HIS D 2 89  ? -0.901  -7.726  12.099  1.00 93.21 ? 485  HIS D CD2   1 
ATOM   5945 C  CE1   . HIS D 2 89  ? -0.082  -7.287  10.111  1.00 94.10 ? 485  HIS D CE1   1 
ATOM   5946 N  NE2   . HIS D 2 89  ? -1.190  -7.270  10.840  1.00 94.37 ? 485  HIS D NE2   1 
ATOM   5947 N  N     . PHE D 2 90  ? 1.107   -9.393  16.828  1.00 88.35 ? 486  PHE D N     1 
ATOM   5948 C  CA    . PHE D 2 90  ? 1.870   -10.074 17.876  1.00 88.88 ? 486  PHE D CA    1 
ATOM   5949 C  C     . PHE D 2 90  ? 0.957   -10.716 18.911  1.00 88.83 ? 486  PHE D C     1 
ATOM   5950 O  O     . PHE D 2 90  ? -0.263  -10.471 18.819  1.00 89.20 ? 486  PHE D O     1 
ATOM   5951 C  CB    . PHE D 2 90  ? 2.823   -9.104  18.581  1.00 88.84 ? 486  PHE D CB    1 
ATOM   5952 C  CG    . PHE D 2 90  ? 4.168   -8.984  17.919  1.00 88.74 ? 486  PHE D CG    1 
ATOM   5953 C  CD1   . PHE D 2 90  ? 4.302   -8.361  16.680  1.00 88.22 ? 486  PHE D CD1   1 
ATOM   5954 C  CD2   . PHE D 2 90  ? 5.305   -9.498  18.538  1.00 89.00 ? 486  PHE D CD2   1 
ATOM   5955 C  CE1   . PHE D 2 90  ? 5.549   -8.247  16.066  1.00 88.94 ? 486  PHE D CE1   1 
ATOM   5956 C  CE2   . PHE D 2 90  ? 6.561   -9.391  17.935  1.00 89.56 ? 486  PHE D CE2   1 
ATOM   5957 C  CZ    . PHE D 2 90  ? 6.683   -8.764  16.694  1.00 89.27 ? 486  PHE D CZ    1 
ATOM   5958 N  N     . LEU E 3 4   ? 34.462  31.226  50.670  1.00 55.96 ? 102  LEU E N     1 
ATOM   5959 C  CA    . LEU E 3 4   ? 33.137  31.380  51.270  1.00 56.10 ? 102  LEU E CA    1 
ATOM   5960 C  C     . LEU E 3 4   ? 32.166  30.237  50.860  1.00 54.82 ? 102  LEU E C     1 
ATOM   5961 O  O     . LEU E 3 4   ? 31.451  29.686  51.705  1.00 54.00 ? 102  LEU E O     1 
ATOM   5962 C  CB    . LEU E 3 4   ? 32.564  32.747  50.860  1.00 56.45 ? 102  LEU E CB    1 
ATOM   5963 C  CG    . LEU E 3 4   ? 31.426  33.380  51.656  1.00 56.70 ? 102  LEU E CG    1 
ATOM   5964 C  CD1   . LEU E 3 4   ? 31.854  33.606  53.104  1.00 55.41 ? 102  LEU E CD1   1 
ATOM   5965 C  CD2   . LEU E 3 4   ? 31.048  34.701  50.988  1.00 56.83 ? 102  LEU E CD2   1 
ATOM   5966 N  N     . PRO E 3 5   ? 32.125  29.877  49.557  1.00 53.58 ? 103  PRO E N     1 
ATOM   5967 C  CA    . PRO E 3 5   ? 31.234  28.803  49.084  1.00 53.35 ? 103  PRO E CA    1 
ATOM   5968 C  C     . PRO E 3 5   ? 31.671  27.407  49.542  1.00 52.71 ? 103  PRO E C     1 
ATOM   5969 O  O     . PRO E 3 5   ? 32.858  27.078  49.509  1.00 53.34 ? 103  PRO E O     1 
ATOM   5970 C  CB    . PRO E 3 5   ? 31.254  28.976  47.564  1.00 52.91 ? 103  PRO E CB    1 
ATOM   5971 C  CG    . PRO E 3 5   ? 32.601  29.545  47.312  1.00 53.22 ? 103  PRO E CG    1 
ATOM   5972 C  CD    . PRO E 3 5   ? 32.757  30.563  48.420  1.00 52.96 ? 103  PRO E CD    1 
ATOM   5973 N  N     . ALA E 3 6   ? 30.707  26.591  49.969  1.00 52.60 ? 104  ALA E N     1 
ATOM   5974 C  CA    . ALA E 3 6   ? 30.993  25.242  50.483  1.00 52.40 ? 104  ALA E CA    1 
ATOM   5975 C  C     . ALA E 3 6   ? 31.507  24.249  49.446  1.00 52.63 ? 104  ALA E C     1 
ATOM   5976 O  O     . ALA E 3 6   ? 30.903  23.198  49.216  1.00 53.29 ? 104  ALA E O     1 
ATOM   5977 C  CB    . ALA E 3 6   ? 29.753  24.669  51.176  1.00 49.54 ? 104  ALA E CB    1 
ATOM   5978 N  N     . THR E 3 7   ? 32.632  24.588  48.831  1.00 53.89 ? 105  THR E N     1 
ATOM   5979 C  CA    . THR E 3 7   ? 33.274  23.751  47.815  1.00 54.62 ? 105  THR E CA    1 
ATOM   5980 C  C     . THR E 3 7   ? 33.554  22.334  48.309  1.00 53.45 ? 105  THR E C     1 
ATOM   5981 O  O     . THR E 3 7   ? 33.591  21.392  47.517  1.00 53.73 ? 105  THR E O     1 
ATOM   5982 C  CB    . THR E 3 7   ? 34.626  24.368  47.389  1.00 55.67 ? 105  THR E CB    1 
ATOM   5983 O  OG1   . THR E 3 7   ? 34.401  25.656  46.806  1.00 57.80 ? 105  THR E OG1   1 
ATOM   5984 C  CG2   . THR E 3 7   ? 35.335  23.477  46.394  1.00 58.56 ? 105  THR E CG2   1 
ATOM   5985 N  N     . GLY E 3 8   ? 33.752  22.197  49.618  1.00 52.40 ? 106  GLY E N     1 
ATOM   5986 C  CA    . GLY E 3 8   ? 34.048  20.899  50.195  1.00 51.15 ? 106  GLY E CA    1 
ATOM   5987 C  C     . GLY E 3 8   ? 32.875  19.939  50.265  1.00 51.76 ? 106  GLY E C     1 
ATOM   5988 O  O     . GLY E 3 8   ? 33.063  18.754  50.571  1.00 53.20 ? 106  GLY E O     1 
ATOM   5989 N  N     . ASP E 3 9   ? 31.668  20.433  49.990  1.00 49.37 ? 107  ASP E N     1 
ATOM   5990 C  CA    . ASP E 3 9   ? 30.476  19.594  50.034  1.00 47.10 ? 107  ASP E CA    1 
ATOM   5991 C  C     . ASP E 3 9   ? 30.373  18.706  48.791  1.00 47.83 ? 107  ASP E C     1 
ATOM   5992 O  O     . ASP E 3 9   ? 29.520  17.807  48.724  1.00 46.50 ? 107  ASP E O     1 
ATOM   5993 C  CB    . ASP E 3 9   ? 29.215  20.453  50.156  1.00 45.38 ? 107  ASP E CB    1 
ATOM   5994 C  CG    . ASP E 3 9   ? 29.144  21.223  51.466  1.00 43.50 ? 107  ASP E CG    1 
ATOM   5995 O  OD1   . ASP E 3 9   ? 30.053  21.092  52.302  1.00 45.61 ? 107  ASP E OD1   1 
ATOM   5996 O  OD2   . ASP E 3 9   ? 28.167  21.968  51.664  1.00 42.37 ? 107  ASP E OD2   1 
ATOM   5997 N  N     . PHE E 3 10  ? 31.243  18.955  47.813  1.00 47.55 ? 108  PHE E N     1 
ATOM   5998 C  CA    . PHE E 3 10  ? 31.238  18.173  46.582  1.00 49.37 ? 108  PHE E CA    1 
ATOM   5999 C  C     . PHE E 3 10  ? 32.489  17.316  46.419  1.00 51.33 ? 108  PHE E C     1 
ATOM   6000 O  O     . PHE E 3 10  ? 33.592  17.717  46.792  1.00 52.95 ? 108  PHE E O     1 
ATOM   6001 C  CB    . PHE E 3 10  ? 31.104  19.091  45.365  1.00 47.51 ? 108  PHE E CB    1 
ATOM   6002 C  CG    . PHE E 3 10  ? 29.925  20.025  45.438  1.00 45.74 ? 108  PHE E CG    1 
ATOM   6003 C  CD1   . PHE E 3 10  ? 30.009  21.228  46.139  1.00 45.77 ? 108  PHE E CD1   1 
ATOM   6004 C  CD2   . PHE E 3 10  ? 28.706  19.689  44.837  1.00 44.00 ? 108  PHE E CD2   1 
ATOM   6005 C  CE1   . PHE E 3 10  ? 28.906  22.076  46.241  1.00 46.61 ? 108  PHE E CE1   1 
ATOM   6006 C  CE2   . PHE E 3 10  ? 27.590  20.532  44.932  1.00 43.46 ? 108  PHE E CE2   1 
ATOM   6007 C  CZ    . PHE E 3 10  ? 27.704  21.716  45.628  1.00 44.23 ? 108  PHE E CZ    1 
ATOM   6008 N  N     . MET E 3 11  ? 32.308  16.132  45.852  1.00 52.95 ? 109  MET E N     1 
ATOM   6009 C  CA    . MET E 3 11  ? 33.413  15.218  45.618  1.00 54.10 ? 109  MET E CA    1 
ATOM   6010 C  C     . MET E 3 11  ? 33.363  14.783  44.163  1.00 54.59 ? 109  MET E C     1 
ATOM   6011 O  O     . MET E 3 11  ? 32.308  14.397  43.658  1.00 53.35 ? 109  MET E O     1 
ATOM   6012 C  CB    . MET E 3 11  ? 33.289  13.991  46.525  1.00 56.40 ? 109  MET E CB    1 
ATOM   6013 C  CG    . MET E 3 11  ? 34.410  12.980  46.368  1.00 59.29 ? 109  MET E CG    1 
ATOM   6014 S  SD    . MET E 3 11  ? 34.119  11.457  47.317  1.00 64.68 ? 109  MET E SD    1 
ATOM   6015 C  CE    . MET E 3 11  ? 32.995  10.619  46.263  1.00 61.20 ? 109  MET E CE    1 
ATOM   6016 N  N     . ASN E 3 12  ? 34.501  14.848  43.484  1.00 56.33 ? 110  ASN E N     1 
ATOM   6017 C  CA    . ASN E 3 12  ? 34.553  14.439  42.088  1.00 57.84 ? 110  ASN E CA    1 
ATOM   6018 C  C     . ASN E 3 12  ? 34.438  12.926  42.105  1.00 57.39 ? 110  ASN E C     1 
ATOM   6019 O  O     . ASN E 3 12  ? 35.255  12.257  42.729  1.00 57.80 ? 110  ASN E O     1 
ATOM   6020 C  CB    . ASN E 3 12  ? 35.883  14.843  41.458  1.00 60.47 ? 110  ASN E CB    1 
ATOM   6021 C  CG    . ASN E 3 12  ? 35.879  14.702  39.946  1.00 63.52 ? 110  ASN E CG    1 
ATOM   6022 O  OD1   . ASN E 3 12  ? 35.184  15.444  39.245  1.00 64.86 ? 110  ASN E OD1   1 
ATOM   6023 N  ND2   . ASN E 3 12  ? 36.647  13.744  39.434  1.00 64.76 ? 110  ASN E ND2   1 
ATOM   6024 N  N     . MET E 3 13  ? 33.434  12.376  41.432  1.00 56.97 ? 111  MET E N     1 
ATOM   6025 C  CA    . MET E 3 13  ? 33.277  10.931  41.451  1.00 56.88 ? 111  MET E CA    1 
ATOM   6026 C  C     . MET E 3 13  ? 32.368  10.381  40.365  1.00 58.05 ? 111  MET E C     1 
ATOM   6027 O  O     . MET E 3 13  ? 31.734  11.121  39.612  1.00 59.58 ? 111  MET E O     1 
ATOM   6028 C  CB    . MET E 3 13  ? 32.710  10.503  42.793  1.00 55.39 ? 111  MET E CB    1 
ATOM   6029 C  CG    . MET E 3 13  ? 31.311  11.045  42.975  1.00 57.79 ? 111  MET E CG    1 
ATOM   6030 S  SD    . MET E 3 13  ? 30.362  10.306  44.282  1.00 57.98 ? 111  MET E SD    1 
ATOM   6031 C  CE    . MET E 3 13  ? 29.841  8.771   43.475  1.00 57.39 ? 111  MET E CE    1 
ATOM   6032 N  N     . SER E 3 14  ? 32.315  9.055   40.315  1.00 58.92 ? 112  SER E N     1 
ATOM   6033 C  CA    . SER E 3 14  ? 31.499  8.324   39.364  1.00 59.42 ? 112  SER E CA    1 
ATOM   6034 C  C     . SER E 3 14  ? 30.831  7.242   40.203  1.00 59.56 ? 112  SER E C     1 
ATOM   6035 O  O     . SER E 3 14  ? 31.374  6.831   41.225  1.00 59.16 ? 112  SER E O     1 
ATOM   6036 C  CB    . SER E 3 14  ? 32.400  7.695   38.304  1.00 59.92 ? 112  SER E CB    1 
ATOM   6037 O  OG    . SER E 3 14  ? 31.721  7.574   37.068  1.00 62.50 ? 112  SER E OG    1 
ATOM   6038 N  N     . PRO E 3 15  ? 29.639  6.779   39.802  1.00 60.39 ? 113  PRO E N     1 
ATOM   6039 C  CA    . PRO E 3 15  ? 28.984  5.737   40.600  1.00 61.21 ? 113  PRO E CA    1 
ATOM   6040 C  C     . PRO E 3 15  ? 29.863  4.518   40.898  1.00 62.48 ? 113  PRO E C     1 
ATOM   6041 O  O     . PRO E 3 15  ? 30.775  4.188   40.136  1.00 62.90 ? 113  PRO E O     1 
ATOM   6042 C  CB    . PRO E 3 15  ? 27.723  5.407   39.789  1.00 60.83 ? 113  PRO E CB    1 
ATOM   6043 C  CG    . PRO E 3 15  ? 27.974  6.023   38.417  1.00 60.08 ? 113  PRO E CG    1 
ATOM   6044 C  CD    . PRO E 3 15  ? 28.748  7.260   38.734  1.00 59.83 ? 113  PRO E CD    1 
ATOM   6045 N  N     . VAL E 3 16  ? 29.574  3.862   42.022  1.00 63.91 ? 114  VAL E N     1 
ATOM   6046 C  CA    . VAL E 3 16  ? 30.321  2.690   42.469  1.00 64.42 ? 114  VAL E CA    1 
ATOM   6047 C  C     . VAL E 3 16  ? 29.699  1.414   41.896  1.00 64.72 ? 114  VAL E C     1 
ATOM   6048 O  O     . VAL E 3 16  ? 29.744  1.195   40.686  1.00 64.90 ? 114  VAL E O     1 
ATOM   6049 C  CB    . VAL E 3 16  ? 30.363  2.619   44.017  1.00 64.12 ? 114  VAL E CB    1 
ATOM   6050 C  CG1   . VAL E 3 16  ? 31.275  1.484   44.477  1.00 62.66 ? 114  VAL E CG1   1 
ATOM   6051 C  CG2   . VAL E 3 16  ? 30.866  3.943   44.580  1.00 62.84 ? 114  VAL E CG2   1 
ATOM   6052 N  N     . GLY E 3 17  ? 29.129  0.557   42.736  1.00 66.19 ? 115  GLY E N     1 
ATOM   6053 C  CA    . GLY E 3 17  ? 28.519  -0.649  42.198  1.00 66.88 ? 115  GLY E CA    1 
ATOM   6054 C  C     . GLY E 3 17  ? 28.462  -1.866  43.096  1.00 66.49 ? 115  GLY E C     1 
ATOM   6055 O  O     . GLY E 3 17  ? 27.979  -2.911  42.659  1.00 65.87 ? 115  GLY E O     1 
ATOM   6056 N  N     . LEU F 3 4   ? -15.774 42.395  -8.928  1.00 52.18 ? 102  LEU F N     1 
ATOM   6057 C  CA    . LEU F 3 4   ? -14.505 42.569  -9.629  1.00 52.13 ? 102  LEU F CA    1 
ATOM   6058 C  C     . LEU F 3 4   ? -13.640 41.283  -9.640  1.00 51.65 ? 102  LEU F C     1 
ATOM   6059 O  O     . LEU F 3 4   ? -12.993 40.984  -10.647 1.00 52.41 ? 102  LEU F O     1 
ATOM   6060 C  CB    . LEU F 3 4   ? -13.733 43.772  -9.046  1.00 51.40 ? 102  LEU F CB    1 
ATOM   6061 C  CG    . LEU F 3 4   ? -12.727 44.500  -9.973  1.00 53.77 ? 102  LEU F CG    1 
ATOM   6062 C  CD1   . LEU F 3 4   ? -13.190 44.422  -11.425 1.00 53.65 ? 102  LEU F CD1   1 
ATOM   6063 C  CD2   . LEU F 3 4   ? -12.565 45.970  -9.562  1.00 49.42 ? 102  LEU F CD2   1 
ATOM   6064 N  N     . PRO F 3 5   ? -13.640 40.496  -8.539  1.00 50.38 ? 103  PRO F N     1 
ATOM   6065 C  CA    . PRO F 3 5   ? -12.861 39.242  -8.436  1.00 50.13 ? 103  PRO F CA    1 
ATOM   6066 C  C     . PRO F 3 5   ? -13.401 38.162  -9.376  1.00 50.86 ? 103  PRO F C     1 
ATOM   6067 O  O     . PRO F 3 5   ? -14.609 37.955  -9.426  1.00 53.31 ? 103  PRO F O     1 
ATOM   6068 C  CB    . PRO F 3 5   ? -13.067 38.815  -6.984  1.00 48.75 ? 103  PRO F CB    1 
ATOM   6069 C  CG    . PRO F 3 5   ? -13.413 40.085  -6.278  1.00 49.71 ? 103  PRO F CG    1 
ATOM   6070 C  CD    . PRO F 3 5   ? -14.281 40.816  -7.251  1.00 48.83 ? 103  PRO F CD    1 
ATOM   6071 N  N     . ALA F 3 6   ? -12.525 37.467  -10.101 1.00 50.65 ? 104  ALA F N     1 
ATOM   6072 C  CA    . ALA F 3 6   ? -12.956 36.426  -11.044 1.00 50.48 ? 104  ALA F CA    1 
ATOM   6073 C  C     . ALA F 3 6   ? -13.532 35.174  -10.380 1.00 51.32 ? 104  ALA F C     1 
ATOM   6074 O  O     . ALA F 3 6   ? -13.027 34.066  -10.572 1.00 51.85 ? 104  ALA F O     1 
ATOM   6075 C  CB    . ALA F 3 6   ? -11.797 36.040  -11.955 1.00 49.57 ? 104  ALA F CB    1 
ATOM   6076 N  N     . THR F 3 7   ? -14.596 35.352  -9.604  1.00 52.32 ? 105  THR F N     1 
ATOM   6077 C  CA    . THR F 3 7   ? -15.220 34.231  -8.908  1.00 52.05 ? 105  THR F CA    1 
ATOM   6078 C  C     . THR F 3 7   ? -15.719 33.131  -9.846  1.00 51.62 ? 105  THR F C     1 
ATOM   6079 O  O     . THR F 3 7   ? -15.892 31.988  -9.427  1.00 52.46 ? 105  THR F O     1 
ATOM   6080 C  CB    . THR F 3 7   ? -16.371 34.716  -7.984  1.00 51.91 ? 105  THR F CB    1 
ATOM   6081 O  OG1   . THR F 3 7   ? -17.162 35.701  -8.665  1.00 54.17 ? 105  THR F OG1   1 
ATOM   6082 C  CG2   . THR F 3 7   ? -15.799 35.326  -6.702  1.00 50.54 ? 105  THR F CG2   1 
ATOM   6083 N  N     . GLY F 3 8   ? -15.934 33.471  -11.113 1.00 51.42 ? 106  GLY F N     1 
ATOM   6084 C  CA    . GLY F 3 8   ? -16.405 32.492  -12.076 1.00 50.18 ? 106  GLY F CA    1 
ATOM   6085 C  C     . GLY F 3 8   ? -15.331 31.525  -12.540 1.00 51.38 ? 106  GLY F C     1 
ATOM   6086 O  O     . GLY F 3 8   ? -15.630 30.543  -13.223 1.00 52.37 ? 106  GLY F O     1 
ATOM   6087 N  N     . ASP F 3 9   ? -14.079 31.791  -12.177 1.00 50.16 ? 107  ASP F N     1 
ATOM   6088 C  CA    . ASP F 3 9   ? -12.971 30.911  -12.559 1.00 48.97 ? 107  ASP F CA    1 
ATOM   6089 C  C     . ASP F 3 9   ? -12.925 29.640  -11.711 1.00 48.24 ? 107  ASP F C     1 
ATOM   6090 O  O     . ASP F 3 9   ? -12.180 28.703  -12.022 1.00 45.61 ? 107  ASP F O     1 
ATOM   6091 C  CB    . ASP F 3 9   ? -11.631 31.646  -12.426 1.00 49.11 ? 107  ASP F CB    1 
ATOM   6092 C  CG    . ASP F 3 9   ? -11.428 32.690  -13.499 1.00 48.73 ? 107  ASP F CG    1 
ATOM   6093 O  OD1   . ASP F 3 9   ? -12.250 32.734  -14.443 1.00 49.90 ? 107  ASP F OD1   1 
ATOM   6094 O  OD2   . ASP F 3 9   ? -10.442 33.454  -13.405 1.00 49.51 ? 107  ASP F OD2   1 
ATOM   6095 N  N     . PHE F 3 10  ? -13.720 29.615  -10.642 1.00 48.46 ? 108  PHE F N     1 
ATOM   6096 C  CA    . PHE F 3 10  ? -13.765 28.461  -9.748  1.00 50.24 ? 108  PHE F CA    1 
ATOM   6097 C  C     . PHE F 3 10  ? -15.099 27.716  -9.822  1.00 51.54 ? 108  PHE F C     1 
ATOM   6098 O  O     . PHE F 3 10  ? -16.161 28.321  -9.975  1.00 53.14 ? 108  PHE F O     1 
ATOM   6099 C  CB    . PHE F 3 10  ? -13.504 28.899  -8.302  1.00 49.09 ? 108  PHE F CB    1 
ATOM   6100 C  CG    . PHE F 3 10  ? -12.260 29.727  -8.147  1.00 48.31 ? 108  PHE F CG    1 
ATOM   6101 C  CD1   . PHE F 3 10  ? -12.198 31.019  -8.668  1.00 47.90 ? 108  PHE F CD1   1 
ATOM   6102 C  CD2   . PHE F 3 10  ? -11.126 29.211  -7.517  1.00 49.33 ? 108  PHE F CD2   1 
ATOM   6103 C  CE1   . PHE F 3 10  ? -11.041 31.779  -8.571  1.00 49.06 ? 108  PHE F CE1   1 
ATOM   6104 C  CE2   . PHE F 3 10  ? -9.954  29.966  -7.413  1.00 49.22 ? 108  PHE F CE2   1 
ATOM   6105 C  CZ    . PHE F 3 10  ? -9.929  31.243  -7.942  1.00 49.55 ? 108  PHE F CZ    1 
ATOM   6106 N  N     . MET F 3 11  ? -15.024 26.397  -9.711  1.00 52.62 ? 109  MET F N     1 
ATOM   6107 C  CA    . MET F 3 11  ? -16.196 25.534  -9.756  1.00 53.47 ? 109  MET F CA    1 
ATOM   6108 C  C     . MET F 3 11  ? -16.160 24.634  -8.523  1.00 54.53 ? 109  MET F C     1 
ATOM   6109 O  O     . MET F 3 11  ? -15.128 24.032  -8.220  1.00 53.85 ? 109  MET F O     1 
ATOM   6110 C  CB    . MET F 3 11  ? -16.152 24.691  -11.032 1.00 53.23 ? 109  MET F CB    1 
ATOM   6111 C  CG    . MET F 3 11  ? -16.964 23.419  -10.979 1.00 54.27 ? 109  MET F CG    1 
ATOM   6112 S  SD    . MET F 3 11  ? -16.501 22.276  -12.300 1.00 59.84 ? 109  MET F SD    1 
ATOM   6113 C  CE    . MET F 3 11  ? -18.006 21.343  -12.480 1.00 58.06 ? 109  MET F CE    1 
ATOM   6114 N  N     . ASN F 3 12  ? -17.276 24.549  -7.806  1.00 55.89 ? 110  ASN F N     1 
ATOM   6115 C  CA    . ASN F 3 12  ? -17.319 23.704  -6.622  1.00 56.96 ? 110  ASN F CA    1 
ATOM   6116 C  C     . ASN F 3 12  ? -17.369 22.277  -7.137  1.00 56.52 ? 110  ASN F C     1 
ATOM   6117 O  O     . ASN F 3 12  ? -18.279 21.918  -7.879  1.00 56.18 ? 110  ASN F O     1 
ATOM   6118 C  CB    . ASN F 3 12  ? -18.559 24.002  -5.784  1.00 59.91 ? 110  ASN F CB    1 
ATOM   6119 C  CG    . ASN F 3 12  ? -18.392 23.574  -4.342  1.00 63.20 ? 110  ASN F CG    1 
ATOM   6120 O  OD1   . ASN F 3 12  ? -18.036 22.429  -4.062  1.00 65.40 ? 110  ASN F OD1   1 
ATOM   6121 N  ND2   . ASN F 3 12  ? -18.642 24.493  -3.415  1.00 64.22 ? 110  ASN F ND2   1 
ATOM   6122 N  N     . MET F 3 13  ? -16.399 21.457  -6.752  1.00 56.96 ? 111  MET F N     1 
ATOM   6123 C  CA    . MET F 3 13  ? -16.378 20.093  -7.254  1.00 58.20 ? 111  MET F CA    1 
ATOM   6124 C  C     . MET F 3 13  ? -15.498 19.138  -6.464  1.00 59.21 ? 111  MET F C     1 
ATOM   6125 O  O     . MET F 3 13  ? -14.798 19.536  -5.531  1.00 59.37 ? 111  MET F O     1 
ATOM   6126 C  CB    . MET F 3 13  ? -15.893 20.095  -8.702  1.00 57.71 ? 111  MET F CB    1 
ATOM   6127 C  CG    . MET F 3 13  ? -14.492 20.682  -8.855  1.00 58.29 ? 111  MET F CG    1 
ATOM   6128 S  SD    . MET F 3 13  ? -13.559 19.907  -10.186 1.00 63.38 ? 111  MET F SD    1 
ATOM   6129 C  CE    . MET F 3 13  ? -12.683 18.605  -9.312  1.00 60.73 ? 111  MET F CE    1 
ATOM   6130 N  N     . SER F 3 14  ? -15.554 17.870  -6.870  1.00 59.32 ? 112  SER F N     1 
ATOM   6131 C  CA    . SER F 3 14  ? -14.773 16.790  -6.284  1.00 59.84 ? 112  SER F CA    1 
ATOM   6132 C  C     . SER F 3 14  ? -14.264 16.002  -7.481  1.00 60.42 ? 112  SER F C     1 
ATOM   6133 O  O     . SER F 3 14  ? -14.859 16.041  -8.555  1.00 60.62 ? 112  SER F O     1 
ATOM   6134 C  CB    . SER F 3 14  ? -15.654 15.887  -5.417  1.00 61.09 ? 112  SER F CB    1 
ATOM   6135 O  OG    . SER F 3 14  ? -16.615 15.207  -6.208  1.00 60.43 ? 112  SER F OG    1 
ATOM   6136 N  N     . PRO F 3 15  ? -13.159 15.270  -7.313  1.00 60.80 ? 113  PRO F N     1 
ATOM   6137 C  CA    . PRO F 3 15  ? -12.599 14.483  -8.413  1.00 61.75 ? 113  PRO F CA    1 
ATOM   6138 C  C     . PRO F 3 15  ? -13.626 13.584  -9.089  1.00 62.71 ? 113  PRO F C     1 
ATOM   6139 O  O     . PRO F 3 15  ? -14.581 13.118  -8.462  1.00 62.45 ? 113  PRO F O     1 
ATOM   6140 C  CB    . PRO F 3 15  ? -11.498 13.676  -7.732  1.00 60.51 ? 113  PRO F CB    1 
ATOM   6141 C  CG    . PRO F 3 15  ? -11.068 14.591  -6.618  1.00 61.18 ? 113  PRO F CG    1 
ATOM   6142 C  CD    . PRO F 3 15  ? -12.394 15.057  -6.075  1.00 60.83 ? 113  PRO F CD    1 
ATOM   6143 N  N     . VAL F 3 16  ? -13.409 13.353  -10.376 1.00 63.78 ? 114  VAL F N     1 
ATOM   6144 C  CA    . VAL F 3 16  ? -14.271 12.516  -11.186 1.00 65.56 ? 114  VAL F CA    1 
ATOM   6145 C  C     . VAL F 3 16  ? -13.746 11.076  -11.144 1.00 66.00 ? 114  VAL F C     1 
ATOM   6146 O  O     . VAL F 3 16  ? -13.838 10.389  -10.111 1.00 67.03 ? 114  VAL F O     1 
ATOM   6147 C  CB    . VAL F 3 16  ? -14.280 13.047  -12.639 1.00 66.21 ? 114  VAL F CB    1 
ATOM   6148 C  CG1   . VAL F 3 16  ? -15.292 12.284  -13.488 1.00 67.24 ? 114  VAL F CG1   1 
ATOM   6149 C  CG2   . VAL F 3 16  ? -14.585 14.530  -12.628 1.00 66.15 ? 114  VAL F CG2   1 
HETATM 6150 MN MN    . MN  G 4 .   ? 24.485  26.227  46.085  1.00 35.36 ? 201  MN  A MN    1 
HETATM 6151 MN MN    . MN  H 4 .   ? -6.408  35.515  -6.806  1.00 35.51 ? 202  MN  B MN    1 
HETATM 6152 N  NS    . 112 I 5 .   ? 26.558  22.616  45.711  1.00 44.88 ? 117  112 E NS    1 
HETATM 6153 C  C2S   . 112 I 5 .   ? 26.344  23.935  45.749  1.00 48.07 ? 117  112 E C2S   1 
HETATM 6154 O  O2S   . 112 I 5 .   ? 25.164  24.280  45.812  1.00 48.85 ? 117  112 E O2S   1 
HETATM 6155 C  C1S   . 112 I 5 .   ? 27.445  24.995  45.731  1.00 49.10 ? 117  112 E C1S   1 
HETATM 6156 P  PG    . 112 I 5 .   ? 26.970  27.210  47.889  1.00 49.56 ? 117  112 E PG    1 
HETATM 6157 S  S1G   . 112 I 5 .   ? 28.058  25.565  47.371  1.00 53.97 ? 117  112 E S1G   1 
HETATM 6158 O  O2G   . 112 I 5 .   ? 25.518  26.925  47.847  1.00 48.44 ? 117  112 E O2G   1 
HETATM 6159 O  O3G   . 112 I 5 .   ? 27.439  27.752  49.205  1.00 48.66 ? 117  112 E O3G   1 
HETATM 6160 P  PB    . 112 I 5 .   ? 26.921  28.332  45.316  1.00 41.88 ? 117  112 E PB    1 
HETATM 6161 O  O1B   . 112 I 5 .   ? 28.149  28.409  44.528  1.00 42.47 ? 117  112 E O1B   1 
HETATM 6162 O  O2B   . 112 I 5 .   ? 25.784  27.468  44.856  1.00 39.97 ? 117  112 E O2B   1 
HETATM 6163 O  O3B   . 112 I 5 .   ? 27.119  28.299  46.834  1.00 45.61 ? 117  112 E O3B   1 
HETATM 6164 P  PA    . 112 I 5 .   ? 25.478  30.634  44.721  1.00 40.70 ? 117  112 E PA    1 
HETATM 6165 O  O1A   . 112 I 5 .   ? 26.134  31.102  43.503  1.00 44.61 ? 117  112 E O1A   1 
HETATM 6166 O  O2A   . 112 I 5 .   ? 24.207  29.903  44.664  1.00 42.56 ? 117  112 E O2A   1 
HETATM 6167 O  O3A   . 112 I 5 .   ? 26.533  29.800  45.418  1.00 42.78 ? 117  112 E O3A   1 
HETATM 6168 O  "O5'" . 112 I 5 .   ? 25.234  31.942  45.641  1.00 44.64 ? 117  112 E "O5'" 1 
HETATM 6169 C  "C5'" . 112 I 5 .   ? 26.196  32.554  46.563  1.00 46.87 ? 117  112 E "C5'" 1 
HETATM 6170 C  "C4'" . 112 I 5 .   ? 25.526  33.215  47.745  1.00 47.07 ? 117  112 E "C4'" 1 
HETATM 6171 O  "O4'" . 112 I 5 .   ? 24.631  34.240  47.254  1.00 46.88 ? 117  112 E "O4'" 1 
HETATM 6172 C  "C3'" . 112 I 5 .   ? 24.639  32.291  48.564  1.00 48.24 ? 117  112 E "C3'" 1 
HETATM 6173 O  "O3'" . 112 I 5 .   ? 25.394  31.709  49.616  1.00 52.31 ? 117  112 E "O3'" 1 
HETATM 6174 C  "C2'" . 112 I 5 .   ? 23.619  33.235  49.173  1.00 48.65 ? 117  112 E "C2'" 1 
HETATM 6175 O  "O2'" . 112 I 5 .   ? 24.125  33.807  50.362  1.00 53.02 ? 117  112 E "O2'" 1 
HETATM 6176 C  "C1'" . 112 I 5 .   ? 23.484  34.304  48.082  1.00 47.39 ? 117  112 E "C1'" 1 
HETATM 6177 N  N9    . 112 I 5 .   ? 22.297  34.190  47.235  1.00 44.67 ? 117  112 E N9    1 
HETATM 6178 C  C8    . 112 I 5 .   ? 22.097  33.342  46.171  1.00 43.30 ? 117  112 E C8    1 
HETATM 6179 N  N7    . 112 I 5 .   ? 20.948  33.517  45.565  1.00 41.61 ? 117  112 E N7    1 
HETATM 6180 C  C5    . 112 I 5 .   ? 20.341  34.536  46.283  1.00 40.99 ? 117  112 E C5    1 
HETATM 6181 C  C6    . 112 I 5 .   ? 19.102  35.192  46.140  1.00 39.42 ? 117  112 E C6    1 
HETATM 6182 N  N6    . 112 I 5 .   ? 18.216  34.911  45.179  1.00 36.49 ? 117  112 E N6    1 
HETATM 6183 N  N1    . 112 I 5 .   ? 18.798  36.156  47.029  1.00 39.87 ? 117  112 E N1    1 
HETATM 6184 C  C2    . 112 I 5 .   ? 19.686  36.444  47.992  1.00 40.59 ? 117  112 E C2    1 
HETATM 6185 N  N3    . 112 I 5 .   ? 20.880  35.905  48.228  1.00 41.33 ? 117  112 E N3    1 
HETATM 6186 C  C4    . 112 I 5 .   ? 21.155  34.949  47.325  1.00 42.14 ? 117  112 E C4    1 
HETATM 6187 N  NS    . 112 J 5 .   ? -8.716  32.045  -7.833  1.00 48.67 ? 117  112 F NS    1 
HETATM 6188 C  C2S   . 112 J 5 .   ? -8.370  33.277  -7.477  1.00 50.90 ? 117  112 F C2S   1 
HETATM 6189 O  O2S   . 112 J 5 .   ? -7.166  33.460  -7.363  1.00 48.67 ? 117  112 F O2S   1 
HETATM 6190 C  C1S   . 112 J 5 .   ? -9.353  34.429  -7.207  1.00 54.22 ? 117  112 F C1S   1 
HETATM 6191 P  PG    . 112 J 5 .   ? -8.546  37.302  -8.172  1.00 52.47 ? 117  112 F PG    1 
HETATM 6192 S  S1G   . 112 J 5 .   ? -9.657  35.645  -8.573  1.00 62.22 ? 117  112 F S1G   1 
HETATM 6193 O  O2G   . 112 J 5 .   ? -7.075  36.980  -8.189  1.00 53.78 ? 117  112 F O2G   1 
HETATM 6194 O  O3G   . 112 J 5 .   ? -8.879  38.388  -9.113  1.00 53.84 ? 117  112 F O3G   1 
HETATM 6195 P  PB    . 112 J 5 .   ? -8.726  37.289  -5.344  1.00 42.25 ? 117  112 F PB    1 
HETATM 6196 O  O1B   . 112 J 5 .   ? -9.968  37.018  -4.637  1.00 47.48 ? 117  112 F O1B   1 
HETATM 6197 O  O2B   . 112 J 5 .   ? -7.654  36.299  -5.198  1.00 46.63 ? 117  112 F O2B   1 
HETATM 6198 O  O3B   . 112 J 5 .   ? -8.868  37.826  -6.767  1.00 48.56 ? 117  112 F O3B   1 
HETATM 6199 P  PA    . 112 J 5 .   ? -7.199  39.210  -3.888  1.00 48.41 ? 117  112 F PA    1 
HETATM 6200 O  O1A   . 112 J 5 .   ? -7.785  39.021  -2.555  1.00 48.83 ? 117  112 F O1A   1 
HETATM 6201 O  O2A   . 112 J 5 .   ? -5.832  38.676  -4.124  1.00 51.74 ? 117  112 F O2A   1 
HETATM 6202 O  O3A   . 112 J 5 .   ? -8.204  38.659  -4.903  1.00 48.33 ? 117  112 F O3A   1 
HETATM 6203 O  "O5'" . 112 J 5 .   ? -7.122  40.802  -4.247  1.00 47.20 ? 117  112 F "O5'" 1 
HETATM 6204 C  "C5'" . 112 J 5 .   ? -8.034  41.764  -4.890  1.00 45.40 ? 117  112 F "C5'" 1 
HETATM 6205 C  "C4'" . 112 J 5 .   ? -7.180  42.577  -5.831  1.00 44.33 ? 117  112 F "C4'" 1 
HETATM 6206 O  "O4'" . 112 J 5 .   ? -6.086  43.130  -5.077  1.00 43.73 ? 117  112 F "O4'" 1 
HETATM 6207 C  "C3'" . 112 J 5 .   ? -6.520  41.743  -6.918  1.00 47.04 ? 117  112 F "C3'" 1 
HETATM 6208 O  "O3'" . 112 J 5 .   ? -7.345  41.768  -8.074  1.00 50.46 ? 117  112 F "O3'" 1 
HETATM 6209 C  "C2'" . 112 J 5 .   ? -5.186  42.433  -7.195  1.00 44.16 ? 117  112 F "C2'" 1 
HETATM 6210 O  "O2'" . 112 J 5 .   ? -5.231  43.273  -8.328  1.00 50.71 ? 117  112 F "O2'" 1 
HETATM 6211 C  "C1'" . 112 J 5 .   ? -4.952  43.243  -5.912  1.00 42.89 ? 117  112 F "C1'" 1 
HETATM 6212 N  N9    . 112 J 5 .   ? -3.758  42.923  -5.133  1.00 40.61 ? 117  112 F N9    1 
HETATM 6213 C  C8    . 112 J 5 .   ? -3.537  41.858  -4.295  1.00 39.73 ? 117  112 F C8    1 
HETATM 6214 N  N7    . 112 J 5 .   ? -2.340  41.855  -3.753  1.00 38.38 ? 117  112 F N7    1 
HETATM 6215 C  C5    . 112 J 5 .   ? -1.732  42.989  -4.269  1.00 37.28 ? 117  112 F C5    1 
HETATM 6216 C  C6    . 112 J 5 .   ? -0.444  43.542  -4.104  1.00 36.49 ? 117  112 F C6    1 
HETATM 6217 N  N6    . 112 J 5 .   ? 0.511   42.999  -3.344  1.00 34.44 ? 117  112 F N6    1 
HETATM 6218 N  N1    . 112 J 5 .   ? -0.162  44.686  -4.763  1.00 37.30 ? 117  112 F N1    1 
HETATM 6219 C  C2    . 112 J 5 .   ? -1.112  45.234  -5.534  1.00 37.20 ? 117  112 F C2    1 
HETATM 6220 N  N3    . 112 J 5 .   ? -2.353  44.811  -5.771  1.00 39.41 ? 117  112 F N3    1 
HETATM 6221 C  C4    . 112 J 5 .   ? -2.602  43.666  -5.108  1.00 39.06 ? 117  112 F C4    1 
HETATM 6222 O  O     . HOH K 6 .   ? 25.334  25.661  42.035  1.00 34.93 ? 1    HOH A O     1 
HETATM 6223 O  O     . HOH K 6 .   ? 8.728   32.319  44.874  1.00 28.27 ? 2    HOH A O     1 
HETATM 6224 O  O     . HOH K 6 .   ? 28.602  29.464  41.286  1.00 35.57 ? 3    HOH A O     1 
HETATM 6225 O  O     . HOH K 6 .   ? 18.615  16.524  46.274  1.00 26.09 ? 5    HOH A O     1 
HETATM 6226 O  O     . HOH K 6 .   ? 3.119   28.501  45.086  1.00 33.30 ? 8    HOH A O     1 
HETATM 6227 O  O     . HOH K 6 .   ? 24.937  20.413  36.183  1.00 32.81 ? 14   HOH A O     1 
HETATM 6228 O  O     . HOH K 6 .   ? 21.609  10.137  57.070  1.00 35.71 ? 15   HOH A O     1 
HETATM 6229 O  O     . HOH K 6 .   ? 8.800   30.228  41.849  1.00 33.99 ? 17   HOH A O     1 
HETATM 6230 O  O     . HOH K 6 .   ? 13.440  38.504  50.771  1.00 41.22 ? 18   HOH A O     1 
HETATM 6231 O  O     . HOH K 6 .   ? 11.667  45.594  45.168  1.00 36.23 ? 21   HOH A O     1 
HETATM 6232 O  O     . HOH K 6 .   ? 23.765  22.723  42.708  1.00 41.10 ? 22   HOH A O     1 
HETATM 6233 O  O     . HOH K 6 .   ? 4.763   29.719  53.382  1.00 40.73 ? 25   HOH A O     1 
HETATM 6234 O  O     . HOH K 6 .   ? 6.830   15.686  68.584  1.00 37.55 ? 27   HOH A O     1 
HETATM 6235 O  O     . HOH K 6 .   ? 18.218  3.592   28.661  1.00 41.07 ? 28   HOH A O     1 
HETATM 6236 O  O     . HOH K 6 .   ? 5.385   14.633  45.895  1.00 27.36 ? 30   HOH A O     1 
HETATM 6237 O  O     . HOH K 6 .   ? 17.436  18.746  32.400  1.00 36.81 ? 33   HOH A O     1 
HETATM 6238 O  O     . HOH K 6 .   ? 25.429  21.797  57.563  1.00 38.93 ? 39   HOH A O     1 
HETATM 6239 O  O     . HOH K 6 .   ? 9.720   47.413  43.898  1.00 46.43 ? 41   HOH A O     1 
HETATM 6240 O  O     . HOH K 6 .   ? 21.953  15.318  46.689  1.00 31.77 ? 42   HOH A O     1 
HETATM 6241 O  O     . HOH K 6 .   ? 9.459   18.325  32.987  1.00 37.19 ? 43   HOH A O     1 
HETATM 6242 O  O     . HOH K 6 .   ? 22.669  17.803  48.104  1.00 34.29 ? 44   HOH A O     1 
HETATM 6243 O  O     . HOH K 6 .   ? 25.528  16.864  37.723  1.00 33.56 ? 46   HOH A O     1 
HETATM 6244 O  O     . HOH K 6 .   ? 11.698  15.880  43.325  1.00 37.17 ? 47   HOH A O     1 
HETATM 6245 O  O     . HOH K 6 .   ? 27.434  21.100  32.798  1.00 34.33 ? 48   HOH A O     1 
HETATM 6246 O  O     . HOH K 6 .   ? 23.585  22.757  53.237  1.00 35.81 ? 51   HOH A O     1 
HETATM 6247 O  O     . HOH K 6 .   ? 13.103  40.364  44.376  1.00 23.50 ? 52   HOH A O     1 
HETATM 6248 O  O     . HOH K 6 .   ? 10.917  29.776  40.277  1.00 30.98 ? 53   HOH A O     1 
HETATM 6249 O  O     . HOH K 6 .   ? 10.988  31.097  38.160  1.00 32.94 ? 54   HOH A O     1 
HETATM 6250 O  O     . HOH K 6 .   ? 18.290  1.398   47.491  1.00 40.58 ? 57   HOH A O     1 
HETATM 6251 O  O     . HOH K 6 .   ? 0.824   26.324  41.873  1.00 46.12 ? 59   HOH A O     1 
HETATM 6252 O  O     . HOH K 6 .   ? 35.102  31.508  43.625  1.00 49.43 ? 60   HOH A O     1 
HETATM 6253 O  O     . HOH K 6 .   ? 23.407  27.829  46.081  1.00 22.25 ? 63   HOH A O     1 
HETATM 6254 O  O     . HOH K 6 .   ? 17.197  0.007   44.901  1.00 36.25 ? 69   HOH A O     1 
HETATM 6255 O  O     . HOH K 6 .   ? 4.956   15.929  43.662  1.00 36.24 ? 71   HOH A O     1 
HETATM 6256 O  O     . HOH K 6 .   ? 7.143   29.313  67.636  1.00 44.20 ? 73   HOH A O     1 
HETATM 6257 O  O     . HOH K 6 .   ? 2.456   29.790  55.205  1.00 40.75 ? 75   HOH A O     1 
HETATM 6258 O  O     . HOH K 6 .   ? 14.418  19.520  29.336  1.00 43.16 ? 76   HOH A O     1 
HETATM 6259 O  O     . HOH L 6 .   ? -14.944 41.984  -0.680  1.00 35.81 ? 4    HOH B O     1 
HETATM 6260 O  O     . HOH L 6 .   ? 5.399   17.592  -7.164  1.00 28.01 ? 6    HOH B O     1 
HETATM 6261 O  O     . HOH L 6 .   ? 13.149  42.093  -11.902 1.00 29.01 ? 7    HOH B O     1 
HETATM 6262 O  O     . HOH L 6 .   ? 3.039   16.247  1.172   1.00 37.42 ? 9    HOH B O     1 
HETATM 6263 O  O     . HOH L 6 .   ? 7.999   22.629  2.473   1.00 30.30 ? 10   HOH B O     1 
HETATM 6264 O  O     . HOH L 6 .   ? 7.521   16.150  -14.984 1.00 33.93 ? 12   HOH B O     1 
HETATM 6265 O  O     . HOH L 6 .   ? 9.703   39.871  -4.420  1.00 38.33 ? 13   HOH B O     1 
HETATM 6266 O  O     . HOH L 6 .   ? 6.017   23.582  -7.961  1.00 40.46 ? 16   HOH B O     1 
HETATM 6267 O  O     . HOH L 6 .   ? -1.355  26.055  -10.503 1.00 23.82 ? 19   HOH B O     1 
HETATM 6268 O  O     . HOH L 6 .   ? 13.259  39.657  -13.228 1.00 27.62 ? 20   HOH B O     1 
HETATM 6269 O  O     . HOH L 6 .   ? 7.988   36.815  2.265   1.00 35.81 ? 24   HOH B O     1 
HETATM 6270 O  O     . HOH L 6 .   ? 11.769  23.221  -11.004 1.00 42.22 ? 31   HOH B O     1 
HETATM 6271 O  O     . HOH L 6 .   ? 9.490   36.541  -1.921  1.00 34.25 ? 32   HOH B O     1 
HETATM 6272 O  O     . HOH L 6 .   ? -7.569  34.747  -18.983 1.00 29.79 ? 34   HOH B O     1 
HETATM 6273 O  O     . HOH L 6 .   ? 9.320   32.179  -31.822 1.00 37.79 ? 35   HOH B O     1 
HETATM 6274 O  O     . HOH L 6 .   ? -4.770  23.449  -22.314 1.00 35.06 ? 38   HOH B O     1 
HETATM 6275 O  O     . HOH L 6 .   ? -6.576  30.358  -28.850 1.00 32.57 ? 45   HOH B O     1 
HETATM 6276 O  O     . HOH L 6 .   ? 6.196   47.532  -1.460  1.00 40.58 ? 49   HOH B O     1 
HETATM 6277 O  O     . HOH L 6 .   ? -10.166 28.382  -25.977 1.00 28.58 ? 50   HOH B O     1 
HETATM 6278 O  O     . HOH L 6 .   ? -1.172  22.279  -9.188  1.00 40.29 ? 65   HOH B O     1 
HETATM 6279 O  O     . HOH L 6 .   ? -6.076  31.080  -5.020  1.00 43.21 ? 67   HOH B O     1 
HETATM 6280 O  O     . HOH L 6 .   ? -10.292 28.117  -3.365  1.00 42.64 ? 68   HOH B O     1 
HETATM 6281 O  O     . HOH L 6 .   ? 10.965  44.328  -8.057  1.00 47.06 ? 70   HOH B O     1 
HETATM 6282 O  O     . HOH L 6 .   ? -7.543  45.707  -17.383 1.00 38.53 ? 74   HOH B O     1 
HETATM 6283 O  O     . HOH L 6 .   ? -8.029  11.983  -17.274 1.00 42.41 ? 77   HOH B O     1 
HETATM 6284 O  O     . HOH M 6 .   ? 3.452   9.449   -0.461  1.00 25.39 ? 23   HOH C O     1 
HETATM 6285 O  O     . HOH M 6 .   ? 5.325   6.949   -2.954  1.00 36.86 ? 36   HOH C O     1 
HETATM 6286 O  O     . HOH M 6 .   ? -0.049  10.934  2.544   1.00 32.35 ? 40   HOH C O     1 
HETATM 6287 O  O     . HOH M 6 .   ? 6.865   16.992  8.962   1.00 38.90 ? 79   HOH C O     1 
HETATM 6288 O  O     . HOH N 6 .   ? 11.955  4.791   31.836  1.00 32.15 ? 26   HOH D O     1 
HETATM 6289 O  O     . HOH N 6 .   ? 8.205   5.798   33.711  1.00 28.95 ? 37   HOH D O     1 
HETATM 6290 O  O     . HOH N 6 .   ? -4.469  1.141   32.905  1.00 37.64 ? 55   HOH D O     1 
HETATM 6291 O  O     . HOH N 6 .   ? -9.698  7.040   20.048  1.00 42.48 ? 56   HOH D O     1 
HETATM 6292 O  O     . HOH N 6 .   ? 15.820  6.141   29.439  1.00 45.11 ? 58   HOH D O     1 
HETATM 6293 O  O     . HOH N 6 .   ? 5.672   6.742   34.489  1.00 40.50 ? 72   HOH D O     1 
HETATM 6294 O  O     . HOH N 6 .   ? -9.745  13.550  23.267  1.00 45.88 ? 78   HOH D O     1 
HETATM 6295 O  O     . HOH O 6 .   ? 28.945  16.048  50.550  1.00 44.74 ? 61   HOH E O     1 
HETATM 6296 O  O     . HOH O 6 .   ? 25.290  29.090  48.966  1.00 37.99 ? 62   HOH E O     1 
HETATM 6297 O  O     . HOH O 6 .   ? 25.288  28.021  42.405  1.00 49.03 ? 64   HOH E O     1 
HETATM 6298 O  O     . HOH P 6 .   ? -7.183  34.848  -2.615  1.00 42.68 ? 11   HOH F O     1 
HETATM 6299 O  O     . HOH P 6 .   ? -12.071 27.759  -14.531 1.00 37.00 ? 29   HOH F O     1 
HETATM 6300 O  O     . HOH P 6 .   ? -5.205  37.287  -6.262  1.00 17.64 ? 66   HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   978  ?    ?   ?   A . n 
A 1 2   PHE 2   979  ?    ?   ?   A . n 
A 1 3   PRO 3   980  ?    ?   ?   A . n 
A 1 4   SER 4   981  ?    ?   ?   A . n 
A 1 5   SER 5   982  ?    ?   ?   A . n 
A 1 6   VAL 6   983  ?    ?   ?   A . n 
A 1 7   TYR 7   984  ?    ?   ?   A . n 
A 1 8   VAL 8   985  ?    ?   ?   A . n 
A 1 9   PRO 9   986  ?    ?   ?   A . n 
A 1 10  ASP 10  987  987  ASP ASP A . n 
A 1 11  GLU 11  988  988  GLU GLU A . n 
A 1 12  TRP 12  989  989  TRP TRP A . n 
A 1 13  GLU 13  990  990  GLU GLU A . n 
A 1 14  VAL 14  991  991  VAL VAL A . n 
A 1 15  SER 15  992  992  SER SER A . n 
A 1 16  ARG 16  993  993  ARG ARG A . n 
A 1 17  GLU 17  994  994  GLU GLU A . n 
A 1 18  LYS 18  995  995  LYS LYS A . n 
A 1 19  ILE 19  996  996  ILE ILE A . n 
A 1 20  THR 20  997  997  THR THR A . n 
A 1 21  LEU 21  998  998  LEU LEU A . n 
A 1 22  LEU 22  999  999  LEU LEU A . n 
A 1 23  ARG 23  1000 1000 ARG ARG A . n 
A 1 24  GLU 24  1001 1001 GLU GLU A . n 
A 1 25  LEU 25  1002 1002 LEU LEU A . n 
A 1 26  GLY 26  1003 1003 GLY GLY A . n 
A 1 27  GLN 27  1004 1004 GLN GLN A . n 
A 1 28  GLY 28  1005 1005 GLY GLY A . n 
A 1 29  SER 29  1006 1006 SER SER A . n 
A 1 30  PHE 30  1007 1007 PHE PHE A . n 
A 1 31  GLY 31  1008 1008 GLY GLY A . n 
A 1 32  MET 32  1009 1009 MET MET A . n 
A 1 33  VAL 33  1010 1010 VAL VAL A . n 
A 1 34  TYR 34  1011 1011 TYR TYR A . n 
A 1 35  GLU 35  1012 1012 GLU GLU A . n 
A 1 36  GLY 36  1013 1013 GLY GLY A . n 
A 1 37  ASN 37  1014 1014 ASN ASN A . n 
A 1 38  ALA 38  1015 1015 ALA ALA A . n 
A 1 39  ARG 39  1016 1016 ARG ARG A . n 
A 1 40  ASP 40  1017 1017 ASP ASP A . n 
A 1 41  ILE 41  1018 1018 ILE ILE A . n 
A 1 42  ILE 42  1019 1019 ILE ILE A . n 
A 1 43  LYS 43  1020 1020 LYS LYS A . n 
A 1 44  GLY 44  1021 1021 GLY GLY A . n 
A 1 45  GLU 45  1022 1022 GLU GLU A . n 
A 1 46  ALA 46  1023 1023 ALA ALA A . n 
A 1 47  GLU 47  1024 1024 GLU GLU A . n 
A 1 48  THR 48  1025 1025 THR THR A . n 
A 1 49  ARG 49  1026 1026 ARG ARG A . n 
A 1 50  VAL 50  1027 1027 VAL VAL A . n 
A 1 51  ALA 51  1028 1028 ALA ALA A . n 
A 1 52  VAL 52  1029 1029 VAL VAL A . n 
A 1 53  LYS 53  1030 1030 LYS LYS A . n 
A 1 54  THR 54  1031 1031 THR THR A . n 
A 1 55  VAL 55  1032 1032 VAL VAL A . n 
A 1 56  ASN 56  1033 1033 ASN ASN A . n 
A 1 57  GLU 57  1034 1034 GLU GLU A . n 
A 1 58  SER 58  1035 1035 SER SER A . n 
A 1 59  ALA 59  1036 1036 ALA ALA A . n 
A 1 60  SER 60  1037 1037 SER SER A . n 
A 1 61  LEU 61  1038 1038 LEU LEU A . n 
A 1 62  ARG 62  1039 1039 ARG ARG A . n 
A 1 63  GLU 63  1040 1040 GLU GLU A . n 
A 1 64  ARG 64  1041 1041 ARG ARG A . n 
A 1 65  ILE 65  1042 1042 ILE ILE A . n 
A 1 66  GLU 66  1043 1043 GLU GLU A . n 
A 1 67  PHE 67  1044 1044 PHE PHE A . n 
A 1 68  LEU 68  1045 1045 LEU LEU A . n 
A 1 69  ASN 69  1046 1046 ASN ASN A . n 
A 1 70  GLU 70  1047 1047 GLU GLU A . n 
A 1 71  ALA 71  1048 1048 ALA ALA A . n 
A 1 72  SER 72  1049 1049 SER SER A . n 
A 1 73  VAL 73  1050 1050 VAL VAL A . n 
A 1 74  MET 74  1051 1051 MET MET A . n 
A 1 75  LYS 75  1052 1052 LYS LYS A . n 
A 1 76  GLY 76  1053 1053 GLY GLY A . n 
A 1 77  PHE 77  1054 1054 PHE PHE A . n 
A 1 78  THR 78  1055 1055 THR THR A . n 
A 1 79  CYS 79  1056 1056 CYS CYS A . n 
A 1 80  HIS 80  1057 1057 HIS HIS A . n 
A 1 81  HIS 81  1058 1058 HIS HIS A . n 
A 1 82  VAL 82  1059 1059 VAL VAL A . n 
A 1 83  VAL 83  1060 1060 VAL VAL A . n 
A 1 84  ARG 84  1061 1061 ARG ARG A . n 
A 1 85  LEU 85  1062 1062 LEU LEU A . n 
A 1 86  LEU 86  1063 1063 LEU LEU A . n 
A 1 87  GLY 87  1064 1064 GLY GLY A . n 
A 1 88  VAL 88  1065 1065 VAL VAL A . n 
A 1 89  VAL 89  1066 1066 VAL VAL A . n 
A 1 90  SER 90  1067 1067 SER SER A . n 
A 1 91  LYS 91  1068 1068 LYS LYS A . n 
A 1 92  GLY 92  1069 1069 GLY GLY A . n 
A 1 93  GLN 93  1070 1070 GLN GLN A . n 
A 1 94  PRO 94  1071 1071 PRO PRO A . n 
A 1 95  THR 95  1072 1072 THR THR A . n 
A 1 96  LEU 96  1073 1073 LEU LEU A . n 
A 1 97  VAL 97  1074 1074 VAL VAL A . n 
A 1 98  VAL 98  1075 1075 VAL VAL A . n 
A 1 99  MET 99  1076 1076 MET MET A . n 
A 1 100 GLU 100 1077 1077 GLU GLU A . n 
A 1 101 LEU 101 1078 1078 LEU LEU A . n 
A 1 102 MET 102 1079 1079 MET MET A . n 
A 1 103 ALA 103 1080 1080 ALA ALA A . n 
A 1 104 HIS 104 1081 1081 HIS HIS A . n 
A 1 105 GLY 105 1082 1082 GLY GLY A . n 
A 1 106 ASP 106 1083 1083 ASP ASP A . n 
A 1 107 LEU 107 1084 1084 LEU LEU A . n 
A 1 108 LYS 108 1085 1085 LYS LYS A . n 
A 1 109 SER 109 1086 1086 SER SER A . n 
A 1 110 TYR 110 1087 1087 TYR TYR A . n 
A 1 111 LEU 111 1088 1088 LEU LEU A . n 
A 1 112 ARG 112 1089 1089 ARG ARG A . n 
A 1 113 SER 113 1090 1090 SER SER A . n 
A 1 114 LEU 114 1091 1091 LEU LEU A . n 
A 1 115 ARG 115 1092 1092 ARG ARG A . n 
A 1 116 PRO 116 1093 1093 PRO PRO A . n 
A 1 117 GLU 117 1094 1094 GLU GLU A . n 
A 1 118 ALA 118 1095 1095 ALA ALA A . n 
A 1 119 GLU 119 1096 1096 GLU GLU A . n 
A 1 120 ASN 120 1097 1097 ASN ASN A . n 
A 1 121 ASN 121 1098 1098 ASN ASN A . n 
A 1 122 PRO 122 1099 1099 PRO PRO A . n 
A 1 123 GLY 123 1100 1100 GLY GLY A . n 
A 1 124 ARG 124 1101 1101 ARG ARG A . n 
A 1 125 PRO 125 1102 1102 PRO PRO A . n 
A 1 126 PRO 126 1103 1103 PRO PRO A . n 
A 1 127 PRO 127 1104 1104 PRO PRO A . n 
A 1 128 THR 128 1105 1105 THR THR A . n 
A 1 129 LEU 129 1106 1106 LEU LEU A . n 
A 1 130 GLN 130 1107 1107 GLN GLN A . n 
A 1 131 GLU 131 1108 1108 GLU GLU A . n 
A 1 132 MET 132 1109 1109 MET MET A . n 
A 1 133 ILE 133 1110 1110 ILE ILE A . n 
A 1 134 GLN 134 1111 1111 GLN GLN A . n 
A 1 135 MET 135 1112 1112 MET MET A . n 
A 1 136 ALA 136 1113 1113 ALA ALA A . n 
A 1 137 ALA 137 1114 1114 ALA ALA A . n 
A 1 138 GLU 138 1115 1115 GLU GLU A . n 
A 1 139 ILE 139 1116 1116 ILE ILE A . n 
A 1 140 ALA 140 1117 1117 ALA ALA A . n 
A 1 141 ASP 141 1118 1118 ASP ASP A . n 
A 1 142 GLY 142 1119 1119 GLY GLY A . n 
A 1 143 MET 143 1120 1120 MET MET A . n 
A 1 144 ALA 144 1121 1121 ALA ALA A . n 
A 1 145 TYR 145 1122 1122 TYR TYR A . n 
A 1 146 LEU 146 1123 1123 LEU LEU A . n 
A 1 147 ASN 147 1124 1124 ASN ASN A . n 
A 1 148 ALA 148 1125 1125 ALA ALA A . n 
A 1 149 LYS 149 1126 1126 LYS LYS A . n 
A 1 150 LYS 150 1127 1127 LYS LYS A . n 
A 1 151 PHE 151 1128 1128 PHE PHE A . n 
A 1 152 VAL 152 1129 1129 VAL VAL A . n 
A 1 153 HIS 153 1130 1130 HIS HIS A . n 
A 1 154 ARG 154 1131 1131 ARG ARG A . n 
A 1 155 ASP 155 1132 1132 ASP ASP A . n 
A 1 156 LEU 156 1133 1133 LEU LEU A . n 
A 1 157 ALA 157 1134 1134 ALA ALA A . n 
A 1 158 ALA 158 1135 1135 ALA ALA A . n 
A 1 159 ARG 159 1136 1136 ARG ARG A . n 
A 1 160 ASN 160 1137 1137 ASN ASN A . n 
A 1 161 CYS 161 1138 1138 CYS CYS A . n 
A 1 162 MET 162 1139 1139 MET MET A . n 
A 1 163 VAL 163 1140 1140 VAL VAL A . n 
A 1 164 ALA 164 1141 1141 ALA ALA A . n 
A 1 165 HIS 165 1142 1142 HIS HIS A . n 
A 1 166 ASP 166 1143 1143 ASP ASP A . n 
A 1 167 PHE 167 1144 1144 PHE PHE A . n 
A 1 168 THR 168 1145 1145 THR THR A . n 
A 1 169 VAL 169 1146 1146 VAL VAL A . n 
A 1 170 LYS 170 1147 1147 LYS LYS A . n 
A 1 171 ILE 171 1148 1148 ILE ILE A . n 
A 1 172 GLY 172 1149 1149 GLY GLY A . n 
A 1 173 ASP 173 1150 1150 ASP ASP A . n 
A 1 174 PHE 174 1151 1151 PHE PHE A . n 
A 1 175 GLY 175 1152 1152 GLY GLY A . n 
A 1 176 MET 176 1153 1153 MET MET A . n 
A 1 177 THR 177 1154 1154 THR THR A . n 
A 1 178 ARG 178 1155 1155 ARG ARG A . n 
A 1 179 ASP 179 1156 1156 ASP ASP A . n 
A 1 180 ILE 180 1157 1157 ILE ILE A . n 
A 1 181 PTR 181 1158 1158 PTR PTR A . n 
A 1 182 GLU 182 1159 1159 GLU GLU A . n 
A 1 183 THR 183 1160 1160 THR THR A . n 
A 1 184 ASP 184 1161 1161 ASP ASP A . n 
A 1 185 PTR 185 1162 1162 PTR PTR A . n 
A 1 186 PTR 186 1163 1163 PTR PTR A . n 
A 1 187 ARG 187 1164 1164 ARG ARG A . n 
A 1 188 LYS 188 1165 1165 LYS LYS A . n 
A 1 189 GLY 189 1166 1166 GLY GLY A . n 
A 1 190 GLY 190 1167 1167 GLY GLY A . n 
A 1 191 LYS 191 1168 1168 LYS LYS A . n 
A 1 192 GLY 192 1169 1169 GLY GLY A . n 
A 1 193 LEU 193 1170 1170 LEU LEU A . n 
A 1 194 LEU 194 1171 1171 LEU LEU A . n 
A 1 195 PRO 195 1172 1172 PRO PRO A . n 
A 1 196 VAL 196 1173 1173 VAL VAL A . n 
A 1 197 ARG 197 1174 1174 ARG ARG A . n 
A 1 198 TRP 198 1175 1175 TRP TRP A . n 
A 1 199 MET 199 1176 1176 MET MET A . n 
A 1 200 ALA 200 1177 1177 ALA ALA A . n 
A 1 201 PRO 201 1178 1178 PRO PRO A . n 
A 1 202 GLU 202 1179 1179 GLU GLU A . n 
A 1 203 SER 203 1180 1180 SER SER A . n 
A 1 204 LEU 204 1181 1181 LEU LEU A . n 
A 1 205 LYS 205 1182 1182 LYS LYS A . n 
A 1 206 ASP 206 1183 1183 ASP ASP A . n 
A 1 207 GLY 207 1184 1184 GLY GLY A . n 
A 1 208 VAL 208 1185 1185 VAL VAL A . n 
A 1 209 PHE 209 1186 1186 PHE PHE A . n 
A 1 210 THR 210 1187 1187 THR THR A . n 
A 1 211 THR 211 1188 1188 THR THR A . n 
A 1 212 SER 212 1189 1189 SER SER A . n 
A 1 213 SER 213 1190 1190 SER SER A . n 
A 1 214 ASP 214 1191 1191 ASP ASP A . n 
A 1 215 MET 215 1192 1192 MET MET A . n 
A 1 216 TRP 216 1193 1193 TRP TRP A . n 
A 1 217 SER 217 1194 1194 SER SER A . n 
A 1 218 PHE 218 1195 1195 PHE PHE A . n 
A 1 219 GLY 219 1196 1196 GLY GLY A . n 
A 1 220 VAL 220 1197 1197 VAL VAL A . n 
A 1 221 VAL 221 1198 1198 VAL VAL A . n 
A 1 222 LEU 222 1199 1199 LEU LEU A . n 
A 1 223 TRP 223 1200 1200 TRP TRP A . n 
A 1 224 GLU 224 1201 1201 GLU GLU A . n 
A 1 225 ILE 225 1202 1202 ILE ILE A . n 
A 1 226 THR 226 1203 1203 THR THR A . n 
A 1 227 SER 227 1204 1204 SER SER A . n 
A 1 228 LEU 228 1205 1205 LEU LEU A . n 
A 1 229 ALA 229 1206 1206 ALA ALA A . n 
A 1 230 GLU 230 1207 1207 GLU GLU A . n 
A 1 231 GLN 231 1208 1208 GLN GLN A . n 
A 1 232 PRO 232 1209 1209 PRO PRO A . n 
A 1 233 TYR 233 1210 1210 TYR TYR A . n 
A 1 234 GLN 234 1211 1211 GLN GLN A . n 
A 1 235 GLY 235 1212 1212 GLY GLY A . n 
A 1 236 LEU 236 1213 1213 LEU LEU A . n 
A 1 237 SER 237 1214 1214 SER SER A . n 
A 1 238 ASN 238 1215 1215 ASN ASN A . n 
A 1 239 GLU 239 1216 1216 GLU GLU A . n 
A 1 240 GLN 240 1217 1217 GLN GLN A . n 
A 1 241 VAL 241 1218 1218 VAL VAL A . n 
A 1 242 LEU 242 1219 1219 LEU LEU A . n 
A 1 243 LYS 243 1220 1220 LYS LYS A . n 
A 1 244 PHE 244 1221 1221 PHE PHE A . n 
A 1 245 VAL 245 1222 1222 VAL VAL A . n 
A 1 246 MET 246 1223 1223 MET MET A . n 
A 1 247 ASP 247 1224 1224 ASP ASP A . n 
A 1 248 GLY 248 1225 1225 GLY GLY A . n 
A 1 249 GLY 249 1226 1226 GLY GLY A . n 
A 1 250 TYR 250 1227 1227 TYR TYR A . n 
A 1 251 LEU 251 1228 1228 LEU LEU A . n 
A 1 252 ASP 252 1229 1229 ASP ASP A . n 
A 1 253 GLN 253 1230 1230 GLN GLN A . n 
A 1 254 PRO 254 1231 1231 PRO PRO A . n 
A 1 255 ASP 255 1232 1232 ASP ASP A . n 
A 1 256 ASN 256 1233 1233 ASN ASN A . n 
A 1 257 CYS 257 1234 1234 CYS CYS A . n 
A 1 258 PRO 258 1235 1235 PRO PRO A . n 
A 1 259 GLU 259 1236 1236 GLU GLU A . n 
A 1 260 ARG 260 1237 1237 ARG ARG A . n 
A 1 261 VAL 261 1238 1238 VAL VAL A . n 
A 1 262 THR 262 1239 1239 THR THR A . n 
A 1 263 ASP 263 1240 1240 ASP ASP A . n 
A 1 264 LEU 264 1241 1241 LEU LEU A . n 
A 1 265 MET 265 1242 1242 MET MET A . n 
A 1 266 ARG 266 1243 1243 ARG ARG A . n 
A 1 267 MET 267 1244 1244 MET MET A . n 
A 1 268 CYS 268 1245 1245 CYS CYS A . n 
A 1 269 TRP 269 1246 1246 TRP TRP A . n 
A 1 270 GLN 270 1247 1247 GLN GLN A . n 
A 1 271 PHE 271 1248 1248 PHE PHE A . n 
A 1 272 ASN 272 1249 1249 ASN ASN A . n 
A 1 273 PRO 273 1250 1250 PRO PRO A . n 
A 1 274 ASN 274 1251 1251 ASN ASN A . n 
A 1 275 MET 275 1252 1252 MET MET A . n 
A 1 276 ARG 276 1253 1253 ARG ARG A . n 
A 1 277 PRO 277 1254 1254 PRO PRO A . n 
A 1 278 THR 278 1255 1255 THR THR A . n 
A 1 279 PHE 279 1256 1256 PHE PHE A . n 
A 1 280 LEU 280 1257 1257 LEU LEU A . n 
A 1 281 GLU 281 1258 1258 GLU GLU A . n 
A 1 282 ILE 282 1259 1259 ILE ILE A . n 
A 1 283 VAL 283 1260 1260 VAL VAL A . n 
A 1 284 ASN 284 1261 1261 ASN ASN A . n 
A 1 285 LEU 285 1262 1262 LEU LEU A . n 
A 1 286 LEU 286 1263 1263 LEU LEU A . n 
A 1 287 LYS 287 1264 1264 LYS LYS A . n 
A 1 288 ASP 288 1265 1265 ASP ASP A . n 
A 1 289 ASP 289 1266 1266 ASP ASP A . n 
A 1 290 LEU 290 1267 1267 LEU LEU A . n 
A 1 291 HIS 291 1268 1268 HIS HIS A . n 
A 1 292 PRO 292 1269 1269 PRO PRO A . n 
A 1 293 SER 293 1270 1270 SER SER A . n 
A 1 294 PHE 294 1271 1271 PHE PHE A . n 
A 1 295 PRO 295 1272 1272 PRO PRO A . n 
A 1 296 GLU 296 1273 1273 GLU GLU A . n 
A 1 297 VAL 297 1274 1274 VAL VAL A . n 
A 1 298 SER 298 1275 1275 SER SER A . n 
A 1 299 PHE 299 1276 1276 PHE PHE A . n 
A 1 300 PHE 300 1277 1277 PHE PHE A . n 
A 1 301 HIS 301 1278 1278 HIS HIS A . n 
A 1 302 SER 302 1279 1279 SER SER A . n 
A 1 303 GLU 303 1280 1280 GLU GLU A . n 
A 1 304 GLU 304 1281 1281 GLU GLU A . n 
A 1 305 ASN 305 1282 1282 ASN ASN A . n 
A 1 306 LYS 306 1283 1283 LYS LYS A . n 
B 1 1   VAL 1   978  ?    ?   ?   B . n 
B 1 2   PHE 2   979  ?    ?   ?   B . n 
B 1 3   PRO 3   980  ?    ?   ?   B . n 
B 1 4   SER 4   981  ?    ?   ?   B . n 
B 1 5   SER 5   982  ?    ?   ?   B . n 
B 1 6   VAL 6   983  ?    ?   ?   B . n 
B 1 7   TYR 7   984  ?    ?   ?   B . n 
B 1 8   VAL 8   985  ?    ?   ?   B . n 
B 1 9   PRO 9   986  ?    ?   ?   B . n 
B 1 10  ASP 10  987  987  ASP ASP B . n 
B 1 11  GLU 11  988  988  GLU GLU B . n 
B 1 12  TRP 12  989  989  TRP TRP B . n 
B 1 13  GLU 13  990  990  GLU GLU B . n 
B 1 14  VAL 14  991  991  VAL VAL B . n 
B 1 15  SER 15  992  992  SER SER B . n 
B 1 16  ARG 16  993  993  ARG ARG B . n 
B 1 17  GLU 17  994  994  GLU GLU B . n 
B 1 18  LYS 18  995  995  LYS LYS B . n 
B 1 19  ILE 19  996  996  ILE ILE B . n 
B 1 20  THR 20  997  997  THR THR B . n 
B 1 21  LEU 21  998  998  LEU LEU B . n 
B 1 22  LEU 22  999  999  LEU LEU B . n 
B 1 23  ARG 23  1000 1000 ARG ARG B . n 
B 1 24  GLU 24  1001 1001 GLU GLU B . n 
B 1 25  LEU 25  1002 1002 LEU LEU B . n 
B 1 26  GLY 26  1003 1003 GLY GLY B . n 
B 1 27  GLN 27  1004 1004 GLN GLN B . n 
B 1 28  GLY 28  1005 1005 GLY GLY B . n 
B 1 29  SER 29  1006 1006 SER SER B . n 
B 1 30  PHE 30  1007 1007 PHE PHE B . n 
B 1 31  GLY 31  1008 1008 GLY GLY B . n 
B 1 32  MET 32  1009 1009 MET MET B . n 
B 1 33  VAL 33  1010 1010 VAL VAL B . n 
B 1 34  TYR 34  1011 1011 TYR TYR B . n 
B 1 35  GLU 35  1012 1012 GLU GLU B . n 
B 1 36  GLY 36  1013 1013 GLY GLY B . n 
B 1 37  ASN 37  1014 1014 ASN ASN B . n 
B 1 38  ALA 38  1015 1015 ALA ALA B . n 
B 1 39  ARG 39  1016 1016 ARG ARG B . n 
B 1 40  ASP 40  1017 1017 ASP ASP B . n 
B 1 41  ILE 41  1018 1018 ILE ILE B . n 
B 1 42  ILE 42  1019 1019 ILE ILE B . n 
B 1 43  LYS 43  1020 1020 LYS LYS B . n 
B 1 44  GLY 44  1021 1021 GLY GLY B . n 
B 1 45  GLU 45  1022 1022 GLU GLU B . n 
B 1 46  ALA 46  1023 1023 ALA ALA B . n 
B 1 47  GLU 47  1024 1024 GLU GLU B . n 
B 1 48  THR 48  1025 1025 THR THR B . n 
B 1 49  ARG 49  1026 1026 ARG ARG B . n 
B 1 50  VAL 50  1027 1027 VAL VAL B . n 
B 1 51  ALA 51  1028 1028 ALA ALA B . n 
B 1 52  VAL 52  1029 1029 VAL VAL B . n 
B 1 53  LYS 53  1030 1030 LYS LYS B . n 
B 1 54  THR 54  1031 1031 THR THR B . n 
B 1 55  VAL 55  1032 1032 VAL VAL B . n 
B 1 56  ASN 56  1033 1033 ASN ASN B . n 
B 1 57  GLU 57  1034 1034 GLU GLU B . n 
B 1 58  SER 58  1035 1035 SER SER B . n 
B 1 59  ALA 59  1036 1036 ALA ALA B . n 
B 1 60  SER 60  1037 1037 SER SER B . n 
B 1 61  LEU 61  1038 1038 LEU LEU B . n 
B 1 62  ARG 62  1039 1039 ARG ARG B . n 
B 1 63  GLU 63  1040 1040 GLU GLU B . n 
B 1 64  ARG 64  1041 1041 ARG ARG B . n 
B 1 65  ILE 65  1042 1042 ILE ILE B . n 
B 1 66  GLU 66  1043 1043 GLU GLU B . n 
B 1 67  PHE 67  1044 1044 PHE PHE B . n 
B 1 68  LEU 68  1045 1045 LEU LEU B . n 
B 1 69  ASN 69  1046 1046 ASN ASN B . n 
B 1 70  GLU 70  1047 1047 GLU GLU B . n 
B 1 71  ALA 71  1048 1048 ALA ALA B . n 
B 1 72  SER 72  1049 1049 SER SER B . n 
B 1 73  VAL 73  1050 1050 VAL VAL B . n 
B 1 74  MET 74  1051 1051 MET MET B . n 
B 1 75  LYS 75  1052 1052 LYS LYS B . n 
B 1 76  GLY 76  1053 1053 GLY GLY B . n 
B 1 77  PHE 77  1054 1054 PHE PHE B . n 
B 1 78  THR 78  1055 1055 THR THR B . n 
B 1 79  CYS 79  1056 1056 CYS CYS B . n 
B 1 80  HIS 80  1057 1057 HIS HIS B . n 
B 1 81  HIS 81  1058 1058 HIS HIS B . n 
B 1 82  VAL 82  1059 1059 VAL VAL B . n 
B 1 83  VAL 83  1060 1060 VAL VAL B . n 
B 1 84  ARG 84  1061 1061 ARG ARG B . n 
B 1 85  LEU 85  1062 1062 LEU LEU B . n 
B 1 86  LEU 86  1063 1063 LEU LEU B . n 
B 1 87  GLY 87  1064 1064 GLY GLY B . n 
B 1 88  VAL 88  1065 1065 VAL VAL B . n 
B 1 89  VAL 89  1066 1066 VAL VAL B . n 
B 1 90  SER 90  1067 1067 SER SER B . n 
B 1 91  LYS 91  1068 1068 LYS LYS B . n 
B 1 92  GLY 92  1069 1069 GLY GLY B . n 
B 1 93  GLN 93  1070 1070 GLN GLN B . n 
B 1 94  PRO 94  1071 1071 PRO PRO B . n 
B 1 95  THR 95  1072 1072 THR THR B . n 
B 1 96  LEU 96  1073 1073 LEU LEU B . n 
B 1 97  VAL 97  1074 1074 VAL VAL B . n 
B 1 98  VAL 98  1075 1075 VAL VAL B . n 
B 1 99  MET 99  1076 1076 MET MET B . n 
B 1 100 GLU 100 1077 1077 GLU GLU B . n 
B 1 101 LEU 101 1078 1078 LEU LEU B . n 
B 1 102 MET 102 1079 1079 MET MET B . n 
B 1 103 ALA 103 1080 1080 ALA ALA B . n 
B 1 104 HIS 104 1081 1081 HIS HIS B . n 
B 1 105 GLY 105 1082 1082 GLY GLY B . n 
B 1 106 ASP 106 1083 1083 ASP ASP B . n 
B 1 107 LEU 107 1084 1084 LEU LEU B . n 
B 1 108 LYS 108 1085 1085 LYS LYS B . n 
B 1 109 SER 109 1086 1086 SER SER B . n 
B 1 110 TYR 110 1087 1087 TYR TYR B . n 
B 1 111 LEU 111 1088 1088 LEU LEU B . n 
B 1 112 ARG 112 1089 1089 ARG ARG B . n 
B 1 113 SER 113 1090 1090 SER SER B . n 
B 1 114 LEU 114 1091 1091 LEU LEU B . n 
B 1 115 ARG 115 1092 1092 ARG ARG B . n 
B 1 116 PRO 116 1093 1093 PRO PRO B . n 
B 1 117 GLU 117 1094 1094 GLU GLU B . n 
B 1 118 ALA 118 1095 1095 ALA ALA B . n 
B 1 119 GLU 119 1096 1096 GLU GLU B . n 
B 1 120 ASN 120 1097 1097 ASN ASN B . n 
B 1 121 ASN 121 1098 1098 ASN ASN B . n 
B 1 122 PRO 122 1099 1099 PRO PRO B . n 
B 1 123 GLY 123 1100 1100 GLY GLY B . n 
B 1 124 ARG 124 1101 1101 ARG ARG B . n 
B 1 125 PRO 125 1102 1102 PRO PRO B . n 
B 1 126 PRO 126 1103 1103 PRO PRO B . n 
B 1 127 PRO 127 1104 1104 PRO PRO B . n 
B 1 128 THR 128 1105 1105 THR THR B . n 
B 1 129 LEU 129 1106 1106 LEU LEU B . n 
B 1 130 GLN 130 1107 1107 GLN GLN B . n 
B 1 131 GLU 131 1108 1108 GLU GLU B . n 
B 1 132 MET 132 1109 1109 MET MET B . n 
B 1 133 ILE 133 1110 1110 ILE ILE B . n 
B 1 134 GLN 134 1111 1111 GLN GLN B . n 
B 1 135 MET 135 1112 1112 MET MET B . n 
B 1 136 ALA 136 1113 1113 ALA ALA B . n 
B 1 137 ALA 137 1114 1114 ALA ALA B . n 
B 1 138 GLU 138 1115 1115 GLU GLU B . n 
B 1 139 ILE 139 1116 1116 ILE ILE B . n 
B 1 140 ALA 140 1117 1117 ALA ALA B . n 
B 1 141 ASP 141 1118 1118 ASP ASP B . n 
B 1 142 GLY 142 1119 1119 GLY GLY B . n 
B 1 143 MET 143 1120 1120 MET MET B . n 
B 1 144 ALA 144 1121 1121 ALA ALA B . n 
B 1 145 TYR 145 1122 1122 TYR TYR B . n 
B 1 146 LEU 146 1123 1123 LEU LEU B . n 
B 1 147 ASN 147 1124 1124 ASN ASN B . n 
B 1 148 ALA 148 1125 1125 ALA ALA B . n 
B 1 149 LYS 149 1126 1126 LYS LYS B . n 
B 1 150 LYS 150 1127 1127 LYS LYS B . n 
B 1 151 PHE 151 1128 1128 PHE PHE B . n 
B 1 152 VAL 152 1129 1129 VAL VAL B . n 
B 1 153 HIS 153 1130 1130 HIS HIS B . n 
B 1 154 ARG 154 1131 1131 ARG ARG B . n 
B 1 155 ASP 155 1132 1132 ASP ASP B . n 
B 1 156 LEU 156 1133 1133 LEU LEU B . n 
B 1 157 ALA 157 1134 1134 ALA ALA B . n 
B 1 158 ALA 158 1135 1135 ALA ALA B . n 
B 1 159 ARG 159 1136 1136 ARG ARG B . n 
B 1 160 ASN 160 1137 1137 ASN ASN B . n 
B 1 161 CYS 161 1138 1138 CYS CYS B . n 
B 1 162 MET 162 1139 1139 MET MET B . n 
B 1 163 VAL 163 1140 1140 VAL VAL B . n 
B 1 164 ALA 164 1141 1141 ALA ALA B . n 
B 1 165 HIS 165 1142 1142 HIS HIS B . n 
B 1 166 ASP 166 1143 1143 ASP ASP B . n 
B 1 167 PHE 167 1144 1144 PHE PHE B . n 
B 1 168 THR 168 1145 1145 THR THR B . n 
B 1 169 VAL 169 1146 1146 VAL VAL B . n 
B 1 170 LYS 170 1147 1147 LYS LYS B . n 
B 1 171 ILE 171 1148 1148 ILE ILE B . n 
B 1 172 GLY 172 1149 1149 GLY GLY B . n 
B 1 173 ASP 173 1150 1150 ASP ASP B . n 
B 1 174 PHE 174 1151 1151 PHE PHE B . n 
B 1 175 GLY 175 1152 1152 GLY GLY B . n 
B 1 176 MET 176 1153 1153 MET MET B . n 
B 1 177 THR 177 1154 1154 THR THR B . n 
B 1 178 ARG 178 1155 1155 ARG ARG B . n 
B 1 179 ASP 179 1156 1156 ASP ASP B . n 
B 1 180 ILE 180 1157 1157 ILE ILE B . n 
B 1 181 PTR 181 1158 1158 PTR PTR B . n 
B 1 182 GLU 182 1159 1159 GLU GLU B . n 
B 1 183 THR 183 1160 1160 THR THR B . n 
B 1 184 ASP 184 1161 1161 ASP ASP B . n 
B 1 185 PTR 185 1162 1162 PTR PTR B . n 
B 1 186 PTR 186 1163 1163 PTR PTR B . n 
B 1 187 ARG 187 1164 1164 ARG ARG B . n 
B 1 188 LYS 188 1165 1165 LYS LYS B . n 
B 1 189 GLY 189 1166 1166 GLY GLY B . n 
B 1 190 GLY 190 1167 1167 GLY GLY B . n 
B 1 191 LYS 191 1168 1168 LYS LYS B . n 
B 1 192 GLY 192 1169 1169 GLY GLY B . n 
B 1 193 LEU 193 1170 1170 LEU LEU B . n 
B 1 194 LEU 194 1171 1171 LEU LEU B . n 
B 1 195 PRO 195 1172 1172 PRO PRO B . n 
B 1 196 VAL 196 1173 1173 VAL VAL B . n 
B 1 197 ARG 197 1174 1174 ARG ARG B . n 
B 1 198 TRP 198 1175 1175 TRP TRP B . n 
B 1 199 MET 199 1176 1176 MET MET B . n 
B 1 200 ALA 200 1177 1177 ALA ALA B . n 
B 1 201 PRO 201 1178 1178 PRO PRO B . n 
B 1 202 GLU 202 1179 1179 GLU GLU B . n 
B 1 203 SER 203 1180 1180 SER SER B . n 
B 1 204 LEU 204 1181 1181 LEU LEU B . n 
B 1 205 LYS 205 1182 1182 LYS LYS B . n 
B 1 206 ASP 206 1183 1183 ASP ASP B . n 
B 1 207 GLY 207 1184 1184 GLY GLY B . n 
B 1 208 VAL 208 1185 1185 VAL VAL B . n 
B 1 209 PHE 209 1186 1186 PHE PHE B . n 
B 1 210 THR 210 1187 1187 THR THR B . n 
B 1 211 THR 211 1188 1188 THR THR B . n 
B 1 212 SER 212 1189 1189 SER SER B . n 
B 1 213 SER 213 1190 1190 SER SER B . n 
B 1 214 ASP 214 1191 1191 ASP ASP B . n 
B 1 215 MET 215 1192 1192 MET MET B . n 
B 1 216 TRP 216 1193 1193 TRP TRP B . n 
B 1 217 SER 217 1194 1194 SER SER B . n 
B 1 218 PHE 218 1195 1195 PHE PHE B . n 
B 1 219 GLY 219 1196 1196 GLY GLY B . n 
B 1 220 VAL 220 1197 1197 VAL VAL B . n 
B 1 221 VAL 221 1198 1198 VAL VAL B . n 
B 1 222 LEU 222 1199 1199 LEU LEU B . n 
B 1 223 TRP 223 1200 1200 TRP TRP B . n 
B 1 224 GLU 224 1201 1201 GLU GLU B . n 
B 1 225 ILE 225 1202 1202 ILE ILE B . n 
B 1 226 THR 226 1203 1203 THR THR B . n 
B 1 227 SER 227 1204 1204 SER SER B . n 
B 1 228 LEU 228 1205 1205 LEU LEU B . n 
B 1 229 ALA 229 1206 1206 ALA ALA B . n 
B 1 230 GLU 230 1207 1207 GLU GLU B . n 
B 1 231 GLN 231 1208 1208 GLN GLN B . n 
B 1 232 PRO 232 1209 1209 PRO PRO B . n 
B 1 233 TYR 233 1210 1210 TYR TYR B . n 
B 1 234 GLN 234 1211 1211 GLN GLN B . n 
B 1 235 GLY 235 1212 1212 GLY GLY B . n 
B 1 236 LEU 236 1213 1213 LEU LEU B . n 
B 1 237 SER 237 1214 1214 SER SER B . n 
B 1 238 ASN 238 1215 1215 ASN ASN B . n 
B 1 239 GLU 239 1216 1216 GLU GLU B . n 
B 1 240 GLN 240 1217 1217 GLN GLN B . n 
B 1 241 VAL 241 1218 1218 VAL VAL B . n 
B 1 242 LEU 242 1219 1219 LEU LEU B . n 
B 1 243 LYS 243 1220 1220 LYS LYS B . n 
B 1 244 PHE 244 1221 1221 PHE PHE B . n 
B 1 245 VAL 245 1222 1222 VAL VAL B . n 
B 1 246 MET 246 1223 1223 MET MET B . n 
B 1 247 ASP 247 1224 1224 ASP ASP B . n 
B 1 248 GLY 248 1225 1225 GLY GLY B . n 
B 1 249 GLY 249 1226 1226 GLY GLY B . n 
B 1 250 TYR 250 1227 1227 TYR TYR B . n 
B 1 251 LEU 251 1228 1228 LEU LEU B . n 
B 1 252 ASP 252 1229 1229 ASP ASP B . n 
B 1 253 GLN 253 1230 1230 GLN GLN B . n 
B 1 254 PRO 254 1231 1231 PRO PRO B . n 
B 1 255 ASP 255 1232 1232 ASP ASP B . n 
B 1 256 ASN 256 1233 1233 ASN ASN B . n 
B 1 257 CYS 257 1234 1234 CYS CYS B . n 
B 1 258 PRO 258 1235 1235 PRO PRO B . n 
B 1 259 GLU 259 1236 1236 GLU GLU B . n 
B 1 260 ARG 260 1237 1237 ARG ARG B . n 
B 1 261 VAL 261 1238 1238 VAL VAL B . n 
B 1 262 THR 262 1239 1239 THR THR B . n 
B 1 263 ASP 263 1240 1240 ASP ASP B . n 
B 1 264 LEU 264 1241 1241 LEU LEU B . n 
B 1 265 MET 265 1242 1242 MET MET B . n 
B 1 266 ARG 266 1243 1243 ARG ARG B . n 
B 1 267 MET 267 1244 1244 MET MET B . n 
B 1 268 CYS 268 1245 1245 CYS CYS B . n 
B 1 269 TRP 269 1246 1246 TRP TRP B . n 
B 1 270 GLN 270 1247 1247 GLN GLN B . n 
B 1 271 PHE 271 1248 1248 PHE PHE B . n 
B 1 272 ASN 272 1249 1249 ASN ASN B . n 
B 1 273 PRO 273 1250 1250 PRO PRO B . n 
B 1 274 ASN 274 1251 1251 ASN ASN B . n 
B 1 275 MET 275 1252 1252 MET MET B . n 
B 1 276 ARG 276 1253 1253 ARG ARG B . n 
B 1 277 PRO 277 1254 1254 PRO PRO B . n 
B 1 278 THR 278 1255 1255 THR THR B . n 
B 1 279 PHE 279 1256 1256 PHE PHE B . n 
B 1 280 LEU 280 1257 1257 LEU LEU B . n 
B 1 281 GLU 281 1258 1258 GLU GLU B . n 
B 1 282 ILE 282 1259 1259 ILE ILE B . n 
B 1 283 VAL 283 1260 1260 VAL VAL B . n 
B 1 284 ASN 284 1261 1261 ASN ASN B . n 
B 1 285 LEU 285 1262 1262 LEU LEU B . n 
B 1 286 LEU 286 1263 1263 LEU LEU B . n 
B 1 287 LYS 287 1264 1264 LYS LYS B . n 
B 1 288 ASP 288 1265 1265 ASP ASP B . n 
B 1 289 ASP 289 1266 1266 ASP ASP B . n 
B 1 290 LEU 290 1267 1267 LEU LEU B . n 
B 1 291 HIS 291 1268 1268 HIS HIS B . n 
B 1 292 PRO 292 1269 1269 PRO PRO B . n 
B 1 293 SER 293 1270 1270 SER SER B . n 
B 1 294 PHE 294 1271 1271 PHE PHE B . n 
B 1 295 PRO 295 1272 1272 PRO PRO B . n 
B 1 296 GLU 296 1273 1273 GLU GLU B . n 
B 1 297 VAL 297 1274 1274 VAL VAL B . n 
B 1 298 SER 298 1275 1275 SER SER B . n 
B 1 299 PHE 299 1276 1276 PHE PHE B . n 
B 1 300 PHE 300 1277 1277 PHE PHE B . n 
B 1 301 HIS 301 1278 1278 HIS HIS B . n 
B 1 302 SER 302 1279 1279 SER SER B . n 
B 1 303 GLU 303 1280 1280 GLU GLU B . n 
B 1 304 GLU 304 1281 1281 GLU GLU B . n 
B 1 305 ASN 305 1282 1282 ASN ASN B . n 
B 1 306 LYS 306 1283 1283 LYS LYS B . n 
C 2 1   GLY 1   397  ?    ?   ?   C . n 
C 2 2   SER 2   398  ?    ?   ?   C . n 
C 2 3   HIS 3   399  ?    ?   ?   C . n 
C 2 4   MET 4   400  ?    ?   ?   C . n 
C 2 5   GLU 5   401  ?    ?   ?   C . n 
C 2 6   LEU 6   402  402  LEU LEU C . n 
C 2 7   GLU 7   403  403  GLU GLU C . n 
C 2 8   LEU 8   404  404  LEU LEU C . n 
C 2 9   SER 9   405  405  SER SER C . n 
C 2 10  ASP 10  406  406  ASP ASP C . n 
C 2 11  TYR 11  407  407  TYR TYR C . n 
C 2 12  PRO 12  408  408  PRO PRO C . n 
C 2 13  TRP 13  409  409  TRP TRP C . n 
C 2 14  PHE 14  410  410  PHE PHE C . n 
C 2 15  HIS 15  411  411  HIS HIS C . n 
C 2 16  GLY 16  412  412  GLY GLY C . n 
C 2 17  THR 17  413  413  THR THR C . n 
C 2 18  LEU 18  414  414  LEU LEU C . n 
C 2 19  SER 19  415  415  SER SER C . n 
C 2 20  ARG 20  416  416  ARG ARG C . n 
C 2 21  VAL 21  417  417  VAL VAL C . n 
C 2 22  LYS 22  418  418  LYS LYS C . n 
C 2 23  ALA 23  419  419  ALA ALA C . n 
C 2 24  ALA 24  420  420  ALA ALA C . n 
C 2 25  GLN 25  421  421  GLN GLN C . n 
C 2 26  LEU 26  422  422  LEU LEU C . n 
C 2 27  VAL 27  423  423  VAL VAL C . n 
C 2 28  LEU 28  424  424  LEU LEU C . n 
C 2 29  ALA 29  425  425  ALA ALA C . n 
C 2 30  GLY 30  426  426  GLY GLY C . n 
C 2 31  GLY 31  427  427  GLY GLY C . n 
C 2 32  PRO 32  428  428  PRO PRO C . n 
C 2 33  ARG 33  429  429  ARG ARG C . n 
C 2 34  SER 34  430  430  SER SER C . n 
C 2 35  HIS 35  431  431  HIS HIS C . n 
C 2 36  GLY 36  432  432  GLY GLY C . n 
C 2 37  LEU 37  433  433  LEU LEU C . n 
C 2 38  PHE 38  434  434  PHE PHE C . n 
C 2 39  VAL 39  435  435  VAL VAL C . n 
C 2 40  ILE 40  436  436  ILE ILE C . n 
C 2 41  ARG 41  437  437  ARG ARG C . n 
C 2 42  GLN 42  438  438  GLN GLN C . n 
C 2 43  SER 43  439  439  SER SER C . n 
C 2 44  GLU 44  440  440  GLU GLU C . n 
C 2 45  THR 45  441  441  THR THR C . n 
C 2 46  ARG 46  442  442  ARG ARG C . n 
C 2 47  PRO 47  443  443  PRO PRO C . n 
C 2 48  GLY 48  444  444  GLY GLY C . n 
C 2 49  GLU 49  445  445  GLU GLU C . n 
C 2 50  CYS 50  446  446  CYS CYS C . n 
C 2 51  VAL 51  447  447  VAL VAL C . n 
C 2 52  LEU 52  448  448  LEU LEU C . n 
C 2 53  THR 53  449  449  THR THR C . n 
C 2 54  PHE 54  450  450  PHE PHE C . n 
C 2 55  ASN 55  451  451  ASN ASN C . n 
C 2 56  PHE 56  452  452  PHE PHE C . n 
C 2 57  GLN 57  453  453  GLN GLN C . n 
C 2 58  GLY 58  454  454  GLY GLY C . n 
C 2 59  LYS 59  455  455  LYS LYS C . n 
C 2 60  ALA 60  456  456  ALA ALA C . n 
C 2 61  LYS 61  457  457  LYS LYS C . n 
C 2 62  HIS 62  458  458  HIS HIS C . n 
C 2 63  LEU 63  459  459  LEU LEU C . n 
C 2 64  ARG 64  460  460  ARG ARG C . n 
C 2 65  LEU 65  461  461  LEU LEU C . n 
C 2 66  SER 66  462  462  SER SER C . n 
C 2 67  LEU 67  463  463  LEU LEU C . n 
C 2 68  ASN 68  464  464  ASN ASN C . n 
C 2 69  GLY 69  465  ?    ?   ?   C . n 
C 2 70  HIS 70  466  ?    ?   ?   C . n 
C 2 71  GLY 71  467  467  GLY GLY C . n 
C 2 72  GLN 72  468  468  GLN GLN C . n 
C 2 73  CYS 73  469  469  CYS CYS C . n 
C 2 74  HIS 74  470  470  HIS HIS C . n 
C 2 75  VAL 75  471  471  VAL VAL C . n 
C 2 76  GLN 76  472  472  GLN GLN C . n 
C 2 77  HIS 77  473  473  HIS HIS C . n 
C 2 78  LEU 78  474  474  LEU LEU C . n 
C 2 79  TRP 79  475  475  TRP TRP C . n 
C 2 80  PHE 80  476  476  PHE PHE C . n 
C 2 81  GLN 81  477  477  GLN GLN C . n 
C 2 82  SER 82  478  478  SER SER C . n 
C 2 83  VAL 83  479  479  VAL VAL C . n 
C 2 84  PHE 84  480  480  PHE PHE C . n 
C 2 85  ASP 85  481  481  ASP ASP C . n 
C 2 86  MET 86  482  482  MET MET C . n 
C 2 87  LEU 87  483  483  LEU LEU C . n 
C 2 88  ARG 88  484  484  ARG ARG C . n 
C 2 89  HIS 89  485  485  HIS HIS C . n 
C 2 90  PHE 90  486  486  PHE PHE C . n 
C 2 91  HIS 91  487  ?    ?   ?   C . n 
C 2 92  THR 92  488  ?    ?   ?   C . n 
C 2 93  HIS 93  489  ?    ?   ?   C . n 
C 2 94  PRO 94  490  ?    ?   ?   C . n 
C 2 95  ILE 95  491  ?    ?   ?   C . n 
C 2 96  PRO 96  492  ?    ?   ?   C . n 
C 2 97  LEU 97  493  ?    ?   ?   C . n 
C 2 98  GLU 98  494  ?    ?   ?   C . n 
C 2 99  SER 99  495  ?    ?   ?   C . n 
C 2 100 GLY 100 496  ?    ?   ?   C . n 
C 2 101 GLY 101 497  ?    ?   ?   C . n 
C 2 102 SER 102 498  ?    ?   ?   C . n 
C 2 103 ALA 103 499  ?    ?   ?   C . n 
C 2 104 ASP 104 500  ?    ?   ?   C . n 
C 2 105 ILE 105 501  ?    ?   ?   C . n 
C 2 106 THR 106 502  ?    ?   ?   C . n 
C 2 107 LEU 107 503  ?    ?   ?   C . n 
C 2 108 ARG 108 504  ?    ?   ?   C . n 
C 2 109 SER 109 505  ?    ?   ?   C . n 
C 2 110 TYR 110 506  ?    ?   ?   C . n 
C 2 111 VAL 111 507  ?    ?   ?   C . n 
C 2 112 ARG 112 508  ?    ?   ?   C . n 
C 2 113 ALA 113 509  ?    ?   ?   C . n 
C 2 114 GLN 114 510  ?    ?   ?   C . n 
D 2 1   GLY 1   397  ?    ?   ?   D . n 
D 2 2   SER 2   398  ?    ?   ?   D . n 
D 2 3   HIS 3   399  ?    ?   ?   D . n 
D 2 4   MET 4   400  ?    ?   ?   D . n 
D 2 5   GLU 5   401  ?    ?   ?   D . n 
D 2 6   LEU 6   402  402  LEU LEU D . n 
D 2 7   GLU 7   403  403  GLU GLU D . n 
D 2 8   LEU 8   404  404  LEU LEU D . n 
D 2 9   SER 9   405  405  SER SER D . n 
D 2 10  ASP 10  406  406  ASP ASP D . n 
D 2 11  TYR 11  407  407  TYR TYR D . n 
D 2 12  PRO 12  408  408  PRO PRO D . n 
D 2 13  TRP 13  409  409  TRP TRP D . n 
D 2 14  PHE 14  410  410  PHE PHE D . n 
D 2 15  HIS 15  411  411  HIS HIS D . n 
D 2 16  GLY 16  412  412  GLY GLY D . n 
D 2 17  THR 17  413  413  THR THR D . n 
D 2 18  LEU 18  414  414  LEU LEU D . n 
D 2 19  SER 19  415  415  SER SER D . n 
D 2 20  ARG 20  416  416  ARG ARG D . n 
D 2 21  VAL 21  417  417  VAL VAL D . n 
D 2 22  LYS 22  418  418  LYS LYS D . n 
D 2 23  ALA 23  419  419  ALA ALA D . n 
D 2 24  ALA 24  420  420  ALA ALA D . n 
D 2 25  GLN 25  421  421  GLN GLN D . n 
D 2 26  LEU 26  422  422  LEU LEU D . n 
D 2 27  VAL 27  423  423  VAL VAL D . n 
D 2 28  LEU 28  424  424  LEU LEU D . n 
D 2 29  ALA 29  425  425  ALA ALA D . n 
D 2 30  GLY 30  426  426  GLY GLY D . n 
D 2 31  GLY 31  427  427  GLY GLY D . n 
D 2 32  PRO 32  428  428  PRO PRO D . n 
D 2 33  ARG 33  429  429  ARG ARG D . n 
D 2 34  SER 34  430  430  SER SER D . n 
D 2 35  HIS 35  431  431  HIS HIS D . n 
D 2 36  GLY 36  432  432  GLY GLY D . n 
D 2 37  LEU 37  433  433  LEU LEU D . n 
D 2 38  PHE 38  434  434  PHE PHE D . n 
D 2 39  VAL 39  435  435  VAL VAL D . n 
D 2 40  ILE 40  436  436  ILE ILE D . n 
D 2 41  ARG 41  437  437  ARG ARG D . n 
D 2 42  GLN 42  438  438  GLN GLN D . n 
D 2 43  SER 43  439  439  SER SER D . n 
D 2 44  GLU 44  440  440  GLU GLU D . n 
D 2 45  THR 45  441  441  THR THR D . n 
D 2 46  ARG 46  442  442  ARG ARG D . n 
D 2 47  PRO 47  443  443  PRO PRO D . n 
D 2 48  GLY 48  444  444  GLY GLY D . n 
D 2 49  GLU 49  445  445  GLU GLU D . n 
D 2 50  CYS 50  446  446  CYS CYS D . n 
D 2 51  VAL 51  447  447  VAL VAL D . n 
D 2 52  LEU 52  448  448  LEU LEU D . n 
D 2 53  THR 53  449  449  THR THR D . n 
D 2 54  PHE 54  450  450  PHE PHE D . n 
D 2 55  ASN 55  451  451  ASN ASN D . n 
D 2 56  PHE 56  452  452  PHE PHE D . n 
D 2 57  GLN 57  453  453  GLN GLN D . n 
D 2 58  GLY 58  454  454  GLY GLY D . n 
D 2 59  LYS 59  455  455  LYS LYS D . n 
D 2 60  ALA 60  456  456  ALA ALA D . n 
D 2 61  LYS 61  457  457  LYS LYS D . n 
D 2 62  HIS 62  458  458  HIS HIS D . n 
D 2 63  LEU 63  459  459  LEU LEU D . n 
D 2 64  ARG 64  460  460  ARG ARG D . n 
D 2 65  LEU 65  461  461  LEU LEU D . n 
D 2 66  SER 66  462  462  SER SER D . n 
D 2 67  LEU 67  463  463  LEU LEU D . n 
D 2 68  ASN 68  464  464  ASN ASN D . n 
D 2 69  GLY 69  465  ?    ?   ?   D . n 
D 2 70  HIS 70  466  ?    ?   ?   D . n 
D 2 71  GLY 71  467  467  GLY GLY D . n 
D 2 72  GLN 72  468  468  GLN GLN D . n 
D 2 73  CYS 73  469  469  CYS CYS D . n 
D 2 74  HIS 74  470  470  HIS HIS D . n 
D 2 75  VAL 75  471  471  VAL VAL D . n 
D 2 76  GLN 76  472  472  GLN GLN D . n 
D 2 77  HIS 77  473  473  HIS HIS D . n 
D 2 78  LEU 78  474  474  LEU LEU D . n 
D 2 79  TRP 79  475  475  TRP TRP D . n 
D 2 80  PHE 80  476  476  PHE PHE D . n 
D 2 81  GLN 81  477  477  GLN GLN D . n 
D 2 82  SER 82  478  478  SER SER D . n 
D 2 83  VAL 83  479  479  VAL VAL D . n 
D 2 84  PHE 84  480  480  PHE PHE D . n 
D 2 85  ASP 85  481  481  ASP ASP D . n 
D 2 86  MET 86  482  482  MET MET D . n 
D 2 87  LEU 87  483  483  LEU LEU D . n 
D 2 88  ARG 88  484  484  ARG ARG D . n 
D 2 89  HIS 89  485  485  HIS HIS D . n 
D 2 90  PHE 90  486  486  PHE PHE D . n 
D 2 91  HIS 91  487  ?    ?   ?   D . n 
D 2 92  THR 92  488  ?    ?   ?   D . n 
D 2 93  HIS 93  489  ?    ?   ?   D . n 
D 2 94  PRO 94  490  ?    ?   ?   D . n 
D 2 95  ILE 95  491  ?    ?   ?   D . n 
D 2 96  PRO 96  492  ?    ?   ?   D . n 
D 2 97  LEU 97  493  ?    ?   ?   D . n 
D 2 98  GLU 98  494  ?    ?   ?   D . n 
D 2 99  SER 99  495  ?    ?   ?   D . n 
D 2 100 GLY 100 496  ?    ?   ?   D . n 
D 2 101 GLY 101 497  ?    ?   ?   D . n 
D 2 102 SER 102 498  ?    ?   ?   D . n 
D 2 103 ALA 103 499  ?    ?   ?   D . n 
D 2 104 ASP 104 500  ?    ?   ?   D . n 
D 2 105 ILE 105 501  ?    ?   ?   D . n 
D 2 106 THR 106 502  ?    ?   ?   D . n 
D 2 107 LEU 107 503  ?    ?   ?   D . n 
D 2 108 ARG 108 504  ?    ?   ?   D . n 
D 2 109 SER 109 505  ?    ?   ?   D . n 
D 2 110 TYR 110 506  ?    ?   ?   D . n 
D 2 111 VAL 111 507  ?    ?   ?   D . n 
D 2 112 ARG 112 508  ?    ?   ?   D . n 
D 2 113 ALA 113 509  ?    ?   ?   D . n 
D 2 114 GLN 114 510  ?    ?   ?   D . n 
E 3 1   LYS 1   99   ?    ?   ?   E . n 
E 3 2   LYS 2   100  ?    ?   ?   E . n 
E 3 3   LYS 3   101  ?    ?   ?   E . n 
E 3 4   LEU 4   102  102  LEU LEU E . n 
E 3 5   PRO 5   103  103  PRO PRO E . n 
E 3 6   ALA 6   104  104  ALA ALA E . n 
E 3 7   THR 7   105  105  THR THR E . n 
E 3 8   GLY 8   106  106  GLY GLY E . n 
E 3 9   ASP 9   107  107  ASP ASP E . n 
E 3 10  PHE 10  108  108  PHE PHE E . n 
E 3 11  MET 11  109  109  MET MET E . n 
E 3 12  ASN 12  110  110  ASN ASN E . n 
E 3 13  MET 13  111  111  MET MET E . n 
E 3 14  SER 14  112  112  SER SER E . n 
E 3 15  PRO 15  113  113  PRO PRO E . n 
E 3 16  VAL 16  114  114  VAL VAL E . n 
E 3 17  GLY 17  115  115  GLY GLY E . n 
E 3 18  ASP 18  116  ?    ?   ?   E . n 
F 3 1   LYS 1   99   ?    ?   ?   F . n 
F 3 2   LYS 2   100  ?    ?   ?   F . n 
F 3 3   LYS 3   101  ?    ?   ?   F . n 
F 3 4   LEU 4   102  102  LEU LEU F . n 
F 3 5   PRO 5   103  103  PRO PRO F . n 
F 3 6   ALA 6   104  104  ALA ALA F . n 
F 3 7   THR 7   105  105  THR THR F . n 
F 3 8   GLY 8   106  106  GLY GLY F . n 
F 3 9   ASP 9   107  107  ASP ASP F . n 
F 3 10  PHE 10  108  108  PHE PHE F . n 
F 3 11  MET 11  109  109  MET MET F . n 
F 3 12  ASN 12  110  110  ASN ASN F . n 
F 3 13  MET 13  111  111  MET MET F . n 
F 3 14  SER 14  112  112  SER SER F . n 
F 3 15  PRO 15  113  113  PRO PRO F . n 
F 3 16  VAL 16  114  114  VAL VAL F . n 
F 3 17  GLY 17  115  ?    ?   ?   F . n 
F 3 18  ASP 18  116  ?    ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 MN  1  201 201 MN  MN  A . 
H 4 MN  1  202 202 MN  MN  B . 
I 5 112 1  117 101 112 112 E . 
J 5 112 1  117 101 112 112 F . 
K 6 HOH 1  1   1   HOH HOH A . 
K 6 HOH 2  2   2   HOH HOH A . 
K 6 HOH 3  3   3   HOH HOH A . 
K 6 HOH 4  5   5   HOH HOH A . 
K 6 HOH 5  8   8   HOH HOH A . 
K 6 HOH 6  14  14  HOH HOH A . 
K 6 HOH 7  15  15  HOH HOH A . 
K 6 HOH 8  17  17  HOH HOH A . 
K 6 HOH 9  18  18  HOH HOH A . 
K 6 HOH 10 21  21  HOH HOH A . 
K 6 HOH 11 22  22  HOH HOH A . 
K 6 HOH 12 25  25  HOH HOH A . 
K 6 HOH 13 27  27  HOH HOH A . 
K 6 HOH 14 28  28  HOH HOH A . 
K 6 HOH 15 30  30  HOH HOH A . 
K 6 HOH 16 33  33  HOH HOH A . 
K 6 HOH 17 39  39  HOH HOH A . 
K 6 HOH 18 41  41  HOH HOH A . 
K 6 HOH 19 42  42  HOH HOH A . 
K 6 HOH 20 43  43  HOH HOH A . 
K 6 HOH 21 44  44  HOH HOH A . 
K 6 HOH 22 46  46  HOH HOH A . 
K 6 HOH 23 47  47  HOH HOH A . 
K 6 HOH 24 48  48  HOH HOH A . 
K 6 HOH 25 51  51  HOH HOH A . 
K 6 HOH 26 52  52  HOH HOH A . 
K 6 HOH 27 53  53  HOH HOH A . 
K 6 HOH 28 54  54  HOH HOH A . 
K 6 HOH 29 57  57  HOH HOH A . 
K 6 HOH 30 59  59  HOH HOH A . 
K 6 HOH 31 60  60  HOH HOH A . 
K 6 HOH 32 63  63  HOH HOH A . 
K 6 HOH 33 69  69  HOH HOH A . 
K 6 HOH 34 71  71  HOH HOH A . 
K 6 HOH 35 73  73  HOH HOH A . 
K 6 HOH 36 75  75  HOH HOH A . 
K 6 HOH 37 76  76  HOH HOH A . 
L 6 HOH 1  4   4   HOH HOH B . 
L 6 HOH 2  6   6   HOH HOH B . 
L 6 HOH 3  7   7   HOH HOH B . 
L 6 HOH 4  9   9   HOH HOH B . 
L 6 HOH 5  10  10  HOH HOH B . 
L 6 HOH 6  12  12  HOH HOH B . 
L 6 HOH 7  13  13  HOH HOH B . 
L 6 HOH 8  16  16  HOH HOH B . 
L 6 HOH 9  19  19  HOH HOH B . 
L 6 HOH 10 20  20  HOH HOH B . 
L 6 HOH 11 24  24  HOH HOH B . 
L 6 HOH 12 31  31  HOH HOH B . 
L 6 HOH 13 32  32  HOH HOH B . 
L 6 HOH 14 34  34  HOH HOH B . 
L 6 HOH 15 35  35  HOH HOH B . 
L 6 HOH 16 38  38  HOH HOH B . 
L 6 HOH 17 45  45  HOH HOH B . 
L 6 HOH 18 49  49  HOH HOH B . 
L 6 HOH 19 50  50  HOH HOH B . 
L 6 HOH 20 65  65  HOH HOH B . 
L 6 HOH 21 67  67  HOH HOH B . 
L 6 HOH 22 68  68  HOH HOH B . 
L 6 HOH 23 70  70  HOH HOH B . 
L 6 HOH 24 74  74  HOH HOH B . 
L 6 HOH 25 77  77  HOH HOH B . 
M 6 HOH 1  23  23  HOH HOH C . 
M 6 HOH 2  36  36  HOH HOH C . 
M 6 HOH 3  40  40  HOH HOH C . 
M 6 HOH 4  79  79  HOH HOH C . 
N 6 HOH 1  26  26  HOH HOH D . 
N 6 HOH 2  37  37  HOH HOH D . 
N 6 HOH 3  55  55  HOH HOH D . 
N 6 HOH 4  56  56  HOH HOH D . 
N 6 HOH 5  58  58  HOH HOH D . 
N 6 HOH 6  72  72  HOH HOH D . 
N 6 HOH 7  78  78  HOH HOH D . 
O 6 HOH 1  61  61  HOH HOH E . 
O 6 HOH 2  62  62  HOH HOH E . 
O 6 HOH 3  64  64  HOH HOH E . 
P 6 HOH 1  11  11  HOH HOH F . 
P 6 HOH 2  29  29  HOH HOH F . 
P 6 HOH 3  66  66  HOH HOH F . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A PTR 181 A PTR 1158 ? TYR O-PHOSPHOTYROSINE 
2 A PTR 185 A PTR 1162 ? TYR O-PHOSPHOTYROSINE 
3 A PTR 186 A PTR 1163 ? TYR O-PHOSPHOTYROSINE 
4 B PTR 181 B PTR 1158 ? TYR O-PHOSPHOTYROSINE 
5 B PTR 185 B PTR 1162 ? TYR O-PHOSPHOTYROSINE 
6 B PTR 186 B PTR 1163 ? TYR O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? K HOH .   ? A HOH 63   ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 OD1 ? A ASN 160 ? A ASN 1137 ? 1_555 83.2  ? 
2  O   ? K HOH .   ? A HOH 63   ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 79.3  ? 
3  OD1 ? A ASN 160 ? A ASN 1137 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 92.7  ? 
4  O   ? K HOH .   ? A HOH 63   ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2S ? I 112 .   ? E 112 117  ? 1_555 163.5 ? 
5  OD1 ? A ASN 160 ? A ASN 1137 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2S ? I 112 .   ? E 112 117  ? 1_555 87.8  ? 
6  OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2S ? I 112 .   ? E 112 117  ? 1_555 87.3  ? 
7  O   ? K HOH .   ? A HOH 63   ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2G ? I 112 .   ? E 112 117  ? 1_555 90.0  ? 
8  OD1 ? A ASN 160 ? A ASN 1137 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2G ? I 112 .   ? E 112 117  ? 1_555 95.6  ? 
9  OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2G ? I 112 .   ? E 112 117  ? 1_555 165.6 ? 
10 O2S ? I 112 .   ? E 112 117  ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2G ? I 112 .   ? E 112 117  ? 1_555 104.7 ? 
11 O   ? K HOH .   ? A HOH 63   ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2B ? I 112 .   ? E 112 117  ? 1_555 81.9  ? 
12 OD1 ? A ASN 160 ? A ASN 1137 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2B ? I 112 .   ? E 112 117  ? 1_555 164.3 ? 
13 OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2B ? I 112 .   ? E 112 117  ? 1_555 79.6  ? 
14 O2S ? I 112 .   ? E 112 117  ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2B ? I 112 .   ? E 112 117  ? 1_555 105.4 ? 
15 O2G ? I 112 .   ? E 112 117  ? 1_555 MN ? G MN . ? A MN 201 ? 1_555 O2B ? I 112 .   ? E 112 117  ? 1_555 89.5  ? 
16 OD1 ? B ASN 160 ? B ASN 1137 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 OD2 ? B ASP 173 ? B ASP 1150 ? 1_555 83.5  ? 
17 OD1 ? B ASN 160 ? B ASN 1137 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O   ? P HOH .   ? F HOH 66   ? 1_555 82.1  ? 
18 OD2 ? B ASP 173 ? B ASP 1150 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O   ? P HOH .   ? F HOH 66   ? 1_555 89.2  ? 
19 OD1 ? B ASN 160 ? B ASN 1137 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2G ? J 112 .   ? F 112 117  ? 1_555 97.2  ? 
20 OD2 ? B ASP 173 ? B ASP 1150 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2G ? J 112 .   ? F 112 117  ? 1_555 166.0 ? 
21 O   ? P HOH .   ? F HOH 66   ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2G ? J 112 .   ? F 112 117  ? 1_555 77.2  ? 
22 OD1 ? B ASN 160 ? B ASN 1137 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2S ? J 112 .   ? F 112 117  ? 1_555 86.2  ? 
23 OD2 ? B ASP 173 ? B ASP 1150 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2S ? J 112 .   ? F 112 117  ? 1_555 82.8  ? 
24 O   ? P HOH .   ? F HOH 66   ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2S ? J 112 .   ? F 112 117  ? 1_555 166.5 ? 
25 O2G ? J 112 .   ? F 112 117  ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2S ? J 112 .   ? F 112 117  ? 1_555 111.2 ? 
26 OD1 ? B ASN 160 ? B ASN 1137 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2B ? J 112 .   ? F 112 117  ? 1_555 157.6 ? 
27 OD2 ? B ASP 173 ? B ASP 1150 ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2B ? J 112 .   ? F 112 117  ? 1_555 81.8  ? 
28 O   ? P HOH .   ? F HOH 66   ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2B ? J 112 .   ? F 112 117  ? 1_555 80.9  ? 
29 O2G ? J 112 .   ? F 112 117  ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2B ? J 112 .   ? F 112 117  ? 1_555 93.0  ? 
30 O2S ? J 112 .   ? F 112 117  ? 1_555 MN ? H MN . ? B MN 202 ? 1_555 O2B ? J 112 .   ? F 112 117  ? 1_555 108.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-30 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_conn_type       
5 4 'Structure model' struct_ref_seq_dif     
6 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 4 'Structure model' '_pdbx_struct_conn_angle.value'               
18 4 'Structure model' '_struct_conn.conn_type_id'                   
19 4 'Structure model' '_struct_conn.id'                             
20 4 'Structure model' '_struct_conn.pdbx_dist_value'                
21 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
27 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
28 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
29 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
30 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
34 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
35 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
36 4 'Structure model' '_struct_conn_type.id'                        
37 4 'Structure model' '_struct_ref_seq_dif.details'                 
38 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
39 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
40 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 999  ? ? -91.05  -68.55  
2  1 PHE A 1007 ? ? -143.57 27.30   
3  1 LYS A 1068 ? ? -59.87  105.66  
4  1 PRO A 1099 ? ? -62.55  -93.55  
5  1 ARG A 1131 ? ? 70.05   -11.76  
6  1 ASP A 1132 ? ? -140.47 45.27   
7  1 ASP A 1150 ? ? 50.78   88.11   
8  1 ASP A 1266 ? ? -88.01  48.51   
9  1 LEU B 999  ? ? -91.18  -66.23  
10 1 PHE B 1007 ? ? -144.16 28.07   
11 1 PRO B 1099 ? ? -62.26  -94.01  
12 1 ARG B 1131 ? ? 70.11   -13.29  
13 1 ASP B 1150 ? ? 49.47   88.05   
14 1 ASP B 1161 ? ? 80.61   0.71    
15 1 ASN B 1233 ? ? 57.36   16.59   
16 1 SER C 430  ? ? -88.28  31.15   
17 1 THR C 441  ? ? -83.93  -74.40  
18 1 ARG C 484  ? ? -46.65  -19.18  
19 1 HIS C 485  ? ? -92.96  39.25   
20 1 LEU D 404  ? ? -28.57  -44.28  
21 1 THR D 441  ? ? -82.82  -76.05  
22 1 GLN D 468  ? ? 82.99   -0.91   
23 1 HIS D 485  ? ? -93.74  41.20   
24 1 ALA E 104  ? ? -67.83  59.30   
25 1 VAL E 114  ? ? -89.61  -113.35 
26 1 ALA F 104  ? ? -69.35  59.17   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 988  ? CG  ? A GLU 11  CG  
2   1 Y 1 A GLU 988  ? CD  ? A GLU 11  CD  
3   1 Y 1 A GLU 988  ? OE1 ? A GLU 11  OE1 
4   1 Y 1 A GLU 988  ? OE2 ? A GLU 11  OE2 
5   1 Y 1 A ARG 1016 ? CG  ? A ARG 39  CG  
6   1 Y 1 A ARG 1016 ? CD  ? A ARG 39  CD  
7   1 Y 1 A ARG 1016 ? NE  ? A ARG 39  NE  
8   1 Y 1 A ARG 1016 ? CZ  ? A ARG 39  CZ  
9   1 Y 1 A ARG 1016 ? NH1 ? A ARG 39  NH1 
10  1 Y 1 A ARG 1016 ? NH2 ? A ARG 39  NH2 
11  1 Y 1 A LYS 1020 ? CG  ? A LYS 43  CG  
12  1 Y 1 A LYS 1020 ? CD  ? A LYS 43  CD  
13  1 Y 1 A LYS 1020 ? CE  ? A LYS 43  CE  
14  1 Y 1 A LYS 1020 ? NZ  ? A LYS 43  NZ  
15  1 Y 1 A GLU 1034 ? CG  ? A GLU 57  CG  
16  1 Y 1 A GLU 1034 ? CD  ? A GLU 57  CD  
17  1 Y 1 A GLU 1034 ? OE1 ? A GLU 57  OE1 
18  1 Y 1 A GLU 1034 ? OE2 ? A GLU 57  OE2 
19  1 Y 1 A LYS 1068 ? CG  ? A LYS 91  CG  
20  1 Y 1 A LYS 1068 ? CD  ? A LYS 91  CD  
21  1 Y 1 A LYS 1068 ? CE  ? A LYS 91  CE  
22  1 Y 1 A LYS 1068 ? NZ  ? A LYS 91  NZ  
23  1 Y 1 A GLN 1070 ? CG  ? A GLN 93  CG  
24  1 Y 1 A GLN 1070 ? CD  ? A GLN 93  CD  
25  1 Y 1 A GLN 1070 ? OE1 ? A GLN 93  OE1 
26  1 Y 1 A GLN 1070 ? NE2 ? A GLN 93  NE2 
27  1 Y 1 A GLU 1094 ? CG  ? A GLU 117 CG  
28  1 Y 1 A GLU 1094 ? CD  ? A GLU 117 CD  
29  1 Y 1 A GLU 1094 ? OE1 ? A GLU 117 OE1 
30  1 Y 1 A GLU 1094 ? OE2 ? A GLU 117 OE2 
31  1 Y 1 A GLU 1096 ? CG  ? A GLU 119 CG  
32  1 Y 1 A GLU 1096 ? CD  ? A GLU 119 CD  
33  1 Y 1 A GLU 1096 ? OE1 ? A GLU 119 OE1 
34  1 Y 1 A GLU 1096 ? OE2 ? A GLU 119 OE2 
35  1 Y 1 A LYS 1168 ? CG  ? A LYS 191 CG  
36  1 Y 1 A LYS 1168 ? CD  ? A LYS 191 CD  
37  1 Y 1 A LYS 1168 ? CE  ? A LYS 191 CE  
38  1 Y 1 A LYS 1168 ? NZ  ? A LYS 191 NZ  
39  1 Y 1 A GLU 1236 ? CG  ? A GLU 259 CG  
40  1 Y 1 A GLU 1236 ? CD  ? A GLU 259 CD  
41  1 Y 1 A GLU 1236 ? OE1 ? A GLU 259 OE1 
42  1 Y 1 A GLU 1236 ? OE2 ? A GLU 259 OE2 
43  1 Y 1 A ARG 1243 ? CG  ? A ARG 266 CG  
44  1 Y 1 A ARG 1243 ? CD  ? A ARG 266 CD  
45  1 Y 1 A ARG 1243 ? NE  ? A ARG 266 NE  
46  1 Y 1 A ARG 1243 ? CZ  ? A ARG 266 CZ  
47  1 Y 1 A ARG 1243 ? NH1 ? A ARG 266 NH1 
48  1 Y 1 A ARG 1243 ? NH2 ? A ARG 266 NH2 
49  1 Y 1 A GLU 1280 ? CG  ? A GLU 303 CG  
50  1 Y 1 A GLU 1280 ? CD  ? A GLU 303 CD  
51  1 Y 1 A GLU 1280 ? OE1 ? A GLU 303 OE1 
52  1 Y 1 A GLU 1280 ? OE2 ? A GLU 303 OE2 
53  1 Y 1 A LYS 1283 ? CG  ? A LYS 306 CG  
54  1 Y 1 A LYS 1283 ? CD  ? A LYS 306 CD  
55  1 Y 1 A LYS 1283 ? CE  ? A LYS 306 CE  
56  1 Y 1 A LYS 1283 ? NZ  ? A LYS 306 NZ  
57  1 Y 1 B GLU 988  ? CG  ? B GLU 11  CG  
58  1 Y 1 B GLU 988  ? CD  ? B GLU 11  CD  
59  1 Y 1 B GLU 988  ? OE1 ? B GLU 11  OE1 
60  1 Y 1 B GLU 988  ? OE2 ? B GLU 11  OE2 
61  1 Y 1 B ARG 1016 ? CG  ? B ARG 39  CG  
62  1 Y 1 B ARG 1016 ? CD  ? B ARG 39  CD  
63  1 Y 1 B ARG 1016 ? NE  ? B ARG 39  NE  
64  1 Y 1 B ARG 1016 ? CZ  ? B ARG 39  CZ  
65  1 Y 1 B ARG 1016 ? NH1 ? B ARG 39  NH1 
66  1 Y 1 B ARG 1016 ? NH2 ? B ARG 39  NH2 
67  1 Y 1 B LYS 1020 ? CG  ? B LYS 43  CG  
68  1 Y 1 B LYS 1020 ? CD  ? B LYS 43  CD  
69  1 Y 1 B LYS 1020 ? CE  ? B LYS 43  CE  
70  1 Y 1 B LYS 1020 ? NZ  ? B LYS 43  NZ  
71  1 Y 1 B GLU 1024 ? CG  ? B GLU 47  CG  
72  1 Y 1 B GLU 1024 ? CD  ? B GLU 47  CD  
73  1 Y 1 B GLU 1024 ? OE1 ? B GLU 47  OE1 
74  1 Y 1 B GLU 1024 ? OE2 ? B GLU 47  OE2 
75  1 Y 1 B GLU 1034 ? CG  ? B GLU 57  CG  
76  1 Y 1 B GLU 1034 ? CD  ? B GLU 57  CD  
77  1 Y 1 B GLU 1034 ? OE1 ? B GLU 57  OE1 
78  1 Y 1 B GLU 1034 ? OE2 ? B GLU 57  OE2 
79  1 Y 1 B ARG 1039 ? CG  ? B ARG 62  CG  
80  1 Y 1 B ARG 1039 ? CD  ? B ARG 62  CD  
81  1 Y 1 B ARG 1039 ? NE  ? B ARG 62  NE  
82  1 Y 1 B ARG 1039 ? CZ  ? B ARG 62  CZ  
83  1 Y 1 B ARG 1039 ? NH1 ? B ARG 62  NH1 
84  1 Y 1 B ARG 1039 ? NH2 ? B ARG 62  NH2 
85  1 Y 1 B LYS 1068 ? CG  ? B LYS 91  CG  
86  1 Y 1 B LYS 1068 ? CD  ? B LYS 91  CD  
87  1 Y 1 B LYS 1068 ? CE  ? B LYS 91  CE  
88  1 Y 1 B LYS 1068 ? NZ  ? B LYS 91  NZ  
89  1 Y 1 B GLN 1070 ? CG  ? B GLN 93  CG  
90  1 Y 1 B GLN 1070 ? CD  ? B GLN 93  CD  
91  1 Y 1 B GLN 1070 ? OE1 ? B GLN 93  OE1 
92  1 Y 1 B GLN 1070 ? NE2 ? B GLN 93  NE2 
93  1 Y 1 B GLU 1094 ? CG  ? B GLU 117 CG  
94  1 Y 1 B GLU 1094 ? CD  ? B GLU 117 CD  
95  1 Y 1 B GLU 1094 ? OE1 ? B GLU 117 OE1 
96  1 Y 1 B GLU 1094 ? OE2 ? B GLU 117 OE2 
97  1 Y 1 B GLU 1096 ? CG  ? B GLU 119 CG  
98  1 Y 1 B GLU 1096 ? CD  ? B GLU 119 CD  
99  1 Y 1 B GLU 1096 ? OE1 ? B GLU 119 OE1 
100 1 Y 1 B GLU 1096 ? OE2 ? B GLU 119 OE2 
101 1 Y 1 B LYS 1168 ? CG  ? B LYS 191 CG  
102 1 Y 1 B LYS 1168 ? CD  ? B LYS 191 CD  
103 1 Y 1 B LYS 1168 ? CE  ? B LYS 191 CE  
104 1 Y 1 B LYS 1168 ? NZ  ? B LYS 191 NZ  
105 1 Y 1 B ARG 1243 ? CG  ? B ARG 266 CG  
106 1 Y 1 B ARG 1243 ? CD  ? B ARG 266 CD  
107 1 Y 1 B ARG 1243 ? NE  ? B ARG 266 NE  
108 1 Y 1 B ARG 1243 ? CZ  ? B ARG 266 CZ  
109 1 Y 1 B ARG 1243 ? NH1 ? B ARG 266 NH1 
110 1 Y 1 B ARG 1243 ? NH2 ? B ARG 266 NH2 
111 1 Y 1 B GLU 1280 ? CG  ? B GLU 303 CG  
112 1 Y 1 B GLU 1280 ? CD  ? B GLU 303 CD  
113 1 Y 1 B GLU 1280 ? OE1 ? B GLU 303 OE1 
114 1 Y 1 B GLU 1280 ? OE2 ? B GLU 303 OE2 
115 1 Y 1 B LYS 1283 ? CG  ? B LYS 306 CG  
116 1 Y 1 B LYS 1283 ? CD  ? B LYS 306 CD  
117 1 Y 1 B LYS 1283 ? CE  ? B LYS 306 CE  
118 1 Y 1 B LYS 1283 ? NZ  ? B LYS 306 NZ  
119 1 Y 1 C LYS 418  ? CG  ? C LYS 22  CG  
120 1 Y 1 C LYS 418  ? CD  ? C LYS 22  CD  
121 1 Y 1 C LYS 418  ? CE  ? C LYS 22  CE  
122 1 Y 1 C LYS 418  ? NZ  ? C LYS 22  NZ  
123 1 Y 1 C ARG 429  ? CG  ? C ARG 33  CG  
124 1 Y 1 C ARG 429  ? CD  ? C ARG 33  CD  
125 1 Y 1 C ARG 429  ? NE  ? C ARG 33  NE  
126 1 Y 1 C ARG 429  ? CZ  ? C ARG 33  CZ  
127 1 Y 1 C ARG 429  ? NH1 ? C ARG 33  NH1 
128 1 Y 1 C ARG 429  ? NH2 ? C ARG 33  NH2 
129 1 Y 1 C ASN 464  ? CG  ? C ASN 68  CG  
130 1 Y 1 C ASN 464  ? OD1 ? C ASN 68  OD1 
131 1 Y 1 C ASN 464  ? ND2 ? C ASN 68  ND2 
132 1 Y 1 C HIS 485  ? CG  ? C HIS 89  CG  
133 1 Y 1 C HIS 485  ? ND1 ? C HIS 89  ND1 
134 1 Y 1 C HIS 485  ? CD2 ? C HIS 89  CD2 
135 1 Y 1 C HIS 485  ? CE1 ? C HIS 89  CE1 
136 1 Y 1 C HIS 485  ? NE2 ? C HIS 89  NE2 
137 1 Y 1 D ARG 429  ? CG  ? D ARG 33  CG  
138 1 Y 1 D ARG 429  ? CD  ? D ARG 33  CD  
139 1 Y 1 D ARG 429  ? NE  ? D ARG 33  NE  
140 1 Y 1 D ARG 429  ? CZ  ? D ARG 33  CZ  
141 1 Y 1 D ARG 429  ? NH1 ? D ARG 33  NH1 
142 1 Y 1 D ARG 429  ? NH2 ? D ARG 33  NH2 
143 1 Y 1 D ARG 442  ? CG  ? D ARG 46  CG  
144 1 Y 1 D ARG 442  ? CD  ? D ARG 46  CD  
145 1 Y 1 D ARG 442  ? NE  ? D ARG 46  NE  
146 1 Y 1 D ARG 442  ? CZ  ? D ARG 46  CZ  
147 1 Y 1 D ARG 442  ? NH1 ? D ARG 46  NH1 
148 1 Y 1 D ARG 442  ? NH2 ? D ARG 46  NH2 
149 1 Y 1 D GLN 468  ? CB  ? D GLN 72  CB  
150 1 Y 1 D GLN 468  ? CG  ? D GLN 72  CG  
151 1 Y 1 D GLN 468  ? CD  ? D GLN 72  CD  
152 1 Y 1 D GLN 468  ? OE1 ? D GLN 72  OE1 
153 1 Y 1 D GLN 468  ? NE2 ? D GLN 72  NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 978 ? A VAL 1   
2  1 Y 1 A PHE 979 ? A PHE 2   
3  1 Y 1 A PRO 980 ? A PRO 3   
4  1 Y 1 A SER 981 ? A SER 4   
5  1 Y 1 A SER 982 ? A SER 5   
6  1 Y 1 A VAL 983 ? A VAL 6   
7  1 Y 1 A TYR 984 ? A TYR 7   
8  1 Y 1 A VAL 985 ? A VAL 8   
9  1 Y 1 A PRO 986 ? A PRO 9   
10 1 Y 1 B VAL 978 ? B VAL 1   
11 1 Y 1 B PHE 979 ? B PHE 2   
12 1 Y 1 B PRO 980 ? B PRO 3   
13 1 Y 1 B SER 981 ? B SER 4   
14 1 Y 1 B SER 982 ? B SER 5   
15 1 Y 1 B VAL 983 ? B VAL 6   
16 1 Y 1 B TYR 984 ? B TYR 7   
17 1 Y 1 B VAL 985 ? B VAL 8   
18 1 Y 1 B PRO 986 ? B PRO 9   
19 1 Y 1 C GLY 397 ? C GLY 1   
20 1 Y 1 C SER 398 ? C SER 2   
21 1 Y 1 C HIS 399 ? C HIS 3   
22 1 Y 1 C MET 400 ? C MET 4   
23 1 Y 1 C GLU 401 ? C GLU 5   
24 1 Y 1 C GLY 465 ? C GLY 69  
25 1 Y 1 C HIS 466 ? C HIS 70  
26 1 Y 1 C HIS 487 ? C HIS 91  
27 1 Y 1 C THR 488 ? C THR 92  
28 1 Y 1 C HIS 489 ? C HIS 93  
29 1 Y 1 C PRO 490 ? C PRO 94  
30 1 Y 1 C ILE 491 ? C ILE 95  
31 1 Y 1 C PRO 492 ? C PRO 96  
32 1 Y 1 C LEU 493 ? C LEU 97  
33 1 Y 1 C GLU 494 ? C GLU 98  
34 1 Y 1 C SER 495 ? C SER 99  
35 1 Y 1 C GLY 496 ? C GLY 100 
36 1 Y 1 C GLY 497 ? C GLY 101 
37 1 Y 1 C SER 498 ? C SER 102 
38 1 Y 1 C ALA 499 ? C ALA 103 
39 1 Y 1 C ASP 500 ? C ASP 104 
40 1 Y 1 C ILE 501 ? C ILE 105 
41 1 Y 1 C THR 502 ? C THR 106 
42 1 Y 1 C LEU 503 ? C LEU 107 
43 1 Y 1 C ARG 504 ? C ARG 108 
44 1 Y 1 C SER 505 ? C SER 109 
45 1 Y 1 C TYR 506 ? C TYR 110 
46 1 Y 1 C VAL 507 ? C VAL 111 
47 1 Y 1 C ARG 508 ? C ARG 112 
48 1 Y 1 C ALA 509 ? C ALA 113 
49 1 Y 1 C GLN 510 ? C GLN 114 
50 1 Y 1 D GLY 397 ? D GLY 1   
51 1 Y 1 D SER 398 ? D SER 2   
52 1 Y 1 D HIS 399 ? D HIS 3   
53 1 Y 1 D MET 400 ? D MET 4   
54 1 Y 1 D GLU 401 ? D GLU 5   
55 1 Y 1 D GLY 465 ? D GLY 69  
56 1 Y 1 D HIS 466 ? D HIS 70  
57 1 Y 1 D HIS 487 ? D HIS 91  
58 1 Y 1 D THR 488 ? D THR 92  
59 1 Y 1 D HIS 489 ? D HIS 93  
60 1 Y 1 D PRO 490 ? D PRO 94  
61 1 Y 1 D ILE 491 ? D ILE 95  
62 1 Y 1 D PRO 492 ? D PRO 96  
63 1 Y 1 D LEU 493 ? D LEU 97  
64 1 Y 1 D GLU 494 ? D GLU 98  
65 1 Y 1 D SER 495 ? D SER 99  
66 1 Y 1 D GLY 496 ? D GLY 100 
67 1 Y 1 D GLY 497 ? D GLY 101 
68 1 Y 1 D SER 498 ? D SER 102 
69 1 Y 1 D ALA 499 ? D ALA 103 
70 1 Y 1 D ASP 500 ? D ASP 104 
71 1 Y 1 D ILE 501 ? D ILE 105 
72 1 Y 1 D THR 502 ? D THR 106 
73 1 Y 1 D LEU 503 ? D LEU 107 
74 1 Y 1 D ARG 504 ? D ARG 108 
75 1 Y 1 D SER 505 ? D SER 109 
76 1 Y 1 D TYR 506 ? D TYR 110 
77 1 Y 1 D VAL 507 ? D VAL 111 
78 1 Y 1 D ARG 508 ? D ARG 112 
79 1 Y 1 D ALA 509 ? D ALA 113 
80 1 Y 1 D GLN 510 ? D GLN 114 
81 1 Y 1 E LYS 99  ? E LYS 1   
82 1 Y 1 E LYS 100 ? E LYS 2   
83 1 Y 1 E LYS 101 ? E LYS 3   
84 1 Y 1 E ASP 116 ? E ASP 18  
85 1 Y 1 F LYS 99  ? F LYS 1   
86 1 Y 1 F LYS 100 ? F LYS 2   
87 1 Y 1 F LYS 101 ? F LYS 3   
88 1 Y 1 F GLY 115 ? F GLY 17  
89 1 Y 1 F ASP 116 ? F ASP 18  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                                                     MN  
5 'THIOPHOSPHORIC ACID O-((ADENOSYL-PHOSPHO)PHOSPHO)-S-ACETAMIDYL-DIESTER' 112 
6 water                                                                    HOH 
#