data_1RT7
# 
_entry.id   1RT7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RT7         
WWPDB D_1000176212 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RT7 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-29 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ren, J.'        1 
'Stammers, D.K.' 2 
'Stuart, D.I.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.' Biochemistry               
37  14394 14403 1998 BICHAW US 0006-2960 0033 ? 9772165 10.1021/bi981309m 
1       'Continuous and Discontinuous Changes in the Unit Cell of HIV-1 Reverse Transcriptase Crystals on Dehydration' 
'Acta Crystallogr.,Sect.D' 54  938   ?     1998 ABCRE6 DK 0907-4449 0766 ? ?       ?                 
2       
;3'-Azido-3'-Deoxythymidine Drug Resistance Mutations in HIV-1 Reverse Transcriptase Can Induce Long Range Conformational Changes
;
Proc.Natl.Acad.Sci.USA     95  9518  ?     1998 PNASA6 US 0027-8424 0040 ? ?       ?                 
3       
;Unique Features in the Structure of the Complex between HIV-1 Reverse Transcriptase and the Bis(Heteroaryl)Piperazine (Bhap) U-90152 Explain Resistance Mutations for This Nonnucleoside Inhibitor
;
Proc.Natl.Acad.Sci.USA     94  3984  ?     1997 PNASA6 US 0027-8424 0040 ? ?       ?                 
4       
;Complexes of HIV-1 Reverse Transcriptase with Inhibitors of the HEPT Series Reveal Conformational Changes Relevant to the Design of Potent Non-Nucleoside Inhibitors
;
J.Med.Chem.                39  1589  ?     1996 JMCMAR US 0022-2623 0151 ? ?       ?                 
5       'The Structure of HIV-1 Reverse Transcriptase Complexed with 9-Chloro-TIBO: Lessons for Inhibitor Design' Structure 3   
915   ?     1995 STRUE6 UK 0969-2126 2005 ? ?       ?                 
6       'High Resolution Structures of HIV-1 RT from Four RT-Inhibitor Complexes' Nat.Struct.Biol.           2   293   ?     1995 
NSBIEW US 1072-8368 2024 ? ?       ?                 
7       'Mechanism of Inhibition of HIV-1 Reverse Transcriptase by Non-Nucleoside Inhibitors' Nat.Struct.Biol.           2   303   
?     1995 NSBIEW US 1072-8368 2024 ? ?       ?                 
8       'Crystals of HIV-1 Reverse Transcriptase Diffracting to 2.2 A Resolution' J.Mol.Biol.                242 586   ?     1994 
JMOBAK UK 0022-2836 0070 ? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ren, J.'        1  
primary 'Esnouf, R.M.'   2  
primary 'Hopkins, A.L.'  3  
primary 'Warren, J.'     4  
primary 'Balzarini, J.'  5  
primary 'Stuart, D.I.'   6  
primary 'Stammers, D.K.' 7  
1       'Esnouf, R.M.'   8  
1       'Ren, J.'        9  
1       'Garman, E.F.'   10 
1       'Somers, D.O.'   11 
1       'Ross, C.K.'     12 
1       'Jones, E.Y.'    13 
1       'Stammers, D.K.' 14 
1       'Stuart, D.I.'   15 
2       'Ren, J.'        16 
2       'Esnouf, R.M.'   17 
2       'Hopkins, A.L.'  18 
2       'Jones, E.Y.'    19 
2       'Kirby, I.'      20 
2       'Keeling, J.'    21 
2       'Ross, C.K.'     22 
2       'Larder, B.A.'   23 
2       'Stuart, D.I.'   24 
2       'Stammers, D.K.' 25 
3       'Esnouf, R.M.'   26 
3       'Ren, J.'        27 
3       'Hopkins, A.L.'  28 
3       'Ross, C.K.'     29 
3       'Jones, E.Y.'    30 
3       'Stammers, D.K.' 31 
3       'Stuart, D.I.'   32 
4       'Hopkins, A.L.'  33 
4       'Ren, J.'        34 
4       'Esnouf, R.M.'   35 
4       'Willcox, B.E.'  36 
4       'Jones, E.Y.'    37 
4       'Ross, C.'       38 
4       'Miyasaka, T.'   39 
4       'Walker, R.T.'   40 
4       'Tanaka, H.'     41 
4       'Stammers, D.K.' 42 
4       'Stuart, D.I.'   43 
5       'Ren, J.'        44 
5       'Esnouf, R.'     45 
5       'Hopkins, A.'    46 
5       'Ross, C.'       47 
5       'Jones, Y.'      48 
5       'Stammers, D.'   49 
5       'Stuart, D.'     50 
6       'Ren, J.'        51 
6       'Esnouf, R.'     52 
6       'Garman, E.'     53 
6       'Somers, D.'     54 
6       'Ross, C.'       55 
6       'Kirby, I.'      56 
6       'Keeling, J.'    57 
6       'Darby, G.'      58 
6       'Jones, Y.'      59 
6       'Stuart, D.'     60 
6       'Stammers, D.'   61 
7       'Esnouf, R.'     62 
7       'Ren, J.'        63 
7       'Ross, C.'       64 
7       'Jones, Y.'      65 
7       'Stammers, D.'   66 
7       'Stuart, D.'     67 
8       'Stammers, D.K.' 68 
8       'Somers, D.O.'   69 
8       'Ross, C.K.'     70 
8       'Kirby, I.'      71 
8       'Ray, P.H.'      72 
8       'Wilson, J.E.'   73 
8       'Norman, M.'     74 
8       'Ren, J.S.'      75 
8       'Esnouf, R.M.'   76 
8       'Garman, E.F.'   77 
8       'Jones, E.Y.'    78 
8       'Stuart, D.I.'   79 
# 
_cell.entry_id           1RT7 
_cell.length_a           137.600 
_cell.length_b           109.500 
_cell.length_c           72.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RT7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 REVERSE TRANSCRIPTASE'                                                                64594.949 1 
2.7.7.49 ? ? ? 
2 polymer     man 'HIV-1 REVERSE TRANSCRIPTASE'                                                                51399.047 1 
2.7.7.49 ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                                                              94.971    1 ? ? ? ? 
4 non-polymer syn '1-METHYL ETHYL 1-CHLORO-5-[[(5,6DIHYDRO-2-METHYL-1,4-OXATHIIN-3-YL)CARBONYL]AMINO]BENZOATE' 355.836   1 ? ? ? ? 
5 water       nat water                                                                                        18.015    5 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQL(CSD)KLLRGTKALTEVIPLTEEAELELAENREILKEPVHG
VYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKE
TWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQK
TELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
RKVL
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)' no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 ARG n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 TYR n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 CSD n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 ARG n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 THR n 
1 469 LEU n 
1 470 THR n 
1 471 ASP n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 GLN n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
1 559 VAL n 
1 560 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 CYS n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Lentivirus POL 'Human immunodeficiency virus 1' 'HXB2 ISOLATE' ? ? ? ? 'HIV-1 M:B_HXB2R' 11706 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? Lentivirus POL 'Human immunodeficiency virus 1' 'HXB2 ISOLATE' ? ? ? ? 'HIV-1 M:B_HXB2R' 11706 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP POL_HV1H2 P04585 1 587 ? ? 
2 UNP POL_HV1H2 P04585 2 587 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RT7 A 1 ? 560 ? P04585 587 ? 1146 ? 1 560 
2 2 1RT7 B 1 ? 440 ? P04585 587 ? 1026 ? 1 440 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1RT7 
_struct_ref_seq_dif.mon_id                       CSD 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      280 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P04585 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          435 
_struct_ref_seq_dif.details                      'MODIFIED RESIDUE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            280 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                      ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'        133.103 
CSD 'L-peptide linking' n 3-SULFINOALANINE                                                                             
'S-CYSTEINESULFINIC ACID; S-SULFINOCYSTEINE' 'C3 H7 N O4 S'      153.157 
CYS 'L-peptide linking' y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                      ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                        ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                      ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                                                              ? 'O4 P -3' 
94.971  
PRO 'L-peptide linking' y PROLINE                                                                                      ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                       ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                    ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                     ? 
'C9 H11 N O3'       181.189 
UC4 non-polymer         . '1-METHYL ETHYL 1-CHLORO-5-[[(5,6DIHYDRO-2-METHYL-1,4-OXATHIIN-3-YL)CARBONYL]AMINO]BENZOATE' UC84 
'C16 H18 Cl N O4 S' 355.836 
VAL 'L-peptide linking' y VALINE                                                                                       ? 
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1RT7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.description           'ALL DATA INCLUDED APART FROM OUTLIERS' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    0.2MM 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             0.87 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RT7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   19595 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.3 
_reflns.pdbx_Rmerge_I_obs            0.1030000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.74 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   71.3 
_reflns_shell.Rmerge_I_obs           0.4510000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.73 
_reflns_shell.pdbx_redundancy        1.96 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RT7 
_refine.ls_number_reflns_obs                     19595 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    87.3 
_refine.ls_R_factor_obs                          0.2580000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2580000 
_refine.ls_R_factor_R_free                       0.3350000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  827 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               54 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;DUE TO THE LOW RATIO BETWEEN THE NUMBER OF REFLECTIONS AND THE NUMBER OF PARAMETERS TO BE REFINED, ATOMS DISTANT FROM THE NNI-BINDING SITE (DEFINED AS ATOMS MORE THAN 25 ANGSTROM FROM THE CA ATOM OF TYR188) WERE TIGHTLY RESTRAINED TO THEIR POSITION IN THE NINE-DOMAIN RIGID-BODY REFINED MODEL OF RT-MKC-442 COMPLEX, AND STRONG STEREOCHEMICAL RESTRAINTS WERE EMPLOYED IN THE REFINEMENT. THE ABOVE THERMAL FACTOR AND RMS DEVIATIONS OF THE STEREOCHEMISTRY ARE TAKEN FROM THE FINAL MODEL WHICH WAS REFINED USING THE WHOLE DATA SET. THE FINAL R FACTOR FOR THE WHOLE DATA SET IS 0.252.
;
_refine.pdbx_starting_model                      'RT-MKC-442 COMPLEX (PDB ENTRY 1RT1)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7821 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             11 
_refine_hist.number_atoms_total               7855 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.9  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             4.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            8.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             6.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            12.0  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.0 
_refine_ls_shell.d_res_low                        3.14 
_refine_ls_shell.number_reflns_R_work             1897 
_refine_ls_shell.R_factor_R_work                  0.3290000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4130000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 UC84.PAR     UC84.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RT7 
_struct.title                     'HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC84' 
_struct.pdbx_descriptor           
'HIV-1 REVERSE TRANSCRIPTASE, 1-METHYL ETHYL 1-CHLORO-5-[[(5,6DIHYDRO-2-METHYL-1,4-OXATHIIN-3-YL)CARBONYL]AMINO]BENZOATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RT7 
_struct_keywords.pdbx_keywords   NUCLEOTIDYLTRANSFERASE 
_struct_keywords.text            'NUCLEOTIDYLTRANSFERASE, HIV-1 REVERSE TRANSCRIPTASE, AIDS, NUCLEOSIDE INHIBITION, DRUG DESIGN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 28  ? GLU A 44  ? GLU A 28  GLU A 44  1 ? 17 
HELX_P HELX_P2  2  ARG A 78  ? ARG A 83  ? ARG A 78  ARG A 83  1 ? 6  
HELX_P HELX_P3  3  PRO A 97  ? GLY A 99  ? PRO A 97  GLY A 99  5 ? 3  
HELX_P HELX_P4  4  GLY A 112 ? SER A 117 ? GLY A 112 SER A 117 5 ? 6  
HELX_P HELX_P5  5  PHE A 124 ? THR A 128 ? PHE A 124 THR A 128 5 ? 5  
HELX_P HELX_P6  6  SER A 156 ? GLN A 174 ? SER A 156 GLN A 174 1 ? 19 
HELX_P HELX_P7  7  ILE A 195 ? TRP A 212 ? ILE A 195 TRP A 212 1 ? 18 
HELX_P HELX_P8  8  VAL A 254 ? ILE A 270 ? VAL A 254 ILE A 270 1 ? 17 
HELX_P HELX_P9  9  ARG A 277 ? LYS A 281 ? ARG A 277 LYS A 281 5 ? 5  
HELX_P HELX_P10 10 GLU A 297 ? LYS A 311 ? GLU A 297 LYS A 311 1 ? 15 
HELX_P HELX_P11 11 ASP A 364 ? ILE A 382 ? ASP A 364 ILE A 382 1 ? 19 
HELX_P HELX_P12 12 LYS A 395 ? GLU A 404 ? LYS A 395 GLU A 404 1 ? 10 
HELX_P HELX_P13 13 ASN A 474 ? ASP A 488 ? ASN A 474 ASP A 488 1 ? 15 
HELX_P HELX_P14 14 GLN A 500 ? ALA A 508 ? GLN A 500 ALA A 508 1 ? 9  
HELX_P HELX_P15 15 GLU A 516 ? LYS A 527 ? GLU A 516 LYS A 527 1 ? 12 
HELX_P HELX_P16 16 GLU B 28  ? LYS B 43  ? GLU B 28  LYS B 43  1 ? 16 
HELX_P HELX_P17 17 ARG B 78  ? ARG B 83  ? ARG B 78  ARG B 83  1 ? 6  
HELX_P HELX_P18 18 ALA B 98  ? LYS B 102 ? ALA B 98  LYS B 102 5 ? 5  
HELX_P HELX_P19 19 GLY B 112 ? SER B 117 ? GLY B 112 SER B 117 5 ? 6  
HELX_P HELX_P20 20 ARG B 125 ? THR B 128 ? ARG B 125 THR B 128 5 ? 4  
HELX_P HELX_P21 21 ILE B 135 ? ASN B 137 ? ILE B 135 ASN B 137 5 ? 3  
HELX_P HELX_P22 22 LYS B 154 ? GLN B 174 ? LYS B 154 GLN B 174 1 ? 21 
HELX_P HELX_P23 23 ILE B 195 ? LEU B 210 ? ILE B 195 LEU B 210 1 ? 16 
HELX_P HELX_P24 24 PRO B 236 ? LYS B 238 ? PRO B 236 LYS B 238 5 ? 3  
HELX_P HELX_P25 25 VAL B 254 ? GLN B 269 ? VAL B 254 GLN B 269 1 ? 16 
HELX_P HELX_P26 26 ARG B 277 ? LEU B 282 ? ARG B 277 LEU B 282 1 ? 6  
HELX_P HELX_P27 27 GLU B 297 ? LEU B 310 ? GLU B 297 LEU B 310 1 ? 14 
HELX_P HELX_P28 28 ASP B 364 ? TRP B 383 ? ASP B 364 TRP B 383 1 ? 20 
HELX_P HELX_P29 29 LYS B 395 ? TRP B 401 ? LYS B 395 TRP B 401 1 ? 7  
HELX_P HELX_P30 30 THR B 403 ? TYR B 405 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P31 31 PRO B 421 ? LEU B 429 ? PRO B 421 LEU B 429 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A CSD 280 N ? ? ? 1_555 A LEU 279 C ? ? A CSD 280 A LEU 279 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale ? ? A CSD 280 C ? ? ? 1_555 A LYS 281 N ? ? A CSD 280 A LYS 281 1_555 ? ? ? ? ? ? ? 1.326 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 13  A . ? LYS 13  A PRO 14  A ? PRO 14  A 1 1.73  
2 PRO 225 A . ? PRO 225 A PRO 226 A ? PRO 226 A 1 -0.12 
3 PRO 420 A . ? PRO 420 A PRO 421 A ? PRO 421 A 1 0.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 5 ? 
F ? 3 ? 
G ? 2 ? 
H ? 3 ? 
I ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 47  ? LYS A 49  ? ILE A 47  LYS A 49  
A 2 ILE A 142 ? TYR A 146 ? ILE A 142 TYR A 146 
A 3 PHE A 130 ? ILE A 132 ? PHE A 130 ILE A 132 
B 1 SER A 105 ? ASP A 110 ? SER A 105 ASP A 110 
B 2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
B 3 ILE A 178 ? TYR A 183 ? ILE A 178 TYR A 183 
C 1 TYR A 232 ? HIS A 235 ? TYR A 232 HIS A 235 
C 2 LYS A 238 ? VAL A 241 ? LYS A 238 VAL A 241 
D 1 TRP A 414 ? PHE A 416 ? TRP A 414 PHE A 416 
D 2 LYS A 388 ? LEU A 391 ? LYS A 388 LEU A 391 
D 3 ILE A 326 ? LYS A 331 ? ILE A 326 LYS A 331 
D 4 TRP A 337 ? TYR A 342 ? TRP A 337 TYR A 342 
D 5 ASN A 348 ? TYR A 354 ? ASN A 348 TYR A 354 
E 1 GLN A 464 ? THR A 470 ? GLN A 464 THR A 470 
E 2 LEU A 452 ? THR A 459 ? LEU A 452 THR A 459 
E 3 GLU A 438 ? ASN A 447 ? GLU A 438 ASN A 447 
E 4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
E 5 LYS A 530 ? TRP A 535 ? LYS A 530 TRP A 535 
F 1 ILE B 47  ? LYS B 49  ? ILE B 47  LYS B 49  
F 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
F 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
G 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
G 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
H 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
H 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
H 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
I 1 GLU B 413 ? PHE B 416 ? GLU B 413 PHE B 416 
I 2 LYS B 388 ? LEU B 391 ? LYS B 388 LEU B 391 
I 3 ILE B 326 ? GLY B 333 ? ILE B 326 GLY B 333 
I 4 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
I 5 ASN B 348 ? ALA B 355 ? ASN B 348 ALA B 355 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 48  ? O SER A 48  N GLN A 145 ? N GLN A 145 
A 2 3 O ILE A 142 ? O ILE A 142 N ILE A 132 ? N ILE A 132 
B 1 2 O SER A 105 ? O SER A 105 N SER A 191 ? N SER A 191 
B 2 3 O ASP A 186 ? O ASP A 186 N TYR A 183 ? N TYR A 183 
C 1 2 O GLU A 233 ? O GLU A 233 N THR A 240 ? N THR A 240 
D 1 2 O GLU A 415 ? O GLU A 415 N PHE A 389 ? N PHE A 389 
D 2 3 O LYS A 388 ? O LYS A 388 N ALA A 327 ? N ALA A 327 
D 3 4 O ILE A 326 ? O ILE A 326 N TYR A 342 ? N TYR A 342 
D 4 5 O TRP A 337 ? O TRP A 337 N TYR A 354 ? N TYR A 354 
E 1 2 O LYS A 465 ? O LYS A 465 N TYR A 457 ? N TYR A 457 
E 2 3 O LEU A 452 ? O LEU A 452 N ASN A 447 ? N ASN A 447 
E 3 4 O GLU A 438 ? O GLU A 438 N ASN A 494 ? N ASN A 494 
E 4 5 O VAL A 493 ? O VAL A 493 N LYS A 530 ? N LYS A 530 
F 1 2 O SER B 48  ? O SER B 48  N GLN B 145 ? N GLN B 145 
F 2 3 O ILE B 142 ? O ILE B 142 N ILE B 132 ? N ILE B 132 
G 1 2 O PHE B 61  ? O PHE B 61  N LEU B 74  ? N LEU B 74  
H 1 2 O SER B 105 ? O SER B 105 N SER B 191 ? N SER B 191 
H 2 3 O ASP B 186 ? O ASP B 186 N TYR B 183 ? N TYR B 183 
I 1 2 O GLU B 413 ? O GLU B 413 N PHE B 389 ? N PHE B 389 
I 2 3 O LYS B 388 ? O LYS B 388 N ALA B 327 ? N ALA B 327 
I 3 4 O ILE B 326 ? O ILE B 326 N TYR B 342 ? N TYR B 342 
I 4 5 O TRP B 337 ? O TRP B 337 N TYR B 354 ? N TYR B 354 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PO4 A 1000' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE UC4 A 999'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ILE A 94  ? ILE A 94  . ? 1_555 ? 
2  AC1 6  PRO A 95  ? PRO A 95  . ? 1_555 ? 
3  AC1 6  HIS A 96  ? HIS A 96  . ? 1_555 ? 
4  AC1 6  PRO A 97  ? PRO A 97  . ? 1_555 ? 
5  AC1 6  TRP A 229 ? TRP A 229 . ? 1_555 ? 
6  AC1 6  MET A 230 ? MET A 230 . ? 1_555 ? 
7  AC2 11 LEU A 100 ? LEU A 100 . ? 1_555 ? 
8  AC2 11 LYS A 101 ? LYS A 101 . ? 1_555 ? 
9  AC2 11 LYS A 103 ? LYS A 103 . ? 1_555 ? 
10 AC2 11 VAL A 106 ? VAL A 106 . ? 1_555 ? 
11 AC2 11 VAL A 179 ? VAL A 179 . ? 1_555 ? 
12 AC2 11 TYR A 181 ? TYR A 181 . ? 1_555 ? 
13 AC2 11 TYR A 188 ? TYR A 188 . ? 1_555 ? 
14 AC2 11 GLY A 190 ? GLY A 190 . ? 1_555 ? 
15 AC2 11 PHE A 227 ? PHE A 227 . ? 1_555 ? 
16 AC2 11 LEU A 234 ? LEU A 234 . ? 1_555 ? 
17 AC2 11 TYR A 318 ? TYR A 318 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RT7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RT7 
_atom_sites.fract_transf_matrix[1][1]   0.007267 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009132 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013889 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 4   ? 10.175  -53.211 43.556  1.00 78.61  ? 4    PRO A N   1 
ATOM   2    C  CA  . PRO A 1 4   ? 11.265  -54.133 43.170  1.00 82.04  ? 4    PRO A CA  1 
ATOM   3    C  C   . PRO A 1 4   ? 11.976  -53.523 41.966  1.00 84.81  ? 4    PRO A C   1 
ATOM   4    O  O   . PRO A 1 4   ? 12.142  -54.174 40.932  1.00 86.06  ? 4    PRO A O   1 
ATOM   5    C  CB  . PRO A 1 4   ? 10.587  -55.424 42.754  1.00 77.89  ? 4    PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 4   ? 9.334   -54.868 42.080  1.00 74.86  ? 4    PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 4   ? 8.885   -53.698 42.986  1.00 77.61  ? 4    PRO A CD  1 
ATOM   8    N  N   . ILE A 1 5   ? 12.382  -52.265 42.104  1.00 83.89  ? 5    ILE A N   1 
ATOM   9    C  CA  . ILE A 1 5   ? 13.051  -51.553 41.017  1.00 78.19  ? 5    ILE A CA  1 
ATOM   10   C  C   . ILE A 1 5   ? 14.499  -51.227 41.402  1.00 74.65  ? 5    ILE A C   1 
ATOM   11   O  O   . ILE A 1 5   ? 14.779  -50.889 42.559  1.00 68.46  ? 5    ILE A O   1 
ATOM   12   C  CB  . ILE A 1 5   ? 12.247  -50.285 40.645  1.00 70.53  ? 5    ILE A CB  1 
ATOM   13   C  CG1 . ILE A 1 5   ? 10.770  -50.673 40.461  1.00 62.85  ? 5    ILE A CG1 1 
ATOM   14   C  CG2 . ILE A 1 5   ? 12.778  -49.684 39.342  1.00 59.20  ? 5    ILE A CG2 1 
ATOM   15   C  CD1 . ILE A 1 5   ? 9.772   -49.598 40.787  1.00 49.78  ? 5    ILE A CD1 1 
ATOM   16   N  N   . GLU A 1 6   ? 15.412  -51.363 40.440  1.00 71.19  ? 6    GLU A N   1 
ATOM   17   C  CA  . GLU A 1 6   ? 16.831  -51.127 40.691  1.00 67.11  ? 6    GLU A CA  1 
ATOM   18   C  C   . GLU A 1 6   ? 17.213  -49.697 41.062  1.00 58.40  ? 6    GLU A C   1 
ATOM   19   O  O   . GLU A 1 6   ? 17.060  -48.775 40.252  1.00 53.48  ? 6    GLU A O   1 
ATOM   20   C  CB  . GLU A 1 6   ? 17.686  -51.616 39.514  1.00 70.00  ? 6    GLU A CB  1 
ATOM   21   C  CG  . GLU A 1 6   ? 19.194  -51.515 39.770  1.00 79.36  ? 6    GLU A CG  1 
ATOM   22   C  CD  . GLU A 1 6   ? 19.672  -52.338 40.973  1.00 85.38  ? 6    GLU A CD  1 
ATOM   23   O  OE1 . GLU A 1 6   ? 19.398  -51.965 42.141  1.00 79.41  ? 6    GLU A OE1 1 
ATOM   24   O  OE2 . GLU A 1 6   ? 20.351  -53.356 40.742  1.00 89.35  ? 6    GLU A OE2 1 
ATOM   25   N  N   . THR A 1 7   ? 17.728  -49.540 42.286  1.00 52.41  ? 7    THR A N   1 
ATOM   26   C  CA  . THR A 1 7   ? 18.164  -48.244 42.811  1.00 43.43  ? 7    THR A CA  1 
ATOM   27   C  C   . THR A 1 7   ? 19.247  -47.644 41.928  1.00 43.03  ? 7    THR A C   1 
ATOM   28   O  O   . THR A 1 7   ? 19.942  -48.361 41.208  1.00 43.78  ? 7    THR A O   1 
ATOM   29   C  CB  . THR A 1 7   ? 18.725  -48.331 44.289  1.00 29.78  ? 7    THR A CB  1 
ATOM   30   O  OG1 . THR A 1 7   ? 19.530  -49.510 44.472  1.00 10.66  ? 7    THR A OG1 1 
ATOM   31   C  CG2 . THR A 1 7   ? 17.605  -48.308 45.297  1.00 13.20  ? 7    THR A CG2 1 
ATOM   32   N  N   . VAL A 1 8   ? 19.365  -46.322 41.971  1.00 41.74  ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? 20.372  -45.609 41.201  1.00 40.92  ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? 21.478  -45.236 42.192  1.00 44.11  ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? 21.194  -44.958 43.361  1.00 43.42  ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? 19.753  -44.357 40.519  1.00 36.01  ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? 20.826  -43.369 40.106  1.00 39.90  ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? 18.949  -44.780 39.300  1.00 22.05  ? 8    VAL A CG2 1 
ATOM   39   N  N   . PRO A 1 9   ? 22.753  -45.319 41.764  1.00 46.46  ? 9    PRO A N   1 
ATOM   40   C  CA  . PRO A 1 9   ? 23.921  -44.994 42.602  1.00 52.75  ? 9    PRO A CA  1 
ATOM   41   C  C   . PRO A 1 9   ? 24.080  -43.490 42.859  1.00 59.64  ? 9    PRO A C   1 
ATOM   42   O  O   . PRO A 1 9   ? 24.452  -42.736 41.957  1.00 58.54  ? 9    PRO A O   1 
ATOM   43   C  CB  . PRO A 1 9   ? 25.080  -45.538 41.775  1.00 52.35  ? 9    PRO A CB  1 
ATOM   44   C  CG  . PRO A 1 9   ? 24.591  -45.327 40.354  1.00 42.50  ? 9    PRO A CG  1 
ATOM   45   C  CD  . PRO A 1 9   ? 23.171  -45.792 40.429  1.00 30.49  ? 9    PRO A CD  1 
ATOM   46   N  N   . VAL A 1 10  ? 23.802  -43.061 44.088  1.00 65.73  ? 10   VAL A N   1 
ATOM   47   C  CA  . VAL A 1 10  ? 23.896  -41.645 44.450  1.00 77.66  ? 10   VAL A CA  1 
ATOM   48   C  C   . VAL A 1 10  ? 25.075  -41.367 45.378  1.00 80.88  ? 10   VAL A C   1 
ATOM   49   O  O   . VAL A 1 10  ? 25.317  -42.132 46.321  1.00 82.12  ? 10   VAL A O   1 
ATOM   50   C  CB  . VAL A 1 10  ? 22.591  -41.152 45.123  1.00 85.82  ? 10   VAL A CB  1 
ATOM   51   C  CG1 . VAL A 1 10  ? 22.636  -39.639 45.346  1.00 90.38  ? 10   VAL A CG1 1 
ATOM   52   C  CG2 . VAL A 1 10  ? 21.386  -41.528 44.272  1.00 90.15  ? 10   VAL A CG2 1 
ATOM   53   N  N   . LYS A 1 11  ? 25.776  -40.256 45.132  1.00 83.44  ? 11   LYS A N   1 
ATOM   54   C  CA  . LYS A 1 11  ? 26.950  -39.872 45.925  1.00 81.70  ? 11   LYS A CA  1 
ATOM   55   C  C   . LYS A 1 11  ? 26.936  -38.404 46.352  1.00 73.56  ? 11   LYS A C   1 
ATOM   56   O  O   . LYS A 1 11  ? 26.218  -37.583 45.784  1.00 68.16  ? 11   LYS A O   1 
ATOM   57   C  CB  . LYS A 1 11  ? 28.232  -40.121 45.128  1.00 88.10  ? 11   LYS A CB  1 
ATOM   58   C  CG  . LYS A 1 11  ? 28.319  -41.496 44.488  1.00 92.78  ? 11   LYS A CG  1 
ATOM   59   C  CD  . LYS A 1 11  ? 29.758  -41.871 44.182  1.00 96.49  ? 11   LYS A CD  1 
ATOM   60   C  CE  . LYS A 1 11  ? 30.571  -42.028 45.464  1.00 97.84  ? 11   LYS A CE  1 
ATOM   61   N  NZ  . LYS A 1 11  ? 30.008  -43.081 46.359  1.00 94.98  ? 11   LYS A NZ  1 
ATOM   62   N  N   . LEU A 1 12  ? 27.764  -38.088 47.342  1.00 69.52  ? 12   LEU A N   1 
ATOM   63   C  CA  . LEU A 1 12  ? 27.857  -36.729 47.821  1.00 71.01  ? 12   LEU A CA  1 
ATOM   64   C  C   . LEU A 1 12  ? 28.845  -35.891 47.019  1.00 73.81  ? 12   LEU A C   1 
ATOM   65   O  O   . LEU A 1 12  ? 30.025  -36.220 46.870  1.00 73.45  ? 12   LEU A O   1 
ATOM   66   C  CB  . LEU A 1 12  ? 28.117  -36.633 49.323  1.00 71.81  ? 12   LEU A CB  1 
ATOM   67   C  CG  . LEU A 1 12  ? 26.848  -36.789 50.171  1.00 68.84  ? 12   LEU A CG  1 
ATOM   68   C  CD1 . LEU A 1 12  ? 27.135  -36.405 51.611  1.00 69.38  ? 12   LEU A CD1 1 
ATOM   69   C  CD2 . LEU A 1 12  ? 25.724  -35.914 49.637  1.00 65.34  ? 12   LEU A CD2 1 
ATOM   70   N  N   . LYS A 1 13  ? 28.303  -34.791 46.524  1.00 78.74  ? 13   LYS A N   1 
ATOM   71   C  CA  . LYS A 1 13  ? 28.919  -33.769 45.698  1.00 82.88  ? 13   LYS A CA  1 
ATOM   72   C  C   . LYS A 1 13  ? 30.008  -33.958 44.631  1.00 84.87  ? 13   LYS A C   1 
ATOM   73   O  O   . LYS A 1 13  ? 29.639  -34.319 43.488  1.00 85.26  ? 13   LYS A O   1 
ATOM   74   C  CB  . LYS A 1 13  ? 29.051  -32.452 46.440  1.00 82.81  ? 13   LYS A CB  1 
ATOM   75   C  CG  . LYS A 1 13  ? 28.724  -31.246 45.537  1.00 85.45  ? 13   LYS A CG  1 
ATOM   76   C  CD  . LYS A 1 13  ? 27.266  -30.772 45.670  1.00 82.62  ? 13   LYS A CD  1 
ATOM   77   C  CE  . LYS A 1 13  ? 26.789  -30.000 44.434  1.00 83.13  ? 13   LYS A CE  1 
ATOM   78   N  NZ  . LYS A 1 13  ? 25.850  -28.848 44.708  1.00 86.61  ? 13   LYS A NZ  1 
ATOM   79   N  N   . PRO A 1 14  ? 31.339  -33.854 44.945  1.00 85.15  ? 14   PRO A N   1 
ATOM   80   C  CA  . PRO A 1 14  ? 32.425  -33.644 45.910  1.00 82.12  ? 14   PRO A CA  1 
ATOM   81   C  C   . PRO A 1 14  ? 32.351  -33.779 47.415  1.00 78.91  ? 14   PRO A C   1 
ATOM   82   O  O   . PRO A 1 14  ? 31.708  -32.995 48.104  1.00 73.10  ? 14   PRO A O   1 
ATOM   83   C  CB  . PRO A 1 14  ? 33.043  -32.300 45.492  1.00 82.24  ? 14   PRO A CB  1 
ATOM   84   C  CG  . PRO A 1 14  ? 32.681  -32.131 44.061  1.00 88.08  ? 14   PRO A CG  1 
ATOM   85   C  CD  . PRO A 1 14  ? 31.844  -33.343 43.650  1.00 90.53  ? 14   PRO A CD  1 
ATOM   86   N  N   . GLY A 1 15  ? 33.196  -34.704 47.871  1.00 79.46  ? 15   GLY A N   1 
ATOM   87   C  CA  . GLY A 1 15  ? 33.384  -35.048 49.271  1.00 78.40  ? 15   GLY A CA  1 
ATOM   88   C  C   . GLY A 1 15  ? 32.986  -34.085 50.359  1.00 81.44  ? 15   GLY A C   1 
ATOM   89   O  O   . GLY A 1 15  ? 33.824  -33.551 51.076  1.00 82.36  ? 15   GLY A O   1 
ATOM   90   N  N   . MET A 1 16  ? 31.686  -33.852 50.458  1.00 84.40  ? 16   MET A N   1 
ATOM   91   C  CA  . MET A 1 16  ? 31.134  -32.991 51.487  1.00 84.52  ? 16   MET A CA  1 
ATOM   92   C  C   . MET A 1 16  ? 30.647  -33.988 52.523  1.00 81.65  ? 16   MET A C   1 
ATOM   93   O  O   . MET A 1 16  ? 31.066  -35.154 52.535  1.00 79.48  ? 16   MET A O   1 
ATOM   94   C  CB  . MET A 1 16  ? 29.961  -32.185 50.941  1.00 89.14  ? 16   MET A CB  1 
ATOM   95   C  CG  . MET A 1 16  ? 30.328  -31.087 49.964  1.00 92.58  ? 16   MET A CG  1 
ATOM   96   S  SD  . MET A 1 16  ? 28.866  -30.382 49.160  1.00 98.53  ? 16   MET A SD  1 
ATOM   97   C  CE  . MET A 1 16  ? 28.435  -29.028 50.251  1.00 93.78  ? 16   MET A CE  1 
ATOM   98   N  N   . ASP A 1 17  ? 29.723  -33.567 53.363  1.00 80.49  ? 17   ASP A N   1 
ATOM   99   C  CA  . ASP A 1 17  ? 29.194  -34.461 54.358  1.00 77.32  ? 17   ASP A CA  1 
ATOM   100  C  C   . ASP A 1 17  ? 27.699  -34.275 54.367  1.00 75.03  ? 17   ASP A C   1 
ATOM   101  O  O   . ASP A 1 17  ? 27.204  -33.245 53.911  1.00 72.52  ? 17   ASP A O   1 
ATOM   102  C  CB  . ASP A 1 17  ? 29.787  -34.138 55.726  1.00 76.89  ? 17   ASP A CB  1 
ATOM   103  C  CG  . ASP A 1 17  ? 29.436  -35.171 56.757  1.00 75.66  ? 17   ASP A CG  1 
ATOM   104  O  OD1 . ASP A 1 17  ? 29.489  -36.375 56.422  1.00 70.34  ? 17   ASP A OD1 1 
ATOM   105  O  OD2 . ASP A 1 17  ? 29.104  -34.774 57.893  1.00 75.70  ? 17   ASP A OD2 1 
ATOM   106  N  N   . GLY A 1 18  ? 26.981  -35.286 54.836  1.00 74.05  ? 18   GLY A N   1 
ATOM   107  C  CA  . GLY A 1 18  ? 25.538  -35.178 54.890  1.00 77.11  ? 18   GLY A CA  1 
ATOM   108  C  C   . GLY A 1 18  ? 25.146  -34.082 55.859  1.00 77.00  ? 18   GLY A C   1 
ATOM   109  O  O   . GLY A 1 18  ? 25.904  -33.799 56.796  1.00 77.92  ? 18   GLY A O   1 
ATOM   110  N  N   . PRO A 1 19  ? 23.976  -33.446 55.669  1.00 76.31  ? 19   PRO A N   1 
ATOM   111  C  CA  . PRO A 1 19  ? 23.526  -32.373 56.562  1.00 75.29  ? 19   PRO A CA  1 
ATOM   112  C  C   . PRO A 1 19  ? 23.441  -32.807 58.025  1.00 71.31  ? 19   PRO A C   1 
ATOM   113  O  O   . PRO A 1 19  ? 23.203  -33.978 58.331  1.00 60.90  ? 19   PRO A O   1 
ATOM   114  C  CB  . PRO A 1 19  ? 22.158  -31.988 55.981  1.00 77.65  ? 19   PRO A CB  1 
ATOM   115  C  CG  . PRO A 1 19  ? 21.697  -33.251 55.305  1.00 77.11  ? 19   PRO A CG  1 
ATOM   116  C  CD  . PRO A 1 19  ? 22.960  -33.733 54.642  1.00 74.20  ? 19   PRO A CD  1 
ATOM   117  N  N   . LYS A 1 20  ? 23.681  -31.855 58.921  1.00 76.04  ? 20   LYS A N   1 
ATOM   118  C  CA  . LYS A 1 20  ? 23.645  -32.107 60.357  1.00 79.72  ? 20   LYS A CA  1 
ATOM   119  C  C   . LYS A 1 20  ? 22.914  -30.958 61.052  1.00 81.66  ? 20   LYS A C   1 
ATOM   120  O  O   . LYS A 1 20  ? 23.321  -30.502 62.122  1.00 82.75  ? 20   LYS A O   1 
ATOM   121  C  CB  . LYS A 1 20  ? 25.072  -32.240 60.895  1.00 79.55  ? 20   LYS A CB  1 
ATOM   122  C  CG  . LYS A 1 20  ? 25.884  -33.324 60.203  1.00 86.46  ? 20   LYS A CG  1 
ATOM   123  C  CD  . LYS A 1 20  ? 27.365  -33.183 60.493  1.00 94.12  ? 20   LYS A CD  1 
ATOM   124  C  CE  . LYS A 1 20  ? 27.884  -34.349 61.318  1.00 94.32  ? 20   LYS A CE  1 
ATOM   125  N  NZ  . LYS A 1 20  ? 27.787  -35.637 60.580  1.00 94.09  ? 20   LYS A NZ  1 
ATOM   126  N  N   . VAL A 1 21  ? 21.850  -30.475 60.413  1.00 82.04  ? 21   VAL A N   1 
ATOM   127  C  CA  . VAL A 1 21  ? 21.043  -29.382 60.952  1.00 79.37  ? 21   VAL A CA  1 
ATOM   128  C  C   . VAL A 1 21  ? 20.142  -29.889 62.084  1.00 82.30  ? 21   VAL A C   1 
ATOM   129  O  O   . VAL A 1 21  ? 19.565  -30.971 61.999  1.00 85.40  ? 21   VAL A O   1 
ATOM   130  C  CB  . VAL A 1 21  ? 20.224  -28.651 59.828  1.00 71.79  ? 21   VAL A CB  1 
ATOM   131  C  CG1 . VAL A 1 21  ? 19.619  -29.649 58.852  1.00 64.62  ? 21   VAL A CG1 1 
ATOM   132  C  CG2 . VAL A 1 21  ? 19.141  -27.755 60.435  1.00 62.55  ? 21   VAL A CG2 1 
ATOM   133  N  N   . LYS A 1 22  ? 20.064  -29.103 63.153  1.00 84.54  ? 22   LYS A N   1 
ATOM   134  C  CA  . LYS A 1 22  ? 19.277  -29.436 64.342  1.00 87.88  ? 22   LYS A CA  1 
ATOM   135  C  C   . LYS A 1 22  ? 17.768  -29.384 64.130  1.00 88.23  ? 22   LYS A C   1 
ATOM   136  O  O   . LYS A 1 22  ? 17.267  -28.616 63.302  1.00 86.17  ? 22   LYS A O   1 
ATOM   137  C  CB  . LYS A 1 22  ? 19.675  -28.540 65.533  1.00 91.14  ? 22   LYS A CB  1 
ATOM   138  C  CG  . LYS A 1 22  ? 20.256  -27.170 65.153  1.00 91.43  ? 22   LYS A CG  1 
ATOM   139  C  CD  . LYS A 1 22  ? 21.741  -27.265 64.768  1.00 82.97  ? 22   LYS A CD  1 
ATOM   140  C  CE  . LYS A 1 22  ? 22.233  -26.019 64.021  1.00 76.69  ? 22   LYS A CE  1 
ATOM   141  N  NZ  . LYS A 1 22  ? 22.136  -26.056 62.515  1.00 66.24  ? 22   LYS A NZ  1 
ATOM   142  N  N   . GLN A 1 23  ? 17.049  -30.199 64.896  1.00 89.59  ? 23   GLN A N   1 
ATOM   143  C  CA  . GLN A 1 23  ? 15.602  -30.255 64.791  1.00 90.20  ? 23   GLN A CA  1 
ATOM   144  C  C   . GLN A 1 23  ? 14.877  -29.118 65.501  1.00 93.54  ? 23   GLN A C   1 
ATOM   145  O  O   . GLN A 1 23  ? 14.990  -28.931 66.719  1.00 92.28  ? 23   GLN A O   1 
ATOM   146  C  CB  . GLN A 1 23  ? 15.062  -31.611 65.259  1.00 80.98  ? 23   GLN A CB  1 
ATOM   147  C  CG  . GLN A 1 23  ? 13.539  -31.737 65.174  1.00 72.05  ? 23   GLN A CG  1 
ATOM   148  C  CD  . GLN A 1 23  ? 12.970  -31.353 63.808  1.00 64.64  ? 23   GLN A CD  1 
ATOM   149  O  OE1 . GLN A 1 23  ? 13.441  -31.820 62.768  1.00 68.48  ? 23   GLN A OE1 1 
ATOM   150  N  NE2 . GLN A 1 23  ? 11.953  -30.498 63.810  1.00 48.44  ? 23   GLN A NE2 1 
ATOM   151  N  N   . TRP A 1 24  ? 14.136  -28.374 64.687  1.00 97.34  ? 24   TRP A N   1 
ATOM   152  C  CA  . TRP A 1 24  ? 13.315  -27.233 65.080  1.00 102.07 ? 24   TRP A CA  1 
ATOM   153  C  C   . TRP A 1 24  ? 12.368  -27.676 66.210  1.00 104.71 ? 24   TRP A C   1 
ATOM   154  O  O   . TRP A 1 24  ? 11.810  -28.778 66.162  1.00 110.40 ? 24   TRP A O   1 
ATOM   155  C  CB  . TRP A 1 24  ? 12.514  -26.818 63.836  1.00 105.52 ? 24   TRP A CB  1 
ATOM   156  C  CG  . TRP A 1 24  ? 11.902  -25.452 63.827  1.00 110.57 ? 24   TRP A CG  1 
ATOM   157  C  CD1 . TRP A 1 24  ? 10.695  -25.094 64.356  1.00 113.37 ? 24   TRP A CD1 1 
ATOM   158  C  CD2 . TRP A 1 24  ? 12.407  -24.284 63.155  1.00 111.42 ? 24   TRP A CD2 1 
ATOM   159  N  NE1 . TRP A 1 24  ? 10.411  -23.786 64.045  1.00 118.09 ? 24   TRP A NE1 1 
ATOM   160  C  CE2 . TRP A 1 24  ? 11.445  -23.263 63.311  1.00 115.64 ? 24   TRP A CE2 1 
ATOM   161  C  CE3 . TRP A 1 24  ? 13.578  -24.005 62.432  1.00 106.81 ? 24   TRP A CE3 1 
ATOM   162  C  CZ2 . TRP A 1 24  ? 11.614  -21.978 62.769  1.00 113.43 ? 24   TRP A CZ2 1 
ATOM   163  C  CZ3 . TRP A 1 24  ? 13.746  -22.725 61.892  1.00 107.27 ? 24   TRP A CZ3 1 
ATOM   164  C  CH2 . TRP A 1 24  ? 12.767  -21.731 62.066  1.00 109.02 ? 24   TRP A CH2 1 
ATOM   165  N  N   . PRO A 1 25  ? 12.207  -26.848 67.258  1.00 99.04  ? 25   PRO A N   1 
ATOM   166  C  CA  . PRO A 1 25  ? 11.318  -27.212 68.368  1.00 97.00  ? 25   PRO A CA  1 
ATOM   167  C  C   . PRO A 1 25  ? 9.827   -27.062 68.018  1.00 99.06  ? 25   PRO A C   1 
ATOM   168  O  O   . PRO A 1 25  ? 9.399   -26.010 67.533  1.00 101.18 ? 25   PRO A O   1 
ATOM   169  C  CB  . PRO A 1 25  ? 11.747  -26.238 69.457  1.00 92.22  ? 25   PRO A CB  1 
ATOM   170  C  CG  . PRO A 1 25  ? 12.104  -25.006 68.674  1.00 84.43  ? 25   PRO A CG  1 
ATOM   171  C  CD  . PRO A 1 25  ? 12.904  -25.576 67.533  1.00 92.18  ? 25   PRO A CD  1 
ATOM   172  N  N   . LEU A 1 26  ? 9.042   -28.110 68.270  1.00 96.03  ? 26   LEU A N   1 
ATOM   173  C  CA  . LEU A 1 26  ? 7.608   -28.089 67.972  1.00 90.21  ? 26   LEU A CA  1 
ATOM   174  C  C   . LEU A 1 26  ? 6.767   -28.361 69.215  1.00 90.25  ? 26   LEU A C   1 
ATOM   175  O  O   . LEU A 1 26  ? 7.309   -28.640 70.289  1.00 93.21  ? 26   LEU A O   1 
ATOM   176  C  CB  . LEU A 1 26  ? 7.266   -29.110 66.881  1.00 88.99  ? 26   LEU A CB  1 
ATOM   177  C  CG  . LEU A 1 26  ? 7.856   -28.938 65.474  1.00 83.66  ? 26   LEU A CG  1 
ATOM   178  C  CD1 . LEU A 1 26  ? 7.300   -30.020 64.555  1.00 78.73  ? 26   LEU A CD1 1 
ATOM   179  C  CD2 . LEU A 1 26  ? 7.533   -27.557 64.913  1.00 73.98  ? 26   LEU A CD2 1 
ATOM   180  N  N   . THR A 1 27  ? 5.444   -28.274 69.066  1.00 89.30  ? 27   THR A N   1 
ATOM   181  C  CA  . THR A 1 27  ? 4.514   -28.498 70.177  1.00 89.33  ? 27   THR A CA  1 
ATOM   182  C  C   . THR A 1 27  ? 3.999   -29.933 70.239  1.00 87.42  ? 27   THR A C   1 
ATOM   183  O  O   . THR A 1 27  ? 4.015   -30.645 69.234  1.00 81.51  ? 27   THR A O   1 
ATOM   184  C  CB  . THR A 1 27  ? 3.278   -27.569 70.086  1.00 85.87  ? 27   THR A CB  1 
ATOM   185  O  OG1 . THR A 1 27  ? 2.456   -27.963 68.980  1.00 84.75  ? 27   THR A OG1 1 
ATOM   186  C  CG2 . THR A 1 27  ? 3.703   -26.125 69.905  1.00 88.42  ? 27   THR A CG2 1 
ATOM   187  N  N   . GLU A 1 28  ? 3.465   -30.311 71.401  1.00 86.97  ? 28   GLU A N   1 
ATOM   188  C  CA  . GLU A 1 28  ? 2.907   -31.644 71.624  1.00 84.34  ? 28   GLU A CA  1 
ATOM   189  C  C   . GLU A 1 28  ? 1.924   -31.966 70.508  1.00 80.81  ? 28   GLU A C   1 
ATOM   190  O  O   . GLU A 1 28  ? 1.823   -33.109 70.076  1.00 77.82  ? 28   GLU A O   1 
ATOM   191  C  CB  . GLU A 1 28  ? 2.174   -31.697 72.968  1.00 89.97  ? 28   GLU A CB  1 
ATOM   192  C  CG  . GLU A 1 28  ? 0.951   -30.776 73.037  1.00 99.09  ? 28   GLU A CG  1 
ATOM   193  C  CD  . GLU A 1 28  ? 0.135   -30.937 74.310  1.00 100.49 ? 28   GLU A CD  1 
ATOM   194  O  OE1 . GLU A 1 28  ? -0.276  -32.076 74.625  1.00 103.95 ? 28   GLU A OE1 1 
ATOM   195  O  OE2 . GLU A 1 28  ? -0.113  -29.914 74.985  1.00 94.17  ? 28   GLU A OE2 1 
ATOM   196  N  N   . GLU A 1 29  ? 1.203   -30.940 70.057  1.00 83.85  ? 29   GLU A N   1 
ATOM   197  C  CA  . GLU A 1 29  ? 0.224   -31.073 68.982  1.00 87.98  ? 29   GLU A CA  1 
ATOM   198  C  C   . GLU A 1 29  ? 0.896   -31.444 67.658  1.00 90.51  ? 29   GLU A C   1 
ATOM   199  O  O   . GLU A 1 29  ? 0.648   -32.522 67.111  1.00 95.99  ? 29   GLU A O   1 
ATOM   200  C  CB  . GLU A 1 29  ? -0.570  -29.773 68.820  1.00 85.47  ? 29   GLU A CB  1 
ATOM   201  C  CG  . GLU A 1 29  ? -1.601  -29.811 67.694  1.00 88.84  ? 29   GLU A CG  1 
ATOM   202  C  CD  . GLU A 1 29  ? -2.468  -28.557 67.617  1.00 96.37  ? 29   GLU A CD  1 
ATOM   203  O  OE1 . GLU A 1 29  ? -2.281  -27.627 68.435  1.00 100.49 ? 29   GLU A OE1 1 
ATOM   204  O  OE2 . GLU A 1 29  ? -3.348  -28.506 66.732  1.00 94.90  ? 29   GLU A OE2 1 
ATOM   205  N  N   . LYS A 1 30  ? 1.749   -30.552 67.157  1.00 87.37  ? 30   LYS A N   1 
ATOM   206  C  CA  . LYS A 1 30  ? 2.474   -30.771 65.903  1.00 85.71  ? 30   LYS A CA  1 
ATOM   207  C  C   . LYS A 1 30  ? 3.264   -32.079 65.917  1.00 82.59  ? 30   LYS A C   1 
ATOM   208  O  O   . LYS A 1 30  ? 3.426   -32.737 64.882  1.00 78.12  ? 30   LYS A O   1 
ATOM   209  C  CB  . LYS A 1 30  ? 3.432   -29.611 65.642  1.00 94.45  ? 30   LYS A CB  1 
ATOM   210  C  CG  . LYS A 1 30  ? 2.768   -28.270 65.360  1.00 97.97  ? 30   LYS A CG  1 
ATOM   211  C  CD  . LYS A 1 30  ? 3.828   -27.194 65.214  1.00 96.90  ? 30   LYS A CD  1 
ATOM   212  C  CE  . LYS A 1 30  ? 3.245   -25.852 64.832  1.00 92.81  ? 30   LYS A CE  1 
ATOM   213  N  NZ  . LYS A 1 30  ? 4.323   -24.824 64.806  1.00 95.69  ? 30   LYS A NZ  1 
ATOM   214  N  N   . ILE A 1 31  ? 3.771   -32.428 67.095  1.00 81.54  ? 31   ILE A N   1 
ATOM   215  C  CA  . ILE A 1 31  ? 4.538   -33.651 67.295  1.00 78.26  ? 31   ILE A CA  1 
ATOM   216  C  C   . ILE A 1 31  ? 3.628   -34.860 67.133  1.00 72.83  ? 31   ILE A C   1 
ATOM   217  O  O   . ILE A 1 31  ? 3.897   -35.738 66.315  1.00 69.28  ? 31   ILE A O   1 
ATOM   218  C  CB  . ILE A 1 31  ? 5.169   -33.688 68.711  1.00 84.21  ? 31   ILE A CB  1 
ATOM   219  C  CG1 . ILE A 1 31  ? 6.250   -32.612 68.833  1.00 91.54  ? 31   ILE A CG1 1 
ATOM   220  C  CG2 . ILE A 1 31  ? 5.744   -35.074 69.012  1.00 87.70  ? 31   ILE A CG2 1 
ATOM   221  C  CD1 . ILE A 1 31  ? 6.783   -32.436 70.241  1.00 97.22  ? 31   ILE A CD1 1 
ATOM   222  N  N   . LYS A 1 32  ? 2.526   -34.867 67.878  1.00 70.78  ? 32   LYS A N   1 
ATOM   223  C  CA  . LYS A 1 32  ? 1.575   -35.968 67.847  1.00 70.57  ? 32   LYS A CA  1 
ATOM   224  C  C   . LYS A 1 32  ? 1.072   -36.286 66.452  1.00 71.16  ? 32   LYS A C   1 
ATOM   225  O  O   . LYS A 1 32  ? 0.782   -37.444 66.144  1.00 75.05  ? 32   LYS A O   1 
ATOM   226  C  CB  . LYS A 1 32  ? 0.415   -35.700 68.798  1.00 71.69  ? 32   LYS A CB  1 
ATOM   227  C  CG  . LYS A 1 32  ? 0.161   -36.849 69.766  1.00 84.09  ? 32   LYS A CG  1 
ATOM   228  C  CD  . LYS A 1 32  ? 1.459   -37.336 70.421  1.00 93.24  ? 32   LYS A CD  1 
ATOM   229  C  CE  . LYS A 1 32  ? 2.125   -36.258 71.274  1.00 93.86  ? 32   LYS A CE  1 
ATOM   230  N  NZ  . LYS A 1 32  ? 3.426   -36.724 71.834  1.00 93.78  ? 32   LYS A NZ  1 
ATOM   231  N  N   . ALA A 1 33  ? 0.987   -35.264 65.606  1.00 68.82  ? 33   ALA A N   1 
ATOM   232  C  CA  . ALA A 1 33  ? 0.549   -35.448 64.226  1.00 72.78  ? 33   ALA A CA  1 
ATOM   233  C  C   . ALA A 1 33  ? 1.652   -36.152 63.432  1.00 74.60  ? 33   ALA A C   1 
ATOM   234  O  O   . ALA A 1 33  ? 1.411   -37.163 62.764  1.00 77.31  ? 33   ALA A O   1 
ATOM   235  C  CB  . ALA A 1 33  ? 0.225   -34.110 63.596  1.00 69.28  ? 33   ALA A CB  1 
ATOM   236  N  N   . LEU A 1 34  ? 2.865   -35.619 63.518  1.00 71.76  ? 34   LEU A N   1 
ATOM   237  C  CA  . LEU A 1 34  ? 4.006   -36.200 62.819  1.00 67.30  ? 34   LEU A CA  1 
ATOM   238  C  C   . LEU A 1 34  ? 4.236   -37.634 63.281  1.00 62.05  ? 34   LEU A C   1 
ATOM   239  O  O   . LEU A 1 34  ? 4.576   -38.506 62.487  1.00 56.67  ? 34   LEU A O   1 
ATOM   240  C  CB  . LEU A 1 34  ? 5.251   -35.342 63.051  1.00 67.38  ? 34   LEU A CB  1 
ATOM   241  C  CG  . LEU A 1 34  ? 5.283   -34.084 62.183  1.00 59.81  ? 34   LEU A CG  1 
ATOM   242  C  CD1 . LEU A 1 34  ? 6.228   -33.034 62.735  1.00 59.90  ? 34   LEU A CD1 1 
ATOM   243  C  CD2 . LEU A 1 34  ? 5.688   -34.500 60.798  1.00 52.03  ? 34   LEU A CD2 1 
ATOM   244  N  N   . VAL A 1 35  ? 4.010   -37.878 64.564  1.00 63.45  ? 35   VAL A N   1 
ATOM   245  C  CA  . VAL A 1 35  ? 4.166   -39.209 65.129  1.00 67.90  ? 35   VAL A CA  1 
ATOM   246  C  C   . VAL A 1 35  ? 3.212   -40.141 64.375  1.00 66.05  ? 35   VAL A C   1 
ATOM   247  O  O   . VAL A 1 35  ? 3.600   -41.227 63.949  1.00 65.23  ? 35   VAL A O   1 
ATOM   248  C  CB  . VAL A 1 35  ? 3.842   -39.214 66.661  1.00 70.46  ? 35   VAL A CB  1 
ATOM   249  C  CG1 . VAL A 1 35  ? 3.749   -40.640 67.190  1.00 78.32  ? 35   VAL A CG1 1 
ATOM   250  C  CG2 . VAL A 1 35  ? 4.917   -38.451 67.435  1.00 54.13  ? 35   VAL A CG2 1 
ATOM   251  N  N   . GLU A 1 36  ? 1.990   -39.668 64.154  1.00 64.78  ? 36   GLU A N   1 
ATOM   252  C  CA  . GLU A 1 36  ? 0.956   -40.429 63.451  1.00 68.48  ? 36   GLU A CA  1 
ATOM   253  C  C   . GLU A 1 36  ? 1.362   -40.748 62.012  1.00 58.57  ? 36   GLU A C   1 
ATOM   254  O  O   . GLU A 1 36  ? 1.515   -41.910 61.638  1.00 55.26  ? 36   GLU A O   1 
ATOM   255  C  CB  . GLU A 1 36  ? -0.364  -39.634 63.443  1.00 82.03  ? 36   GLU A CB  1 
ATOM   256  C  CG  . GLU A 1 36  ? -1.613  -40.420 63.027  1.00 88.37  ? 36   GLU A CG  1 
ATOM   257  C  CD  . GLU A 1 36  ? -2.247  -41.186 64.182  1.00 91.32  ? 36   GLU A CD  1 
ATOM   258  O  OE1 . GLU A 1 36  ? -2.885  -40.542 65.046  1.00 92.33  ? 36   GLU A OE1 1 
ATOM   259  O  OE2 . GLU A 1 36  ? -2.114  -42.430 64.223  1.00 86.37  ? 36   GLU A OE2 1 
ATOM   260  N  N   . ILE A 1 37  ? 1.551   -39.705 61.216  1.00 53.99  ? 37   ILE A N   1 
ATOM   261  C  CA  . ILE A 1 37  ? 1.917   -39.855 59.813  1.00 57.40  ? 37   ILE A CA  1 
ATOM   262  C  C   . ILE A 1 37  ? 3.151   -40.722 59.609  1.00 57.61  ? 37   ILE A C   1 
ATOM   263  O  O   . ILE A 1 37  ? 3.209   -41.540 58.688  1.00 58.81  ? 37   ILE A O   1 
ATOM   264  C  CB  . ILE A 1 37  ? 2.163   -38.480 59.166  1.00 59.58  ? 37   ILE A CB  1 
ATOM   265  C  CG1 . ILE A 1 37  ? 0.885   -37.644 59.232  1.00 56.77  ? 37   ILE A CG1 1 
ATOM   266  C  CG2 . ILE A 1 37  ? 2.632   -38.641 57.720  1.00 55.21  ? 37   ILE A CG2 1 
ATOM   267  C  CD1 . ILE A 1 37  ? 1.114   -36.190 58.931  1.00 61.97  ? 37   ILE A CD1 1 
ATOM   268  N  N   . CYS A 1 38  ? 4.121   -40.577 60.494  1.00 56.92  ? 38   CYS A N   1 
ATOM   269  C  CA  . CYS A 1 38  ? 5.348   -41.334 60.369  1.00 54.22  ? 38   CYS A CA  1 
ATOM   270  C  C   . CYS A 1 38  ? 5.227   -42.811 60.692  1.00 52.10  ? 38   CYS A C   1 
ATOM   271  O  O   . CYS A 1 38  ? 5.955   -43.618 60.124  1.00 52.46  ? 38   CYS A O   1 
ATOM   272  C  CB  . CYS A 1 38  ? 6.457   -40.643 61.148  1.00 54.66  ? 38   CYS A CB  1 
ATOM   273  S  SG  . CYS A 1 38  ? 6.761   -38.994 60.449  1.00 41.52  ? 38   CYS A SG  1 
ATOM   274  N  N   . THR A 1 39  ? 4.299   -43.174 61.572  1.00 59.00  ? 39   THR A N   1 
ATOM   275  C  CA  . THR A 1 39  ? 4.082   -44.583 61.908  1.00 65.94  ? 39   THR A CA  1 
ATOM   276  C  C   . THR A 1 39  ? 3.489   -45.245 60.650  1.00 67.58  ? 39   THR A C   1 
ATOM   277  O  O   . THR A 1 39  ? 3.865   -46.368 60.269  1.00 58.24  ? 39   THR A O   1 
ATOM   278  C  CB  . THR A 1 39  ? 3.110   -44.728 63.107  1.00 63.23  ? 39   THR A CB  1 
ATOM   279  O  OG1 . THR A 1 39  ? 3.606   -43.968 64.213  1.00 66.31  ? 39   THR A OG1 1 
ATOM   280  C  CG2 . THR A 1 39  ? 2.993   -46.176 63.535  1.00 64.73  ? 39   THR A CG2 1 
ATOM   281  N  N   . GLU A 1 40  ? 2.599   -44.503 59.990  1.00 71.31  ? 40   GLU A N   1 
ATOM   282  C  CA  . GLU A 1 40  ? 1.955   -44.942 58.756  1.00 75.92  ? 40   GLU A CA  1 
ATOM   283  C  C   . GLU A 1 40  ? 3.031   -45.154 57.698  1.00 75.85  ? 40   GLU A C   1 
ATOM   284  O  O   . GLU A 1 40  ? 3.155   -46.246 57.132  1.00 79.52  ? 40   GLU A O   1 
ATOM   285  C  CB  . GLU A 1 40  ? 0.949   -43.884 58.276  1.00 81.78  ? 40   GLU A CB  1 
ATOM   286  C  CG  . GLU A 1 40  ? 0.622   -43.911 56.773  1.00 87.44  ? 40   GLU A CG  1 
ATOM   287  C  CD  . GLU A 1 40  ? -0.260  -45.079 56.356  1.00 95.56  ? 40   GLU A CD  1 
ATOM   288  O  OE1 . GLU A 1 40  ? 0.197   -46.242 56.421  1.00 102.49 ? 40   GLU A OE1 1 
ATOM   289  O  OE2 . GLU A 1 40  ? -1.412  -44.828 55.942  1.00 94.99  ? 40   GLU A OE2 1 
ATOM   290  N  N   . MET A 1 41  ? 3.818   -44.109 57.450  1.00 69.82  ? 41   MET A N   1 
ATOM   291  C  CA  . MET A 1 41  ? 4.896   -44.172 56.469  1.00 66.77  ? 41   MET A CA  1 
ATOM   292  C  C   . MET A 1 41  ? 5.847   -45.322 56.822  1.00 57.88  ? 41   MET A C   1 
ATOM   293  O  O   . MET A 1 41  ? 6.310   -46.059 55.941  1.00 45.57  ? 41   MET A O   1 
ATOM   294  C  CB  . MET A 1 41  ? 5.652   -42.834 56.417  1.00 70.31  ? 41   MET A CB  1 
ATOM   295  C  CG  . MET A 1 41  ? 4.794   -41.637 55.998  1.00 79.59  ? 41   MET A CG  1 
ATOM   296  S  SD  . MET A 1 41  ? 5.681   -40.047 55.939  1.00 87.63  ? 41   MET A SD  1 
ATOM   297  C  CE  . MET A 1 41  ? 5.243   -39.445 54.306  1.00 86.88  ? 41   MET A CE  1 
ATOM   298  N  N   . GLU A 1 42  ? 6.089   -45.493 58.118  1.00 58.40  ? 42   GLU A N   1 
ATOM   299  C  CA  . GLU A 1 42  ? 6.957   -46.549 58.613  1.00 62.10  ? 42   GLU A CA  1 
ATOM   300  C  C   . GLU A 1 42  ? 6.431   -47.874 58.104  1.00 65.99  ? 42   GLU A C   1 
ATOM   301  O  O   . GLU A 1 42  ? 7.187   -48.711 57.600  1.00 66.69  ? 42   GLU A O   1 
ATOM   302  C  CB  . GLU A 1 42  ? 6.959   -46.565 60.142  1.00 58.95  ? 42   GLU A CB  1 
ATOM   303  C  CG  . GLU A 1 42  ? 7.658   -47.771 60.747  1.00 74.97  ? 42   GLU A CG  1 
ATOM   304  C  CD  . GLU A 1 42  ? 7.413   -47.915 62.240  1.00 93.39  ? 42   GLU A CD  1 
ATOM   305  O  OE1 . GLU A 1 42  ? 6.395   -47.388 62.745  1.00 96.66  ? 42   GLU A OE1 1 
ATOM   306  O  OE2 . GLU A 1 42  ? 8.241   -48.571 62.910  1.00 101.03 ? 42   GLU A OE2 1 
ATOM   307  N  N   . LYS A 1 43  ? 5.117   -48.036 58.177  1.00 64.97  ? 43   LYS A N   1 
ATOM   308  C  CA  . LYS A 1 43  ? 4.531   -49.275 57.740  1.00 66.34  ? 43   LYS A CA  1 
ATOM   309  C  C   . LYS A 1 43  ? 4.340   -49.402 56.234  1.00 71.40  ? 43   LYS A C   1 
ATOM   310  O  O   . LYS A 1 43  ? 4.473   -50.497 55.685  1.00 72.64  ? 43   LYS A O   1 
ATOM   311  C  CB  . LYS A 1 43  ? 3.264   -49.584 58.533  1.00 57.16  ? 43   LYS A CB  1 
ATOM   312  C  CG  . LYS A 1 43  ? 3.151   -51.071 58.869  1.00 63.14  ? 43   LYS A CG  1 
ATOM   313  C  CD  . LYS A 1 43  ? 4.541   -51.742 59.041  1.00 62.60  ? 43   LYS A CD  1 
ATOM   314  C  CE  . LYS A 1 43  ? 5.130   -51.578 60.442  1.00 51.81  ? 43   LYS A CE  1 
ATOM   315  N  NZ  . LYS A 1 43  ? 6.602   -51.352 60.426  1.00 31.11  ? 43   LYS A NZ  1 
ATOM   316  N  N   . GLU A 1 44  ? 4.097   -48.293 55.545  1.00 76.39  ? 44   GLU A N   1 
ATOM   317  C  CA  . GLU A 1 44  ? 3.938   -48.370 54.096  1.00 85.96  ? 44   GLU A CA  1 
ATOM   318  C  C   . GLU A 1 44  ? 5.266   -48.825 53.489  1.00 84.98  ? 44   GLU A C   1 
ATOM   319  O  O   . GLU A 1 44  ? 5.321   -49.253 52.334  1.00 84.25  ? 44   GLU A O   1 
ATOM   320  C  CB  . GLU A 1 44  ? 3.499   -47.023 53.511  1.00 98.24  ? 44   GLU A CB  1 
ATOM   321  C  CG  . GLU A 1 44  ? 2.082   -46.605 53.899  1.00 110.66 ? 44   GLU A CG  1 
ATOM   322  C  CD  . GLU A 1 44  ? 1.633   -45.313 53.230  1.00 119.60 ? 44   GLU A CD  1 
ATOM   323  O  OE1 . GLU A 1 44  ? 1.925   -44.220 53.766  1.00 125.04 ? 44   GLU A OE1 1 
ATOM   324  O  OE2 . GLU A 1 44  ? 0.977   -45.391 52.170  1.00 121.13 ? 44   GLU A OE2 1 
ATOM   325  N  N   . GLY A 1 45  ? 6.327   -48.725 54.290  1.00 86.07  ? 45   GLY A N   1 
ATOM   326  C  CA  . GLY A 1 45  ? 7.654   -49.136 53.868  1.00 89.51  ? 45   GLY A CA  1 
ATOM   327  C  C   . GLY A 1 45  ? 8.493   -47.982 53.355  1.00 93.36  ? 45   GLY A C   1 
ATOM   328  O  O   . GLY A 1 45  ? 9.667   -48.159 53.018  1.00 94.24  ? 45   GLY A O   1 
ATOM   329  N  N   . LYS A 1 46  ? 7.903   -46.790 53.335  1.00 93.30  ? 46   LYS A N   1 
ATOM   330  C  CA  . LYS A 1 46  ? 8.572   -45.593 52.840  1.00 93.67  ? 46   LYS A CA  1 
ATOM   331  C  C   . LYS A 1 46  ? 9.754   -45.103 53.691  1.00 92.42  ? 46   LYS A C   1 
ATOM   332  O  O   . LYS A 1 46  ? 10.756  -44.619 53.151  1.00 93.79  ? 46   LYS A O   1 
ATOM   333  C  CB  . LYS A 1 46  ? 7.535   -44.478 52.627  1.00 94.97  ? 46   LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 46  ? 6.539   -44.772 51.496  1.00 94.62  ? 46   LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 46  ? 5.121   -44.260 51.787  1.00 99.59  ? 46   LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 46  ? 4.930   -42.766 51.531  1.00 105.08 ? 46   LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 46  ? 5.733   -41.870 52.417  1.00 106.96 ? 46   LYS A NZ  1 
ATOM   338  N  N   . ILE A 1 47  ? 9.653   -45.244 55.010  1.00 86.08  ? 47   ILE A N   1 
ATOM   339  C  CA  . ILE A 1 47  ? 10.718  -44.803 55.908  1.00 80.38  ? 47   ILE A CA  1 
ATOM   340  C  C   . ILE A 1 47  ? 11.072  -45.903 56.899  1.00 78.14  ? 47   ILE A C   1 
ATOM   341  O  O   . ILE A 1 47  ? 10.340  -46.884 57.027  1.00 75.24  ? 47   ILE A O   1 
ATOM   342  C  CB  . ILE A 1 47  ? 10.298  -43.545 56.712  1.00 80.21  ? 47   ILE A CB  1 
ATOM   343  C  CG1 . ILE A 1 47  ? 9.132   -43.875 57.648  1.00 78.39  ? 47   ILE A CG1 1 
ATOM   344  C  CG2 . ILE A 1 47  ? 9.903   -42.418 55.768  1.00 82.38  ? 47   ILE A CG2 1 
ATOM   345  C  CD1 . ILE A 1 47  ? 8.711   -42.731 58.544  1.00 74.82  ? 47   ILE A CD1 1 
ATOM   346  N  N   . SER A 1 48  ? 12.174  -45.721 57.619  1.00 77.27  ? 48   SER A N   1 
ATOM   347  C  CA  . SER A 1 48  ? 12.607  -46.698 58.609  1.00 79.03  ? 48   SER A CA  1 
ATOM   348  C  C   . SER A 1 48  ? 13.219  -46.060 59.842  1.00 79.47  ? 48   SER A C   1 
ATOM   349  O  O   . SER A 1 48  ? 14.057  -45.160 59.754  1.00 76.46  ? 48   SER A O   1 
ATOM   350  C  CB  . SER A 1 48  ? 13.587  -47.713 58.012  1.00 78.98  ? 48   SER A CB  1 
ATOM   351  O  OG  . SER A 1 48  ? 12.935  -48.938 57.701  1.00 73.65  ? 48   SER A OG  1 
ATOM   352  N  N   . LYS A 1 49  ? 12.753  -46.524 60.993  1.00 84.06  ? 49   LYS A N   1 
ATOM   353  C  CA  . LYS A 1 49  ? 13.218  -46.056 62.288  1.00 87.58  ? 49   LYS A CA  1 
ATOM   354  C  C   . LYS A 1 49  ? 14.686  -46.455 62.438  1.00 90.19  ? 49   LYS A C   1 
ATOM   355  O  O   . LYS A 1 49  ? 15.061  -47.600 62.174  1.00 90.97  ? 49   LYS A O   1 
ATOM   356  C  CB  . LYS A 1 49  ? 12.354  -46.695 63.386  1.00 87.72  ? 49   LYS A CB  1 
ATOM   357  C  CG  . LYS A 1 49  ? 12.228  -45.909 64.694  1.00 80.75  ? 49   LYS A CG  1 
ATOM   358  C  CD  . LYS A 1 49  ? 10.891  -46.220 65.391  1.00 77.04  ? 49   LYS A CD  1 
ATOM   359  C  CE  . LYS A 1 49  ? 10.687  -47.722 65.624  1.00 77.60  ? 49   LYS A CE  1 
ATOM   360  N  NZ  . LYS A 1 49  ? 9.260   -48.090 65.872  1.00 70.00  ? 49   LYS A NZ  1 
ATOM   361  N  N   . ILE A 1 50  ? 15.522  -45.482 62.777  1.00 92.10  ? 50   ILE A N   1 
ATOM   362  C  CA  . ILE A 1 50  ? 16.946  -45.721 62.962  1.00 94.65  ? 50   ILE A CA  1 
ATOM   363  C  C   . ILE A 1 50  ? 17.278  -45.435 64.435  1.00 99.10  ? 50   ILE A C   1 
ATOM   364  O  O   . ILE A 1 50  ? 16.368  -45.284 65.254  1.00 98.96  ? 50   ILE A O   1 
ATOM   365  C  CB  . ILE A 1 50  ? 17.777  -44.835 61.987  1.00 91.42  ? 50   ILE A CB  1 
ATOM   366  C  CG1 . ILE A 1 50  ? 19.237  -45.291 61.958  1.00 86.05  ? 50   ILE A CG1 1 
ATOM   367  C  CG2 . ILE A 1 50  ? 17.645  -43.361 62.354  1.00 90.24  ? 50   ILE A CG2 1 
ATOM   368  C  CD1 . ILE A 1 50  ? 20.103  -44.522 61.007  1.00 81.39  ? 50   ILE A CD1 1 
ATOM   369  N  N   . GLY A 1 51  ? 18.563  -45.383 64.781  1.00 102.62 ? 51   GLY A N   1 
ATOM   370  C  CA  . GLY A 1 51  ? 18.943  -45.118 66.156  1.00 108.50 ? 51   GLY A CA  1 
ATOM   371  C  C   . GLY A 1 51  ? 20.074  -44.113 66.307  1.00 112.12 ? 51   GLY A C   1 
ATOM   372  O  O   . GLY A 1 51  ? 20.098  -43.096 65.614  1.00 111.96 ? 51   GLY A O   1 
ATOM   373  N  N   . PRO A 1 52  ? 21.043  -44.391 67.200  1.00 115.59 ? 52   PRO A N   1 
ATOM   374  C  CA  . PRO A 1 52  ? 22.217  -43.556 67.501  1.00 112.10 ? 52   PRO A CA  1 
ATOM   375  C  C   . PRO A 1 52  ? 23.290  -43.601 66.413  1.00 106.30 ? 52   PRO A C   1 
ATOM   376  O  O   . PRO A 1 52  ? 24.212  -42.785 66.395  1.00 101.70 ? 52   PRO A O   1 
ATOM   377  C  CB  . PRO A 1 52  ? 22.734  -44.172 68.797  1.00 114.51 ? 52   PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 52  ? 22.466  -45.631 68.577  1.00 119.44 ? 52   PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 52  ? 21.056  -45.622 68.015  1.00 119.54 ? 52   PRO A CD  1 
ATOM   380  N  N   . GLU A 1 53  ? 23.177  -44.575 65.519  1.00 103.88 ? 53   GLU A N   1 
ATOM   381  C  CA  . GLU A 1 53  ? 24.137  -44.722 64.445  1.00 99.43  ? 53   GLU A CA  1 
ATOM   382  C  C   . GLU A 1 53  ? 23.783  -43.834 63.257  1.00 92.80  ? 53   GLU A C   1 
ATOM   383  O  O   . GLU A 1 53  ? 23.389  -44.323 62.196  1.00 93.81  ? 53   GLU A O   1 
ATOM   384  C  CB  . GLU A 1 53  ? 24.242  -46.192 64.024  1.00 104.17 ? 53   GLU A CB  1 
ATOM   385  C  CG  . GLU A 1 53  ? 25.345  -46.464 63.013  1.00 113.99 ? 53   GLU A CG  1 
ATOM   386  C  CD  . GLU A 1 53  ? 26.623  -45.708 63.332  1.00 121.94 ? 53   GLU A CD  1 
ATOM   387  O  OE1 . GLU A 1 53  ? 27.153  -45.867 64.455  1.00 127.62 ? 53   GLU A OE1 1 
ATOM   388  O  OE2 . GLU A 1 53  ? 27.085  -44.940 62.460  1.00 122.82 ? 53   GLU A OE2 1 
ATOM   389  N  N   . ASN A 1 54  ? 23.896  -42.525 63.460  1.00 84.24  ? 54   ASN A N   1 
ATOM   390  C  CA  . ASN A 1 54  ? 23.612  -41.541 62.418  1.00 78.45  ? 54   ASN A CA  1 
ATOM   391  C  C   . ASN A 1 54  ? 23.779  -40.129 62.972  1.00 76.58  ? 54   ASN A C   1 
ATOM   392  O  O   . ASN A 1 54  ? 23.098  -39.743 63.921  1.00 77.09  ? 54   ASN A O   1 
ATOM   393  C  CB  . ASN A 1 54  ? 22.191  -41.707 61.857  1.00 67.42  ? 54   ASN A CB  1 
ATOM   394  C  CG  . ASN A 1 54  ? 22.009  -41.023 60.502  1.00 51.05  ? 54   ASN A CG  1 
ATOM   395  O  OD1 . ASN A 1 54  ? 22.739  -40.094 60.154  1.00 37.66  ? 54   ASN A OD1 1 
ATOM   396  N  ND2 . ASN A 1 54  ? 21.043  -41.492 59.729  1.00 62.90  ? 54   ASN A ND2 1 
ATOM   397  N  N   . PRO A 1 55  ? 24.749  -39.369 62.434  1.00 70.81  ? 55   PRO A N   1 
ATOM   398  C  CA  . PRO A 1 55  ? 25.007  -37.996 62.875  1.00 71.51  ? 55   PRO A CA  1 
ATOM   399  C  C   . PRO A 1 55  ? 24.267  -36.981 62.001  1.00 73.98  ? 55   PRO A C   1 
ATOM   400  O  O   . PRO A 1 55  ? 24.187  -35.796 62.334  1.00 79.88  ? 55   PRO A O   1 
ATOM   401  C  CB  . PRO A 1 55  ? 26.506  -37.874 62.673  1.00 70.09  ? 55   PRO A CB  1 
ATOM   402  C  CG  . PRO A 1 55  ? 26.689  -38.605 61.373  1.00 61.98  ? 55   PRO A CG  1 
ATOM   403  C  CD  . PRO A 1 55  ? 25.840  -39.848 61.562  1.00 60.59  ? 55   PRO A CD  1 
ATOM   404  N  N   . TYR A 1 56  ? 23.737  -37.456 60.880  1.00 69.33  ? 56   TYR A N   1 
ATOM   405  C  CA  . TYR A 1 56  ? 23.031  -36.604 59.931  1.00 59.71  ? 56   TYR A CA  1 
ATOM   406  C  C   . TYR A 1 56  ? 21.622  -36.302 60.391  1.00 52.35  ? 56   TYR A C   1 
ATOM   407  O  O   . TYR A 1 56  ? 21.082  -36.993 61.259  1.00 51.24  ? 56   TYR A O   1 
ATOM   408  C  CB  . TYR A 1 56  ? 23.042  -37.265 58.560  1.00 51.91  ? 56   TYR A CB  1 
ATOM   409  C  CG  . TYR A 1 56  ? 24.432  -37.699 58.184  1.00 48.58  ? 56   TYR A CG  1 
ATOM   410  C  CD1 . TYR A 1 56  ? 25.428  -36.758 57.927  1.00 43.48  ? 56   TYR A CD1 1 
ATOM   411  C  CD2 . TYR A 1 56  ? 24.765  -39.047 58.121  1.00 53.79  ? 56   TYR A CD2 1 
ATOM   412  C  CE1 . TYR A 1 56  ? 26.714  -37.148 57.615  1.00 53.64  ? 56   TYR A CE1 1 
ATOM   413  C  CE2 . TYR A 1 56  ? 26.054  -39.454 57.809  1.00 59.85  ? 56   TYR A CE2 1 
ATOM   414  C  CZ  . TYR A 1 56  ? 27.026  -38.501 57.554  1.00 64.80  ? 56   TYR A CZ  1 
ATOM   415  O  OH  . TYR A 1 56  ? 28.300  -38.906 57.217  1.00 66.81  ? 56   TYR A OH  1 
ATOM   416  N  N   . ASN A 1 57  ? 21.024  -35.268 59.817  1.00 43.35  ? 57   ASN A N   1 
ATOM   417  C  CA  . ASN A 1 57  ? 19.689  -34.884 60.222  1.00 38.97  ? 57   ASN A CA  1 
ATOM   418  C  C   . ASN A 1 57  ? 19.143  -33.746 59.384  1.00 43.54  ? 57   ASN A C   1 
ATOM   419  O  O   . ASN A 1 57  ? 19.881  -32.861 58.944  1.00 38.06  ? 57   ASN A O   1 
ATOM   420  C  CB  . ASN A 1 57  ? 19.701  -34.460 61.694  1.00 31.28  ? 57   ASN A CB  1 
ATOM   421  C  CG  . ASN A 1 57  ? 18.322  -34.415 62.293  1.00 38.87  ? 57   ASN A CG  1 
ATOM   422  O  OD1 . ASN A 1 57  ? 17.695  -33.362 62.378  1.00 51.89  ? 57   ASN A OD1 1 
ATOM   423  N  ND2 . ASN A 1 57  ? 17.820  -35.571 62.681  1.00 42.21  ? 57   ASN A ND2 1 
ATOM   424  N  N   . THR A 1 58  ? 17.834  -33.763 59.195  1.00 55.46  ? 58   THR A N   1 
ATOM   425  C  CA  . THR A 1 58  ? 17.146  -32.735 58.439  1.00 63.25  ? 58   THR A CA  1 
ATOM   426  C  C   . THR A 1 58  ? 15.916  -32.366 59.266  1.00 67.84  ? 58   THR A C   1 
ATOM   427  O  O   . THR A 1 58  ? 15.304  -33.227 59.911  1.00 66.21  ? 58   THR A O   1 
ATOM   428  C  CB  . THR A 1 58  ? 16.757  -33.245 57.036  1.00 61.76  ? 58   THR A CB  1 
ATOM   429  O  OG1 . THR A 1 58  ? 17.928  -33.734 56.364  1.00 62.39  ? 58   THR A OG1 1 
ATOM   430  C  CG2 . THR A 1 58  ? 16.163  -32.130 56.213  1.00 53.30  ? 58   THR A CG2 1 
ATOM   431  N  N   . PRO A 1 59  ? 15.576  -31.072 59.309  1.00 71.20  ? 59   PRO A N   1 
ATOM   432  C  CA  . PRO A 1 59  ? 14.418  -30.621 60.080  1.00 75.87  ? 59   PRO A CA  1 
ATOM   433  C  C   . PRO A 1 59  ? 13.074  -30.990 59.457  1.00 77.87  ? 59   PRO A C   1 
ATOM   434  O  O   . PRO A 1 59  ? 12.859  -30.802 58.254  1.00 79.90  ? 59   PRO A O   1 
ATOM   435  C  CB  . PRO A 1 59  ? 14.619  -29.109 60.114  1.00 76.24  ? 59   PRO A CB  1 
ATOM   436  C  CG  . PRO A 1 59  ? 15.213  -28.840 58.764  1.00 71.02  ? 59   PRO A CG  1 
ATOM   437  C  CD  . PRO A 1 59  ? 16.245  -29.934 58.654  1.00 70.20  ? 59   PRO A CD  1 
ATOM   438  N  N   . VAL A 1 60  ? 12.191  -31.559 60.269  1.00 76.93  ? 60   VAL A N   1 
ATOM   439  C  CA  . VAL A 1 60  ? 10.860  -31.909 59.804  1.00 78.35  ? 60   VAL A CA  1 
ATOM   440  C  C   . VAL A 1 60  ? 9.937   -30.831 60.352  1.00 86.90  ? 60   VAL A C   1 
ATOM   441  O  O   . VAL A 1 60  ? 10.185  -30.280 61.430  1.00 87.13  ? 60   VAL A O   1 
ATOM   442  C  CB  . VAL A 1 60  ? 10.408  -33.281 60.317  1.00 70.24  ? 60   VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 60  ? 10.228  -33.254 61.827  1.00 60.97  ? 60   VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 60  ? 9.125   -33.693 59.621  1.00 70.49  ? 60   VAL A CG2 1 
ATOM   445  N  N   . PHE A 1 61  ? 8.882   -30.529 59.609  1.00 96.12  ? 61   PHE A N   1 
ATOM   446  C  CA  . PHE A 1 61  ? 7.926   -29.502 59.999  1.00 106.84 ? 61   PHE A CA  1 
ATOM   447  C  C   . PHE A 1 61  ? 6.492   -30.033 59.903  1.00 112.65 ? 61   PHE A C   1 
ATOM   448  O  O   . PHE A 1 61  ? 6.243   -31.062 59.262  1.00 115.01 ? 61   PHE A O   1 
ATOM   449  C  CB  . PHE A 1 61  ? 8.101   -28.258 59.113  1.00 109.83 ? 61   PHE A CB  1 
ATOM   450  C  CG  . PHE A 1 61  ? 9.448   -27.581 59.259  1.00 112.67 ? 61   PHE A CG  1 
ATOM   451  C  CD1 . PHE A 1 61  ? 9.741   -26.813 60.385  1.00 109.76 ? 61   PHE A CD1 1 
ATOM   452  C  CD2 . PHE A 1 61  ? 10.418  -27.704 58.265  1.00 111.84 ? 61   PHE A CD2 1 
ATOM   453  C  CE1 . PHE A 1 61  ? 10.978  -26.179 60.520  1.00 103.41 ? 61   PHE A CE1 1 
ATOM   454  C  CE2 . PHE A 1 61  ? 11.659  -27.071 58.394  1.00 107.56 ? 61   PHE A CE2 1 
ATOM   455  C  CZ  . PHE A 1 61  ? 11.937  -26.308 59.524  1.00 102.56 ? 61   PHE A CZ  1 
ATOM   456  N  N   . ALA A 1 62  ? 5.556   -29.326 60.534  1.00 115.22 ? 62   ALA A N   1 
ATOM   457  C  CA  . ALA A 1 62  ? 4.147   -29.718 60.536  1.00 115.82 ? 62   ALA A CA  1 
ATOM   458  C  C   . ALA A 1 62  ? 3.236   -28.584 60.059  1.00 116.91 ? 62   ALA A C   1 
ATOM   459  O  O   . ALA A 1 62  ? 3.128   -27.550 60.720  1.00 117.13 ? 62   ALA A O   1 
ATOM   460  C  CB  . ALA A 1 62  ? 3.737   -30.171 61.934  1.00 109.95 ? 62   ALA A CB  1 
ATOM   461  N  N   . ILE A 1 63  ? 2.595   -28.780 58.907  1.00 117.08 ? 63   ILE A N   1 
ATOM   462  C  CA  . ILE A 1 63  ? 1.688   -27.785 58.332  1.00 120.24 ? 63   ILE A CA  1 
ATOM   463  C  C   . ILE A 1 63  ? 0.322   -28.412 58.053  1.00 123.43 ? 63   ILE A C   1 
ATOM   464  O  O   . ILE A 1 63  ? 0.230   -29.617 57.821  1.00 126.50 ? 63   ILE A O   1 
ATOM   465  C  CB  . ILE A 1 63  ? 2.248   -27.195 56.998  1.00 121.95 ? 63   ILE A CB  1 
ATOM   466  C  CG1 . ILE A 1 63  ? 2.371   -28.279 55.919  1.00 119.50 ? 63   ILE A CG1 1 
ATOM   467  C  CG2 . ILE A 1 63  ? 3.596   -26.529 57.232  1.00 125.26 ? 63   ILE A CG2 1 
ATOM   468  C  CD1 . ILE A 1 63  ? 1.185   -28.350 54.960  1.00 116.75 ? 63   ILE A CD1 1 
ATOM   469  N  N   . LYS A 1 64  ? -0.737  -27.607 58.094  1.00 123.58 ? 64   LYS A N   1 
ATOM   470  C  CA  . LYS A 1 64  ? -2.077  -28.115 57.811  1.00 122.31 ? 64   LYS A CA  1 
ATOM   471  C  C   . LYS A 1 64  ? -2.500  -27.516 56.477  1.00 123.04 ? 64   LYS A C   1 
ATOM   472  O  O   . LYS A 1 64  ? -2.389  -26.302 56.271  1.00 122.97 ? 64   LYS A O   1 
ATOM   473  C  CB  . LYS A 1 64  ? -3.080  -27.753 58.923  1.00 120.38 ? 64   LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 64  ? -3.613  -26.320 58.916  1.00 123.60 ? 64   LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 64  ? -2.546  -25.307 59.303  1.00 131.42 ? 64   LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 64  ? -2.211  -25.389 60.783  1.00 137.24 ? 64   LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 64  ? -0.991  -24.596 61.127  1.00 142.98 ? 64   LYS A NZ  1 
ATOM   478  N  N   . LYS A 1 65  ? -2.881  -28.370 55.535  1.00 122.74 ? 65   LYS A N   1 
ATOM   479  C  CA  . LYS A 1 65  ? -3.299  -27.879 54.233  1.00 121.77 ? 65   LYS A CA  1 
ATOM   480  C  C   . LYS A 1 65  ? -4.804  -27.642 54.210  1.00 120.87 ? 65   LYS A C   1 
ATOM   481  O  O   . LYS A 1 65  ? -5.496  -27.859 55.203  1.00 114.90 ? 65   LYS A O   1 
ATOM   482  C  CB  . LYS A 1 65  ? -2.872  -28.833 53.111  1.00 118.88 ? 65   LYS A CB  1 
ATOM   483  C  CG  . LYS A 1 65  ? -2.826  -28.173 51.737  1.00 114.82 ? 65   LYS A CG  1 
ATOM   484  C  CD  . LYS A 1 65  ? -2.382  -29.129 50.661  1.00 117.32 ? 65   LYS A CD  1 
ATOM   485  C  CE  . LYS A 1 65  ? -2.488  -28.484 49.294  1.00 119.17 ? 65   LYS A CE  1 
ATOM   486  N  NZ  . LYS A 1 65  ? -2.011  -29.406 48.229  1.00 122.51 ? 65   LYS A NZ  1 
ATOM   487  N  N   . LYS A 1 66  ? -5.301  -27.210 53.060  1.00 124.96 ? 66   LYS A N   1 
ATOM   488  C  CA  . LYS A 1 66  ? -6.708  -26.913 52.881  1.00 130.27 ? 66   LYS A CA  1 
ATOM   489  C  C   . LYS A 1 66  ? -7.572  -28.157 52.685  1.00 137.57 ? 66   LYS A C   1 
ATOM   490  O  O   . LYS A 1 66  ? -8.495  -28.386 53.464  1.00 138.22 ? 66   LYS A O   1 
ATOM   491  C  CB  . LYS A 1 66  ? -6.872  -25.967 51.692  1.00 127.90 ? 66   LYS A CB  1 
ATOM   492  C  CG  . LYS A 1 66  ? -5.917  -24.783 51.725  1.00 126.63 ? 66   LYS A CG  1 
ATOM   493  C  CD  . LYS A 1 66  ? -5.332  -24.513 50.349  1.00 127.93 ? 66   LYS A CD  1 
ATOM   494  C  CE  . LYS A 1 66  ? -4.198  -23.504 50.417  1.00 123.41 ? 66   LYS A CE  1 
ATOM   495  N  NZ  . LYS A 1 66  ? -3.635  -23.234 49.069  1.00 119.60 ? 66   LYS A NZ  1 
ATOM   496  N  N   . ASP A 1 67  ? -7.224  -28.987 51.697  1.00 143.87 ? 67   ASP A N   1 
ATOM   497  C  CA  . ASP A 1 67  ? -7.992  -30.199 51.361  1.00 147.78 ? 67   ASP A CA  1 
ATOM   498  C  C   . ASP A 1 67  ? -8.688  -30.958 52.500  1.00 149.51 ? 67   ASP A C   1 
ATOM   499  O  O   . ASP A 1 67  ? -9.812  -31.441 52.330  1.00 150.37 ? 67   ASP A O   1 
ATOM   500  C  CB  . ASP A 1 67  ? -7.174  -31.163 50.475  1.00 149.94 ? 67   ASP A CB  1 
ATOM   501  C  CG  . ASP A 1 67  ? -5.845  -31.571 51.094  1.00 153.98 ? 67   ASP A CG  1 
ATOM   502  O  OD1 . ASP A 1 67  ? -5.799  -32.596 51.809  1.00 155.69 ? 67   ASP A OD1 1 
ATOM   503  O  OD2 . ASP A 1 67  ? -4.838  -30.883 50.832  1.00 155.91 ? 67   ASP A OD2 1 
ATOM   504  N  N   . SER A 1 68  ? -8.033  -31.052 53.654  1.00 150.04 ? 68   SER A N   1 
ATOM   505  C  CA  . SER A 1 68  ? -8.612  -31.737 54.808  1.00 147.20 ? 68   SER A CA  1 
ATOM   506  C  C   . SER A 1 68  ? -8.316  -30.985 56.107  1.00 144.40 ? 68   SER A C   1 
ATOM   507  O  O   . SER A 1 68  ? -8.767  -31.395 57.180  1.00 144.09 ? 68   SER A O   1 
ATOM   508  C  CB  . SER A 1 68  ? -8.055  -33.165 54.920  1.00 146.43 ? 68   SER A CB  1 
ATOM   509  O  OG  . SER A 1 68  ? -8.168  -33.879 53.699  1.00 148.79 ? 68   SER A OG  1 
ATOM   510  N  N   . THR A 1 69  ? -7.537  -29.906 56.013  1.00 141.28 ? 69   THR A N   1 
ATOM   511  C  CA  . THR A 1 69  ? -7.129  -29.124 57.182  1.00 136.67 ? 69   THR A CA  1 
ATOM   512  C  C   . THR A 1 69  ? -6.416  -30.067 58.162  1.00 134.40 ? 69   THR A C   1 
ATOM   513  O  O   . THR A 1 69  ? -6.062  -29.692 59.282  1.00 134.96 ? 69   THR A O   1 
ATOM   514  C  CB  . THR A 1 69  ? -8.339  -28.448 57.863  1.00 136.58 ? 69   THR A CB  1 
ATOM   515  O  OG1 . THR A 1 69  ? -9.131  -27.780 56.872  1.00 132.97 ? 69   THR A OG1 1 
ATOM   516  C  CG2 . THR A 1 69  ? -7.869  -27.418 58.884  1.00 139.79 ? 69   THR A CG2 1 
ATOM   517  N  N   . LYS A 1 70  ? -6.148  -31.277 57.675  1.00 130.35 ? 70   LYS A N   1 
ATOM   518  C  CA  . LYS A 1 70  ? -5.504  -32.338 58.425  1.00 125.18 ? 70   LYS A CA  1 
ATOM   519  C  C   . LYS A 1 70  ? -4.020  -32.054 58.504  1.00 123.93 ? 70   LYS A C   1 
ATOM   520  O  O   . LYS A 1 70  ? -3.426  -31.541 57.552  1.00 123.76 ? 70   LYS A O   1 
ATOM   521  C  CB  . LYS A 1 70  ? -5.757  -33.677 57.720  1.00 120.92 ? 70   LYS A CB  1 
ATOM   522  C  CG  . LYS A 1 70  ? -4.936  -34.857 58.217  1.00 114.13 ? 70   LYS A CG  1 
ATOM   523  C  CD  . LYS A 1 70  ? -5.319  -36.137 57.475  1.00 110.37 ? 70   LYS A CD  1 
ATOM   524  C  CE  . LYS A 1 70  ? -5.170  -35.990 55.962  1.00 106.62 ? 70   LYS A CE  1 
ATOM   525  N  NZ  . LYS A 1 70  ? -5.539  -37.237 55.233  1.00 101.76 ? 70   LYS A NZ  1 
ATOM   526  N  N   . TRP A 1 71  ? -3.444  -32.344 59.664  1.00 122.91 ? 71   TRP A N   1 
ATOM   527  C  CA  . TRP A 1 71  ? -2.024  -32.142 59.893  1.00 120.57 ? 71   TRP A CA  1 
ATOM   528  C  C   . TRP A 1 71  ? -1.224  -33.008 58.924  1.00 117.79 ? 71   TRP A C   1 
ATOM   529  O  O   . TRP A 1 71  ? -1.458  -34.214 58.822  1.00 116.88 ? 71   TRP A O   1 
ATOM   530  C  CB  . TRP A 1 71  ? -1.664  -32.518 61.334  1.00 122.43 ? 71   TRP A CB  1 
ATOM   531  C  CG  . TRP A 1 71  ? -1.727  -31.393 62.344  1.00 122.90 ? 71   TRP A CG  1 
ATOM   532  C  CD1 . TRP A 1 71  ? -2.281  -31.445 63.594  1.00 124.50 ? 71   TRP A CD1 1 
ATOM   533  C  CD2 . TRP A 1 71  ? -1.141  -30.088 62.225  1.00 125.00 ? 71   TRP A CD2 1 
ATOM   534  N  NE1 . TRP A 1 71  ? -2.065  -30.263 64.262  1.00 126.01 ? 71   TRP A NE1 1 
ATOM   535  C  CE2 . TRP A 1 71  ? -1.369  -29.412 63.444  1.00 126.62 ? 71   TRP A CE2 1 
ATOM   536  C  CE3 . TRP A 1 71  ? -0.438  -29.429 61.207  1.00 125.66 ? 71   TRP A CE3 1 
ATOM   537  C  CZ2 . TRP A 1 71  ? -0.921  -28.109 63.676  1.00 129.13 ? 71   TRP A CZ2 1 
ATOM   538  C  CZ3 . TRP A 1 71  ? 0.009   -28.134 61.438  1.00 127.48 ? 71   TRP A CZ3 1 
ATOM   539  C  CH2 . TRP A 1 71  ? -0.234  -27.489 62.664  1.00 131.23 ? 71   TRP A CH2 1 
ATOM   540  N  N   . ARG A 1 72  ? -0.326  -32.374 58.178  1.00 115.73 ? 72   ARG A N   1 
ATOM   541  C  CA  . ARG A 1 72  ? 0.527   -33.071 57.218  1.00 114.09 ? 72   ARG A CA  1 
ATOM   542  C  C   . ARG A 1 72  ? 1.972   -32.901 57.703  1.00 110.00 ? 72   ARG A C   1 
ATOM   543  O  O   . ARG A 1 72  ? 2.196   -32.581 58.873  1.00 111.71 ? 72   ARG A O   1 
ATOM   544  C  CB  . ARG A 1 72  ? 0.353   -32.479 55.812  1.00 117.61 ? 72   ARG A CB  1 
ATOM   545  C  CG  . ARG A 1 72  ? -1.022  -31.878 55.546  1.00 121.73 ? 72   ARG A CG  1 
ATOM   546  C  CD  . ARG A 1 72  ? -1.294  -31.713 54.064  1.00 128.93 ? 72   ARG A CD  1 
ATOM   547  N  NE  . ARG A 1 72  ? -1.708  -32.970 53.443  1.00 137.07 ? 72   ARG A NE  1 
ATOM   548  C  CZ  . ARG A 1 72  ? -2.933  -33.486 53.534  1.00 140.04 ? 72   ARG A CZ  1 
ATOM   549  N  NH1 . ARG A 1 72  ? -3.879  -32.858 54.222  1.00 140.56 ? 72   ARG A NH1 1 
ATOM   550  N  NH2 . ARG A 1 72  ? -3.213  -34.635 52.933  1.00 140.53 ? 72   ARG A NH2 1 
ATOM   551  N  N   . LYS A 1 73  ? 2.951   -33.093 56.825  1.00 103.46 ? 73   LYS A N   1 
ATOM   552  C  CA  . LYS A 1 73  ? 4.344   -32.945 57.232  1.00 96.55  ? 73   LYS A CA  1 
ATOM   553  C  C   . LYS A 1 73  ? 5.250   -32.500 56.093  1.00 92.99  ? 73   LYS A C   1 
ATOM   554  O  O   . LYS A 1 73  ? 4.945   -32.722 54.916  1.00 91.94  ? 73   LYS A O   1 
ATOM   555  C  CB  . LYS A 1 73  ? 4.871   -34.248 57.836  1.00 93.64  ? 73   LYS A CB  1 
ATOM   556  C  CG  . LYS A 1 73  ? 5.284   -35.298 56.837  1.00 91.18  ? 73   LYS A CG  1 
ATOM   557  C  CD  . LYS A 1 73  ? 6.694   -35.776 57.129  1.00 85.65  ? 73   LYS A CD  1 
ATOM   558  C  CE  . LYS A 1 73  ? 7.189   -36.720 56.044  1.00 86.47  ? 73   LYS A CE  1 
ATOM   559  N  NZ  . LYS A 1 73  ? 7.220   -36.085 54.693  1.00 76.91  ? 73   LYS A NZ  1 
ATOM   560  N  N   . LEU A 1 74  ? 6.386   -31.912 56.454  1.00 86.88  ? 74   LEU A N   1 
ATOM   561  C  CA  . LEU A 1 74  ? 7.343   -31.425 55.474  1.00 80.76  ? 74   LEU A CA  1 
ATOM   562  C  C   . LEU A 1 74  ? 8.773   -31.572 55.985  1.00 75.84  ? 74   LEU A C   1 
ATOM   563  O  O   . LEU A 1 74  ? 9.052   -31.315 57.151  1.00 68.16  ? 74   LEU A O   1 
ATOM   564  C  CB  . LEU A 1 74  ? 7.056   -29.952 55.175  1.00 75.24  ? 74   LEU A CB  1 
ATOM   565  C  CG  . LEU A 1 74  ? 7.739   -29.330 53.961  1.00 69.75  ? 74   LEU A CG  1 
ATOM   566  C  CD1 . LEU A 1 74  ? 7.240   -30.000 52.676  1.00 74.54  ? 74   LEU A CD1 1 
ATOM   567  C  CD2 . LEU A 1 74  ? 7.446   -27.837 53.940  1.00 70.94  ? 74   LEU A CD2 1 
ATOM   568  N  N   . VAL A 1 75  ? 9.675   -32.016 55.120  1.00 76.82  ? 75   VAL A N   1 
ATOM   569  C  CA  . VAL A 1 75  ? 11.072  -32.165 55.510  1.00 79.53  ? 75   VAL A CA  1 
ATOM   570  C  C   . VAL A 1 75  ? 11.935  -31.219 54.663  1.00 86.35  ? 75   VAL A C   1 
ATOM   571  O  O   . VAL A 1 75  ? 11.928  -31.288 53.428  1.00 90.98  ? 75   VAL A O   1 
ATOM   572  C  CB  . VAL A 1 75  ? 11.541  -33.613 55.359  1.00 71.03  ? 75   VAL A CB  1 
ATOM   573  C  CG1 . VAL A 1 75  ? 12.846  -33.814 56.105  1.00 68.92  ? 75   VAL A CG1 1 
ATOM   574  C  CG2 . VAL A 1 75  ? 10.476  -34.561 55.882  1.00 69.54  ? 75   VAL A CG2 1 
ATOM   575  N  N   . ASP A 1 76  ? 12.674  -30.339 55.335  1.00 87.99  ? 76   ASP A N   1 
ATOM   576  C  CA  . ASP A 1 76  ? 13.504  -29.336 54.667  1.00 89.81  ? 76   ASP A CA  1 
ATOM   577  C  C   . ASP A 1 76  ? 14.856  -29.839 54.166  1.00 87.60  ? 76   ASP A C   1 
ATOM   578  O  O   . ASP A 1 76  ? 15.888  -29.647 54.812  1.00 89.64  ? 76   ASP A O   1 
ATOM   579  C  CB  . ASP A 1 76  ? 13.697  -28.132 55.593  1.00 98.72  ? 76   ASP A CB  1 
ATOM   580  C  CG  . ASP A 1 76  ? 13.667  -26.801 54.850  1.00 107.33 ? 76   ASP A CG  1 
ATOM   581  O  OD1 . ASP A 1 76  ? 13.893  -26.782 53.619  1.00 109.18 ? 76   ASP A OD1 1 
ATOM   582  O  OD2 . ASP A 1 76  ? 13.413  -25.766 55.507  1.00 107.34 ? 76   ASP A OD2 1 
ATOM   583  N  N   . PHE A 1 77  ? 14.853  -30.404 52.967  1.00 87.20  ? 77   PHE A N   1 
ATOM   584  C  CA  . PHE A 1 77  ? 16.063  -30.950 52.362  1.00 90.07  ? 77   PHE A CA  1 
ATOM   585  C  C   . PHE A 1 77  ? 17.095  -29.975 51.825  1.00 87.77  ? 77   PHE A C   1 
ATOM   586  O  O   . PHE A 1 77  ? 18.178  -30.399 51.424  1.00 79.44  ? 77   PHE A O   1 
ATOM   587  C  CB  . PHE A 1 77  ? 15.687  -31.929 51.256  1.00 96.94  ? 77   PHE A CB  1 
ATOM   588  C  CG  . PHE A 1 77  ? 15.113  -33.200 51.768  1.00 105.79 ? 77   PHE A CG  1 
ATOM   589  C  CD1 . PHE A 1 77  ? 15.820  -33.954 52.700  1.00 107.16 ? 77   PHE A CD1 1 
ATOM   590  C  CD2 . PHE A 1 77  ? 13.859  -33.632 51.355  1.00 106.47 ? 77   PHE A CD2 1 
ATOM   591  C  CE1 . PHE A 1 77  ? 15.290  -35.120 53.217  1.00 109.09 ? 77   PHE A CE1 1 
ATOM   592  C  CE2 . PHE A 1 77  ? 13.316  -34.797 51.866  1.00 109.04 ? 77   PHE A CE2 1 
ATOM   593  C  CZ  . PHE A 1 77  ? 14.034  -35.546 52.801  1.00 112.80 ? 77   PHE A CZ  1 
ATOM   594  N  N   . ARG A 1 78  ? 16.777  -28.682 51.842  1.00 90.94  ? 78   ARG A N   1 
ATOM   595  C  CA  . ARG A 1 78  ? 17.672  -27.644 51.326  1.00 89.24  ? 78   ARG A CA  1 
ATOM   596  C  C   . ARG A 1 78  ? 19.155  -27.975 51.450  1.00 85.14  ? 78   ARG A C   1 
ATOM   597  O  O   . ARG A 1 78  ? 19.869  -28.018 50.443  1.00 78.17  ? 78   ARG A O   1 
ATOM   598  C  CB  . ARG A 1 78  ? 17.370  -26.287 51.980  1.00 91.24  ? 78   ARG A CB  1 
ATOM   599  C  CG  . ARG A 1 78  ? 16.120  -25.605 51.427  1.00 91.61  ? 78   ARG A CG  1 
ATOM   600  C  CD  . ARG A 1 78  ? 15.955  -24.182 51.952  1.00 91.69  ? 78   ARG A CD  1 
ATOM   601  N  NE  . ARG A 1 78  ? 15.640  -24.147 53.378  1.00 87.32  ? 78   ARG A NE  1 
ATOM   602  C  CZ  . ARG A 1 78  ? 15.530  -23.033 54.100  1.00 88.10  ? 78   ARG A CZ  1 
ATOM   603  N  NH1 . ARG A 1 78  ? 15.706  -21.839 53.542  1.00 80.03  ? 78   ARG A NH1 1 
ATOM   604  N  NH2 . ARG A 1 78  ? 15.235  -23.116 55.390  1.00 93.98  ? 78   ARG A NH2 1 
ATOM   605  N  N   . GLU A 1 79  ? 19.590  -28.283 52.670  1.00 83.59  ? 79   GLU A N   1 
ATOM   606  C  CA  . GLU A 1 79  ? 20.987  -28.620 52.925  1.00 81.19  ? 79   GLU A CA  1 
ATOM   607  C  C   . GLU A 1 79  ? 21.408  -29.893 52.211  1.00 73.34  ? 79   GLU A C   1 
ATOM   608  O  O   . GLU A 1 79  ? 22.378  -29.899 51.459  1.00 71.97  ? 79   GLU A O   1 
ATOM   609  C  CB  . GLU A 1 79  ? 21.249  -28.758 54.424  1.00 95.96  ? 79   GLU A CB  1 
ATOM   610  C  CG  . GLU A 1 79  ? 21.039  -27.472 55.201  1.00 119.62 ? 79   GLU A CG  1 
ATOM   611  C  CD  . GLU A 1 79  ? 21.762  -26.281 54.581  1.00 132.71 ? 79   GLU A CD  1 
ATOM   612  O  OE1 . GLU A 1 79  ? 23.008  -26.212 54.678  1.00 133.08 ? 79   GLU A OE1 1 
ATOM   613  O  OE2 . GLU A 1 79  ? 21.078  -25.411 53.995  1.00 140.71 ? 79   GLU A OE2 1 
ATOM   614  N  N   . LEU A 1 80  ? 20.675  -30.973 52.443  1.00 64.47  ? 80   LEU A N   1 
ATOM   615  C  CA  . LEU A 1 80  ? 20.997  -32.230 51.801  1.00 62.96  ? 80   LEU A CA  1 
ATOM   616  C  C   . LEU A 1 80  ? 21.130  -32.019 50.302  1.00 64.03  ? 80   LEU A C   1 
ATOM   617  O  O   . LEU A 1 80  ? 22.091  -32.477 49.684  1.00 64.67  ? 80   LEU A O   1 
ATOM   618  C  CB  . LEU A 1 80  ? 19.905  -33.260 52.070  1.00 72.45  ? 80   LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 80  ? 20.071  -34.586 51.320  1.00 75.19  ? 80   LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 80  ? 21.412  -35.221 51.671  1.00 81.13  ? 80   LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 80  ? 18.923  -35.518 51.654  1.00 62.02  ? 80   LEU A CD2 1 
ATOM   622  N  N   . ASN A 1 81  ? 20.172  -31.295 49.733  1.00 64.96  ? 81   ASN A N   1 
ATOM   623  C  CA  . ASN A 1 81  ? 20.157  -31.010 48.308  1.00 63.85  ? 81   ASN A CA  1 
ATOM   624  C  C   . ASN A 1 81  ? 21.446  -30.325 47.888  1.00 67.85  ? 81   ASN A C   1 
ATOM   625  O  O   . ASN A 1 81  ? 22.123  -30.796 46.971  1.00 62.84  ? 81   ASN A O   1 
ATOM   626  C  CB  . ASN A 1 81  ? 18.950  -30.141 47.947  1.00 67.59  ? 81   ASN A CB  1 
ATOM   627  C  CG  . ASN A 1 81  ? 17.631  -30.850 48.184  1.00 73.43  ? 81   ASN A CG  1 
ATOM   628  O  OD1 . ASN A 1 81  ? 17.603  -32.051 48.459  1.00 75.06  ? 81   ASN A OD1 1 
ATOM   629  N  ND2 . ASN A 1 81  ? 16.529  -30.115 48.076  1.00 72.52  ? 81   ASN A ND2 1 
ATOM   630  N  N   . LYS A 1 82  ? 21.819  -29.253 48.592  1.00 72.25  ? 82   LYS A N   1 
ATOM   631  C  CA  . LYS A 1 82  ? 23.046  -28.528 48.260  1.00 73.16  ? 82   LYS A CA  1 
ATOM   632  C  C   . LYS A 1 82  ? 24.301  -29.381 48.463  1.00 68.51  ? 82   LYS A C   1 
ATOM   633  O  O   . LYS A 1 82  ? 25.394  -28.995 48.043  1.00 64.92  ? 82   LYS A O   1 
ATOM   634  C  CB  . LYS A 1 82  ? 23.160  -27.189 49.026  1.00 77.91  ? 82   LYS A CB  1 
ATOM   635  C  CG  . LYS A 1 82  ? 23.236  -27.288 50.554  1.00 78.96  ? 82   LYS A CG  1 
ATOM   636  C  CD  . LYS A 1 82  ? 24.017  -26.128 51.188  1.00 70.81  ? 82   LYS A CD  1 
ATOM   637  C  CE  . LYS A 1 82  ? 25.497  -26.234 50.846  1.00 71.64  ? 82   LYS A CE  1 
ATOM   638  N  NZ  . LYS A 1 82  ? 26.378  -25.324 51.628  1.00 73.56  ? 82   LYS A NZ  1 
ATOM   639  N  N   . ARG A 1 83  ? 24.136  -30.542 49.095  1.00 68.21  ? 83   ARG A N   1 
ATOM   640  C  CA  . ARG A 1 83  ? 25.248  -31.466 49.350  1.00 67.52  ? 83   ARG A CA  1 
ATOM   641  C  C   . ARG A 1 83  ? 25.227  -32.699 48.433  1.00 65.26  ? 83   ARG A C   1 
ATOM   642  O  O   . ARG A 1 83  ? 26.238  -33.396 48.273  1.00 61.60  ? 83   ARG A O   1 
ATOM   643  C  CB  . ARG A 1 83  ? 25.258  -31.883 50.825  1.00 56.00  ? 83   ARG A CB  1 
ATOM   644  C  CG  . ARG A 1 83  ? 25.754  -30.785 51.745  1.00 42.88  ? 83   ARG A CG  1 
ATOM   645  C  CD  . ARG A 1 83  ? 25.303  -30.991 53.171  1.00 49.75  ? 83   ARG A CD  1 
ATOM   646  N  NE  . ARG A 1 83  ? 26.017  -30.112 54.098  1.00 63.68  ? 83   ARG A NE  1 
ATOM   647  C  CZ  . ARG A 1 83  ? 25.651  -28.870 54.406  1.00 65.62  ? 83   ARG A CZ  1 
ATOM   648  N  NH1 . ARG A 1 83  ? 24.567  -28.331 53.866  1.00 62.28  ? 83   ARG A NH1 1 
ATOM   649  N  NH2 . ARG A 1 83  ? 26.377  -28.161 55.261  1.00 71.03  ? 83   ARG A NH2 1 
ATOM   650  N  N   . THR A 1 84  ? 24.081  -32.936 47.805  1.00 61.72  ? 84   THR A N   1 
ATOM   651  C  CA  . THR A 1 84  ? 23.904  -34.061 46.901  1.00 55.42  ? 84   THR A CA  1 
ATOM   652  C  C   . THR A 1 84  ? 24.610  -33.798 45.576  1.00 47.93  ? 84   THR A C   1 
ATOM   653  O  O   . THR A 1 84  ? 24.700  -32.658 45.127  1.00 49.36  ? 84   THR A O   1 
ATOM   654  C  CB  . THR A 1 84  ? 22.406  -34.293 46.644  1.00 63.48  ? 84   THR A CB  1 
ATOM   655  O  OG1 . THR A 1 84  ? 21.749  -34.573 47.889  1.00 76.93  ? 84   THR A OG1 1 
ATOM   656  C  CG2 . THR A 1 84  ? 22.191  -35.452 45.695  1.00 58.58  ? 84   THR A CG2 1 
ATOM   657  N  N   . GLN A 1 85  ? 25.127  -34.856 44.962  1.00 40.60  ? 85   GLN A N   1 
ATOM   658  C  CA  . GLN A 1 85  ? 25.817  -34.745 43.679  1.00 34.65  ? 85   GLN A CA  1 
ATOM   659  C  C   . GLN A 1 85  ? 24.884  -34.149 42.623  1.00 28.46  ? 85   GLN A C   1 
ATOM   660  O  O   . GLN A 1 85  ? 23.673  -34.135 42.792  1.00 15.11  ? 85   GLN A O   1 
ATOM   661  C  CB  . GLN A 1 85  ? 26.210  -36.134 43.182  1.00 34.98  ? 85   GLN A CB  1 
ATOM   662  C  CG  . GLN A 1 85  ? 25.007  -36.902 42.632  1.00 37.93  ? 85   GLN A CG  1 
ATOM   663  C  CD  . GLN A 1 85  ? 25.379  -38.126 41.819  1.00 41.78  ? 85   GLN A CD  1 
ATOM   664  O  OE1 . GLN A 1 85  ? 25.674  -39.181 42.385  1.00 54.23  ? 85   GLN A OE1 1 
ATOM   665  N  NE2 . GLN A 1 85  ? 25.337  -38.005 40.487  1.00 2.00   ? 85   GLN A NE2 1 
ATOM   666  N  N   . ASP A 1 86  ? 25.453  -33.759 41.489  1.00 34.96  ? 86   ASP A N   1 
ATOM   667  C  CA  . ASP A 1 86  ? 24.666  -33.223 40.387  1.00 31.78  ? 86   ASP A CA  1 
ATOM   668  C  C   . ASP A 1 86  ? 24.194  -34.367 39.520  1.00 21.49  ? 86   ASP A C   1 
ATOM   669  O  O   . ASP A 1 86  ? 24.847  -35.403 39.436  1.00 20.67  ? 86   ASP A O   1 
ATOM   670  C  CB  . ASP A 1 86  ? 25.499  -32.272 39.540  1.00 38.94  ? 86   ASP A CB  1 
ATOM   671  C  CG  . ASP A 1 86  ? 25.571  -30.899 40.135  1.00 53.41  ? 86   ASP A CG  1 
ATOM   672  O  OD1 . ASP A 1 86  ? 26.141  -30.764 41.242  1.00 45.62  ? 86   ASP A OD1 1 
ATOM   673  O  OD2 . ASP A 1 86  ? 25.029  -29.964 39.507  1.00 67.69  ? 86   ASP A OD2 1 
ATOM   674  N  N   . PHE A 1 87  ? 23.048  -34.184 38.891  1.00 23.02  ? 87   PHE A N   1 
ATOM   675  C  CA  . PHE A 1 87  ? 22.495  -35.203 38.017  1.00 30.36  ? 87   PHE A CA  1 
ATOM   676  C  C   . PHE A 1 87  ? 22.343  -34.531 36.693  1.00 32.23  ? 87   PHE A C   1 
ATOM   677  O  O   . PHE A 1 87  ? 22.632  -33.345 36.571  1.00 25.99  ? 87   PHE A O   1 
ATOM   678  C  CB  . PHE A 1 87  ? 21.116  -35.650 38.496  1.00 24.74  ? 87   PHE A CB  1 
ATOM   679  C  CG  . PHE A 1 87  ? 21.107  -36.157 39.894  1.00 27.80  ? 87   PHE A CG  1 
ATOM   680  C  CD1 . PHE A 1 87  ? 21.337  -37.502 40.157  1.00 39.14  ? 87   PHE A CD1 1 
ATOM   681  C  CD2 . PHE A 1 87  ? 20.896  -35.285 40.962  1.00 23.35  ? 87   PHE A CD2 1 
ATOM   682  C  CE1 . PHE A 1 87  ? 21.357  -37.978 41.472  1.00 45.42  ? 87   PHE A CE1 1 
ATOM   683  C  CE2 . PHE A 1 87  ? 20.914  -35.744 42.273  1.00 27.88  ? 87   PHE A CE2 1 
ATOM   684  C  CZ  . PHE A 1 87  ? 21.146  -37.095 42.533  1.00 40.81  ? 87   PHE A CZ  1 
ATOM   685  N  N   . TRP A 1 88  ? 21.924  -35.286 35.690  1.00 50.71  ? 88   TRP A N   1 
ATOM   686  C  CA  . TRP A 1 88  ? 21.722  -34.682 34.394  1.00 72.71  ? 88   TRP A CA  1 
ATOM   687  C  C   . TRP A 1 88  ? 20.413  -33.905 34.477  1.00 83.49  ? 88   TRP A C   1 
ATOM   688  O  O   . TRP A 1 88  ? 19.509  -34.271 35.240  1.00 83.19  ? 88   TRP A O   1 
ATOM   689  C  CB  . TRP A 1 88  ? 21.670  -35.719 33.274  1.00 76.42  ? 88   TRP A CB  1 
ATOM   690  C  CG  . TRP A 1 88  ? 21.716  -35.073 31.915  1.00 88.00  ? 88   TRP A CG  1 
ATOM   691  C  CD1 . TRP A 1 88  ? 20.960  -35.398 30.825  1.00 96.02  ? 88   TRP A CD1 1 
ATOM   692  C  CD2 . TRP A 1 88  ? 22.542  -33.966 31.517  1.00 90.80  ? 88   TRP A CD2 1 
ATOM   693  N  NE1 . TRP A 1 88  ? 21.264  -34.564 29.772  1.00 97.73  ? 88   TRP A NE1 1 
ATOM   694  C  CE2 . TRP A 1 88  ? 22.228  -33.674 30.169  1.00 92.87  ? 88   TRP A CE2 1 
ATOM   695  C  CE3 . TRP A 1 88  ? 23.511  -33.187 32.166  1.00 89.26  ? 88   TRP A CE3 1 
ATOM   696  C  CZ2 . TRP A 1 88  ? 22.847  -32.638 29.461  1.00 90.35  ? 88   TRP A CZ2 1 
ATOM   697  C  CZ3 . TRP A 1 88  ? 24.126  -32.156 31.463  1.00 88.58  ? 88   TRP A CZ3 1 
ATOM   698  C  CH2 . TRP A 1 88  ? 23.791  -31.892 30.123  1.00 87.54  ? 88   TRP A CH2 1 
ATOM   699  N  N   . GLU A 1 89  ? 20.352  -32.794 33.747  1.00 91.17  ? 89   GLU A N   1 
ATOM   700  C  CA  . GLU A 1 89  ? 19.174  -31.937 33.725  1.00 95.49  ? 89   GLU A CA  1 
ATOM   701  C  C   . GLU A 1 89  ? 17.896  -32.715 33.453  1.00 95.51  ? 89   GLU A C   1 
ATOM   702  O  O   . GLU A 1 89  ? 17.841  -33.549 32.548  1.00 91.89  ? 89   GLU A O   1 
ATOM   703  C  CB  . GLU A 1 89  ? 19.328  -30.823 32.671  1.00 98.30  ? 89   GLU A CB  1 
ATOM   704  C  CG  . GLU A 1 89  ? 19.520  -31.312 31.222  1.00 97.93  ? 89   GLU A CG  1 
ATOM   705  C  CD  . GLU A 1 89  ? 18.367  -30.940 30.285  1.00 95.91  ? 89   GLU A CD  1 
ATOM   706  O  OE1 . GLU A 1 89  ? 17.293  -31.577 30.362  1.00 95.40  ? 89   GLU A OE1 1 
ATOM   707  O  OE2 . GLU A 1 89  ? 18.542  -30.023 29.452  1.00 94.53  ? 89   GLU A OE2 1 
ATOM   708  N  N   . VAL A 1 90  ? 16.890  -32.477 34.284  1.00 99.69  ? 90   VAL A N   1 
ATOM   709  C  CA  . VAL A 1 90  ? 15.600  -33.117 34.099  1.00 104.29 ? 90   VAL A CA  1 
ATOM   710  C  C   . VAL A 1 90  ? 14.985  -32.378 32.899  1.00 110.15 ? 90   VAL A C   1 
ATOM   711  O  O   . VAL A 1 90  ? 15.439  -31.282 32.550  1.00 112.96 ? 90   VAL A O   1 
ATOM   712  C  CB  . VAL A 1 90  ? 14.719  -32.971 35.368  1.00 101.67 ? 90   VAL A CB  1 
ATOM   713  C  CG1 . VAL A 1 90  ? 15.459  -33.513 36.580  1.00 101.25 ? 90   VAL A CG1 1 
ATOM   714  C  CG2 . VAL A 1 90  ? 14.347  -31.516 35.601  1.00 104.37 ? 90   VAL A CG2 1 
ATOM   715  N  N   . GLN A 1 91  ? 13.982  -32.970 32.254  1.00 113.48 ? 91   GLN A N   1 
ATOM   716  C  CA  . GLN A 1 91  ? 13.351  -32.345 31.087  1.00 115.49 ? 91   GLN A CA  1 
ATOM   717  C  C   . GLN A 1 91  ? 12.952  -30.907 31.383  1.00 109.93 ? 91   GLN A C   1 
ATOM   718  O  O   . GLN A 1 91  ? 12.025  -30.654 32.152  1.00 112.24 ? 91   GLN A O   1 
ATOM   719  C  CB  . GLN A 1 91  ? 12.110  -33.134 30.635  1.00 126.59 ? 91   GLN A CB  1 
ATOM   720  C  CG  . GLN A 1 91  ? 11.377  -32.541 29.414  1.00 131.41 ? 91   GLN A CG  1 
ATOM   721  C  CD  . GLN A 1 91  ? 9.966   -33.101 29.235  1.00 133.99 ? 91   GLN A CD  1 
ATOM   722  O  OE1 . GLN A 1 91  ? 9.116   -32.964 30.116  1.00 134.00 ? 91   GLN A OE1 1 
ATOM   723  N  NE2 . GLN A 1 91  ? 9.713   -33.722 28.092  1.00 132.40 ? 91   GLN A NE2 1 
ATOM   724  N  N   . LEU A 1 92  ? 13.700  -29.967 30.828  1.00 102.03 ? 92   LEU A N   1 
ATOM   725  C  CA  . LEU A 1 92  ? 13.379  -28.568 31.031  1.00 95.41  ? 92   LEU A CA  1 
ATOM   726  C  C   . LEU A 1 92  ? 12.697  -28.017 29.790  1.00 86.48  ? 92   LEU A C   1 
ATOM   727  O  O   . LEU A 1 92  ? 12.063  -26.958 29.827  1.00 85.56  ? 92   LEU A O   1 
ATOM   728  C  CB  . LEU A 1 92  ? 14.628  -27.773 31.397  1.00 100.62 ? 92   LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 92  ? 14.588  -27.257 32.842  1.00 106.46 ? 92   LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 92  ? 13.444  -26.253 32.990  1.00 107.98 ? 92   LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 92  ? 14.417  -28.413 33.830  1.00 101.41 ? 92   LEU A CD2 1 
ATOM   732  N  N   . GLY A 1 93  ? 12.806  -28.772 28.700  1.00 77.32  ? 93   GLY A N   1 
ATOM   733  C  CA  . GLY A 1 93  ? 12.184  -28.383 27.451  1.00 61.47  ? 93   GLY A CA  1 
ATOM   734  C  C   . GLY A 1 93  ? 10.901  -29.181 27.335  1.00 49.85  ? 93   GLY A C   1 
ATOM   735  O  O   . GLY A 1 93  ? 10.940  -30.358 26.990  1.00 45.72  ? 93   GLY A O   1 
ATOM   736  N  N   . ILE A 1 94  ? 9.781   -28.571 27.717  1.00 40.26  ? 94   ILE A N   1 
ATOM   737  C  CA  . ILE A 1 94  ? 8.476   -29.225 27.654  1.00 28.81  ? 94   ILE A CA  1 
ATOM   738  C  C   . ILE A 1 94  ? 7.885   -29.118 26.251  1.00 38.03  ? 94   ILE A C   1 
ATOM   739  O  O   . ILE A 1 94  ? 8.247   -28.225 25.474  1.00 42.72  ? 94   ILE A O   1 
ATOM   740  C  CB  . ILE A 1 94  ? 7.484   -28.635 28.678  1.00 27.40  ? 94   ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 94  ? 7.224   -27.149 28.409  1.00 37.49  ? 94   ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 94  ? 8.008   -28.835 30.094  1.00 24.35  ? 94   ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 94  ? 8.289   -26.197 28.970  1.00 53.56  ? 94   ILE A CD1 1 
ATOM   744  N  N   . PRO A 1 95  ? 6.968   -30.031 25.896  1.00 42.26  ? 95   PRO A N   1 
ATOM   745  C  CA  . PRO A 1 95  ? 6.380   -29.966 24.556  1.00 36.39  ? 95   PRO A CA  1 
ATOM   746  C  C   . PRO A 1 95  ? 5.569   -28.700 24.407  1.00 29.69  ? 95   PRO A C   1 
ATOM   747  O  O   . PRO A 1 95  ? 5.098   -28.132 25.393  1.00 29.48  ? 95   PRO A O   1 
ATOM   748  C  CB  . PRO A 1 95  ? 5.468   -31.191 24.521  1.00 41.50  ? 95   PRO A CB  1 
ATOM   749  C  CG  . PRO A 1 95  ? 6.056   -32.113 25.573  1.00 42.60  ? 95   PRO A CG  1 
ATOM   750  C  CD  . PRO A 1 95  ? 6.396   -31.149 26.663  1.00 40.80  ? 95   PRO A CD  1 
ATOM   751  N  N   . HIS A 1 96  ? 5.439   -28.234 23.178  1.00 26.50  ? 96   HIS A N   1 
ATOM   752  C  CA  . HIS A 1 96  ? 4.652   -27.039 22.915  1.00 28.32  ? 96   HIS A CA  1 
ATOM   753  C  C   . HIS A 1 96  ? 3.426   -27.477 22.132  1.00 20.58  ? 96   HIS A C   1 
ATOM   754  O  O   . HIS A 1 96  ? 3.549   -28.147 21.110  1.00 24.74  ? 96   HIS A O   1 
ATOM   755  C  CB  . HIS A 1 96  ? 5.431   -25.991 22.110  1.00 36.34  ? 96   HIS A CB  1 
ATOM   756  C  CG  . HIS A 1 96  ? 4.676   -24.707 21.911  1.00 58.63  ? 96   HIS A CG  1 
ATOM   757  N  ND1 . HIS A 1 96  ? 4.719   -23.668 22.817  1.00 60.33  ? 96   HIS A ND1 1 
ATOM   758  C  CD2 . HIS A 1 96  ? 3.829   -24.311 20.929  1.00 61.12  ? 96   HIS A CD2 1 
ATOM   759  C  CE1 . HIS A 1 96  ? 3.931   -22.689 22.404  1.00 54.99  ? 96   HIS A CE1 1 
ATOM   760  N  NE2 . HIS A 1 96  ? 3.379   -23.055 21.262  1.00 58.61  ? 96   HIS A NE2 1 
ATOM   761  N  N   . PRO A 1 97  ? 2.227   -27.127 22.621  1.00 6.73   ? 97   PRO A N   1 
ATOM   762  C  CA  . PRO A 1 97  ? 0.955   -27.466 21.992  1.00 5.32   ? 97   PRO A CA  1 
ATOM   763  C  C   . PRO A 1 97  ? 0.980   -27.479 20.466  1.00 5.17   ? 97   PRO A C   1 
ATOM   764  O  O   . PRO A 1 97  ? 0.550   -28.446 19.851  1.00 9.17   ? 97   PRO A O   1 
ATOM   765  C  CB  . PRO A 1 97  ? 0.030   -26.406 22.567  1.00 12.34  ? 97   PRO A CB  1 
ATOM   766  C  CG  . PRO A 1 97  ? 0.483   -26.407 24.011  1.00 9.21   ? 97   PRO A CG  1 
ATOM   767  C  CD  . PRO A 1 97  ? 1.997   -26.407 23.889  1.00 3.84   ? 97   PRO A CD  1 
ATOM   768  N  N   . ALA A 1 98  ? 1.536   -26.438 19.861  1.00 9.14   ? 98   ALA A N   1 
ATOM   769  C  CA  . ALA A 1 98  ? 1.625   -26.352 18.412  1.00 7.87   ? 98   ALA A CA  1 
ATOM   770  C  C   . ALA A 1 98  ? 2.331   -27.550 17.789  1.00 9.50   ? 98   ALA A C   1 
ATOM   771  O  O   . ALA A 1 98  ? 2.096   -27.863 16.625  1.00 2.60   ? 98   ALA A O   1 
ATOM   772  C  CB  . ALA A 1 98  ? 2.341   -25.096 18.032  1.00 24.91  ? 98   ALA A CB  1 
ATOM   773  N  N   . GLY A 1 99  ? 3.239   -28.164 18.556  1.00 19.74  ? 99   GLY A N   1 
ATOM   774  C  CA  . GLY A 1 99  ? 4.005   -29.324 18.111  1.00 22.43  ? 99   GLY A CA  1 
ATOM   775  C  C   . GLY A 1 99  ? 3.372   -30.690 18.343  1.00 24.05  ? 99   GLY A C   1 
ATOM   776  O  O   . GLY A 1 99  ? 3.735   -31.651 17.657  1.00 26.99  ? 99   GLY A O   1 
ATOM   777  N  N   . LEU A 1 100 ? 2.468   -30.795 19.321  1.00 13.17  ? 100  LEU A N   1 
ATOM   778  C  CA  . LEU A 1 100 ? 1.783   -32.056 19.607  1.00 14.06  ? 100  LEU A CA  1 
ATOM   779  C  C   . LEU A 1 100 ? 0.903   -32.463 18.406  1.00 27.28  ? 100  LEU A C   1 
ATOM   780  O  O   . LEU A 1 100 ? 0.503   -31.619 17.593  1.00 26.68  ? 100  LEU A O   1 
ATOM   781  C  CB  . LEU A 1 100 ? 0.868   -31.916 20.822  1.00 2.00   ? 100  LEU A CB  1 
ATOM   782  C  CG  . LEU A 1 100 ? 1.306   -31.177 22.082  1.00 17.02  ? 100  LEU A CG  1 
ATOM   783  C  CD1 . LEU A 1 100 ? 0.163   -31.252 23.071  1.00 24.49  ? 100  LEU A CD1 1 
ATOM   784  C  CD2 . LEU A 1 100 ? 2.583   -31.759 22.687  1.00 21.91  ? 100  LEU A CD2 1 
ATOM   785  N  N   . LYS A 1 101 ? 0.577   -33.750 18.314  1.00 29.30  ? 101  LYS A N   1 
ATOM   786  C  CA  . LYS A 1 101 ? -0.266  -34.242 17.236  1.00 24.99  ? 101  LYS A CA  1 
ATOM   787  C  C   . LYS A 1 101 ? -1.675  -34.491 17.757  1.00 28.98  ? 101  LYS A C   1 
ATOM   788  O  O   . LYS A 1 101 ? -1.859  -34.732 18.956  1.00 24.68  ? 101  LYS A O   1 
ATOM   789  C  CB  . LYS A 1 101 ? 0.304   -35.532 16.655  1.00 27.08  ? 101  LYS A CB  1 
ATOM   790  C  CG  . LYS A 1 101 ? 1.591   -35.366 15.874  1.00 35.50  ? 101  LYS A CG  1 
ATOM   791  C  CD  . LYS A 1 101 ? 2.777   -35.710 16.736  1.00 51.26  ? 101  LYS A CD  1 
ATOM   792  C  CE  . LYS A 1 101 ? 4.083   -35.391 16.036  1.00 67.56  ? 101  LYS A CE  1 
ATOM   793  N  NZ  . LYS A 1 101 ? 4.996   -34.695 16.988  1.00 77.18  ? 101  LYS A NZ  1 
ATOM   794  N  N   . LYS A 1 102 ? -2.668  -34.416 16.864  1.00 32.04  ? 102  LYS A N   1 
ATOM   795  C  CA  . LYS A 1 102 ? -4.061  -34.648 17.256  1.00 29.78  ? 102  LYS A CA  1 
ATOM   796  C  C   . LYS A 1 102 ? -4.341  -36.140 17.462  1.00 27.15  ? 102  LYS A C   1 
ATOM   797  O  O   . LYS A 1 102 ? -3.935  -36.985 16.648  1.00 15.19  ? 102  LYS A O   1 
ATOM   798  C  CB  . LYS A 1 102 ? -5.045  -34.028 16.250  1.00 33.80  ? 102  LYS A CB  1 
ATOM   799  C  CG  . LYS A 1 102 ? -5.475  -34.922 15.096  1.00 38.17  ? 102  LYS A CG  1 
ATOM   800  C  CD  . LYS A 1 102 ? -6.799  -34.452 14.502  1.00 38.42  ? 102  LYS A CD  1 
ATOM   801  C  CE  . LYS A 1 102 ? -7.916  -34.372 15.558  1.00 45.46  ? 102  LYS A CE  1 
ATOM   802  N  NZ  . LYS A 1 102 ? -7.944  -35.554 16.484  1.00 44.24  ? 102  LYS A NZ  1 
ATOM   803  N  N   . LYS A 1 103 ? -5.059  -36.448 18.541  1.00 32.47  ? 103  LYS A N   1 
ATOM   804  C  CA  . LYS A 1 103 ? -5.369  -37.828 18.903  1.00 36.28  ? 103  LYS A CA  1 
ATOM   805  C  C   . LYS A 1 103 ? -6.844  -38.115 19.077  1.00 44.85  ? 103  LYS A C   1 
ATOM   806  O  O   . LYS A 1 103 ? -7.612  -37.212 19.405  1.00 55.40  ? 103  LYS A O   1 
ATOM   807  C  CB  . LYS A 1 103 ? -4.654  -38.168 20.204  1.00 21.82  ? 103  LYS A CB  1 
ATOM   808  C  CG  . LYS A 1 103 ? -3.177  -37.949 20.114  1.00 7.30   ? 103  LYS A CG  1 
ATOM   809  C  CD  . LYS A 1 103 ? -2.512  -38.967 19.241  1.00 16.73  ? 103  LYS A CD  1 
ATOM   810  C  CE  . LYS A 1 103 ? -1.254  -38.393 18.653  1.00 13.01  ? 103  LYS A CE  1 
ATOM   811  N  NZ  . LYS A 1 103 ? -1.183  -38.731 17.220  1.00 5.05   ? 103  LYS A NZ  1 
ATOM   812  N  N   . LYS A 1 104 ? -7.219  -39.383 18.894  1.00 43.78  ? 104  LYS A N   1 
ATOM   813  C  CA  . LYS A 1 104 ? -8.603  -39.834 19.055  1.00 41.53  ? 104  LYS A CA  1 
ATOM   814  C  C   . LYS A 1 104 ? -9.013  -39.657 20.516  1.00 38.01  ? 104  LYS A C   1 
ATOM   815  O  O   . LYS A 1 104 ? -10.144 -39.287 20.822  1.00 39.47  ? 104  LYS A O   1 
ATOM   816  C  CB  . LYS A 1 104 ? -8.724  -41.310 18.681  1.00 50.86  ? 104  LYS A CB  1 
ATOM   817  C  CG  . LYS A 1 104 ? -9.752  -41.604 17.603  1.00 58.32  ? 104  LYS A CG  1 
ATOM   818  C  CD  . LYS A 1 104 ? -9.266  -41.181 16.227  1.00 59.68  ? 104  LYS A CD  1 
ATOM   819  C  CE  . LYS A 1 104 ? -10.322 -41.450 15.173  1.00 57.02  ? 104  LYS A CE  1 
ATOM   820  N  NZ  . LYS A 1 104 ? -11.572 -40.691 15.471  1.00 60.64  ? 104  LYS A NZ  1 
ATOM   821  N  N   . SER A 1 105 ? -8.091  -39.965 21.416  1.00 34.03  ? 105  SER A N   1 
ATOM   822  C  CA  . SER A 1 105 ? -8.331  -39.820 22.839  1.00 32.15  ? 105  SER A CA  1 
ATOM   823  C  C   . SER A 1 105 ? -7.000  -39.515 23.449  1.00 27.61  ? 105  SER A C   1 
ATOM   824  O  O   . SER A 1 105 ? -5.953  -39.748 22.844  1.00 24.69  ? 105  SER A O   1 
ATOM   825  C  CB  . SER A 1 105 ? -8.825  -41.128 23.466  1.00 42.07  ? 105  SER A CB  1 
ATOM   826  O  OG  . SER A 1 105 ? -10.125 -41.469 23.042  1.00 56.96  ? 105  SER A OG  1 
ATOM   827  N  N   . VAL A 1 106 ? -7.048  -39.043 24.677  1.00 26.59  ? 106  VAL A N   1 
ATOM   828  C  CA  . VAL A 1 106 ? -5.857  -38.736 25.436  1.00 25.91  ? 106  VAL A CA  1 
ATOM   829  C  C   . VAL A 1 106 ? -6.319  -38.905 26.854  1.00 22.36  ? 106  VAL A C   1 
ATOM   830  O  O   . VAL A 1 106 ? -7.422  -38.483 27.200  1.00 23.88  ? 106  VAL A O   1 
ATOM   831  C  CB  . VAL A 1 106 ? -5.412  -37.285 25.272  1.00 26.95  ? 106  VAL A CB  1 
ATOM   832  C  CG1 . VAL A 1 106 ? -4.276  -36.997 26.242  1.00 25.59  ? 106  VAL A CG1 1 
ATOM   833  C  CG2 . VAL A 1 106 ? -4.997  -37.007 23.833  1.00 2.00   ? 106  VAL A CG2 1 
ATOM   834  N  N   . THR A 1 107 ? -5.504  -39.560 27.660  1.00 15.37  ? 107  THR A N   1 
ATOM   835  C  CA  . THR A 1 107 ? -5.851  -39.776 29.042  1.00 18.62  ? 107  THR A CA  1 
ATOM   836  C  C   . THR A 1 107 ? -4.687  -39.397 29.915  1.00 21.06  ? 107  THR A C   1 
ATOM   837  O  O   . THR A 1 107 ? -3.528  -39.528 29.518  1.00 18.67  ? 107  THR A O   1 
ATOM   838  C  CB  . THR A 1 107 ? -6.167  -41.248 29.289  1.00 15.67  ? 107  THR A CB  1 
ATOM   839  O  OG1 . THR A 1 107 ? -7.244  -41.646 28.421  1.00 7.82   ? 107  THR A OG1 1 
ATOM   840  C  CG2 . THR A 1 107 ? -6.506  -41.493 30.785  1.00 2.00   ? 107  THR A CG2 1 
ATOM   841  N  N   . VAL A 1 108 ? -4.995  -38.868 31.087  1.00 24.67  ? 108  VAL A N   1 
ATOM   842  C  CA  . VAL A 1 108 ? -3.944  -38.538 32.026  1.00 29.92  ? 108  VAL A CA  1 
ATOM   843  C  C   . VAL A 1 108 ? -4.087  -39.479 33.225  1.00 22.60  ? 108  VAL A C   1 
ATOM   844  O  O   . VAL A 1 108 ? -5.186  -39.716 33.714  1.00 15.68  ? 108  VAL A O   1 
ATOM   845  C  CB  . VAL A 1 108 ? -3.971  -37.070 32.458  1.00 28.67  ? 108  VAL A CB  1 
ATOM   846  C  CG1 . VAL A 1 108 ? -5.363  -36.675 32.899  1.00 25.45  ? 108  VAL A CG1 1 
ATOM   847  C  CG2 . VAL A 1 108 ? -2.951  -36.848 33.573  1.00 23.86  ? 108  VAL A CG2 1 
ATOM   848  N  N   . LEU A 1 109 ? -2.985  -40.123 33.577  1.00 23.62  ? 109  LEU A N   1 
ATOM   849  C  CA  . LEU A 1 109 ? -2.945  -41.051 34.691  1.00 28.47  ? 109  LEU A CA  1 
ATOM   850  C  C   . LEU A 1 109 ? -2.093  -40.373 35.757  1.00 27.79  ? 109  LEU A C   1 
ATOM   851  O  O   . LEU A 1 109 ? -1.096  -39.697 35.447  1.00 21.77  ? 109  LEU A O   1 
ATOM   852  C  CB  . LEU A 1 109 ? -2.321  -42.371 34.227  1.00 33.09  ? 109  LEU A CB  1 
ATOM   853  C  CG  . LEU A 1 109 ? -2.839  -43.701 34.773  1.00 28.27  ? 109  LEU A CG  1 
ATOM   854  C  CD1 . LEU A 1 109 ? -4.349  -43.783 34.701  1.00 25.35  ? 109  LEU A CD1 1 
ATOM   855  C  CD2 . LEU A 1 109 ? -2.237  -44.805 33.951  1.00 32.94  ? 109  LEU A CD2 1 
ATOM   856  N  N   . ASP A 1 110 ? -2.476  -40.534 37.013  1.00 28.90  ? 110  ASP A N   1 
ATOM   857  C  CA  . ASP A 1 110 ? -1.716  -39.865 38.046  1.00 41.08  ? 110  ASP A CA  1 
ATOM   858  C  C   . ASP A 1 110 ? -0.900  -40.734 38.972  1.00 43.10  ? 110  ASP A C   1 
ATOM   859  O  O   . ASP A 1 110 ? -1.388  -41.229 39.987  1.00 46.13  ? 110  ASP A O   1 
ATOM   860  C  CB  . ASP A 1 110 ? -2.589  -38.921 38.857  1.00 44.61  ? 110  ASP A CB  1 
ATOM   861  C  CG  . ASP A 1 110 ? -1.816  -37.731 39.351  1.00 52.31  ? 110  ASP A CG  1 
ATOM   862  O  OD1 . ASP A 1 110 ? -1.126  -37.850 40.389  1.00 51.68  ? 110  ASP A OD1 1 
ATOM   863  O  OD2 . ASP A 1 110 ? -1.856  -36.689 38.664  1.00 57.13  ? 110  ASP A OD2 1 
ATOM   864  N  N   . VAL A 1 111 ? 0.376   -40.845 38.645  1.00 39.20  ? 111  VAL A N   1 
ATOM   865  C  CA  . VAL A 1 111 ? 1.317   -41.618 39.426  1.00 33.48  ? 111  VAL A CA  1 
ATOM   866  C  C   . VAL A 1 111 ? 1.756   -40.725 40.595  1.00 43.86  ? 111  VAL A C   1 
ATOM   867  O  O   . VAL A 1 111 ? 2.945   -40.533 40.858  1.00 43.72  ? 111  VAL A O   1 
ATOM   868  C  CB  . VAL A 1 111 ? 2.486   -42.053 38.522  1.00 28.16  ? 111  VAL A CB  1 
ATOM   869  C  CG1 . VAL A 1 111 ? 2.095   -43.297 37.777  1.00 29.53  ? 111  VAL A CG1 1 
ATOM   870  C  CG2 . VAL A 1 111 ? 2.797   -40.977 37.477  1.00 29.21  ? 111  VAL A CG2 1 
ATOM   871  N  N   . GLY A 1 112 ? 0.750   -40.227 41.314  1.00 52.84  ? 112  GLY A N   1 
ATOM   872  C  CA  . GLY A 1 112 ? 0.931   -39.319 42.432  1.00 60.02  ? 112  GLY A CA  1 
ATOM   873  C  C   . GLY A 1 112 ? 2.158   -39.463 43.298  1.00 62.16  ? 112  GLY A C   1 
ATOM   874  O  O   . GLY A 1 112 ? 3.251   -39.014 42.943  1.00 62.42  ? 112  GLY A O   1 
ATOM   875  N  N   . ASP A 1 113 ? 1.980   -40.068 44.460  1.00 65.99  ? 113  ASP A N   1 
ATOM   876  C  CA  . ASP A 1 113 ? 3.105   -40.239 45.356  1.00 75.88  ? 113  ASP A CA  1 
ATOM   877  C  C   . ASP A 1 113 ? 3.995   -41.375 44.880  1.00 77.64  ? 113  ASP A C   1 
ATOM   878  O  O   . ASP A 1 113 ? 4.456   -42.197 45.676  1.00 74.76  ? 113  ASP A O   1 
ATOM   879  C  CB  . ASP A 1 113 ? 2.644   -40.446 46.804  1.00 78.40  ? 113  ASP A CB  1 
ATOM   880  C  CG  . ASP A 1 113 ? 1.404   -41.304 46.910  1.00 85.51  ? 113  ASP A CG  1 
ATOM   881  O  OD1 . ASP A 1 113 ? 1.243   -42.240 46.097  1.00 88.95  ? 113  ASP A OD1 1 
ATOM   882  O  OD2 . ASP A 1 113 ? 0.583   -41.031 47.809  1.00 91.11  ? 113  ASP A OD2 1 
ATOM   883  N  N   . ALA A 1 114 ? 4.243   -41.412 43.573  1.00 76.54  ? 114  ALA A N   1 
ATOM   884  C  CA  . ALA A 1 114 ? 5.101   -42.432 43.012  1.00 78.44  ? 114  ALA A CA  1 
ATOM   885  C  C   . ALA A 1 114 ? 6.524   -42.095 43.449  1.00 78.48  ? 114  ALA A C   1 
ATOM   886  O  O   . ALA A 1 114 ? 7.421   -42.936 43.374  1.00 73.40  ? 114  ALA A O   1 
ATOM   887  C  CB  . ALA A 1 114 ? 4.977   -42.477 41.508  1.00 80.36  ? 114  ALA A CB  1 
ATOM   888  N  N   . TYR A 1 115 ? 6.722   -40.855 43.905  1.00 80.94  ? 115  TYR A N   1 
ATOM   889  C  CA  . TYR A 1 115 ? 8.016   -40.413 44.423  1.00 83.02  ? 115  TYR A CA  1 
ATOM   890  C  C   . TYR A 1 115 ? 8.377   -41.403 45.520  1.00 81.38  ? 115  TYR A C   1 
ATOM   891  O  O   . TYR A 1 115 ? 9.471   -41.965 45.550  1.00 77.94  ? 115  TYR A O   1 
ATOM   892  C  CB  . TYR A 1 115 ? 7.887   -39.027 45.057  1.00 86.45  ? 115  TYR A CB  1 
ATOM   893  C  CG  . TYR A 1 115 ? 8.224   -37.899 44.132  1.00 93.91  ? 115  TYR A CG  1 
ATOM   894  C  CD1 . TYR A 1 115 ? 9.442   -37.873 43.452  1.00 98.05  ? 115  TYR A CD1 1 
ATOM   895  C  CD2 . TYR A 1 115 ? 7.340   -36.844 43.948  1.00 93.97  ? 115  TYR A CD2 1 
ATOM   896  C  CE1 . TYR A 1 115 ? 9.774   -36.820 42.612  1.00 103.25 ? 115  TYR A CE1 1 
ATOM   897  C  CE2 . TYR A 1 115 ? 7.661   -35.782 43.111  1.00 103.91 ? 115  TYR A CE2 1 
ATOM   898  C  CZ  . TYR A 1 115 ? 8.881   -35.775 42.446  1.00 106.92 ? 115  TYR A CZ  1 
ATOM   899  O  OH  . TYR A 1 115 ? 9.209   -34.718 41.627  1.00 108.94 ? 115  TYR A OH  1 
ATOM   900  N  N   . PHE A 1 116 ? 7.389   -41.667 46.367  1.00 82.51  ? 116  PHE A N   1 
ATOM   901  C  CA  . PHE A 1 116 ? 7.523   -42.582 47.489  1.00 76.09  ? 116  PHE A CA  1 
ATOM   902  C  C   . PHE A 1 116 ? 7.341   -44.052 47.085  1.00 69.99  ? 116  PHE A C   1 
ATOM   903  O  O   . PHE A 1 116 ? 7.147   -44.918 47.935  1.00 68.98  ? 116  PHE A O   1 
ATOM   904  C  CB  . PHE A 1 116 ? 6.529   -42.186 48.587  1.00 76.22  ? 116  PHE A CB  1 
ATOM   905  C  CG  . PHE A 1 116 ? 6.759   -40.800 49.152  1.00 75.86  ? 116  PHE A CG  1 
ATOM   906  C  CD1 . PHE A 1 116 ? 6.268   -39.669 48.499  1.00 79.53  ? 116  PHE A CD1 1 
ATOM   907  C  CD2 . PHE A 1 116 ? 7.456   -40.629 50.345  1.00 68.38  ? 116  PHE A CD2 1 
ATOM   908  C  CE1 . PHE A 1 116 ? 6.469   -38.397 49.031  1.00 75.78  ? 116  PHE A CE1 1 
ATOM   909  C  CE2 . PHE A 1 116 ? 7.659   -39.360 50.882  1.00 66.45  ? 116  PHE A CE2 1 
ATOM   910  C  CZ  . PHE A 1 116 ? 7.166   -38.243 50.228  1.00 72.39  ? 116  PHE A CZ  1 
ATOM   911  N  N   . SER A 1 117 ? 7.383   -44.322 45.784  1.00 65.98  ? 117  SER A N   1 
ATOM   912  C  CA  . SER A 1 117 ? 7.258   -45.678 45.269  1.00 64.19  ? 117  SER A CA  1 
ATOM   913  C  C   . SER A 1 117 ? 8.646   -46.210 44.893  1.00 66.73  ? 117  SER A C   1 
ATOM   914  O  O   . SER A 1 117 ? 8.912   -47.407 45.008  1.00 72.25  ? 117  SER A O   1 
ATOM   915  C  CB  . SER A 1 117 ? 6.348   -45.711 44.036  1.00 64.90  ? 117  SER A CB  1 
ATOM   916  O  OG  . SER A 1 117 ? 5.081   -45.139 44.309  1.00 69.57  ? 117  SER A OG  1 
ATOM   917  N  N   . VAL A 1 118 ? 9.525   -45.320 44.430  1.00 66.16  ? 118  VAL A N   1 
ATOM   918  C  CA  . VAL A 1 118 ? 10.886  -45.697 44.023  1.00 52.69  ? 118  VAL A CA  1 
ATOM   919  C  C   . VAL A 1 118 ? 11.855  -45.799 45.198  1.00 50.46  ? 118  VAL A C   1 
ATOM   920  O  O   . VAL A 1 118 ? 11.990  -44.860 45.990  1.00 48.01  ? 118  VAL A O   1 
ATOM   921  C  CB  . VAL A 1 118 ? 11.468  -44.706 42.983  1.00 42.06  ? 118  VAL A CB  1 
ATOM   922  C  CG1 . VAL A 1 118 ? 12.843  -45.167 42.514  1.00 40.47  ? 118  VAL A CG1 1 
ATOM   923  C  CG2 . VAL A 1 118 ? 10.529  -44.575 41.801  1.00 34.38  ? 118  VAL A CG2 1 
ATOM   924  N  N   . PRO A 1 119 ? 12.570  -46.934 45.298  1.00 52.70  ? 119  PRO A N   1 
ATOM   925  C  CA  . PRO A 1 119 ? 13.544  -47.201 46.363  1.00 51.68  ? 119  PRO A CA  1 
ATOM   926  C  C   . PRO A 1 119 ? 14.698  -46.205 46.344  1.00 51.79  ? 119  PRO A C   1 
ATOM   927  O  O   . PRO A 1 119 ? 15.114  -45.743 45.276  1.00 51.76  ? 119  PRO A O   1 
ATOM   928  C  CB  . PRO A 1 119 ? 14.050  -48.606 46.018  1.00 54.81  ? 119  PRO A CB  1 
ATOM   929  C  CG  . PRO A 1 119 ? 12.928  -49.211 45.215  1.00 60.93  ? 119  PRO A CG  1 
ATOM   930  C  CD  . PRO A 1 119 ? 12.507  -48.066 44.354  1.00 54.70  ? 119  PRO A CD  1 
ATOM   931  N  N   . LEU A 1 120 ? 15.222  -45.886 47.522  1.00 50.21  ? 120  LEU A N   1 
ATOM   932  C  CA  . LEU A 1 120 ? 16.342  -44.963 47.623  1.00 56.03  ? 120  LEU A CA  1 
ATOM   933  C  C   . LEU A 1 120 ? 17.604  -45.809 47.583  1.00 57.65  ? 120  LEU A C   1 
ATOM   934  O  O   . LEU A 1 120 ? 17.578  -46.973 47.983  1.00 51.11  ? 120  LEU A O   1 
ATOM   935  C  CB  . LEU A 1 120 ? 16.305  -44.190 48.950  1.00 56.32  ? 120  LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 120 ? 16.587  -42.677 48.965  1.00 52.89  ? 120  LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 120 ? 17.246  -42.296 50.275  1.00 46.66  ? 120  LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 120 ? 17.474  -42.256 47.809  1.00 45.91  ? 120  LEU A CD2 1 
ATOM   939  N  N   . ASP A 1 121 ? 18.690  -45.248 47.058  1.00 63.88  ? 121  ASP A N   1 
ATOM   940  C  CA  . ASP A 1 121 ? 19.953  -45.969 47.023  1.00 70.84  ? 121  ASP A CA  1 
ATOM   941  C  C   . ASP A 1 121 ? 20.324  -46.206 48.485  1.00 76.15  ? 121  ASP A C   1 
ATOM   942  O  O   . ASP A 1 121 ? 20.747  -45.288 49.195  1.00 78.13  ? 121  ASP A O   1 
ATOM   943  C  CB  . ASP A 1 121 ? 21.044  -45.150 46.326  1.00 68.48  ? 121  ASP A CB  1 
ATOM   944  C  CG  . ASP A 1 121 ? 22.379  -45.886 46.258  1.00 66.88  ? 121  ASP A CG  1 
ATOM   945  O  OD1 . ASP A 1 121 ? 22.398  -47.025 45.748  1.00 64.80  ? 121  ASP A OD1 1 
ATOM   946  O  OD2 . ASP A 1 121 ? 23.407  -45.327 46.710  1.00 65.00  ? 121  ASP A OD2 1 
ATOM   947  N  N   . GLU A 1 122 ? 20.069  -47.426 48.938  1.00 76.92  ? 122  GLU A N   1 
ATOM   948  C  CA  . GLU A 1 122 ? 20.344  -47.867 50.300  1.00 82.08  ? 122  GLU A CA  1 
ATOM   949  C  C   . GLU A 1 122 ? 21.533  -47.206 50.998  1.00 83.95  ? 122  GLU A C   1 
ATOM   950  O  O   . GLU A 1 122 ? 21.485  -46.951 52.201  1.00 85.55  ? 122  GLU A O   1 
ATOM   951  C  CB  . GLU A 1 122 ? 20.477  -49.398 50.342  1.00 87.11  ? 122  GLU A CB  1 
ATOM   952  C  CG  . GLU A 1 122 ? 21.272  -50.023 49.186  1.00 93.59  ? 122  GLU A CG  1 
ATOM   953  C  CD  . GLU A 1 122 ? 20.552  -49.945 47.840  1.00 94.41  ? 122  GLU A CD  1 
ATOM   954  O  OE1 . GLU A 1 122 ? 19.433  -50.489 47.721  1.00 98.38  ? 122  GLU A OE1 1 
ATOM   955  O  OE2 . GLU A 1 122 ? 21.101  -49.328 46.903  1.00 91.79  ? 122  GLU A OE2 1 
ATOM   956  N  N   . ASP A 1 123 ? 22.586  -46.910 50.241  1.00 85.13  ? 123  ASP A N   1 
ATOM   957  C  CA  . ASP A 1 123 ? 23.778  -46.278 50.799  1.00 86.15  ? 123  ASP A CA  1 
ATOM   958  C  C   . ASP A 1 123 ? 23.521  -44.836 51.239  1.00 82.28  ? 123  ASP A C   1 
ATOM   959  O  O   . ASP A 1 123 ? 23.800  -44.454 52.382  1.00 78.98  ? 123  ASP A O   1 
ATOM   960  C  CB  . ASP A 1 123 ? 24.925  -46.317 49.779  1.00 96.18  ? 123  ASP A CB  1 
ATOM   961  C  CG  . ASP A 1 123 ? 25.619  -47.675 49.719  1.00 106.65 ? 123  ASP A CG  1 
ATOM   962  O  OD1 . ASP A 1 123 ? 24.958  -48.680 49.374  1.00 109.52 ? 123  ASP A OD1 1 
ATOM   963  O  OD2 . ASP A 1 123 ? 26.834  -47.737 50.013  1.00 110.34 ? 123  ASP A OD2 1 
ATOM   964  N  N   . PHE A 1 124 ? 22.938  -44.061 50.332  1.00 78.36  ? 124  PHE A N   1 
ATOM   965  C  CA  . PHE A 1 124 ? 22.642  -42.650 50.557  1.00 72.47  ? 124  PHE A CA  1 
ATOM   966  C  C   . PHE A 1 124 ? 21.621  -42.411 51.677  1.00 61.76  ? 124  PHE A C   1 
ATOM   967  O  O   . PHE A 1 124 ? 21.677  -41.395 52.365  1.00 48.16  ? 124  PHE A O   1 
ATOM   968  C  CB  . PHE A 1 124 ? 22.140  -42.042 49.240  1.00 77.09  ? 124  PHE A CB  1 
ATOM   969  C  CG  . PHE A 1 124 ? 22.131  -40.534 49.208  1.00 87.65  ? 124  PHE A CG  1 
ATOM   970  C  CD1 . PHE A 1 124 ? 23.253  -39.829 48.784  1.00 90.86  ? 124  PHE A CD1 1 
ATOM   971  C  CD2 . PHE A 1 124 ? 20.983  -39.818 49.546  1.00 92.34  ? 124  PHE A CD2 1 
ATOM   972  C  CE1 . PHE A 1 124 ? 23.232  -38.435 48.691  1.00 93.92  ? 124  PHE A CE1 1 
ATOM   973  C  CE2 . PHE A 1 124 ? 20.952  -38.424 49.456  1.00 92.26  ? 124  PHE A CE2 1 
ATOM   974  C  CZ  . PHE A 1 124 ? 22.077  -37.733 49.027  1.00 94.08  ? 124  PHE A CZ  1 
ATOM   975  N  N   . ARG A 1 125 ? 20.739  -43.381 51.893  1.00 62.87  ? 125  ARG A N   1 
ATOM   976  C  CA  . ARG A 1 125 ? 19.672  -43.284 52.890  1.00 61.42  ? 125  ARG A CA  1 
ATOM   977  C  C   . ARG A 1 125 ? 19.958  -42.642 54.237  1.00 68.66  ? 125  ARG A C   1 
ATOM   978  O  O   . ARG A 1 125 ? 19.110  -41.929 54.774  1.00 68.93  ? 125  ARG A O   1 
ATOM   979  C  CB  . ARG A 1 125 ? 19.025  -44.641 53.114  1.00 50.74  ? 125  ARG A CB  1 
ATOM   980  C  CG  . ARG A 1 125 ? 18.275  -45.145 51.911  1.00 43.14  ? 125  ARG A CG  1 
ATOM   981  C  CD  . ARG A 1 125 ? 17.481  -46.370 52.258  1.00 40.64  ? 125  ARG A CD  1 
ATOM   982  N  NE  . ARG A 1 125 ? 16.908  -46.975 51.067  1.00 53.32  ? 125  ARG A NE  1 
ATOM   983  C  CZ  . ARG A 1 125 ? 16.867  -48.282 50.844  1.00 63.55  ? 125  ARG A CZ  1 
ATOM   984  N  NH1 . ARG A 1 125 ? 17.367  -49.125 51.743  1.00 71.66  ? 125  ARG A NH1 1 
ATOM   985  N  NH2 . ARG A 1 125 ? 16.359  -48.746 49.709  1.00 60.84  ? 125  ARG A NH2 1 
ATOM   986  N  N   . LYS A 1 126 ? 21.133  -42.888 54.795  1.00 77.30  ? 126  LYS A N   1 
ATOM   987  C  CA  . LYS A 1 126 ? 21.462  -42.308 56.091  1.00 87.98  ? 126  LYS A CA  1 
ATOM   988  C  C   . LYS A 1 126 ? 21.416  -40.774 56.094  1.00 94.56  ? 126  LYS A C   1 
ATOM   989  O  O   . LYS A 1 126 ? 21.125  -40.159 57.122  1.00 98.47  ? 126  LYS A O   1 
ATOM   990  C  CB  . LYS A 1 126 ? 22.828  -42.805 56.560  1.00 97.98  ? 126  LYS A CB  1 
ATOM   991  C  CG  . LYS A 1 126 ? 23.935  -42.609 55.546  1.00 114.09 ? 126  LYS A CG  1 
ATOM   992  C  CD  . LYS A 1 126 ? 25.262  -43.083 56.095  1.00 124.88 ? 126  LYS A CD  1 
ATOM   993  C  CE  . LYS A 1 126 ? 26.370  -42.866 55.085  1.00 133.42 ? 126  LYS A CE  1 
ATOM   994  N  NZ  . LYS A 1 126 ? 26.120  -43.626 53.833  1.00 136.12 ? 126  LYS A NZ  1 
ATOM   995  N  N   . TYR A 1 127 ? 21.648  -40.165 54.933  1.00 98.39  ? 127  TYR A N   1 
ATOM   996  C  CA  . TYR A 1 127 ? 21.651  -38.706 54.799  1.00 98.80  ? 127  TYR A CA  1 
ATOM   997  C  C   . TYR A 1 127 ? 20.268  -38.060 54.902  1.00 96.73  ? 127  TYR A C   1 
ATOM   998  O  O   . TYR A 1 127 ? 20.149  -36.871 55.212  1.00 99.11  ? 127  TYR A O   1 
ATOM   999  C  CB  . TYR A 1 127 ? 22.314  -38.302 53.480  1.00 100.14 ? 127  TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 127 ? 23.734  -38.803 53.335  1.00 101.78 ? 127  TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 127 ? 24.733  -38.392 54.216  1.00 102.44 ? 127  TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 127 ? 24.077  -39.691 52.319  1.00 103.91 ? 127  TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 127 ? 26.039  -38.851 54.087  1.00 104.71 ? 127  TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 127 ? 25.378  -40.157 52.181  1.00 104.97 ? 127  TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 127 ? 26.354  -39.733 53.067  1.00 106.72 ? 127  TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 127 ? 27.643  -40.190 52.932  1.00 110.55 ? 127  TYR A OH  1 
ATOM   1007 N  N   . THR A 1 128 ? 19.228  -38.845 54.651  1.00 91.12  ? 128  THR A N   1 
ATOM   1008 C  CA  . THR A 1 128 ? 17.865  -38.342 54.716  1.00 88.60  ? 128  THR A CA  1 
ATOM   1009 C  C   . THR A 1 128 ? 17.268  -38.443 56.124  1.00 85.08  ? 128  THR A C   1 
ATOM   1010 O  O   . THR A 1 128 ? 16.056  -38.340 56.293  1.00 85.77  ? 128  THR A O   1 
ATOM   1011 C  CB  . THR A 1 128 ? 16.962  -39.113 53.738  1.00 88.26  ? 128  THR A CB  1 
ATOM   1012 O  OG1 . THR A 1 128 ? 16.996  -40.507 54.062  1.00 92.16  ? 128  THR A OG1 1 
ATOM   1013 C  CG2 . THR A 1 128 ? 17.441  -38.934 52.312  1.00 87.50  ? 128  THR A CG2 1 
ATOM   1014 N  N   . ALA A 1 129 ? 18.112  -38.670 57.126  1.00 80.90  ? 129  ALA A N   1 
ATOM   1015 C  CA  . ALA A 1 129 ? 17.648  -38.799 58.504  1.00 76.84  ? 129  ALA A CA  1 
ATOM   1016 C  C   . ALA A 1 129 ? 17.061  -37.508 59.076  1.00 79.32  ? 129  ALA A C   1 
ATOM   1017 O  O   . ALA A 1 129 ? 17.567  -36.414 58.813  1.00 78.22  ? 129  ALA A O   1 
ATOM   1018 C  CB  . ALA A 1 129 ? 18.778  -39.293 59.383  1.00 62.16  ? 129  ALA A CB  1 
ATOM   1019 N  N   . PHE A 1 130 ? 15.994  -37.649 59.861  1.00 79.43  ? 130  PHE A N   1 
ATOM   1020 C  CA  . PHE A 1 130 ? 15.331  -36.512 60.497  1.00 87.80  ? 130  PHE A CA  1 
ATOM   1021 C  C   . PHE A 1 130 ? 14.849  -36.912 61.890  1.00 89.85  ? 130  PHE A C   1 
ATOM   1022 O  O   . PHE A 1 130 ? 14.994  -38.075 62.278  1.00 88.14  ? 130  PHE A O   1 
ATOM   1023 C  CB  . PHE A 1 130 ? 14.169  -35.999 59.639  1.00 97.07  ? 130  PHE A CB  1 
ATOM   1024 C  CG  . PHE A 1 130 ? 13.157  -37.053 59.269  1.00 103.76 ? 130  PHE A CG  1 
ATOM   1025 C  CD1 . PHE A 1 130 ? 13.309  -37.802 58.107  1.00 101.66 ? 130  PHE A CD1 1 
ATOM   1026 C  CD2 . PHE A 1 130 ? 12.022  -37.254 60.051  1.00 108.82 ? 130  PHE A CD2 1 
ATOM   1027 C  CE1 . PHE A 1 130 ? 12.347  -38.732 57.724  1.00 98.83  ? 130  PHE A CE1 1 
ATOM   1028 C  CE2 . PHE A 1 130 ? 11.052  -38.184 59.676  1.00 107.54 ? 130  PHE A CE2 1 
ATOM   1029 C  CZ  . PHE A 1 130 ? 11.216  -38.922 58.509  1.00 102.36 ? 130  PHE A CZ  1 
ATOM   1030 N  N   . THR A 1 131 ? 14.292  -35.966 62.647  1.00 90.57  ? 131  THR A N   1 
ATOM   1031 C  CA  . THR A 1 131 ? 13.828  -36.274 64.003  1.00 91.81  ? 131  THR A CA  1 
ATOM   1032 C  C   . THR A 1 131 ? 12.539  -35.596 64.457  1.00 93.56  ? 131  THR A C   1 
ATOM   1033 O  O   . THR A 1 131 ? 12.358  -34.392 64.283  1.00 92.02  ? 131  THR A O   1 
ATOM   1034 C  CB  . THR A 1 131 ? 14.918  -35.954 65.047  1.00 88.26  ? 131  THR A CB  1 
ATOM   1035 O  OG1 . THR A 1 131 ? 16.094  -36.715 64.756  1.00 88.77  ? 131  THR A OG1 1 
ATOM   1036 C  CG2 . THR A 1 131 ? 14.444  -36.300 66.455  1.00 86.61  ? 131  THR A CG2 1 
ATOM   1037 N  N   . ILE A 1 132 ? 11.651  -36.392 65.047  1.00 97.58  ? 132  ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 132 ? 10.388  -35.905 65.583  1.00 102.77 ? 132  ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 132 ? 10.710  -35.486 67.020  1.00 106.70 ? 132  ILE A C   1 
ATOM   1040 O  O   . ILE A 1 132 ? 11.000  -36.331 67.875  1.00 105.23 ? 132  ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 132 ? 9.301   -37.015 65.572  1.00 103.98 ? 132  ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 132 ? 9.003   -37.441 64.128  1.00 105.37 ? 132  ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 132 ? 8.029   -36.525 66.257  1.00 104.51 ? 132  ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 132 ? 7.949   -38.527 63.999  1.00 107.25 ? 132  ILE A CD1 1 
ATOM   1045 N  N   . PRO A 1 133 ? 10.688  -34.170 67.293  1.00 110.39 ? 133  PRO A N   1 
ATOM   1046 C  CA  . PRO A 1 133 ? 10.983  -33.605 68.614  1.00 109.91 ? 133  PRO A CA  1 
ATOM   1047 C  C   . PRO A 1 133 ? 10.112  -34.142 69.738  1.00 107.48 ? 133  PRO A C   1 
ATOM   1048 O  O   . PRO A 1 133 ? 9.062   -34.740 69.503  1.00 109.22 ? 133  PRO A O   1 
ATOM   1049 C  CB  . PRO A 1 133 ? 10.751  -32.106 68.401  1.00 112.58 ? 133  PRO A CB  1 
ATOM   1050 C  CG  . PRO A 1 133 ? 9.680   -32.079 67.357  1.00 112.47 ? 133  PRO A CG  1 
ATOM   1051 C  CD  . PRO A 1 133 ? 10.179  -33.123 66.387  1.00 113.51 ? 133  PRO A CD  1 
ATOM   1052 N  N   . SER A 1 134 ? 10.580  -33.955 70.963  1.00 104.53 ? 134  SER A N   1 
ATOM   1053 C  CA  . SER A 1 134 ? 9.835   -34.389 72.129  1.00 105.02 ? 134  SER A CA  1 
ATOM   1054 C  C   . SER A 1 134 ? 9.143   -33.137 72.679  1.00 105.33 ? 134  SER A C   1 
ATOM   1055 O  O   . SER A 1 134 ? 9.435   -32.019 72.238  1.00 100.68 ? 134  SER A O   1 
ATOM   1056 C  CB  . SER A 1 134 ? 10.790  -34.999 73.166  1.00 101.96 ? 134  SER A CB  1 
ATOM   1057 O  OG  . SER A 1 134 ? 10.082  -35.765 74.128  1.00 103.37 ? 134  SER A OG  1 
ATOM   1058 N  N   . ILE A 1 135 ? 8.210   -33.324 73.608  1.00 110.33 ? 135  ILE A N   1 
ATOM   1059 C  CA  . ILE A 1 135 ? 7.493   -32.197 74.196  1.00 117.20 ? 135  ILE A CA  1 
ATOM   1060 C  C   . ILE A 1 135 ? 8.509   -31.260 74.833  1.00 121.02 ? 135  ILE A C   1 
ATOM   1061 O  O   . ILE A 1 135 ? 9.072   -31.567 75.888  1.00 116.70 ? 135  ILE A O   1 
ATOM   1062 C  CB  . ILE A 1 135 ? 6.450   -32.661 75.260  1.00 120.57 ? 135  ILE A CB  1 
ATOM   1063 C  CG1 . ILE A 1 135 ? 5.254   -33.346 74.584  1.00 123.19 ? 135  ILE A CG1 1 
ATOM   1064 C  CG2 . ILE A 1 135 ? 5.958   -31.474 76.085  1.00 117.06 ? 135  ILE A CG2 1 
ATOM   1065 C  CD1 . ILE A 1 135 ? 5.555   -34.707 73.982  1.00 126.05 ? 135  ILE A CD1 1 
ATOM   1066 N  N   . ASN A 1 136 ? 8.772   -30.144 74.160  1.00 129.50 ? 136  ASN A N   1 
ATOM   1067 C  CA  . ASN A 1 136 ? 9.735   -29.136 74.609  1.00 137.24 ? 136  ASN A CA  1 
ATOM   1068 C  C   . ASN A 1 136 ? 11.082  -29.736 75.025  1.00 142.11 ? 136  ASN A C   1 
ATOM   1069 O  O   . ASN A 1 136 ? 11.471  -29.692 76.192  1.00 144.34 ? 136  ASN A O   1 
ATOM   1070 C  CB  . ASN A 1 136 ? 9.160   -28.263 75.740  1.00 138.87 ? 136  ASN A CB  1 
ATOM   1071 C  CG  . ASN A 1 136 ? 10.043  -27.051 76.062  1.00 136.12 ? 136  ASN A CG  1 
ATOM   1072 O  OD1 . ASN A 1 136 ? 10.659  -26.981 77.120  1.00 141.33 ? 136  ASN A OD1 1 
ATOM   1073 N  ND2 . ASN A 1 136 ? 10.094  -26.093 75.150  1.00 129.26 ? 136  ASN A ND2 1 
ATOM   1074 N  N   . ASN A 1 137 ? 11.761  -30.335 74.053  1.00 145.75 ? 137  ASN A N   1 
ATOM   1075 C  CA  . ASN A 1 137 ? 13.085  -30.930 74.248  1.00 148.74 ? 137  ASN A CA  1 
ATOM   1076 C  C   . ASN A 1 137 ? 13.253  -31.859 75.458  1.00 152.17 ? 137  ASN A C   1 
ATOM   1077 O  O   . ASN A 1 137 ? 14.070  -31.594 76.338  1.00 153.93 ? 137  ASN A O   1 
ATOM   1078 C  CB  . ASN A 1 137 ? 14.158  -29.824 74.271  1.00 146.02 ? 137  ASN A CB  1 
ATOM   1079 C  CG  . ASN A 1 137 ? 15.536  -30.324 73.858  1.00 143.71 ? 137  ASN A CG  1 
ATOM   1080 O  OD1 . ASN A 1 137 ? 15.697  -31.472 73.431  1.00 145.98 ? 137  ASN A OD1 1 
ATOM   1081 N  ND2 . ASN A 1 137 ? 16.529  -29.443 73.932  1.00 135.60 ? 137  ASN A ND2 1 
ATOM   1082 N  N   . GLU A 1 138 ? 12.444  -32.917 75.519  1.00 151.99 ? 138  GLU A N   1 
ATOM   1083 C  CA  . GLU A 1 138 ? 12.545  -33.913 76.596  1.00 148.40 ? 138  GLU A CA  1 
ATOM   1084 C  C   . GLU A 1 138 ? 13.648  -34.856 76.103  1.00 146.08 ? 138  GLU A C   1 
ATOM   1085 O  O   . GLU A 1 138 ? 14.434  -34.474 75.232  1.00 147.44 ? 138  GLU A O   1 
ATOM   1086 C  CB  . GLU A 1 138 ? 11.215  -34.666 76.768  1.00 146.28 ? 138  GLU A CB  1 
ATOM   1087 C  CG  . GLU A 1 138 ? 10.073  -33.834 77.376  1.00 145.61 ? 138  GLU A CG  1 
ATOM   1088 C  CD  . GLU A 1 138 ? 8.731   -34.556 77.416  1.00 145.15 ? 138  GLU A CD  1 
ATOM   1089 O  OE1 . GLU A 1 138 ? 8.393   -35.279 76.453  1.00 144.07 ? 138  GLU A OE1 1 
ATOM   1090 O  OE2 . GLU A 1 138 ? 7.993   -34.392 78.415  1.00 142.44 ? 138  GLU A OE2 1 
ATOM   1091 N  N   . THR A 1 139 ? 13.761  -36.061 76.653  1.00 143.30 ? 139  THR A N   1 
ATOM   1092 C  CA  . THR A 1 139 ? 14.792  -36.973 76.158  1.00 139.34 ? 139  THR A CA  1 
ATOM   1093 C  C   . THR A 1 139 ? 14.551  -37.257 74.657  1.00 133.24 ? 139  THR A C   1 
ATOM   1094 O  O   . THR A 1 139 ? 13.522  -36.854 74.106  1.00 136.20 ? 139  THR A O   1 
ATOM   1095 C  CB  . THR A 1 139 ? 14.859  -38.283 77.000  1.00 142.22 ? 139  THR A CB  1 
ATOM   1096 O  OG1 . THR A 1 139 ? 13.698  -38.392 77.831  1.00 138.34 ? 139  THR A OG1 1 
ATOM   1097 C  CG2 . THR A 1 139 ? 16.110  -38.288 77.881  1.00 145.11 ? 139  THR A CG2 1 
ATOM   1098 N  N   . PRO A 1 140 ? 15.497  -37.945 73.981  1.00 125.46 ? 140  PRO A N   1 
ATOM   1099 C  CA  . PRO A 1 140 ? 15.408  -38.277 72.556  1.00 118.74 ? 140  PRO A CA  1 
ATOM   1100 C  C   . PRO A 1 140 ? 14.047  -38.402 71.893  1.00 112.46 ? 140  PRO A C   1 
ATOM   1101 O  O   . PRO A 1 140 ? 13.163  -39.139 72.349  1.00 111.84 ? 140  PRO A O   1 
ATOM   1102 C  CB  . PRO A 1 140 ? 16.189  -39.578 72.468  1.00 120.38 ? 140  PRO A CB  1 
ATOM   1103 C  CG  . PRO A 1 140 ? 17.313  -39.314 73.383  1.00 122.99 ? 140  PRO A CG  1 
ATOM   1104 C  CD  . PRO A 1 140 ? 16.686  -38.595 74.567  1.00 125.07 ? 140  PRO A CD  1 
ATOM   1105 N  N   . GLY A 1 141 ? 13.905  -37.640 70.810  1.00 106.77 ? 141  GLY A N   1 
ATOM   1106 C  CA  . GLY A 1 141 ? 12.701  -37.657 70.013  1.00 101.56 ? 141  GLY A CA  1 
ATOM   1107 C  C   . GLY A 1 141 ? 12.812  -38.872 69.119  1.00 101.19 ? 141  GLY A C   1 
ATOM   1108 O  O   . GLY A 1 141 ? 13.813  -39.594 69.174  1.00 102.59 ? 141  GLY A O   1 
ATOM   1109 N  N   . ILE A 1 142 ? 11.824  -39.078 68.257  1.00 98.87  ? 142  ILE A N   1 
ATOM   1110 C  CA  . ILE A 1 142 ? 11.824  -40.245 67.377  1.00 96.05  ? 142  ILE A CA  1 
ATOM   1111 C  C   . ILE A 1 142 ? 12.677  -40.025 66.119  1.00 93.98  ? 142  ILE A C   1 
ATOM   1112 O  O   . ILE A 1 142 ? 12.550  -39.001 65.450  1.00 91.46  ? 142  ILE A O   1 
ATOM   1113 C  CB  . ILE A 1 142 ? 10.381  -40.636 66.984  1.00 94.75  ? 142  ILE A CB  1 
ATOM   1114 C  CG1 . ILE A 1 142 ? 9.439   -40.422 68.177  1.00 88.48  ? 142  ILE A CG1 1 
ATOM   1115 C  CG2 . ILE A 1 142 ? 10.321  -42.090 66.539  1.00 96.94  ? 142  ILE A CG2 1 
ATOM   1116 C  CD1 . ILE A 1 142 ? 9.906   -41.058 69.475  1.00 86.39  ? 142  ILE A CD1 1 
ATOM   1117 N  N   . ARG A 1 143 ? 13.527  -41.003 65.802  1.00 92.52  ? 143  ARG A N   1 
ATOM   1118 C  CA  . ARG A 1 143 ? 14.413  -40.934 64.633  1.00 90.68  ? 143  ARG A CA  1 
ATOM   1119 C  C   . ARG A 1 143 ? 14.023  -41.845 63.471  1.00 83.22  ? 143  ARG A C   1 
ATOM   1120 O  O   . ARG A 1 143 ? 13.651  -43.001 63.678  1.00 81.40  ? 143  ARG A O   1 
ATOM   1121 C  CB  . ARG A 1 143 ? 15.847  -41.251 65.041  1.00 99.19  ? 143  ARG A CB  1 
ATOM   1122 C  CG  . ARG A 1 143 ? 16.716  -40.025 65.210  1.00 109.77 ? 143  ARG A CG  1 
ATOM   1123 C  CD  . ARG A 1 143 ? 18.192  -40.401 65.212  1.00 116.20 ? 143  ARG A CD  1 
ATOM   1124 N  NE  . ARG A 1 143 ? 19.038  -39.262 64.870  1.00 115.98 ? 143  ARG A NE  1 
ATOM   1125 C  CZ  . ARG A 1 143 ? 19.131  -38.734 63.652  1.00 115.87 ? 143  ARG A CZ  1 
ATOM   1126 N  NH1 . ARG A 1 143 ? 18.437  -39.239 62.639  1.00 116.10 ? 143  ARG A NH1 1 
ATOM   1127 N  NH2 . ARG A 1 143 ? 19.889  -37.667 63.455  1.00 115.03 ? 143  ARG A NH2 1 
ATOM   1128 N  N   . TYR A 1 144 ? 14.183  -41.338 62.251  1.00 78.48  ? 144  TYR A N   1 
ATOM   1129 C  CA  . TYR A 1 144 ? 13.843  -42.078 61.033  1.00 77.36  ? 144  TYR A CA  1 
ATOM   1130 C  C   . TYR A 1 144 ? 14.768  -41.706 59.869  1.00 73.47  ? 144  TYR A C   1 
ATOM   1131 O  O   . TYR A 1 144 ? 15.620  -40.820 59.988  1.00 71.40  ? 144  TYR A O   1 
ATOM   1132 C  CB  . TYR A 1 144 ? 12.412  -41.745 60.582  1.00 82.79  ? 144  TYR A CB  1 
ATOM   1133 C  CG  . TYR A 1 144 ? 11.273  -42.332 61.385  1.00 86.86  ? 144  TYR A CG  1 
ATOM   1134 C  CD1 . TYR A 1 144 ? 10.903  -43.665 61.233  1.00 89.66  ? 144  TYR A CD1 1 
ATOM   1135 C  CD2 . TYR A 1 144 ? 10.512  -41.532 62.241  1.00 91.93  ? 144  TYR A CD2 1 
ATOM   1136 C  CE1 . TYR A 1 144 ? 9.799   -44.190 61.908  1.00 94.53  ? 144  TYR A CE1 1 
ATOM   1137 C  CE2 . TYR A 1 144 ? 9.406   -42.047 62.922  1.00 92.51  ? 144  TYR A CE2 1 
ATOM   1138 C  CZ  . TYR A 1 144 ? 9.055   -43.377 62.748  1.00 94.05  ? 144  TYR A CZ  1 
ATOM   1139 O  OH  . TYR A 1 144 ? 7.957   -43.893 63.401  1.00 97.02  ? 144  TYR A OH  1 
ATOM   1140 N  N   . GLN A 1 145 ? 14.547  -42.369 58.736  1.00 70.92  ? 145  GLN A N   1 
ATOM   1141 C  CA  . GLN A 1 145 ? 15.282  -42.134 57.495  1.00 75.03  ? 145  GLN A CA  1 
ATOM   1142 C  C   . GLN A 1 145 ? 14.411  -42.629 56.333  1.00 77.84  ? 145  GLN A C   1 
ATOM   1143 O  O   . GLN A 1 145 ? 13.560  -43.509 56.516  1.00 78.83  ? 145  GLN A O   1 
ATOM   1144 C  CB  . GLN A 1 145 ? 16.643  -42.850 57.492  1.00 79.72  ? 145  GLN A CB  1 
ATOM   1145 C  CG  . GLN A 1 145 ? 16.595  -44.377 57.517  1.00 74.81  ? 145  GLN A CG  1 
ATOM   1146 C  CD  . GLN A 1 145 ? 17.955  -45.007 57.270  1.00 66.20  ? 145  GLN A CD  1 
ATOM   1147 O  OE1 . GLN A 1 145 ? 18.902  -44.792 58.030  1.00 56.09  ? 145  GLN A OE1 1 
ATOM   1148 N  NE2 . GLN A 1 145 ? 18.060  -45.789 56.201  1.00 65.98  ? 145  GLN A NE2 1 
ATOM   1149 N  N   . TYR A 1 146 ? 14.592  -42.039 55.155  1.00 78.38  ? 146  TYR A N   1 
ATOM   1150 C  CA  . TYR A 1 146 ? 13.816  -42.420 53.978  1.00 78.47  ? 146  TYR A CA  1 
ATOM   1151 C  C   . TYR A 1 146 ? 14.414  -43.654 53.316  1.00 74.27  ? 146  TYR A C   1 
ATOM   1152 O  O   . TYR A 1 146 ? 15.615  -43.908 53.413  1.00 70.25  ? 146  TYR A O   1 
ATOM   1153 C  CB  . TYR A 1 146 ? 13.777  -41.277 52.952  1.00 86.12  ? 146  TYR A CB  1 
ATOM   1154 C  CG  . TYR A 1 146 ? 12.594  -40.317 53.033  1.00 93.70  ? 146  TYR A CG  1 
ATOM   1155 C  CD1 . TYR A 1 146 ? 12.563  -39.272 53.965  1.00 95.57  ? 146  TYR A CD1 1 
ATOM   1156 C  CD2 . TYR A 1 146 ? 11.552  -40.394 52.106  1.00 98.46  ? 146  TYR A CD2 1 
ATOM   1157 C  CE1 . TYR A 1 146 ? 11.523  -38.320 53.962  1.00 98.33  ? 146  TYR A CE1 1 
ATOM   1158 C  CE2 . TYR A 1 146 ? 10.515  -39.452 52.095  1.00 103.02 ? 146  TYR A CE2 1 
ATOM   1159 C  CZ  . TYR A 1 146 ? 10.505  -38.416 53.018  1.00 102.12 ? 146  TYR A CZ  1 
ATOM   1160 O  OH  . TYR A 1 146 ? 9.492   -37.475 52.967  1.00 97.57  ? 146  TYR A OH  1 
ATOM   1161 N  N   . ASN A 1 147 ? 13.555  -44.429 52.667  1.00 74.02  ? 147  ASN A N   1 
ATOM   1162 C  CA  . ASN A 1 147 ? 13.965  -45.633 51.953  1.00 70.75  ? 147  ASN A CA  1 
ATOM   1163 C  C   . ASN A 1 147 ? 13.490  -45.477 50.502  1.00 68.50  ? 147  ASN A C   1 
ATOM   1164 O  O   . ASN A 1 147 ? 13.667  -46.377 49.674  1.00 70.01  ? 147  ASN A O   1 
ATOM   1165 C  CB  . ASN A 1 147 ? 13.325  -46.890 52.582  1.00 68.63  ? 147  ASN A CB  1 
ATOM   1166 C  CG  . ASN A 1 147 ? 13.889  -47.232 53.971  1.00 64.59  ? 147  ASN A CG  1 
ATOM   1167 O  OD1 . ASN A 1 147 ? 15.049  -46.953 54.279  1.00 71.11  ? 147  ASN A OD1 1 
ATOM   1168 N  ND2 . ASN A 1 147 ? 13.069  -47.873 54.799  1.00 43.18  ? 147  ASN A ND2 1 
ATOM   1169 N  N   . VAL A 1 148 ? 12.913  -44.312 50.201  1.00 61.15  ? 148  VAL A N   1 
ATOM   1170 C  CA  . VAL A 1 148 ? 12.371  -43.993 48.878  1.00 53.36  ? 148  VAL A CA  1 
ATOM   1171 C  C   . VAL A 1 148 ? 12.714  -42.551 48.492  1.00 53.70  ? 148  VAL A C   1 
ATOM   1172 O  O   . VAL A 1 148 ? 13.366  -41.844 49.267  1.00 55.50  ? 148  VAL A O   1 
ATOM   1173 C  CB  . VAL A 1 148 ? 10.831  -44.142 48.875  1.00 49.97  ? 148  VAL A CB  1 
ATOM   1174 C  CG1 . VAL A 1 148 ? 10.442  -45.598 49.063  1.00 53.65  ? 148  VAL A CG1 1 
ATOM   1175 C  CG2 . VAL A 1 148 ? 10.214  -43.298 49.990  1.00 46.09  ? 148  VAL A CG2 1 
ATOM   1176 N  N   . LEU A 1 149 ? 12.287  -42.124 47.302  1.00 50.41  ? 149  LEU A N   1 
ATOM   1177 C  CA  . LEU A 1 149 ? 12.527  -40.749 46.816  1.00 49.63  ? 149  LEU A CA  1 
ATOM   1178 C  C   . LEU A 1 149 ? 11.684  -39.720 47.603  1.00 47.21  ? 149  LEU A C   1 
ATOM   1179 O  O   . LEU A 1 149 ? 10.450  -39.631 47.441  1.00 42.23  ? 149  LEU A O   1 
ATOM   1180 C  CB  . LEU A 1 149 ? 12.229  -40.643 45.306  1.00 42.22  ? 149  LEU A CB  1 
ATOM   1181 C  CG  . LEU A 1 149 ? 13.307  -40.966 44.263  1.00 15.85  ? 149  LEU A CG  1 
ATOM   1182 C  CD1 . LEU A 1 149 ? 14.172  -42.138 44.694  1.00 24.71  ? 149  LEU A CD1 1 
ATOM   1183 C  CD2 . LEU A 1 149 ? 12.647  -41.232 42.932  1.00 2.00   ? 149  LEU A CD2 1 
ATOM   1184 N  N   . PRO A 1 150 ? 12.351  -38.893 48.432  1.00 41.20  ? 150  PRO A N   1 
ATOM   1185 C  CA  . PRO A 1 150 ? 11.660  -37.887 49.242  1.00 34.90  ? 150  PRO A CA  1 
ATOM   1186 C  C   . PRO A 1 150 ? 11.096  -36.691 48.504  1.00 37.55  ? 150  PRO A C   1 
ATOM   1187 O  O   . PRO A 1 150 ? 11.745  -36.102 47.640  1.00 40.40  ? 150  PRO A O   1 
ATOM   1188 C  CB  . PRO A 1 150 ? 12.735  -37.438 50.233  1.00 9.82   ? 150  PRO A CB  1 
ATOM   1189 C  CG  . PRO A 1 150 ? 13.810  -38.475 50.131  1.00 17.20  ? 150  PRO A CG  1 
ATOM   1190 C  CD  . PRO A 1 150 ? 13.797  -38.846 48.691  1.00 28.44  ? 150  PRO A CD  1 
ATOM   1191 N  N   . GLN A 1 151 ? 9.884   -36.318 48.879  1.00 45.11  ? 151  GLN A N   1 
ATOM   1192 C  CA  . GLN A 1 151 ? 9.253   -35.155 48.296  1.00 54.94  ? 151  GLN A CA  1 
ATOM   1193 C  C   . GLN A 1 151 ? 10.147  -33.972 48.677  1.00 57.60  ? 151  GLN A C   1 
ATOM   1194 O  O   . GLN A 1 151 ? 10.436  -33.749 49.861  1.00 56.46  ? 151  GLN A O   1 
ATOM   1195 C  CB  . GLN A 1 151 ? 7.855   -34.978 48.882  1.00 60.91  ? 151  GLN A CB  1 
ATOM   1196 C  CG  . GLN A 1 151 ? 6.745   -35.327 47.921  1.00 62.23  ? 151  GLN A CG  1 
ATOM   1197 C  CD  . GLN A 1 151 ? 6.498   -34.235 46.910  1.00 55.29  ? 151  GLN A CD  1 
ATOM   1198 O  OE1 . GLN A 1 151 ? 5.947   -33.189 47.236  1.00 57.53  ? 151  GLN A OE1 1 
ATOM   1199 N  NE2 . GLN A 1 151 ? 6.908   -34.469 45.678  1.00 50.29  ? 151  GLN A NE2 1 
ATOM   1200 N  N   . GLY A 1 152 ? 10.649  -33.274 47.665  1.00 58.40  ? 152  GLY A N   1 
ATOM   1201 C  CA  . GLY A 1 152 ? 11.510  -32.135 47.915  1.00 57.31  ? 152  GLY A CA  1 
ATOM   1202 C  C   . GLY A 1 152 ? 12.993  -32.415 47.741  1.00 53.15  ? 152  GLY A C   1 
ATOM   1203 O  O   . GLY A 1 152 ? 13.791  -31.478 47.631  1.00 53.92  ? 152  GLY A O   1 
ATOM   1204 N  N   . TRP A 1 153 ? 13.379  -33.686 47.719  1.00 44.50  ? 153  TRP A N   1 
ATOM   1205 C  CA  . TRP A 1 153 ? 14.785  -34.006 47.552  1.00 44.76  ? 153  TRP A CA  1 
ATOM   1206 C  C   . TRP A 1 153 ? 15.265  -33.898 46.104  1.00 42.10  ? 153  TRP A C   1 
ATOM   1207 O  O   . TRP A 1 153 ? 14.645  -34.431 45.182  1.00 45.08  ? 153  TRP A O   1 
ATOM   1208 C  CB  . TRP A 1 153 ? 15.129  -35.375 48.123  1.00 52.09  ? 153  TRP A CB  1 
ATOM   1209 C  CG  . TRP A 1 153 ? 16.525  -35.754 47.792  1.00 57.21  ? 153  TRP A CG  1 
ATOM   1210 C  CD1 . TRP A 1 153 ? 17.660  -35.069 48.120  1.00 56.92  ? 153  TRP A CD1 1 
ATOM   1211 C  CD2 . TRP A 1 153 ? 16.937  -36.855 46.984  1.00 59.34  ? 153  TRP A CD2 1 
ATOM   1212 N  NE1 . TRP A 1 153 ? 18.753  -35.670 47.552  1.00 61.22  ? 153  TRP A NE1 1 
ATOM   1213 C  CE2 . TRP A 1 153 ? 18.341  -36.772 46.851  1.00 62.00  ? 153  TRP A CE2 1 
ATOM   1214 C  CE3 . TRP A 1 153 ? 16.257  -37.905 46.353  1.00 60.52  ? 153  TRP A CE3 1 
ATOM   1215 C  CZ2 . TRP A 1 153 ? 19.081  -37.702 46.112  1.00 57.69  ? 153  TRP A CZ2 1 
ATOM   1216 C  CZ3 . TRP A 1 153 ? 16.991  -38.829 45.618  1.00 61.40  ? 153  TRP A CZ3 1 
ATOM   1217 C  CH2 . TRP A 1 153 ? 18.392  -38.720 45.505  1.00 58.75  ? 153  TRP A CH2 1 
ATOM   1218 N  N   . LYS A 1 154 ? 16.442  -33.299 45.961  1.00 38.35  ? 154  LYS A N   1 
ATOM   1219 C  CA  . LYS A 1 154 ? 17.110  -33.030 44.690  1.00 36.10  ? 154  LYS A CA  1 
ATOM   1220 C  C   . LYS A 1 154 ? 17.102  -34.128 43.619  1.00 31.96  ? 154  LYS A C   1 
ATOM   1221 O  O   . LYS A 1 154 ? 16.794  -33.869 42.449  1.00 26.51  ? 154  LYS A O   1 
ATOM   1222 C  CB  . LYS A 1 154 ? 18.558  -32.590 44.972  1.00 41.74  ? 154  LYS A CB  1 
ATOM   1223 C  CG  . LYS A 1 154 ? 19.253  -31.856 43.823  1.00 27.37  ? 154  LYS A CG  1 
ATOM   1224 C  CD  . LYS A 1 154 ? 20.747  -31.733 44.082  1.00 28.42  ? 154  LYS A CD  1 
ATOM   1225 C  CE  . LYS A 1 154 ? 21.521  -31.452 42.790  1.00 30.50  ? 154  LYS A CE  1 
ATOM   1226 N  NZ  . LYS A 1 154 ? 22.979  -31.650 42.992  1.00 32.04  ? 154  LYS A NZ  1 
ATOM   1227 N  N   . GLY A 1 155 ? 17.486  -35.339 44.000  1.00 27.83  ? 155  GLY A N   1 
ATOM   1228 C  CA  . GLY A 1 155 ? 17.522  -36.417 43.028  1.00 25.85  ? 155  GLY A CA  1 
ATOM   1229 C  C   . GLY A 1 155 ? 16.174  -36.932 42.566  1.00 20.14  ? 155  GLY A C   1 
ATOM   1230 O  O   . GLY A 1 155 ? 15.979  -37.211 41.376  1.00 14.74  ? 155  GLY A O   1 
ATOM   1231 N  N   . SER A 1 156 ? 15.233  -37.004 43.500  1.00 19.17  ? 156  SER A N   1 
ATOM   1232 C  CA  . SER A 1 156 ? 13.892  -37.512 43.232  1.00 25.98  ? 156  SER A CA  1 
ATOM   1233 C  C   . SER A 1 156 ? 13.360  -37.349 41.796  1.00 21.21  ? 156  SER A C   1 
ATOM   1234 O  O   . SER A 1 156 ? 13.177  -38.338 41.095  1.00 13.04  ? 156  SER A O   1 
ATOM   1235 C  CB  . SER A 1 156 ? 12.880  -36.971 44.266  1.00 25.12  ? 156  SER A CB  1 
ATOM   1236 O  OG  . SER A 1 156 ? 13.231  -37.345 45.593  1.00 2.44   ? 156  SER A OG  1 
ATOM   1237 N  N   . PRO A 1 157 ? 13.212  -36.107 41.307  1.00 24.21  ? 157  PRO A N   1 
ATOM   1238 C  CA  . PRO A 1 157 ? 12.703  -35.848 39.953  1.00 27.76  ? 157  PRO A CA  1 
ATOM   1239 C  C   . PRO A 1 157 ? 13.333  -36.621 38.802  1.00 25.96  ? 157  PRO A C   1 
ATOM   1240 O  O   . PRO A 1 157 ? 12.654  -37.374 38.089  1.00 26.78  ? 157  PRO A O   1 
ATOM   1241 C  CB  . PRO A 1 157 ? 12.934  -34.354 39.789  1.00 29.02  ? 157  PRO A CB  1 
ATOM   1242 C  CG  . PRO A 1 157 ? 12.714  -33.857 41.169  1.00 45.76  ? 157  PRO A CG  1 
ATOM   1243 C  CD  . PRO A 1 157 ? 13.517  -34.838 41.984  1.00 31.55  ? 157  PRO A CD  1 
ATOM   1244 N  N   . ALA A 1 158 ? 14.625  -36.417 38.608  1.00 24.86  ? 158  ALA A N   1 
ATOM   1245 C  CA  . ALA A 1 158 ? 15.321  -37.079 37.523  1.00 31.36  ? 158  ALA A CA  1 
ATOM   1246 C  C   . ALA A 1 158 ? 15.245  -38.597 37.667  1.00 37.25  ? 158  ALA A C   1 
ATOM   1247 O  O   . ALA A 1 158 ? 15.077  -39.322 36.677  1.00 35.20  ? 158  ALA A O   1 
ATOM   1248 C  CB  . ALA A 1 158 ? 16.768  -36.610 37.476  1.00 29.64  ? 158  ALA A CB  1 
ATOM   1249 N  N   . ILE A 1 159 ? 15.336  -39.063 38.912  1.00 41.87  ? 159  ILE A N   1 
ATOM   1250 C  CA  . ILE A 1 159 ? 15.294  -40.487 39.228  1.00 47.63  ? 159  ILE A CA  1 
ATOM   1251 C  C   . ILE A 1 159 ? 13.944  -41.099 38.870  1.00 50.28  ? 159  ILE A C   1 
ATOM   1252 O  O   . ILE A 1 159 ? 13.861  -42.028 38.058  1.00 50.59  ? 159  ILE A O   1 
ATOM   1253 C  CB  . ILE A 1 159 ? 15.612  -40.713 40.714  1.00 49.65  ? 159  ILE A CB  1 
ATOM   1254 C  CG1 . ILE A 1 159 ? 17.077  -40.357 40.971  1.00 58.86  ? 159  ILE A CG1 1 
ATOM   1255 C  CG2 . ILE A 1 159 ? 15.314  -42.150 41.120  1.00 47.17  ? 159  ILE A CG2 1 
ATOM   1256 C  CD1 . ILE A 1 159 ? 17.481  -40.406 42.425  1.00 69.52  ? 159  ILE A CD1 1 
ATOM   1257 N  N   . PHE A 1 160 ? 12.896  -40.551 39.471  1.00 49.20  ? 160  PHE A N   1 
ATOM   1258 C  CA  . PHE A 1 160 ? 11.524  -40.974 39.240  1.00 47.77  ? 160  PHE A CA  1 
ATOM   1259 C  C   . PHE A 1 160 ? 11.321  -41.107 37.734  1.00 42.08  ? 160  PHE A C   1 
ATOM   1260 O  O   . PHE A 1 160 ? 10.911  -42.160 37.252  1.00 36.21  ? 160  PHE A O   1 
ATOM   1261 C  CB  . PHE A 1 160 ? 10.589  -39.911 39.838  1.00 59.55  ? 160  PHE A CB  1 
ATOM   1262 C  CG  . PHE A 1 160 ? 9.137   -40.061 39.465  1.00 70.67  ? 160  PHE A CG  1 
ATOM   1263 C  CD1 . PHE A 1 160 ? 8.674   -39.674 38.204  1.00 75.32  ? 160  PHE A CD1 1 
ATOM   1264 C  CD2 . PHE A 1 160 ? 8.214   -40.506 40.401  1.00 69.90  ? 160  PHE A CD2 1 
ATOM   1265 C  CE1 . PHE A 1 160 ? 7.316   -39.725 37.890  1.00 73.43  ? 160  PHE A CE1 1 
ATOM   1266 C  CE2 . PHE A 1 160 ? 6.857   -40.557 40.091  1.00 71.44  ? 160  PHE A CE2 1 
ATOM   1267 C  CZ  . PHE A 1 160 ? 6.407   -40.167 38.838  1.00 72.21  ? 160  PHE A CZ  1 
ATOM   1268 N  N   . GLN A 1 161 ? 11.683  -40.053 37.005  1.00 44.05  ? 161  GLN A N   1 
ATOM   1269 C  CA  . GLN A 1 161 ? 11.551  -40.004 35.552  1.00 42.57  ? 161  GLN A CA  1 
ATOM   1270 C  C   . GLN A 1 161 ? 12.195  -41.211 34.875  1.00 37.79  ? 161  GLN A C   1 
ATOM   1271 O  O   . GLN A 1 161 ? 11.543  -41.915 34.108  1.00 36.53  ? 161  GLN A O   1 
ATOM   1272 C  CB  . GLN A 1 161 ? 12.177  -38.715 35.016  1.00 51.98  ? 161  GLN A CB  1 
ATOM   1273 C  CG  . GLN A 1 161 ? 11.565  -38.212 33.712  1.00 80.19  ? 161  GLN A CG  1 
ATOM   1274 C  CD  . GLN A 1 161 ? 10.274  -37.418 33.920  1.00 103.41 ? 161  GLN A CD  1 
ATOM   1275 O  OE1 . GLN A 1 161 ? 9.833   -37.197 35.051  1.00 114.53 ? 161  GLN A OE1 1 
ATOM   1276 N  NE2 . GLN A 1 161 ? 9.684   -36.954 32.823  1.00 110.94 ? 161  GLN A NE2 1 
ATOM   1277 N  N   . SER A 1 162 ? 13.469  -41.450 35.174  1.00 38.26  ? 162  SER A N   1 
ATOM   1278 C  CA  . SER A 1 162 ? 14.207  -42.574 34.602  1.00 39.20  ? 162  SER A CA  1 
ATOM   1279 C  C   . SER A 1 162 ? 13.507  -43.889 34.900  1.00 28.60  ? 162  SER A C   1 
ATOM   1280 O  O   . SER A 1 162 ? 13.244  -44.697 33.999  1.00 21.62  ? 162  SER A O   1 
ATOM   1281 C  CB  . SER A 1 162 ? 15.618  -42.630 35.185  1.00 53.78  ? 162  SER A CB  1 
ATOM   1282 O  OG  . SER A 1 162 ? 16.248  -43.873 34.892  1.00 65.58  ? 162  SER A OG  1 
ATOM   1283 N  N   . SER A 1 163 ? 13.247  -44.110 36.181  1.00 22.75  ? 163  SER A N   1 
ATOM   1284 C  CA  . SER A 1 163 ? 12.569  -45.308 36.631  1.00 28.63  ? 163  SER A CA  1 
ATOM   1285 C  C   . SER A 1 163 ? 11.369  -45.561 35.723  1.00 35.22  ? 163  SER A C   1 
ATOM   1286 O  O   . SER A 1 163 ? 11.247  -46.625 35.110  1.00 44.17  ? 163  SER A O   1 
ATOM   1287 C  CB  . SER A 1 163 ? 12.106  -45.114 38.074  1.00 24.33  ? 163  SER A CB  1 
ATOM   1288 O  OG  . SER A 1 163 ? 13.202  -44.808 38.923  1.00 30.88  ? 163  SER A OG  1 
ATOM   1289 N  N   . MET A 1 164 ? 10.528  -44.545 35.579  1.00 37.00  ? 164  MET A N   1 
ATOM   1290 C  CA  . MET A 1 164 ? 9.345   -44.636 34.739  1.00 32.31  ? 164  MET A CA  1 
ATOM   1291 C  C   . MET A 1 164 ? 9.723   -45.080 33.342  1.00 24.54  ? 164  MET A C   1 
ATOM   1292 O  O   . MET A 1 164 ? 9.137   -46.014 32.802  1.00 26.68  ? 164  MET A O   1 
ATOM   1293 C  CB  . MET A 1 164 ? 8.644   -43.275 34.663  1.00 37.48  ? 164  MET A CB  1 
ATOM   1294 C  CG  . MET A 1 164 ? 7.329   -43.262 33.878  1.00 42.31  ? 164  MET A CG  1 
ATOM   1295 S  SD  . MET A 1 164 ? 6.023   -44.361 34.526  1.00 47.23  ? 164  MET A SD  1 
ATOM   1296 C  CE  . MET A 1 164 ? 5.985   -43.888 36.256  1.00 10.02  ? 164  MET A CE  1 
ATOM   1297 N  N   . THR A 1 165 ? 10.762  -44.461 32.800  1.00 24.18  ? 165  THR A N   1 
ATOM   1298 C  CA  . THR A 1 165 ? 11.207  -44.750 31.445  1.00 33.03  ? 165  THR A CA  1 
ATOM   1299 C  C   . THR A 1 165 ? 11.530  -46.214 31.145  1.00 29.36  ? 165  THR A C   1 
ATOM   1300 O  O   . THR A 1 165 ? 11.235  -46.706 30.047  1.00 20.77  ? 165  THR A O   1 
ATOM   1301 C  CB  . THR A 1 165 ? 12.409  -43.877 31.076  1.00 39.58  ? 165  THR A CB  1 
ATOM   1302 O  OG1 . THR A 1 165 ? 12.167  -42.535 31.516  1.00 29.32  ? 165  THR A OG1 1 
ATOM   1303 C  CG2 . THR A 1 165 ? 12.624  -43.887 29.559  1.00 43.53  ? 165  THR A CG2 1 
ATOM   1304 N  N   . LYS A 1 166 ? 12.160  -46.893 32.102  1.00 29.87  ? 166  LYS A N   1 
ATOM   1305 C  CA  . LYS A 1 166 ? 12.520  -48.303 31.936  1.00 24.43  ? 166  LYS A CA  1 
ATOM   1306 C  C   . LYS A 1 166 ? 11.227  -49.107 31.958  1.00 11.76  ? 166  LYS A C   1 
ATOM   1307 O  O   . LYS A 1 166 ? 10.869  -49.766 30.965  1.00 2.33   ? 166  LYS A O   1 
ATOM   1308 C  CB  . LYS A 1 166 ? 13.488  -48.750 33.049  1.00 26.58  ? 166  LYS A CB  1 
ATOM   1309 C  CG  . LYS A 1 166 ? 14.868  -48.053 32.972  1.00 48.98  ? 166  LYS A CG  1 
ATOM   1310 C  CD  . LYS A 1 166 ? 15.827  -48.386 34.138  1.00 64.54  ? 166  LYS A CD  1 
ATOM   1311 C  CE  . LYS A 1 166 ? 15.533  -47.583 35.412  1.00 68.99  ? 166  LYS A CE  1 
ATOM   1312 N  NZ  . LYS A 1 166 ? 16.543  -47.820 36.497  1.00 66.76  ? 166  LYS A NZ  1 
ATOM   1313 N  N   . ILE A 1 167 ? 10.484  -48.937 33.051  1.00 2.00   ? 167  ILE A N   1 
ATOM   1314 C  CA  . ILE A 1 167 ? 9.204   -49.599 33.274  1.00 6.72   ? 167  ILE A CA  1 
ATOM   1315 C  C   . ILE A 1 167 ? 8.265   -49.496 32.053  1.00 16.69  ? 167  ILE A C   1 
ATOM   1316 O  O   . ILE A 1 167 ? 7.514   -50.435 31.728  1.00 13.25  ? 167  ILE A O   1 
ATOM   1317 C  CB  . ILE A 1 167 ? 8.526   -49.004 34.518  1.00 2.00   ? 167  ILE A CB  1 
ATOM   1318 C  CG1 . ILE A 1 167 ? 9.385   -49.301 35.749  1.00 17.03  ? 167  ILE A CG1 1 
ATOM   1319 C  CG2 . ILE A 1 167 ? 7.158   -49.572 34.706  1.00 2.00   ? 167  ILE A CG2 1 
ATOM   1320 C  CD1 . ILE A 1 167 ? 8.741   -48.968 37.093  1.00 2.00   ? 167  ILE A CD1 1 
ATOM   1321 N  N   . LEU A 1 168 ? 8.334   -48.374 31.352  1.00 19.91  ? 168  LEU A N   1 
ATOM   1322 C  CA  . LEU A 1 168 ? 7.494   -48.189 30.189  1.00 22.14  ? 168  LEU A CA  1 
ATOM   1323 C  C   . LEU A 1 168 ? 8.089   -48.786 28.930  1.00 27.34  ? 168  LEU A C   1 
ATOM   1324 O  O   . LEU A 1 168 ? 7.336   -49.177 28.031  1.00 33.88  ? 168  LEU A O   1 
ATOM   1325 C  CB  . LEU A 1 168 ? 7.167   -46.710 29.979  1.00 19.37  ? 168  LEU A CB  1 
ATOM   1326 C  CG  . LEU A 1 168 ? 6.424   -46.049 31.145  1.00 24.31  ? 168  LEU A CG  1 
ATOM   1327 C  CD1 . LEU A 1 168 ? 6.137   -44.598 30.823  1.00 30.36  ? 168  LEU A CD1 1 
ATOM   1328 C  CD2 . LEU A 1 168 ? 5.134   -46.798 31.448  1.00 26.43  ? 168  LEU A CD2 1 
ATOM   1329 N  N   . GLU A 1 169 ? 9.415   -48.924 28.881  1.00 26.85  ? 169  GLU A N   1 
ATOM   1330 C  CA  . GLU A 1 169 ? 10.070  -49.475 27.693  1.00 33.53  ? 169  GLU A CA  1 
ATOM   1331 C  C   . GLU A 1 169 ? 9.316   -50.686 27.131  1.00 34.33  ? 169  GLU A C   1 
ATOM   1332 O  O   . GLU A 1 169 ? 8.906   -50.687 25.957  1.00 31.69  ? 169  GLU A O   1 
ATOM   1333 C  CB  . GLU A 1 169 ? 11.538  -49.831 27.959  1.00 43.25  ? 169  GLU A CB  1 
ATOM   1334 C  CG  . GLU A 1 169 ? 12.289  -50.204 26.671  1.00 66.79  ? 169  GLU A CG  1 
ATOM   1335 C  CD  . GLU A 1 169 ? 13.745  -50.624 26.867  1.00 79.89  ? 169  GLU A CD  1 
ATOM   1336 O  OE1 . GLU A 1 169 ? 14.111  -51.088 27.970  1.00 91.90  ? 169  GLU A OE1 1 
ATOM   1337 O  OE2 . GLU A 1 169 ? 14.523  -50.505 25.891  1.00 76.14  ? 169  GLU A OE2 1 
ATOM   1338 N  N   . PRO A 1 170 ? 9.036   -51.687 27.986  1.00 31.32  ? 170  PRO A N   1 
ATOM   1339 C  CA  . PRO A 1 170 ? 8.317   -52.894 27.563  1.00 25.30  ? 170  PRO A CA  1 
ATOM   1340 C  C   . PRO A 1 170 ? 7.007   -52.561 26.831  1.00 22.86  ? 170  PRO A C   1 
ATOM   1341 O  O   . PRO A 1 170 ? 6.827   -52.868 25.648  1.00 2.00   ? 170  PRO A O   1 
ATOM   1342 C  CB  . PRO A 1 170 ? 8.012   -53.585 28.899  1.00 18.55  ? 170  PRO A CB  1 
ATOM   1343 C  CG  . PRO A 1 170 ? 9.124   -53.180 29.768  1.00 23.21  ? 170  PRO A CG  1 
ATOM   1344 C  CD  . PRO A 1 170 ? 9.311   -51.730 29.436  1.00 32.13  ? 170  PRO A CD  1 
ATOM   1345 N  N   . PHE A 1 171 ? 6.104   -51.915 27.566  1.00 32.33  ? 171  PHE A N   1 
ATOM   1346 C  CA  . PHE A 1 171 ? 4.790   -51.537 27.063  1.00 34.72  ? 171  PHE A CA  1 
ATOM   1347 C  C   . PHE A 1 171 ? 4.895   -50.779 25.741  1.00 28.95  ? 171  PHE A C   1 
ATOM   1348 O  O   . PHE A 1 171 ? 4.219   -51.116 24.760  1.00 14.00  ? 171  PHE A O   1 
ATOM   1349 C  CB  . PHE A 1 171 ? 4.065   -50.690 28.123  1.00 36.55  ? 171  PHE A CB  1 
ATOM   1350 C  CG  . PHE A 1 171 ? 2.616   -50.416 27.805  1.00 45.82  ? 171  PHE A CG  1 
ATOM   1351 C  CD1 . PHE A 1 171 ? 1.620   -51.280 28.234  1.00 45.61  ? 171  PHE A CD1 1 
ATOM   1352 C  CD2 . PHE A 1 171 ? 2.245   -49.283 27.092  1.00 50.88  ? 171  PHE A CD2 1 
ATOM   1353 C  CE1 . PHE A 1 171 ? 0.276   -51.017 27.956  1.00 42.13  ? 171  PHE A CE1 1 
ATOM   1354 C  CE2 . PHE A 1 171 ? 0.898   -49.018 26.812  1.00 49.77  ? 171  PHE A CE2 1 
ATOM   1355 C  CZ  . PHE A 1 171 ? -0.081  -49.887 27.246  1.00 39.34  ? 171  PHE A CZ  1 
ATOM   1356 N  N   . ARG A 1 172 ? 5.772   -49.780 25.712  1.00 26.32  ? 172  ARG A N   1 
ATOM   1357 C  CA  . ARG A 1 172 ? 5.943   -48.985 24.515  1.00 34.86  ? 172  ARG A CA  1 
ATOM   1358 C  C   . ARG A 1 172 ? 6.303   -49.880 23.349  1.00 33.15  ? 172  ARG A C   1 
ATOM   1359 O  O   . ARG A 1 172 ? 5.634   -49.846 22.311  1.00 22.88  ? 172  ARG A O   1 
ATOM   1360 C  CB  . ARG A 1 172 ? 7.021   -47.922 24.709  1.00 43.56  ? 172  ARG A CB  1 
ATOM   1361 C  CG  . ARG A 1 172 ? 6.758   -46.976 25.863  1.00 50.49  ? 172  ARG A CG  1 
ATOM   1362 C  CD  . ARG A 1 172 ? 7.553   -45.686 25.725  1.00 49.25  ? 172  ARG A CD  1 
ATOM   1363 N  NE  . ARG A 1 172 ? 7.875   -45.107 27.028  1.00 51.56  ? 172  ARG A NE  1 
ATOM   1364 C  CZ  . ARG A 1 172 ? 7.810   -43.809 27.315  1.00 43.45  ? 172  ARG A CZ  1 
ATOM   1365 N  NH1 . ARG A 1 172 ? 7.423   -42.936 26.393  1.00 32.47  ? 172  ARG A NH1 1 
ATOM   1366 N  NH2 . ARG A 1 172 ? 8.175   -43.380 28.519  1.00 32.70  ? 172  ARG A NH2 1 
ATOM   1367 N  N   . LYS A 1 173 ? 7.323   -50.713 23.548  1.00 36.43  ? 173  LYS A N   1 
ATOM   1368 C  CA  . LYS A 1 173 ? 7.789   -51.629 22.506  1.00 42.63  ? 173  LYS A CA  1 
ATOM   1369 C  C   . LYS A 1 173 ? 6.653   -52.475 21.942  1.00 47.77  ? 173  LYS A C   1 
ATOM   1370 O  O   . LYS A 1 173 ? 6.553   -52.674 20.724  1.00 49.46  ? 173  LYS A O   1 
ATOM   1371 C  CB  . LYS A 1 173 ? 8.906   -52.537 23.036  1.00 28.21  ? 173  LYS A CB  1 
ATOM   1372 C  CG  . LYS A 1 173 ? 10.297  -51.931 22.929  1.00 38.87  ? 173  LYS A CG  1 
ATOM   1373 C  CD  . LYS A 1 173 ? 11.015  -51.923 24.275  1.00 38.77  ? 173  LYS A CD  1 
ATOM   1374 C  CE  . LYS A 1 173 ? 11.273  -53.327 24.808  1.00 39.66  ? 173  LYS A CE  1 
ATOM   1375 N  NZ  . LYS A 1 173 ? 11.813  -53.349 26.205  1.00 21.65  ? 173  LYS A NZ  1 
ATOM   1376 N  N   . GLN A 1 174 ? 5.767   -52.913 22.830  1.00 45.01  ? 174  GLN A N   1 
ATOM   1377 C  CA  . GLN A 1 174 ? 4.639   -53.741 22.450  1.00 45.09  ? 174  GLN A CA  1 
ATOM   1378 C  C   . GLN A 1 174 ? 3.577   -53.036 21.614  1.00 46.37  ? 174  GLN A C   1 
ATOM   1379 O  O   . GLN A 1 174 ? 3.072   -53.600 20.643  1.00 54.77  ? 174  GLN A O   1 
ATOM   1380 C  CB  . GLN A 1 174 ? 4.012   -54.344 23.695  1.00 51.21  ? 174  GLN A CB  1 
ATOM   1381 C  CG  . GLN A 1 174 ? 4.958   -55.269 24.424  1.00 65.21  ? 174  GLN A CG  1 
ATOM   1382 C  CD  . GLN A 1 174 ? 4.499   -55.595 25.828  1.00 75.44  ? 174  GLN A CD  1 
ATOM   1383 O  OE1 . GLN A 1 174 ? 5.311   -55.684 26.745  1.00 84.62  ? 174  GLN A OE1 1 
ATOM   1384 N  NE2 . GLN A 1 174 ? 3.196   -55.769 26.009  1.00 74.50  ? 174  GLN A NE2 1 
ATOM   1385 N  N   . ASN A 1 175 ? 3.238   -51.807 21.976  1.00 36.94  ? 175  ASN A N   1 
ATOM   1386 C  CA  . ASN A 1 175 ? 2.220   -51.066 21.237  1.00 23.15  ? 175  ASN A CA  1 
ATOM   1387 C  C   . ASN A 1 175 ? 2.773   -49.731 20.755  1.00 10.04  ? 175  ASN A C   1 
ATOM   1388 O  O   . ASN A 1 175 ? 2.521   -48.685 21.327  1.00 2.00   ? 175  ASN A O   1 
ATOM   1389 C  CB  . ASN A 1 175 ? 0.957   -50.899 22.087  1.00 13.10  ? 175  ASN A CB  1 
ATOM   1390 C  CG  . ASN A 1 175 ? 1.260   -50.915 23.565  1.00 29.21  ? 175  ASN A CG  1 
ATOM   1391 O  OD1 . ASN A 1 175 ? 0.989   -51.897 24.256  1.00 38.92  ? 175  ASN A OD1 1 
ATOM   1392 N  ND2 . ASN A 1 175 ? 1.890   -49.854 24.049  1.00 24.40  ? 175  ASN A ND2 1 
ATOM   1393 N  N   . PRO A 1 176 ? 3.478   -49.761 19.624  1.00 21.81  ? 176  PRO A N   1 
ATOM   1394 C  CA  . PRO A 1 176 ? 4.089   -48.580 19.013  1.00 33.97  ? 176  PRO A CA  1 
ATOM   1395 C  C   . PRO A 1 176 ? 3.078   -47.475 18.771  1.00 36.20  ? 176  PRO A C   1 
ATOM   1396 O  O   . PRO A 1 176 ? 3.392   -46.294 18.882  1.00 36.63  ? 176  PRO A O   1 
ATOM   1397 C  CB  . PRO A 1 176 ? 4.621   -49.128 17.687  1.00 37.71  ? 176  PRO A CB  1 
ATOM   1398 C  CG  . PRO A 1 176 ? 3.639   -50.201 17.358  1.00 24.09  ? 176  PRO A CG  1 
ATOM   1399 C  CD  . PRO A 1 176 ? 3.524   -50.900 18.693  1.00 19.94  ? 176  PRO A CD  1 
ATOM   1400 N  N   . ASP A 1 177 ? 1.859   -47.875 18.442  1.00 39.06  ? 177  ASP A N   1 
ATOM   1401 C  CA  . ASP A 1 177 ? 0.790   -46.936 18.166  1.00 45.40  ? 177  ASP A CA  1 
ATOM   1402 C  C   . ASP A 1 177 ? 0.155   -46.325 19.422  1.00 43.66  ? 177  ASP A C   1 
ATOM   1403 O  O   . ASP A 1 177 ? -1.046  -46.038 19.453  1.00 48.91  ? 177  ASP A O   1 
ATOM   1404 C  CB  . ASP A 1 177 ? -0.272  -47.599 17.279  1.00 56.75  ? 177  ASP A CB  1 
ATOM   1405 C  CG  . ASP A 1 177 ? -0.961  -48.781 17.955  1.00 68.65  ? 177  ASP A CG  1 
ATOM   1406 O  OD1 . ASP A 1 177 ? -0.397  -49.388 18.899  1.00 60.15  ? 177  ASP A OD1 1 
ATOM   1407 O  OD2 . ASP A 1 177 ? -2.085  -49.107 17.518  1.00 79.99  ? 177  ASP A OD2 1 
ATOM   1408 N  N   . ILE A 1 178 ? 0.953   -46.170 20.470  1.00 33.70  ? 178  ILE A N   1 
ATOM   1409 C  CA  . ILE A 1 178 ? 0.490   -45.562 21.708  1.00 30.94  ? 178  ILE A CA  1 
ATOM   1410 C  C   . ILE A 1 178 ? 1.593   -44.608 22.184  1.00 39.84  ? 178  ILE A C   1 
ATOM   1411 O  O   . ILE A 1 178 ? 2.750   -45.021 22.357  1.00 43.13  ? 178  ILE A O   1 
ATOM   1412 C  CB  . ILE A 1 178 ? 0.171   -46.624 22.800  1.00 21.74  ? 178  ILE A CB  1 
ATOM   1413 C  CG1 . ILE A 1 178 ? -1.266  -47.128 22.656  1.00 38.34  ? 178  ILE A CG1 1 
ATOM   1414 C  CG2 . ILE A 1 178 ? 0.342   -46.044 24.194  1.00 2.00   ? 178  ILE A CG2 1 
ATOM   1415 C  CD1 . ILE A 1 178 ? -1.492  -48.105 21.523  1.00 55.35  ? 178  ILE A CD1 1 
ATOM   1416 N  N   . VAL A 1 179 ? 1.238   -43.332 22.355  1.00 36.26  ? 179  VAL A N   1 
ATOM   1417 C  CA  . VAL A 1 179 ? 2.177   -42.297 22.803  1.00 29.98  ? 179  VAL A CA  1 
ATOM   1418 C  C   . VAL A 1 179 ? 1.944   -41.964 24.280  1.00 21.26  ? 179  VAL A C   1 
ATOM   1419 O  O   . VAL A 1 179 ? 0.810   -41.693 24.674  1.00 24.95  ? 179  VAL A O   1 
ATOM   1420 C  CB  . VAL A 1 179 ? 2.004   -41.018 21.969  1.00 31.55  ? 179  VAL A CB  1 
ATOM   1421 C  CG1 . VAL A 1 179 ? 3.106   -40.007 22.312  1.00 31.36  ? 179  VAL A CG1 1 
ATOM   1422 C  CG2 . VAL A 1 179 ? 1.981   -41.362 20.483  1.00 15.07  ? 179  VAL A CG2 1 
ATOM   1423 N  N   . ILE A 1 180 ? 3.015   -41.940 25.073  1.00 6.52   ? 180  ILE A N   1 
ATOM   1424 C  CA  . ILE A 1 180 ? 2.927   -41.666 26.513  1.00 12.96  ? 180  ILE A CA  1 
ATOM   1425 C  C   . ILE A 1 180 ? 3.802   -40.500 26.962  1.00 18.10  ? 180  ILE A C   1 
ATOM   1426 O  O   . ILE A 1 180 ? 5.028   -40.577 26.884  1.00 31.58  ? 180  ILE A O   1 
ATOM   1427 C  CB  . ILE A 1 180 ? 3.394   -42.902 27.328  1.00 20.95  ? 180  ILE A CB  1 
ATOM   1428 C  CG1 . ILE A 1 180 ? 2.594   -44.136 26.909  1.00 29.36  ? 180  ILE A CG1 1 
ATOM   1429 C  CG2 . ILE A 1 180 ? 3.316   -42.645 28.860  1.00 5.12   ? 180  ILE A CG2 1 
ATOM   1430 C  CD1 . ILE A 1 180 ? 3.204   -45.433 27.398  1.00 44.65  ? 180  ILE A CD1 1 
ATOM   1431 N  N   . TYR A 1 181 ? 3.195   -39.439 27.474  1.00 14.53  ? 181  TYR A N   1 
ATOM   1432 C  CA  . TYR A 1 181 ? 3.985   -38.317 27.955  1.00 12.42  ? 181  TYR A CA  1 
ATOM   1433 C  C   . TYR A 1 181 ? 4.163   -38.279 29.484  1.00 8.62   ? 181  TYR A C   1 
ATOM   1434 O  O   . TYR A 1 181 ? 3.215   -38.449 30.272  1.00 2.00   ? 181  TYR A O   1 
ATOM   1435 C  CB  . TYR A 1 181 ? 3.438   -36.991 27.446  1.00 8.41   ? 181  TYR A CB  1 
ATOM   1436 C  CG  . TYR A 1 181 ? 4.188   -35.805 28.018  1.00 31.09  ? 181  TYR A CG  1 
ATOM   1437 C  CD1 . TYR A 1 181 ? 5.513   -35.535 27.649  1.00 51.24  ? 181  TYR A CD1 1 
ATOM   1438 C  CD2 . TYR A 1 181 ? 3.577   -34.952 28.922  1.00 22.94  ? 181  TYR A CD2 1 
ATOM   1439 C  CE1 . TYR A 1 181 ? 6.199   -34.434 28.171  1.00 46.02  ? 181  TYR A CE1 1 
ATOM   1440 C  CE2 . TYR A 1 181 ? 4.244   -33.862 29.443  1.00 35.39  ? 181  TYR A CE2 1 
ATOM   1441 C  CZ  . TYR A 1 181 ? 5.549   -33.600 29.070  1.00 38.04  ? 181  TYR A CZ  1 
ATOM   1442 O  OH  . TYR A 1 181 ? 6.166   -32.483 29.593  1.00 22.02  ? 181  TYR A OH  1 
ATOM   1443 N  N   . GLN A 1 182 ? 5.406   -38.081 29.891  1.00 8.06   ? 182  GLN A N   1 
ATOM   1444 C  CA  . GLN A 1 182 ? 5.712   -38.019 31.298  1.00 15.11  ? 182  GLN A CA  1 
ATOM   1445 C  C   . GLN A 1 182 ? 6.025   -36.587 31.703  1.00 17.28  ? 182  GLN A C   1 
ATOM   1446 O  O   . GLN A 1 182 ? 6.777   -35.881 31.028  1.00 14.81  ? 182  GLN A O   1 
ATOM   1447 C  CB  . GLN A 1 182 ? 6.884   -38.935 31.630  1.00 20.67  ? 182  GLN A CB  1 
ATOM   1448 C  CG  . GLN A 1 182 ? 6.653   -39.843 32.838  1.00 45.78  ? 182  GLN A CG  1 
ATOM   1449 C  CD  . GLN A 1 182 ? 6.657   -39.116 34.182  1.00 62.47  ? 182  GLN A CD  1 
ATOM   1450 O  OE1 . GLN A 1 182 ? 7.619   -39.214 34.937  1.00 74.47  ? 182  GLN A OE1 1 
ATOM   1451 N  NE2 . GLN A 1 182 ? 5.567   -38.430 34.503  1.00 59.57  ? 182  GLN A NE2 1 
ATOM   1452 N  N   . TYR A 1 183 ? 5.383   -36.151 32.778  1.00 13.27  ? 183  TYR A N   1 
ATOM   1453 C  CA  . TYR A 1 183 ? 5.578   -34.829 33.311  1.00 5.55   ? 183  TYR A CA  1 
ATOM   1454 C  C   . TYR A 1 183 ? 5.184   -34.872 34.763  1.00 12.57  ? 183  TYR A C   1 
ATOM   1455 O  O   . TYR A 1 183 ? 4.045   -35.192 35.075  1.00 20.21  ? 183  TYR A O   1 
ATOM   1456 C  CB  . TYR A 1 183 ? 4.689   -33.817 32.611  1.00 20.16  ? 183  TYR A CB  1 
ATOM   1457 C  CG  . TYR A 1 183 ? 4.870   -32.451 33.207  1.00 53.65  ? 183  TYR A CG  1 
ATOM   1458 C  CD1 . TYR A 1 183 ? 6.073   -31.765 33.052  1.00 68.66  ? 183  TYR A CD1 1 
ATOM   1459 C  CD2 . TYR A 1 183 ? 3.896   -31.892 34.024  1.00 64.36  ? 183  TYR A CD2 1 
ATOM   1460 C  CE1 . TYR A 1 183 ? 6.307   -30.566 33.703  1.00 68.46  ? 183  TYR A CE1 1 
ATOM   1461 C  CE2 . TYR A 1 183 ? 4.124   -30.690 34.682  1.00 73.89  ? 183  TYR A CE2 1 
ATOM   1462 C  CZ  . TYR A 1 183 ? 5.332   -30.037 34.518  1.00 71.90  ? 183  TYR A CZ  1 
ATOM   1463 O  OH  . TYR A 1 183 ? 5.574   -28.864 35.184  1.00 81.72  ? 183  TYR A OH  1 
ATOM   1464 N  N   . MET A 1 184 ? 6.101   -34.521 35.654  1.00 14.10  ? 184  MET A N   1 
ATOM   1465 C  CA  . MET A 1 184 ? 5.785   -34.529 37.072  1.00 24.29  ? 184  MET A CA  1 
ATOM   1466 C  C   . MET A 1 184 ? 5.330   -35.947 37.385  1.00 29.52  ? 184  MET A C   1 
ATOM   1467 O  O   . MET A 1 184 ? 5.940   -36.913 36.917  1.00 19.69  ? 184  MET A O   1 
ATOM   1468 C  CB  . MET A 1 184 ? 4.645   -33.535 37.357  1.00 35.86  ? 184  MET A CB  1 
ATOM   1469 C  CG  . MET A 1 184 ? 4.938   -32.494 38.440  1.00 56.86  ? 184  MET A CG  1 
ATOM   1470 S  SD  . MET A 1 184 ? 6.084   -31.187 37.913  1.00 54.06  ? 184  MET A SD  1 
ATOM   1471 C  CE  . MET A 1 184 ? 7.615   -31.760 38.648  1.00 52.96  ? 184  MET A CE  1 
ATOM   1472 N  N   . ASP A 1 185 ? 4.198   -36.056 38.077  1.00 37.34  ? 185  ASP A N   1 
ATOM   1473 C  CA  . ASP A 1 185 ? 3.617   -37.343 38.446  1.00 32.93  ? 185  ASP A CA  1 
ATOM   1474 C  C   . ASP A 1 185 ? 2.450   -37.608 37.503  1.00 26.17  ? 185  ASP A C   1 
ATOM   1475 O  O   . ASP A 1 185 ? 1.460   -38.226 37.881  1.00 30.78  ? 185  ASP A O   1 
ATOM   1476 C  CB  . ASP A 1 185 ? 3.097   -37.287 39.884  1.00 37.52  ? 185  ASP A CB  1 
ATOM   1477 C  CG  . ASP A 1 185 ? 4.072   -36.626 40.825  1.00 48.43  ? 185  ASP A CG  1 
ATOM   1478 O  OD1 . ASP A 1 185 ? 5.156   -37.205 41.056  1.00 53.82  ? 185  ASP A OD1 1 
ATOM   1479 O  OD2 . ASP A 1 185 ? 3.757   -35.522 41.322  1.00 53.17  ? 185  ASP A OD2 1 
ATOM   1480 N  N   . ASP A 1 186 ? 2.557   -37.120 36.277  1.00 21.06  ? 186  ASP A N   1 
ATOM   1481 C  CA  . ASP A 1 186 ? 1.497   -37.307 35.306  1.00 18.29  ? 186  ASP A CA  1 
ATOM   1482 C  C   . ASP A 1 186 ? 1.904   -38.036 34.035  1.00 15.69  ? 186  ASP A C   1 
ATOM   1483 O  O   . ASP A 1 186 ? 2.959   -37.765 33.444  1.00 10.91  ? 186  ASP A O   1 
ATOM   1484 C  CB  . ASP A 1 186 ? 0.859   -35.969 34.967  1.00 16.51  ? 186  ASP A CB  1 
ATOM   1485 C  CG  . ASP A 1 186 ? -0.166  -35.546 35.990  1.00 49.93  ? 186  ASP A CG  1 
ATOM   1486 O  OD1 . ASP A 1 186 ? -1.283  -36.106 35.972  1.00 67.14  ? 186  ASP A OD1 1 
ATOM   1487 O  OD2 . ASP A 1 186 ? 0.144   -34.675 36.827  1.00 69.02  ? 186  ASP A OD2 1 
ATOM   1488 N  N   . LEU A 1 187 ? 1.084   -39.006 33.650  1.00 14.75  ? 187  LEU A N   1 
ATOM   1489 C  CA  . LEU A 1 187 ? 1.329   -39.768 32.433  1.00 16.26  ? 187  LEU A CA  1 
ATOM   1490 C  C   . LEU A 1 187 ? 0.220   -39.376 31.468  1.00 15.79  ? 187  LEU A C   1 
ATOM   1491 O  O   . LEU A 1 187 ? -0.956  -39.401 31.830  1.00 2.00   ? 187  LEU A O   1 
ATOM   1492 C  CB  . LEU A 1 187 ? 1.325   -41.270 32.725  1.00 2.00   ? 187  LEU A CB  1 
ATOM   1493 C  CG  . LEU A 1 187 ? 2.387   -41.671 33.757  1.00 2.22   ? 187  LEU A CG  1 
ATOM   1494 C  CD1 . LEU A 1 187 ? 2.667   -43.159 33.762  1.00 2.00   ? 187  LEU A CD1 1 
ATOM   1495 C  CD2 . LEU A 1 187 ? 3.658   -40.963 33.407  1.00 31.37  ? 187  LEU A CD2 1 
ATOM   1496 N  N   . TYR A 1 188 ? 0.602   -38.898 30.288  1.00 17.13  ? 188  TYR A N   1 
ATOM   1497 C  CA  . TYR A 1 188 ? -0.368  -38.475 29.282  1.00 20.75  ? 188  TYR A CA  1 
ATOM   1498 C  C   . TYR A 1 188 ? -0.349  -39.425 28.106  1.00 27.48  ? 188  TYR A C   1 
ATOM   1499 O  O   . TYR A 1 188 ? 0.512   -39.332 27.237  1.00 32.07  ? 188  TYR A O   1 
ATOM   1500 C  CB  . TYR A 1 188 ? -0.050  -37.067 28.816  1.00 21.81  ? 188  TYR A CB  1 
ATOM   1501 C  CG  . TYR A 1 188 ? -0.172  -36.046 29.928  1.00 42.79  ? 188  TYR A CG  1 
ATOM   1502 C  CD1 . TYR A 1 188 ? 0.827   -35.915 30.899  1.00 20.31  ? 188  TYR A CD1 1 
ATOM   1503 C  CD2 . TYR A 1 188 ? -1.300  -35.213 30.015  1.00 45.40  ? 188  TYR A CD2 1 
ATOM   1504 C  CE1 . TYR A 1 188 ? 0.704   -34.988 31.919  1.00 22.17  ? 188  TYR A CE1 1 
ATOM   1505 C  CE2 . TYR A 1 188 ? -1.431  -34.285 31.032  1.00 26.95  ? 188  TYR A CE2 1 
ATOM   1506 C  CZ  . TYR A 1 188 ? -0.428  -34.174 31.983  1.00 28.74  ? 188  TYR A CZ  1 
ATOM   1507 O  OH  . TYR A 1 188 ? -0.562  -33.249 32.999  1.00 33.45  ? 188  TYR A OH  1 
ATOM   1508 N  N   . VAL A 1 189 ? -1.284  -40.366 28.107  1.00 27.39  ? 189  VAL A N   1 
ATOM   1509 C  CA  . VAL A 1 189 ? -1.382  -41.360 27.051  1.00 14.16  ? 189  VAL A CA  1 
ATOM   1510 C  C   . VAL A 1 189 ? -2.514  -41.086 26.041  1.00 8.49   ? 189  VAL A C   1 
ATOM   1511 O  O   . VAL A 1 189 ? -3.708  -40.996 26.399  1.00 2.00   ? 189  VAL A O   1 
ATOM   1512 C  CB  . VAL A 1 189 ? -1.562  -42.763 27.643  1.00 20.03  ? 189  VAL A CB  1 
ATOM   1513 C  CG1 . VAL A 1 189 ? -1.298  -43.801 26.564  1.00 25.92  ? 189  VAL A CG1 1 
ATOM   1514 C  CG2 . VAL A 1 189 ? -0.651  -42.968 28.865  1.00 9.36   ? 189  VAL A CG2 1 
ATOM   1515 N  N   . GLY A 1 190 ? -2.142  -40.964 24.773  1.00 7.66   ? 190  GLY A N   1 
ATOM   1516 C  CA  . GLY A 1 190 ? -3.133  -40.709 23.740  1.00 15.74  ? 190  GLY A CA  1 
ATOM   1517 C  C   . GLY A 1 190 ? -3.021  -41.727 22.629  1.00 19.85  ? 190  GLY A C   1 
ATOM   1518 O  O   . GLY A 1 190 ? -2.069  -42.509 22.621  1.00 29.92  ? 190  GLY A O   1 
ATOM   1519 N  N   . SER A 1 191 ? -3.967  -41.731 21.692  1.00 22.93  ? 191  SER A N   1 
ATOM   1520 C  CA  . SER A 1 191 ? -3.914  -42.694 20.590  1.00 29.10  ? 191  SER A CA  1 
ATOM   1521 C  C   . SER A 1 191 ? -4.889  -42.366 19.481  1.00 26.34  ? 191  SER A C   1 
ATOM   1522 O  O   . SER A 1 191 ? -5.677  -41.423 19.581  1.00 22.23  ? 191  SER A O   1 
ATOM   1523 C  CB  . SER A 1 191 ? -4.275  -44.092 21.090  1.00 26.03  ? 191  SER A CB  1 
ATOM   1524 O  OG  . SER A 1 191 ? -5.686  -44.190 21.281  1.00 19.91  ? 191  SER A OG  1 
ATOM   1525 N  N   . ASP A 1 192 ? -4.887  -43.234 18.473  1.00 25.63  ? 192  ASP A N   1 
ATOM   1526 C  CA  . ASP A 1 192 ? -5.785  -43.126 17.337  1.00 26.70  ? 192  ASP A CA  1 
ATOM   1527 C  C   . ASP A 1 192 ? -6.649  -44.375 17.285  1.00 24.30  ? 192  ASP A C   1 
ATOM   1528 O  O   . ASP A 1 192 ? -7.386  -44.615 16.337  1.00 12.13  ? 192  ASP A O   1 
ATOM   1529 C  CB  . ASP A 1 192 ? -4.996  -42.916 16.051  1.00 34.35  ? 192  ASP A CB  1 
ATOM   1530 C  CG  . ASP A 1 192 ? -4.443  -41.500 15.945  1.00 42.47  ? 192  ASP A CG  1 
ATOM   1531 O  OD1 . ASP A 1 192 ? -5.122  -40.552 16.409  1.00 51.00  ? 192  ASP A OD1 1 
ATOM   1532 O  OD2 . ASP A 1 192 ? -3.330  -41.332 15.406  1.00 39.68  ? 192  ASP A OD2 1 
ATOM   1533 N  N   . LEU A 1 193 ? -6.561  -45.153 18.357  1.00 40.06  ? 193  LEU A N   1 
ATOM   1534 C  CA  . LEU A 1 193 ? -7.330  -46.380 18.511  1.00 51.74  ? 193  LEU A CA  1 
ATOM   1535 C  C   . LEU A 1 193 ? -8.785  -46.057 18.831  1.00 53.90  ? 193  LEU A C   1 
ATOM   1536 O  O   . LEU A 1 193 ? -9.124  -44.918 19.169  1.00 61.07  ? 193  LEU A O   1 
ATOM   1537 C  CB  . LEU A 1 193 ? -6.770  -47.213 19.670  1.00 50.64  ? 193  LEU A CB  1 
ATOM   1538 C  CG  . LEU A 1 193 ? -5.352  -47.772 19.573  1.00 56.76  ? 193  LEU A CG  1 
ATOM   1539 C  CD1 . LEU A 1 193 ? -5.019  -48.521 20.867  1.00 58.76  ? 193  LEU A CD1 1 
ATOM   1540 C  CD2 . LEU A 1 193 ? -5.233  -48.685 18.348  1.00 56.96  ? 193  LEU A CD2 1 
ATOM   1541 N  N   . GLU A 1 194 ? -9.634  -47.074 18.748  1.00 49.12  ? 194  GLU A N   1 
ATOM   1542 C  CA  . GLU A 1 194 ? -11.030 -46.908 19.077  1.00 39.33  ? 194  GLU A CA  1 
ATOM   1543 C  C   . GLU A 1 194 ? -11.081 -46.804 20.587  1.00 25.91  ? 194  GLU A C   1 
ATOM   1544 O  O   . GLU A 1 194 ? -10.340 -47.485 21.296  1.00 12.24  ? 194  GLU A O   1 
ATOM   1545 C  CB  . GLU A 1 194 ? -11.853 -48.074 18.538  1.00 53.98  ? 194  GLU A CB  1 
ATOM   1546 C  CG  . GLU A 1 194 ? -11.824 -48.125 17.010  1.00 76.77  ? 194  GLU A CG  1 
ATOM   1547 C  CD  . GLU A 1 194 ? -11.857 -46.728 16.377  1.00 89.62  ? 194  GLU A CD  1 
ATOM   1548 O  OE1 . GLU A 1 194 ? -12.751 -45.923 16.733  1.00 102.40 ? 194  GLU A OE1 1 
ATOM   1549 O  OE2 . GLU A 1 194 ? -10.978 -46.426 15.540  1.00 83.77  ? 194  GLU A OE2 1 
ATOM   1550 N  N   . ILE A 1 195 ? -11.926 -45.903 21.061  1.00 18.80  ? 195  ILE A N   1 
ATOM   1551 C  CA  . ILE A 1 195 ? -12.064 -45.627 22.479  1.00 21.94  ? 195  ILE A CA  1 
ATOM   1552 C  C   . ILE A 1 195 ? -12.086 -46.858 23.386  1.00 29.63  ? 195  ILE A C   1 
ATOM   1553 O  O   . ILE A 1 195 ? -11.565 -46.821 24.506  1.00 30.09  ? 195  ILE A O   1 
ATOM   1554 C  CB  . ILE A 1 195 ? -13.286 -44.748 22.733  1.00 21.53  ? 195  ILE A CB  1 
ATOM   1555 C  CG1 . ILE A 1 195 ? -14.561 -45.592 22.756  1.00 48.95  ? 195  ILE A CG1 1 
ATOM   1556 C  CG2 . ILE A 1 195 ? -13.417 -43.734 21.605  1.00 16.89  ? 195  ILE A CG2 1 
ATOM   1557 C  CD1 . ILE A 1 195 ? -15.784 -44.821 23.195  1.00 61.71  ? 195  ILE A CD1 1 
ATOM   1558 N  N   . GLY A 1 196 ? -12.695 -47.939 22.904  1.00 26.69  ? 196  GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 196 ? -12.752 -49.154 23.689  1.00 19.69  ? 196  GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 196 ? -11.340 -49.677 23.796  1.00 24.29  ? 196  GLY A C   1 
ATOM   1561 O  O   . GLY A 1 196 ? -10.782 -49.781 24.896  1.00 18.87  ? 196  GLY A O   1 
ATOM   1562 N  N   . GLN A 1 197 ? -10.757 -49.949 22.627  1.00 28.35  ? 197  GLN A N   1 
ATOM   1563 C  CA  . GLN A 1 197 ? -9.389  -50.438 22.512  1.00 29.10  ? 197  GLN A CA  1 
ATOM   1564 C  C   . GLN A 1 197 ? -8.506  -49.571 23.411  1.00 26.46  ? 197  GLN A C   1 
ATOM   1565 O  O   . GLN A 1 197 ? -7.789  -50.082 24.272  1.00 15.12  ? 197  GLN A O   1 
ATOM   1566 C  CB  . GLN A 1 197 ? -8.930  -50.346 21.046  1.00 30.71  ? 197  GLN A CB  1 
ATOM   1567 C  CG  . GLN A 1 197 ? -9.255  -51.576 20.175  1.00 48.05  ? 197  GLN A CG  1 
ATOM   1568 C  CD  . GLN A 1 197 ? -8.272  -52.750 20.374  1.00 60.83  ? 197  GLN A CD  1 
ATOM   1569 O  OE1 . GLN A 1 197 ? -7.399  -52.708 21.243  1.00 68.01  ? 197  GLN A OE1 1 
ATOM   1570 N  NE2 . GLN A 1 197 ? -8.425  -53.802 19.566  1.00 56.22  ? 197  GLN A NE2 1 
ATOM   1571 N  N   . HIS A 1 198 ? -8.664  -48.254 23.268  1.00 27.09  ? 198  HIS A N   1 
ATOM   1572 C  CA  . HIS A 1 198 ? -7.927  -47.258 24.041  1.00 24.54  ? 198  HIS A CA  1 
ATOM   1573 C  C   . HIS A 1 198 ? -8.088  -47.469 25.552  1.00 24.21  ? 198  HIS A C   1 
ATOM   1574 O  O   . HIS A 1 198 ? -7.115  -47.729 26.273  1.00 14.68  ? 198  HIS A O   1 
ATOM   1575 C  CB  . HIS A 1 198 ? -8.416  -45.856 23.667  1.00 17.29  ? 198  HIS A CB  1 
ATOM   1576 C  CG  . HIS A 1 198 ? -7.690  -44.746 24.376  1.00 41.29  ? 198  HIS A CG  1 
ATOM   1577 N  ND1 . HIS A 1 198 ? -6.634  -44.061 23.815  1.00 40.18  ? 198  HIS A ND1 1 
ATOM   1578 C  CD2 . HIS A 1 198 ? -7.856  -44.220 25.613  1.00 49.82  ? 198  HIS A CD2 1 
ATOM   1579 C  CE1 . HIS A 1 198 ? -6.176  -43.169 24.671  1.00 24.01  ? 198  HIS A CE1 1 
ATOM   1580 N  NE2 . HIS A 1 198 ? -6.899  -43.245 25.775  1.00 37.01  ? 198  HIS A NE2 1 
ATOM   1581 N  N   . ARG A 1 199 ? -9.320  -47.327 26.021  1.00 24.56  ? 199  ARG A N   1 
ATOM   1582 C  CA  . ARG A 1 199 ? -9.647  -47.492 27.429  1.00 33.11  ? 199  ARG A CA  1 
ATOM   1583 C  C   . ARG A 1 199 ? -9.124  -48.839 27.937  1.00 34.68  ? 199  ARG A C   1 
ATOM   1584 O  O   . ARG A 1 199 ? -8.673  -48.967 29.093  1.00 30.63  ? 199  ARG A O   1 
ATOM   1585 C  CB  . ARG A 1 199 ? -11.162 -47.386 27.593  1.00 43.32  ? 199  ARG A CB  1 
ATOM   1586 C  CG  . ARG A 1 199 ? -11.720 -47.915 28.906  1.00 62.36  ? 199  ARG A CG  1 
ATOM   1587 C  CD  . ARG A 1 199 ? -12.502 -49.198 28.666  1.00 66.78  ? 199  ARG A CD  1 
ATOM   1588 N  NE  . ARG A 1 199 ? -13.526 -49.028 27.636  1.00 66.02  ? 199  ARG A NE  1 
ATOM   1589 C  CZ  . ARG A 1 199 ? -14.212 -50.025 27.087  1.00 73.51  ? 199  ARG A CZ  1 
ATOM   1590 N  NH1 . ARG A 1 199 ? -13.992 -51.280 27.461  1.00 82.53  ? 199  ARG A NH1 1 
ATOM   1591 N  NH2 . ARG A 1 199 ? -15.125 -49.769 26.162  1.00 74.63  ? 199  ARG A NH2 1 
ATOM   1592 N  N   . THR A 1 200 ? -9.177  -49.831 27.052  1.00 26.85  ? 200  THR A N   1 
ATOM   1593 C  CA  . THR A 1 200 ? -8.702  -51.162 27.360  1.00 21.64  ? 200  THR A CA  1 
ATOM   1594 C  C   . THR A 1 200 ? -7.199  -51.056 27.636  1.00 17.31  ? 200  THR A C   1 
ATOM   1595 O  O   . THR A 1 200 ? -6.742  -51.336 28.746  1.00 8.92   ? 200  THR A O   1 
ATOM   1596 C  CB  . THR A 1 200 ? -8.974  -52.141 26.169  1.00 21.51  ? 200  THR A CB  1 
ATOM   1597 O  OG1 . THR A 1 200 ? -10.388 -52.292 25.980  1.00 4.23   ? 200  THR A OG1 1 
ATOM   1598 C  CG2 . THR A 1 200 ? -8.348  -53.515 26.424  1.00 9.13   ? 200  THR A CG2 1 
ATOM   1599 N  N   . LYS A 1 201 ? -6.459  -50.557 26.647  1.00 20.61  ? 201  LYS A N   1 
ATOM   1600 C  CA  . LYS A 1 201 ? -5.010  -50.409 26.741  1.00 24.54  ? 201  LYS A CA  1 
ATOM   1601 C  C   . LYS A 1 201 ? -4.580  -49.601 27.962  1.00 22.35  ? 201  LYS A C   1 
ATOM   1602 O  O   . LYS A 1 201 ? -3.563  -49.918 28.607  1.00 16.19  ? 201  LYS A O   1 
ATOM   1603 C  CB  . LYS A 1 201 ? -4.470  -49.801 25.451  1.00 24.12  ? 201  LYS A CB  1 
ATOM   1604 C  CG  . LYS A 1 201 ? -4.487  -50.772 24.278  1.00 28.49  ? 201  LYS A CG  1 
ATOM   1605 C  CD  . LYS A 1 201 ? -3.468  -51.890 24.459  1.00 34.13  ? 201  LYS A CD  1 
ATOM   1606 C  CE  . LYS A 1 201 ? -3.534  -52.906 23.321  1.00 45.27  ? 201  LYS A CE  1 
ATOM   1607 N  NZ  . LYS A 1 201 ? -2.487  -53.971 23.431  1.00 49.89  ? 201  LYS A NZ  1 
ATOM   1608 N  N   . ILE A 1 202 ? -5.367  -48.573 28.274  1.00 14.33  ? 202  ILE A N   1 
ATOM   1609 C  CA  . ILE A 1 202 ? -5.132  -47.739 29.439  1.00 14.53  ? 202  ILE A CA  1 
ATOM   1610 C  C   . ILE A 1 202 ? -5.070  -48.691 30.626  1.00 16.03  ? 202  ILE A C   1 
ATOM   1611 O  O   . ILE A 1 202 ? -4.093  -48.708 31.387  1.00 11.01  ? 202  ILE A O   1 
ATOM   1612 C  CB  . ILE A 1 202 ? -6.314  -46.753 29.670  1.00 30.65  ? 202  ILE A CB  1 
ATOM   1613 C  CG1 . ILE A 1 202 ? -6.030  -45.396 29.018  1.00 37.22  ? 202  ILE A CG1 1 
ATOM   1614 C  CG2 . ILE A 1 202 ? -6.565  -46.538 31.178  1.00 42.07  ? 202  ILE A CG2 1 
ATOM   1615 C  CD1 . ILE A 1 202 ? -5.738  -45.456 27.561  1.00 41.75  ? 202  ILE A CD1 1 
ATOM   1616 N  N   . GLU A 1 203 ? -6.111  -49.511 30.745  1.00 16.00  ? 203  GLU A N   1 
ATOM   1617 C  CA  . GLU A 1 203 ? -6.199  -50.470 31.831  1.00 19.34  ? 203  GLU A CA  1 
ATOM   1618 C  C   . GLU A 1 203 ? -4.979  -51.389 31.861  1.00 14.86  ? 203  GLU A C   1 
ATOM   1619 O  O   . GLU A 1 203 ? -4.318  -51.524 32.897  1.00 2.00   ? 203  GLU A O   1 
ATOM   1620 C  CB  . GLU A 1 203 ? -7.498  -51.278 31.735  1.00 21.05  ? 203  GLU A CB  1 
ATOM   1621 C  CG  . GLU A 1 203 ? -7.762  -52.159 32.956  1.00 41.35  ? 203  GLU A CG  1 
ATOM   1622 C  CD  . GLU A 1 203 ? -7.601  -51.416 34.289  1.00 53.08  ? 203  GLU A CD  1 
ATOM   1623 O  OE1 . GLU A 1 203 ? -8.097  -50.271 34.404  1.00 57.28  ? 203  GLU A OE1 1 
ATOM   1624 O  OE2 . GLU A 1 203 ? -6.977  -51.979 35.222  1.00 49.04  ? 203  GLU A OE2 1 
ATOM   1625 N  N   . GLU A 1 204 ? -4.664  -51.988 30.719  1.00 16.97  ? 204  GLU A N   1 
ATOM   1626 C  CA  . GLU A 1 204 ? -3.513  -52.871 30.628  1.00 19.96  ? 204  GLU A CA  1 
ATOM   1627 C  C   . GLU A 1 204 ? -2.288  -52.149 31.177  1.00 26.59  ? 204  GLU A C   1 
ATOM   1628 O  O   . GLU A 1 204 ? -1.567  -52.672 32.038  1.00 26.34  ? 204  GLU A O   1 
ATOM   1629 C  CB  . GLU A 1 204 ? -3.259  -53.247 29.179  1.00 19.90  ? 204  GLU A CB  1 
ATOM   1630 C  CG  . GLU A 1 204 ? -2.010  -54.089 28.993  1.00 24.45  ? 204  GLU A CG  1 
ATOM   1631 C  CD  . GLU A 1 204 ? -1.820  -54.523 27.559  1.00 35.86  ? 204  GLU A CD  1 
ATOM   1632 O  OE1 . GLU A 1 204 ? -2.595  -54.061 26.687  1.00 42.87  ? 204  GLU A OE1 1 
ATOM   1633 O  OE2 . GLU A 1 204 ? -0.902  -55.333 27.307  1.00 34.01  ? 204  GLU A OE2 1 
ATOM   1634 N  N   . LEU A 1 205 ? -2.077  -50.935 30.681  1.00 23.68  ? 205  LEU A N   1 
ATOM   1635 C  CA  . LEU A 1 205 ? -0.962  -50.117 31.103  1.00 23.98  ? 205  LEU A CA  1 
ATOM   1636 C  C   . LEU A 1 205 ? -0.994  -49.916 32.626  1.00 22.59  ? 205  LEU A C   1 
ATOM   1637 O  O   . LEU A 1 205 ? 0.013   -50.166 33.304  1.00 12.19  ? 205  LEU A O   1 
ATOM   1638 C  CB  . LEU A 1 205 ? -1.004  -48.793 30.351  1.00 29.50  ? 205  LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1 205 ? 0.208   -47.868 30.446  1.00 46.35  ? 205  LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1 205 ? -0.076  -46.764 31.437  1.00 58.22  ? 205  LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1 205 ? 1.466   -48.637 30.829  1.00 59.72  ? 205  LEU A CD2 1 
ATOM   1642 N  N   . ARG A 1 206 ? -2.150  -49.499 33.152  1.00 20.01  ? 206  ARG A N   1 
ATOM   1643 C  CA  . ARG A 1 206 ? -2.338  -49.305 34.593  1.00 21.95  ? 206  ARG A CA  1 
ATOM   1644 C  C   . ARG A 1 206 ? -1.853  -50.553 35.302  1.00 30.12  ? 206  ARG A C   1 
ATOM   1645 O  O   . ARG A 1 206 ? -0.935  -50.501 36.115  1.00 35.10  ? 206  ARG A O   1 
ATOM   1646 C  CB  . ARG A 1 206 ? -3.817  -49.187 34.946  1.00 25.52  ? 206  ARG A CB  1 
ATOM   1647 C  CG  . ARG A 1 206 ? -4.396  -47.822 35.053  1.00 30.97  ? 206  ARG A CG  1 
ATOM   1648 C  CD  . ARG A 1 206 ? -5.615  -47.874 35.967  1.00 46.28  ? 206  ARG A CD  1 
ATOM   1649 N  NE  . ARG A 1 206 ? -5.235  -47.934 37.383  1.00 68.64  ? 206  ARG A NE  1 
ATOM   1650 C  CZ  . ARG A 1 206 ? -5.736  -48.778 38.282  1.00 80.71  ? 206  ARG A CZ  1 
ATOM   1651 N  NH1 . ARG A 1 206 ? -6.652  -49.674 37.931  1.00 89.47  ? 206  ARG A NH1 1 
ATOM   1652 N  NH2 . ARG A 1 206 ? -5.354  -48.689 39.554  1.00 77.10  ? 206  ARG A NH2 1 
ATOM   1653 N  N   . GLN A 1 207 ? -2.498  -51.677 34.984  1.00 33.21  ? 207  GLN A N   1 
ATOM   1654 C  CA  . GLN A 1 207 ? -2.182  -52.977 35.569  1.00 38.74  ? 207  GLN A CA  1 
ATOM   1655 C  C   . GLN A 1 207 ? -0.686  -53.216 35.568  1.00 35.78  ? 207  GLN A C   1 
ATOM   1656 O  O   . GLN A 1 207 ? -0.109  -53.698 36.555  1.00 30.49  ? 207  GLN A O   1 
ATOM   1657 C  CB  . GLN A 1 207 ? -2.872  -54.110 34.793  1.00 49.24  ? 207  GLN A CB  1 
ATOM   1658 C  CG  . GLN A 1 207 ? -4.306  -54.415 35.236  1.00 64.62  ? 207  GLN A CG  1 
ATOM   1659 C  CD  . GLN A 1 207 ? -4.739  -55.849 34.919  1.00 66.38  ? 207  GLN A CD  1 
ATOM   1660 O  OE1 . GLN A 1 207 ? -4.792  -56.254 33.758  1.00 59.50  ? 207  GLN A OE1 1 
ATOM   1661 N  NE2 . GLN A 1 207 ? -5.039  -56.624 35.959  1.00 61.50  ? 207  GLN A NE2 1 
ATOM   1662 N  N   . HIS A 1 208 ? -0.070  -52.888 34.439  1.00 34.03  ? 208  HIS A N   1 
ATOM   1663 C  CA  . HIS A 1 208 ? 1.356   -53.041 34.283  1.00 29.81  ? 208  HIS A CA  1 
ATOM   1664 C  C   . HIS A 1 208 ? 2.011   -52.275 35.414  1.00 27.15  ? 208  HIS A C   1 
ATOM   1665 O  O   . HIS A 1 208 ? 2.829   -52.827 36.147  1.00 32.39  ? 208  HIS A O   1 
ATOM   1666 C  CB  . HIS A 1 208 ? 1.797   -52.481 32.938  1.00 40.26  ? 208  HIS A CB  1 
ATOM   1667 C  CG  . HIS A 1 208 ? 3.280   -52.497 32.731  1.00 56.72  ? 208  HIS A CG  1 
ATOM   1668 N  ND1 . HIS A 1 208 ? 3.883   -51.877 31.659  1.00 68.96  ? 208  HIS A ND1 1 
ATOM   1669 C  CD2 . HIS A 1 208 ? 4.280   -53.058 33.453  1.00 55.05  ? 208  HIS A CD2 1 
ATOM   1670 C  CE1 . HIS A 1 208 ? 5.190   -52.054 31.727  1.00 69.19  ? 208  HIS A CE1 1 
ATOM   1671 N  NE2 . HIS A 1 208 ? 5.458   -52.768 32.807  1.00 59.86  ? 208  HIS A NE2 1 
ATOM   1672 N  N   . LEU A 1 209 ? 1.619   -51.018 35.586  1.00 18.10  ? 209  LEU A N   1 
ATOM   1673 C  CA  . LEU A 1 209 ? 2.193   -50.202 36.641  1.00 13.26  ? 209  LEU A CA  1 
ATOM   1674 C  C   . LEU A 1 209 ? 2.032   -50.933 37.942  1.00 19.52  ? 209  LEU A C   1 
ATOM   1675 O  O   . LEU A 1 209 ? 3.007   -51.188 38.632  1.00 17.08  ? 209  LEU A O   1 
ATOM   1676 C  CB  . LEU A 1 209 ? 1.493   -48.856 36.720  1.00 5.48   ? 209  LEU A CB  1 
ATOM   1677 C  CG  . LEU A 1 209 ? 1.621   -48.117 35.396  1.00 31.03  ? 209  LEU A CG  1 
ATOM   1678 C  CD1 . LEU A 1 209 ? 1.102   -46.720 35.583  1.00 33.83  ? 209  LEU A CD1 1 
ATOM   1679 C  CD2 . LEU A 1 209 ? 3.078   -48.107 34.908  1.00 31.67  ? 209  LEU A CD2 1 
ATOM   1680 N  N   . LEU A 1 210 ? 0.795   -51.318 38.225  1.00 31.17  ? 210  LEU A N   1 
ATOM   1681 C  CA  . LEU A 1 210 ? 0.435   -52.043 39.432  1.00 40.93  ? 210  LEU A CA  1 
ATOM   1682 C  C   . LEU A 1 210 ? 1.457   -53.120 39.757  1.00 53.84  ? 210  LEU A C   1 
ATOM   1683 O  O   . LEU A 1 210 ? 1.845   -53.290 40.921  1.00 56.20  ? 210  LEU A O   1 
ATOM   1684 C  CB  . LEU A 1 210 ? -0.949  -52.665 39.258  1.00 39.56  ? 210  LEU A CB  1 
ATOM   1685 C  CG  . LEU A 1 210 ? -2.131  -51.742 39.561  1.00 51.14  ? 210  LEU A CG  1 
ATOM   1686 C  CD1 . LEU A 1 210 ? -2.299  -51.647 41.076  1.00 55.12  ? 210  LEU A CD1 1 
ATOM   1687 C  CD2 . LEU A 1 210 ? -1.946  -50.346 38.938  1.00 50.37  ? 210  LEU A CD2 1 
ATOM   1688 N  N   . ARG A 1 211 ? 1.904   -53.826 38.721  1.00 58.46  ? 211  ARG A N   1 
ATOM   1689 C  CA  . ARG A 1 211 ? 2.905   -54.872 38.879  1.00 65.13  ? 211  ARG A CA  1 
ATOM   1690 C  C   . ARG A 1 211 ? 4.157   -54.325 39.563  1.00 68.80  ? 211  ARG A C   1 
ATOM   1691 O  O   . ARG A 1 211 ? 4.761   -54.986 40.408  1.00 75.25  ? 211  ARG A O   1 
ATOM   1692 C  CB  . ARG A 1 211 ? 3.295   -55.448 37.519  1.00 73.03  ? 211  ARG A CB  1 
ATOM   1693 C  CG  . ARG A 1 211 ? 2.528   -56.688 37.100  1.00 87.41  ? 211  ARG A CG  1 
ATOM   1694 C  CD  . ARG A 1 211 ? 3.327   -57.483 36.062  1.00 95.23  ? 211  ARG A CD  1 
ATOM   1695 N  NE  . ARG A 1 211 ? 4.674   -57.824 36.538  1.00 96.05  ? 211  ARG A NE  1 
ATOM   1696 C  CZ  . ARG A 1 211 ? 5.799   -57.497 35.906  1.00 89.75  ? 211  ARG A CZ  1 
ATOM   1697 N  NH1 . ARG A 1 211 ? 5.750   -56.821 34.768  1.00 96.57  ? 211  ARG A NH1 1 
ATOM   1698 N  NH2 . ARG A 1 211 ? 6.976   -57.827 36.419  1.00 83.59  ? 211  ARG A NH2 1 
ATOM   1699 N  N   . TRP A 1 212 ? 4.547   -53.115 39.182  1.00 65.94  ? 212  TRP A N   1 
ATOM   1700 C  CA  . TRP A 1 212 ? 5.721   -52.463 39.747  1.00 61.08  ? 212  TRP A CA  1 
ATOM   1701 C  C   . TRP A 1 212 ? 5.424   -51.644 41.003  1.00 59.26  ? 212  TRP A C   1 
ATOM   1702 O  O   . TRP A 1 212 ? 6.214   -50.784 41.400  1.00 49.88  ? 212  TRP A O   1 
ATOM   1703 C  CB  . TRP A 1 212 ? 6.355   -51.581 38.691  1.00 56.76  ? 212  TRP A CB  1 
ATOM   1704 C  CG  . TRP A 1 212 ? 6.775   -52.347 37.504  1.00 45.10  ? 212  TRP A CG  1 
ATOM   1705 C  CD1 . TRP A 1 212 ? 6.081   -52.499 36.343  1.00 45.73  ? 212  TRP A CD1 1 
ATOM   1706 C  CD2 . TRP A 1 212 ? 8.025   -53.019 37.323  1.00 47.19  ? 212  TRP A CD2 1 
ATOM   1707 N  NE1 . TRP A 1 212 ? 6.827   -53.214 35.437  1.00 48.58  ? 212  TRP A NE1 1 
ATOM   1708 C  CE2 . TRP A 1 212 ? 8.026   -53.543 36.008  1.00 51.48  ? 212  TRP A CE2 1 
ATOM   1709 C  CE3 . TRP A 1 212 ? 9.147   -53.225 38.136  1.00 50.65  ? 212  TRP A CE3 1 
ATOM   1710 C  CZ2 . TRP A 1 212 ? 9.119   -54.260 35.486  1.00 44.08  ? 212  TRP A CZ2 1 
ATOM   1711 C  CZ3 . TRP A 1 212 ? 10.235  -53.942 37.617  1.00 49.53  ? 212  TRP A CZ3 1 
ATOM   1712 C  CH2 . TRP A 1 212 ? 10.208  -54.448 36.302  1.00 45.10  ? 212  TRP A CH2 1 
ATOM   1713 N  N   . GLY A 1 213 ? 4.281   -51.917 41.620  1.00 62.68  ? 213  GLY A N   1 
ATOM   1714 C  CA  . GLY A 1 213 ? 3.896   -51.215 42.826  1.00 65.35  ? 213  GLY A CA  1 
ATOM   1715 C  C   . GLY A 1 213 ? 3.362   -49.829 42.549  1.00 66.29  ? 213  GLY A C   1 
ATOM   1716 O  O   . GLY A 1 213 ? 2.981   -49.116 43.477  1.00 64.84  ? 213  GLY A O   1 
ATOM   1717 N  N   . LEU A 1 214 ? 3.315   -49.447 41.277  1.00 67.34  ? 214  LEU A N   1 
ATOM   1718 C  CA  . LEU A 1 214 ? 2.824   -48.131 40.909  1.00 73.03  ? 214  LEU A CA  1 
ATOM   1719 C  C   . LEU A 1 214 ? 1.320   -47.969 41.012  1.00 80.66  ? 214  LEU A C   1 
ATOM   1720 O  O   . LEU A 1 214 ? 0.581   -48.268 40.073  1.00 80.43  ? 214  LEU A O   1 
ATOM   1721 C  CB  . LEU A 1 214 ? 3.296   -47.743 39.515  1.00 72.48  ? 214  LEU A CB  1 
ATOM   1722 C  CG  . LEU A 1 214 ? 4.760   -47.315 39.415  1.00 78.90  ? 214  LEU A CG  1 
ATOM   1723 C  CD1 . LEU A 1 214 ? 5.041   -46.886 37.985  1.00 81.58  ? 214  LEU A CD1 1 
ATOM   1724 C  CD2 . LEU A 1 214 ? 5.068   -46.169 40.396  1.00 69.89  ? 214  LEU A CD2 1 
ATOM   1725 N  N   . THR A 1 215 ? 0.880   -47.514 42.180  1.00 89.83  ? 215  THR A N   1 
ATOM   1726 C  CA  . THR A 1 215 ? -0.532  -47.262 42.424  1.00 98.05  ? 215  THR A CA  1 
ATOM   1727 C  C   . THR A 1 215 ? -0.981  -46.129 41.494  1.00 105.00 ? 215  THR A C   1 
ATOM   1728 O  O   . THR A 1 215 ? -0.274  -45.132 41.321  1.00 106.33 ? 215  THR A O   1 
ATOM   1729 C  CB  . THR A 1 215 ? -0.789  -46.910 43.914  1.00 98.80  ? 215  THR A CB  1 
ATOM   1730 O  OG1 . THR A 1 215 ? 0.352   -46.239 44.467  1.00 93.18  ? 215  THR A OG1 1 
ATOM   1731 C  CG2 . THR A 1 215 ? -1.055  -48.173 44.718  1.00 102.86 ? 215  THR A CG2 1 
ATOM   1732 N  N   . THR A 1 216 ? -2.158  -46.301 40.907  1.00 111.43 ? 216  THR A N   1 
ATOM   1733 C  CA  . THR A 1 216 ? -2.732  -45.355 39.948  1.00 117.05 ? 216  THR A CA  1 
ATOM   1734 C  C   . THR A 1 216 ? -4.119  -44.888 40.463  1.00 121.10 ? 216  THR A C   1 
ATOM   1735 O  O   . THR A 1 216 ? -4.663  -45.507 41.378  1.00 119.94 ? 216  THR A O   1 
ATOM   1736 C  CB  . THR A 1 216 ? -2.691  -46.065 38.550  1.00 119.45 ? 216  THR A CB  1 
ATOM   1737 O  OG1 . THR A 1 216 ? -1.330  -46.101 38.099  1.00 120.38 ? 216  THR A OG1 1 
ATOM   1738 C  CG2 . THR A 1 216 ? -3.529  -45.412 37.508  1.00 114.73 ? 216  THR A CG2 1 
ATOM   1739 N  N   . PRO A 1 217 ? -4.647  -43.743 39.961  1.00 126.75 ? 217  PRO A N   1 
ATOM   1740 C  CA  . PRO A 1 217 ? -5.926  -43.120 40.320  1.00 130.69 ? 217  PRO A CA  1 
ATOM   1741 C  C   . PRO A 1 217 ? -7.179  -43.780 40.860  1.00 136.08 ? 217  PRO A C   1 
ATOM   1742 O  O   . PRO A 1 217 ? -7.460  -44.958 40.664  1.00 138.43 ? 217  PRO A O   1 
ATOM   1743 C  CB  . PRO A 1 217 ? -6.267  -42.258 39.090  1.00 128.01 ? 217  PRO A CB  1 
ATOM   1744 C  CG  . PRO A 1 217 ? -5.225  -42.572 38.083  1.00 128.16 ? 217  PRO A CG  1 
ATOM   1745 C  CD  . PRO A 1 217 ? -4.028  -42.893 38.937  1.00 128.37 ? 217  PRO A CD  1 
ATOM   1746 N  N   . ASP A 1 218 ? -7.899  -42.921 41.579  1.00 141.42 ? 218  ASP A N   1 
ATOM   1747 C  CA  . ASP A 1 218 ? -9.197  -43.164 42.198  1.00 146.60 ? 218  ASP A CA  1 
ATOM   1748 C  C   . ASP A 1 218 ? -10.068 -42.194 41.377  1.00 147.63 ? 218  ASP A C   1 
ATOM   1749 O  O   . ASP A 1 218 ? -9.693  -41.028 41.192  1.00 148.94 ? 218  ASP A O   1 
ATOM   1750 C  CB  . ASP A 1 218 ? -9.156  -42.733 43.688  1.00 148.02 ? 218  ASP A CB  1 
ATOM   1751 C  CG  . ASP A 1 218 ? -10.545 -42.613 44.331  1.00 147.08 ? 218  ASP A CG  1 
ATOM   1752 O  OD1 . ASP A 1 218 ? -11.309 -43.602 44.350  1.00 147.75 ? 218  ASP A OD1 1 
ATOM   1753 O  OD2 . ASP A 1 218 ? -10.870 -41.513 44.839  1.00 144.99 ? 218  ASP A OD2 1 
ATOM   1754 N  N   . LYS A 1 219 ? -11.197 -42.667 40.859  1.00 145.40 ? 219  LYS A N   1 
ATOM   1755 C  CA  . LYS A 1 219 ? -12.077 -41.834 40.042  1.00 141.06 ? 219  LYS A CA  1 
ATOM   1756 C  C   . LYS A 1 219 ? -12.300 -40.371 40.455  1.00 141.34 ? 219  LYS A C   1 
ATOM   1757 O  O   . LYS A 1 219 ? -12.603 -39.536 39.595  1.00 141.26 ? 219  LYS A O   1 
ATOM   1758 C  CB  . LYS A 1 219 ? -13.406 -42.558 39.801  1.00 137.80 ? 219  LYS A CB  1 
ATOM   1759 C  CG  . LYS A 1 219 ? -13.258 -43.791 38.917  1.00 133.47 ? 219  LYS A CG  1 
ATOM   1760 C  CD  . LYS A 1 219 ? -14.522 -44.633 38.913  1.00 131.35 ? 219  LYS A CD  1 
ATOM   1761 C  CE  . LYS A 1 219 ? -14.298 -45.918 38.121  1.00 128.66 ? 219  LYS A CE  1 
ATOM   1762 N  NZ  . LYS A 1 219 ? -15.477 -46.836 38.171  1.00 127.00 ? 219  LYS A NZ  1 
ATOM   1763 N  N   . LYS A 1 220 ? -12.137 -40.048 41.740  1.00 141.41 ? 220  LYS A N   1 
ATOM   1764 C  CA  . LYS A 1 220 ? -12.300 -38.678 42.235  1.00 138.59 ? 220  LYS A CA  1 
ATOM   1765 C  C   . LYS A 1 220 ? -11.213 -37.719 41.729  1.00 135.20 ? 220  LYS A C   1 
ATOM   1766 O  O   . LYS A 1 220 ? -11.501 -36.579 41.343  1.00 134.51 ? 220  LYS A O   1 
ATOM   1767 C  CB  . LYS A 1 220 ? -12.308 -38.639 43.769  1.00 136.13 ? 220  LYS A CB  1 
ATOM   1768 C  CG  . LYS A 1 220 ? -13.546 -39.203 44.433  1.00 134.16 ? 220  LYS A CG  1 
ATOM   1769 C  CD  . LYS A 1 220 ? -13.570 -38.863 45.928  1.00 135.59 ? 220  LYS A CD  1 
ATOM   1770 C  CE  . LYS A 1 220 ? -13.656 -37.355 46.157  1.00 137.06 ? 220  LYS A CE  1 
ATOM   1771 N  NZ  . LYS A 1 220 ? -13.703 -36.981 47.602  1.00 137.20 ? 220  LYS A NZ  1 
ATOM   1772 N  N   . HIS A 1 221 ? -9.961  -38.173 41.777  1.00 130.04 ? 221  HIS A N   1 
ATOM   1773 C  CA  . HIS A 1 221 ? -8.812  -37.370 41.339  1.00 123.02 ? 221  HIS A CA  1 
ATOM   1774 C  C   . HIS A 1 221 ? -8.642  -37.344 39.814  1.00 116.16 ? 221  HIS A C   1 
ATOM   1775 O  O   . HIS A 1 221 ? -7.788  -36.619 39.296  1.00 113.69 ? 221  HIS A O   1 
ATOM   1776 C  CB  . HIS A 1 221 ? -7.507  -37.905 41.958  1.00 124.14 ? 221  HIS A CB  1 
ATOM   1777 C  CG  . HIS A 1 221 ? -7.352  -37.629 43.425  1.00 120.84 ? 221  HIS A CG  1 
ATOM   1778 N  ND1 . HIS A 1 221 ? -7.014  -36.389 43.924  1.00 118.67 ? 221  HIS A ND1 1 
ATOM   1779 C  CD2 . HIS A 1 221 ? -7.427  -38.456 44.497  1.00 120.83 ? 221  HIS A CD2 1 
ATOM   1780 C  CE1 . HIS A 1 221 ? -6.883  -36.462 45.234  1.00 119.72 ? 221  HIS A CE1 1 
ATOM   1781 N  NE2 . HIS A 1 221 ? -7.128  -37.704 45.610  1.00 120.96 ? 221  HIS A NE2 1 
ATOM   1782 N  N   . GLN A 1 222 ? -9.435  -38.152 39.112  1.00 109.72 ? 222  GLN A N   1 
ATOM   1783 C  CA  . GLN A 1 222 ? -9.368  -38.247 37.651  1.00 101.01 ? 222  GLN A CA  1 
ATOM   1784 C  C   . GLN A 1 222 ? -9.532  -36.937 36.885  1.00 97.22  ? 222  GLN A C   1 
ATOM   1785 O  O   . GLN A 1 222 ? -10.574 -36.278 36.954  1.00 97.79  ? 222  GLN A O   1 
ATOM   1786 C  CB  . GLN A 1 222 ? -10.372 -39.282 37.132  1.00 90.35  ? 222  GLN A CB  1 
ATOM   1787 C  CG  . GLN A 1 222 ? -9.759  -40.640 36.872  1.00 76.71  ? 222  GLN A CG  1 
ATOM   1788 C  CD  . GLN A 1 222 ? -8.610  -40.561 35.887  1.00 74.15  ? 222  GLN A CD  1 
ATOM   1789 O  OE1 . GLN A 1 222 ? -8.693  -39.873 34.876  1.00 69.19  ? 222  GLN A OE1 1 
ATOM   1790 N  NE2 . GLN A 1 222 ? -7.524  -41.253 36.189  1.00 81.44  ? 222  GLN A NE2 1 
ATOM   1791 N  N   . LYS A 1 223 ? -8.497  -36.584 36.131  1.00 91.11  ? 223  LYS A N   1 
ATOM   1792 C  CA  . LYS A 1 223 ? -8.513  -35.363 35.343  1.00 85.93  ? 223  LYS A CA  1 
ATOM   1793 C  C   . LYS A 1 223 ? -9.163  -35.666 33.999  1.00 75.71  ? 223  LYS A C   1 
ATOM   1794 O  O   . LYS A 1 223 ? -8.976  -36.747 33.439  1.00 76.96  ? 223  LYS A O   1 
ATOM   1795 C  CB  . LYS A 1 223 ? -7.091  -34.833 35.123  1.00 95.43  ? 223  LYS A CB  1 
ATOM   1796 C  CG  . LYS A 1 223 ? -6.236  -34.678 36.382  1.00 100.22 ? 223  LYS A CG  1 
ATOM   1797 C  CD  . LYS A 1 223 ? -4.949  -33.901 36.073  1.00 101.99 ? 223  LYS A CD  1 
ATOM   1798 C  CE  . LYS A 1 223 ? -4.000  -33.863 37.265  1.00 101.21 ? 223  LYS A CE  1 
ATOM   1799 N  NZ  . LYS A 1 223 ? -3.113  -32.665 37.225  1.00 95.94  ? 223  LYS A NZ  1 
ATOM   1800 N  N   . GLU A 1 224 ? -9.894  -34.694 33.469  1.00 64.02  ? 224  GLU A N   1 
ATOM   1801 C  CA  . GLU A 1 224 ? -10.585 -34.852 32.199  1.00 52.92  ? 224  GLU A CA  1 
ATOM   1802 C  C   . GLU A 1 224 ? -10.249 -33.702 31.267  1.00 42.83  ? 224  GLU A C   1 
ATOM   1803 O  O   . GLU A 1 224 ? -9.886  -32.618 31.720  1.00 38.04  ? 224  GLU A O   1 
ATOM   1804 C  CB  . GLU A 1 224 ? -12.101 -34.882 32.430  1.00 58.91  ? 224  GLU A CB  1 
ATOM   1805 C  CG  . GLU A 1 224 ? -12.609 -36.142 33.099  1.00 71.90  ? 224  GLU A CG  1 
ATOM   1806 C  CD  . GLU A 1 224 ? -12.296 -37.384 32.284  1.00 86.25  ? 224  GLU A CD  1 
ATOM   1807 O  OE1 . GLU A 1 224 ? -12.621 -37.401 31.075  1.00 90.18  ? 224  GLU A OE1 1 
ATOM   1808 O  OE2 . GLU A 1 224 ? -11.717 -38.340 32.848  1.00 89.77  ? 224  GLU A OE2 1 
ATOM   1809 N  N   . PRO A 1 225 ? -10.305 -33.943 29.948  1.00 38.23  ? 225  PRO A N   1 
ATOM   1810 C  CA  . PRO A 1 225 ? -10.008 -32.884 28.975  1.00 40.97  ? 225  PRO A CA  1 
ATOM   1811 C  C   . PRO A 1 225 ? -11.080 -31.784 29.035  1.00 42.90  ? 225  PRO A C   1 
ATOM   1812 O  O   . PRO A 1 225 ? -12.210 -32.028 29.478  1.00 47.13  ? 225  PRO A O   1 
ATOM   1813 C  CB  . PRO A 1 225 ? -10.047 -33.624 27.631  1.00 36.64  ? 225  PRO A CB  1 
ATOM   1814 C  CG  . PRO A 1 225 ? -9.630  -34.996 27.992  1.00 32.80  ? 225  PRO A CG  1 
ATOM   1815 C  CD  . PRO A 1 225 ? -10.391 -35.252 29.280  1.00 24.12  ? 225  PRO A CD  1 
ATOM   1816 N  N   . PRO A 1 226 ? -10.745 -30.564 28.575  1.00 38.39  ? 226  PRO A N   1 
ATOM   1817 C  CA  . PRO A 1 226 ? -9.439  -30.190 28.021  1.00 30.12  ? 226  PRO A CA  1 
ATOM   1818 C  C   . PRO A 1 226 ? -8.385  -30.161 29.121  1.00 24.61  ? 226  PRO A C   1 
ATOM   1819 O  O   . PRO A 1 226 ? -8.699  -30.411 30.287  1.00 29.32  ? 226  PRO A O   1 
ATOM   1820 C  CB  . PRO A 1 226 ? -9.698  -28.797 27.475  1.00 26.44  ? 226  PRO A CB  1 
ATOM   1821 C  CG  . PRO A 1 226 ? -10.673 -28.238 28.461  1.00 24.48  ? 226  PRO A CG  1 
ATOM   1822 C  CD  . PRO A 1 226 ? -11.638 -29.394 28.646  1.00 33.26  ? 226  PRO A CD  1 
ATOM   1823 N  N   . PHE A 1 227 ? -7.139  -29.875 28.764  1.00 18.65  ? 227  PHE A N   1 
ATOM   1824 C  CA  . PHE A 1 227 ? -6.087  -29.833 29.778  1.00 25.72  ? 227  PHE A CA  1 
ATOM   1825 C  C   . PHE A 1 227 ? -5.391  -28.473 29.814  1.00 20.16  ? 227  PHE A C   1 
ATOM   1826 O  O   . PHE A 1 227 ? -5.206  -27.846 28.769  1.00 2.30   ? 227  PHE A O   1 
ATOM   1827 C  CB  . PHE A 1 227 ? -5.065  -30.960 29.541  1.00 33.65  ? 227  PHE A CB  1 
ATOM   1828 C  CG  . PHE A 1 227 ? -5.641  -32.355 29.668  1.00 23.41  ? 227  PHE A CG  1 
ATOM   1829 C  CD1 . PHE A 1 227 ? -6.082  -32.833 30.911  1.00 12.77  ? 227  PHE A CD1 1 
ATOM   1830 C  CD2 . PHE A 1 227 ? -5.735  -33.192 28.543  1.00 9.88   ? 227  PHE A CD2 1 
ATOM   1831 C  CE1 . PHE A 1 227 ? -6.614  -34.128 31.045  1.00 14.72  ? 227  PHE A CE1 1 
ATOM   1832 C  CE2 . PHE A 1 227 ? -6.259  -34.489 28.647  1.00 16.07  ? 227  PHE A CE2 1 
ATOM   1833 C  CZ  . PHE A 1 227 ? -6.703  -34.964 29.905  1.00 35.04  ? 227  PHE A CZ  1 
ATOM   1834 N  N   . LEU A 1 228 ? -5.027  -28.016 31.016  1.00 27.12  ? 228  LEU A N   1 
ATOM   1835 C  CA  . LEU A 1 228 ? -4.352  -26.721 31.170  1.00 36.12  ? 228  LEU A CA  1 
ATOM   1836 C  C   . LEU A 1 228 ? -2.835  -26.819 31.058  1.00 38.23  ? 228  LEU A C   1 
ATOM   1837 O  O   . LEU A 1 228 ? -2.138  -27.218 32.001  1.00 40.61  ? 228  LEU A O   1 
ATOM   1838 C  CB  . LEU A 1 228 ? -4.737  -26.043 32.491  1.00 35.19  ? 228  LEU A CB  1 
ATOM   1839 C  CG  . LEU A 1 228 ? -6.207  -25.632 32.611  1.00 50.61  ? 228  LEU A CG  1 
ATOM   1840 C  CD1 . LEU A 1 228 ? -6.437  -24.844 33.909  1.00 52.72  ? 228  LEU A CD1 1 
ATOM   1841 C  CD2 . LEU A 1 228 ? -6.623  -24.811 31.382  1.00 43.17  ? 228  LEU A CD2 1 
ATOM   1842 N  N   . TRP A 1 229 ? -2.324  -26.423 29.905  1.00 35.90  ? 229  TRP A N   1 
ATOM   1843 C  CA  . TRP A 1 229 ? -0.893  -26.472 29.657  1.00 43.73  ? 229  TRP A CA  1 
ATOM   1844 C  C   . TRP A 1 229 ? -0.418  -25.027 29.524  1.00 47.80  ? 229  TRP A C   1 
ATOM   1845 O  O   . TRP A 1 229 ? -0.223  -24.518 28.408  1.00 44.59  ? 229  TRP A O   1 
ATOM   1846 C  CB  . TRP A 1 229 ? -0.621  -27.274 28.375  1.00 41.10  ? 229  TRP A CB  1 
ATOM   1847 C  CG  . TRP A 1 229 ? 0.766   -27.872 28.235  1.00 35.34  ? 229  TRP A CG  1 
ATOM   1848 C  CD1 . TRP A 1 229 ? 1.569   -27.823 27.124  1.00 32.42  ? 229  TRP A CD1 1 
ATOM   1849 C  CD2 . TRP A 1 229 ? 1.484   -28.643 29.216  1.00 29.92  ? 229  TRP A CD2 1 
ATOM   1850 N  NE1 . TRP A 1 229 ? 2.738   -28.514 27.354  1.00 36.62  ? 229  TRP A NE1 1 
ATOM   1851 C  CE2 . TRP A 1 229 ? 2.716   -29.028 28.623  1.00 33.05  ? 229  TRP A CE2 1 
ATOM   1852 C  CE3 . TRP A 1 229 ? 1.211   -29.051 30.526  1.00 27.42  ? 229  TRP A CE3 1 
ATOM   1853 C  CZ2 . TRP A 1 229 ? 3.672   -29.801 29.305  1.00 34.29  ? 229  TRP A CZ2 1 
ATOM   1854 C  CZ3 . TRP A 1 229 ? 2.165   -29.824 31.204  1.00 41.15  ? 229  TRP A CZ3 1 
ATOM   1855 C  CH2 . TRP A 1 229 ? 3.381   -30.190 30.587  1.00 34.01  ? 229  TRP A CH2 1 
ATOM   1856 N  N   . MET A 1 230 ? -0.327  -24.358 30.673  1.00 49.34  ? 230  MET A N   1 
ATOM   1857 C  CA  . MET A 1 230 ? 0.112   -22.972 30.754  1.00 57.76  ? 230  MET A CA  1 
ATOM   1858 C  C   . MET A 1 230 ? -0.440  -22.083 29.629  1.00 59.19  ? 230  MET A C   1 
ATOM   1859 O  O   . MET A 1 230 ? 0.144   -21.983 28.543  1.00 54.84  ? 230  MET A O   1 
ATOM   1860 C  CB  . MET A 1 230 ? 1.650   -22.890 30.800  1.00 70.63  ? 230  MET A CB  1 
ATOM   1861 C  CG  . MET A 1 230 ? 2.313   -23.410 32.092  1.00 77.49  ? 230  MET A CG  1 
ATOM   1862 S  SD  . MET A 1 230 ? 2.283   -25.222 32.299  1.00 82.40  ? 230  MET A SD  1 
ATOM   1863 C  CE  . MET A 1 230 ? 3.873   -25.676 31.614  1.00 75.93  ? 230  MET A CE  1 
ATOM   1864 N  N   . GLY A 1 231 ? -1.592  -21.470 29.887  1.00 58.39  ? 231  GLY A N   1 
ATOM   1865 C  CA  . GLY A 1 231 ? -2.191  -20.576 28.911  1.00 52.68  ? 231  GLY A CA  1 
ATOM   1866 C  C   . GLY A 1 231 ? -3.008  -21.261 27.844  1.00 47.14  ? 231  GLY A C   1 
ATOM   1867 O  O   . GLY A 1 231 ? -3.683  -20.600 27.046  1.00 54.08  ? 231  GLY A O   1 
ATOM   1868 N  N   . TYR A 1 232 ? -2.951  -22.584 27.813  1.00 38.66  ? 232  TYR A N   1 
ATOM   1869 C  CA  . TYR A 1 232 ? -3.714  -23.327 26.828  1.00 31.24  ? 232  TYR A CA  1 
ATOM   1870 C  C   . TYR A 1 232 ? -4.633  -24.393 27.412  1.00 27.29  ? 232  TYR A C   1 
ATOM   1871 O  O   . TYR A 1 232 ? -4.352  -25.002 28.451  1.00 21.93  ? 232  TYR A O   1 
ATOM   1872 C  CB  . TYR A 1 232 ? -2.792  -23.980 25.801  1.00 25.58  ? 232  TYR A CB  1 
ATOM   1873 C  CG  . TYR A 1 232 ? -2.020  -23.022 24.937  1.00 27.63  ? 232  TYR A CG  1 
ATOM   1874 C  CD1 . TYR A 1 232 ? -0.777  -22.549 25.344  1.00 34.20  ? 232  TYR A CD1 1 
ATOM   1875 C  CD2 . TYR A 1 232 ? -2.493  -22.647 23.678  1.00 27.38  ? 232  TYR A CD2 1 
ATOM   1876 C  CE1 . TYR A 1 232 ? -0.015  -21.731 24.517  1.00 46.36  ? 232  TYR A CE1 1 
ATOM   1877 C  CE2 . TYR A 1 232 ? -1.738  -21.831 22.833  1.00 30.20  ? 232  TYR A CE2 1 
ATOM   1878 C  CZ  . TYR A 1 232 ? -0.495  -21.380 23.260  1.00 50.27  ? 232  TYR A CZ  1 
ATOM   1879 O  OH  . TYR A 1 232 ? 0.299   -20.612 22.431  1.00 62.52  ? 232  TYR A OH  1 
ATOM   1880 N  N   . GLU A 1 233 ? -5.767  -24.554 26.745  1.00 30.68  ? 233  GLU A N   1 
ATOM   1881 C  CA  . GLU A 1 233 ? -6.758  -25.551 27.079  1.00 26.60  ? 233  GLU A CA  1 
ATOM   1882 C  C   . GLU A 1 233 ? -6.635  -26.456 25.869  1.00 25.51  ? 233  GLU A C   1 
ATOM   1883 O  O   . GLU A 1 233 ? -6.769  -25.998 24.730  1.00 21.62  ? 233  GLU A O   1 
ATOM   1884 C  CB  . GLU A 1 233 ? -8.161  -24.939 27.157  1.00 29.92  ? 233  GLU A CB  1 
ATOM   1885 C  CG  . GLU A 1 233 ? -8.457  -24.236 28.476  1.00 54.83  ? 233  GLU A CG  1 
ATOM   1886 C  CD  . GLU A 1 233 ? -9.861  -23.638 28.554  1.00 73.82  ? 233  GLU A CD  1 
ATOM   1887 O  OE1 . GLU A 1 233 ? -10.280 -22.948 27.595  1.00 82.45  ? 233  GLU A OE1 1 
ATOM   1888 O  OE2 . GLU A 1 233 ? -10.537 -23.839 29.592  1.00 76.16  ? 233  GLU A OE2 1 
ATOM   1889 N  N   . LEU A 1 234 ? -6.304  -27.719 26.114  1.00 29.20  ? 234  LEU A N   1 
ATOM   1890 C  CA  . LEU A 1 234 ? -6.127  -28.687 25.044  1.00 30.85  ? 234  LEU A CA  1 
ATOM   1891 C  C   . LEU A 1 234 ? -7.195  -29.748 24.983  1.00 30.61  ? 234  LEU A C   1 
ATOM   1892 O  O   . LEU A 1 234 ? -7.411  -30.479 25.943  1.00 23.84  ? 234  LEU A O   1 
ATOM   1893 C  CB  . LEU A 1 234 ? -4.802  -29.425 25.199  1.00 38.58  ? 234  LEU A CB  1 
ATOM   1894 C  CG  . LEU A 1 234 ? -3.445  -28.741 25.195  1.00 33.08  ? 234  LEU A CG  1 
ATOM   1895 C  CD1 . LEU A 1 234 ? -3.275  -27.932 23.925  1.00 34.83  ? 234  LEU A CD1 1 
ATOM   1896 C  CD2 . LEU A 1 234 ? -3.303  -27.893 26.439  1.00 40.16  ? 234  LEU A CD2 1 
ATOM   1897 N  N   . HIS A 1 235 ? -7.859  -29.830 23.845  1.00 44.65  ? 235  HIS A N   1 
ATOM   1898 C  CA  . HIS A 1 235 ? -8.862  -30.860 23.608  1.00 54.04  ? 235  HIS A CA  1 
ATOM   1899 C  C   . HIS A 1 235 ? -8.169  -31.691 22.534  1.00 52.02  ? 235  HIS A C   1 
ATOM   1900 O  O   . HIS A 1 235 ? -7.545  -31.138 21.633  1.00 53.05  ? 235  HIS A O   1 
ATOM   1901 C  CB  . HIS A 1 235 ? -10.148 -30.259 23.054  1.00 63.47  ? 235  HIS A CB  1 
ATOM   1902 C  CG  . HIS A 1 235 ? -10.678 -29.125 23.866  1.00 76.12  ? 235  HIS A CG  1 
ATOM   1903 N  ND1 . HIS A 1 235 ? -11.687 -29.278 24.789  1.00 82.78  ? 235  HIS A ND1 1 
ATOM   1904 C  CD2 . HIS A 1 235 ? -10.354 -27.810 23.870  1.00 86.43  ? 235  HIS A CD2 1 
ATOM   1905 C  CE1 . HIS A 1 235 ? -11.972 -28.102 25.321  1.00 96.50  ? 235  HIS A CE1 1 
ATOM   1906 N  NE2 . HIS A 1 235 ? -11.178 -27.195 24.784  1.00 96.76  ? 235  HIS A NE2 1 
ATOM   1907 N  N   . PRO A 1 236 ? -8.264  -33.024 22.606  1.00 48.13  ? 236  PRO A N   1 
ATOM   1908 C  CA  . PRO A 1 236 ? -7.608  -33.872 21.601  1.00 42.33  ? 236  PRO A CA  1 
ATOM   1909 C  C   . PRO A 1 236 ? -7.889  -33.477 20.143  1.00 39.78  ? 236  PRO A C   1 
ATOM   1910 O  O   . PRO A 1 236 ? -7.087  -33.744 19.256  1.00 38.41  ? 236  PRO A O   1 
ATOM   1911 C  CB  . PRO A 1 236 ? -8.120  -35.272 21.948  1.00 36.34  ? 236  PRO A CB  1 
ATOM   1912 C  CG  . PRO A 1 236 ? -9.436  -34.998 22.645  1.00 46.11  ? 236  PRO A CG  1 
ATOM   1913 C  CD  . PRO A 1 236 ? -9.100  -33.830 23.512  1.00 49.41  ? 236  PRO A CD  1 
ATOM   1914 N  N   . ASP A 1 237 ? -9.014  -32.812 19.913  1.00 41.07  ? 237  ASP A N   1 
ATOM   1915 C  CA  . ASP A 1 237 ? -9.389  -32.365 18.576  1.00 45.24  ? 237  ASP A CA  1 
ATOM   1916 C  C   . ASP A 1 237 ? -8.624  -31.087 18.195  1.00 47.95  ? 237  ASP A C   1 
ATOM   1917 O  O   . ASP A 1 237 ? -8.149  -30.952 17.058  1.00 41.18  ? 237  ASP A O   1 
ATOM   1918 C  CB  . ASP A 1 237 ? -10.912 -32.139 18.489  1.00 60.01  ? 237  ASP A CB  1 
ATOM   1919 C  CG  . ASP A 1 237 ? -11.576 -31.945 19.865  1.00 74.70  ? 237  ASP A CG  1 
ATOM   1920 O  OD1 . ASP A 1 237 ? -11.831 -32.958 20.552  1.00 81.60  ? 237  ASP A OD1 1 
ATOM   1921 O  OD2 . ASP A 1 237 ? -11.860 -30.792 20.258  1.00 79.22  ? 237  ASP A OD2 1 
ATOM   1922 N  N   . LYS A 1 238 ? -8.481  -30.181 19.167  1.00 46.25  ? 238  LYS A N   1 
ATOM   1923 C  CA  . LYS A 1 238 ? -7.785  -28.910 18.981  1.00 45.52  ? 238  LYS A CA  1 
ATOM   1924 C  C   . LYS A 1 238 ? -7.474  -28.260 20.338  1.00 43.37  ? 238  LYS A C   1 
ATOM   1925 O  O   . LYS A 1 238 ? -7.878  -28.766 21.383  1.00 35.12  ? 238  LYS A O   1 
ATOM   1926 C  CB  . LYS A 1 238 ? -8.638  -27.954 18.126  1.00 60.78  ? 238  LYS A CB  1 
ATOM   1927 C  CG  . LYS A 1 238 ? -9.727  -27.154 18.869  1.00 74.23  ? 238  LYS A CG  1 
ATOM   1928 C  CD  . LYS A 1 238 ? -10.900 -28.025 19.308  1.00 94.20  ? 238  LYS A CD  1 
ATOM   1929 C  CE  . LYS A 1 238 ? -12.042 -27.207 19.920  1.00 102.47 ? 238  LYS A CE  1 
ATOM   1930 N  NZ  . LYS A 1 238 ? -11.721 -26.639 21.263  1.00 106.85 ? 238  LYS A NZ  1 
ATOM   1931 N  N   . TRP A 1 239 ? -6.763  -27.133 20.315  1.00 45.95  ? 239  TRP A N   1 
ATOM   1932 C  CA  . TRP A 1 239 ? -6.423  -26.391 21.531  1.00 36.07  ? 239  TRP A CA  1 
ATOM   1933 C  C   . TRP A 1 239 ? -7.137  -25.052 21.498  1.00 27.55  ? 239  TRP A C   1 
ATOM   1934 O  O   . TRP A 1 239 ? -7.561  -24.591 20.440  1.00 15.50  ? 239  TRP A O   1 
ATOM   1935 C  CB  . TRP A 1 239 ? -4.911  -26.151 21.638  1.00 44.25  ? 239  TRP A CB  1 
ATOM   1936 C  CG  . TRP A 1 239 ? -4.269  -25.508 20.414  1.00 54.00  ? 239  TRP A CG  1 
ATOM   1937 C  CD1 . TRP A 1 239 ? -3.726  -26.160 19.343  1.00 56.83  ? 239  TRP A CD1 1 
ATOM   1938 C  CD2 . TRP A 1 239 ? -4.064  -24.099 20.169  1.00 50.27  ? 239  TRP A CD2 1 
ATOM   1939 N  NE1 . TRP A 1 239 ? -3.193  -25.256 18.455  1.00 54.47  ? 239  TRP A NE1 1 
ATOM   1940 C  CE2 . TRP A 1 239 ? -3.385  -23.989 18.931  1.00 46.72  ? 239  TRP A CE2 1 
ATOM   1941 C  CE3 . TRP A 1 239 ? -4.384  -22.929 20.872  1.00 38.73  ? 239  TRP A CE3 1 
ATOM   1942 C  CZ2 . TRP A 1 239 ? -3.023  -22.754 18.382  1.00 37.61  ? 239  TRP A CZ2 1 
ATOM   1943 C  CZ3 . TRP A 1 239 ? -4.023  -21.708 20.330  1.00 33.87  ? 239  TRP A CZ3 1 
ATOM   1944 C  CH2 . TRP A 1 239 ? -3.348  -21.630 19.093  1.00 44.90  ? 239  TRP A CH2 1 
ATOM   1945 N  N   . THR A 1 240 ? -7.212  -24.397 22.648  1.00 35.01  ? 240  THR A N   1 
ATOM   1946 C  CA  . THR A 1 240 ? -7.873  -23.102 22.761  1.00 40.53  ? 240  THR A CA  1 
ATOM   1947 C  C   . THR A 1 240 ? -7.088  -22.294 23.766  1.00 39.51  ? 240  THR A C   1 
ATOM   1948 O  O   . THR A 1 240 ? -6.525  -22.865 24.701  1.00 38.18  ? 240  THR A O   1 
ATOM   1949 C  CB  . THR A 1 240 ? -9.326  -23.252 23.274  1.00 37.50  ? 240  THR A CB  1 
ATOM   1950 O  OG1 . THR A 1 240 ? -9.379  -24.230 24.321  1.00 44.75  ? 240  THR A OG1 1 
ATOM   1951 C  CG2 . THR A 1 240 ? -10.217 -23.706 22.178  1.00 33.59  ? 240  THR A CG2 1 
ATOM   1952 N  N   . VAL A 1 241 ? -6.998  -20.985 23.568  1.00 33.26  ? 241  VAL A N   1 
ATOM   1953 C  CA  . VAL A 1 241 ? -6.266  -20.193 24.530  1.00 33.20  ? 241  VAL A CA  1 
ATOM   1954 C  C   . VAL A 1 241 ? -7.212  -19.794 25.648  1.00 38.97  ? 241  VAL A C   1 
ATOM   1955 O  O   . VAL A 1 241 ? -8.331  -19.324 25.400  1.00 27.28  ? 241  VAL A O   1 
ATOM   1956 C  CB  . VAL A 1 241 ? -5.617  -18.973 23.893  1.00 21.93  ? 241  VAL A CB  1 
ATOM   1957 C  CG1 . VAL A 1 241 ? -4.717  -18.280 24.883  1.00 11.99  ? 241  VAL A CG1 1 
ATOM   1958 C  CG2 . VAL A 1 241 ? -4.831  -19.395 22.697  1.00 25.61  ? 241  VAL A CG2 1 
ATOM   1959 N  N   . GLN A 1 242 ? -6.763  -20.045 26.875  1.00 50.82  ? 242  GLN A N   1 
ATOM   1960 C  CA  . GLN A 1 242 ? -7.527  -19.736 28.075  1.00 72.03  ? 242  GLN A CA  1 
ATOM   1961 C  C   . GLN A 1 242 ? -7.942  -18.270 28.105  1.00 84.59  ? 242  GLN A C   1 
ATOM   1962 O  O   . GLN A 1 242 ? -7.116  -17.385 27.863  1.00 86.11  ? 242  GLN A O   1 
ATOM   1963 C  CB  . GLN A 1 242 ? -6.692  -20.030 29.324  1.00 77.17  ? 242  GLN A CB  1 
ATOM   1964 C  CG  . GLN A 1 242 ? -6.402  -21.496 29.562  1.00 87.04  ? 242  GLN A CG  1 
ATOM   1965 C  CD  . GLN A 1 242 ? -5.593  -21.732 30.822  1.00 94.32  ? 242  GLN A CD  1 
ATOM   1966 O  OE1 . GLN A 1 242 ? -4.477  -22.250 30.768  1.00 97.63  ? 242  GLN A OE1 1 
ATOM   1967 N  NE2 . GLN A 1 242 ? -6.151  -21.355 31.966  1.00 97.91  ? 242  GLN A NE2 1 
ATOM   1968 N  N   . PRO A 1 243 ? -9.224  -17.994 28.411  1.00 93.06  ? 243  PRO A N   1 
ATOM   1969 C  CA  . PRO A 1 243 ? -9.742  -16.623 28.477  1.00 100.51 ? 243  PRO A CA  1 
ATOM   1970 C  C   . PRO A 1 243 ? -9.077  -15.846 29.626  1.00 109.21 ? 243  PRO A C   1 
ATOM   1971 O  O   . PRO A 1 243 ? -9.388  -16.064 30.804  1.00 114.92 ? 243  PRO A O   1 
ATOM   1972 C  CB  . PRO A 1 243 ? -11.237 -16.840 28.721  1.00 96.98  ? 243  PRO A CB  1 
ATOM   1973 C  CG  . PRO A 1 243 ? -11.268 -18.127 29.497  1.00 95.69  ? 243  PRO A CG  1 
ATOM   1974 C  CD  . PRO A 1 243 ? -10.284 -18.968 28.729  1.00 92.65  ? 243  PRO A CD  1 
ATOM   1975 N  N   . ILE A 1 244 ? -8.123  -14.985 29.274  1.00 108.85 ? 244  ILE A N   1 
ATOM   1976 C  CA  . ILE A 1 244 ? -7.387  -14.176 30.248  1.00 103.18 ? 244  ILE A CA  1 
ATOM   1977 C  C   . ILE A 1 244 ? -8.215  -12.945 30.663  1.00 102.96 ? 244  ILE A C   1 
ATOM   1978 O  O   . ILE A 1 244 ? -8.821  -12.278 29.814  1.00 98.70  ? 244  ILE A O   1 
ATOM   1979 C  CB  . ILE A 1 244 ? -5.981  -13.793 29.684  1.00 96.48  ? 244  ILE A CB  1 
ATOM   1980 C  CG1 . ILE A 1 244 ? -5.218  -12.894 30.663  1.00 99.94  ? 244  ILE A CG1 1 
ATOM   1981 C  CG2 . ILE A 1 244 ? -6.110  -13.192 28.291  1.00 85.34  ? 244  ILE A CG2 1 
ATOM   1982 C  CD1 . ILE A 1 244 ? -3.828  -12.483 30.185  1.00 99.89  ? 244  ILE A CD1 1 
ATOM   1983 N  N   . VAL A 1 245 ? -8.247  -12.666 31.969  1.00 104.72 ? 245  VAL A N   1 
ATOM   1984 C  CA  . VAL A 1 245 ? -9.029  -11.555 32.530  1.00 104.86 ? 245  VAL A CA  1 
ATOM   1985 C  C   . VAL A 1 245 ? -8.286  -10.330 33.088  1.00 103.23 ? 245  VAL A C   1 
ATOM   1986 O  O   . VAL A 1 245 ? -7.365  -10.459 33.902  1.00 105.59 ? 245  VAL A O   1 
ATOM   1987 C  CB  . VAL A 1 245 ? -9.976  -12.062 33.648  1.00 106.52 ? 245  VAL A CB  1 
ATOM   1988 C  CG1 . VAL A 1 245 ? -10.991 -13.027 33.073  1.00 117.87 ? 245  VAL A CG1 1 
ATOM   1989 C  CG2 . VAL A 1 245 ? -9.179  -12.738 34.766  1.00 102.54 ? 245  VAL A CG2 1 
ATOM   1990 N  N   . LEU A 1 246 ? -8.720  -9.146  32.659  1.00 96.79  ? 246  LEU A N   1 
ATOM   1991 C  CA  . LEU A 1 246 ? -8.163  -7.869  33.114  1.00 87.23  ? 246  LEU A CA  1 
ATOM   1992 C  C   . LEU A 1 246 ? -9.201  -7.340  34.093  1.00 90.64  ? 246  LEU A C   1 
ATOM   1993 O  O   . LEU A 1 246 ? -10.353 -7.145  33.722  1.00 92.42  ? 246  LEU A O   1 
ATOM   1994 C  CB  . LEU A 1 246 ? -8.050  -6.894  31.943  1.00 72.90  ? 246  LEU A CB  1 
ATOM   1995 C  CG  . LEU A 1 246 ? -7.378  -7.466  30.696  1.00 57.57  ? 246  LEU A CG  1 
ATOM   1996 C  CD1 . LEU A 1 246 ? -7.539  -6.532  29.502  1.00 39.34  ? 246  LEU A CD1 1 
ATOM   1997 C  CD2 . LEU A 1 246 ? -5.923  -7.739  31.005  1.00 48.94  ? 246  LEU A CD2 1 
ATOM   1998 N  N   . PRO A 1 247 ? -8.830  -7.151  35.366  1.00 92.85  ? 247  PRO A N   1 
ATOM   1999 C  CA  . PRO A 1 247 ? -9.816  -6.647  36.329  1.00 92.55  ? 247  PRO A CA  1 
ATOM   2000 C  C   . PRO A 1 247 ? -10.088 -5.158  36.161  1.00 92.37  ? 247  PRO A C   1 
ATOM   2001 O  O   . PRO A 1 247 ? -9.178  -4.394  35.855  1.00 95.87  ? 247  PRO A O   1 
ATOM   2002 C  CB  . PRO A 1 247 ? -9.149  -6.943  37.670  1.00 92.74  ? 247  PRO A CB  1 
ATOM   2003 C  CG  . PRO A 1 247 ? -7.691  -6.723  37.361  1.00 89.82  ? 247  PRO A CG  1 
ATOM   2004 C  CD  . PRO A 1 247 ? -7.529  -7.404  36.014  1.00 92.87  ? 247  PRO A CD  1 
ATOM   2005 N  N   . GLU A 1 248 ? -11.344 -4.753  36.306  1.00 91.53  ? 248  GLU A N   1 
ATOM   2006 C  CA  . GLU A 1 248 ? -11.685 -3.339  36.198  1.00 91.84  ? 248  GLU A CA  1 
ATOM   2007 C  C   . GLU A 1 248 ? -11.599 -2.768  37.608  1.00 89.86  ? 248  GLU A C   1 
ATOM   2008 O  O   . GLU A 1 248 ? -12.219 -3.294  38.537  1.00 91.08  ? 248  GLU A O   1 
ATOM   2009 C  CB  . GLU A 1 248 ? -13.095 -3.149  35.644  1.00 94.13  ? 248  GLU A CB  1 
ATOM   2010 C  CG  . GLU A 1 248 ? -13.456 -1.688  35.389  1.00 103.40 ? 248  GLU A CG  1 
ATOM   2011 C  CD  . GLU A 1 248 ? -13.160 -1.235  33.966  1.00 110.07 ? 248  GLU A CD  1 
ATOM   2012 O  OE1 . GLU A 1 248 ? -11.992 -1.320  33.526  1.00 112.08 ? 248  GLU A OE1 1 
ATOM   2013 O  OE2 . GLU A 1 248 ? -14.109 -0.784  33.289  1.00 113.33 ? 248  GLU A OE2 1 
ATOM   2014 N  N   . LYS A 1 249 ? -10.803 -1.719  37.777  1.00 82.27  ? 249  LYS A N   1 
ATOM   2015 C  CA  . LYS A 1 249 ? -10.635 -1.112  39.086  1.00 75.95  ? 249  LYS A CA  1 
ATOM   2016 C  C   . LYS A 1 249 ? -10.644 0.392   38.964  1.00 75.98  ? 249  LYS A C   1 
ATOM   2017 O  O   . LYS A 1 249 ? -10.763 0.946   37.867  1.00 78.05  ? 249  LYS A O   1 
ATOM   2018 C  CB  . LYS A 1 249 ? -9.303  -1.545  39.704  1.00 72.87  ? 249  LYS A CB  1 
ATOM   2019 C  CG  . LYS A 1 249 ? -9.127  -3.045  39.848  1.00 78.22  ? 249  LYS A CG  1 
ATOM   2020 C  CD  . LYS A 1 249 ? -7.665  -3.420  40.054  1.00 88.46  ? 249  LYS A CD  1 
ATOM   2021 C  CE  . LYS A 1 249 ? -7.128  -2.947  41.398  1.00 94.21  ? 249  LYS A CE  1 
ATOM   2022 N  NZ  . LYS A 1 249 ? -6.591  -4.092  42.187  1.00 95.14  ? 249  LYS A NZ  1 
ATOM   2023 N  N   . ASP A 1 250 ? -10.506 1.044   40.110  1.00 75.73  ? 250  ASP A N   1 
ATOM   2024 C  CA  . ASP A 1 250 ? -10.464 2.495   40.184  1.00 74.85  ? 250  ASP A CA  1 
ATOM   2025 C  C   . ASP A 1 250 ? -9.219  2.923   40.976  1.00 71.63  ? 250  ASP A C   1 
ATOM   2026 O  O   . ASP A 1 250 ? -9.076  4.082   41.353  1.00 68.69  ? 250  ASP A O   1 
ATOM   2027 C  CB  . ASP A 1 250 ? -11.760 3.045   40.807  1.00 76.04  ? 250  ASP A CB  1 
ATOM   2028 C  CG  . ASP A 1 250 ? -12.426 2.058   41.763  1.00 76.09  ? 250  ASP A CG  1 
ATOM   2029 O  OD1 . ASP A 1 250 ? -13.096 1.118   41.276  1.00 72.84  ? 250  ASP A OD1 1 
ATOM   2030 O  OD2 . ASP A 1 250 ? -12.288 2.230   42.995  1.00 76.07  ? 250  ASP A OD2 1 
ATOM   2031 N  N   . SER A 1 251 ? -8.305  1.975   41.189  1.00 71.45  ? 251  SER A N   1 
ATOM   2032 C  CA  . SER A 1 251 ? -7.053  2.214   41.915  1.00 66.87  ? 251  SER A CA  1 
ATOM   2033 C  C   . SER A 1 251 ? -5.973  1.234   41.413  1.00 64.15  ? 251  SER A C   1 
ATOM   2034 O  O   . SER A 1 251 ? -6.051  0.035   41.691  1.00 59.38  ? 251  SER A O   1 
ATOM   2035 C  CB  . SER A 1 251 ? -7.278  2.035   43.426  1.00 55.31  ? 251  SER A CB  1 
ATOM   2036 O  OG  . SER A 1 251 ? -6.099  2.308   44.162  1.00 34.35  ? 251  SER A OG  1 
ATOM   2037 N  N   . TRP A 1 252 ? -4.993  1.741   40.657  1.00 64.68  ? 252  TRP A N   1 
ATOM   2038 C  CA  . TRP A 1 252 ? -3.910  0.908   40.106  1.00 66.35  ? 252  TRP A CA  1 
ATOM   2039 C  C   . TRP A 1 252 ? -2.511  1.209   40.662  1.00 60.08  ? 252  TRP A C   1 
ATOM   2040 O  O   . TRP A 1 252 ? -1.965  2.297   40.456  1.00 59.94  ? 252  TRP A O   1 
ATOM   2041 C  CB  . TRP A 1 252 ? -3.856  1.038   38.580  1.00 77.06  ? 252  TRP A CB  1 
ATOM   2042 C  CG  . TRP A 1 252 ? -5.134  0.682   37.879  1.00 95.91  ? 252  TRP A CG  1 
ATOM   2043 C  CD1 . TRP A 1 252 ? -6.215  1.497   37.673  1.00 100.47 ? 252  TRP A CD1 1 
ATOM   2044 C  CD2 . TRP A 1 252 ? -5.451  -0.569  37.254  1.00 105.96 ? 252  TRP A CD2 1 
ATOM   2045 N  NE1 . TRP A 1 252 ? -7.179  0.832   36.953  1.00 103.67 ? 252  TRP A NE1 1 
ATOM   2046 C  CE2 . TRP A 1 252 ? -6.739  -0.436  36.681  1.00 107.16 ? 252  TRP A CE2 1 
ATOM   2047 C  CE3 . TRP A 1 252 ? -4.771  -1.788  37.119  1.00 112.81 ? 252  TRP A CE3 1 
ATOM   2048 C  CZ2 . TRP A 1 252 ? -7.361  -1.478  35.982  1.00 113.06 ? 252  TRP A CZ2 1 
ATOM   2049 C  CZ3 . TRP A 1 252 ? -5.390  -2.825  36.423  1.00 115.66 ? 252  TRP A CZ3 1 
ATOM   2050 C  CH2 . TRP A 1 252 ? -6.673  -2.660  35.864  1.00 116.09 ? 252  TRP A CH2 1 
ATOM   2051 N  N   . THR A 1 253 ? -1.930  0.249   41.370  1.00 49.76  ? 253  THR A N   1 
ATOM   2052 C  CA  . THR A 1 253 ? -0.597  0.451   41.902  1.00 40.40  ? 253  THR A CA  1 
ATOM   2053 C  C   . THR A 1 253 ? 0.382   0.110   40.785  1.00 32.07  ? 253  THR A C   1 
ATOM   2054 O  O   . THR A 1 253 ? -0.018  -0.414  39.728  1.00 2.38   ? 253  THR A O   1 
ATOM   2055 C  CB  . THR A 1 253 ? -0.308  -0.435  43.157  1.00 37.69  ? 253  THR A CB  1 
ATOM   2056 O  OG1 . THR A 1 253 ? -0.086  -1.796  42.763  1.00 48.17  ? 253  THR A OG1 1 
ATOM   2057 C  CG2 . THR A 1 253 ? -1.475  -0.377  44.133  1.00 17.48  ? 253  THR A CG2 1 
ATOM   2058 N  N   . VAL A 1 254 ? 1.658   0.394   41.032  1.00 33.84  ? 254  VAL A N   1 
ATOM   2059 C  CA  . VAL A 1 254 ? 2.709   0.110   40.065  1.00 33.04  ? 254  VAL A CA  1 
ATOM   2060 C  C   . VAL A 1 254 ? 2.718   -1.401  39.841  1.00 28.96  ? 254  VAL A C   1 
ATOM   2061 O  O   . VAL A 1 254 ? 2.758   -1.860  38.689  1.00 24.31  ? 254  VAL A O   1 
ATOM   2062 C  CB  . VAL A 1 254 ? 4.084   0.607   40.569  1.00 27.23  ? 254  VAL A CB  1 
ATOM   2063 C  CG1 . VAL A 1 254 ? 5.147   0.427   39.507  1.00 20.47  ? 254  VAL A CG1 1 
ATOM   2064 C  CG2 . VAL A 1 254 ? 3.989   2.063   40.935  1.00 29.62  ? 254  VAL A CG2 1 
ATOM   2065 N  N   . ASN A 1 255 ? 2.613   -2.157  40.935  1.00 14.27  ? 255  ASN A N   1 
ATOM   2066 C  CA  . ASN A 1 255 ? 2.572   -3.613  40.858  1.00 23.74  ? 255  ASN A CA  1 
ATOM   2067 C  C   . ASN A 1 255 ? 1.515   -4.013  39.863  1.00 26.44  ? 255  ASN A C   1 
ATOM   2068 O  O   . ASN A 1 255 ? 1.769   -4.757  38.909  1.00 27.29  ? 255  ASN A O   1 
ATOM   2069 C  CB  . ASN A 1 255 ? 2.154   -4.215  42.191  1.00 27.22  ? 255  ASN A CB  1 
ATOM   2070 C  CG  . ASN A 1 255 ? 3.281   -4.312  43.150  1.00 35.06  ? 255  ASN A CG  1 
ATOM   2071 O  OD1 . ASN A 1 255 ? 3.139   -3.967  44.329  1.00 31.51  ? 255  ASN A OD1 1 
ATOM   2072 N  ND2 . ASN A 1 255 ? 4.431   -4.776  42.661  1.00 41.51  ? 255  ASN A ND2 1 
ATOM   2073 N  N   . ASP A 1 256 ? 0.320   -3.498  40.117  1.00 28.62  ? 256  ASP A N   1 
ATOM   2074 C  CA  . ASP A 1 256 ? -0.850  -3.760  39.304  1.00 29.87  ? 256  ASP A CA  1 
ATOM   2075 C  C   . ASP A 1 256 ? -0.560  -3.490  37.847  1.00 25.70  ? 256  ASP A C   1 
ATOM   2076 O  O   . ASP A 1 256 ? -0.949  -4.261  36.973  1.00 19.45  ? 256  ASP A O   1 
ATOM   2077 C  CB  . ASP A 1 256 ? -2.008  -2.878  39.775  1.00 33.94  ? 256  ASP A CB  1 
ATOM   2078 C  CG  . ASP A 1 256 ? -2.384  -3.126  41.232  1.00 45.68  ? 256  ASP A CG  1 
ATOM   2079 O  OD1 . ASP A 1 256 ? -1.799  -4.018  41.886  1.00 49.42  ? 256  ASP A OD1 1 
ATOM   2080 O  OD2 . ASP A 1 256 ? -3.275  -2.416  41.733  1.00 55.59  ? 256  ASP A OD2 1 
ATOM   2081 N  N   . ILE A 1 257 ? 0.168   -2.413  37.594  1.00 28.48  ? 257  ILE A N   1 
ATOM   2082 C  CA  . ILE A 1 257 ? 0.491   -2.050  36.230  1.00 27.23  ? 257  ILE A CA  1 
ATOM   2083 C  C   . ILE A 1 257 ? 1.559   -2.946  35.621  1.00 27.63  ? 257  ILE A C   1 
ATOM   2084 O  O   . ILE A 1 257 ? 1.482   -3.296  34.446  1.00 23.51  ? 257  ILE A O   1 
ATOM   2085 C  CB  . ILE A 1 257 ? 0.888   -0.582  36.127  1.00 19.24  ? 257  ILE A CB  1 
ATOM   2086 C  CG1 . ILE A 1 257 ? -0.094  0.263   36.953  1.00 17.36  ? 257  ILE A CG1 1 
ATOM   2087 C  CG2 . ILE A 1 257 ? 0.803   -0.148  34.658  1.00 17.27  ? 257  ILE A CG2 1 
ATOM   2088 C  CD1 . ILE A 1 257 ? 0.382   1.658   37.286  1.00 16.18  ? 257  ILE A CD1 1 
ATOM   2089 N  N   . GLN A 1 258 ? 2.519   -3.372  36.431  1.00 28.06  ? 258  GLN A N   1 
ATOM   2090 C  CA  . GLN A 1 258 ? 3.583   -4.233  35.937  1.00 28.24  ? 258  GLN A CA  1 
ATOM   2091 C  C   . GLN A 1 258 ? 3.018   -5.604  35.616  1.00 29.72  ? 258  GLN A C   1 
ATOM   2092 O  O   . GLN A 1 258 ? 3.144   -6.097  34.480  1.00 22.37  ? 258  GLN A O   1 
ATOM   2093 C  CB  . GLN A 1 258 ? 4.688   -4.355  36.979  1.00 30.58  ? 258  GLN A CB  1 
ATOM   2094 C  CG  . GLN A 1 258 ? 5.237   -3.017  37.423  1.00 26.51  ? 258  GLN A CG  1 
ATOM   2095 C  CD  . GLN A 1 258 ? 6.530   -3.144  38.198  1.00 25.83  ? 258  GLN A CD  1 
ATOM   2096 O  OE1 . GLN A 1 258 ? 6.552   -3.622  39.342  1.00 10.28  ? 258  GLN A OE1 1 
ATOM   2097 N  NE2 . GLN A 1 258 ? 7.623   -2.714  37.578  1.00 33.58  ? 258  GLN A NE2 1 
ATOM   2098 N  N   . LYS A 1 259 ? 2.389   -6.204  36.628  1.00 31.03  ? 259  LYS A N   1 
ATOM   2099 C  CA  . LYS A 1 259 ? 1.768   -7.523  36.505  1.00 37.74  ? 259  LYS A CA  1 
ATOM   2100 C  C   . LYS A 1 259 ? 0.869   -7.508  35.271  1.00 27.68  ? 259  LYS A C   1 
ATOM   2101 O  O   . LYS A 1 259 ? 0.924   -8.391  34.408  1.00 27.73  ? 259  LYS A O   1 
ATOM   2102 C  CB  . LYS A 1 259 ? 0.926   -7.820  37.751  1.00 44.13  ? 259  LYS A CB  1 
ATOM   2103 C  CG  . LYS A 1 259 ? 1.726   -8.042  39.024  1.00 61.71  ? 259  LYS A CG  1 
ATOM   2104 C  CD  . LYS A 1 259 ? 0.800   -8.015  40.246  1.00 80.66  ? 259  LYS A CD  1 
ATOM   2105 C  CE  . LYS A 1 259 ? 1.165   -9.059  41.327  1.00 83.78  ? 259  LYS A CE  1 
ATOM   2106 N  NZ  . LYS A 1 259 ? 2.441   -8.831  42.083  1.00 68.94  ? 259  LYS A NZ  1 
ATOM   2107 N  N   . LEU A 1 260 ? 0.073   -6.457  35.189  1.00 19.44  ? 260  LEU A N   1 
ATOM   2108 C  CA  . LEU A 1 260 ? -0.834  -6.257  34.084  1.00 21.22  ? 260  LEU A CA  1 
ATOM   2109 C  C   . LEU A 1 260 ? -0.059  -6.299  32.765  1.00 15.83  ? 260  LEU A C   1 
ATOM   2110 O  O   . LEU A 1 260 ? -0.278  -7.183  31.935  1.00 11.23  ? 260  LEU A O   1 
ATOM   2111 C  CB  . LEU A 1 260 ? -1.521  -4.907  34.259  1.00 11.37  ? 260  LEU A CB  1 
ATOM   2112 C  CG  . LEU A 1 260 ? -2.559  -4.507  33.225  1.00 22.62  ? 260  LEU A CG  1 
ATOM   2113 C  CD1 . LEU A 1 260 ? -3.604  -5.596  33.064  1.00 11.42  ? 260  LEU A CD1 1 
ATOM   2114 C  CD2 . LEU A 1 260 ? -3.193  -3.206  33.664  1.00 36.99  ? 260  LEU A CD2 1 
ATOM   2115 N  N   . VAL A 1 261 ? 0.866   -5.360  32.611  1.00 12.27  ? 261  VAL A N   1 
ATOM   2116 C  CA  . VAL A 1 261 ? 1.698   -5.263  31.427  1.00 16.76  ? 261  VAL A CA  1 
ATOM   2117 C  C   . VAL A 1 261 ? 2.230   -6.640  31.081  1.00 24.20  ? 261  VAL A C   1 
ATOM   2118 O  O   . VAL A 1 261 ? 2.311   -7.010  29.902  1.00 16.83  ? 261  VAL A O   1 
ATOM   2119 C  CB  . VAL A 1 261 ? 2.906   -4.315  31.667  1.00 15.54  ? 261  VAL A CB  1 
ATOM   2120 C  CG1 . VAL A 1 261 ? 3.857   -4.369  30.489  1.00 12.26  ? 261  VAL A CG1 1 
ATOM   2121 C  CG2 . VAL A 1 261 ? 2.434   -2.883  31.873  1.00 13.27  ? 261  VAL A CG2 1 
ATOM   2122 N  N   . GLY A 1 262 ? 2.586   -7.399  32.117  1.00 36.78  ? 262  GLY A N   1 
ATOM   2123 C  CA  . GLY A 1 262 ? 3.107   -8.740  31.908  1.00 45.39  ? 262  GLY A CA  1 
ATOM   2124 C  C   . GLY A 1 262 ? 2.105   -9.592  31.153  1.00 42.93  ? 262  GLY A C   1 
ATOM   2125 O  O   . GLY A 1 262 ? 2.327   -9.974  29.986  1.00 32.36  ? 262  GLY A O   1 
ATOM   2126 N  N   . LYS A 1 263 ? 0.975   -9.834  31.816  1.00 38.44  ? 263  LYS A N   1 
ATOM   2127 C  CA  . LYS A 1 263 ? -0.110  -10.622 31.259  1.00 37.67  ? 263  LYS A CA  1 
ATOM   2128 C  C   . LYS A 1 263 ? -0.443  -10.170 29.845  1.00 24.84  ? 263  LYS A C   1 
ATOM   2129 O  O   . LYS A 1 263 ? -0.626  -10.992 28.946  1.00 24.46  ? 263  LYS A O   1 
ATOM   2130 C  CB  . LYS A 1 263 ? -1.332  -10.539 32.173  1.00 54.86  ? 263  LYS A CB  1 
ATOM   2131 C  CG  . LYS A 1 263 ? -1.071  -11.154 33.546  1.00 75.90  ? 263  LYS A CG  1 
ATOM   2132 C  CD  . LYS A 1 263 ? -2.319  -11.222 34.406  1.00 87.38  ? 263  LYS A CD  1 
ATOM   2133 C  CE  . LYS A 1 263 ? -2.015  -11.864 35.756  1.00 94.46  ? 263  LYS A CE  1 
ATOM   2134 N  NZ  . LYS A 1 263 ? -3.196  -11.829 36.666  1.00 94.39  ? 263  LYS A NZ  1 
ATOM   2135 N  N   . LEU A 1 264 ? -0.492  -8.864  29.644  1.00 13.90  ? 264  LEU A N   1 
ATOM   2136 C  CA  . LEU A 1 264 ? -0.766  -8.326  28.324  1.00 19.18  ? 264  LEU A CA  1 
ATOM   2137 C  C   . LEU A 1 264 ? 0.257   -8.863  27.336  1.00 20.04  ? 264  LEU A C   1 
ATOM   2138 O  O   . LEU A 1 264 ? -0.100  -9.481  26.325  1.00 7.12   ? 264  LEU A O   1 
ATOM   2139 C  CB  . LEU A 1 264 ? -0.667  -6.799  28.330  1.00 31.94  ? 264  LEU A CB  1 
ATOM   2140 C  CG  . LEU A 1 264 ? -1.886  -5.915  28.610  1.00 40.40  ? 264  LEU A CG  1 
ATOM   2141 C  CD1 . LEU A 1 264 ? -3.021  -6.343  27.694  1.00 46.94  ? 264  LEU A CD1 1 
ATOM   2142 C  CD2 . LEU A 1 264 ? -2.306  -5.963  30.059  1.00 30.58  ? 264  LEU A CD2 1 
ATOM   2143 N  N   . ASN A 1 265 ? 1.529   -8.644  27.670  1.00 35.52  ? 265  ASN A N   1 
ATOM   2144 C  CA  . ASN A 1 265 ? 2.664   -9.054  26.847  1.00 46.11  ? 265  ASN A CA  1 
ATOM   2145 C  C   . ASN A 1 265 ? 2.557   -10.505 26.417  1.00 45.55  ? 265  ASN A C   1 
ATOM   2146 O  O   . ASN A 1 265 ? 2.773   -10.837 25.247  1.00 48.54  ? 265  ASN A O   1 
ATOM   2147 C  CB  . ASN A 1 265 ? 3.975   -8.838  27.599  1.00 60.88  ? 265  ASN A CB  1 
ATOM   2148 C  CG  . ASN A 1 265 ? 5.188   -8.970  26.695  1.00 80.38  ? 265  ASN A CG  1 
ATOM   2149 O  OD1 . ASN A 1 265 ? 5.746   -10.055 26.538  1.00 89.71  ? 265  ASN A OD1 1 
ATOM   2150 N  ND2 . ASN A 1 265 ? 5.596   -7.862  26.085  1.00 88.46  ? 265  ASN A ND2 1 
ATOM   2151 N  N   . TRP A 1 266 ? 2.225   -11.370 27.366  1.00 39.65  ? 266  TRP A N   1 
ATOM   2152 C  CA  . TRP A 1 266 ? 2.063   -12.780 27.067  1.00 36.19  ? 266  TRP A CA  1 
ATOM   2153 C  C   . TRP A 1 266 ? 1.020   -12.948 25.940  1.00 29.65  ? 266  TRP A C   1 
ATOM   2154 O  O   . TRP A 1 266 ? 1.251   -13.638 24.942  1.00 25.44  ? 266  TRP A O   1 
ATOM   2155 C  CB  . TRP A 1 266 ? 1.632   -13.517 28.336  1.00 44.19  ? 266  TRP A CB  1 
ATOM   2156 C  CG  . TRP A 1 266 ? 0.997   -14.829 28.066  1.00 60.41  ? 266  TRP A CG  1 
ATOM   2157 C  CD1 . TRP A 1 266 ? -0.339  -15.091 27.999  1.00 66.40  ? 266  TRP A CD1 1 
ATOM   2158 C  CD2 . TRP A 1 266 ? 1.666   -16.052 27.757  1.00 74.45  ? 266  TRP A CD2 1 
ATOM   2159 N  NE1 . TRP A 1 266 ? -0.545  -16.402 27.655  1.00 78.40  ? 266  TRP A NE1 1 
ATOM   2160 C  CE2 . TRP A 1 266 ? 0.670   -17.017 27.500  1.00 82.53  ? 266  TRP A CE2 1 
ATOM   2161 C  CE3 . TRP A 1 266 ? 3.013   -16.429 27.669  1.00 86.18  ? 266  TRP A CE3 1 
ATOM   2162 C  CZ2 . TRP A 1 266 ? 0.976   -18.339 27.157  1.00 92.72  ? 266  TRP A CZ2 1 
ATOM   2163 C  CZ3 . TRP A 1 266 ? 3.321   -17.744 27.328  1.00 94.30  ? 266  TRP A CZ3 1 
ATOM   2164 C  CH2 . TRP A 1 266 ? 2.304   -18.683 27.076  1.00 97.98  ? 266  TRP A CH2 1 
ATOM   2165 N  N   . ALA A 1 267 ? -0.098  -12.251 26.076  1.00 31.04  ? 267  ALA A N   1 
ATOM   2166 C  CA  . ALA A 1 267 ? -1.169  -12.317 25.092  1.00 34.66  ? 267  ALA A CA  1 
ATOM   2167 C  C   . ALA A 1 267 ? -0.742  -11.775 23.735  1.00 35.44  ? 267  ALA A C   1 
ATOM   2168 O  O   . ALA A 1 267 ? -1.253  -12.198 22.690  1.00 29.34  ? 267  ALA A O   1 
ATOM   2169 C  CB  . ALA A 1 267 ? -2.382  -11.562 25.598  1.00 33.44  ? 267  ALA A CB  1 
ATOM   2170 N  N   . SER A 1 268 ? 0.200   -10.842 23.759  1.00 36.73  ? 268  SER A N   1 
ATOM   2171 C  CA  . SER A 1 268 ? 0.703   -10.228 22.546  1.00 43.92  ? 268  SER A CA  1 
ATOM   2172 C  C   . SER A 1 268 ? 1.184   -11.268 21.550  1.00 49.82  ? 268  SER A C   1 
ATOM   2173 O  O   . SER A 1 268 ? 1.206   -11.023 20.343  1.00 53.90  ? 268  SER A O   1 
ATOM   2174 C  CB  . SER A 1 268 ? 1.833   -9.275  22.895  1.00 49.46  ? 268  SER A CB  1 
ATOM   2175 O  OG  . SER A 1 268 ? 1.392   -8.318  23.844  1.00 54.51  ? 268  SER A OG  1 
ATOM   2176 N  N   . GLN A 1 269 ? 1.575   -12.428 22.060  1.00 50.89  ? 269  GLN A N   1 
ATOM   2177 C  CA  . GLN A 1 269 ? 2.042   -13.500 21.203  1.00 52.20  ? 269  GLN A CA  1 
ATOM   2178 C  C   . GLN A 1 269 ? 0.873   -14.100 20.416  1.00 53.24  ? 269  GLN A C   1 
ATOM   2179 O  O   . GLN A 1 269 ? 0.928   -14.210 19.189  1.00 53.87  ? 269  GLN A O   1 
ATOM   2180 C  CB  . GLN A 1 269 ? 2.720   -14.573 22.054  1.00 55.13  ? 269  GLN A CB  1 
ATOM   2181 C  CG  . GLN A 1 269 ? 4.009   -14.108 22.731  1.00 60.22  ? 269  GLN A CG  1 
ATOM   2182 C  CD  . GLN A 1 269 ? 5.234   -14.172 21.820  1.00 61.69  ? 269  GLN A CD  1 
ATOM   2183 O  OE1 . GLN A 1 269 ? 5.123   -14.358 20.604  1.00 57.48  ? 269  GLN A OE1 1 
ATOM   2184 N  NE2 . GLN A 1 269 ? 6.410   -14.000 22.410  1.00 58.26  ? 269  GLN A NE2 1 
ATOM   2185 N  N   . ILE A 1 270 ? -0.227  -14.362 21.118  1.00 49.69  ? 270  ILE A N   1 
ATOM   2186 C  CA  . ILE A 1 270 ? -1.407  -14.986 20.519  1.00 44.32  ? 270  ILE A CA  1 
ATOM   2187 C  C   . ILE A 1 270 ? -2.370  -14.015 19.832  1.00 47.17  ? 270  ILE A C   1 
ATOM   2188 O  O   . ILE A 1 270 ? -2.606  -14.099 18.625  1.00 43.98  ? 270  ILE A O   1 
ATOM   2189 C  CB  . ILE A 1 270 ? -2.211  -15.775 21.588  1.00 30.30  ? 270  ILE A CB  1 
ATOM   2190 C  CG1 . ILE A 1 270 ? -1.270  -16.602 22.478  1.00 29.11  ? 270  ILE A CG1 1 
ATOM   2191 C  CG2 . ILE A 1 270 ? -3.200  -16.689 20.908  1.00 27.71  ? 270  ILE A CG2 1 
ATOM   2192 C  CD1 . ILE A 1 270 ? -1.658  -16.650 23.992  1.00 2.00   ? 270  ILE A CD1 1 
ATOM   2193 N  N   . TYR A 1 271 ? -2.948  -13.122 20.630  1.00 50.51  ? 271  TYR A N   1 
ATOM   2194 C  CA  . TYR A 1 271 ? -3.923  -12.152 20.156  1.00 52.44  ? 271  TYR A CA  1 
ATOM   2195 C  C   . TYR A 1 271 ? -3.316  -10.995 19.384  1.00 58.13  ? 271  TYR A C   1 
ATOM   2196 O  O   . TYR A 1 271 ? -2.433  -10.297 19.888  1.00 62.50  ? 271  TYR A O   1 
ATOM   2197 C  CB  . TYR A 1 271 ? -4.718  -11.590 21.333  1.00 60.67  ? 271  TYR A CB  1 
ATOM   2198 C  CG  . TYR A 1 271 ? -5.614  -12.582 22.048  1.00 73.86  ? 271  TYR A CG  1 
ATOM   2199 C  CD1 . TYR A 1 271 ? -5.128  -13.364 23.094  1.00 77.54  ? 271  TYR A CD1 1 
ATOM   2200 C  CD2 . TYR A 1 271 ? -6.967  -12.696 21.717  1.00 82.05  ? 271  TYR A CD2 1 
ATOM   2201 C  CE1 . TYR A 1 271 ? -5.970  -14.235 23.803  1.00 87.66  ? 271  TYR A CE1 1 
ATOM   2202 C  CE2 . TYR A 1 271 ? -7.820  -13.562 22.419  1.00 87.22  ? 271  TYR A CE2 1 
ATOM   2203 C  CZ  . TYR A 1 271 ? -7.315  -14.328 23.462  1.00 87.96  ? 271  TYR A CZ  1 
ATOM   2204 O  OH  . TYR A 1 271 ? -8.147  -15.180 24.166  1.00 81.86  ? 271  TYR A OH  1 
ATOM   2205 N  N   . PRO A 1 272 ? -3.787  -10.775 18.143  1.00 60.19  ? 272  PRO A N   1 
ATOM   2206 C  CA  . PRO A 1 272 ? -3.336  -9.707  17.243  1.00 64.60  ? 272  PRO A CA  1 
ATOM   2207 C  C   . PRO A 1 272 ? -3.949  -8.350  17.594  1.00 67.25  ? 272  PRO A C   1 
ATOM   2208 O  O   . PRO A 1 272 ? -5.174  -8.208  17.603  1.00 63.57  ? 272  PRO A O   1 
ATOM   2209 C  CB  . PRO A 1 272 ? -3.846  -10.177 15.878  1.00 55.95  ? 272  PRO A CB  1 
ATOM   2210 C  CG  . PRO A 1 272 ? -3.936  -11.649 16.027  1.00 58.87  ? 272  PRO A CG  1 
ATOM   2211 C  CD  . PRO A 1 272 ? -4.554  -11.771 17.386  1.00 60.36  ? 272  PRO A CD  1 
ATOM   2212 N  N   . GLY A 1 273 ? -3.097  -7.361  17.868  1.00 67.13  ? 273  GLY A N   1 
ATOM   2213 C  CA  . GLY A 1 273 ? -3.585  -6.029  18.189  1.00 61.23  ? 273  GLY A CA  1 
ATOM   2214 C  C   . GLY A 1 273 ? -3.198  -5.441  19.536  1.00 56.33  ? 273  GLY A C   1 
ATOM   2215 O  O   . GLY A 1 273 ? -3.253  -4.216  19.706  1.00 55.86  ? 273  GLY A O   1 
ATOM   2216 N  N   . ILE A 1 274 ? -2.814  -6.295  20.485  1.00 45.66  ? 274  ILE A N   1 
ATOM   2217 C  CA  . ILE A 1 274 ? -2.426  -5.848  21.824  1.00 45.88  ? 274  ILE A CA  1 
ATOM   2218 C  C   . ILE A 1 274 ? -1.350  -4.756  21.789  1.00 47.65  ? 274  ILE A C   1 
ATOM   2219 O  O   . ILE A 1 274 ? -0.483  -4.765  20.914  1.00 50.52  ? 274  ILE A O   1 
ATOM   2220 C  CB  . ILE A 1 274 ? -1.921  -7.039  22.695  1.00 45.02  ? 274  ILE A CB  1 
ATOM   2221 C  CG1 . ILE A 1 274 ? -2.955  -8.166  22.684  1.00 56.84  ? 274  ILE A CG1 1 
ATOM   2222 C  CG2 . ILE A 1 274 ? -1.662  -6.596  24.151  1.00 29.36  ? 274  ILE A CG2 1 
ATOM   2223 C  CD1 . ILE A 1 274 ? -4.353  -7.749  23.145  1.00 55.58  ? 274  ILE A CD1 1 
ATOM   2224 N  N   . LYS A 1 275 ? -1.440  -3.808  22.727  1.00 47.32  ? 275  LYS A N   1 
ATOM   2225 C  CA  . LYS A 1 275 ? -0.491  -2.696  22.869  1.00 36.59  ? 275  LYS A CA  1 
ATOM   2226 C  C   . LYS A 1 275 ? -0.386  -2.277  24.340  1.00 32.60  ? 275  LYS A C   1 
ATOM   2227 O  O   . LYS A 1 275 ? -1.372  -2.363  25.076  1.00 29.72  ? 275  LYS A O   1 
ATOM   2228 C  CB  . LYS A 1 275 ? -0.943  -1.520  22.015  1.00 30.27  ? 275  LYS A CB  1 
ATOM   2229 C  CG  . LYS A 1 275 ? -0.684  -1.765  20.556  1.00 50.91  ? 275  LYS A CG  1 
ATOM   2230 C  CD  . LYS A 1 275 ? -1.536  -0.914  19.639  1.00 59.56  ? 275  LYS A CD  1 
ATOM   2231 C  CE  . LYS A 1 275 ? -0.854  -0.777  18.283  1.00 60.02  ? 275  LYS A CE  1 
ATOM   2232 N  NZ  . LYS A 1 275 ? 0.040   -1.942  17.985  1.00 60.53  ? 275  LYS A NZ  1 
ATOM   2233 N  N   . VAL A 1 276 ? 0.814   -1.926  24.803  1.00 26.50  ? 276  VAL A N   1 
ATOM   2234 C  CA  . VAL A 1 276 ? 0.964   -1.489  26.200  1.00 36.66  ? 276  VAL A CA  1 
ATOM   2235 C  C   . VAL A 1 276 ? 1.713   -0.181  26.347  1.00 30.74  ? 276  VAL A C   1 
ATOM   2236 O  O   . VAL A 1 276 ? 2.004   0.247   27.460  1.00 17.86  ? 276  VAL A O   1 
ATOM   2237 C  CB  . VAL A 1 276 ? 1.671   -2.523  27.118  1.00 48.39  ? 276  VAL A CB  1 
ATOM   2238 C  CG1 . VAL A 1 276 ? 0.760   -3.693  27.410  1.00 53.64  ? 276  VAL A CG1 1 
ATOM   2239 C  CG2 . VAL A 1 276 ? 2.980   -2.971  26.504  1.00 58.60  ? 276  VAL A CG2 1 
ATOM   2240 N  N   . ARG A 1 277 ? 1.952   0.483   25.224  1.00 36.90  ? 277  ARG A N   1 
ATOM   2241 C  CA  . ARG A 1 277 ? 2.680   1.748   25.204  1.00 38.73  ? 277  ARG A CA  1 
ATOM   2242 C  C   . ARG A 1 277 ? 2.260   2.712   26.323  1.00 38.82  ? 277  ARG A C   1 
ATOM   2243 O  O   . ARG A 1 277 ? 3.078   3.106   27.168  1.00 30.38  ? 277  ARG A O   1 
ATOM   2244 C  CB  . ARG A 1 277 ? 2.499   2.405   23.835  1.00 31.90  ? 277  ARG A CB  1 
ATOM   2245 C  CG  . ARG A 1 277 ? 3.519   3.468   23.515  1.00 48.18  ? 277  ARG A CG  1 
ATOM   2246 C  CD  . ARG A 1 277 ? 3.519   3.795   22.027  1.00 67.22  ? 277  ARG A CD  1 
ATOM   2247 N  NE  . ARG A 1 277 ? 4.394   4.926   21.728  1.00 87.05  ? 277  ARG A NE  1 
ATOM   2248 C  CZ  . ARG A 1 277 ? 4.087   6.200   21.969  1.00 95.56  ? 277  ARG A CZ  1 
ATOM   2249 N  NH1 . ARG A 1 277 ? 2.917   6.522   22.512  1.00 97.67  ? 277  ARG A NH1 1 
ATOM   2250 N  NH2 . ARG A 1 277 ? 4.976   7.154   21.716  1.00 98.63  ? 277  ARG A NH2 1 
ATOM   2251 N  N   . GLN A 1 278 ? 0.965   3.017   26.360  1.00 39.92  ? 278  GLN A N   1 
ATOM   2252 C  CA  . GLN A 1 278 ? 0.406   3.938   27.339  1.00 38.27  ? 278  GLN A CA  1 
ATOM   2253 C  C   . GLN A 1 278 ? 0.466   3.417   28.747  1.00 35.53  ? 278  GLN A C   1 
ATOM   2254 O  O   . GLN A 1 278 ? 0.463   4.193   29.694  1.00 36.96  ? 278  GLN A O   1 
ATOM   2255 C  CB  . GLN A 1 278 ? -1.034  4.291   26.980  1.00 49.18  ? 278  GLN A CB  1 
ATOM   2256 C  CG  . GLN A 1 278 ? -1.168  4.927   25.607  1.00 51.77  ? 278  GLN A CG  1 
ATOM   2257 C  CD  . GLN A 1 278 ? -0.203  6.075   25.416  1.00 51.69  ? 278  GLN A CD  1 
ATOM   2258 O  OE1 . GLN A 1 278 ? 0.422   6.208   24.366  1.00 49.43  ? 278  GLN A OE1 1 
ATOM   2259 N  NE2 . GLN A 1 278 ? -0.061  6.904   26.445  1.00 57.35  ? 278  GLN A NE2 1 
ATOM   2260 N  N   . LEU A 1 279 ? 0.483   2.099   28.876  1.00 39.72  ? 279  LEU A N   1 
ATOM   2261 C  CA  . LEU A 1 279 ? 0.560   1.453   30.177  1.00 43.04  ? 279  LEU A CA  1 
ATOM   2262 C  C   . LEU A 1 279 ? 1.978   1.574   30.733  1.00 36.95  ? 279  LEU A C   1 
ATOM   2263 O  O   . LEU A 1 279 ? 2.178   1.960   31.893  1.00 33.68  ? 279  LEU A O   1 
ATOM   2264 C  CB  . LEU A 1 279 ? 0.171   -0.023  30.046  1.00 51.73  ? 279  LEU A CB  1 
ATOM   2265 C  CG  . LEU A 1 279 ? -1.262  -0.394  30.431  1.00 63.92  ? 279  LEU A CG  1 
ATOM   2266 C  CD1 . LEU A 1 279 ? -1.452  -0.127  31.923  1.00 73.02  ? 279  LEU A CD1 1 
ATOM   2267 C  CD2 . LEU A 1 279 ? -2.280  0.378   29.600  1.00 57.63  ? 279  LEU A CD2 1 
HETATM 2268 N  N   . CSD A 1 280 ? 2.949   1.231   29.890  1.00 34.73  ? 280  CSD A N   1 
HETATM 2269 C  CA  . CSD A 1 280 ? 4.360   1.294   30.239  1.00 35.50  ? 280  CSD A CA  1 
HETATM 2270 C  CB  . CSD A 1 280 ? 5.224   0.926   29.021  1.00 37.52  ? 280  CSD A CB  1 
HETATM 2271 S  SG  . CSD A 1 280 ? 5.995   -0.734  28.932  1.00 51.20  ? 280  CSD A SG  1 
HETATM 2272 C  C   . CSD A 1 280 ? 4.656   2.718   30.692  1.00 34.91  ? 280  CSD A C   1 
HETATM 2273 O  O   . CSD A 1 280 ? 5.298   2.956   31.729  1.00 30.07  ? 280  CSD A O   1 
HETATM 2274 O  OD1 . CSD A 1 280 ? 6.854   -0.921  27.726  1.00 42.03  ? 280  CSD A OD1 1 
HETATM 2275 O  OD2 . CSD A 1 280 ? 6.537   -1.051  30.280  1.00 39.30  ? 280  CSD A OD2 1 
ATOM   2276 N  N   . LYS A 1 281 ? 4.079   3.657   29.954  1.00 32.08  ? 281  LYS A N   1 
ATOM   2277 C  CA  . LYS A 1 281 ? 4.227   5.079   30.212  1.00 32.93  ? 281  LYS A CA  1 
ATOM   2278 C  C   . LYS A 1 281 ? 3.948   5.441   31.675  1.00 32.97  ? 281  LYS A C   1 
ATOM   2279 O  O   . LYS A 1 281 ? 4.627   6.284   32.258  1.00 37.06  ? 281  LYS A O   1 
ATOM   2280 C  CB  . LYS A 1 281 ? 3.282   5.835   29.290  1.00 39.57  ? 281  LYS A CB  1 
ATOM   2281 C  CG  . LYS A 1 281 ? 3.661   7.259   29.018  1.00 49.95  ? 281  LYS A CG  1 
ATOM   2282 C  CD  . LYS A 1 281 ? 2.946   7.749   27.773  1.00 65.82  ? 281  LYS A CD  1 
ATOM   2283 C  CE  . LYS A 1 281 ? 3.246   9.212   27.501  1.00 81.74  ? 281  LYS A CE  1 
ATOM   2284 N  NZ  . LYS A 1 281 ? 2.775   9.649   26.153  1.00 92.17  ? 281  LYS A NZ  1 
ATOM   2285 N  N   . LEU A 1 282 ? 2.989   4.758   32.280  1.00 29.92  ? 282  LEU A N   1 
ATOM   2286 C  CA  . LEU A 1 282 ? 2.619   5.007   33.667  1.00 32.22  ? 282  LEU A CA  1 
ATOM   2287 C  C   . LEU A 1 282 ? 3.708   4.687   34.678  1.00 34.57  ? 282  LEU A C   1 
ATOM   2288 O  O   . LEU A 1 282 ? 3.645   5.119   35.842  1.00 35.60  ? 282  LEU A O   1 
ATOM   2289 C  CB  . LEU A 1 282 ? 1.396   4.175   34.018  1.00 35.33  ? 282  LEU A CB  1 
ATOM   2290 C  CG  . LEU A 1 282 ? 0.024   4.730   33.680  1.00 37.61  ? 282  LEU A CG  1 
ATOM   2291 C  CD1 . LEU A 1 282 ? 0.008   5.415   32.316  1.00 47.11  ? 282  LEU A CD1 1 
ATOM   2292 C  CD2 . LEU A 1 282 ? -0.933  3.567   33.732  1.00 47.20  ? 282  LEU A CD2 1 
ATOM   2293 N  N   . LEU A 1 283 ? 4.671   3.880   34.252  1.00 26.70  ? 283  LEU A N   1 
ATOM   2294 C  CA  . LEU A 1 283 ? 5.756   3.465   35.130  1.00 31.34  ? 283  LEU A CA  1 
ATOM   2295 C  C   . LEU A 1 283 ? 6.866   4.507   35.324  1.00 31.11  ? 283  LEU A C   1 
ATOM   2296 O  O   . LEU A 1 283 ? 7.630   4.450   36.303  1.00 21.54  ? 283  LEU A O   1 
ATOM   2297 C  CB  . LEU A 1 283 ? 6.339   2.151   34.616  1.00 39.64  ? 283  LEU A CB  1 
ATOM   2298 C  CG  . LEU A 1 283 ? 5.510   0.866   34.742  1.00 44.77  ? 283  LEU A CG  1 
ATOM   2299 C  CD1 . LEU A 1 283 ? 4.135   1.128   35.341  1.00 51.88  ? 283  LEU A CD1 1 
ATOM   2300 C  CD2 . LEU A 1 283 ? 5.411   0.185   33.382  1.00 33.83  ? 283  LEU A CD2 1 
ATOM   2301 N  N   . ARG A 1 284 ? 6.935   5.462   34.397  1.00 32.05  ? 284  ARG A N   1 
ATOM   2302 C  CA  . ARG A 1 284 ? 7.935   6.529   34.424  1.00 27.07  ? 284  ARG A CA  1 
ATOM   2303 C  C   . ARG A 1 284 ? 8.048   7.222   35.783  1.00 24.30  ? 284  ARG A C   1 
ATOM   2304 O  O   . ARG A 1 284 ? 7.054   7.692   36.350  1.00 19.66  ? 284  ARG A O   1 
ATOM   2305 C  CB  . ARG A 1 284 ? 7.612   7.559   33.345  1.00 24.40  ? 284  ARG A CB  1 
ATOM   2306 C  CG  . ARG A 1 284 ? 7.510   6.969   31.965  1.00 28.38  ? 284  ARG A CG  1 
ATOM   2307 C  CD  . ARG A 1 284 ? 7.095   7.998   30.947  1.00 36.06  ? 284  ARG A CD  1 
ATOM   2308 N  NE  . ARG A 1 284 ? 7.331   7.525   29.585  1.00 53.87  ? 284  ARG A NE  1 
ATOM   2309 C  CZ  . ARG A 1 284 ? 7.258   8.292   28.499  1.00 70.93  ? 284  ARG A CZ  1 
ATOM   2310 N  NH1 . ARG A 1 284 ? 6.949   9.577   28.606  1.00 80.39  ? 284  ARG A NH1 1 
ATOM   2311 N  NH2 . ARG A 1 284 ? 7.517   7.782   27.302  1.00 74.14  ? 284  ARG A NH2 1 
ATOM   2312 N  N   . GLY A 1 285 ? 9.265   7.254   36.307  1.00 24.74  ? 285  GLY A N   1 
ATOM   2313 C  CA  . GLY A 1 285 ? 9.525   7.888   37.585  1.00 23.77  ? 285  GLY A CA  1 
ATOM   2314 C  C   . GLY A 1 285 ? 8.734   7.391   38.782  1.00 21.12  ? 285  GLY A C   1 
ATOM   2315 O  O   . GLY A 1 285 ? 8.375   8.188   39.649  1.00 14.23  ? 285  GLY A O   1 
ATOM   2316 N  N   . THR A 1 286 ? 8.452   6.096   38.859  1.00 20.35  ? 286  THR A N   1 
ATOM   2317 C  CA  . THR A 1 286 ? 7.699   5.575   40.003  1.00 20.08  ? 286  THR A CA  1 
ATOM   2318 C  C   . THR A 1 286 ? 8.532   5.451   41.294  1.00 22.51  ? 286  THR A C   1 
ATOM   2319 O  O   . THR A 1 286 ? 9.667   4.975   41.270  1.00 12.54  ? 286  THR A O   1 
ATOM   2320 C  CB  . THR A 1 286 ? 7.069   4.248   39.643  1.00 4.70   ? 286  THR A CB  1 
ATOM   2321 O  OG1 . THR A 1 286 ? 8.041   3.449   38.965  1.00 29.59  ? 286  THR A OG1 1 
ATOM   2322 C  CG2 . THR A 1 286 ? 5.892   4.477   38.725  1.00 2.00   ? 286  THR A CG2 1 
ATOM   2323 N  N   . LYS A 1 287 ? 7.950   5.837   42.425  1.00 30.63  ? 287  LYS A N   1 
ATOM   2324 C  CA  . LYS A 1 287 ? 8.680   5.786   43.686  1.00 46.15  ? 287  LYS A CA  1 
ATOM   2325 C  C   . LYS A 1 287 ? 8.487   4.564   44.577  1.00 50.88  ? 287  LYS A C   1 
ATOM   2326 O  O   . LYS A 1 287 ? 9.293   4.340   45.475  1.00 56.94  ? 287  LYS A O   1 
ATOM   2327 C  CB  . LYS A 1 287 ? 8.445   7.064   44.496  1.00 59.26  ? 287  LYS A CB  1 
ATOM   2328 C  CG  . LYS A 1 287 ? 7.043   7.230   45.059  1.00 71.15  ? 287  LYS A CG  1 
ATOM   2329 C  CD  . LYS A 1 287 ? 6.970   8.478   45.924  1.00 78.97  ? 287  LYS A CD  1 
ATOM   2330 C  CE  . LYS A 1 287 ? 5.597   8.670   46.541  1.00 79.37  ? 287  LYS A CE  1 
ATOM   2331 N  NZ  . LYS A 1 287 ? 5.517   9.959   47.295  1.00 78.01  ? 287  LYS A NZ  1 
ATOM   2332 N  N   . ALA A 1 288 ? 7.435   3.781   44.345  1.00 58.54  ? 288  ALA A N   1 
ATOM   2333 C  CA  . ALA A 1 288 ? 7.166   2.577   45.154  1.00 63.72  ? 288  ALA A CA  1 
ATOM   2334 C  C   . ALA A 1 288 ? 6.181   1.634   44.457  1.00 64.35  ? 288  ALA A C   1 
ATOM   2335 O  O   . ALA A 1 288 ? 5.335   2.076   43.686  1.00 64.07  ? 288  ALA A O   1 
ATOM   2336 C  CB  . ALA A 1 288 ? 6.635   2.961   46.546  1.00 56.95  ? 288  ALA A CB  1 
ATOM   2337 N  N   . LEU A 1 289 ? 6.280   0.340   44.751  1.00 65.95  ? 289  LEU A N   1 
ATOM   2338 C  CA  . LEU A 1 289 ? 5.402   -0.669  44.145  1.00 60.33  ? 289  LEU A CA  1 
ATOM   2339 C  C   . LEU A 1 289 ? 3.955   -0.412  44.560  1.00 55.53  ? 289  LEU A C   1 
ATOM   2340 O  O   . LEU A 1 289 ? 3.025   -0.487  43.743  1.00 52.85  ? 289  LEU A O   1 
ATOM   2341 C  CB  . LEU A 1 289 ? 5.823   -2.083  44.577  1.00 60.40  ? 289  LEU A CB  1 
ATOM   2342 C  CG  . LEU A 1 289 ? 7.167   -2.700  44.149  1.00 48.03  ? 289  LEU A CG  1 
ATOM   2343 C  CD1 . LEU A 1 289 ? 7.284   -2.726  42.630  1.00 43.23  ? 289  LEU A CD1 1 
ATOM   2344 C  CD2 . LEU A 1 289 ? 8.339   -1.947  44.773  1.00 53.61  ? 289  LEU A CD2 1 
ATOM   2345 N  N   . THR A 1 290 ? 3.789   -0.081  45.836  1.00 48.08  ? 290  THR A N   1 
ATOM   2346 C  CA  . THR A 1 290 ? 2.483   0.212   46.393  1.00 44.54  ? 290  THR A CA  1 
ATOM   2347 C  C   . THR A 1 290 ? 2.018   1.598   45.972  1.00 49.96  ? 290  THR A C   1 
ATOM   2348 O  O   . THR A 1 290 ? 1.046   2.114   46.518  1.00 52.96  ? 290  THR A O   1 
ATOM   2349 C  CB  . THR A 1 290 ? 2.490   0.153   47.943  1.00 39.20  ? 290  THR A CB  1 
ATOM   2350 O  OG1 . THR A 1 290 ? 3.578   0.935   48.462  1.00 33.01  ? 290  THR A OG1 1 
ATOM   2351 C  CG2 . THR A 1 290 ? 2.611   -1.282  48.427  1.00 42.42  ? 290  THR A CG2 1 
ATOM   2352 N  N   . GLU A 1 291 ? 2.716   2.216   45.024  1.00 52.11  ? 291  GLU A N   1 
ATOM   2353 C  CA  . GLU A 1 291 ? 2.329   3.548   44.577  1.00 57.52  ? 291  GLU A CA  1 
ATOM   2354 C  C   . GLU A 1 291 ? 1.165   3.468   43.605  1.00 58.15  ? 291  GLU A C   1 
ATOM   2355 O  O   . GLU A 1 291 ? 1.161   2.637   42.692  1.00 55.71  ? 291  GLU A O   1 
ATOM   2356 C  CB  . GLU A 1 291 ? 3.494   4.271   43.911  1.00 59.90  ? 291  GLU A CB  1 
ATOM   2357 C  CG  . GLU A 1 291 ? 3.174   5.702   43.519  1.00 56.65  ? 291  GLU A CG  1 
ATOM   2358 C  CD  . GLU A 1 291 ? 4.171   6.282   42.538  1.00 62.97  ? 291  GLU A CD  1 
ATOM   2359 O  OE1 . GLU A 1 291 ? 5.079   5.550   42.084  1.00 62.99  ? 291  GLU A OE1 1 
ATOM   2360 O  OE2 . GLU A 1 291 ? 4.034   7.477   42.212  1.00 63.42  ? 291  GLU A OE2 1 
ATOM   2361 N  N   . VAL A 1 292 ? 0.197   4.358   43.796  1.00 59.98  ? 292  VAL A N   1 
ATOM   2362 C  CA  . VAL A 1 292 ? -0.995  4.407   42.957  1.00 63.78  ? 292  VAL A CA  1 
ATOM   2363 C  C   . VAL A 1 292 ? -0.839  5.423   41.831  1.00 59.11  ? 292  VAL A C   1 
ATOM   2364 O  O   . VAL A 1 292 ? -0.698  6.617   42.078  1.00 59.58  ? 292  VAL A O   1 
ATOM   2365 C  CB  . VAL A 1 292 ? -2.259  4.768   43.791  1.00 65.98  ? 292  VAL A CB  1 
ATOM   2366 C  CG1 . VAL A 1 292 ? -3.498  4.733   42.908  1.00 67.24  ? 292  VAL A CG1 1 
ATOM   2367 C  CG2 . VAL A 1 292 ? -2.416  3.815   44.979  1.00 61.46  ? 292  VAL A CG2 1 
ATOM   2368 N  N   . ILE A 1 293 ? -0.842  4.946   40.594  1.00 55.95  ? 293  ILE A N   1 
ATOM   2369 C  CA  . ILE A 1 293 ? -0.716  5.838   39.456  1.00 54.68  ? 293  ILE A CA  1 
ATOM   2370 C  C   . ILE A 1 293 ? -2.034  5.862   38.700  1.00 62.08  ? 293  ILE A C   1 
ATOM   2371 O  O   . ILE A 1 293 ? -2.532  4.832   38.238  1.00 54.09  ? 293  ILE A O   1 
ATOM   2372 C  CB  . ILE A 1 293 ? 0.434   5.428   38.495  1.00 51.81  ? 293  ILE A CB  1 
ATOM   2373 C  CG1 . ILE A 1 293 ? 1.793   5.604   39.179  1.00 52.56  ? 293  ILE A CG1 1 
ATOM   2374 C  CG2 . ILE A 1 293 ? 0.401   6.275   37.225  1.00 37.90  ? 293  ILE A CG2 1 
ATOM   2375 C  CD1 . ILE A 1 293 ? 2.076   4.594   40.256  1.00 40.36  ? 293  ILE A CD1 1 
ATOM   2376 N  N   . PRO A 1 294 ? -2.656  7.043   38.628  1.00 72.52  ? 294  PRO A N   1 
ATOM   2377 C  CA  . PRO A 1 294 ? -3.929  7.207   37.927  1.00 69.47  ? 294  PRO A CA  1 
ATOM   2378 C  C   . PRO A 1 294 ? -3.723  7.025   36.429  1.00 60.36  ? 294  PRO A C   1 
ATOM   2379 O  O   . PRO A 1 294 ? -2.710  7.445   35.866  1.00 54.48  ? 294  PRO A O   1 
ATOM   2380 C  CB  . PRO A 1 294 ? -4.317  8.643   38.271  1.00 77.72  ? 294  PRO A CB  1 
ATOM   2381 C  CG  . PRO A 1 294 ? -2.981  9.324   38.400  1.00 80.91  ? 294  PRO A CG  1 
ATOM   2382 C  CD  . PRO A 1 294 ? -2.204  8.319   39.210  1.00 78.67  ? 294  PRO A CD  1 
ATOM   2383 N  N   . LEU A 1 295 ? -4.686  6.385   35.786  1.00 58.77  ? 295  LEU A N   1 
ATOM   2384 C  CA  . LEU A 1 295 ? -4.581  6.153   34.361  1.00 57.48  ? 295  LEU A CA  1 
ATOM   2385 C  C   . LEU A 1 295 ? -4.941  7.399   33.581  1.00 50.28  ? 295  LEU A C   1 
ATOM   2386 O  O   . LEU A 1 295 ? -5.873  8.119   33.937  1.00 51.38  ? 295  LEU A O   1 
ATOM   2387 C  CB  . LEU A 1 295 ? -5.505  5.014   33.925  1.00 65.57  ? 295  LEU A CB  1 
ATOM   2388 C  CG  . LEU A 1 295 ? -5.558  3.714   34.727  1.00 70.83  ? 295  LEU A CG  1 
ATOM   2389 C  CD1 . LEU A 1 295 ? -6.164  2.641   33.836  1.00 76.31  ? 295  LEU A CD1 1 
ATOM   2390 C  CD2 . LEU A 1 295 ? -4.171  3.290   35.194  1.00 67.81  ? 295  LEU A CD2 1 
ATOM   2391 N  N   . THR A 1 296 ? -4.172  7.681   32.542  1.00 45.15  ? 296  THR A N   1 
ATOM   2392 C  CA  . THR A 1 296 ? -4.477  8.821   31.698  1.00 44.98  ? 296  THR A CA  1 
ATOM   2393 C  C   . THR A 1 296 ? -5.685  8.408   30.886  1.00 40.98  ? 296  THR A C   1 
ATOM   2394 O  O   . THR A 1 296 ? -6.166  7.284   31.006  1.00 38.85  ? 296  THR A O   1 
ATOM   2395 C  CB  . THR A 1 296 ? -3.353  9.122   30.694  1.00 47.15  ? 296  THR A CB  1 
ATOM   2396 O  OG1 . THR A 1 296 ? -2.881  7.896   30.119  1.00 56.28  ? 296  THR A OG1 1 
ATOM   2397 C  CG2 . THR A 1 296 ? -2.221  9.862   31.358  1.00 47.00  ? 296  THR A CG2 1 
ATOM   2398 N  N   . GLU A 1 297 ? -6.164  9.318   30.053  1.00 44.20  ? 297  GLU A N   1 
ATOM   2399 C  CA  . GLU A 1 297 ? -7.288  9.029   29.185  1.00 49.46  ? 297  GLU A CA  1 
ATOM   2400 C  C   . GLU A 1 297 ? -6.823  7.955   28.210  1.00 47.44  ? 297  GLU A C   1 
ATOM   2401 O  O   . GLU A 1 297 ? -7.490  6.934   28.022  1.00 54.61  ? 297  GLU A O   1 
ATOM   2402 C  CB  . GLU A 1 297 ? -7.691  10.283  28.406  1.00 62.46  ? 297  GLU A CB  1 
ATOM   2403 C  CG  . GLU A 1 297 ? -8.894  10.085  27.489  1.00 85.27  ? 297  GLU A CG  1 
ATOM   2404 C  CD  . GLU A 1 297 ? -9.085  11.224  26.500  1.00 94.79  ? 297  GLU A CD  1 
ATOM   2405 O  OE1 . GLU A 1 297 ? -8.465  11.184  25.413  1.00 94.85  ? 297  GLU A OE1 1 
ATOM   2406 O  OE2 . GLU A 1 297 ? -9.863  12.154  26.802  1.00 99.19  ? 297  GLU A OE2 1 
ATOM   2407 N  N   . GLU A 1 298 ? -5.636  8.157   27.652  1.00 34.91  ? 298  GLU A N   1 
ATOM   2408 C  CA  . GLU A 1 298 ? -5.089  7.213   26.690  1.00 42.22  ? 298  GLU A CA  1 
ATOM   2409 C  C   . GLU A 1 298 ? -4.871  5.845   27.317  1.00 38.21  ? 298  GLU A C   1 
ATOM   2410 O  O   . GLU A 1 298 ? -5.095  4.811   26.675  1.00 40.55  ? 298  GLU A O   1 
ATOM   2411 C  CB  . GLU A 1 298 ? -3.791  7.741   26.088  1.00 60.67  ? 298  GLU A CB  1 
ATOM   2412 C  CG  . GLU A 1 298 ? -3.970  8.967   25.201  1.00 75.51  ? 298  GLU A CG  1 
ATOM   2413 C  CD  . GLU A 1 298 ? -3.841  10.290  25.952  1.00 83.29  ? 298  GLU A CD  1 
ATOM   2414 O  OE1 . GLU A 1 298 ? -4.098  10.345  27.180  1.00 80.60  ? 298  GLU A OE1 1 
ATOM   2415 O  OE2 . GLU A 1 298 ? -3.473  11.288  25.296  1.00 84.82  ? 298  GLU A OE2 1 
ATOM   2416 N  N   . ALA A 1 299 ? -4.433  5.836   28.568  1.00 30.32  ? 299  ALA A N   1 
ATOM   2417 C  CA  . ALA A 1 299 ? -4.228  4.577   29.265  1.00 39.87  ? 299  ALA A CA  1 
ATOM   2418 C  C   . ALA A 1 299 ? -5.573  3.835   29.344  1.00 43.87  ? 299  ALA A C   1 
ATOM   2419 O  O   . ALA A 1 299 ? -5.716  2.710   28.852  1.00 50.07  ? 299  ALA A O   1 
ATOM   2420 C  CB  . ALA A 1 299 ? -3.687  4.837   30.665  1.00 30.98  ? 299  ALA A CB  1 
ATOM   2421 N  N   . GLU A 1 300 ? -6.568  4.513   29.905  1.00 37.47  ? 300  GLU A N   1 
ATOM   2422 C  CA  . GLU A 1 300 ? -7.898  3.967   30.071  1.00 28.49  ? 300  GLU A CA  1 
ATOM   2423 C  C   . GLU A 1 300 ? -8.448  3.466   28.755  1.00 32.85  ? 300  GLU A C   1 
ATOM   2424 O  O   . GLU A 1 300 ? -9.197  2.481   28.723  1.00 33.36  ? 300  GLU A O   1 
ATOM   2425 C  CB  . GLU A 1 300 ? -8.824  5.038   30.604  1.00 33.26  ? 300  GLU A CB  1 
ATOM   2426 C  CG  . GLU A 1 300 ? -9.849  4.495   31.549  1.00 51.47  ? 300  GLU A CG  1 
ATOM   2427 C  CD  . GLU A 1 300 ? -9.219  4.050   32.847  1.00 57.97  ? 300  GLU A CD  1 
ATOM   2428 O  OE1 . GLU A 1 300 ? -8.566  4.889   33.507  1.00 41.97  ? 300  GLU A OE1 1 
ATOM   2429 O  OE2 . GLU A 1 300 ? -9.373  2.861   33.201  1.00 68.07  ? 300  GLU A OE2 1 
ATOM   2430 N  N   . LEU A 1 301 ? -8.086  4.162   27.676  1.00 30.67  ? 301  LEU A N   1 
ATOM   2431 C  CA  . LEU A 1 301 ? -8.531  3.809   26.337  1.00 29.38  ? 301  LEU A CA  1 
ATOM   2432 C  C   . LEU A 1 301 ? -7.966  2.494   25.851  1.00 29.65  ? 301  LEU A C   1 
ATOM   2433 O  O   . LEU A 1 301 ? -8.737  1.568   25.570  1.00 28.29  ? 301  LEU A O   1 
ATOM   2434 C  CB  . LEU A 1 301 ? -8.184  4.898   25.323  1.00 37.42  ? 301  LEU A CB  1 
ATOM   2435 C  CG  . LEU A 1 301 ? -8.375  4.488   23.852  1.00 50.17  ? 301  LEU A CG  1 
ATOM   2436 C  CD1 . LEU A 1 301 ? -9.804  3.992   23.578  1.00 58.69  ? 301  LEU A CD1 1 
ATOM   2437 C  CD2 . LEU A 1 301 ? -8.033  5.654   22.955  1.00 61.58  ? 301  LEU A CD2 1 
ATOM   2438 N  N   . GLU A 1 302 ? -6.638  2.398   25.728  1.00 31.45  ? 302  GLU A N   1 
ATOM   2439 C  CA  . GLU A 1 302 ? -6.058  1.145   25.244  1.00 35.67  ? 302  GLU A CA  1 
ATOM   2440 C  C   . GLU A 1 302 ? -6.482  -0.035  26.127  1.00 30.73  ? 302  GLU A C   1 
ATOM   2441 O  O   . GLU A 1 302 ? -6.809  -1.106  25.613  1.00 25.92  ? 302  GLU A O   1 
ATOM   2442 C  CB  . GLU A 1 302 ? -4.532  1.223   24.998  1.00 37.05  ? 302  GLU A CB  1 
ATOM   2443 C  CG  . GLU A 1 302 ? -3.577  1.216   26.216  1.00 44.35  ? 302  GLU A CG  1 
ATOM   2444 C  CD  . GLU A 1 302 ? -2.075  1.132   25.812  1.00 33.27  ? 302  GLU A CD  1 
ATOM   2445 O  OE1 . GLU A 1 302 ? -1.770  1.198   24.587  1.00 15.25  ? 302  GLU A OE1 1 
ATOM   2446 O  OE2 . GLU A 1 302 ? -1.203  1.010   26.720  1.00 2.00   ? 302  GLU A OE2 1 
ATOM   2447 N  N   . LEU A 1 303 ? -6.608  0.207   27.430  1.00 19.69  ? 303  LEU A N   1 
ATOM   2448 C  CA  . LEU A 1 303 ? -7.046  -0.826  28.344  1.00 26.13  ? 303  LEU A CA  1 
ATOM   2449 C  C   . LEU A 1 303 ? -8.424  -1.331  27.890  1.00 39.61  ? 303  LEU A C   1 
ATOM   2450 O  O   . LEU A 1 303 ? -8.700  -2.532  27.903  1.00 41.27  ? 303  LEU A O   1 
ATOM   2451 C  CB  . LEU A 1 303 ? -7.139  -0.272  29.768  1.00 31.37  ? 303  LEU A CB  1 
ATOM   2452 C  CG  . LEU A 1 303 ? -7.657  -1.258  30.829  1.00 39.12  ? 303  LEU A CG  1 
ATOM   2453 C  CD1 . LEU A 1 303 ? -6.707  -2.437  30.911  1.00 36.71  ? 303  LEU A CD1 1 
ATOM   2454 C  CD2 . LEU A 1 303 ? -7.826  -0.598  32.203  1.00 35.40  ? 303  LEU A CD2 1 
ATOM   2455 N  N   . ALA A 1 304 ? -9.280  -0.411  27.461  1.00 49.90  ? 304  ALA A N   1 
ATOM   2456 C  CA  . ALA A 1 304 ? -10.617 -0.775  27.009  1.00 51.89  ? 304  ALA A CA  1 
ATOM   2457 C  C   . ALA A 1 304 ? -10.566 -1.557  25.707  1.00 47.68  ? 304  ALA A C   1 
ATOM   2458 O  O   . ALA A 1 304 ? -11.266 -2.559  25.558  1.00 48.34  ? 304  ALA A O   1 
ATOM   2459 C  CB  . ALA A 1 304 ? -11.477 0.468   26.848  1.00 60.06  ? 304  ALA A CB  1 
ATOM   2460 N  N   . GLU A 1 305 ? -9.722  -1.114  24.778  1.00 45.43  ? 305  GLU A N   1 
ATOM   2461 C  CA  . GLU A 1 305 ? -9.582  -1.779  23.481  1.00 52.38  ? 305  GLU A CA  1 
ATOM   2462 C  C   . GLU A 1 305 ? -9.066  -3.203  23.670  1.00 55.87  ? 305  GLU A C   1 
ATOM   2463 O  O   . GLU A 1 305 ? -9.488  -4.141  22.977  1.00 55.91  ? 305  GLU A O   1 
ATOM   2464 C  CB  . GLU A 1 305 ? -8.606  -1.009  22.601  1.00 53.37  ? 305  GLU A CB  1 
ATOM   2465 C  CG  . GLU A 1 305 ? -8.913  0.462   22.490  1.00 68.21  ? 305  GLU A CG  1 
ATOM   2466 C  CD  . GLU A 1 305 ? -7.712  1.276   22.051  1.00 88.96  ? 305  GLU A CD  1 
ATOM   2467 O  OE1 . GLU A 1 305 ? -6.560  0.822   22.250  1.00 90.20  ? 305  GLU A OE1 1 
ATOM   2468 O  OE2 . GLU A 1 305 ? -7.921  2.383   21.510  1.00 100.94 ? 305  GLU A OE2 1 
ATOM   2469 N  N   . ASN A 1 306 ? -8.155  -3.351  24.624  1.00 52.44  ? 306  ASN A N   1 
ATOM   2470 C  CA  . ASN A 1 306 ? -7.558  -4.637  24.934  1.00 54.35  ? 306  ASN A CA  1 
ATOM   2471 C  C   . ASN A 1 306 ? -8.592  -5.614  25.481  1.00 51.62  ? 306  ASN A C   1 
ATOM   2472 O  O   . ASN A 1 306 ? -8.648  -6.764  25.047  1.00 50.91  ? 306  ASN A O   1 
ATOM   2473 C  CB  . ASN A 1 306 ? -6.400  -4.468  25.932  1.00 66.50  ? 306  ASN A CB  1 
ATOM   2474 C  CG  . ASN A 1 306 ? -5.138  -3.872  25.291  1.00 70.65  ? 306  ASN A CG  1 
ATOM   2475 O  OD1 . ASN A 1 306 ? -4.977  -3.871  24.062  1.00 67.49  ? 306  ASN A OD1 1 
ATOM   2476 N  ND2 . ASN A 1 306 ? -4.233  -3.373  26.130  1.00 62.89  ? 306  ASN A ND2 1 
ATOM   2477 N  N   . ARG A 1 307 ? -9.410  -5.165  26.428  1.00 53.28  ? 307  ARG A N   1 
ATOM   2478 C  CA  . ARG A 1 307 ? -10.443 -6.025  27.006  1.00 53.65  ? 307  ARG A CA  1 
ATOM   2479 C  C   . ARG A 1 307 ? -11.268 -6.612  25.874  1.00 56.46  ? 307  ARG A C   1 
ATOM   2480 O  O   . ARG A 1 307 ? -11.553 -7.809  25.855  1.00 56.51  ? 307  ARG A O   1 
ATOM   2481 C  CB  . ARG A 1 307 ? -11.362 -5.233  27.938  1.00 46.89  ? 307  ARG A CB  1 
ATOM   2482 C  CG  . ARG A 1 307 ? -10.707 -4.755  29.208  1.00 42.41  ? 307  ARG A CG  1 
ATOM   2483 C  CD  . ARG A 1 307 ? -11.599 -3.764  29.925  1.00 41.30  ? 307  ARG A CD  1 
ATOM   2484 N  NE  . ARG A 1 307 ? -11.015 -3.324  31.188  1.00 46.42  ? 307  ARG A NE  1 
ATOM   2485 C  CZ  . ARG A 1 307 ? -10.888 -4.092  32.265  1.00 36.85  ? 307  ARG A CZ  1 
ATOM   2486 N  NH1 . ARG A 1 307 ? -11.302 -5.344  32.245  1.00 16.30  ? 307  ARG A NH1 1 
ATOM   2487 N  NH2 . ARG A 1 307 ? -10.329 -3.609  33.363  1.00 52.88  ? 307  ARG A NH2 1 
ATOM   2488 N  N   . GLU A 1 308 ? -11.580 -5.768  24.895  1.00 60.12  ? 308  GLU A N   1 
ATOM   2489 C  CA  . GLU A 1 308 ? -12.376 -6.180  23.748  1.00 63.87  ? 308  GLU A CA  1 
ATOM   2490 C  C   . GLU A 1 308 ? -11.700 -7.291  22.951  1.00 57.68  ? 308  GLU A C   1 
ATOM   2491 O  O   . GLU A 1 308 ? -12.283 -8.357  22.744  1.00 59.54  ? 308  GLU A O   1 
ATOM   2492 C  CB  . GLU A 1 308 ? -12.715 -4.965  22.879  1.00 69.45  ? 308  GLU A CB  1 
ATOM   2493 C  CG  . GLU A 1 308 ? -13.543 -3.939  23.658  1.00 87.87  ? 308  GLU A CG  1 
ATOM   2494 C  CD  . GLU A 1 308 ? -13.945 -2.713  22.857  1.00 100.43 ? 308  GLU A CD  1 
ATOM   2495 O  OE1 . GLU A 1 308 ? -13.495 -2.562  21.700  1.00 104.75 ? 308  GLU A OE1 1 
ATOM   2496 O  OE2 . GLU A 1 308 ? -14.719 -1.891  23.400  1.00 107.07 ? 308  GLU A OE2 1 
ATOM   2497 N  N   . ILE A 1 309 ? -10.448 -7.075  22.569  1.00 47.18  ? 309  ILE A N   1 
ATOM   2498 C  CA  . ILE A 1 309 ? -9.716  -8.079  21.813  1.00 41.06  ? 309  ILE A CA  1 
ATOM   2499 C  C   . ILE A 1 309 ? -9.622  -9.404  22.584  1.00 35.40  ? 309  ILE A C   1 
ATOM   2500 O  O   . ILE A 1 309 ? -9.942  -10.469 22.051  1.00 21.12  ? 309  ILE A O   1 
ATOM   2501 C  CB  . ILE A 1 309 ? -8.309  -7.555  21.438  1.00 42.04  ? 309  ILE A CB  1 
ATOM   2502 C  CG1 . ILE A 1 309 ? -8.448  -6.354  20.495  1.00 44.93  ? 309  ILE A CG1 1 
ATOM   2503 C  CG2 . ILE A 1 309 ? -7.484  -8.658  20.787  1.00 43.57  ? 309  ILE A CG2 1 
ATOM   2504 C  CD1 . ILE A 1 309 ? -7.177  -5.579  20.274  1.00 46.61  ? 309  ILE A CD1 1 
ATOM   2505 N  N   . LEU A 1 310 ? -9.267  -9.317  23.862  1.00 45.69  ? 310  LEU A N   1 
ATOM   2506 C  CA  . LEU A 1 310 ? -9.115  -10.494 24.722  1.00 54.38  ? 310  LEU A CA  1 
ATOM   2507 C  C   . LEU A 1 310 ? -10.344 -11.369 24.904  1.00 58.21  ? 310  LEU A C   1 
ATOM   2508 O  O   . LEU A 1 310 ? -10.244 -12.496 25.412  1.00 53.81  ? 310  LEU A O   1 
ATOM   2509 C  CB  . LEU A 1 310 ? -8.578  -10.093 26.092  1.00 57.32  ? 310  LEU A CB  1 
ATOM   2510 C  CG  . LEU A 1 310 ? -7.135  -9.601  26.076  1.00 57.20  ? 310  LEU A CG  1 
ATOM   2511 C  CD1 . LEU A 1 310 ? -6.624  -9.545  27.497  1.00 63.96  ? 310  LEU A CD1 1 
ATOM   2512 C  CD2 . LEU A 1 310 ? -6.279  -10.537 25.244  1.00 56.74  ? 310  LEU A CD2 1 
ATOM   2513 N  N   . LYS A 1 311 ? -11.502 -10.842 24.522  1.00 63.30  ? 311  LYS A N   1 
ATOM   2514 C  CA  . LYS A 1 311 ? -12.741 -11.594 24.629  1.00 67.35  ? 311  LYS A CA  1 
ATOM   2515 C  C   . LYS A 1 311 ? -13.031 -12.294 23.312  1.00 70.34  ? 311  LYS A C   1 
ATOM   2516 O  O   . LYS A 1 311 ? -14.174 -12.609 22.994  1.00 72.89  ? 311  LYS A O   1 
ATOM   2517 C  CB  . LYS A 1 311 ? -13.896 -10.686 25.052  1.00 71.05  ? 311  LYS A CB  1 
ATOM   2518 C  CG  . LYS A 1 311 ? -13.758 -10.189 26.495  1.00 76.49  ? 311  LYS A CG  1 
ATOM   2519 C  CD  . LYS A 1 311 ? -14.930 -9.324  26.962  1.00 67.88  ? 311  LYS A CD  1 
ATOM   2520 C  CE  . LYS A 1 311 ? -15.035 -8.022  26.179  1.00 56.73  ? 311  LYS A CE  1 
ATOM   2521 N  NZ  . LYS A 1 311 ? -16.082 -7.150  26.754  1.00 49.72  ? 311  LYS A NZ  1 
ATOM   2522 N  N   . GLU A 1 312 ? -11.980 -12.507 22.533  1.00 74.50  ? 312  GLU A N   1 
ATOM   2523 C  CA  . GLU A 1 312 ? -12.104 -13.196 21.267  1.00 78.42  ? 312  GLU A CA  1 
ATOM   2524 C  C   . GLU A 1 312 ? -11.616 -14.623 21.537  1.00 77.52  ? 312  GLU A C   1 
ATOM   2525 O  O   . GLU A 1 312 ? -10.670 -14.838 22.299  1.00 72.89  ? 312  GLU A O   1 
ATOM   2526 C  CB  . GLU A 1 312 ? -11.248 -12.503 20.204  1.00 84.89  ? 312  GLU A CB  1 
ATOM   2527 C  CG  . GLU A 1 312 ? -11.557 -12.919 18.771  1.00 94.38  ? 312  GLU A CG  1 
ATOM   2528 C  CD  . GLU A 1 312 ? -10.446 -13.744 18.141  1.00 101.05 ? 312  GLU A CD  1 
ATOM   2529 O  OE1 . GLU A 1 312 ? -9.322  -13.214 17.999  1.00 106.77 ? 312  GLU A OE1 1 
ATOM   2530 O  OE2 . GLU A 1 312 ? -10.694 -14.918 17.785  1.00 100.08 ? 312  GLU A OE2 1 
ATOM   2531 N  N   . PRO A 1 313 ? -12.306 -15.622 20.975  1.00 77.45  ? 313  PRO A N   1 
ATOM   2532 C  CA  . PRO A 1 313 ? -11.918 -17.018 21.176  1.00 76.83  ? 313  PRO A CA  1 
ATOM   2533 C  C   . PRO A 1 313 ? -10.800 -17.479 20.236  1.00 76.94  ? 313  PRO A C   1 
ATOM   2534 O  O   . PRO A 1 313 ? -11.044 -17.796 19.067  1.00 76.60  ? 313  PRO A O   1 
ATOM   2535 C  CB  . PRO A 1 313 ? -13.218 -17.761 20.897  1.00 71.55  ? 313  PRO A CB  1 
ATOM   2536 C  CG  . PRO A 1 313 ? -13.794 -16.962 19.771  1.00 76.43  ? 313  PRO A CG  1 
ATOM   2537 C  CD  . PRO A 1 313 ? -13.574 -15.530 20.230  1.00 78.06  ? 313  PRO A CD  1 
ATOM   2538 N  N   . VAL A 1 314 ? -9.567  -17.468 20.723  1.00 74.26  ? 314  VAL A N   1 
ATOM   2539 C  CA  . VAL A 1 314 ? -8.464  -17.936 19.900  1.00 70.62  ? 314  VAL A CA  1 
ATOM   2540 C  C   . VAL A 1 314 ? -8.354  -19.455 20.050  1.00 70.05  ? 314  VAL A C   1 
ATOM   2541 O  O   . VAL A 1 314 ? -8.041  -19.988 21.129  1.00 63.65  ? 314  VAL A O   1 
ATOM   2542 C  CB  . VAL A 1 314 ? -7.136  -17.222 20.224  1.00 71.80  ? 314  VAL A CB  1 
ATOM   2543 C  CG1 . VAL A 1 314 ? -7.128  -15.831 19.599  1.00 78.88  ? 314  VAL A CG1 1 
ATOM   2544 C  CG2 . VAL A 1 314 ? -6.958  -17.104 21.708  1.00 72.16  ? 314  VAL A CG2 1 
ATOM   2545 N  N   . HIS A 1 315 ? -8.719  -20.138 18.969  1.00 70.03  ? 315  HIS A N   1 
ATOM   2546 C  CA  . HIS A 1 315 ? -8.715  -21.595 18.894  1.00 66.11  ? 315  HIS A CA  1 
ATOM   2547 C  C   . HIS A 1 315 ? -7.622  -22.048 17.949  1.00 60.40  ? 315  HIS A C   1 
ATOM   2548 O  O   . HIS A 1 315 ? -7.357  -21.376 16.948  1.00 61.47  ? 315  HIS A O   1 
ATOM   2549 C  CB  . HIS A 1 315 ? -10.064 -22.091 18.379  1.00 70.84  ? 315  HIS A CB  1 
ATOM   2550 C  CG  . HIS A 1 315 ? -11.138 -22.097 19.416  1.00 76.76  ? 315  HIS A CG  1 
ATOM   2551 N  ND1 . HIS A 1 315 ? -11.950 -23.185 19.637  1.00 85.22  ? 315  HIS A ND1 1 
ATOM   2552 C  CD2 . HIS A 1 315 ? -11.520 -21.156 20.315  1.00 84.38  ? 315  HIS A CD2 1 
ATOM   2553 C  CE1 . HIS A 1 315 ? -12.789 -22.919 20.623  1.00 88.93  ? 315  HIS A CE1 1 
ATOM   2554 N  NE2 . HIS A 1 315 ? -12.544 -21.694 21.053  1.00 85.99  ? 315  HIS A NE2 1 
ATOM   2555 N  N   . GLY A 1 316 ? -7.062  -23.225 18.208  1.00 50.53  ? 316  GLY A N   1 
ATOM   2556 C  CA  . GLY A 1 316 ? -5.987  -23.710 17.369  1.00 45.07  ? 316  GLY A CA  1 
ATOM   2557 C  C   . GLY A 1 316 ? -5.957  -25.165 16.943  1.00 35.39  ? 316  GLY A C   1 
ATOM   2558 O  O   . GLY A 1 316 ? -6.631  -26.023 17.506  1.00 19.28  ? 316  GLY A O   1 
ATOM   2559 N  N   . VAL A 1 317 ? -5.043  -25.428 16.013  1.00 35.69  ? 317  VAL A N   1 
ATOM   2560 C  CA  . VAL A 1 317 ? -4.836  -26.732 15.385  1.00 30.44  ? 317  VAL A CA  1 
ATOM   2561 C  C   . VAL A 1 317 ? -3.544  -27.427 15.852  1.00 27.15  ? 317  VAL A C   1 
ATOM   2562 O  O   . VAL A 1 317 ? -2.586  -26.751 16.243  1.00 6.87   ? 317  VAL A O   1 
ATOM   2563 C  CB  . VAL A 1 317 ? -4.753  -26.518 13.847  1.00 21.74  ? 317  VAL A CB  1 
ATOM   2564 C  CG1 . VAL A 1 317 ? -4.391  -27.796 13.123  1.00 2.00   ? 317  VAL A CG1 1 
ATOM   2565 C  CG2 . VAL A 1 317 ? -6.063  -25.929 13.337  1.00 20.68  ? 317  VAL A CG2 1 
ATOM   2566 N  N   . TYR A 1 318 ? -3.540  -28.768 15.813  1.00 23.89  ? 318  TYR A N   1 
ATOM   2567 C  CA  . TYR A 1 318 ? -2.373  -29.588 16.170  1.00 16.58  ? 318  TYR A CA  1 
ATOM   2568 C  C   . TYR A 1 318 ? -1.492  -29.940 14.932  1.00 21.87  ? 318  TYR A C   1 
ATOM   2569 O  O   . TYR A 1 318 ? -1.861  -29.677 13.773  1.00 11.47  ? 318  TYR A O   1 
ATOM   2570 C  CB  . TYR A 1 318 ? -2.817  -30.873 16.847  1.00 12.95  ? 318  TYR A CB  1 
ATOM   2571 C  CG  . TYR A 1 318 ? -3.356  -30.702 18.242  1.00 22.76  ? 318  TYR A CG  1 
ATOM   2572 C  CD1 . TYR A 1 318 ? -2.538  -30.258 19.280  1.00 15.29  ? 318  TYR A CD1 1 
ATOM   2573 C  CD2 . TYR A 1 318 ? -4.667  -31.058 18.544  1.00 20.75  ? 318  TYR A CD2 1 
ATOM   2574 C  CE1 . TYR A 1 318 ? -3.010  -30.180 20.584  1.00 9.54   ? 318  TYR A CE1 1 
ATOM   2575 C  CE2 . TYR A 1 318 ? -5.145  -30.984 19.844  1.00 24.14  ? 318  TYR A CE2 1 
ATOM   2576 C  CZ  . TYR A 1 318 ? -4.317  -30.544 20.860  1.00 19.98  ? 318  TYR A CZ  1 
ATOM   2577 O  OH  . TYR A 1 318 ? -4.817  -30.447 22.142  1.00 22.73  ? 318  TYR A OH  1 
ATOM   2578 N  N   . TYR A 1 319 ? -0.351  -30.577 15.167  1.00 27.87  ? 319  TYR A N   1 
ATOM   2579 C  CA  . TYR A 1 319 ? 0.551   -30.902 14.065  1.00 33.91  ? 319  TYR A CA  1 
ATOM   2580 C  C   . TYR A 1 319 ? 0.248   -32.208 13.331  1.00 35.19  ? 319  TYR A C   1 
ATOM   2581 O  O   . TYR A 1 319 ? 0.080   -33.263 13.953  1.00 35.59  ? 319  TYR A O   1 
ATOM   2582 C  CB  . TYR A 1 319 ? 2.027   -30.861 14.538  1.00 34.23  ? 319  TYR A CB  1 
ATOM   2583 C  CG  . TYR A 1 319 ? 3.074   -31.093 13.435  1.00 29.67  ? 319  TYR A CG  1 
ATOM   2584 C  CD1 . TYR A 1 319 ? 3.001   -30.420 12.208  1.00 12.10  ? 319  TYR A CD1 1 
ATOM   2585 C  CD2 . TYR A 1 319 ? 4.112   -32.016 13.611  1.00 26.57  ? 319  TYR A CD2 1 
ATOM   2586 C  CE1 . TYR A 1 319 ? 3.923   -30.663 11.188  1.00 15.30  ? 319  TYR A CE1 1 
ATOM   2587 C  CE2 . TYR A 1 319 ? 5.036   -32.270 12.602  1.00 19.22  ? 319  TYR A CE2 1 
ATOM   2588 C  CZ  . TYR A 1 319 ? 4.938   -31.596 11.390  1.00 30.65  ? 319  TYR A CZ  1 
ATOM   2589 O  OH  . TYR A 1 319 ? 5.838   -31.890 10.378  1.00 34.87  ? 319  TYR A OH  1 
ATOM   2590 N  N   . ASP A 1 320 ? 0.154   -32.112 12.004  1.00 35.66  ? 320  ASP A N   1 
ATOM   2591 C  CA  . ASP A 1 320 ? -0.082  -33.269 11.145  1.00 36.13  ? 320  ASP A CA  1 
ATOM   2592 C  C   . ASP A 1 320 ? 1.134   -33.437 10.245  1.00 29.54  ? 320  ASP A C   1 
ATOM   2593 O  O   . ASP A 1 320 ? 1.231   -32.804 9.187   1.00 32.67  ? 320  ASP A O   1 
ATOM   2594 C  CB  . ASP A 1 320 ? -1.332  -33.095 10.283  1.00 47.97  ? 320  ASP A CB  1 
ATOM   2595 C  CG  . ASP A 1 320 ? -1.421  -34.139 9.175   1.00 64.46  ? 320  ASP A CG  1 
ATOM   2596 O  OD1 . ASP A 1 320 ? -1.267  -35.348 9.462   1.00 74.81  ? 320  ASP A OD1 1 
ATOM   2597 O  OD2 . ASP A 1 320 ? -1.614  -33.747 8.009   1.00 63.22  ? 320  ASP A OD2 1 
ATOM   2598 N  N   . PRO A 1 321 ? 2.041   -34.355 10.615  1.00 20.79  ? 321  PRO A N   1 
ATOM   2599 C  CA  . PRO A 1 321 ? 3.275   -34.645 9.879   1.00 17.75  ? 321  PRO A CA  1 
ATOM   2600 C  C   . PRO A 1 321 ? 3.189   -34.827 8.371   1.00 16.52  ? 321  PRO A C   1 
ATOM   2601 O  O   . PRO A 1 321 ? 4.213   -34.764 7.706   1.00 20.02  ? 321  PRO A O   1 
ATOM   2602 C  CB  . PRO A 1 321 ? 3.784   -35.911 10.565  1.00 17.31  ? 321  PRO A CB  1 
ATOM   2603 C  CG  . PRO A 1 321 ? 3.361   -35.711 11.985  1.00 2.00   ? 321  PRO A CG  1 
ATOM   2604 C  CD  . PRO A 1 321 ? 1.936   -35.216 11.810  1.00 3.91   ? 321  PRO A CD  1 
ATOM   2605 N  N   . SER A 1 322 ? 1.990   -35.020 7.825   1.00 23.38  ? 322  SER A N   1 
ATOM   2606 C  CA  . SER A 1 322 ? 1.848   -35.240 6.383   1.00 36.08  ? 322  SER A CA  1 
ATOM   2607 C  C   . SER A 1 322 ? 1.627   -33.989 5.562   1.00 39.30  ? 322  SER A C   1 
ATOM   2608 O  O   . SER A 1 322 ? 1.563   -34.052 4.335   1.00 36.13  ? 322  SER A O   1 
ATOM   2609 C  CB  . SER A 1 322 ? 0.710   -36.219 6.101   1.00 47.43  ? 322  SER A CB  1 
ATOM   2610 O  OG  . SER A 1 322 ? -0.502  -35.753 6.657   1.00 47.35  ? 322  SER A OG  1 
ATOM   2611 N  N   . LYS A 1 323 ? 1.468   -32.861 6.243   1.00 51.10  ? 323  LYS A N   1 
ATOM   2612 C  CA  . LYS A 1 323 ? 1.234   -31.593 5.573   1.00 54.89  ? 323  LYS A CA  1 
ATOM   2613 C  C   . LYS A 1 323 ? 2.414   -30.644 5.760   1.00 57.62  ? 323  LYS A C   1 
ATOM   2614 O  O   . LYS A 1 323 ? 3.230   -30.824 6.676   1.00 58.08  ? 323  LYS A O   1 
ATOM   2615 C  CB  . LYS A 1 323 ? -0.071  -30.965 6.084   1.00 55.91  ? 323  LYS A CB  1 
ATOM   2616 C  CG  . LYS A 1 323 ? -1.323  -31.784 5.741   1.00 56.38  ? 323  LYS A CG  1 
ATOM   2617 C  CD  . LYS A 1 323 ? -2.597  -31.247 6.406   1.00 60.83  ? 323  LYS A CD  1 
ATOM   2618 C  CE  . LYS A 1 323 ? -3.378  -30.297 5.503   1.00 64.15  ? 323  LYS A CE  1 
ATOM   2619 N  NZ  . LYS A 1 323 ? -4.541  -29.661 6.200   1.00 47.00  ? 323  LYS A NZ  1 
ATOM   2620 N  N   . ASP A 1 324 ? 2.498   -29.641 4.884   1.00 57.55  ? 324  ASP A N   1 
ATOM   2621 C  CA  . ASP A 1 324 ? 3.569   -28.639 4.919   1.00 56.98  ? 324  ASP A CA  1 
ATOM   2622 C  C   . ASP A 1 324 ? 3.550   -27.781 6.199   1.00 50.85  ? 324  ASP A C   1 
ATOM   2623 O  O   . ASP A 1 324 ? 2.499   -27.619 6.832   1.00 48.16  ? 324  ASP A O   1 
ATOM   2624 C  CB  . ASP A 1 324 ? 3.450   -27.691 3.713   1.00 64.75  ? 324  ASP A CB  1 
ATOM   2625 C  CG  . ASP A 1 324 ? 3.602   -28.397 2.372   1.00 74.57  ? 324  ASP A CG  1 
ATOM   2626 O  OD1 . ASP A 1 324 ? 4.360   -29.388 2.282   1.00 82.48  ? 324  ASP A OD1 1 
ATOM   2627 O  OD2 . ASP A 1 324 ? 2.974   -27.934 1.393   1.00 68.70  ? 324  ASP A OD2 1 
ATOM   2628 N  N   . LEU A 1 325 ? 4.722   -27.268 6.583   1.00 38.44  ? 325  LEU A N   1 
ATOM   2629 C  CA  . LEU A 1 325 ? 4.867   -26.376 7.743   1.00 21.43  ? 325  LEU A CA  1 
ATOM   2630 C  C   . LEU A 1 325 ? 5.144   -24.998 7.135   1.00 18.67  ? 325  LEU A C   1 
ATOM   2631 O  O   . LEU A 1 325 ? 6.164   -24.811 6.461   1.00 2.00   ? 325  LEU A O   1 
ATOM   2632 C  CB  . LEU A 1 325 ? 6.052   -26.792 8.624   1.00 13.15  ? 325  LEU A CB  1 
ATOM   2633 C  CG  . LEU A 1 325 ? 5.783   -27.188 10.089  1.00 15.12  ? 325  LEU A CG  1 
ATOM   2634 C  CD1 . LEU A 1 325 ? 7.092   -27.518 10.768  1.00 2.00   ? 325  LEU A CD1 1 
ATOM   2635 C  CD2 . LEU A 1 325 ? 5.062   -26.091 10.852  1.00 2.00   ? 325  LEU A CD2 1 
ATOM   2636 N  N   . ILE A 1 326 ? 4.225   -24.049 7.318   1.00 32.43  ? 326  ILE A N   1 
ATOM   2637 C  CA  . ILE A 1 326 ? 4.401   -22.712 6.734   1.00 31.87  ? 326  ILE A CA  1 
ATOM   2638 C  C   . ILE A 1 326 ? 4.455   -21.560 7.731   1.00 26.78  ? 326  ILE A C   1 
ATOM   2639 O  O   . ILE A 1 326 ? 3.671   -21.499 8.681   1.00 20.60  ? 326  ILE A O   1 
ATOM   2640 C  CB  . ILE A 1 326 ? 3.325   -22.405 5.683   1.00 23.85  ? 326  ILE A CB  1 
ATOM   2641 C  CG1 . ILE A 1 326 ? 3.082   -23.635 4.805   1.00 18.80  ? 326  ILE A CG1 1 
ATOM   2642 C  CG2 . ILE A 1 326 ? 3.794   -21.256 4.816   1.00 2.00   ? 326  ILE A CG2 1 
ATOM   2643 C  CD1 . ILE A 1 326 ? 1.738   -23.620 4.106   1.00 46.15  ? 326  ILE A CD1 1 
ATOM   2644 N  N   . ALA A 1 327 ? 5.363   -20.626 7.472   1.00 28.99  ? 327  ALA A N   1 
ATOM   2645 C  CA  . ALA A 1 327 ? 5.557   -19.476 8.343   1.00 36.49  ? 327  ALA A CA  1 
ATOM   2646 C  C   . ALA A 1 327 ? 5.476   -18.137 7.613   1.00 37.92  ? 327  ALA A C   1 
ATOM   2647 O  O   . ALA A 1 327 ? 6.262   -17.877 6.694   1.00 42.32  ? 327  ALA A O   1 
ATOM   2648 C  CB  . ALA A 1 327 ? 6.901   -19.599 9.049   1.00 32.68  ? 327  ALA A CB  1 
ATOM   2649 N  N   . GLU A 1 328 ? 4.532   -17.287 8.015   1.00 34.54  ? 328  GLU A N   1 
ATOM   2650 C  CA  . GLU A 1 328 ? 4.413   -15.975 7.385   1.00 29.52  ? 328  GLU A CA  1 
ATOM   2651 C  C   . GLU A 1 328 ? 4.769   -14.878 8.385   1.00 24.70  ? 328  GLU A C   1 
ATOM   2652 O  O   . GLU A 1 328 ? 4.452   -14.970 9.579   1.00 10.37  ? 328  GLU A O   1 
ATOM   2653 C  CB  . GLU A 1 328 ? 3.024   -15.738 6.792   1.00 15.45  ? 328  GLU A CB  1 
ATOM   2654 C  CG  . GLU A 1 328 ? 3.028   -14.643 5.761   1.00 23.72  ? 328  GLU A CG  1 
ATOM   2655 C  CD  . GLU A 1 328 ? 1.649   -14.148 5.419   1.00 52.91  ? 328  GLU A CD  1 
ATOM   2656 O  OE1 . GLU A 1 328 ? 0.832   -14.957 4.923   1.00 63.87  ? 328  GLU A OE1 1 
ATOM   2657 O  OE2 . GLU A 1 328 ? 1.387   -12.942 5.635   1.00 61.33  ? 328  GLU A OE2 1 
ATOM   2658 N  N   . ILE A 1 329 ? 5.493   -13.878 7.892   1.00 30.53  ? 329  ILE A N   1 
ATOM   2659 C  CA  . ILE A 1 329 ? 5.937   -12.766 8.715   1.00 33.34  ? 329  ILE A CA  1 
ATOM   2660 C  C   . ILE A 1 329 ? 5.422   -11.407 8.228   1.00 31.07  ? 329  ILE A C   1 
ATOM   2661 O  O   . ILE A 1 329 ? 5.092   -11.215 7.041   1.00 21.77  ? 329  ILE A O   1 
ATOM   2662 C  CB  . ILE A 1 329 ? 7.491   -12.721 8.798   1.00 28.89  ? 329  ILE A CB  1 
ATOM   2663 C  CG1 . ILE A 1 329 ? 8.039   -14.096 9.181   1.00 12.74  ? 329  ILE A CG1 1 
ATOM   2664 C  CG2 . ILE A 1 329 ? 7.932   -11.708 9.839   1.00 32.27  ? 329  ILE A CG2 1 
ATOM   2665 C  CD1 . ILE A 1 329 ? 9.541   -14.157 9.282   1.00 17.09  ? 329  ILE A CD1 1 
ATOM   2666 N  N   . GLN A 1 330 ? 5.308   -10.489 9.182   1.00 28.04  ? 330  GLN A N   1 
ATOM   2667 C  CA  . GLN A 1 330 ? 4.864   -9.141  8.924   1.00 27.47  ? 330  GLN A CA  1 
ATOM   2668 C  C   . GLN A 1 330 ? 5.771   -8.241  9.728   1.00 35.87  ? 330  GLN A C   1 
ATOM   2669 O  O   . GLN A 1 330 ? 6.170   -8.597  10.853  1.00 24.40  ? 330  GLN A O   1 
ATOM   2670 C  CB  . GLN A 1 330 ? 3.437   -8.919  9.418   1.00 22.82  ? 330  GLN A CB  1 
ATOM   2671 C  CG  . GLN A 1 330 ? 2.378   -9.728  8.722   1.00 33.07  ? 330  GLN A CG  1 
ATOM   2672 C  CD  . GLN A 1 330 ? 2.355   -11.162 9.189   1.00 32.95  ? 330  GLN A CD  1 
ATOM   2673 O  OE1 . GLN A 1 330 ? 2.358   -11.437 10.393  1.00 2.00   ? 330  GLN A OE1 1 
ATOM   2674 N  NE2 . GLN A 1 330 ? 2.346   -12.090 8.239   1.00 42.20  ? 330  GLN A NE2 1 
ATOM   2675 N  N   . LYS A 1 331 ? 6.183   -7.131  9.114   1.00 45.39  ? 331  LYS A N   1 
ATOM   2676 C  CA  . LYS A 1 331 ? 6.999   -6.159  9.823   1.00 47.96  ? 331  LYS A CA  1 
ATOM   2677 C  C   . LYS A 1 331 ? 5.945   -5.256  10.410  1.00 47.40  ? 331  LYS A C   1 
ATOM   2678 O  O   . LYS A 1 331 ? 5.237   -4.547  9.682   1.00 46.44  ? 331  LYS A O   1 
ATOM   2679 C  CB  . LYS A 1 331 ? 7.900   -5.328  8.907   1.00 56.42  ? 331  LYS A CB  1 
ATOM   2680 C  CG  . LYS A 1 331 ? 8.776   -4.353  9.721   1.00 58.29  ? 331  LYS A CG  1 
ATOM   2681 C  CD  . LYS A 1 331 ? 9.352   -3.197  8.905   1.00 51.90  ? 331  LYS A CD  1 
ATOM   2682 C  CE  . LYS A 1 331 ? 9.968   -2.146  9.832   1.00 38.86  ? 331  LYS A CE  1 
ATOM   2683 N  NZ  . LYS A 1 331 ? 10.636  -0.989  9.158   1.00 27.64  ? 331  LYS A NZ  1 
ATOM   2684 N  N   . GLN A 1 332 ? 5.781   -5.366  11.717  1.00 45.79  ? 332  GLN A N   1 
ATOM   2685 C  CA  . GLN A 1 332 ? 4.805   -4.579  12.429  1.00 47.95  ? 332  GLN A CA  1 
ATOM   2686 C  C   . GLN A 1 332 ? 5.553   -3.350  12.958  1.00 50.52  ? 332  GLN A C   1 
ATOM   2687 O  O   . GLN A 1 332 ? 5.967   -3.292  14.123  1.00 54.78  ? 332  GLN A O   1 
ATOM   2688 C  CB  . GLN A 1 332 ? 4.213   -5.423  13.556  1.00 53.72  ? 332  GLN A CB  1 
ATOM   2689 C  CG  . GLN A 1 332 ? 3.135   -4.737  14.368  1.00 73.59  ? 332  GLN A CG  1 
ATOM   2690 C  CD  . GLN A 1 332 ? 2.974   -5.358  15.743  1.00 83.49  ? 332  GLN A CD  1 
ATOM   2691 O  OE1 . GLN A 1 332 ? 1.859   -5.584  16.206  1.00 92.25  ? 332  GLN A OE1 1 
ATOM   2692 N  NE2 . GLN A 1 332 ? 4.095   -5.634  16.407  1.00 84.26  ? 332  GLN A NE2 1 
ATOM   2693 N  N   . GLY A 1 333 ? 5.749   -2.376  12.077  1.00 44.16  ? 333  GLY A N   1 
ATOM   2694 C  CA  . GLY A 1 333 ? 6.459   -1.177  12.462  1.00 39.42  ? 333  GLY A CA  1 
ATOM   2695 C  C   . GLY A 1 333 ? 7.931   -1.513  12.491  1.00 37.15  ? 333  GLY A C   1 
ATOM   2696 O  O   . GLY A 1 333 ? 8.302   -2.667  12.285  1.00 33.33  ? 333  GLY A O   1 
ATOM   2697 N  N   . GLN A 1 334 ? 8.770   -0.517  12.752  1.00 41.13  ? 334  GLN A N   1 
ATOM   2698 C  CA  . GLN A 1 334 ? 10.209  -0.724  12.793  1.00 43.27  ? 334  GLN A CA  1 
ATOM   2699 C  C   . GLN A 1 334 ? 10.665  -1.574  13.971  1.00 45.62  ? 334  GLN A C   1 
ATOM   2700 O  O   . GLN A 1 334 ? 10.245  -1.353  15.106  1.00 48.67  ? 334  GLN A O   1 
ATOM   2701 C  CB  . GLN A 1 334 ? 10.940  0.615   12.814  1.00 45.13  ? 334  GLN A CB  1 
ATOM   2702 C  CG  . GLN A 1 334 ? 12.404  0.485   13.198  1.00 58.98  ? 334  GLN A CG  1 
ATOM   2703 C  CD  . GLN A 1 334 ? 13.153  1.794   13.129  1.00 65.60  ? 334  GLN A CD  1 
ATOM   2704 O  OE1 . GLN A 1 334 ? 13.343  2.476   14.141  1.00 61.30  ? 334  GLN A OE1 1 
ATOM   2705 N  NE2 . GLN A 1 334 ? 13.601  2.149   11.931  1.00 72.90  ? 334  GLN A NE2 1 
ATOM   2706 N  N   . GLY A 1 335 ? 11.505  -2.564  13.683  1.00 47.33  ? 335  GLY A N   1 
ATOM   2707 C  CA  . GLY A 1 335 ? 12.043  -3.419  14.726  1.00 47.65  ? 335  GLY A CA  1 
ATOM   2708 C  C   . GLY A 1 335 ? 11.115  -4.461  15.306  1.00 47.16  ? 335  GLY A C   1 
ATOM   2709 O  O   . GLY A 1 335 ? 11.516  -5.234  16.178  1.00 47.32  ? 335  GLY A O   1 
ATOM   2710 N  N   . GLN A 1 336 ? 9.879   -4.491  14.830  1.00 47.74  ? 336  GLN A N   1 
ATOM   2711 C  CA  . GLN A 1 336 ? 8.916   -5.455  15.328  1.00 45.96  ? 336  GLN A CA  1 
ATOM   2712 C  C   . GLN A 1 336 ? 8.453   -6.353  14.196  1.00 40.90  ? 336  GLN A C   1 
ATOM   2713 O  O   . GLN A 1 336 ? 8.261   -5.897  13.056  1.00 32.88  ? 336  GLN A O   1 
ATOM   2714 C  CB  . GLN A 1 336 ? 7.739   -4.738  15.973  1.00 48.01  ? 336  GLN A CB  1 
ATOM   2715 C  CG  . GLN A 1 336 ? 8.165   -3.766  17.045  1.00 67.67  ? 336  GLN A CG  1 
ATOM   2716 C  CD  . GLN A 1 336 ? 6.994   -3.118  17.736  1.00 87.97  ? 336  GLN A CD  1 
ATOM   2717 O  OE1 . GLN A 1 336 ? 6.814   -3.262  18.948  1.00 96.20  ? 336  GLN A OE1 1 
ATOM   2718 N  NE2 . GLN A 1 336 ? 6.178   -2.407  16.971  1.00 88.11  ? 336  GLN A NE2 1 
ATOM   2719 N  N   . TRP A 1 337 ? 8.321   -7.642  14.508  1.00 38.26  ? 337  TRP A N   1 
ATOM   2720 C  CA  . TRP A 1 337 ? 7.899   -8.635  13.520  1.00 32.39  ? 337  TRP A CA  1 
ATOM   2721 C  C   . TRP A 1 337 ? 6.876   -9.659  14.031  1.00 25.84  ? 337  TRP A C   1 
ATOM   2722 O  O   . TRP A 1 337 ? 7.016   -10.256 15.123  1.00 2.00   ? 337  TRP A O   1 
ATOM   2723 C  CB  . TRP A 1 337 ? 9.117   -9.371  12.962  1.00 25.53  ? 337  TRP A CB  1 
ATOM   2724 C  CG  . TRP A 1 337 ? 10.228  -8.462  12.529  1.00 24.39  ? 337  TRP A CG  1 
ATOM   2725 C  CD1 . TRP A 1 337 ? 11.157  -7.844  13.331  1.00 21.84  ? 337  TRP A CD1 1 
ATOM   2726 C  CD2 . TRP A 1 337 ? 10.537  -8.074  11.189  1.00 10.55  ? 337  TRP A CD2 1 
ATOM   2727 N  NE1 . TRP A 1 337 ? 12.023  -7.099  12.561  1.00 2.00   ? 337  TRP A NE1 1 
ATOM   2728 C  CE2 . TRP A 1 337 ? 11.660  -7.222  11.245  1.00 16.93  ? 337  TRP A CE2 1 
ATOM   2729 C  CE3 . TRP A 1 337 ? 9.976   -8.367  9.946   1.00 2.00   ? 337  TRP A CE3 1 
ATOM   2730 C  CZ2 . TRP A 1 337 ? 12.228  -6.660  10.093  1.00 31.20  ? 337  TRP A CZ2 1 
ATOM   2731 C  CZ3 . TRP A 1 337 ? 10.543  -7.811  8.806   1.00 2.00   ? 337  TRP A CZ3 1 
ATOM   2732 C  CH2 . TRP A 1 337 ? 11.651  -6.969  8.884   1.00 3.04   ? 337  TRP A CH2 1 
ATOM   2733 N  N   . THR A 1 338 ? 5.838   -9.848  13.228  1.00 25.72  ? 338  THR A N   1 
ATOM   2734 C  CA  . THR A 1 338 ? 4.793   -10.797 13.550  1.00 19.55  ? 338  THR A CA  1 
ATOM   2735 C  C   . THR A 1 338 ? 4.899   -11.999 12.629  1.00 11.59  ? 338  THR A C   1 
ATOM   2736 O  O   . THR A 1 338 ? 5.296   -11.880 11.469  1.00 2.00   ? 338  THR A O   1 
ATOM   2737 C  CB  . THR A 1 338 ? 3.423   -10.155 13.431  1.00 14.81  ? 338  THR A CB  1 
ATOM   2738 O  OG1 . THR A 1 338 ? 3.433   -9.203  12.353  1.00 4.13   ? 338  THR A OG1 1 
ATOM   2739 C  CG2 . THR A 1 338 ? 3.059   -9.477  14.752  1.00 17.51  ? 338  THR A CG2 1 
ATOM   2740 N  N   . TYR A 1 339 ? 4.612   -13.166 13.181  1.00 15.85  ? 339  TYR A N   1 
ATOM   2741 C  CA  . TYR A 1 339 ? 4.681   -14.400 12.424  1.00 23.84  ? 339  TYR A CA  1 
ATOM   2742 C  C   . TYR A 1 339 ? 3.572   -15.346 12.899  1.00 26.23  ? 339  TYR A C   1 
ATOM   2743 O  O   . TYR A 1 339 ? 3.064   -15.228 14.018  1.00 24.37  ? 339  TYR A O   1 
ATOM   2744 C  CB  . TYR A 1 339 ? 6.073   -15.059 12.590  1.00 19.54  ? 339  TYR A CB  1 
ATOM   2745 C  CG  . TYR A 1 339 ? 6.328   -15.671 13.972  1.00 21.98  ? 339  TYR A CG  1 
ATOM   2746 C  CD1 . TYR A 1 339 ? 6.825   -14.892 15.025  1.00 22.46  ? 339  TYR A CD1 1 
ATOM   2747 C  CD2 . TYR A 1 339 ? 6.013   -17.016 14.242  1.00 4.68   ? 339  TYR A CD2 1 
ATOM   2748 C  CE1 . TYR A 1 339 ? 6.994   -15.430 16.317  1.00 18.60  ? 339  TYR A CE1 1 
ATOM   2749 C  CE2 . TYR A 1 339 ? 6.179   -17.564 15.525  1.00 10.31  ? 339  TYR A CE2 1 
ATOM   2750 C  CZ  . TYR A 1 339 ? 6.666   -16.763 16.560  1.00 24.72  ? 339  TYR A CZ  1 
ATOM   2751 O  OH  . TYR A 1 339 ? 6.794   -17.273 17.838  1.00 23.95  ? 339  TYR A OH  1 
ATOM   2752 N  N   . GLN A 1 340 ? 3.190   -16.273 12.031  1.00 33.82  ? 340  GLN A N   1 
ATOM   2753 C  CA  . GLN A 1 340 ? 2.155   -17.256 12.333  1.00 29.89  ? 340  GLN A CA  1 
ATOM   2754 C  C   . GLN A 1 340 ? 2.392   -18.514 11.478  1.00 25.86  ? 340  GLN A C   1 
ATOM   2755 O  O   . GLN A 1 340 ? 2.610   -18.435 10.263  1.00 13.92  ? 340  GLN A O   1 
ATOM   2756 C  CB  . GLN A 1 340 ? 0.755   -16.653 12.103  1.00 35.56  ? 340  GLN A CB  1 
ATOM   2757 C  CG  . GLN A 1 340 ? 0.473   -16.048 10.698  1.00 33.07  ? 340  GLN A CG  1 
ATOM   2758 C  CD  . GLN A 1 340 ? 1.008   -14.624 10.470  1.00 27.33  ? 340  GLN A CD  1 
ATOM   2759 O  OE1 . GLN A 1 340 ? 1.142   -14.203 9.324   1.00 42.69  ? 340  GLN A OE1 1 
ATOM   2760 N  NE2 . GLN A 1 340 ? 1.251   -13.868 11.546  1.00 2.00   ? 340  GLN A NE2 1 
ATOM   2761 N  N   . ILE A 1 341 ? 2.467   -19.656 12.148  1.00 30.24  ? 341  ILE A N   1 
ATOM   2762 C  CA  . ILE A 1 341 ? 2.715   -20.930 11.482  1.00 31.03  ? 341  ILE A CA  1 
ATOM   2763 C  C   . ILE A 1 341 ? 1.470   -21.808 11.382  1.00 25.18  ? 341  ILE A C   1 
ATOM   2764 O  O   . ILE A 1 341 ? 0.907   -22.290 12.377  1.00 7.72   ? 341  ILE A O   1 
ATOM   2765 C  CB  . ILE A 1 341 ? 3.834   -21.726 12.178  1.00 37.14  ? 341  ILE A CB  1 
ATOM   2766 C  CG1 . ILE A 1 341 ? 4.947   -20.787 12.638  1.00 26.39  ? 341  ILE A CG1 1 
ATOM   2767 C  CG2 . ILE A 1 341 ? 4.424   -22.731 11.208  1.00 31.05  ? 341  ILE A CG2 1 
ATOM   2768 C  CD1 . ILE A 1 341 ? 5.755   -21.344 13.775  1.00 29.94  ? 341  ILE A CD1 1 
ATOM   2769 N  N   . TYR A 1 342 ? 1.123   -22.100 10.147  1.00 27.34  ? 342  TYR A N   1 
ATOM   2770 C  CA  . TYR A 1 342 ? -0.048  -22.885 9.843   1.00 19.74  ? 342  TYR A CA  1 
ATOM   2771 C  C   . TYR A 1 342 ? 0.334   -23.824 8.694   1.00 18.56  ? 342  TYR A C   1 
ATOM   2772 O  O   . TYR A 1 342 ? 1.299   -23.558 7.942   1.00 2.00   ? 342  TYR A O   1 
ATOM   2773 C  CB  . TYR A 1 342 ? -1.145  -21.925 9.390   1.00 13.75  ? 342  TYR A CB  1 
ATOM   2774 C  CG  . TYR A 1 342 ? -0.770  -21.236 8.103   1.00 16.76  ? 342  TYR A CG  1 
ATOM   2775 C  CD1 . TYR A 1 342 ? 0.268   -20.297 8.061   1.00 9.23   ? 342  TYR A CD1 1 
ATOM   2776 C  CD2 . TYR A 1 342 ? -1.366  -21.616 6.899   1.00 8.98   ? 342  TYR A CD2 1 
ATOM   2777 C  CE1 . TYR A 1 342 ? 0.706   -19.772 6.844   1.00 9.72   ? 342  TYR A CE1 1 
ATOM   2778 C  CE2 . TYR A 1 342 ? -0.945  -21.101 5.689   1.00 2.00   ? 342  TYR A CE2 1 
ATOM   2779 C  CZ  . TYR A 1 342 ? 0.089   -20.189 5.659   1.00 18.83  ? 342  TYR A CZ  1 
ATOM   2780 O  OH  . TYR A 1 342 ? 0.509   -19.726 4.432   1.00 25.14  ? 342  TYR A OH  1 
ATOM   2781 N  N   . GLN A 1 343 ? -0.388  -24.938 8.590   1.00 22.57  ? 343  GLN A N   1 
ATOM   2782 C  CA  . GLN A 1 343 ? -0.141  -25.895 7.513   1.00 30.59  ? 343  GLN A CA  1 
ATOM   2783 C  C   . GLN A 1 343 ? -1.225  -25.655 6.472   1.00 38.32  ? 343  GLN A C   1 
ATOM   2784 O  O   . GLN A 1 343 ? -0.975  -25.659 5.262   1.00 37.17  ? 343  GLN A O   1 
ATOM   2785 C  CB  . GLN A 1 343 ? -0.195  -27.333 8.033   1.00 19.29  ? 343  GLN A CB  1 
ATOM   2786 C  CG  . GLN A 1 343 ? 0.641   -27.555 9.283   1.00 26.84  ? 343  GLN A CG  1 
ATOM   2787 C  CD  . GLN A 1 343 ? 0.814   -29.024 9.639   1.00 29.86  ? 343  GLN A CD  1 
ATOM   2788 O  OE1 . GLN A 1 343 ? 0.495   -29.454 10.766  1.00 5.68   ? 343  GLN A OE1 1 
ATOM   2789 N  NE2 . GLN A 1 343 ? 1.365   -29.795 8.704   1.00 26.09  ? 343  GLN A NE2 1 
ATOM   2790 N  N   . GLU A 1 344 ? -2.428  -25.393 6.972   1.00 50.46  ? 344  GLU A N   1 
ATOM   2791 C  CA  . GLU A 1 344 ? -3.579  -25.131 6.128   1.00 53.12  ? 344  GLU A CA  1 
ATOM   2792 C  C   . GLU A 1 344 ? -4.039  -23.738 6.508   1.00 43.17  ? 344  GLU A C   1 
ATOM   2793 O  O   . GLU A 1 344 ? -4.172  -23.424 7.699   1.00 36.25  ? 344  GLU A O   1 
ATOM   2794 C  CB  . GLU A 1 344 ? -4.687  -26.142 6.410   1.00 73.24  ? 344  GLU A CB  1 
ATOM   2795 C  CG  . GLU A 1 344 ? -5.468  -26.545 5.170   1.00 100.86 ? 344  GLU A CG  1 
ATOM   2796 C  CD  . GLU A 1 344 ? -6.797  -27.190 5.509   1.00 119.93 ? 344  GLU A CD  1 
ATOM   2797 O  OE1 . GLU A 1 344 ? -6.837  -28.415 5.758   1.00 120.73 ? 344  GLU A OE1 1 
ATOM   2798 O  OE2 . GLU A 1 344 ? -7.810  -26.461 5.532   1.00 135.09 ? 344  GLU A OE2 1 
ATOM   2799 N  N   . PRO A 1 345 ? -4.269  -22.878 5.500   1.00 41.28  ? 345  PRO A N   1 
ATOM   2800 C  CA  . PRO A 1 345 ? -4.713  -21.487 5.683   1.00 40.99  ? 345  PRO A CA  1 
ATOM   2801 C  C   . PRO A 1 345 ? -5.659  -21.237 6.860   1.00 37.99  ? 345  PRO A C   1 
ATOM   2802 O  O   . PRO A 1 345 ? -6.542  -22.041 7.145   1.00 34.10  ? 345  PRO A O   1 
ATOM   2803 C  CB  . PRO A 1 345 ? -5.335  -21.158 4.331   1.00 33.38  ? 345  PRO A CB  1 
ATOM   2804 C  CG  . PRO A 1 345 ? -4.383  -21.867 3.381   1.00 25.71  ? 345  PRO A CG  1 
ATOM   2805 C  CD  . PRO A 1 345 ? -4.157  -23.216 4.065   1.00 26.12  ? 345  PRO A CD  1 
ATOM   2806 N  N   . PHE A 1 346 ? -5.385  -20.163 7.593   1.00 44.64  ? 346  PHE A N   1 
ATOM   2807 C  CA  . PHE A 1 346 ? -6.178  -19.754 8.757   1.00 57.81  ? 346  PHE A CA  1 
ATOM   2808 C  C   . PHE A 1 346 ? -6.264  -20.712 9.940   1.00 55.82  ? 346  PHE A C   1 
ATOM   2809 O  O   . PHE A 1 346 ? -6.916  -20.417 10.947  1.00 52.78  ? 346  PHE A O   1 
ATOM   2810 C  CB  . PHE A 1 346 ? -7.576  -19.305 8.341   1.00 70.70  ? 346  PHE A CB  1 
ATOM   2811 C  CG  . PHE A 1 346 ? -7.697  -17.828 8.178   1.00 90.61  ? 346  PHE A CG  1 
ATOM   2812 C  CD1 . PHE A 1 346 ? -7.517  -16.986 9.273   1.00 98.30  ? 346  PHE A CD1 1 
ATOM   2813 C  CD2 . PHE A 1 346 ? -7.972  -17.271 6.935   1.00 103.45 ? 346  PHE A CD2 1 
ATOM   2814 C  CE1 . PHE A 1 346 ? -7.610  -15.606 9.133   1.00 113.24 ? 346  PHE A CE1 1 
ATOM   2815 C  CE2 . PHE A 1 346 ? -8.068  -15.889 6.781   1.00 115.27 ? 346  PHE A CE2 1 
ATOM   2816 C  CZ  . PHE A 1 346 ? -7.887  -15.054 7.883   1.00 118.55 ? 346  PHE A CZ  1 
ATOM   2817 N  N   . LYS A 1 347 ? -5.604  -21.852 9.827   1.00 55.52  ? 347  LYS A N   1 
ATOM   2818 C  CA  . LYS A 1 347 ? -5.600  -22.817 10.905  1.00 57.38  ? 347  LYS A CA  1 
ATOM   2819 C  C   . LYS A 1 347 ? -4.180  -22.826 11.435  1.00 49.25  ? 347  LYS A C   1 
ATOM   2820 O  O   . LYS A 1 347 ? -3.312  -23.531 10.922  1.00 48.01  ? 347  LYS A O   1 
ATOM   2821 C  CB  . LYS A 1 347 ? -6.049  -24.177 10.378  1.00 67.70  ? 347  LYS A CB  1 
ATOM   2822 C  CG  . LYS A 1 347 ? -7.537  -24.188 10.070  1.00 76.67  ? 347  LYS A CG  1 
ATOM   2823 C  CD  . LYS A 1 347 ? -7.994  -25.484 9.436   1.00 93.94  ? 347  LYS A CD  1 
ATOM   2824 C  CE  . LYS A 1 347 ? -9.523  -25.566 9.384   1.00 97.74  ? 347  LYS A CE  1 
ATOM   2825 N  NZ  . LYS A 1 347 ? -10.128 -25.671 10.748  1.00 101.52 ? 347  LYS A NZ  1 
ATOM   2826 N  N   . ASN A 1 348 ? -3.950  -22.000 12.450  1.00 46.17  ? 348  ASN A N   1 
ATOM   2827 C  CA  . ASN A 1 348 ? -2.620  -21.846 13.032  1.00 43.41  ? 348  ASN A CA  1 
ATOM   2828 C  C   . ASN A 1 348 ? -2.248  -22.767 14.167  1.00 33.57  ? 348  ASN A C   1 
ATOM   2829 O  O   . ASN A 1 348 ? -3.042  -23.017 15.084  1.00 27.39  ? 348  ASN A O   1 
ATOM   2830 C  CB  . ASN A 1 348 ? -2.407  -20.412 13.517  1.00 49.73  ? 348  ASN A CB  1 
ATOM   2831 C  CG  . ASN A 1 348 ? -2.700  -19.383 12.451  1.00 56.69  ? 348  ASN A CG  1 
ATOM   2832 O  OD1 . ASN A 1 348 ? -2.292  -19.519 11.290  1.00 42.10  ? 348  ASN A OD1 1 
ATOM   2833 N  ND2 . ASN A 1 348 ? -3.423  -18.339 12.840  1.00 66.26  ? 348  ASN A ND2 1 
ATOM   2834 N  N   . LEU A 1 349 ? -1.003  -23.222 14.113  1.00 28.79  ? 349  LEU A N   1 
ATOM   2835 C  CA  . LEU A 1 349 ? -0.437  -24.078 15.148  1.00 35.38  ? 349  LEU A CA  1 
ATOM   2836 C  C   . LEU A 1 349 ? 0.122   -23.128 16.203  1.00 32.30  ? 349  LEU A C   1 
ATOM   2837 O  O   . LEU A 1 349 ? -0.156  -23.249 17.403  1.00 28.83  ? 349  LEU A O   1 
ATOM   2838 C  CB  . LEU A 1 349 ? 0.724   -24.926 14.607  1.00 36.38  ? 349  LEU A CB  1 
ATOM   2839 C  CG  . LEU A 1 349 ? 0.538   -25.939 13.476  1.00 37.78  ? 349  LEU A CG  1 
ATOM   2840 C  CD1 . LEU A 1 349 ? 1.049   -25.402 12.146  1.00 34.04  ? 349  LEU A CD1 1 
ATOM   2841 C  CD2 . LEU A 1 349 ? 1.318   -27.165 13.837  1.00 43.11  ? 349  LEU A CD2 1 
ATOM   2842 N  N   . LYS A 1 350 ? 0.909   -22.166 15.736  1.00 31.11  ? 350  LYS A N   1 
ATOM   2843 C  CA  . LYS A 1 350 ? 1.518   -21.190 16.621  1.00 29.52  ? 350  LYS A CA  1 
ATOM   2844 C  C   . LYS A 1 350 ? 1.644   -19.883 15.868  1.00 21.37  ? 350  LYS A C   1 
ATOM   2845 O  O   . LYS A 1 350 ? 1.638   -19.873 14.641  1.00 2.00   ? 350  LYS A O   1 
ATOM   2846 C  CB  . LYS A 1 350 ? 2.909   -21.662 17.071  1.00 35.97  ? 350  LYS A CB  1 
ATOM   2847 C  CG  . LYS A 1 350 ? 3.572   -20.802 18.156  1.00 41.12  ? 350  LYS A CG  1 
ATOM   2848 C  CD  . LYS A 1 350 ? 5.024   -21.209 18.404  1.00 35.22  ? 350  LYS A CD  1 
ATOM   2849 C  CE  . LYS A 1 350 ? 5.749   -20.206 19.308  1.00 46.83  ? 350  LYS A CE  1 
ATOM   2850 N  NZ  . LYS A 1 350 ? 5.119   -20.044 20.647  1.00 40.00  ? 350  LYS A NZ  1 
ATOM   2851 N  N   . THR A 1 351 ? 1.670   -18.795 16.638  1.00 28.89  ? 351  THR A N   1 
ATOM   2852 C  CA  . THR A 1 351 ? 1.827   -17.422 16.163  1.00 27.16  ? 351  THR A CA  1 
ATOM   2853 C  C   . THR A 1 351 ? 2.707   -16.767 17.220  1.00 26.66  ? 351  THR A C   1 
ATOM   2854 O  O   . THR A 1 351 ? 3.068   -17.406 18.217  1.00 28.59  ? 351  THR A O   1 
ATOM   2855 C  CB  . THR A 1 351 ? 0.486   -16.650 16.127  1.00 33.64  ? 351  THR A CB  1 
ATOM   2856 O  OG1 . THR A 1 351 ? -0.185  -16.763 17.395  1.00 39.56  ? 351  THR A OG1 1 
ATOM   2857 C  CG2 . THR A 1 351 ? -0.408  -17.166 15.013  1.00 34.93  ? 351  THR A CG2 1 
ATOM   2858 N  N   . GLY A 1 352 ? 3.027   -15.495 17.024  1.00 30.28  ? 352  GLY A N   1 
ATOM   2859 C  CA  . GLY A 1 352 ? 3.854   -14.790 17.985  1.00 27.75  ? 352  GLY A CA  1 
ATOM   2860 C  C   . GLY A 1 352 ? 4.542   -13.610 17.340  1.00 25.38  ? 352  GLY A C   1 
ATOM   2861 O  O   . GLY A 1 352 ? 4.587   -13.496 16.100  1.00 2.00   ? 352  GLY A O   1 
ATOM   2862 N  N   . LYS A 1 353 ? 5.078   -12.722 18.168  1.00 31.80  ? 353  LYS A N   1 
ATOM   2863 C  CA  . LYS A 1 353 ? 5.768   -11.555 17.641  1.00 38.53  ? 353  LYS A CA  1 
ATOM   2864 C  C   . LYS A 1 353 ? 7.017   -11.362 18.475  1.00 33.18  ? 353  LYS A C   1 
ATOM   2865 O  O   . LYS A 1 353 ? 7.052   -11.780 19.636  1.00 10.63  ? 353  LYS A O   1 
ATOM   2866 C  CB  . LYS A 1 353 ? 4.882   -10.304 17.696  1.00 45.26  ? 353  LYS A CB  1 
ATOM   2867 C  CG  . LYS A 1 353 ? 4.707   -9.733  19.097  1.00 59.31  ? 353  LYS A CG  1 
ATOM   2868 C  CD  . LYS A 1 353 ? 3.988   -8.394  19.078  1.00 61.19  ? 353  LYS A CD  1 
ATOM   2869 C  CE  . LYS A 1 353 ? 4.058   -7.720  20.444  1.00 63.30  ? 353  LYS A CE  1 
ATOM   2870 N  NZ  . LYS A 1 353 ? 3.275   -6.452  20.505  1.00 66.87  ? 353  LYS A NZ  1 
ATOM   2871 N  N   . TYR A 1 354 ? 8.047   -10.792 17.847  1.00 43.34  ? 354  TYR A N   1 
ATOM   2872 C  CA  . TYR A 1 354 ? 9.331   -10.525 18.485  1.00 52.74  ? 354  TYR A CA  1 
ATOM   2873 C  C   . TYR A 1 354 ? 9.459   -9.024  18.741  1.00 66.13  ? 354  TYR A C   1 
ATOM   2874 O  O   . TYR A 1 354 ? 9.242   -8.206  17.834  1.00 67.57  ? 354  TYR A O   1 
ATOM   2875 C  CB  . TYR A 1 354 ? 10.481  -11.018 17.603  1.00 45.51  ? 354  TYR A CB  1 
ATOM   2876 C  CG  . TYR A 1 354 ? 10.474  -12.512 17.333  1.00 38.90  ? 354  TYR A CG  1 
ATOM   2877 C  CD1 . TYR A 1 354 ? 10.245  -13.432 18.362  1.00 36.34  ? 354  TYR A CD1 1 
ATOM   2878 C  CD2 . TYR A 1 354 ? 10.718  -13.008 16.048  1.00 33.66  ? 354  TYR A CD2 1 
ATOM   2879 C  CE1 . TYR A 1 354 ? 10.260  -14.809 18.115  1.00 32.53  ? 354  TYR A CE1 1 
ATOM   2880 C  CE2 . TYR A 1 354 ? 10.738  -14.381 15.789  1.00 18.64  ? 354  TYR A CE2 1 
ATOM   2881 C  CZ  . TYR A 1 354 ? 10.510  -15.277 16.825  1.00 23.57  ? 354  TYR A CZ  1 
ATOM   2882 O  OH  . TYR A 1 354 ? 10.546  -16.636 16.571  1.00 20.97  ? 354  TYR A OH  1 
ATOM   2883 N  N   . ALA A 1 355 ? 9.820   -8.686  19.978  1.00 73.18  ? 355  ALA A N   1 
ATOM   2884 C  CA  . ALA A 1 355 ? 9.957   -7.306  20.435  1.00 84.31  ? 355  ALA A CA  1 
ATOM   2885 C  C   . ALA A 1 355 ? 10.907  -6.410  19.645  1.00 92.73  ? 355  ALA A C   1 
ATOM   2886 O  O   . ALA A 1 355 ? 11.832  -6.886  18.988  1.00 93.37  ? 355  ALA A O   1 
ATOM   2887 C  CB  . ALA A 1 355 ? 10.338  -7.292  21.918  1.00 85.70  ? 355  ALA A CB  1 
ATOM   2888 N  N   . ARG A 1 356 ? 10.655  -5.105  19.726  1.00 102.87 ? 356  ARG A N   1 
ATOM   2889 C  CA  . ARG A 1 356 ? 11.471  -4.087  19.067  1.00 113.80 ? 356  ARG A CA  1 
ATOM   2890 C  C   . ARG A 1 356 ? 12.891  -4.201  19.629  1.00 121.00 ? 356  ARG A C   1 
ATOM   2891 O  O   . ARG A 1 356 ? 13.188  -3.667  20.701  1.00 126.61 ? 356  ARG A O   1 
ATOM   2892 C  CB  . ARG A 1 356 ? 10.877  -2.690  19.353  1.00 115.60 ? 356  ARG A CB  1 
ATOM   2893 C  CG  . ARG A 1 356 ? 11.798  -1.488  19.093  1.00 115.35 ? 356  ARG A CG  1 
ATOM   2894 C  CD  . ARG A 1 356 ? 11.942  -1.153  17.618  1.00 113.08 ? 356  ARG A CD  1 
ATOM   2895 N  NE  . ARG A 1 356 ? 13.085  -0.274  17.371  1.00 111.22 ? 356  ARG A NE  1 
ATOM   2896 C  CZ  . ARG A 1 356 ? 14.285  -0.702  16.985  1.00 112.32 ? 356  ARG A CZ  1 
ATOM   2897 N  NH1 . ARG A 1 356 ? 14.502  -1.996  16.799  1.00 115.36 ? 356  ARG A NH1 1 
ATOM   2898 N  NH2 . ARG A 1 356 ? 15.278  0.159   16.802  1.00 113.36 ? 356  ARG A NH2 1 
ATOM   2899 N  N   . MET A 1 357 ? 13.747  -4.952  18.943  1.00 123.49 ? 357  MET A N   1 
ATOM   2900 C  CA  . MET A 1 357 ? 15.123  -5.126  19.393  1.00 128.94 ? 357  MET A CA  1 
ATOM   2901 C  C   . MET A 1 357 ? 15.914  -3.830  19.218  1.00 130.69 ? 357  MET A C   1 
ATOM   2902 O  O   . MET A 1 357 ? 16.450  -3.568  18.139  1.00 132.60 ? 357  MET A O   1 
ATOM   2903 C  CB  . MET A 1 357 ? 15.806  -6.255  18.617  1.00 135.15 ? 357  MET A CB  1 
ATOM   2904 C  CG  . MET A 1 357 ? 17.209  -6.587  19.126  1.00 148.34 ? 357  MET A CG  1 
ATOM   2905 S  SD  . MET A 1 357 ? 18.334  -7.182  17.834  1.00 160.96 ? 357  MET A SD  1 
ATOM   2906 C  CE  . MET A 1 357 ? 17.936  -8.928  17.786  1.00 161.84 ? 357  MET A CE  1 
ATOM   2907 N  N   . ARG A 1 358 ? 15.949  -3.004  20.262  1.00 129.97 ? 358  ARG A N   1 
ATOM   2908 C  CA  . ARG A 1 358 ? 16.681  -1.737  20.225  1.00 126.69 ? 358  ARG A CA  1 
ATOM   2909 C  C   . ARG A 1 358 ? 18.197  -1.962  20.290  1.00 121.99 ? 358  ARG A C   1 
ATOM   2910 O  O   . ARG A 1 358 ? 18.794  -1.977  21.372  1.00 123.18 ? 358  ARG A O   1 
ATOM   2911 C  CB  . ARG A 1 358 ? 16.220  -0.815  21.364  1.00 129.75 ? 358  ARG A CB  1 
ATOM   2912 C  CG  . ARG A 1 358 ? 15.045  0.090   21.004  1.00 135.48 ? 358  ARG A CG  1 
ATOM   2913 C  CD  . ARG A 1 358 ? 14.659  0.991   22.174  1.00 147.10 ? 358  ARG A CD  1 
ATOM   2914 N  NE  . ARG A 1 358 ? 13.833  2.133   21.768  1.00 157.11 ? 358  ARG A NE  1 
ATOM   2915 C  CZ  . ARG A 1 358 ? 14.279  3.384   21.642  1.00 156.09 ? 358  ARG A CZ  1 
ATOM   2916 N  NH1 . ARG A 1 358 ? 15.553  3.670   21.887  1.00 154.49 ? 358  ARG A NH1 1 
ATOM   2917 N  NH2 . ARG A 1 358 ? 13.449  4.356   21.278  1.00 151.03 ? 358  ARG A NH2 1 
ATOM   2918 N  N   . GLY A 1 359 ? 18.802  -2.168  19.124  1.00 113.71 ? 359  GLY A N   1 
ATOM   2919 C  CA  . GLY A 1 359 ? 20.232  -2.404  19.047  1.00 100.24 ? 359  GLY A CA  1 
ATOM   2920 C  C   . GLY A 1 359 ? 21.048  -1.166  18.741  1.00 87.33  ? 359  GLY A C   1 
ATOM   2921 O  O   . GLY A 1 359 ? 20.518  -0.062  18.667  1.00 87.13  ? 359  GLY A O   1 
ATOM   2922 N  N   . ALA A 1 360 ? 22.348  -1.361  18.551  1.00 78.26  ? 360  ALA A N   1 
ATOM   2923 C  CA  . ALA A 1 360 ? 23.262  -0.264  18.253  1.00 73.95  ? 360  ALA A CA  1 
ATOM   2924 C  C   . ALA A 1 360 ? 23.183  0.259   16.816  1.00 65.51  ? 360  ALA A C   1 
ATOM   2925 O  O   . ALA A 1 360 ? 23.371  1.453   16.593  1.00 63.77  ? 360  ALA A O   1 
ATOM   2926 C  CB  . ALA A 1 360 ? 24.705  -0.659  18.602  1.00 77.61  ? 360  ALA A CB  1 
ATOM   2927 N  N   . HIS A 1 361 ? 22.966  -0.634  15.849  1.00 58.33  ? 361  HIS A N   1 
ATOM   2928 C  CA  . HIS A 1 361 ? 22.864  -0.262  14.427  1.00 55.90  ? 361  HIS A CA  1 
ATOM   2929 C  C   . HIS A 1 361 ? 22.745  -1.444  13.464  1.00 47.63  ? 361  HIS A C   1 
ATOM   2930 O  O   . HIS A 1 361 ? 23.651  -2.265  13.349  1.00 45.03  ? 361  HIS A O   1 
ATOM   2931 C  CB  . HIS A 1 361 ? 24.019  0.659   13.975  1.00 61.21  ? 361  HIS A CB  1 
ATOM   2932 C  CG  . HIS A 1 361 ? 25.389  0.098   14.215  1.00 67.55  ? 361  HIS A CG  1 
ATOM   2933 N  ND1 . HIS A 1 361 ? 26.358  0.065   13.233  1.00 70.51  ? 361  HIS A ND1 1 
ATOM   2934 C  CD2 . HIS A 1 361 ? 25.967  -0.415  15.329  1.00 62.22  ? 361  HIS A CD2 1 
ATOM   2935 C  CE1 . HIS A 1 361 ? 27.472  -0.443  13.733  1.00 68.49  ? 361  HIS A CE1 1 
ATOM   2936 N  NE2 . HIS A 1 361 ? 27.261  -0.741  15.003  1.00 58.14  ? 361  HIS A NE2 1 
ATOM   2937 N  N   . THR A 1 362 ? 21.642  -1.486  12.733  1.00 45.97  ? 362  THR A N   1 
ATOM   2938 C  CA  . THR A 1 362 ? 21.373  -2.557  11.781  1.00 38.60  ? 362  THR A CA  1 
ATOM   2939 C  C   . THR A 1 362 ? 20.544  -1.996  10.636  1.00 24.03  ? 362  THR A C   1 
ATOM   2940 O  O   . THR A 1 362 ? 20.561  -0.800  10.363  1.00 5.14   ? 362  THR A O   1 
ATOM   2941 C  CB  . THR A 1 362 ? 20.533  -3.699  12.440  1.00 44.16  ? 362  THR A CB  1 
ATOM   2942 O  OG1 . THR A 1 362 ? 19.719  -3.156  13.490  1.00 30.07  ? 362  THR A OG1 1 
ATOM   2943 C  CG2 . THR A 1 362 ? 21.416  -4.817  12.973  1.00 53.55  ? 362  THR A CG2 1 
ATOM   2944 N  N   . ASN A 1 363 ? 19.755  -2.879  10.038  1.00 24.53  ? 363  ASN A N   1 
ATOM   2945 C  CA  . ASN A 1 363 ? 18.872  -2.568  8.935   1.00 12.67  ? 363  ASN A CA  1 
ATOM   2946 C  C   . ASN A 1 363 ? 17.713  -3.572  9.007   1.00 10.79  ? 363  ASN A C   1 
ATOM   2947 O  O   . ASN A 1 363 ? 17.728  -4.528  9.818   1.00 2.00   ? 363  ASN A O   1 
ATOM   2948 C  CB  . ASN A 1 363 ? 19.619  -2.668  7.592   1.00 11.69  ? 363  ASN A CB  1 
ATOM   2949 C  CG  . ASN A 1 363 ? 19.993  -4.110  7.216   1.00 32.99  ? 363  ASN A CG  1 
ATOM   2950 O  OD1 . ASN A 1 363 ? 19.164  -4.869  6.685   1.00 24.44  ? 363  ASN A OD1 1 
ATOM   2951 N  ND2 . ASN A 1 363 ? 21.244  -4.488  7.483   1.00 29.17  ? 363  ASN A ND2 1 
ATOM   2952 N  N   . ASP A 1 364 ? 16.730  -3.370  8.138   1.00 15.82  ? 364  ASP A N   1 
ATOM   2953 C  CA  . ASP A 1 364 ? 15.543  -4.219  8.089   1.00 23.01  ? 364  ASP A CA  1 
ATOM   2954 C  C   . ASP A 1 364 ? 15.828  -5.642  7.677   1.00 12.96  ? 364  ASP A C   1 
ATOM   2955 O  O   . ASP A 1 364 ? 15.472  -6.590  8.377   1.00 8.88   ? 364  ASP A O   1 
ATOM   2956 C  CB  . ASP A 1 364 ? 14.520  -3.645  7.103   1.00 36.61  ? 364  ASP A CB  1 
ATOM   2957 C  CG  . ASP A 1 364 ? 13.768  -2.452  7.654   1.00 40.30  ? 364  ASP A CG  1 
ATOM   2958 O  OD1 . ASP A 1 364 ? 13.924  -2.113  8.856   1.00 37.54  ? 364  ASP A OD1 1 
ATOM   2959 O  OD2 . ASP A 1 364 ? 12.995  -1.869  6.865   1.00 45.62  ? 364  ASP A OD2 1 
ATOM   2960 N  N   . VAL A 1 365 ? 16.472  -5.770  6.526   1.00 6.51   ? 365  VAL A N   1 
ATOM   2961 C  CA  . VAL A 1 365 ? 16.788  -7.062  5.951   1.00 5.34   ? 365  VAL A CA  1 
ATOM   2962 C  C   . VAL A 1 365 ? 17.505  -7.933  6.972   1.00 2.00   ? 365  VAL A C   1 
ATOM   2963 O  O   . VAL A 1 365 ? 17.169  -9.096  7.160   1.00 2.00   ? 365  VAL A O   1 
ATOM   2964 C  CB  . VAL A 1 365 ? 17.602  -6.893  4.647   1.00 2.00   ? 365  VAL A CB  1 
ATOM   2965 C  CG1 . VAL A 1 365 ? 17.465  -8.117  3.786   1.00 2.00   ? 365  VAL A CG1 1 
ATOM   2966 C  CG2 . VAL A 1 365 ? 17.092  -5.685  3.865   1.00 2.00   ? 365  VAL A CG2 1 
ATOM   2967 N  N   . LYS A 1 366 ? 18.438  -7.336  7.690   1.00 6.41   ? 366  LYS A N   1 
ATOM   2968 C  CA  . LYS A 1 366 ? 19.156  -8.065  8.707   1.00 21.20  ? 366  LYS A CA  1 
ATOM   2969 C  C   . LYS A 1 366 ? 18.137  -8.492  9.752   1.00 24.58  ? 366  LYS A C   1 
ATOM   2970 O  O   . LYS A 1 366 ? 18.063  -9.673  10.129  1.00 30.39  ? 366  LYS A O   1 
ATOM   2971 C  CB  . LYS A 1 366 ? 20.230  -7.173  9.345   1.00 42.61  ? 366  LYS A CB  1 
ATOM   2972 C  CG  . LYS A 1 366 ? 21.007  -7.834  10.498  1.00 60.24  ? 366  LYS A CG  1 
ATOM   2973 C  CD  . LYS A 1 366 ? 21.609  -9.194  10.100  1.00 66.08  ? 366  LYS A CD  1 
ATOM   2974 C  CE  . LYS A 1 366 ? 22.216  -9.924  11.308  1.00 67.83  ? 366  LYS A CE  1 
ATOM   2975 N  NZ  . LYS A 1 366 ? 22.783  -11.278 10.989  1.00 59.59  ? 366  LYS A NZ  1 
ATOM   2976 N  N   . GLN A 1 367 ? 17.325  -7.531  10.184  1.00 16.02  ? 367  GLN A N   1 
ATOM   2977 C  CA  . GLN A 1 367 ? 16.317  -7.780  11.189  1.00 11.92  ? 367  GLN A CA  1 
ATOM   2978 C  C   . GLN A 1 367 ? 15.325  -8.873  10.802  1.00 19.69  ? 367  GLN A C   1 
ATOM   2979 O  O   . GLN A 1 367 ? 14.927  -9.701  11.633  1.00 22.67  ? 367  GLN A O   1 
ATOM   2980 C  CB  . GLN A 1 367 ? 15.607  -6.484  11.511  1.00 17.03  ? 367  GLN A CB  1 
ATOM   2981 C  CG  . GLN A 1 367 ? 16.194  -5.800  12.718  1.00 41.76  ? 367  GLN A CG  1 
ATOM   2982 C  CD  . GLN A 1 367 ? 15.146  -5.045  13.500  1.00 58.67  ? 367  GLN A CD  1 
ATOM   2983 O  OE1 . GLN A 1 367 ? 14.168  -4.553  12.927  1.00 71.61  ? 367  GLN A OE1 1 
ATOM   2984 N  NE2 . GLN A 1 367 ? 15.322  -4.967  14.820  1.00 59.86  ? 367  GLN A NE2 1 
ATOM   2985 N  N   . LEU A 1 368 ? 14.968  -8.896  9.525   1.00 16.97  ? 368  LEU A N   1 
ATOM   2986 C  CA  . LEU A 1 368 ? 14.046  -9.883  8.980   1.00 18.12  ? 368  LEU A CA  1 
ATOM   2987 C  C   . LEU A 1 368 ? 14.743  -11.221 9.145   1.00 14.60  ? 368  LEU A C   1 
ATOM   2988 O  O   . LEU A 1 368 ? 14.164  -12.206 9.599   1.00 22.94  ? 368  LEU A O   1 
ATOM   2989 C  CB  . LEU A 1 368 ? 13.853  -9.611  7.487   1.00 31.39  ? 368  LEU A CB  1 
ATOM   2990 C  CG  . LEU A 1 368 ? 12.614  -10.064 6.710   1.00 23.56  ? 368  LEU A CG  1 
ATOM   2991 C  CD1 . LEU A 1 368 ? 13.029  -10.225 5.270   1.00 29.97  ? 368  LEU A CD1 1 
ATOM   2992 C  CD2 . LEU A 1 368 ? 12.058  -11.364 7.232   1.00 10.98  ? 368  LEU A CD2 1 
ATOM   2993 N  N   . THR A 1 369 ? 16.011  -11.225 8.772   1.00 9.30   ? 369  THR A N   1 
ATOM   2994 C  CA  . THR A 1 369 ? 16.854  -12.389 8.855   1.00 6.65   ? 369  THR A CA  1 
ATOM   2995 C  C   . THR A 1 369 ? 16.845  -12.957 10.264  1.00 3.37   ? 369  THR A C   1 
ATOM   2996 O  O   . THR A 1 369 ? 16.516  -14.133 10.470  1.00 2.00   ? 369  THR A O   1 
ATOM   2997 C  CB  . THR A 1 369 ? 18.281  -12.011 8.412   1.00 5.09   ? 369  THR A CB  1 
ATOM   2998 O  OG1 . THR A 1 369 ? 18.360  -12.068 6.981   1.00 2.00   ? 369  THR A OG1 1 
ATOM   2999 C  CG2 . THR A 1 369 ? 19.313  -12.925 9.033   1.00 23.83  ? 369  THR A CG2 1 
ATOM   3000 N  N   . GLU A 1 370 ? 17.145  -12.105 11.235  1.00 2.00   ? 370  GLU A N   1 
ATOM   3001 C  CA  . GLU A 1 370 ? 17.183  -12.526 12.627  1.00 12.73  ? 370  GLU A CA  1 
ATOM   3002 C  C   . GLU A 1 370 ? 15.846  -13.049 13.141  1.00 8.95   ? 370  GLU A C   1 
ATOM   3003 O  O   . GLU A 1 370 ? 15.790  -13.900 14.035  1.00 10.98  ? 370  GLU A O   1 
ATOM   3004 C  CB  . GLU A 1 370 ? 17.683  -11.388 13.497  1.00 28.20  ? 370  GLU A CB  1 
ATOM   3005 C  CG  . GLU A 1 370 ? 19.102  -10.997 13.179  1.00 40.63  ? 370  GLU A CG  1 
ATOM   3006 C  CD  . GLU A 1 370 ? 19.517  -9.748  13.905  1.00 59.26  ? 370  GLU A CD  1 
ATOM   3007 O  OE1 . GLU A 1 370 ? 19.943  -9.858  15.075  1.00 71.01  ? 370  GLU A OE1 1 
ATOM   3008 O  OE2 . GLU A 1 370 ? 19.400  -8.653  13.309  1.00 62.80  ? 370  GLU A OE2 1 
ATOM   3009 N  N   . ALA A 1 371 ? 14.765  -12.508 12.613  1.00 8.06   ? 371  ALA A N   1 
ATOM   3010 C  CA  . ALA A 1 371 ? 13.452  -12.990 12.997  1.00 15.72  ? 371  ALA A CA  1 
ATOM   3011 C  C   . ALA A 1 371 ? 13.358  -14.425 12.448  1.00 15.97  ? 371  ALA A C   1 
ATOM   3012 O  O   . ALA A 1 371 ? 13.114  -15.383 13.201  1.00 10.70  ? 371  ALA A O   1 
ATOM   3013 C  CB  . ALA A 1 371 ? 12.375  -12.103 12.376  1.00 16.44  ? 371  ALA A CB  1 
ATOM   3014 N  N   . VAL A 1 372 ? 13.662  -14.556 11.152  1.00 11.70  ? 372  VAL A N   1 
ATOM   3015 C  CA  . VAL A 1 372 ? 13.632  -15.828 10.435  1.00 16.88  ? 372  VAL A CA  1 
ATOM   3016 C  C   . VAL A 1 372 ? 14.382  -16.927 11.172  1.00 19.88  ? 372  VAL A C   1 
ATOM   3017 O  O   . VAL A 1 372 ? 13.898  -18.056 11.284  1.00 24.06  ? 372  VAL A O   1 
ATOM   3018 C  CB  . VAL A 1 372 ? 14.233  -15.685 9.005   1.00 16.98  ? 372  VAL A CB  1 
ATOM   3019 C  CG1 . VAL A 1 372 ? 14.544  -17.066 8.395   1.00 2.00   ? 372  VAL A CG1 1 
ATOM   3020 C  CG2 . VAL A 1 372 ? 13.269  -14.924 8.104   1.00 3.14   ? 372  VAL A CG2 1 
ATOM   3021 N  N   . GLN A 1 373 ? 15.562  -16.589 11.672  1.00 20.37  ? 373  GLN A N   1 
ATOM   3022 C  CA  . GLN A 1 373 ? 16.373  -17.555 12.378  1.00 21.98  ? 373  GLN A CA  1 
ATOM   3023 C  C   . GLN A 1 373 ? 15.732  -17.955 13.698  1.00 18.34  ? 373  GLN A C   1 
ATOM   3024 O  O   . GLN A 1 373 ? 15.632  -19.144 14.006  1.00 21.36  ? 373  GLN A O   1 
ATOM   3025 C  CB  . GLN A 1 373 ? 17.802  -17.015 12.569  1.00 32.91  ? 373  GLN A CB  1 
ATOM   3026 C  CG  . GLN A 1 373 ? 18.119  -16.355 13.914  1.00 37.48  ? 373  GLN A CG  1 
ATOM   3027 C  CD  . GLN A 1 373 ? 18.478  -17.367 15.005  1.00 45.63  ? 373  GLN A CD  1 
ATOM   3028 O  OE1 . GLN A 1 373 ? 18.615  -18.561 14.737  1.00 45.87  ? 373  GLN A OE1 1 
ATOM   3029 N  NE2 . GLN A 1 373 ? 18.630  -16.887 16.237  1.00 41.32  ? 373  GLN A NE2 1 
ATOM   3030 N  N   . LYS A 1 374 ? 15.266  -16.965 14.453  1.00 21.90  ? 374  LYS A N   1 
ATOM   3031 C  CA  . LYS A 1 374 ? 14.653  -17.212 15.758  1.00 25.30  ? 374  LYS A CA  1 
ATOM   3032 C  C   . LYS A 1 374 ? 13.548  -18.229 15.599  1.00 16.34  ? 374  LYS A C   1 
ATOM   3033 O  O   . LYS A 1 374 ? 13.416  -19.173 16.400  1.00 4.90   ? 374  LYS A O   1 
ATOM   3034 C  CB  . LYS A 1 374 ? 14.072  -15.913 16.315  1.00 37.90  ? 374  LYS A CB  1 
ATOM   3035 C  CG  . LYS A 1 374 ? 15.095  -14.944 16.874  1.00 48.58  ? 374  LYS A CG  1 
ATOM   3036 C  CD  . LYS A 1 374 ? 14.726  -14.546 18.302  1.00 63.32  ? 374  LYS A CD  1 
ATOM   3037 C  CE  . LYS A 1 374 ? 14.638  -15.768 19.230  1.00 73.12  ? 374  LYS A CE  1 
ATOM   3038 N  NZ  . LYS A 1 374 ? 14.058  -15.416 20.561  1.00 83.77  ? 374  LYS A NZ  1 
ATOM   3039 N  N   . ILE A 1 375 ? 12.784  -18.001 14.532  1.00 10.95  ? 375  ILE A N   1 
ATOM   3040 C  CA  . ILE A 1 375 ? 11.657  -18.813 14.120  1.00 11.45  ? 375  ILE A CA  1 
ATOM   3041 C  C   . ILE A 1 375 ? 12.163  -20.196 13.762  1.00 6.61   ? 375  ILE A C   1 
ATOM   3042 O  O   . ILE A 1 375 ? 11.732  -21.194 14.344  1.00 7.41   ? 375  ILE A O   1 
ATOM   3043 C  CB  . ILE A 1 375 ? 10.987  -18.163 12.886  1.00 21.25  ? 375  ILE A CB  1 
ATOM   3044 C  CG1 . ILE A 1 375 ? 10.264  -16.888 13.323  1.00 20.22  ? 375  ILE A CG1 1 
ATOM   3045 C  CG2 . ILE A 1 375 ? 10.081  -19.157 12.141  1.00 13.57  ? 375  ILE A CG2 1 
ATOM   3046 C  CD1 . ILE A 1 375 ? 9.720   -16.080 12.187  1.00 24.35  ? 375  ILE A CD1 1 
ATOM   3047 N  N   . THR A 1 376 ? 13.101  -20.239 12.828  1.00 2.00   ? 376  THR A N   1 
ATOM   3048 C  CA  . THR A 1 376 ? 13.686  -21.480 12.397  1.00 2.00   ? 376  THR A CA  1 
ATOM   3049 C  C   . THR A 1 376 ? 14.058  -22.341 13.596  1.00 8.77   ? 376  THR A C   1 
ATOM   3050 O  O   . THR A 1 376 ? 13.594  -23.488 13.703  1.00 6.63   ? 376  THR A O   1 
ATOM   3051 C  CB  . THR A 1 376 ? 14.909  -21.217 11.551  1.00 2.00   ? 376  THR A CB  1 
ATOM   3052 O  OG1 . THR A 1 376 ? 14.493  -20.667 10.294  1.00 2.00   ? 376  THR A OG1 1 
ATOM   3053 C  CG2 . THR A 1 376 ? 15.695  -22.496 11.346  1.00 2.00   ? 376  THR A CG2 1 
ATOM   3054 N  N   . THR A 1 377 ? 14.860  -21.780 14.501  1.00 9.53   ? 377  THR A N   1 
ATOM   3055 C  CA  . THR A 1 377 ? 15.271  -22.481 15.705  1.00 17.62  ? 377  THR A CA  1 
ATOM   3056 C  C   . THR A 1 377 ? 14.059  -23.070 16.412  1.00 24.44  ? 377  THR A C   1 
ATOM   3057 O  O   . THR A 1 377 ? 13.992  -24.291 16.614  1.00 23.32  ? 377  THR A O   1 
ATOM   3058 C  CB  . THR A 1 377 ? 16.028  -21.544 16.666  1.00 28.16  ? 377  THR A CB  1 
ATOM   3059 O  OG1 . THR A 1 377 ? 17.376  -21.404 16.206  1.00 36.56  ? 377  THR A OG1 1 
ATOM   3060 C  CG2 . THR A 1 377 ? 16.029  -22.090 18.114  1.00 21.56  ? 377  THR A CG2 1 
ATOM   3061 N  N   . GLU A 1 378 ? 13.098  -22.210 16.753  1.00 32.46  ? 378  GLU A N   1 
ATOM   3062 C  CA  . GLU A 1 378 ? 11.879  -22.646 17.428  1.00 37.32  ? 378  GLU A CA  1 
ATOM   3063 C  C   . GLU A 1 378 ? 11.297  -23.862 16.705  1.00 34.74  ? 378  GLU A C   1 
ATOM   3064 O  O   . GLU A 1 378 ? 11.068  -24.909 17.317  1.00 25.87  ? 378  GLU A O   1 
ATOM   3065 C  CB  . GLU A 1 378 ? 10.845  -21.520 17.436  1.00 44.85  ? 378  GLU A CB  1 
ATOM   3066 C  CG  . GLU A 1 378 ? 10.753  -20.733 18.740  1.00 59.64  ? 378  GLU A CG  1 
ATOM   3067 C  CD  . GLU A 1 378 ? 9.538   -19.806 18.769  1.00 59.91  ? 378  GLU A CD  1 
ATOM   3068 O  OE1 . GLU A 1 378 ? 9.053   -19.434 17.675  1.00 47.12  ? 378  GLU A OE1 1 
ATOM   3069 O  OE2 . GLU A 1 378 ? 9.060   -19.464 19.879  1.00 57.31  ? 378  GLU A OE2 1 
ATOM   3070 N  N   . SER A 1 379 ? 11.122  -23.728 15.392  1.00 34.76  ? 379  SER A N   1 
ATOM   3071 C  CA  . SER A 1 379 ? 10.585  -24.790 14.547  1.00 31.70  ? 379  SER A CA  1 
ATOM   3072 C  C   . SER A 1 379 ? 11.303  -26.122 14.755  1.00 23.27  ? 379  SER A C   1 
ATOM   3073 O  O   . SER A 1 379 ? 10.666  -27.121 15.082  1.00 15.21  ? 379  SER A O   1 
ATOM   3074 C  CB  . SER A 1 379 ? 10.697  -24.391 13.074  1.00 33.35  ? 379  SER A CB  1 
ATOM   3075 O  OG  . SER A 1 379 ? 10.158  -23.101 12.845  1.00 23.37  ? 379  SER A OG  1 
ATOM   3076 N  N   . ILE A 1 380 ? 12.623  -26.126 14.584  1.00 14.36  ? 380  ILE A N   1 
ATOM   3077 C  CA  . ILE A 1 380 ? 13.421  -27.339 14.747  1.00 15.53  ? 380  ILE A CA  1 
ATOM   3078 C  C   . ILE A 1 380 ? 13.165  -28.016 16.094  1.00 5.50   ? 380  ILE A C   1 
ATOM   3079 O  O   . ILE A 1 380 ? 13.170  -29.252 16.195  1.00 2.00   ? 380  ILE A O   1 
ATOM   3080 C  CB  . ILE A 1 380 ? 14.938  -27.056 14.594  1.00 26.18  ? 380  ILE A CB  1 
ATOM   3081 C  CG1 . ILE A 1 380 ? 15.177  -26.213 13.344  1.00 25.37  ? 380  ILE A CG1 1 
ATOM   3082 C  CG2 . ILE A 1 380 ? 15.722  -28.384 14.431  1.00 6.37   ? 380  ILE A CG2 1 
ATOM   3083 C  CD1 . ILE A 1 380 ? 14.712  -26.883 12.106  1.00 11.68  ? 380  ILE A CD1 1 
ATOM   3084 N  N   . VAL A 1 381 ? 12.950  -27.211 17.129  1.00 4.01   ? 381  VAL A N   1 
ATOM   3085 C  CA  . VAL A 1 381 ? 12.659  -27.765 18.446  1.00 4.74   ? 381  VAL A CA  1 
ATOM   3086 C  C   . VAL A 1 381 ? 11.237  -28.326 18.481  1.00 8.11   ? 381  VAL A C   1 
ATOM   3087 O  O   . VAL A 1 381 ? 11.025  -29.462 18.909  1.00 2.00   ? 381  VAL A O   1 
ATOM   3088 C  CB  . VAL A 1 381 ? 12.803  -26.715 19.549  1.00 8.07   ? 381  VAL A CB  1 
ATOM   3089 C  CG1 . VAL A 1 381 ? 12.645  -27.367 20.929  1.00 2.00   ? 381  VAL A CG1 1 
ATOM   3090 C  CG2 . VAL A 1 381 ? 14.153  -26.014 19.424  1.00 22.97  ? 381  VAL A CG2 1 
ATOM   3091 N  N   . ILE A 1 382 ? 10.294  -27.560 17.929  1.00 19.75  ? 382  ILE A N   1 
ATOM   3092 C  CA  . ILE A 1 382 ? 8.872   -27.920 17.898  1.00 19.69  ? 382  ILE A CA  1 
ATOM   3093 C  C   . ILE A 1 382 ? 8.502   -29.097 16.997  1.00 13.12  ? 382  ILE A C   1 
ATOM   3094 O  O   . ILE A 1 382 ? 7.790   -30.026 17.422  1.00 12.61  ? 382  ILE A O   1 
ATOM   3095 C  CB  . ILE A 1 382 ? 7.997   -26.697 17.496  1.00 20.23  ? 382  ILE A CB  1 
ATOM   3096 C  CG1 . ILE A 1 382 ? 8.343   -25.480 18.369  1.00 40.79  ? 382  ILE A CG1 1 
ATOM   3097 C  CG2 . ILE A 1 382 ? 6.526   -27.028 17.671  1.00 13.58  ? 382  ILE A CG2 1 
ATOM   3098 C  CD1 . ILE A 1 382 ? 8.265   -25.713 19.902  1.00 34.15  ? 382  ILE A CD1 1 
ATOM   3099 N  N   . TRP A 1 383 ? 8.954   -29.029 15.746  1.00 6.16   ? 383  TRP A N   1 
ATOM   3100 C  CA  . TRP A 1 383 ? 8.666   -30.062 14.751  1.00 9.77   ? 383  TRP A CA  1 
ATOM   3101 C  C   . TRP A 1 383 ? 9.879   -30.737 14.135  1.00 9.90   ? 383  TRP A C   1 
ATOM   3102 O  O   . TRP A 1 383 ? 9.730   -31.676 13.348  1.00 11.98  ? 383  TRP A O   1 
ATOM   3103 C  CB  . TRP A 1 383 ? 7.810   -29.490 13.633  1.00 2.00   ? 383  TRP A CB  1 
ATOM   3104 C  CG  . TRP A 1 383 ? 6.652   -28.743 14.142  1.00 6.12   ? 383  TRP A CG  1 
ATOM   3105 C  CD1 . TRP A 1 383 ? 5.528   -29.261 14.717  1.00 20.43  ? 383  TRP A CD1 1 
ATOM   3106 C  CD2 . TRP A 1 383 ? 6.464   -27.329 14.093  1.00 14.11  ? 383  TRP A CD2 1 
ATOM   3107 N  NE1 . TRP A 1 383 ? 4.640   -28.256 15.011  1.00 15.15  ? 383  TRP A NE1 1 
ATOM   3108 C  CE2 . TRP A 1 383 ? 5.190   -27.058 14.641  1.00 12.56  ? 383  TRP A CE2 1 
ATOM   3109 C  CE3 . TRP A 1 383 ? 7.250   -26.262 13.636  1.00 24.58  ? 383  TRP A CE3 1 
ATOM   3110 C  CZ2 . TRP A 1 383 ? 4.679   -25.764 14.742  1.00 20.53  ? 383  TRP A CZ2 1 
ATOM   3111 C  CZ3 . TRP A 1 383 ? 6.743   -24.975 13.736  1.00 30.34  ? 383  TRP A CZ3 1 
ATOM   3112 C  CH2 . TRP A 1 383 ? 5.467   -24.737 14.285  1.00 28.99  ? 383  TRP A CH2 1 
ATOM   3113 N  N   . GLY A 1 384 ? 11.071  -30.276 14.497  1.00 7.38   ? 384  GLY A N   1 
ATOM   3114 C  CA  . GLY A 1 384 ? 12.276  -30.860 13.942  1.00 11.61  ? 384  GLY A CA  1 
ATOM   3115 C  C   . GLY A 1 384 ? 12.350  -30.615 12.445  1.00 14.50  ? 384  GLY A C   1 
ATOM   3116 O  O   . GLY A 1 384 ? 13.032  -31.340 11.711  1.00 18.91  ? 384  GLY A O   1 
ATOM   3117 N  N   . LYS A 1 385 ? 11.625  -29.601 11.987  1.00 11.89  ? 385  LYS A N   1 
ATOM   3118 C  CA  . LYS A 1 385 ? 11.599  -29.249 10.577  1.00 21.11  ? 385  LYS A CA  1 
ATOM   3119 C  C   . LYS A 1 385 ? 11.554  -27.731 10.518  1.00 20.52  ? 385  LYS A C   1 
ATOM   3120 O  O   . LYS A 1 385 ? 11.091  -27.080 11.471  1.00 21.70  ? 385  LYS A O   1 
ATOM   3121 C  CB  . LYS A 1 385 ? 10.326  -29.784 9.911   1.00 30.11  ? 385  LYS A CB  1 
ATOM   3122 C  CG  . LYS A 1 385 ? 10.241  -31.279 9.661   1.00 43.62  ? 385  LYS A CG  1 
ATOM   3123 C  CD  . LYS A 1 385 ? 8.890   -31.628 8.998   1.00 59.22  ? 385  LYS A CD  1 
ATOM   3124 C  CE  . LYS A 1 385 ? 8.665   -30.856 7.683   1.00 66.53  ? 385  LYS A CE  1 
ATOM   3125 N  NZ  . LYS A 1 385 ? 7.272   -30.976 7.126   1.00 70.59  ? 385  LYS A NZ  1 
ATOM   3126 N  N   . THR A 1 386 ? 12.075  -27.154 9.443   1.00 10.32  ? 386  THR A N   1 
ATOM   3127 C  CA  . THR A 1 386 ? 11.990  -25.710 9.324   1.00 12.30  ? 386  THR A CA  1 
ATOM   3128 C  C   . THR A 1 386 ? 10.798  -25.493 8.407   1.00 12.25  ? 386  THR A C   1 
ATOM   3129 O  O   . THR A 1 386 ? 10.513  -26.317 7.536   1.00 7.69   ? 386  THR A O   1 
ATOM   3130 C  CB  . THR A 1 386 ? 13.231  -25.048 8.672   1.00 10.72  ? 386  THR A CB  1 
ATOM   3131 O  OG1 . THR A 1 386 ? 13.159  -25.155 7.237   1.00 7.80   ? 386  THR A OG1 1 
ATOM   3132 C  CG2 . THR A 1 386 ? 14.495  -25.688 9.174   1.00 22.65  ? 386  THR A CG2 1 
ATOM   3133 N  N   . PRO A 1 387 ? 10.037  -24.430 8.655   1.00 12.19  ? 387  PRO A N   1 
ATOM   3134 C  CA  . PRO A 1 387 ? 8.863   -24.089 7.852   1.00 12.47  ? 387  PRO A CA  1 
ATOM   3135 C  C   . PRO A 1 387 ? 9.313   -23.417 6.575   1.00 5.46   ? 387  PRO A C   1 
ATOM   3136 O  O   . PRO A 1 387 ? 10.400  -22.836 6.553   1.00 2.00   ? 387  PRO A O   1 
ATOM   3137 C  CB  . PRO A 1 387 ? 8.134   -23.071 8.733   1.00 17.80  ? 387  PRO A CB  1 
ATOM   3138 C  CG  . PRO A 1 387 ? 8.636   -23.371 10.132  1.00 12.74  ? 387  PRO A CG  1 
ATOM   3139 C  CD  . PRO A 1 387 ? 10.085  -23.624 9.884   1.00 18.93  ? 387  PRO A CD  1 
ATOM   3140 N  N   . LYS A 1 388 ? 8.523   -23.545 5.507   1.00 3.51   ? 388  LYS A N   1 
ATOM   3141 C  CA  . LYS A 1 388 ? 8.850   -22.860 4.257   1.00 14.23  ? 388  LYS A CA  1 
ATOM   3142 C  C   . LYS A 1 388 ? 8.496   -21.408 4.617   1.00 24.88  ? 388  LYS A C   1 
ATOM   3143 O  O   . LYS A 1 388 ? 7.550   -21.165 5.383   1.00 21.64  ? 388  LYS A O   1 
ATOM   3144 C  CB  . LYS A 1 388 ? 7.965   -23.320 3.107   1.00 4.79   ? 388  LYS A CB  1 
ATOM   3145 C  CG  . LYS A 1 388 ? 7.504   -24.756 3.212   1.00 52.00  ? 388  LYS A CG  1 
ATOM   3146 C  CD  . LYS A 1 388 ? 6.558   -25.117 2.072   1.00 89.15  ? 388  LYS A CD  1 
ATOM   3147 C  CE  . LYS A 1 388 ? 5.306   -24.226 2.068   1.00 108.14 ? 388  LYS A CE  1 
ATOM   3148 N  NZ  . LYS A 1 388 ? 4.362   -24.508 0.931   1.00 119.90 ? 388  LYS A NZ  1 
ATOM   3149 N  N   . PHE A 1 389 ? 9.240   -20.442 4.094   1.00 28.47  ? 389  PHE A N   1 
ATOM   3150 C  CA  . PHE A 1 389 ? 8.954   -19.064 4.440   1.00 22.98  ? 389  PHE A CA  1 
ATOM   3151 C  C   . PHE A 1 389 ? 8.229   -18.241 3.388   1.00 30.71  ? 389  PHE A C   1 
ATOM   3152 O  O   . PHE A 1 389 ? 8.413   -18.431 2.184   1.00 29.06  ? 389  PHE A O   1 
ATOM   3153 C  CB  . PHE A 1 389 ? 10.234  -18.356 4.891   1.00 18.40  ? 389  PHE A CB  1 
ATOM   3154 C  CG  . PHE A 1 389 ? 10.744  -18.813 6.237   1.00 2.00   ? 389  PHE A CG  1 
ATOM   3155 C  CD1 . PHE A 1 389 ? 10.301  -18.201 7.414   1.00 2.00   ? 389  PHE A CD1 1 
ATOM   3156 C  CD2 . PHE A 1 389 ? 11.665  -19.850 6.332   1.00 4.90   ? 389  PHE A CD2 1 
ATOM   3157 C  CE1 . PHE A 1 389 ? 10.772  -18.617 8.687   1.00 7.79   ? 389  PHE A CE1 1 
ATOM   3158 C  CE2 . PHE A 1 389 ? 12.146  -20.281 7.596   1.00 21.43  ? 389  PHE A CE2 1 
ATOM   3159 C  CZ  . PHE A 1 389 ? 11.697  -19.661 8.779   1.00 12.91  ? 389  PHE A CZ  1 
ATOM   3160 N  N   . LYS A 1 390 ? 7.328   -17.395 3.878   1.00 45.26  ? 390  LYS A N   1 
ATOM   3161 C  CA  . LYS A 1 390 ? 6.553   -16.458 3.065   1.00 53.57  ? 390  LYS A CA  1 
ATOM   3162 C  C   . LYS A 1 390 ? 7.004   -15.122 3.641   1.00 48.51  ? 390  LYS A C   1 
ATOM   3163 O  O   . LYS A 1 390 ? 6.671   -14.776 4.788   1.00 43.80  ? 390  LYS A O   1 
ATOM   3164 C  CB  . LYS A 1 390 ? 5.043   -16.650 3.263   1.00 65.01  ? 390  LYS A CB  1 
ATOM   3165 C  CG  . LYS A 1 390 ? 4.400   -17.615 2.265   1.00 79.57  ? 390  LYS A CG  1 
ATOM   3166 C  CD  . LYS A 1 390 ? 2.884   -17.764 2.487   1.00 95.43  ? 390  LYS A CD  1 
ATOM   3167 C  CE  . LYS A 1 390 ? 2.099   -16.516 2.086   1.00 96.00  ? 390  LYS A CE  1 
ATOM   3168 N  NZ  . LYS A 1 390 ? 0.629   -16.643 2.318   1.00 89.05  ? 390  LYS A NZ  1 
ATOM   3169 N  N   . LEU A 1 391 ? 7.803   -14.395 2.867   1.00 43.12  ? 391  LEU A N   1 
ATOM   3170 C  CA  . LEU A 1 391 ? 8.348   -13.142 3.348   1.00 38.99  ? 391  LEU A CA  1 
ATOM   3171 C  C   . LEU A 1 391 ? 7.940   -11.912 2.566   1.00 37.83  ? 391  LEU A C   1 
ATOM   3172 O  O   . LEU A 1 391 ? 7.865   -11.941 1.331   1.00 39.78  ? 391  LEU A O   1 
ATOM   3173 C  CB  . LEU A 1 391 ? 9.873   -13.245 3.430   1.00 33.62  ? 391  LEU A CB  1 
ATOM   3174 C  CG  . LEU A 1 391 ? 10.426  -14.377 4.320   1.00 29.57  ? 391  LEU A CG  1 
ATOM   3175 C  CD1 . LEU A 1 391 ? 11.933  -14.456 4.194   1.00 32.82  ? 391  LEU A CD1 1 
ATOM   3176 C  CD2 . LEU A 1 391 ? 10.028  -14.188 5.772   1.00 2.00   ? 391  LEU A CD2 1 
ATOM   3177 N  N   . PRO A 1 392 ? 7.609   -10.826 3.292   1.00 33.39  ? 392  PRO A N   1 
ATOM   3178 C  CA  . PRO A 1 392 ? 7.193   -9.533  2.746   1.00 24.52  ? 392  PRO A CA  1 
ATOM   3179 C  C   . PRO A 1 392 ? 8.388   -8.715  2.256   1.00 19.89  ? 392  PRO A C   1 
ATOM   3180 O  O   . PRO A 1 392 ? 8.626   -7.595  2.710   1.00 21.20  ? 392  PRO A O   1 
ATOM   3181 C  CB  . PRO A 1 392 ? 6.494   -8.870  3.941   1.00 30.72  ? 392  PRO A CB  1 
ATOM   3182 C  CG  . PRO A 1 392 ? 7.264   -9.377  5.108   1.00 34.49  ? 392  PRO A CG  1 
ATOM   3183 C  CD  . PRO A 1 392 ? 7.416   -10.853 4.758   1.00 38.15  ? 392  PRO A CD  1 
ATOM   3184 N  N   . ILE A 1 393 ? 9.179   -9.305  1.374   1.00 18.94  ? 393  ILE A N   1 
ATOM   3185 C  CA  . ILE A 1 393 ? 10.344  -8.627  0.805   1.00 17.89  ? 393  ILE A CA  1 
ATOM   3186 C  C   . ILE A 1 393 ? 10.560  -9.262  -0.542  1.00 14.35  ? 393  ILE A C   1 
ATOM   3187 O  O   . ILE A 1 393 ? 10.339  -10.468 -0.693  1.00 8.98   ? 393  ILE A O   1 
ATOM   3188 C  CB  . ILE A 1 393 ? 11.647  -8.811  1.643   1.00 20.99  ? 393  ILE A CB  1 
ATOM   3189 C  CG1 . ILE A 1 393 ? 12.853  -8.300  0.839   1.00 33.92  ? 393  ILE A CG1 1 
ATOM   3190 C  CG2 . ILE A 1 393 ? 11.852  -10.270 2.050   1.00 2.00   ? 393  ILE A CG2 1 
ATOM   3191 C  CD1 . ILE A 1 393 ? 14.216  -8.643  1.434   1.00 43.85  ? 393  ILE A CD1 1 
ATOM   3192 N  N   . GLN A 1 394 ? 10.944  -8.458  -1.527  1.00 10.51  ? 394  GLN A N   1 
ATOM   3193 C  CA  . GLN A 1 394 ? 11.185  -8.994  -2.852  1.00 18.84  ? 394  GLN A CA  1 
ATOM   3194 C  C   . GLN A 1 394 ? 12.468  -9.805  -2.891  1.00 19.59  ? 394  GLN A C   1 
ATOM   3195 O  O   . GLN A 1 394 ? 13.439  -9.487  -2.199  1.00 14.12  ? 394  GLN A O   1 
ATOM   3196 C  CB  . GLN A 1 394 ? 11.259  -7.881  -3.889  1.00 29.99  ? 394  GLN A CB  1 
ATOM   3197 C  CG  . GLN A 1 394 ? 9.912   -7.385  -4.349  1.00 50.89  ? 394  GLN A CG  1 
ATOM   3198 C  CD  . GLN A 1 394 ? 10.025  -6.496  -5.572  1.00 65.97  ? 394  GLN A CD  1 
ATOM   3199 O  OE1 . GLN A 1 394 ? 9.745   -6.920  -6.694  1.00 74.65  ? 394  GLN A OE1 1 
ATOM   3200 N  NE2 . GLN A 1 394 ? 10.462  -5.264  -5.363  1.00 67.42  ? 394  GLN A NE2 1 
ATOM   3201 N  N   . LYS A 1 395 ? 12.465  -10.843 -3.720  1.00 28.34  ? 395  LYS A N   1 
ATOM   3202 C  CA  . LYS A 1 395 ? 13.629  -11.706 -3.900  1.00 37.24  ? 395  LYS A CA  1 
ATOM   3203 C  C   . LYS A 1 395 ? 14.776  -10.882 -4.481  1.00 37.89  ? 395  LYS A C   1 
ATOM   3204 O  O   . LYS A 1 395 ? 15.950  -11.225 -4.321  1.00 38.08  ? 395  LYS A O   1 
ATOM   3205 C  CB  . LYS A 1 395 ? 13.288  -12.873 -4.836  1.00 45.37  ? 395  LYS A CB  1 
ATOM   3206 C  CG  . LYS A 1 395 ? 12.437  -13.982 -4.205  1.00 46.39  ? 395  LYS A CG  1 
ATOM   3207 C  CD  . LYS A 1 395 ? 13.298  -15.086 -3.600  1.00 44.62  ? 395  LYS A CD  1 
ATOM   3208 C  CE  . LYS A 1 395 ? 12.440  -16.193 -3.000  1.00 45.40  ? 395  LYS A CE  1 
ATOM   3209 N  NZ  . LYS A 1 395 ? 13.271  -17.216 -2.298  1.00 37.10  ? 395  LYS A NZ  1 
ATOM   3210 N  N   . GLU A 1 396 ? 14.428  -9.791  -5.156  1.00 40.46  ? 396  GLU A N   1 
ATOM   3211 C  CA  . GLU A 1 396 ? 15.432  -8.914  -5.738  1.00 48.77  ? 396  GLU A CA  1 
ATOM   3212 C  C   . GLU A 1 396 ? 16.088  -8.081  -4.648  1.00 40.88  ? 396  GLU A C   1 
ATOM   3213 O  O   . GLU A 1 396 ? 17.295  -7.847  -4.669  1.00 33.41  ? 396  GLU A O   1 
ATOM   3214 C  CB  . GLU A 1 396 ? 14.800  -8.017  -6.799  1.00 68.22  ? 396  GLU A CB  1 
ATOM   3215 C  CG  . GLU A 1 396 ? 15.394  -8.225  -8.186  1.00 93.23  ? 396  GLU A CG  1 
ATOM   3216 C  CD  . GLU A 1 396 ? 15.373  -9.685  -8.633  1.00 105.64 ? 396  GLU A CD  1 
ATOM   3217 O  OE1 . GLU A 1 396 ? 14.327  -10.141 -9.144  1.00 113.35 ? 396  GLU A OE1 1 
ATOM   3218 O  OE2 . GLU A 1 396 ? 16.407  -10.374 -8.480  1.00 109.88 ? 396  GLU A OE2 1 
ATOM   3219 N  N   . THR A 1 397 ? 15.280  -7.665  -3.681  1.00 37.97  ? 397  THR A N   1 
ATOM   3220 C  CA  . THR A 1 397 ? 15.769  -6.880  -2.559  1.00 39.96  ? 397  THR A CA  1 
ATOM   3221 C  C   . THR A 1 397 ? 16.747  -7.784  -1.824  1.00 42.74  ? 397  THR A C   1 
ATOM   3222 O  O   . THR A 1 397 ? 17.877  -7.393  -1.521  1.00 43.34  ? 397  THR A O   1 
ATOM   3223 C  CB  . THR A 1 397 ? 14.619  -6.516  -1.586  1.00 42.32  ? 397  THR A CB  1 
ATOM   3224 O  OG1 . THR A 1 397 ? 13.479  -6.054  -2.325  1.00 53.19  ? 397  THR A OG1 1 
ATOM   3225 C  CG2 . THR A 1 397 ? 15.058  -5.435  -0.621  1.00 25.47  ? 397  THR A CG2 1 
ATOM   3226 N  N   . TRP A 1 398 ? 16.305  -9.018  -1.590  1.00 46.76  ? 398  TRP A N   1 
ATOM   3227 C  CA  . TRP A 1 398 ? 17.101  -10.019 -0.898  1.00 43.55  ? 398  TRP A CA  1 
ATOM   3228 C  C   . TRP A 1 398 ? 18.435  -10.193 -1.579  1.00 42.02  ? 398  TRP A C   1 
ATOM   3229 O  O   . TRP A 1 398 ? 19.475  -9.951  -0.972  1.00 44.78  ? 398  TRP A O   1 
ATOM   3230 C  CB  . TRP A 1 398 ? 16.379  -11.370 -0.866  1.00 40.48  ? 398  TRP A CB  1 
ATOM   3231 C  CG  . TRP A 1 398 ? 17.234  -12.459 -0.279  1.00 45.72  ? 398  TRP A CG  1 
ATOM   3232 C  CD1 . TRP A 1 398 ? 17.669  -13.596 -0.907  1.00 48.79  ? 398  TRP A CD1 1 
ATOM   3233 C  CD2 . TRP A 1 398 ? 17.811  -12.482 1.036   1.00 32.48  ? 398  TRP A CD2 1 
ATOM   3234 N  NE1 . TRP A 1 398 ? 18.486  -14.316 -0.066  1.00 42.16  ? 398  TRP A NE1 1 
ATOM   3235 C  CE2 . TRP A 1 398 ? 18.591  -13.655 1.130   1.00 41.31  ? 398  TRP A CE2 1 
ATOM   3236 C  CE3 . TRP A 1 398 ? 17.749  -11.620 2.137   1.00 13.18  ? 398  TRP A CE3 1 
ATOM   3237 C  CZ2 . TRP A 1 398 ? 19.309  -13.989 2.287   1.00 53.66  ? 398  TRP A CZ2 1 
ATOM   3238 C  CZ3 . TRP A 1 398 ? 18.466  -11.948 3.290   1.00 28.97  ? 398  TRP A CZ3 1 
ATOM   3239 C  CH2 . TRP A 1 398 ? 19.235  -13.123 3.354   1.00 49.28  ? 398  TRP A CH2 1 
ATOM   3240 N  N   . GLU A 1 399 ? 18.385  -10.591 -2.848  1.00 43.64  ? 399  GLU A N   1 
ATOM   3241 C  CA  . GLU A 1 399 ? 19.577  -10.827 -3.652  1.00 50.39  ? 399  GLU A CA  1 
ATOM   3242 C  C   . GLU A 1 399 ? 20.559  -9.653  -3.551  1.00 47.04  ? 399  GLU A C   1 
ATOM   3243 O  O   . GLU A 1 399 ? 21.709  -9.837  -3.153  1.00 47.76  ? 399  GLU A O   1 
ATOM   3244 C  CB  . GLU A 1 399 ? 19.175  -11.087 -5.115  1.00 61.95  ? 399  GLU A CB  1 
ATOM   3245 C  CG  . GLU A 1 399 ? 20.160  -11.941 -5.944  1.00 73.45  ? 399  GLU A CG  1 
ATOM   3246 C  CD  . GLU A 1 399 ? 20.091  -13.447 -5.652  1.00 79.42  ? 399  GLU A CD  1 
ATOM   3247 O  OE1 . GLU A 1 399 ? 19.004  -13.960 -5.297  1.00 83.02  ? 399  GLU A OE1 1 
ATOM   3248 O  OE2 . GLU A 1 399 ? 21.134  -14.126 -5.792  1.00 78.80  ? 399  GLU A OE2 1 
ATOM   3249 N  N   . THR A 1 400 ? 20.084  -8.443  -3.830  1.00 46.79  ? 400  THR A N   1 
ATOM   3250 C  CA  . THR A 1 400 ? 20.925  -7.244  -3.785  1.00 46.61  ? 400  THR A CA  1 
ATOM   3251 C  C   . THR A 1 400 ? 21.554  -6.938  -2.420  1.00 38.21  ? 400  THR A C   1 
ATOM   3252 O  O   . THR A 1 400 ? 22.714  -6.532  -2.338  1.00 36.28  ? 400  THR A O   1 
ATOM   3253 C  CB  . THR A 1 400 ? 20.147  -6.000  -4.276  1.00 51.11  ? 400  THR A CB  1 
ATOM   3254 O  OG1 . THR A 1 400 ? 19.548  -6.277  -5.553  1.00 52.36  ? 400  THR A OG1 1 
ATOM   3255 C  CG2 . THR A 1 400 ? 21.085  -4.806  -4.420  1.00 47.24  ? 400  THR A CG2 1 
ATOM   3256 N  N   . TRP A 1 401 ? 20.802  -7.122  -1.349  1.00 35.75  ? 401  TRP A N   1 
ATOM   3257 C  CA  . TRP A 1 401 ? 21.352  -6.849  -0.035  1.00 42.66  ? 401  TRP A CA  1 
ATOM   3258 C  C   . TRP A 1 401 ? 22.382  -7.896  0.367   1.00 54.88  ? 401  TRP A C   1 
ATOM   3259 O  O   . TRP A 1 401 ? 23.572  -7.592  0.459   1.00 60.25  ? 401  TRP A O   1 
ATOM   3260 C  CB  . TRP A 1 401 ? 20.254  -6.783  1.018   1.00 30.81  ? 401  TRP A CB  1 
ATOM   3261 C  CG  . TRP A 1 401 ? 20.796  -6.501  2.377   1.00 31.20  ? 401  TRP A CG  1 
ATOM   3262 C  CD1 . TRP A 1 401 ? 21.230  -5.296  2.851   1.00 38.79  ? 401  TRP A CD1 1 
ATOM   3263 C  CD2 . TRP A 1 401 ? 20.980  -7.440  3.444   1.00 36.64  ? 401  TRP A CD2 1 
ATOM   3264 N  NE1 . TRP A 1 401 ? 21.671  -5.425  4.144   1.00 38.93  ? 401  TRP A NE1 1 
ATOM   3265 C  CE2 . TRP A 1 401 ? 21.529  -6.732  4.533   1.00 34.28  ? 401  TRP A CE2 1 
ATOM   3266 C  CE3 . TRP A 1 401 ? 20.728  -8.813  3.582   1.00 42.95  ? 401  TRP A CE3 1 
ATOM   3267 C  CZ2 . TRP A 1 401 ? 21.833  -7.346  5.751   1.00 30.29  ? 401  TRP A CZ2 1 
ATOM   3268 C  CZ3 . TRP A 1 401 ? 21.028  -9.424  4.791   1.00 52.18  ? 401  TRP A CZ3 1 
ATOM   3269 C  CH2 . TRP A 1 401 ? 21.577  -8.687  5.863   1.00 45.76  ? 401  TRP A CH2 1 
ATOM   3270 N  N   . TRP A 1 402 ? 21.912  -9.125  0.594   1.00 63.39  ? 402  TRP A N   1 
ATOM   3271 C  CA  . TRP A 1 402 ? 22.757  -10.250 1.011   1.00 71.21  ? 402  TRP A CA  1 
ATOM   3272 C  C   . TRP A 1 402 ? 24.046  -10.418 0.205   1.00 70.88  ? 402  TRP A C   1 
ATOM   3273 O  O   . TRP A 1 402 ? 25.135  -10.420 0.774   1.00 68.13  ? 402  TRP A O   1 
ATOM   3274 C  CB  . TRP A 1 402 ? 21.929  -11.560 1.041   1.00 79.63  ? 402  TRP A CB  1 
ATOM   3275 C  CG  . TRP A 1 402 ? 22.604  -12.818 0.485   1.00 98.91  ? 402  TRP A CG  1 
ATOM   3276 C  CD1 . TRP A 1 402 ? 23.715  -13.458 0.979   1.00 107.21 ? 402  TRP A CD1 1 
ATOM   3277 C  CD2 . TRP A 1 402 ? 22.212  -13.558 -0.686  1.00 105.32 ? 402  TRP A CD2 1 
ATOM   3278 N  NE1 . TRP A 1 402 ? 24.038  -14.535 0.182   1.00 105.74 ? 402  TRP A NE1 1 
ATOM   3279 C  CE2 . TRP A 1 402 ? 23.133  -14.619 -0.844  1.00 105.29 ? 402  TRP A CE2 1 
ATOM   3280 C  CE3 . TRP A 1 402 ? 21.171  -13.422 -1.617  1.00 102.82 ? 402  TRP A CE3 1 
ATOM   3281 C  CZ2 . TRP A 1 402 ? 23.046  -15.538 -1.896  1.00 104.86 ? 402  TRP A CZ2 1 
ATOM   3282 C  CZ3 . TRP A 1 402 ? 21.085  -14.337 -2.661  1.00 103.66 ? 402  TRP A CZ3 1 
ATOM   3283 C  CH2 . TRP A 1 402 ? 22.017  -15.380 -2.792  1.00 105.66 ? 402  TRP A CH2 1 
ATOM   3284 N  N   . THR A 1 403 ? 23.924  -10.484 -1.117  1.00 70.60  ? 403  THR A N   1 
ATOM   3285 C  CA  . THR A 1 403 ? 25.074  -10.682 -1.989  1.00 69.56  ? 403  THR A CA  1 
ATOM   3286 C  C   . THR A 1 403 ? 26.218  -9.660  -1.821  1.00 75.05  ? 403  THR A C   1 
ATOM   3287 O  O   . THR A 1 403 ? 27.345  -9.908  -2.275  1.00 78.02  ? 403  THR A O   1 
ATOM   3288 C  CB  . THR A 1 403 ? 24.616  -10.779 -3.477  1.00 68.38  ? 403  THR A CB  1 
ATOM   3289 O  OG1 . THR A 1 403 ? 25.411  -11.751 -4.169  1.00 70.63  ? 403  THR A OG1 1 
ATOM   3290 C  CG2 . THR A 1 403 ? 24.722  -9.430  -4.186  1.00 69.79  ? 403  THR A CG2 1 
ATOM   3291 N  N   . GLU A 1 404 ? 25.952  -8.550  -1.131  1.00 73.94  ? 404  GLU A N   1 
ATOM   3292 C  CA  . GLU A 1 404 ? 26.963  -7.513  -0.935  1.00 66.85  ? 404  GLU A CA  1 
ATOM   3293 C  C   . GLU A 1 404 ? 27.283  -7.158  0.516   1.00 56.75  ? 404  GLU A C   1 
ATOM   3294 O  O   . GLU A 1 404 ? 28.169  -6.344  0.770   1.00 62.31  ? 404  GLU A O   1 
ATOM   3295 C  CB  . GLU A 1 404 ? 26.563  -6.245  -1.696  1.00 72.13  ? 404  GLU A CB  1 
ATOM   3296 C  CG  . GLU A 1 404 ? 27.554  -5.833  -2.778  1.00 85.96  ? 404  GLU A CG  1 
ATOM   3297 C  CD  . GLU A 1 404 ? 27.731  -6.892  -3.858  1.00 92.15  ? 404  GLU A CD  1 
ATOM   3298 O  OE1 . GLU A 1 404 ? 26.905  -6.929  -4.798  1.00 92.82  ? 404  GLU A OE1 1 
ATOM   3299 O  OE2 . GLU A 1 404 ? 28.699  -7.683  -3.770  1.00 94.51  ? 404  GLU A OE2 1 
ATOM   3300 N  N   . TYR A 1 405 ? 26.584  -7.772  1.464   1.00 48.92  ? 405  TYR A N   1 
ATOM   3301 C  CA  . TYR A 1 405 ? 26.800  -7.493  2.888   1.00 42.94  ? 405  TYR A CA  1 
ATOM   3302 C  C   . TYR A 1 405 ? 28.110  -8.070  3.426   1.00 37.57  ? 405  TYR A C   1 
ATOM   3303 O  O   . TYR A 1 405 ? 28.519  -9.158  3.047   1.00 37.35  ? 405  TYR A O   1 
ATOM   3304 C  CB  . TYR A 1 405 ? 25.633  -8.027  3.711   1.00 33.64  ? 405  TYR A CB  1 
ATOM   3305 C  CG  . TYR A 1 405 ? 25.487  -7.353  5.038   1.00 4.56   ? 405  TYR A CG  1 
ATOM   3306 C  CD1 . TYR A 1 405 ? 25.274  -5.985  5.113   1.00 6.69   ? 405  TYR A CD1 1 
ATOM   3307 C  CD2 . TYR A 1 405 ? 25.505  -8.090  6.221   1.00 14.37  ? 405  TYR A CD2 1 
ATOM   3308 C  CE1 . TYR A 1 405 ? 25.065  -5.355  6.339   1.00 18.99  ? 405  TYR A CE1 1 
ATOM   3309 C  CE2 . TYR A 1 405 ? 25.303  -7.477  7.455   1.00 21.42  ? 405  TYR A CE2 1 
ATOM   3310 C  CZ  . TYR A 1 405 ? 25.077  -6.106  7.507   1.00 17.23  ? 405  TYR A CZ  1 
ATOM   3311 O  OH  . TYR A 1 405 ? 24.821  -5.496  8.714   1.00 9.04   ? 405  TYR A OH  1 
ATOM   3312 N  N   . TRP A 1 406 ? 28.728  -7.367  4.364   1.00 27.10  ? 406  TRP A N   1 
ATOM   3313 C  CA  . TRP A 1 406 ? 30.002  -7.802  4.917   1.00 19.18  ? 406  TRP A CA  1 
ATOM   3314 C  C   . TRP A 1 406 ? 29.969  -9.057  5.774   1.00 20.25  ? 406  TRP A C   1 
ATOM   3315 O  O   . TRP A 1 406 ? 31.006  -9.689  6.014   1.00 27.42  ? 406  TRP A O   1 
ATOM   3316 C  CB  . TRP A 1 406 ? 30.589  -6.685  5.761   1.00 19.77  ? 406  TRP A CB  1 
ATOM   3317 C  CG  . TRP A 1 406 ? 29.892  -6.517  7.084   1.00 5.38   ? 406  TRP A CG  1 
ATOM   3318 C  CD1 . TRP A 1 406 ? 28.848  -5.691  7.345   1.00 2.00   ? 406  TRP A CD1 1 
ATOM   3319 C  CD2 . TRP A 1 406 ? 30.197  -7.192  8.323   1.00 10.58  ? 406  TRP A CD2 1 
ATOM   3320 N  NE1 . TRP A 1 406 ? 28.478  -5.798  8.664   1.00 15.72  ? 406  TRP A NE1 1 
ATOM   3321 C  CE2 . TRP A 1 406 ? 29.287  -6.711  9.290   1.00 18.66  ? 406  TRP A CE2 1 
ATOM   3322 C  CE3 . TRP A 1 406 ? 31.142  -8.157  8.708   1.00 8.23   ? 406  TRP A CE3 1 
ATOM   3323 C  CZ2 . TRP A 1 406 ? 29.295  -7.158  10.626  1.00 19.66  ? 406  TRP A CZ2 1 
ATOM   3324 C  CZ3 . TRP A 1 406 ? 31.148  -8.605  10.033  1.00 14.85  ? 406  TRP A CZ3 1 
ATOM   3325 C  CH2 . TRP A 1 406 ? 30.230  -8.102  10.976  1.00 8.78   ? 406  TRP A CH2 1 
ATOM   3326 N  N   . GLN A 1 407 ? 28.800  -9.362  6.310   1.00 22.51  ? 407  GLN A N   1 
ATOM   3327 C  CA  . GLN A 1 407 ? 28.647  -10.498 7.207   1.00 25.63  ? 407  GLN A CA  1 
ATOM   3328 C  C   . GLN A 1 407 ? 27.805  -11.584 6.543   1.00 27.36  ? 407  GLN A C   1 
ATOM   3329 O  O   . GLN A 1 407 ? 26.893  -11.286 5.776   1.00 38.68  ? 407  GLN A O   1 
ATOM   3330 C  CB  . GLN A 1 407 ? 27.981  -10.017 8.500   1.00 14.75  ? 407  GLN A CB  1 
ATOM   3331 C  CG  . GLN A 1 407 ? 28.288  -10.833 9.732   1.00 9.80   ? 407  GLN A CG  1 
ATOM   3332 C  CD  . GLN A 1 407 ? 27.316  -10.521 10.841  1.00 17.54  ? 407  GLN A CD  1 
ATOM   3333 O  OE1 . GLN A 1 407 ? 26.158  -10.221 10.572  1.00 30.87  ? 407  GLN A OE1 1 
ATOM   3334 N  NE2 . GLN A 1 407 ? 27.777  -10.553 12.089  1.00 5.25   ? 407  GLN A NE2 1 
ATOM   3335 N  N   . ALA A 1 408 ? 28.122  -12.839 6.828   1.00 22.06  ? 408  ALA A N   1 
ATOM   3336 C  CA  . ALA A 1 408 ? 27.386  -13.950 6.252   1.00 25.14  ? 408  ALA A CA  1 
ATOM   3337 C  C   . ALA A 1 408 ? 25.990  -14.022 6.848   1.00 25.23  ? 408  ALA A C   1 
ATOM   3338 O  O   . ALA A 1 408 ? 25.787  -13.828 8.060   1.00 23.82  ? 408  ALA A O   1 
ATOM   3339 C  CB  . ALA A 1 408 ? 28.134  -15.267 6.471   1.00 38.03  ? 408  ALA A CB  1 
ATOM   3340 N  N   . THR A 1 409 ? 25.038  -14.331 5.980   1.00 25.07  ? 409  THR A N   1 
ATOM   3341 C  CA  . THR A 1 409 ? 23.647  -14.432 6.362   1.00 33.99  ? 409  THR A CA  1 
ATOM   3342 C  C   . THR A 1 409 ? 22.926  -15.336 5.367   1.00 35.10  ? 409  THR A C   1 
ATOM   3343 O  O   . THR A 1 409 ? 23.397  -15.559 4.240   1.00 26.30  ? 409  THR A O   1 
ATOM   3344 C  CB  . THR A 1 409 ? 22.985  -13.027 6.389   1.00 45.35  ? 409  THR A CB  1 
ATOM   3345 O  OG1 . THR A 1 409 ? 21.629  -13.143 6.836   1.00 57.41  ? 409  THR A OG1 1 
ATOM   3346 C  CG2 . THR A 1 409 ? 23.032  -12.355 4.997   1.00 28.31  ? 409  THR A CG2 1 
ATOM   3347 N  N   . TRP A 1 410 ? 21.772  -15.844 5.775   1.00 41.45  ? 410  TRP A N   1 
ATOM   3348 C  CA  . TRP A 1 410 ? 21.010  -16.729 4.908   1.00 44.09  ? 410  TRP A CA  1 
ATOM   3349 C  C   . TRP A 1 410 ? 19.578  -16.940 5.366   1.00 43.68  ? 410  TRP A C   1 
ATOM   3350 O  O   . TRP A 1 410 ? 19.268  -16.953 6.564   1.00 45.09  ? 410  TRP A O   1 
ATOM   3351 C  CB  . TRP A 1 410 ? 21.715  -18.089 4.786   1.00 41.59  ? 410  TRP A CB  1 
ATOM   3352 C  CG  . TRP A 1 410 ? 20.988  -19.109 3.934   1.00 44.05  ? 410  TRP A CG  1 
ATOM   3353 C  CD1 . TRP A 1 410 ? 20.838  -19.089 2.571   1.00 48.19  ? 410  TRP A CD1 1 
ATOM   3354 C  CD2 . TRP A 1 410 ? 20.344  -20.312 4.389   1.00 39.41  ? 410  TRP A CD2 1 
ATOM   3355 N  NE1 . TRP A 1 410 ? 20.147  -20.208 2.149   1.00 30.94  ? 410  TRP A NE1 1 
ATOM   3356 C  CE2 . TRP A 1 410 ? 19.833  -20.974 3.240   1.00 24.54  ? 410  TRP A CE2 1 
ATOM   3357 C  CE3 . TRP A 1 410 ? 20.150  -20.898 5.652   1.00 28.77  ? 410  TRP A CE3 1 
ATOM   3358 C  CZ2 . TRP A 1 410 ? 19.149  -22.185 3.320   1.00 22.75  ? 410  TRP A CZ2 1 
ATOM   3359 C  CZ3 . TRP A 1 410 ? 19.464  -22.112 5.730   1.00 21.54  ? 410  TRP A CZ3 1 
ATOM   3360 C  CH2 . TRP A 1 410 ? 18.974  -22.739 4.571   1.00 22.78  ? 410  TRP A CH2 1 
ATOM   3361 N  N   . ILE A 1 411 ? 18.709  -17.095 4.380   1.00 40.37  ? 411  ILE A N   1 
ATOM   3362 C  CA  . ILE A 1 411 ? 17.312  -17.352 4.625   1.00 35.52  ? 411  ILE A CA  1 
ATOM   3363 C  C   . ILE A 1 411 ? 16.988  -18.631 3.887   1.00 24.67  ? 411  ILE A C   1 
ATOM   3364 O  O   . ILE A 1 411 ? 17.279  -18.756 2.693   1.00 25.80  ? 411  ILE A O   1 
ATOM   3365 C  CB  . ILE A 1 411 ? 16.416  -16.214 4.119   1.00 37.81  ? 411  ILE A CB  1 
ATOM   3366 C  CG1 . ILE A 1 411 ? 16.582  -15.003 5.040   1.00 51.15  ? 411  ILE A CG1 1 
ATOM   3367 C  CG2 . ILE A 1 411 ? 14.949  -16.672 4.081   1.00 35.30  ? 411  ILE A CG2 1 
ATOM   3368 C  CD1 . ILE A 1 411 ? 15.692  -13.838 4.702   1.00 72.11  ? 411  ILE A CD1 1 
ATOM   3369 N  N   . PRO A 1 412 ? 16.503  -19.639 4.622   1.00 13.29  ? 412  PRO A N   1 
ATOM   3370 C  CA  . PRO A 1 412 ? 16.128  -20.942 4.077   1.00 17.19  ? 412  PRO A CA  1 
ATOM   3371 C  C   . PRO A 1 412 ? 15.234  -20.822 2.837   1.00 24.84  ? 412  PRO A C   1 
ATOM   3372 O  O   . PRO A 1 412 ? 15.102  -19.749 2.231   1.00 18.98  ? 412  PRO A O   1 
ATOM   3373 C  CB  . PRO A 1 412 ? 15.380  -21.577 5.242   1.00 19.30  ? 412  PRO A CB  1 
ATOM   3374 C  CG  . PRO A 1 412 ? 16.147  -21.073 6.434   1.00 18.56  ? 412  PRO A CG  1 
ATOM   3375 C  CD  . PRO A 1 412 ? 16.372  -19.619 6.092   1.00 8.81   ? 412  PRO A CD  1 
ATOM   3376 N  N   . GLU A 1 413 ? 14.629  -21.934 2.443   1.00 38.16  ? 413  GLU A N   1 
ATOM   3377 C  CA  . GLU A 1 413 ? 13.745  -21.916 1.282   1.00 44.61  ? 413  GLU A CA  1 
ATOM   3378 C  C   . GLU A 1 413 ? 12.616  -20.964 1.629   1.00 43.03  ? 413  GLU A C   1 
ATOM   3379 O  O   . GLU A 1 413 ? 11.901  -21.152 2.632   1.00 40.96  ? 413  GLU A O   1 
ATOM   3380 C  CB  . GLU A 1 413 ? 13.173  -23.305 1.004   1.00 54.06  ? 413  GLU A CB  1 
ATOM   3381 C  CG  . GLU A 1 413 ? 12.214  -23.349 -0.175  1.00 64.41  ? 413  GLU A CG  1 
ATOM   3382 C  CD  . GLU A 1 413 ? 11.042  -24.300 0.049   1.00 68.39  ? 413  GLU A CD  1 
ATOM   3383 O  OE1 . GLU A 1 413 ? 11.264  -25.457 0.469   1.00 61.92  ? 413  GLU A OE1 1 
ATOM   3384 O  OE2 . GLU A 1 413 ? 9.890   -23.889 -0.207  1.00 68.08  ? 413  GLU A OE2 1 
ATOM   3385 N  N   . TRP A 1 414 ? 12.497  -19.907 0.843   1.00 37.81  ? 414  TRP A N   1 
ATOM   3386 C  CA  . TRP A 1 414 ? 11.454  -18.942 1.099   1.00 36.98  ? 414  TRP A CA  1 
ATOM   3387 C  C   . TRP A 1 414 ? 10.792  -18.509 -0.183  1.00 33.58  ? 414  TRP A C   1 
ATOM   3388 O  O   . TRP A 1 414 ? 11.234  -18.876 -1.286  1.00 23.64  ? 414  TRP A O   1 
ATOM   3389 C  CB  . TRP A 1 414 ? 11.985  -17.739 1.884   1.00 44.07  ? 414  TRP A CB  1 
ATOM   3390 C  CG  . TRP A 1 414 ? 12.910  -16.846 1.115   1.00 53.47  ? 414  TRP A CG  1 
ATOM   3391 C  CD1 . TRP A 1 414 ? 14.243  -17.040 0.882   1.00 58.20  ? 414  TRP A CD1 1 
ATOM   3392 C  CD2 . TRP A 1 414 ? 12.568  -15.605 0.493   1.00 45.33  ? 414  TRP A CD2 1 
ATOM   3393 N  NE1 . TRP A 1 414 ? 14.750  -15.992 0.156   1.00 47.52  ? 414  TRP A NE1 1 
ATOM   3394 C  CE2 . TRP A 1 414 ? 13.746  -15.098 -0.098  1.00 40.86  ? 414  TRP A CE2 1 
ATOM   3395 C  CE3 . TRP A 1 414 ? 11.384  -14.870 0.374   1.00 42.39  ? 414  TRP A CE3 1 
ATOM   3396 C  CZ2 . TRP A 1 414 ? 13.768  -13.889 -0.795  1.00 45.42  ? 414  TRP A CZ2 1 
ATOM   3397 C  CZ3 . TRP A 1 414 ? 11.407  -13.671 -0.320  1.00 35.80  ? 414  TRP A CZ3 1 
ATOM   3398 C  CH2 . TRP A 1 414 ? 12.591  -13.192 -0.895  1.00 38.11  ? 414  TRP A CH2 1 
ATOM   3399 N  N   . GLU A 1 415 ? 9.716   -17.745 -0.011  1.00 37.99  ? 415  GLU A N   1 
ATOM   3400 C  CA  . GLU A 1 415 ? 8.902   -17.241 -1.103  1.00 42.18  ? 415  GLU A CA  1 
ATOM   3401 C  C   . GLU A 1 415 ? 8.317   -15.878 -0.735  1.00 36.59  ? 415  GLU A C   1 
ATOM   3402 O  O   . GLU A 1 415 ? 7.991   -15.620 0.427   1.00 28.76  ? 415  GLU A O   1 
ATOM   3403 C  CB  . GLU A 1 415 ? 7.762   -18.229 -1.375  1.00 55.40  ? 415  GLU A CB  1 
ATOM   3404 C  CG  . GLU A 1 415 ? 6.747   -17.749 -2.401  1.00 72.70  ? 415  GLU A CG  1 
ATOM   3405 C  CD  . GLU A 1 415 ? 5.490   -18.600 -2.442  1.00 77.84  ? 415  GLU A CD  1 
ATOM   3406 O  OE1 . GLU A 1 415 ? 4.752   -18.647 -1.427  1.00 74.17  ? 415  GLU A OE1 1 
ATOM   3407 O  OE2 . GLU A 1 415 ? 5.232   -19.205 -3.505  1.00 83.13  ? 415  GLU A OE2 1 
ATOM   3408 N  N   . PHE A 1 416 ? 8.181   -15.013 -1.735  1.00 37.71  ? 416  PHE A N   1 
ATOM   3409 C  CA  . PHE A 1 416 ? 7.630   -13.679 -1.528  1.00 35.32  ? 416  PHE A CA  1 
ATOM   3410 C  C   . PHE A 1 416 ? 6.104   -13.636 -1.456  1.00 35.40  ? 416  PHE A C   1 
ATOM   3411 O  O   . PHE A 1 416 ? 5.400   -14.295 -2.221  1.00 36.48  ? 416  PHE A O   1 
ATOM   3412 C  CB  . PHE A 1 416 ? 8.104   -12.725 -2.637  1.00 31.43  ? 416  PHE A CB  1 
ATOM   3413 C  CG  . PHE A 1 416 ? 7.422   -11.368 -2.615  1.00 34.55  ? 416  PHE A CG  1 
ATOM   3414 C  CD1 . PHE A 1 416 ? 7.373   -10.605 -1.437  1.00 34.85  ? 416  PHE A CD1 1 
ATOM   3415 C  CD2 . PHE A 1 416 ? 6.821   -10.859 -3.768  1.00 25.54  ? 416  PHE A CD2 1 
ATOM   3416 C  CE1 . PHE A 1 416 ? 6.737   -9.362  -1.410  1.00 27.64  ? 416  PHE A CE1 1 
ATOM   3417 C  CE2 . PHE A 1 416 ? 6.183   -9.619  -3.759  1.00 31.09  ? 416  PHE A CE2 1 
ATOM   3418 C  CZ  . PHE A 1 416 ? 6.140   -8.867  -2.575  1.00 40.97  ? 416  PHE A CZ  1 
ATOM   3419 N  N   . VAL A 1 417 ? 5.599   -12.846 -0.525  1.00 35.06  ? 417  VAL A N   1 
ATOM   3420 C  CA  . VAL A 1 417 ? 4.167   -12.656 -0.392  1.00 35.06  ? 417  VAL A CA  1 
ATOM   3421 C  C   . VAL A 1 417 ? 4.009   -11.149 -0.182  1.00 32.29  ? 417  VAL A C   1 
ATOM   3422 O  O   . VAL A 1 417 ? 4.644   -10.565 0.695   1.00 28.43  ? 417  VAL A O   1 
ATOM   3423 C  CB  . VAL A 1 417 ? 3.555   -13.498 0.775   1.00 36.00  ? 417  VAL A CB  1 
ATOM   3424 C  CG1 . VAL A 1 417 ? 4.123   -13.081 2.135   1.00 19.95  ? 417  VAL A CG1 1 
ATOM   3425 C  CG2 . VAL A 1 417 ? 2.028   -13.402 0.750   1.00 37.73  ? 417  VAL A CG2 1 
ATOM   3426 N  N   . ASN A 1 418 ? 3.265   -10.508 -1.073  1.00 32.94  ? 418  ASN A N   1 
ATOM   3427 C  CA  . ASN A 1 418 ? 3.057   -9.066  -0.998  1.00 35.68  ? 418  ASN A CA  1 
ATOM   3428 C  C   . ASN A 1 418 ? 2.034   -8.655  0.057   1.00 35.51  ? 418  ASN A C   1 
ATOM   3429 O  O   . ASN A 1 418 ? 0.860   -8.460  -0.237  1.00 29.96  ? 418  ASN A O   1 
ATOM   3430 C  CB  . ASN A 1 418 ? 2.646   -8.525  -2.370  1.00 46.01  ? 418  ASN A CB  1 
ATOM   3431 C  CG  . ASN A 1 418 ? 2.536   -7.010  -2.394  1.00 60.99  ? 418  ASN A CG  1 
ATOM   3432 O  OD1 . ASN A 1 418 ? 2.496   -6.354  -1.351  1.00 62.96  ? 418  ASN A OD1 1 
ATOM   3433 N  ND2 . ASN A 1 418 ? 2.498   -6.445  -3.594  1.00 68.49  ? 418  ASN A ND2 1 
ATOM   3434 N  N   . THR A 1 419 ? 2.483   -8.537  1.294   1.00 46.69  ? 419  THR A N   1 
ATOM   3435 C  CA  . THR A 1 419 ? 1.597   -8.130  2.375   1.00 63.71  ? 419  THR A CA  1 
ATOM   3436 C  C   . THR A 1 419 ? 2.244   -6.930  3.058   1.00 60.32  ? 419  THR A C   1 
ATOM   3437 O  O   . THR A 1 419 ? 2.945   -7.062  4.070   1.00 62.05  ? 419  THR A O   1 
ATOM   3438 C  CB  . THR A 1 419 ? 1.325   -9.290  3.387   1.00 77.08  ? 419  THR A CB  1 
ATOM   3439 O  OG1 . THR A 1 419 ? 0.667   -10.374 2.710   1.00 82.34  ? 419  THR A OG1 1 
ATOM   3440 C  CG2 . THR A 1 419 ? 0.429   -8.809  4.546   1.00 75.31  ? 419  THR A CG2 1 
ATOM   3441 N  N   . PRO A 1 420 ? 2.053   -5.741  2.470   1.00 54.57  ? 420  PRO A N   1 
ATOM   3442 C  CA  . PRO A 1 420 ? 2.616   -4.512  3.013   1.00 51.48  ? 420  PRO A CA  1 
ATOM   3443 C  C   . PRO A 1 420 ? 2.357   -4.354  4.515   1.00 45.78  ? 420  PRO A C   1 
ATOM   3444 O  O   . PRO A 1 420 ? 1.404   -4.909  5.058   1.00 46.63  ? 420  PRO A O   1 
ATOM   3445 C  CB  . PRO A 1 420 ? 1.921   -3.436  2.182   1.00 52.53  ? 420  PRO A CB  1 
ATOM   3446 C  CG  . PRO A 1 420 ? 1.785   -4.095  0.854   1.00 52.11  ? 420  PRO A CG  1 
ATOM   3447 C  CD  . PRO A 1 420 ? 1.264   -5.455  1.259   1.00 53.01  ? 420  PRO A CD  1 
ATOM   3448 N  N   . PRO A 1 421 ? 3.239   -3.624  5.206   1.00 39.07  ? 421  PRO A N   1 
ATOM   3449 C  CA  . PRO A 1 421 ? 4.392   -3.009  4.539   1.00 32.07  ? 421  PRO A CA  1 
ATOM   3450 C  C   . PRO A 1 421 ? 5.497   -4.009  4.164   1.00 26.90  ? 421  PRO A C   1 
ATOM   3451 O  O   . PRO A 1 421 ? 5.742   -4.978  4.895   1.00 15.98  ? 421  PRO A O   1 
ATOM   3452 C  CB  . PRO A 1 421 ? 4.852   -1.969  5.557   1.00 29.56  ? 421  PRO A CB  1 
ATOM   3453 C  CG  . PRO A 1 421 ? 4.518   -2.620  6.881   1.00 32.01  ? 421  PRO A CG  1 
ATOM   3454 C  CD  . PRO A 1 421 ? 3.159   -3.238  6.628   1.00 34.70  ? 421  PRO A CD  1 
ATOM   3455 N  N   . LEU A 1 422 ? 6.056   -3.846  2.964   1.00 32.63  ? 422  LEU A N   1 
ATOM   3456 C  CA  . LEU A 1 422 ? 7.147   -4.710  2.496   1.00 37.95  ? 422  LEU A CA  1 
ATOM   3457 C  C   . LEU A 1 422 ? 8.460   -4.100  2.964   1.00 44.44  ? 422  LEU A C   1 
ATOM   3458 O  O   . LEU A 1 422 ? 8.562   -2.872  3.099   1.00 44.58  ? 422  LEU A O   1 
ATOM   3459 C  CB  . LEU A 1 422 ? 7.188   -4.815  0.969   1.00 34.88  ? 422  LEU A CB  1 
ATOM   3460 C  CG  . LEU A 1 422 ? 5.970   -5.312  0.193   1.00 58.95  ? 422  LEU A CG  1 
ATOM   3461 C  CD1 . LEU A 1 422 ? 6.394   -5.597  -1.245  1.00 69.49  ? 422  LEU A CD1 1 
ATOM   3462 C  CD2 . LEU A 1 422 ? 5.387   -6.566  0.828   1.00 60.42  ? 422  LEU A CD2 1 
ATOM   3463 N  N   . VAL A 1 423 ? 9.449   -4.947  3.247   1.00 47.84  ? 423  VAL A N   1 
ATOM   3464 C  CA  . VAL A 1 423 ? 10.753  -4.458  3.683   1.00 44.30  ? 423  VAL A CA  1 
ATOM   3465 C  C   . VAL A 1 423 ? 11.614  -4.195  2.441   1.00 37.83  ? 423  VAL A C   1 
ATOM   3466 O  O   . VAL A 1 423 ? 11.564  -4.931  1.437   1.00 20.41  ? 423  VAL A O   1 
ATOM   3467 C  CB  . VAL A 1 423 ? 11.455  -5.411  4.707   1.00 47.85  ? 423  VAL A CB  1 
ATOM   3468 C  CG1 . VAL A 1 423 ? 10.461  -5.921  5.723   1.00 43.36  ? 423  VAL A CG1 1 
ATOM   3469 C  CG2 . VAL A 1 423 ? 12.143  -6.561  4.025   1.00 55.22  ? 423  VAL A CG2 1 
ATOM   3470 N  N   . LYS A 1 424 ? 12.353  -3.096  2.493   1.00 44.02  ? 424  LYS A N   1 
ATOM   3471 C  CA  . LYS A 1 424 ? 13.190  -2.690  1.375   1.00 43.78  ? 424  LYS A CA  1 
ATOM   3472 C  C   . LYS A 1 424 ? 14.405  -1.919  1.875   1.00 39.84  ? 424  LYS A C   1 
ATOM   3473 O  O   . LYS A 1 424 ? 14.529  -1.630  3.075   1.00 35.69  ? 424  LYS A O   1 
ATOM   3474 C  CB  . LYS A 1 424 ? 12.384  -1.810  0.405   1.00 42.69  ? 424  LYS A CB  1 
ATOM   3475 C  CG  . LYS A 1 424 ? 11.734  -0.596  1.075   1.00 56.95  ? 424  LYS A CG  1 
ATOM   3476 C  CD  . LYS A 1 424 ? 11.452  0.528   0.087   1.00 65.04  ? 424  LYS A CD  1 
ATOM   3477 C  CE  . LYS A 1 424 ? 11.221  1.845   0.821   1.00 65.73  ? 424  LYS A CE  1 
ATOM   3478 N  NZ  . LYS A 1 424 ? 11.345  3.012   -0.093  1.00 69.62  ? 424  LYS A NZ  1 
ATOM   3479 N  N   . LEU A 1 425 ? 15.311  -1.624  0.946   1.00 38.75  ? 425  LEU A N   1 
ATOM   3480 C  CA  . LEU A 1 425 ? 16.527  -0.876  1.243   1.00 38.08  ? 425  LEU A CA  1 
ATOM   3481 C  C   . LEU A 1 425 ? 16.178  0.606   1.233   1.00 35.19  ? 425  LEU A C   1 
ATOM   3482 O  O   . LEU A 1 425 ? 15.725  1.141   0.209   1.00 32.50  ? 425  LEU A O   1 
ATOM   3483 C  CB  . LEU A 1 425 ? 17.605  -1.168  0.191   1.00 46.13  ? 425  LEU A CB  1 
ATOM   3484 C  CG  . LEU A 1 425 ? 18.174  -2.589  0.085   1.00 48.00  ? 425  LEU A CG  1 
ATOM   3485 C  CD1 . LEU A 1 425 ? 19.204  -2.668  -1.044  1.00 45.00  ? 425  LEU A CD1 1 
ATOM   3486 C  CD2 . LEU A 1 425 ? 18.804  -2.993  1.408   1.00 56.10  ? 425  LEU A CD2 1 
ATOM   3487 N  N   . TRP A 1 426 ? 16.387  1.268   2.364   1.00 30.51  ? 426  TRP A N   1 
ATOM   3488 C  CA  . TRP A 1 426 ? 16.062  2.684   2.466   1.00 38.70  ? 426  TRP A CA  1 
ATOM   3489 C  C   . TRP A 1 426 ? 16.925  3.614   1.619   1.00 35.18  ? 426  TRP A C   1 
ATOM   3490 O  O   . TRP A 1 426 ? 16.568  4.768   1.406   1.00 34.05  ? 426  TRP A O   1 
ATOM   3491 C  CB  . TRP A 1 426 ? 16.071  3.116   3.922   1.00 59.35  ? 426  TRP A CB  1 
ATOM   3492 C  CG  . TRP A 1 426 ? 15.029  2.416   4.717   1.00 81.56  ? 426  TRP A CG  1 
ATOM   3493 C  CD1 . TRP A 1 426 ? 15.213  1.340   5.524   1.00 91.77  ? 426  TRP A CD1 1 
ATOM   3494 C  CD2 . TRP A 1 426 ? 13.628  2.733   4.774   1.00 97.55  ? 426  TRP A CD2 1 
ATOM   3495 N  NE1 . TRP A 1 426 ? 14.018  0.960   6.085   1.00 105.34 ? 426  TRP A NE1 1 
ATOM   3496 C  CE2 . TRP A 1 426 ? 13.026  1.796   5.643   1.00 106.45 ? 426  TRP A CE2 1 
ATOM   3497 C  CE3 . TRP A 1 426 ? 12.821  3.713   4.178   1.00 101.87 ? 426  TRP A CE3 1 
ATOM   3498 C  CZ2 . TRP A 1 426 ? 11.652  1.811   5.934   1.00 105.75 ? 426  TRP A CZ2 1 
ATOM   3499 C  CZ3 . TRP A 1 426 ? 11.452  3.727   4.467   1.00 102.51 ? 426  TRP A CZ3 1 
ATOM   3500 C  CH2 . TRP A 1 426 ? 10.886  2.781   5.337   1.00 101.28 ? 426  TRP A CH2 1 
ATOM   3501 N  N   . TYR A 1 427 ? 18.060  3.100   1.154   1.00 33.25  ? 427  TYR A N   1 
ATOM   3502 C  CA  . TYR A 1 427 ? 19.001  3.835   0.309   1.00 29.65  ? 427  TYR A CA  1 
ATOM   3503 C  C   . TYR A 1 427 ? 20.076  2.834   -0.090  1.00 31.60  ? 427  TYR A C   1 
ATOM   3504 O  O   . TYR A 1 427 ? 19.989  1.651   0.255   1.00 28.96  ? 427  TYR A O   1 
ATOM   3505 C  CB  . TYR A 1 427 ? 19.643  5.017   1.070   1.00 29.30  ? 427  TYR A CB  1 
ATOM   3506 C  CG  . TYR A 1 427 ? 20.525  4.639   2.263   1.00 25.11  ? 427  TYR A CG  1 
ATOM   3507 C  CD1 . TYR A 1 427 ? 21.846  4.200   2.074   1.00 18.35  ? 427  TYR A CD1 1 
ATOM   3508 C  CD2 . TYR A 1 427 ? 20.040  4.723   3.578   1.00 16.87  ? 427  TYR A CD2 1 
ATOM   3509 C  CE1 . TYR A 1 427 ? 22.665  3.850   3.160   1.00 24.56  ? 427  TYR A CE1 1 
ATOM   3510 C  CE2 . TYR A 1 427 ? 20.851  4.378   4.673   1.00 29.73  ? 427  TYR A CE2 1 
ATOM   3511 C  CZ  . TYR A 1 427 ? 22.168  3.943   4.457   1.00 35.91  ? 427  TYR A CZ  1 
ATOM   3512 O  OH  . TYR A 1 427 ? 22.996  3.634   5.527   1.00 25.67  ? 427  TYR A OH  1 
ATOM   3513 N  N   . GLN A 1 428 ? 21.081  3.310   -0.814  1.00 36.52  ? 428  GLN A N   1 
ATOM   3514 C  CA  . GLN A 1 428 ? 22.211  2.489   -1.247  1.00 41.24  ? 428  GLN A CA  1 
ATOM   3515 C  C   . GLN A 1 428 ? 23.306  3.466   -1.602  1.00 34.01  ? 428  GLN A C   1 
ATOM   3516 O  O   . GLN A 1 428 ? 23.145  4.270   -2.527  1.00 36.10  ? 428  GLN A O   1 
ATOM   3517 C  CB  . GLN A 1 428 ? 21.863  1.664   -2.493  1.00 57.15  ? 428  GLN A CB  1 
ATOM   3518 C  CG  . GLN A 1 428 ? 20.952  0.467   -2.262  1.00 66.13  ? 428  GLN A CG  1 
ATOM   3519 C  CD  . GLN A 1 428 ? 20.336  -0.029  -3.554  1.00 82.30  ? 428  GLN A CD  1 
ATOM   3520 O  OE1 . GLN A 1 428 ? 20.966  -0.764  -4.317  1.00 87.41  ? 428  GLN A OE1 1 
ATOM   3521 N  NE2 . GLN A 1 428 ? 19.102  0.384   -3.816  1.00 86.99  ? 428  GLN A NE2 1 
ATOM   3522 N  N   . LEU A 1 429 ? 24.389  3.449   -0.837  1.00 28.74  ? 429  LEU A N   1 
ATOM   3523 C  CA  . LEU A 1 429 ? 25.501  4.349   -1.120  1.00 31.52  ? 429  LEU A CA  1 
ATOM   3524 C  C   . LEU A 1 429 ? 26.038  3.999   -2.505  1.00 37.72  ? 429  LEU A C   1 
ATOM   3525 O  O   . LEU A 1 429 ? 26.075  2.823   -2.875  1.00 40.35  ? 429  LEU A O   1 
ATOM   3526 C  CB  . LEU A 1 429 ? 26.600  4.192   -0.077  1.00 19.64  ? 429  LEU A CB  1 
ATOM   3527 C  CG  . LEU A 1 429 ? 26.260  4.721   1.308   1.00 25.37  ? 429  LEU A CG  1 
ATOM   3528 C  CD1 . LEU A 1 429 ? 27.392  4.404   2.275   1.00 26.06  ? 429  LEU A CD1 1 
ATOM   3529 C  CD2 . LEU A 1 429 ? 26.014  6.221   1.214   1.00 25.85  ? 429  LEU A CD2 1 
ATOM   3530 N  N   . GLU A 1 430 ? 26.418  5.013   -3.276  1.00 36.04  ? 430  GLU A N   1 
ATOM   3531 C  CA  . GLU A 1 430 ? 26.932  4.789   -4.617  1.00 43.50  ? 430  GLU A CA  1 
ATOM   3532 C  C   . GLU A 1 430 ? 28.141  3.860   -4.661  1.00 50.70  ? 430  GLU A C   1 
ATOM   3533 O  O   . GLU A 1 430 ? 28.842  3.668   -3.656  1.00 50.92  ? 430  GLU A O   1 
ATOM   3534 C  CB  . GLU A 1 430 ? 27.259  6.118   -5.303  1.00 45.44  ? 430  GLU A CB  1 
ATOM   3535 C  CG  . GLU A 1 430 ? 26.032  6.912   -5.706  1.00 56.23  ? 430  GLU A CG  1 
ATOM   3536 C  CD  . GLU A 1 430 ? 25.064  6.096   -6.545  1.00 63.01  ? 430  GLU A CD  1 
ATOM   3537 O  OE1 . GLU A 1 430 ? 25.297  5.963   -7.769  1.00 60.19  ? 430  GLU A OE1 1 
ATOM   3538 O  OE2 . GLU A 1 430 ? 24.080  5.578   -5.969  1.00 61.44  ? 430  GLU A OE2 1 
ATOM   3539 N  N   . LYS A 1 431 ? 28.352  3.249   -5.823  1.00 50.18  ? 431  LYS A N   1 
ATOM   3540 C  CA  . LYS A 1 431 ? 29.475  2.346   -5.998  1.00 51.15  ? 431  LYS A CA  1 
ATOM   3541 C  C   . LYS A 1 431 ? 30.698  3.199   -6.301  1.00 51.91  ? 431  LYS A C   1 
ATOM   3542 O  O   . LYS A 1 431 ? 31.785  2.987   -5.758  1.00 51.12  ? 431  LYS A O   1 
ATOM   3543 C  CB  . LYS A 1 431 ? 29.200  1.370   -7.147  1.00 46.67  ? 431  LYS A CB  1 
ATOM   3544 C  CG  . LYS A 1 431 ? 29.433  -0.101  -6.810  1.00 36.75  ? 431  LYS A CG  1 
ATOM   3545 C  CD  . LYS A 1 431 ? 28.347  -0.683  -5.901  1.00 35.26  ? 431  LYS A CD  1 
ATOM   3546 C  CE  . LYS A 1 431 ? 28.549  -0.325  -4.423  1.00 45.24  ? 431  LYS A CE  1 
ATOM   3547 N  NZ  . LYS A 1 431 ? 27.521  -0.943  -3.520  1.00 46.11  ? 431  LYS A NZ  1 
ATOM   3548 N  N   . GLU A 1 432 ? 30.481  4.218   -7.118  1.00 55.08  ? 432  GLU A N   1 
ATOM   3549 C  CA  . GLU A 1 432 ? 31.544  5.119   -7.521  1.00 58.46  ? 432  GLU A CA  1 
ATOM   3550 C  C   . GLU A 1 432 ? 31.095  6.543   -7.262  1.00 56.03  ? 432  GLU A C   1 
ATOM   3551 O  O   . GLU A 1 432 ? 29.895  6.811   -7.154  1.00 52.94  ? 432  GLU A O   1 
ATOM   3552 C  CB  . GLU A 1 432 ? 31.846  4.940   -9.018  1.00 62.32  ? 432  GLU A CB  1 
ATOM   3553 C  CG  . GLU A 1 432 ? 32.574  3.644   -9.376  1.00 79.53  ? 432  GLU A CG  1 
ATOM   3554 C  CD  . GLU A 1 432 ? 33.974  3.549   -8.769  1.00 94.87  ? 432  GLU A CD  1 
ATOM   3555 O  OE1 . GLU A 1 432 ? 34.658  4.588   -8.630  1.00 100.34 ? 432  GLU A OE1 1 
ATOM   3556 O  OE2 . GLU A 1 432 ? 34.400  2.424   -8.435  1.00 104.86 ? 432  GLU A OE2 1 
ATOM   3557 N  N   . PRO A 1 433 ? 32.054  7.464   -7.087  1.00 56.53  ? 433  PRO A N   1 
ATOM   3558 C  CA  . PRO A 1 433 ? 31.750  8.878   -6.841  1.00 57.68  ? 433  PRO A CA  1 
ATOM   3559 C  C   . PRO A 1 433 ? 30.872  9.412   -7.980  1.00 60.94  ? 433  PRO A C   1 
ATOM   3560 O  O   . PRO A 1 433 ? 30.997  8.970   -9.131  1.00 63.00  ? 433  PRO A O   1 
ATOM   3561 C  CB  . PRO A 1 433 ? 33.132  9.528   -6.869  1.00 60.09  ? 433  PRO A CB  1 
ATOM   3562 C  CG  . PRO A 1 433 ? 34.023  8.453   -6.366  1.00 59.47  ? 433  PRO A CG  1 
ATOM   3563 C  CD  . PRO A 1 433 ? 33.507  7.219   -7.052  1.00 56.70  ? 433  PRO A CD  1 
ATOM   3564 N  N   . ILE A 1 434 ? 30.012  10.380  -7.674  1.00 60.69  ? 434  ILE A N   1 
ATOM   3565 C  CA  . ILE A 1 434 ? 29.113  10.938  -8.691  1.00 55.19  ? 434  ILE A CA  1 
ATOM   3566 C  C   . ILE A 1 434 ? 29.723  12.082  -9.515  1.00 50.25  ? 434  ILE A C   1 
ATOM   3567 O  O   . ILE A 1 434 ? 30.188  13.083  -8.963  1.00 44.84  ? 434  ILE A O   1 
ATOM   3568 C  CB  . ILE A 1 434 ? 27.777  11.443  -8.074  1.00 46.61  ? 434  ILE A CB  1 
ATOM   3569 C  CG1 . ILE A 1 434 ? 27.282  10.492  -6.970  1.00 42.55  ? 434  ILE A CG1 1 
ATOM   3570 C  CG2 . ILE A 1 434 ? 26.725  11.540  -9.177  1.00 28.59  ? 434  ILE A CG2 1 
ATOM   3571 C  CD1 . ILE A 1 434 ? 26.352  11.148  -5.919  1.00 20.95  ? 434  ILE A CD1 1 
ATOM   3572 N  N   . VAL A 1 435 ? 29.743  11.920  -10.836 1.00 47.23  ? 435  VAL A N   1 
ATOM   3573 C  CA  . VAL A 1 435 ? 30.263  12.967  -11.717 1.00 45.51  ? 435  VAL A CA  1 
ATOM   3574 C  C   . VAL A 1 435 ? 29.186  14.052  -11.772 1.00 51.58  ? 435  VAL A C   1 
ATOM   3575 O  O   . VAL A 1 435 ? 28.008  13.761  -12.016 1.00 50.58  ? 435  VAL A O   1 
ATOM   3576 C  CB  . VAL A 1 435 ? 30.555  12.438  -13.166 1.00 34.04  ? 435  VAL A CB  1 
ATOM   3577 C  CG1 . VAL A 1 435 ? 30.915  13.591  -14.110 1.00 2.00   ? 435  VAL A CG1 1 
ATOM   3578 C  CG2 . VAL A 1 435 ? 31.692  11.432  -13.140 1.00 25.22  ? 435  VAL A CG2 1 
ATOM   3579 N  N   . GLY A 1 436 ? 29.582  15.293  -11.509 1.00 51.31  ? 436  GLY A N   1 
ATOM   3580 C  CA  . GLY A 1 436 ? 28.626  16.385  -11.531 1.00 43.45  ? 436  GLY A CA  1 
ATOM   3581 C  C   . GLY A 1 436 ? 28.361  16.882  -10.129 1.00 30.60  ? 436  GLY A C   1 
ATOM   3582 O  O   . GLY A 1 436 ? 28.708  18.006  -9.803  1.00 26.86  ? 436  GLY A O   1 
ATOM   3583 N  N   . ALA A 1 437 ? 27.787  16.023  -9.294  1.00 32.38  ? 437  ALA A N   1 
ATOM   3584 C  CA  . ALA A 1 437 ? 27.471  16.360  -7.907  1.00 34.57  ? 437  ALA A CA  1 
ATOM   3585 C  C   . ALA A 1 437 ? 28.616  17.051  -7.167  1.00 37.80  ? 437  ALA A C   1 
ATOM   3586 O  O   . ALA A 1 437 ? 29.813  16.799  -7.413  1.00 34.04  ? 437  ALA A O   1 
ATOM   3587 C  CB  . ALA A 1 437 ? 27.043  15.110  -7.142  1.00 30.22  ? 437  ALA A CB  1 
ATOM   3588 N  N   . GLU A 1 438 ? 28.225  17.898  -6.228  1.00 34.79  ? 438  GLU A N   1 
ATOM   3589 C  CA  . GLU A 1 438 ? 29.169  18.649  -5.424  1.00 37.67  ? 438  GLU A CA  1 
ATOM   3590 C  C   . GLU A 1 438 ? 29.913  17.758  -4.434  1.00 38.01  ? 438  GLU A C   1 
ATOM   3591 O  O   . GLU A 1 438 ? 29.414  16.695  -4.042  1.00 41.10  ? 438  GLU A O   1 
ATOM   3592 C  CB  . GLU A 1 438 ? 28.415  19.739  -4.682  1.00 42.57  ? 438  GLU A CB  1 
ATOM   3593 C  CG  . GLU A 1 438 ? 29.250  20.580  -3.759  1.00 42.20  ? 438  GLU A CG  1 
ATOM   3594 C  CD  . GLU A 1 438 ? 28.486  21.771  -3.260  1.00 50.56  ? 438  GLU A CD  1 
ATOM   3595 O  OE1 . GLU A 1 438 ? 27.252  21.666  -3.079  1.00 66.86  ? 438  GLU A OE1 1 
ATOM   3596 O  OE2 . GLU A 1 438 ? 29.114  22.823  -3.066  1.00 53.82  ? 438  GLU A OE2 1 
ATOM   3597 N  N   . THR A 1 439 ? 31.107  18.197  -4.042  1.00 27.15  ? 439  THR A N   1 
ATOM   3598 C  CA  . THR A 1 439 ? 31.934  17.464  -3.092  1.00 26.39  ? 439  THR A CA  1 
ATOM   3599 C  C   . THR A 1 439 ? 32.051  18.233  -1.776  1.00 31.39  ? 439  THR A C   1 
ATOM   3600 O  O   . THR A 1 439 ? 32.360  19.422  -1.779  1.00 31.28  ? 439  THR A O   1 
ATOM   3601 C  CB  . THR A 1 439 ? 33.361  17.266  -3.641  1.00 26.32  ? 439  THR A CB  1 
ATOM   3602 O  OG1 . THR A 1 439 ? 33.321  16.557  -4.894  1.00 3.81   ? 439  THR A OG1 1 
ATOM   3603 C  CG2 . THR A 1 439 ? 34.226  16.517  -2.618  1.00 26.05  ? 439  THR A CG2 1 
ATOM   3604 N  N   . PHE A 1 440 ? 31.823  17.554  -0.657  1.00 35.05  ? 440  PHE A N   1 
ATOM   3605 C  CA  . PHE A 1 440 ? 31.920  18.179  0.661   1.00 34.99  ? 440  PHE A CA  1 
ATOM   3606 C  C   . PHE A 1 440 ? 33.028  17.543  1.474   1.00 31.95  ? 440  PHE A C   1 
ATOM   3607 O  O   . PHE A 1 440 ? 32.894  16.409  1.947   1.00 33.11  ? 440  PHE A O   1 
ATOM   3608 C  CB  . PHE A 1 440 ? 30.615  18.026  1.451   1.00 46.23  ? 440  PHE A CB  1 
ATOM   3609 C  CG  . PHE A 1 440 ? 29.485  18.896  0.963   1.00 63.11  ? 440  PHE A CG  1 
ATOM   3610 C  CD1 . PHE A 1 440 ? 28.951  18.729  -0.313  1.00 66.66  ? 440  PHE A CD1 1 
ATOM   3611 C  CD2 . PHE A 1 440 ? 28.930  19.860  1.799   1.00 62.43  ? 440  PHE A CD2 1 
ATOM   3612 C  CE1 . PHE A 1 440 ? 27.886  19.505  -0.741  1.00 66.76  ? 440  PHE A CE1 1 
ATOM   3613 C  CE2 . PHE A 1 440 ? 27.863  20.643  1.380   1.00 64.11  ? 440  PHE A CE2 1 
ATOM   3614 C  CZ  . PHE A 1 440 ? 27.339  20.465  0.108   1.00 71.25  ? 440  PHE A CZ  1 
ATOM   3615 N  N   . TYR A 1 441 ? 34.142  18.250  1.598   1.00 32.73  ? 441  TYR A N   1 
ATOM   3616 C  CA  . TYR A 1 441 ? 35.266  17.763  2.398   1.00 31.93  ? 441  TYR A CA  1 
ATOM   3617 C  C   . TYR A 1 441 ? 34.873  18.167  3.811   1.00 22.72  ? 441  TYR A C   1 
ATOM   3618 O  O   . TYR A 1 441 ? 34.983  19.335  4.181   1.00 35.51  ? 441  TYR A O   1 
ATOM   3619 C  CB  . TYR A 1 441 ? 36.584  18.441  1.973   1.00 29.28  ? 441  TYR A CB  1 
ATOM   3620 C  CG  . TYR A 1 441 ? 37.144  17.928  0.656   1.00 34.07  ? 441  TYR A CG  1 
ATOM   3621 C  CD1 . TYR A 1 441 ? 36.701  18.436  -0.568  1.00 46.82  ? 441  TYR A CD1 1 
ATOM   3622 C  CD2 . TYR A 1 441 ? 38.091  16.906  0.634   1.00 34.94  ? 441  TYR A CD2 1 
ATOM   3623 C  CE1 . TYR A 1 441 ? 37.187  17.931  -1.778  1.00 46.95  ? 441  TYR A CE1 1 
ATOM   3624 C  CE2 . TYR A 1 441 ? 38.578  16.394  -0.564  1.00 28.19  ? 441  TYR A CE2 1 
ATOM   3625 C  CZ  . TYR A 1 441 ? 38.123  16.907  -1.766  1.00 39.45  ? 441  TYR A CZ  1 
ATOM   3626 O  OH  . TYR A 1 441 ? 38.586  16.370  -2.945  1.00 40.16  ? 441  TYR A OH  1 
ATOM   3627 N  N   . VAL A 1 442 ? 34.321  17.227  4.561   1.00 11.93  ? 442  VAL A N   1 
ATOM   3628 C  CA  . VAL A 1 442 ? 33.862  17.518  5.912   1.00 21.15  ? 442  VAL A CA  1 
ATOM   3629 C  C   . VAL A 1 442 ? 34.911  17.269  6.997   1.00 14.98  ? 442  VAL A C   1 
ATOM   3630 O  O   . VAL A 1 442 ? 35.912  16.589  6.759   1.00 17.68  ? 442  VAL A O   1 
ATOM   3631 C  CB  . VAL A 1 442 ? 32.542  16.734  6.246   1.00 32.44  ? 442  VAL A CB  1 
ATOM   3632 C  CG1 . VAL A 1 442 ? 31.448  17.077  5.249   1.00 22.89  ? 442  VAL A CG1 1 
ATOM   3633 C  CG2 . VAL A 1 442 ? 32.785  15.224  6.259   1.00 43.91  ? 442  VAL A CG2 1 
ATOM   3634 N  N   . ASP A 1 443 ? 34.693  17.855  8.172   1.00 8.45   ? 443  ASP A N   1 
ATOM   3635 C  CA  . ASP A 1 443 ? 35.598  17.678  9.307   1.00 24.98  ? 443  ASP A CA  1 
ATOM   3636 C  C   . ASP A 1 443 ? 35.063  18.271  10.623  1.00 28.91  ? 443  ASP A C   1 
ATOM   3637 O  O   . ASP A 1 443 ? 34.579  19.405  10.678  1.00 29.64  ? 443  ASP A O   1 
ATOM   3638 C  CB  . ASP A 1 443 ? 36.988  18.254  8.997   1.00 37.63  ? 443  ASP A CB  1 
ATOM   3639 C  CG  . ASP A 1 443 ? 38.123  17.368  9.510   1.00 48.10  ? 443  ASP A CG  1 
ATOM   3640 O  OD1 . ASP A 1 443 ? 38.076  16.921  10.680  1.00 35.32  ? 443  ASP A OD1 1 
ATOM   3641 O  OD2 . ASP A 1 443 ? 39.067  17.114  8.729   1.00 65.38  ? 443  ASP A OD2 1 
ATOM   3642 N  N   . GLY A 1 444 ? 35.145  17.475  11.680  1.00 38.01  ? 444  GLY A N   1 
ATOM   3643 C  CA  . GLY A 1 444 ? 34.693  17.905  12.988  1.00 46.83  ? 444  GLY A CA  1 
ATOM   3644 C  C   . GLY A 1 444 ? 35.772  17.594  14.008  1.00 51.48  ? 444  GLY A C   1 
ATOM   3645 O  O   . GLY A 1 444 ? 36.388  16.519  13.965  1.00 47.72  ? 444  GLY A O   1 
ATOM   3646 N  N   . ALA A 1 445 ? 36.025  18.541  14.904  1.00 55.57  ? 445  ALA A N   1 
ATOM   3647 C  CA  . ALA A 1 445 ? 37.039  18.376  15.936  1.00 58.68  ? 445  ALA A CA  1 
ATOM   3648 C  C   . ALA A 1 445 ? 36.507  18.919  17.251  1.00 63.58  ? 445  ALA A C   1 
ATOM   3649 O  O   . ALA A 1 445 ? 35.937  20.014  17.305  1.00 67.39  ? 445  ALA A O   1 
ATOM   3650 C  CB  . ALA A 1 445 ? 38.318  19.108  15.539  1.00 53.34  ? 445  ALA A CB  1 
ATOM   3651 N  N   . ALA A 1 446 ? 36.682  18.147  18.312  1.00 65.67  ? 446  ALA A N   1 
ATOM   3652 C  CA  . ALA A 1 446 ? 36.219  18.558  19.622  1.00 73.23  ? 446  ALA A CA  1 
ATOM   3653 C  C   . ALA A 1 446 ? 37.220  18.137  20.685  1.00 81.29  ? 446  ALA A C   1 
ATOM   3654 O  O   . ALA A 1 446 ? 37.928  17.140  20.539  1.00 85.97  ? 446  ALA A O   1 
ATOM   3655 C  CB  . ALA A 1 446 ? 34.856  17.947  19.909  1.00 74.37  ? 446  ALA A CB  1 
ATOM   3656 N  N   . ASN A 1 447 ? 37.292  18.921  21.749  1.00 84.72  ? 447  ASN A N   1 
ATOM   3657 C  CA  . ASN A 1 447 ? 38.185  18.628  22.855  1.00 83.60  ? 447  ASN A CA  1 
ATOM   3658 C  C   . ASN A 1 447 ? 37.377  17.668  23.716  1.00 77.51  ? 447  ASN A C   1 
ATOM   3659 O  O   . ASN A 1 447 ? 36.348  18.055  24.266  1.00 70.88  ? 447  ASN A O   1 
ATOM   3660 C  CB  . ASN A 1 447 ? 38.487  19.922  23.616  1.00 94.09  ? 447  ASN A CB  1 
ATOM   3661 C  CG  . ASN A 1 447 ? 39.476  19.729  24.752  1.00 101.20 ? 447  ASN A CG  1 
ATOM   3662 O  OD1 . ASN A 1 447 ? 39.405  18.755  25.503  1.00 107.77 ? 447  ASN A OD1 1 
ATOM   3663 N  ND2 . ASN A 1 447 ? 40.385  20.682  24.904  1.00 101.10 ? 447  ASN A ND2 1 
ATOM   3664 N  N   . ARG A 1 448 ? 37.805  16.409  23.782  1.00 78.20  ? 448  ARG A N   1 
ATOM   3665 C  CA  . ARG A 1 448 ? 37.098  15.395  24.568  1.00 77.98  ? 448  ARG A CA  1 
ATOM   3666 C  C   . ARG A 1 448 ? 36.964  15.735  26.042  1.00 70.87  ? 448  ARG A C   1 
ATOM   3667 O  O   . ARG A 1 448 ? 36.095  15.200  26.729  1.00 62.19  ? 448  ARG A O   1 
ATOM   3668 C  CB  . ARG A 1 448 ? 37.755  14.019  24.412  1.00 87.91  ? 448  ARG A CB  1 
ATOM   3669 C  CG  . ARG A 1 448 ? 37.300  13.254  23.176  1.00 87.98  ? 448  ARG A CG  1 
ATOM   3670 C  CD  . ARG A 1 448 ? 35.800  12.978  23.206  1.00 82.96  ? 448  ARG A CD  1 
ATOM   3671 N  NE  . ARG A 1 448 ? 35.340  12.439  21.931  1.00 78.51  ? 448  ARG A NE  1 
ATOM   3672 C  CZ  . ARG A 1 448 ? 34.811  11.232  21.766  1.00 77.96  ? 448  ARG A CZ  1 
ATOM   3673 N  NH1 . ARG A 1 448 ? 34.664  10.415  22.802  1.00 77.08  ? 448  ARG A NH1 1 
ATOM   3674 N  NH2 . ARG A 1 448 ? 34.449  10.833  20.556  1.00 75.21  ? 448  ARG A NH2 1 
ATOM   3675 N  N   . GLU A 1 449 ? 37.823  16.628  26.519  1.00 71.48  ? 449  GLU A N   1 
ATOM   3676 C  CA  . GLU A 1 449 ? 37.787  17.037  27.910  1.00 75.03  ? 449  GLU A CA  1 
ATOM   3677 C  C   . GLU A 1 449 ? 36.928  18.291  28.157  1.00 78.23  ? 449  GLU A C   1 
ATOM   3678 O  O   . GLU A 1 449 ? 36.176  18.326  29.133  1.00 78.19  ? 449  GLU A O   1 
ATOM   3679 C  CB  . GLU A 1 449 ? 39.207  17.177  28.460  1.00 76.99  ? 449  GLU A CB  1 
ATOM   3680 C  CG  . GLU A 1 449 ? 40.000  15.866  28.448  1.00 68.21  ? 449  GLU A CG  1 
ATOM   3681 C  CD  . GLU A 1 449 ? 41.406  16.003  29.011  1.00 70.87  ? 449  GLU A CD  1 
ATOM   3682 O  OE1 . GLU A 1 449 ? 41.585  16.713  30.027  1.00 58.45  ? 449  GLU A OE1 1 
ATOM   3683 O  OE2 . GLU A 1 449 ? 42.333  15.388  28.437  1.00 76.09  ? 449  GLU A OE2 1 
ATOM   3684 N  N   . THR A 1 450 ? 37.022  19.313  27.299  1.00 82.65  ? 450  THR A N   1 
ATOM   3685 C  CA  . THR A 1 450 ? 36.180  20.512  27.478  1.00 88.38  ? 450  THR A CA  1 
ATOM   3686 C  C   . THR A 1 450 ? 34.810  20.286  26.821  1.00 91.96  ? 450  THR A C   1 
ATOM   3687 O  O   . THR A 1 450 ? 33.866  21.058  27.032  1.00 94.55  ? 450  THR A O   1 
ATOM   3688 C  CB  . THR A 1 450 ? 36.806  21.820  26.887  1.00 84.11  ? 450  THR A CB  1 
ATOM   3689 O  OG1 . THR A 1 450 ? 36.933  21.712  25.465  1.00 81.69  ? 450  THR A OG1 1 
ATOM   3690 C  CG2 . THR A 1 450 ? 38.156  22.102  27.493  1.00 81.61  ? 450  THR A CG2 1 
ATOM   3691 N  N   . LYS A 1 451 ? 34.734  19.233  26.004  1.00 89.86  ? 451  LYS A N   1 
ATOM   3692 C  CA  . LYS A 1 451 ? 33.529  18.834  25.270  1.00 81.70  ? 451  LYS A CA  1 
ATOM   3693 C  C   . LYS A 1 451 ? 33.004  19.941  24.367  1.00 79.03  ? 451  LYS A C   1 
ATOM   3694 O  O   . LYS A 1 451 ? 31.808  20.031  24.070  1.00 78.37  ? 451  LYS A O   1 
ATOM   3695 C  CB  . LYS A 1 451 ? 32.463  18.303  26.230  1.00 70.13  ? 451  LYS A CB  1 
ATOM   3696 C  CG  . LYS A 1 451 ? 32.964  17.089  27.000  1.00 58.22  ? 451  LYS A CG  1 
ATOM   3697 C  CD  . LYS A 1 451 ? 31.884  16.422  27.806  1.00 46.98  ? 451  LYS A CD  1 
ATOM   3698 C  CE  . LYS A 1 451 ? 30.798  15.851  26.921  1.00 44.62  ? 451  LYS A CE  1 
ATOM   3699 N  NZ  . LYS A 1 451 ? 31.279  14.681  26.142  1.00 36.28  ? 451  LYS A NZ  1 
ATOM   3700 N  N   . LEU A 1 452 ? 33.942  20.770  23.926  1.00 75.43  ? 452  LEU A N   1 
ATOM   3701 C  CA  . LEU A 1 452 ? 33.675  21.888  23.041  1.00 68.23  ? 452  LEU A CA  1 
ATOM   3702 C  C   . LEU A 1 452 ? 34.236  21.459  21.691  1.00 60.57  ? 452  LEU A C   1 
ATOM   3703 O  O   . LEU A 1 452 ? 35.343  20.923  21.610  1.00 58.63  ? 452  LEU A O   1 
ATOM   3704 C  CB  . LEU A 1 452 ? 34.412  23.136  23.540  1.00 68.99  ? 452  LEU A CB  1 
ATOM   3705 C  CG  . LEU A 1 452 ? 33.647  24.459  23.667  1.00 76.66  ? 452  LEU A CG  1 
ATOM   3706 C  CD1 . LEU A 1 452 ? 33.032  24.854  22.324  1.00 76.20  ? 452  LEU A CD1 1 
ATOM   3707 C  CD2 . LEU A 1 452 ? 32.581  24.356  24.763  1.00 75.30  ? 452  LEU A CD2 1 
ATOM   3708 N  N   . GLY A 1 453 ? 33.474  21.671  20.634  1.00 52.27  ? 453  GLY A N   1 
ATOM   3709 C  CA  . GLY A 1 453 ? 33.955  21.281  19.334  1.00 46.11  ? 453  GLY A CA  1 
ATOM   3710 C  C   . GLY A 1 453 ? 33.404  22.192  18.279  1.00 44.47  ? 453  GLY A C   1 
ATOM   3711 O  O   . GLY A 1 453 ? 32.756  23.192  18.589  1.00 40.26  ? 453  GLY A O   1 
ATOM   3712 N  N   . LYS A 1 454 ? 33.743  21.874  17.038  1.00 48.54  ? 454  LYS A N   1 
ATOM   3713 C  CA  . LYS A 1 454 ? 33.296  22.598  15.854  1.00 49.55  ? 454  LYS A CA  1 
ATOM   3714 C  C   . LYS A 1 454 ? 33.237  21.563  14.754  1.00 47.32  ? 454  LYS A C   1 
ATOM   3715 O  O   . LYS A 1 454 ? 33.960  20.562  14.784  1.00 47.98  ? 454  LYS A O   1 
ATOM   3716 C  CB  . LYS A 1 454 ? 34.300  23.663  15.415  1.00 68.32  ? 454  LYS A CB  1 
ATOM   3717 C  CG  . LYS A 1 454 ? 34.391  24.901  16.277  1.00 89.41  ? 454  LYS A CG  1 
ATOM   3718 C  CD  . LYS A 1 454 ? 35.449  25.847  15.716  1.00 101.68 ? 454  LYS A CD  1 
ATOM   3719 C  CE  . LYS A 1 454 ? 35.588  27.099  16.564  1.00 105.63 ? 454  LYS A CE  1 
ATOM   3720 N  NZ  . LYS A 1 454 ? 35.901  26.754  17.976  1.00 108.52 ? 454  LYS A NZ  1 
ATOM   3721 N  N   . ALA A 1 455 ? 32.403  21.821  13.763  1.00 46.54  ? 455  ALA A N   1 
ATOM   3722 C  CA  . ALA A 1 455 ? 32.253  20.915  12.637  1.00 43.28  ? 455  ALA A CA  1 
ATOM   3723 C  C   . ALA A 1 455 ? 31.939  21.765  11.436  1.00 39.71  ? 455  ALA A C   1 
ATOM   3724 O  O   . ALA A 1 455 ? 31.239  22.778  11.544  1.00 40.35  ? 455  ALA A O   1 
ATOM   3725 C  CB  . ALA A 1 455 ? 31.121  19.933  12.890  1.00 51.57  ? 455  ALA A CB  1 
ATOM   3726 N  N   . GLY A 1 456 ? 32.455  21.358  10.289  1.00 40.69  ? 456  GLY A N   1 
ATOM   3727 C  CA  . GLY A 1 456 ? 32.206  22.118  9.084   1.00 40.76  ? 456  GLY A CA  1 
ATOM   3728 C  C   . GLY A 1 456 ? 32.644  21.413  7.827   1.00 26.54  ? 456  GLY A C   1 
ATOM   3729 O  O   . GLY A 1 456 ? 33.110  20.273  7.866   1.00 6.66   ? 456  GLY A O   1 
ATOM   3730 N  N   . TYR A 1 457 ? 32.509  22.111  6.712   1.00 33.75  ? 457  TYR A N   1 
ATOM   3731 C  CA  . TYR A 1 457 ? 32.872  21.559  5.422   1.00 44.30  ? 457  TYR A CA  1 
ATOM   3732 C  C   . TYR A 1 457 ? 33.332  22.658  4.491   1.00 46.36  ? 457  TYR A C   1 
ATOM   3733 O  O   . TYR A 1 457 ? 33.113  23.849  4.744   1.00 54.52  ? 457  TYR A O   1 
ATOM   3734 C  CB  . TYR A 1 457 ? 31.670  20.846  4.791   1.00 46.53  ? 457  TYR A CB  1 
ATOM   3735 C  CG  . TYR A 1 457 ? 30.495  21.758  4.495   1.00 55.90  ? 457  TYR A CG  1 
ATOM   3736 C  CD1 . TYR A 1 457 ? 30.387  22.408  3.266   1.00 64.27  ? 457  TYR A CD1 1 
ATOM   3737 C  CD2 . TYR A 1 457 ? 29.486  21.965  5.441   1.00 56.46  ? 457  TYR A CD2 1 
ATOM   3738 C  CE1 . TYR A 1 457 ? 29.301  23.243  2.980   1.00 68.26  ? 457  TYR A CE1 1 
ATOM   3739 C  CE2 . TYR A 1 457 ? 28.392  22.800  5.165   1.00 60.29  ? 457  TYR A CE2 1 
ATOM   3740 C  CZ  . TYR A 1 457 ? 28.306  23.437  3.929   1.00 60.49  ? 457  TYR A CZ  1 
ATOM   3741 O  OH  . TYR A 1 457 ? 27.234  24.259  3.633   1.00 42.82  ? 457  TYR A OH  1 
ATOM   3742 N  N   . VAL A 1 458 ? 33.975  22.236  3.414   1.00 43.00  ? 458  VAL A N   1 
ATOM   3743 C  CA  . VAL A 1 458 ? 34.467  23.135  2.381   1.00 40.97  ? 458  VAL A CA  1 
ATOM   3744 C  C   . VAL A 1 458 ? 34.173  22.344  1.129   1.00 32.13  ? 458  VAL A C   1 
ATOM   3745 O  O   . VAL A 1 458 ? 34.545  21.180  1.035   1.00 33.31  ? 458  VAL A O   1 
ATOM   3746 C  CB  . VAL A 1 458 ? 36.012  23.347  2.447   1.00 37.85  ? 458  VAL A CB  1 
ATOM   3747 C  CG1 . VAL A 1 458 ? 36.401  24.576  1.625   1.00 28.34  ? 458  VAL A CG1 1 
ATOM   3748 C  CG2 . VAL A 1 458 ? 36.507  23.448  3.901   1.00 26.95  ? 458  VAL A CG2 1 
ATOM   3749 N  N   . THR A 1 459 ? 33.472  22.925  0.179   1.00 31.64  ? 459  THR A N   1 
ATOM   3750 C  CA  . THR A 1 459 ? 33.197  22.155  -1.013  1.00 33.72  ? 459  THR A CA  1 
ATOM   3751 C  C   . THR A 1 459 ? 34.075  22.613  -2.156  1.00 30.02  ? 459  THR A C   1 
ATOM   3752 O  O   . THR A 1 459 ? 34.680  23.695  -2.098  1.00 12.96  ? 459  THR A O   1 
ATOM   3753 C  CB  . THR A 1 459 ? 31.719  22.226  -1.426  1.00 31.36  ? 459  THR A CB  1 
ATOM   3754 O  OG1 . THR A 1 459 ? 31.487  23.423  -2.177  1.00 36.42  ? 459  THR A OG1 1 
ATOM   3755 C  CG2 . THR A 1 459 ? 30.822  22.215  -0.187  1.00 21.47  ? 459  THR A CG2 1 
ATOM   3756 N  N   . ASN A 1 460 ? 34.157  21.763  -3.176  1.00 33.93  ? 460  ASN A N   1 
ATOM   3757 C  CA  . ASN A 1 460 ? 34.923  22.050  -4.380  1.00 38.64  ? 460  ASN A CA  1 
ATOM   3758 C  C   . ASN A 1 460 ? 34.235  23.229  -5.055  1.00 44.31  ? 460  ASN A C   1 
ATOM   3759 O  O   . ASN A 1 460 ? 34.864  23.967  -5.810  1.00 48.54  ? 460  ASN A O   1 
ATOM   3760 C  CB  . ASN A 1 460 ? 34.886  20.855  -5.340  1.00 34.29  ? 460  ASN A CB  1 
ATOM   3761 C  CG  . ASN A 1 460 ? 33.473  20.553  -5.841  1.00 38.35  ? 460  ASN A CG  1 
ATOM   3762 O  OD1 . ASN A 1 460 ? 32.508  20.608  -5.070  1.00 39.83  ? 460  ASN A OD1 1 
ATOM   3763 N  ND2 . ASN A 1 460 ? 33.343  20.250  -7.131  1.00 37.73  ? 460  ASN A ND2 1 
ATOM   3764 N  N   . ARG A 1 461 ? 32.935  23.381  -4.792  1.00 45.75  ? 461  ARG A N   1 
ATOM   3765 C  CA  . ARG A 1 461 ? 32.143  24.461  -5.378  1.00 52.41  ? 461  ARG A CA  1 
ATOM   3766 C  C   . ARG A 1 461 ? 32.231  25.804  -4.658  1.00 51.54  ? 461  ARG A C   1 
ATOM   3767 O  O   . ARG A 1 461 ? 31.733  26.805  -5.166  1.00 51.64  ? 461  ARG A O   1 
ATOM   3768 C  CB  . ARG A 1 461 ? 30.677  24.043  -5.524  1.00 57.29  ? 461  ARG A CB  1 
ATOM   3769 C  CG  . ARG A 1 461 ? 30.434  22.975  -6.576  1.00 56.27  ? 461  ARG A CG  1 
ATOM   3770 C  CD  . ARG A 1 461 ? 28.957  22.651  -6.712  1.00 61.45  ? 461  ARG A CD  1 
ATOM   3771 N  NE  . ARG A 1 461 ? 28.747  21.462  -7.536  1.00 72.58  ? 461  ARG A NE  1 
ATOM   3772 C  CZ  . ARG A 1 461 ? 27.558  20.933  -7.817  1.00 72.57  ? 461  ARG A CZ  1 
ATOM   3773 N  NH1 . ARG A 1 461 ? 26.444  21.474  -7.348  1.00 81.38  ? 461  ARG A NH1 1 
ATOM   3774 N  NH2 . ARG A 1 461 ? 27.487  19.854  -8.572  1.00 72.62  ? 461  ARG A NH2 1 
ATOM   3775 N  N   . GLY A 1 462 ? 32.829  25.830  -3.472  1.00 52.39  ? 462  GLY A N   1 
ATOM   3776 C  CA  . GLY A 1 462 ? 32.964  27.089  -2.762  1.00 56.31  ? 462  GLY A CA  1 
ATOM   3777 C  C   . GLY A 1 462 ? 32.233  27.196  -1.446  1.00 57.54  ? 462  GLY A C   1 
ATOM   3778 O  O   . GLY A 1 462 ? 32.657  27.929  -0.551  1.00 63.49  ? 462  GLY A O   1 
ATOM   3779 N  N   . ARG A 1 463 ? 31.117  26.489  -1.337  1.00 54.35  ? 463  ARG A N   1 
ATOM   3780 C  CA  . ARG A 1 463 ? 30.312  26.499  -0.116  1.00 51.74  ? 463  ARG A CA  1 
ATOM   3781 C  C   . ARG A 1 463 ? 31.167  26.044  1.071   1.00 48.47  ? 463  ARG A C   1 
ATOM   3782 O  O   . ARG A 1 463 ? 32.035  25.174  0.940   1.00 48.96  ? 463  ARG A O   1 
ATOM   3783 C  CB  . ARG A 1 463 ? 29.114  25.557  -0.280  1.00 47.96  ? 463  ARG A CB  1 
ATOM   3784 C  CG  . ARG A 1 463 ? 27.958  25.788  0.671   1.00 45.59  ? 463  ARG A CG  1 
ATOM   3785 C  CD  . ARG A 1 463 ? 26.989  24.601  0.642   1.00 62.70  ? 463  ARG A CD  1 
ATOM   3786 N  NE  . ARG A 1 463 ? 26.661  24.162  -0.717  1.00 79.06  ? 463  ARG A NE  1 
ATOM   3787 C  CZ  . ARG A 1 463 ? 25.446  24.216  -1.263  1.00 89.04  ? 463  ARG A CZ  1 
ATOM   3788 N  NH1 . ARG A 1 463 ? 24.417  24.692  -0.572  1.00 92.18  ? 463  ARG A NH1 1 
ATOM   3789 N  NH2 . ARG A 1 463 ? 25.264  23.814  -2.516  1.00 91.22  ? 463  ARG A NH2 1 
ATOM   3790 N  N   . GLN A 1 464 ? 30.921  26.644  2.223   1.00 44.15  ? 464  GLN A N   1 
ATOM   3791 C  CA  . GLN A 1 464 ? 31.646  26.304  3.428   1.00 43.48  ? 464  GLN A CA  1 
ATOM   3792 C  C   . GLN A 1 464 ? 30.763  26.639  4.620   1.00 46.97  ? 464  GLN A C   1 
ATOM   3793 O  O   . GLN A 1 464 ? 29.749  27.335  4.479   1.00 49.79  ? 464  GLN A O   1 
ATOM   3794 C  CB  . GLN A 1 464 ? 32.976  27.067  3.493   1.00 53.03  ? 464  GLN A CB  1 
ATOM   3795 C  CG  . GLN A 1 464 ? 32.865  28.580  3.298   1.00 68.05  ? 464  GLN A CG  1 
ATOM   3796 C  CD  . GLN A 1 464 ? 34.222  29.271  3.241   1.00 79.02  ? 464  GLN A CD  1 
ATOM   3797 O  OE1 . GLN A 1 464 ? 35.025  29.017  2.344   1.00 84.08  ? 464  GLN A OE1 1 
ATOM   3798 N  NE2 . GLN A 1 464 ? 34.479  30.156  4.197   1.00 86.91  ? 464  GLN A NE2 1 
ATOM   3799 N  N   . LYS A 1 465 ? 31.126  26.101  5.779   1.00 43.31  ? 465  LYS A N   1 
ATOM   3800 C  CA  . LYS A 1 465 ? 30.387  26.323  7.017   1.00 37.67  ? 465  LYS A CA  1 
ATOM   3801 C  C   . LYS A 1 465 ? 31.134  25.673  8.176   1.00 37.32  ? 465  LYS A C   1 
ATOM   3802 O  O   . LYS A 1 465 ? 31.979  24.801  7.983   1.00 28.61  ? 465  LYS A O   1 
ATOM   3803 C  CB  . LYS A 1 465 ? 28.962  25.748  6.912   1.00 36.65  ? 465  LYS A CB  1 
ATOM   3804 C  CG  . LYS A 1 465 ? 28.191  25.618  8.235   1.00 42.76  ? 465  LYS A CG  1 
ATOM   3805 C  CD  . LYS A 1 465 ? 26.784  25.045  8.033   1.00 51.88  ? 465  LYS A CD  1 
ATOM   3806 C  CE  . LYS A 1 465 ? 25.879  26.037  7.294   1.00 60.85  ? 465  LYS A CE  1 
ATOM   3807 N  NZ  . LYS A 1 465 ? 24.489  25.542  7.093   1.00 55.92  ? 465  LYS A NZ  1 
ATOM   3808 N  N   . VAL A 1 466 ? 30.862  26.174  9.370   1.00 43.00  ? 466  VAL A N   1 
ATOM   3809 C  CA  . VAL A 1 466 ? 31.441  25.682  10.606  1.00 43.94  ? 466  VAL A CA  1 
ATOM   3810 C  C   . VAL A 1 466 ? 30.342  25.908  11.631  1.00 50.09  ? 466  VAL A C   1 
ATOM   3811 O  O   . VAL A 1 466 ? 29.481  26.771  11.441  1.00 50.30  ? 466  VAL A O   1 
ATOM   3812 C  CB  . VAL A 1 466 ? 32.664  26.502  11.035  1.00 41.95  ? 466  VAL A CB  1 
ATOM   3813 C  CG1 . VAL A 1 466 ? 33.211  25.973  12.358  1.00 30.75  ? 466  VAL A CG1 1 
ATOM   3814 C  CG2 . VAL A 1 466 ? 33.727  26.467  9.952   1.00 51.99  ? 466  VAL A CG2 1 
ATOM   3815 N  N   . VAL A 1 467 ? 30.325  25.087  12.670  1.00 54.51  ? 467  VAL A N   1 
ATOM   3816 C  CA  . VAL A 1 467 ? 29.339  25.209  13.732  1.00 61.74  ? 467  VAL A CA  1 
ATOM   3817 C  C   . VAL A 1 467 ? 30.037  24.845  15.034  1.00 67.53  ? 467  VAL A C   1 
ATOM   3818 O  O   . VAL A 1 467 ? 30.733  23.828  15.108  1.00 67.18  ? 467  VAL A O   1 
ATOM   3819 C  CB  . VAL A 1 467 ? 28.124  24.259  13.515  1.00 63.66  ? 467  VAL A CB  1 
ATOM   3820 C  CG1 . VAL A 1 467 ? 27.158  24.365  14.689  1.00 62.40  ? 467  VAL A CG1 1 
ATOM   3821 C  CG2 . VAL A 1 467 ? 27.392  24.600  12.221  1.00 68.32  ? 467  VAL A CG2 1 
ATOM   3822 N  N   . THR A 1 468 ? 29.929  25.707  16.035  1.00 75.02  ? 468  THR A N   1 
ATOM   3823 C  CA  . THR A 1 468 ? 30.549  25.420  17.321  1.00 83.76  ? 468  THR A CA  1 
ATOM   3824 C  C   . THR A 1 468 ? 29.569  24.581  18.127  1.00 87.78  ? 468  THR A C   1 
ATOM   3825 O  O   . THR A 1 468 ? 28.352  24.766  18.028  1.00 89.30  ? 468  THR A O   1 
ATOM   3826 C  CB  . THR A 1 468 ? 30.924  26.708  18.082  1.00 85.70  ? 468  THR A CB  1 
ATOM   3827 O  OG1 . THR A 1 468 ? 31.922  27.424  17.341  1.00 91.74  ? 468  THR A OG1 1 
ATOM   3828 C  CG2 . THR A 1 468 ? 31.477  26.373  19.463  1.00 80.66  ? 468  THR A CG2 1 
ATOM   3829 N  N   . LEU A 1 469 ? 30.093  23.635  18.896  1.00 91.43  ? 469  LEU A N   1 
ATOM   3830 C  CA  . LEU A 1 469 ? 29.254  22.753  19.695  1.00 96.27  ? 469  LEU A CA  1 
ATOM   3831 C  C   . LEU A 1 469 ? 29.754  22.657  21.123  1.00 93.47  ? 469  LEU A C   1 
ATOM   3832 O  O   . LEU A 1 469 ? 30.957  22.599  21.362  1.00 93.67  ? 469  LEU A O   1 
ATOM   3833 C  CB  . LEU A 1 469 ? 29.239  21.351  19.083  1.00 104.58 ? 469  LEU A CB  1 
ATOM   3834 C  CG  . LEU A 1 469 ? 28.974  21.231  17.580  1.00 113.81 ? 469  LEU A CG  1 
ATOM   3835 C  CD1 . LEU A 1 469 ? 29.158  19.788  17.146  1.00 115.49 ? 469  LEU A CD1 1 
ATOM   3836 C  CD2 . LEU A 1 469 ? 27.572  21.725  17.238  1.00 120.78 ? 469  LEU A CD2 1 
ATOM   3837 N  N   . THR A 1 470 ? 28.824  22.652  22.066  1.00 92.12  ? 470  THR A N   1 
ATOM   3838 C  CA  . THR A 1 470 ? 29.155  22.540  23.478  1.00 93.02  ? 470  THR A CA  1 
ATOM   3839 C  C   . THR A 1 470 ? 28.527  21.232  23.970  1.00 90.06  ? 470  THR A C   1 
ATOM   3840 O  O   . THR A 1 470 ? 27.477  20.823  23.467  1.00 92.38  ? 470  THR A O   1 
ATOM   3841 C  CB  . THR A 1 470 ? 28.599  23.749  24.290  1.00 98.72  ? 470  THR A CB  1 
ATOM   3842 O  OG1 . THR A 1 470 ? 27.169  23.792  24.189  1.00 109.56 ? 470  THR A OG1 1 
ATOM   3843 C  CG2 . THR A 1 470 ? 29.168  25.067  23.764  1.00 95.17  ? 470  THR A CG2 1 
ATOM   3844 N  N   . ASP A 1 471 ? 29.175  20.570  24.926  1.00 83.95  ? 471  ASP A N   1 
ATOM   3845 C  CA  . ASP A 1 471 ? 28.675  19.306  25.479  1.00 78.38  ? 471  ASP A CA  1 
ATOM   3846 C  C   . ASP A 1 471 ? 28.542  18.253  24.369  1.00 68.59  ? 471  ASP A C   1 
ATOM   3847 O  O   . ASP A 1 471 ? 27.531  17.553  24.259  1.00 62.25  ? 471  ASP A O   1 
ATOM   3848 C  CB  . ASP A 1 471 ? 27.331  19.524  26.208  1.00 86.99  ? 471  ASP A CB  1 
ATOM   3849 C  CG  . ASP A 1 471 ? 26.942  18.355  27.128  1.00 84.89  ? 471  ASP A CG  1 
ATOM   3850 O  OD1 . ASP A 1 471 ? 27.799  17.493  27.421  1.00 83.08  ? 471  ASP A OD1 1 
ATOM   3851 O  OD2 . ASP A 1 471 ? 25.772  18.311  27.573  1.00 76.81  ? 471  ASP A OD2 1 
ATOM   3852 N  N   . THR A 1 472 ? 29.578  18.173  23.541  1.00 65.29  ? 472  THR A N   1 
ATOM   3853 C  CA  . THR A 1 472 ? 29.646  17.228  22.429  1.00 59.05  ? 472  THR A CA  1 
ATOM   3854 C  C   . THR A 1 472 ? 30.815  16.271  22.679  1.00 53.75  ? 472  THR A C   1 
ATOM   3855 O  O   . THR A 1 472 ? 31.392  16.248  23.771  1.00 47.14  ? 472  THR A O   1 
ATOM   3856 C  CB  . THR A 1 472 ? 29.878  17.980  21.069  1.00 55.47  ? 472  THR A CB  1 
ATOM   3857 O  OG1 . THR A 1 472 ? 29.936  17.044  19.980  1.00 37.21  ? 472  THR A OG1 1 
ATOM   3858 C  CG2 . THR A 1 472 ? 31.172  18.792  21.109  1.00 56.69  ? 472  THR A CG2 1 
ATOM   3859 N  N   . THR A 1 473 ? 31.127  15.466  21.668  1.00 51.26  ? 473  THR A N   1 
ATOM   3860 C  CA  . THR A 1 473 ? 32.235  14.522  21.701  1.00 51.76  ? 473  THR A CA  1 
ATOM   3861 C  C   . THR A 1 473 ? 32.768  14.546  20.285  1.00 50.27  ? 473  THR A C   1 
ATOM   3862 O  O   . THR A 1 473 ? 32.056  14.942  19.352  1.00 46.77  ? 473  THR A O   1 
ATOM   3863 C  CB  . THR A 1 473 ? 31.806  13.074  22.045  1.00 54.86  ? 473  THR A CB  1 
ATOM   3864 O  OG1 . THR A 1 473 ? 30.748  12.655  21.172  1.00 59.09  ? 473  THR A OG1 1 
ATOM   3865 C  CG2 . THR A 1 473 ? 31.374  12.962  23.490  1.00 57.00  ? 473  THR A CG2 1 
ATOM   3866 N  N   . ASN A 1 474 ? 34.011  14.113  20.119  1.00 52.03  ? 474  ASN A N   1 
ATOM   3867 C  CA  . ASN A 1 474 ? 34.630  14.109  18.806  1.00 56.78  ? 474  ASN A CA  1 
ATOM   3868 C  C   . ASN A 1 474 ? 33.852  13.274  17.814  1.00 55.64  ? 474  ASN A C   1 
ATOM   3869 O  O   . ASN A 1 474 ? 33.685  13.663  16.657  1.00 49.53  ? 474  ASN A O   1 
ATOM   3870 C  CB  . ASN A 1 474 ? 36.068  13.618  18.873  1.00 70.70  ? 474  ASN A CB  1 
ATOM   3871 C  CG  . ASN A 1 474 ? 36.965  14.343  17.885  1.00 86.23  ? 474  ASN A CG  1 
ATOM   3872 O  OD1 . ASN A 1 474 ? 38.009  14.874  18.258  1.00 96.10  ? 474  ASN A OD1 1 
ATOM   3873 N  ND2 . ASN A 1 474 ? 36.535  14.416  16.631  1.00 87.55  ? 474  ASN A ND2 1 
ATOM   3874 N  N   . GLN A 1 475 ? 33.364  12.127  18.265  1.00 55.27  ? 475  GLN A N   1 
ATOM   3875 C  CA  . GLN A 1 475 ? 32.595  11.279  17.382  1.00 56.22  ? 475  GLN A CA  1 
ATOM   3876 C  C   . GLN A 1 475 ? 31.395  12.075  16.858  1.00 50.36  ? 475  GLN A C   1 
ATOM   3877 O  O   . GLN A 1 475 ? 31.200  12.201  15.647  1.00 41.09  ? 475  GLN A O   1 
ATOM   3878 C  CB  . GLN A 1 475 ? 32.172  9.988   18.096  1.00 64.60  ? 475  GLN A CB  1 
ATOM   3879 C  CG  . GLN A 1 475 ? 31.187  10.145  19.245  1.00 64.96  ? 475  GLN A CG  1 
ATOM   3880 C  CD  . GLN A 1 475 ? 29.918  9.304   19.061  1.00 83.32  ? 475  GLN A CD  1 
ATOM   3881 O  OE1 . GLN A 1 475 ? 28.974  9.419   19.844  1.00 88.07  ? 475  GLN A OE1 1 
ATOM   3882 N  NE2 . GLN A 1 475 ? 29.893  8.457   18.029  1.00 87.67  ? 475  GLN A NE2 1 
ATOM   3883 N  N   . LYS A 1 476 ? 30.677  12.718  17.772  1.00 51.22  ? 476  LYS A N   1 
ATOM   3884 C  CA  . LYS A 1 476 ? 29.511  13.503  17.403  1.00 52.94  ? 476  LYS A CA  1 
ATOM   3885 C  C   . LYS A 1 476 ? 29.866  14.529  16.331  1.00 48.18  ? 476  LYS A C   1 
ATOM   3886 O  O   . LYS A 1 476 ? 29.273  14.537  15.250  1.00 43.60  ? 476  LYS A O   1 
ATOM   3887 C  CB  . LYS A 1 476 ? 28.916  14.201  18.631  1.00 57.19  ? 476  LYS A CB  1 
ATOM   3888 C  CG  . LYS A 1 476 ? 28.174  13.293  19.617  1.00 47.69  ? 476  LYS A CG  1 
ATOM   3889 C  CD  . LYS A 1 476 ? 27.669  14.131  20.788  1.00 66.69  ? 476  LYS A CD  1 
ATOM   3890 C  CE  . LYS A 1 476 ? 27.050  13.310  21.913  1.00 77.40  ? 476  LYS A CE  1 
ATOM   3891 N  NZ  . LYS A 1 476 ? 26.738  14.179  23.098  1.00 74.42  ? 476  LYS A NZ  1 
ATOM   3892 N  N   . THR A 1 477 ? 30.865  15.358  16.603  1.00 38.99  ? 477  THR A N   1 
ATOM   3893 C  CA  . THR A 1 477 ? 31.254  16.365  15.635  1.00 39.04  ? 477  THR A CA  1 
ATOM   3894 C  C   . THR A 1 477 ? 31.436  15.782  14.242  1.00 30.01  ? 477  THR A C   1 
ATOM   3895 O  O   . THR A 1 477 ? 30.739  16.189  13.313  1.00 22.37  ? 477  THR A O   1 
ATOM   3896 C  CB  . THR A 1 477 ? 32.542  17.096  16.048  1.00 54.42  ? 477  THR A CB  1 
ATOM   3897 O  OG1 . THR A 1 477 ? 33.505  16.145  16.513  1.00 66.72  ? 477  THR A OG1 1 
ATOM   3898 C  CG2 . THR A 1 477 ? 32.261  18.127  17.134  1.00 60.19  ? 477  THR A CG2 1 
ATOM   3899 N  N   . GLU A 1 478 ? 32.324  14.795  14.118  1.00 31.62  ? 478  GLU A N   1 
ATOM   3900 C  CA  . GLU A 1 478 ? 32.621  14.149  12.830  1.00 30.65  ? 478  GLU A CA  1 
ATOM   3901 C  C   . GLU A 1 478 ? 31.332  13.862  12.074  1.00 23.98  ? 478  GLU A C   1 
ATOM   3902 O  O   . GLU A 1 478 ? 31.182  14.211  10.894  1.00 9.52   ? 478  GLU A O   1 
ATOM   3903 C  CB  . GLU A 1 478 ? 33.379  12.835  13.052  1.00 31.74  ? 478  GLU A CB  1 
ATOM   3904 C  CG  . GLU A 1 478 ? 34.673  12.977  13.833  1.00 34.05  ? 478  GLU A CG  1 
ATOM   3905 C  CD  . GLU A 1 478 ? 35.188  11.649  14.354  1.00 43.84  ? 478  GLU A CD  1 
ATOM   3906 O  OE1 . GLU A 1 478 ? 35.877  10.931  13.595  1.00 51.96  ? 478  GLU A OE1 1 
ATOM   3907 O  OE2 . GLU A 1 478 ? 34.908  11.322  15.527  1.00 42.48  ? 478  GLU A OE2 1 
ATOM   3908 N  N   . LEU A 1 479 ? 30.381  13.293  12.806  1.00 22.26  ? 479  LEU A N   1 
ATOM   3909 C  CA  . LEU A 1 479 ? 29.087  12.945  12.260  1.00 26.19  ? 479  LEU A CA  1 
ATOM   3910 C  C   . LEU A 1 479 ? 28.314  14.192  11.848  1.00 25.30  ? 479  LEU A C   1 
ATOM   3911 O  O   . LEU A 1 479 ? 27.902  14.313  10.698  1.00 17.07  ? 479  LEU A O   1 
ATOM   3912 C  CB  . LEU A 1 479 ? 28.301  12.121  13.283  1.00 40.31  ? 479  LEU A CB  1 
ATOM   3913 C  CG  . LEU A 1 479 ? 29.036  10.849  13.753  1.00 70.32  ? 479  LEU A CG  1 
ATOM   3914 C  CD1 . LEU A 1 479 ? 28.397  10.248  15.000  1.00 74.37  ? 479  LEU A CD1 1 
ATOM   3915 C  CD2 . LEU A 1 479 ? 29.095  9.823   12.628  1.00 74.30  ? 479  LEU A CD2 1 
ATOM   3916 N  N   . GLN A 1 480 ? 28.181  15.152  12.758  1.00 31.97  ? 480  GLN A N   1 
ATOM   3917 C  CA  . GLN A 1 480 ? 27.442  16.376  12.459  1.00 30.99  ? 480  GLN A CA  1 
ATOM   3918 C  C   . GLN A 1 480 ? 27.980  17.032  11.194  1.00 27.21  ? 480  GLN A C   1 
ATOM   3919 O  O   . GLN A 1 480 ? 27.221  17.626  10.415  1.00 26.15  ? 480  GLN A O   1 
ATOM   3920 C  CB  . GLN A 1 480 ? 27.492  17.348  13.636  1.00 29.21  ? 480  GLN A CB  1 
ATOM   3921 C  CG  . GLN A 1 480 ? 26.737  18.662  13.399  1.00 61.51  ? 480  GLN A CG  1 
ATOM   3922 C  CD  . GLN A 1 480 ? 25.228  18.497  13.177  1.00 79.27  ? 480  GLN A CD  1 
ATOM   3923 O  OE1 . GLN A 1 480 ? 24.659  17.434  13.431  1.00 86.69  ? 480  GLN A OE1 1 
ATOM   3924 N  NE2 . GLN A 1 480 ? 24.577  19.566  12.716  1.00 78.29  ? 480  GLN A NE2 1 
ATOM   3925 N  N   . ALA A 1 481 ? 29.281  16.878  10.974  1.00 24.38  ? 481  ALA A N   1 
ATOM   3926 C  CA  . ALA A 1 481 ? 29.935  17.436  9.796   1.00 24.62  ? 481  ALA A CA  1 
ATOM   3927 C  C   . ALA A 1 481 ? 29.223  16.857  8.589   1.00 22.74  ? 481  ALA A C   1 
ATOM   3928 O  O   . ALA A 1 481 ? 28.740  17.561  7.690   1.00 12.87  ? 481  ALA A O   1 
ATOM   3929 C  CB  . ALA A 1 481 ? 31.401  17.027  9.782   1.00 21.08  ? 481  ALA A CB  1 
ATOM   3930 N  N   . ILE A 1 482 ? 29.086  15.546  8.651   1.00 32.11  ? 482  ILE A N   1 
ATOM   3931 C  CA  . ILE A 1 482 ? 28.441  14.774  7.616   1.00 38.07  ? 482  ILE A CA  1 
ATOM   3932 C  C   . ILE A 1 482 ? 26.961  15.120  7.526   1.00 35.29  ? 482  ILE A C   1 
ATOM   3933 O  O   . ILE A 1 482 ? 26.400  15.205  6.429   1.00 40.56  ? 482  ILE A O   1 
ATOM   3934 C  CB  . ILE A 1 482 ? 28.607  13.297  7.926   1.00 43.37  ? 482  ILE A CB  1 
ATOM   3935 C  CG1 . ILE A 1 482 ? 30.094  13.000  8.144   1.00 32.78  ? 482  ILE A CG1 1 
ATOM   3936 C  CG2 . ILE A 1 482 ? 28.017  12.466  6.803   1.00 63.16  ? 482  ILE A CG2 1 
ATOM   3937 C  CD1 . ILE A 1 482 ? 30.355  11.822  9.026   1.00 26.31  ? 482  ILE A CD1 1 
ATOM   3938 N  N   . TYR A 1 483 ? 26.336  15.320  8.683   1.00 25.62  ? 483  TYR A N   1 
ATOM   3939 C  CA  . TYR A 1 483 ? 24.932  15.663  8.726   1.00 17.99  ? 483  TYR A CA  1 
ATOM   3940 C  C   . TYR A 1 483 ? 24.698  16.914  7.878   1.00 15.22  ? 483  TYR A C   1 
ATOM   3941 O  O   . TYR A 1 483 ? 23.984  16.867  6.863   1.00 2.00   ? 483  TYR A O   1 
ATOM   3942 C  CB  . TYR A 1 483 ? 24.493  15.902  10.171  1.00 26.87  ? 483  TYR A CB  1 
ATOM   3943 C  CG  . TYR A 1 483 ? 23.009  16.166  10.317  1.00 40.52  ? 483  TYR A CG  1 
ATOM   3944 C  CD1 . TYR A 1 483 ? 22.121  15.855  9.281   1.00 46.70  ? 483  TYR A CD1 1 
ATOM   3945 C  CD2 . TYR A 1 483 ? 22.493  16.737  11.475  1.00 30.86  ? 483  TYR A CD2 1 
ATOM   3946 C  CE1 . TYR A 1 483 ? 20.770  16.108  9.389   1.00 47.47  ? 483  TYR A CE1 1 
ATOM   3947 C  CE2 . TYR A 1 483 ? 21.133  16.994  11.595  1.00 47.97  ? 483  TYR A CE2 1 
ATOM   3948 C  CZ  . TYR A 1 483 ? 20.276  16.678  10.543  1.00 54.55  ? 483  TYR A CZ  1 
ATOM   3949 O  OH  . TYR A 1 483 ? 18.925  16.943  10.624  1.00 63.94  ? 483  TYR A OH  1 
ATOM   3950 N  N   . LEU A 1 484 ? 25.353  18.003  8.278   1.00 21.23  ? 484  LEU A N   1 
ATOM   3951 C  CA  . LEU A 1 484 ? 25.258  19.297  7.599   1.00 20.70  ? 484  LEU A CA  1 
ATOM   3952 C  C   . LEU A 1 484 ? 25.553  19.164  6.126   1.00 10.64  ? 484  LEU A C   1 
ATOM   3953 O  O   . LEU A 1 484 ? 24.897  19.799  5.287   1.00 2.42   ? 484  LEU A O   1 
ATOM   3954 C  CB  . LEU A 1 484 ? 26.243  20.286  8.213   1.00 30.75  ? 484  LEU A CB  1 
ATOM   3955 C  CG  . LEU A 1 484 ? 25.933  20.686  9.649   1.00 37.19  ? 484  LEU A CG  1 
ATOM   3956 C  CD1 . LEU A 1 484 ? 26.977  21.650  10.132  1.00 41.18  ? 484  LEU A CD1 1 
ATOM   3957 C  CD2 . LEU A 1 484 ? 24.558  21.320  9.719   1.00 54.94  ? 484  LEU A CD2 1 
ATOM   3958 N  N   . ALA A 1 485 ? 26.573  18.364  5.823   1.00 9.59   ? 485  ALA A N   1 
ATOM   3959 C  CA  . ALA A 1 485 ? 26.966  18.107  4.443   1.00 20.92  ? 485  ALA A CA  1 
ATOM   3960 C  C   . ALA A 1 485 ? 25.728  17.708  3.629   1.00 16.59  ? 485  ALA A C   1 
ATOM   3961 O  O   . ALA A 1 485 ? 25.410  18.325  2.612   1.00 2.00   ? 485  ALA A O   1 
ATOM   3962 C  CB  . ALA A 1 485 ? 28.003  17.000  4.405   1.00 25.62  ? 485  ALA A CB  1 
ATOM   3963 N  N   . LEU A 1 486 ? 25.000  16.725  4.147   1.00 23.17  ? 486  LEU A N   1 
ATOM   3964 C  CA  . LEU A 1 486 ? 23.785  16.228  3.516   1.00 36.12  ? 486  LEU A CA  1 
ATOM   3965 C  C   . LEU A 1 486 ? 22.696  17.296  3.511   1.00 42.76  ? 486  LEU A C   1 
ATOM   3966 O  O   . LEU A 1 486 ? 22.036  17.510  2.501   1.00 40.35  ? 486  LEU A O   1 
ATOM   3967 C  CB  . LEU A 1 486 ? 23.283  14.993  4.262   1.00 43.68  ? 486  LEU A CB  1 
ATOM   3968 C  CG  . LEU A 1 486 ? 24.147  13.731  4.189   1.00 47.61  ? 486  LEU A CG  1 
ATOM   3969 C  CD1 . LEU A 1 486 ? 23.922  12.894  5.430   1.00 57.97  ? 486  LEU A CD1 1 
ATOM   3970 C  CD2 . LEU A 1 486 ? 23.838  12.936  2.925   1.00 29.42  ? 486  LEU A CD2 1 
ATOM   3971 N  N   . GLN A 1 487 ? 22.524  17.978  4.639   1.00 43.77  ? 487  GLN A N   1 
ATOM   3972 C  CA  . GLN A 1 487 ? 21.512  19.020  4.742   1.00 43.15  ? 487  GLN A CA  1 
ATOM   3973 C  C   . GLN A 1 487 ? 21.665  20.100  3.682   1.00 41.28  ? 487  GLN A C   1 
ATOM   3974 O  O   . GLN A 1 487 ? 20.733  20.395  2.930   1.00 43.00  ? 487  GLN A O   1 
ATOM   3975 C  CB  . GLN A 1 487 ? 21.574  19.696  6.107   1.00 47.55  ? 487  GLN A CB  1 
ATOM   3976 C  CG  . GLN A 1 487 ? 21.117  18.852  7.261   1.00 47.03  ? 487  GLN A CG  1 
ATOM   3977 C  CD  . GLN A 1 487 ? 21.043  19.664  8.529   1.00 56.78  ? 487  GLN A CD  1 
ATOM   3978 O  OE1 . GLN A 1 487 ? 21.970  19.651  9.338   1.00 61.60  ? 487  GLN A OE1 1 
ATOM   3979 N  NE2 . GLN A 1 487 ? 19.952  20.408  8.698   1.00 61.34  ? 487  GLN A NE2 1 
ATOM   3980 N  N   . ASP A 1 488 ? 22.862  20.661  3.607   1.00 33.83  ? 488  ASP A N   1 
ATOM   3981 C  CA  . ASP A 1 488 ? 23.124  21.747  2.688   1.00 28.62  ? 488  ASP A CA  1 
ATOM   3982 C  C   . ASP A 1 488 ? 23.385  21.352  1.252   1.00 26.83  ? 488  ASP A C   1 
ATOM   3983 O  O   . ASP A 1 488 ? 23.571  22.222  0.402   1.00 29.27  ? 488  ASP A O   1 
ATOM   3984 C  CB  . ASP A 1 488 ? 24.259  22.597  3.241   1.00 33.71  ? 488  ASP A CB  1 
ATOM   3985 C  CG  . ASP A 1 488 ? 24.049  22.943  4.701   1.00 43.32  ? 488  ASP A CG  1 
ATOM   3986 O  OD1 . ASP A 1 488 ? 22.939  23.401  5.040   1.00 59.56  ? 488  ASP A OD1 1 
ATOM   3987 O  OD2 . ASP A 1 488 ? 24.968  22.721  5.520   1.00 44.29  ? 488  ASP A OD2 1 
ATOM   3988 N  N   . SER A 1 489 ? 23.353  20.056  0.964   1.00 24.13  ? 489  SER A N   1 
ATOM   3989 C  CA  . SER A 1 489 ? 23.604  19.579  -0.389  1.00 21.98  ? 489  SER A CA  1 
ATOM   3990 C  C   . SER A 1 489 ? 22.333  19.266  -1.171  1.00 24.63  ? 489  SER A C   1 
ATOM   3991 O  O   . SER A 1 489 ? 21.279  19.025  -0.591  1.00 32.24  ? 489  SER A O   1 
ATOM   3992 C  CB  . SER A 1 489 ? 24.492  18.349  -0.333  1.00 23.01  ? 489  SER A CB  1 
ATOM   3993 O  OG  . SER A 1 489 ? 24.014  17.437  0.638   1.00 23.67  ? 489  SER A OG  1 
ATOM   3994 N  N   . GLY A 1 490 ? 22.433  19.269  -2.493  1.00 21.39  ? 490  GLY A N   1 
ATOM   3995 C  CA  . GLY A 1 490 ? 21.270  18.964  -3.302  1.00 19.21  ? 490  GLY A CA  1 
ATOM   3996 C  C   . GLY A 1 490 ? 20.942  17.484  -3.216  1.00 22.10  ? 490  GLY A C   1 
ATOM   3997 O  O   . GLY A 1 490 ? 21.260  16.832  -2.225  1.00 10.88  ? 490  GLY A O   1 
ATOM   3998 N  N   . LEU A 1 491 ? 20.366  16.934  -4.283  1.00 35.78  ? 491  LEU A N   1 
ATOM   3999 C  CA  . LEU A 1 491 ? 19.990  15.515  -4.318  1.00 50.68  ? 491  LEU A CA  1 
ATOM   4000 C  C   . LEU A 1 491 ? 21.120  14.489  -4.478  1.00 56.09  ? 491  LEU A C   1 
ATOM   4001 O  O   . LEU A 1 491 ? 20.948  13.309  -4.145  1.00 58.11  ? 491  LEU A O   1 
ATOM   4002 C  CB  . LEU A 1 491 ? 18.897  15.274  -5.362  1.00 51.44  ? 491  LEU A CB  1 
ATOM   4003 C  CG  . LEU A 1 491 ? 17.447  15.490  -4.894  1.00 61.30  ? 491  LEU A CG  1 
ATOM   4004 C  CD1 . LEU A 1 491 ? 17.377  15.651  -3.362  1.00 53.68  ? 491  LEU A CD1 1 
ATOM   4005 C  CD2 . LEU A 1 491 ? 16.824  16.692  -5.618  1.00 59.89  ? 491  LEU A CD2 1 
ATOM   4006 N  N   . GLU A 1 492 ? 22.251  14.933  -5.017  1.00 56.28  ? 492  GLU A N   1 
ATOM   4007 C  CA  . GLU A 1 492 ? 23.423  14.083  -5.207  1.00 46.79  ? 492  GLU A CA  1 
ATOM   4008 C  C   . GLU A 1 492 ? 24.566  14.718  -4.429  1.00 47.45  ? 492  GLU A C   1 
ATOM   4009 O  O   . GLU A 1 492 ? 24.825  15.914  -4.572  1.00 43.83  ? 492  GLU A O   1 
ATOM   4010 C  CB  . GLU A 1 492 ? 23.790  14.000  -6.679  1.00 28.77  ? 492  GLU A CB  1 
ATOM   4011 C  CG  . GLU A 1 492 ? 22.800  13.236  -7.524  1.00 38.27  ? 492  GLU A CG  1 
ATOM   4012 C  CD  . GLU A 1 492 ? 23.156  13.275  -8.997  1.00 41.63  ? 492  GLU A CD  1 
ATOM   4013 O  OE1 . GLU A 1 492 ? 24.172  13.926  -9.336  1.00 35.87  ? 492  GLU A OE1 1 
ATOM   4014 O  OE2 . GLU A 1 492 ? 22.416  12.669  -9.813  1.00 36.53  ? 492  GLU A OE2 1 
ATOM   4015 N  N   . VAL A 1 493 ? 25.240  13.927  -3.601  1.00 51.64  ? 493  VAL A N   1 
ATOM   4016 C  CA  . VAL A 1 493 ? 26.334  14.447  -2.786  1.00 57.45  ? 493  VAL A CA  1 
ATOM   4017 C  C   . VAL A 1 493 ? 27.528  13.495  -2.673  1.00 59.94  ? 493  VAL A C   1 
ATOM   4018 O  O   . VAL A 1 493 ? 27.358  12.284  -2.502  1.00 64.35  ? 493  VAL A O   1 
ATOM   4019 C  CB  . VAL A 1 493 ? 25.861  14.747  -1.334  1.00 60.85  ? 493  VAL A CB  1 
ATOM   4020 C  CG1 . VAL A 1 493 ? 26.755  15.803  -0.684  1.00 54.27  ? 493  VAL A CG1 1 
ATOM   4021 C  CG2 . VAL A 1 493 ? 24.398  15.153  -1.309  1.00 59.32  ? 493  VAL A CG2 1 
ATOM   4022 N  N   . ASN A 1 494 ? 28.730  14.057  -2.763  1.00 56.84  ? 494  ASN A N   1 
ATOM   4023 C  CA  . ASN A 1 494 ? 29.976  13.303  -2.623  1.00 47.42  ? 494  ASN A CA  1 
ATOM   4024 C  C   . ASN A 1 494 ? 30.573  13.854  -1.346  1.00 44.34  ? 494  ASN A C   1 
ATOM   4025 O  O   . ASN A 1 494 ? 30.906  15.035  -1.274  1.00 38.36  ? 494  ASN A O   1 
ATOM   4026 C  CB  . ASN A 1 494 ? 30.925  13.590  -3.776  1.00 39.88  ? 494  ASN A CB  1 
ATOM   4027 C  CG  . ASN A 1 494 ? 30.447  13.007  -5.082  1.00 56.31  ? 494  ASN A CG  1 
ATOM   4028 O  OD1 . ASN A 1 494 ? 30.068  11.834  -5.160  1.00 50.90  ? 494  ASN A OD1 1 
ATOM   4029 N  ND2 . ASN A 1 494 ? 30.482  13.817  -6.128  1.00 71.19  ? 494  ASN A ND2 1 
ATOM   4030 N  N   . ILE A 1 495 ? 30.684  13.020  -0.327  1.00 44.78  ? 495  ILE A N   1 
ATOM   4031 C  CA  . ILE A 1 495 ? 31.207  13.485  0.948   1.00 44.97  ? 495  ILE A CA  1 
ATOM   4032 C  C   . ILE A 1 495 ? 32.445  12.698  1.314   1.00 47.27  ? 495  ILE A C   1 
ATOM   4033 O  O   . ILE A 1 495 ? 32.477  11.473  1.148   1.00 50.56  ? 495  ILE A O   1 
ATOM   4034 C  CB  . ILE A 1 495 ? 30.153  13.312  2.061   1.00 41.96  ? 495  ILE A CB  1 
ATOM   4035 C  CG1 . ILE A 1 495 ? 28.791  13.827  1.568   1.00 24.47  ? 495  ILE A CG1 1 
ATOM   4036 C  CG2 . ILE A 1 495 ? 30.616  14.019  3.349   1.00 37.63  ? 495  ILE A CG2 1 
ATOM   4037 C  CD1 . ILE A 1 495 ? 27.648  13.467  2.463   1.00 20.67  ? 495  ILE A CD1 1 
ATOM   4038 N  N   . VAL A 1 496 ? 33.483  13.396  1.763   1.00 46.00  ? 496  VAL A N   1 
ATOM   4039 C  CA  . VAL A 1 496 ? 34.705  12.709  2.154   1.00 45.19  ? 496  VAL A CA  1 
ATOM   4040 C  C   . VAL A 1 496 ? 34.921  12.982  3.625   1.00 43.21  ? 496  VAL A C   1 
ATOM   4041 O  O   . VAL A 1 496 ? 34.565  14.048  4.124   1.00 39.20  ? 496  VAL A O   1 
ATOM   4042 C  CB  . VAL A 1 496 ? 35.954  13.145  1.340   1.00 38.83  ? 496  VAL A CB  1 
ATOM   4043 C  CG1 . VAL A 1 496 ? 35.564  13.657  -0.031  1.00 19.56  ? 496  VAL A CG1 1 
ATOM   4044 C  CG2 . VAL A 1 496 ? 36.777  14.159  2.110   1.00 52.83  ? 496  VAL A CG2 1 
ATOM   4045 N  N   . THR A 1 497 ? 35.480  12.003  4.317   1.00 46.23  ? 497  THR A N   1 
ATOM   4046 C  CA  . THR A 1 497 ? 35.728  12.144  5.733   1.00 48.76  ? 497  THR A CA  1 
ATOM   4047 C  C   . THR A 1 497 ? 36.753  11.111  6.171   1.00 50.64  ? 497  THR A C   1 
ATOM   4048 O  O   . THR A 1 497 ? 37.018  10.134  5.469   1.00 50.89  ? 497  THR A O   1 
ATOM   4049 C  CB  . THR A 1 497 ? 34.422  11.953  6.532   1.00 44.68  ? 497  THR A CB  1 
ATOM   4050 O  OG1 . THR A 1 497 ? 34.628  12.298  7.910   1.00 54.32  ? 497  THR A OG1 1 
ATOM   4051 C  CG2 . THR A 1 497 ? 33.963  10.516  6.439   1.00 36.94  ? 497  THR A CG2 1 
ATOM   4052 N  N   . ASP A 1 498 ? 37.339  11.359  7.333   1.00 52.42  ? 498  ASP A N   1 
ATOM   4053 C  CA  . ASP A 1 498 ? 38.334  10.478  7.913   1.00 54.27  ? 498  ASP A CA  1 
ATOM   4054 C  C   . ASP A 1 498 ? 37.747  9.753   9.117   1.00 58.09  ? 498  ASP A C   1 
ATOM   4055 O  O   . ASP A 1 498 ? 38.471  9.115   9.884   1.00 58.90  ? 498  ASP A O   1 
ATOM   4056 C  CB  . ASP A 1 498 ? 39.542  11.292  8.356   1.00 48.35  ? 498  ASP A CB  1 
ATOM   4057 C  CG  . ASP A 1 498 ? 39.186  12.345  9.393   1.00 59.24  ? 498  ASP A CG  1 
ATOM   4058 O  OD1 . ASP A 1 498 ? 39.038  11.995  10.590  1.00 48.74  ? 498  ASP A OD1 1 
ATOM   4059 O  OD2 . ASP A 1 498 ? 39.054  13.525  9.003   1.00 70.38  ? 498  ASP A OD2 1 
ATOM   4060 N  N   . SER A 1 499 ? 36.440  9.890   9.314   1.00 61.44  ? 499  SER A N   1 
ATOM   4061 C  CA  . SER A 1 499 ? 35.791  9.241   10.444  1.00 65.83  ? 499  SER A CA  1 
ATOM   4062 C  C   . SER A 1 499 ? 35.721  7.736   10.224  1.00 63.59  ? 499  SER A C   1 
ATOM   4063 O  O   . SER A 1 499 ? 35.088  7.245   9.285   1.00 62.11  ? 499  SER A O   1 
ATOM   4064 C  CB  . SER A 1 499 ? 34.389  9.814   10.689  1.00 71.26  ? 499  SER A CB  1 
ATOM   4065 O  OG  . SER A 1 499 ? 33.811  9.274   11.874  1.00 67.99  ? 499  SER A OG  1 
ATOM   4066 N  N   . GLN A 1 500 ? 36.388  7.009   11.106  1.00 59.53  ? 500  GLN A N   1 
ATOM   4067 C  CA  . GLN A 1 500 ? 36.415  5.563   11.037  1.00 51.65  ? 500  GLN A CA  1 
ATOM   4068 C  C   . GLN A 1 500 ? 34.989  4.995   11.100  1.00 42.18  ? 500  GLN A C   1 
ATOM   4069 O  O   . GLN A 1 500 ? 34.670  4.039   10.398  1.00 35.68  ? 500  GLN A O   1 
ATOM   4070 C  CB  . GLN A 1 500 ? 37.271  5.040   12.184  1.00 61.11  ? 500  GLN A CB  1 
ATOM   4071 C  CG  . GLN A 1 500 ? 38.360  4.075   11.750  1.00 76.20  ? 500  GLN A CG  1 
ATOM   4072 C  CD  . GLN A 1 500 ? 38.010  2.631   12.064  1.00 91.42  ? 500  GLN A CD  1 
ATOM   4073 O  OE1 . GLN A 1 500 ? 38.327  1.716   11.298  1.00 92.38  ? 500  GLN A OE1 1 
ATOM   4074 N  NE2 . GLN A 1 500 ? 37.362  2.418   13.208  1.00 100.26 ? 500  GLN A NE2 1 
ATOM   4075 N  N   . TYR A 1 501 ? 34.125  5.627   11.894  1.00 30.51  ? 501  TYR A N   1 
ATOM   4076 C  CA  . TYR A 1 501 ? 32.733  5.201   12.043  1.00 20.47  ? 501  TYR A CA  1 
ATOM   4077 C  C   . TYR A 1 501 ? 31.969  5.243   10.709  1.00 10.57  ? 501  TYR A C   1 
ATOM   4078 O  O   . TYR A 1 501 ? 31.100  4.403   10.434  1.00 6.36   ? 501  TYR A O   1 
ATOM   4079 C  CB  . TYR A 1 501 ? 32.034  6.099   13.067  1.00 30.89  ? 501  TYR A CB  1 
ATOM   4080 C  CG  . TYR A 1 501 ? 30.708  5.567   13.576  1.00 42.44  ? 501  TYR A CG  1 
ATOM   4081 C  CD1 . TYR A 1 501 ? 29.565  5.583   12.763  1.00 28.70  ? 501  TYR A CD1 1 
ATOM   4082 C  CD2 . TYR A 1 501 ? 30.599  5.024   14.863  1.00 51.79  ? 501  TYR A CD2 1 
ATOM   4083 C  CE1 . TYR A 1 501 ? 28.346  5.068   13.208  1.00 35.40  ? 501  TYR A CE1 1 
ATOM   4084 C  CE2 . TYR A 1 501 ? 29.376  4.504   15.325  1.00 65.21  ? 501  TYR A CE2 1 
ATOM   4085 C  CZ  . TYR A 1 501 ? 28.253  4.527   14.487  1.00 57.61  ? 501  TYR A CZ  1 
ATOM   4086 O  OH  . TYR A 1 501 ? 27.051  3.997   14.919  1.00 48.87  ? 501  TYR A OH  1 
ATOM   4087 N  N   . ALA A 1 502 ? 32.295  6.231   9.890   1.00 9.05   ? 502  ALA A N   1 
ATOM   4088 C  CA  . ALA A 1 502 ? 31.663  6.411   8.582   1.00 19.00  ? 502  ALA A CA  1 
ATOM   4089 C  C   . ALA A 1 502 ? 32.022  5.260   7.665   1.00 20.91  ? 502  ALA A C   1 
ATOM   4090 O  O   . ALA A 1 502 ? 31.300  4.939   6.707   1.00 9.90   ? 502  ALA A O   1 
ATOM   4091 C  CB  . ALA A 1 502 ? 32.124  7.711   7.967   1.00 29.40  ? 502  ALA A CB  1 
ATOM   4092 N  N   . LEU A 1 503 ? 33.201  4.713   7.925   1.00 25.73  ? 503  LEU A N   1 
ATOM   4093 C  CA  . LEU A 1 503 ? 33.718  3.577   7.192   1.00 28.66  ? 503  LEU A CA  1 
ATOM   4094 C  C   . LEU A 1 503 ? 32.725  2.462   7.530   1.00 28.83  ? 503  LEU A C   1 
ATOM   4095 O  O   . LEU A 1 503 ? 32.278  1.721   6.636   1.00 30.03  ? 503  LEU A O   1 
ATOM   4096 C  CB  . LEU A 1 503 ? 35.126  3.258   7.715   1.00 42.00  ? 503  LEU A CB  1 
ATOM   4097 C  CG  . LEU A 1 503 ? 36.091  2.337   6.967   1.00 39.31  ? 503  LEU A CG  1 
ATOM   4098 C  CD1 . LEU A 1 503 ? 36.266  2.821   5.530   1.00 50.94  ? 503  LEU A CD1 1 
ATOM   4099 C  CD2 . LEU A 1 503 ? 37.433  2.304   7.703   1.00 26.74  ? 503  LEU A CD2 1 
ATOM   4100 N  N   . GLY A 1 504 ? 32.342  2.404   8.813   1.00 19.25  ? 504  GLY A N   1 
ATOM   4101 C  CA  . GLY A 1 504 ? 31.377  1.424   9.277   1.00 12.65  ? 504  GLY A CA  1 
ATOM   4102 C  C   . GLY A 1 504 ? 30.098  1.592   8.475   1.00 12.95  ? 504  GLY A C   1 
ATOM   4103 O  O   . GLY A 1 504 ? 29.620  0.668   7.828   1.00 3.28   ? 504  GLY A O   1 
ATOM   4104 N  N   . ILE A 1 505 ? 29.577  2.809   8.458   1.00 21.36  ? 505  ILE A N   1 
ATOM   4105 C  CA  . ILE A 1 505 ? 28.357  3.119   7.709   1.00 24.96  ? 505  ILE A CA  1 
ATOM   4106 C  C   . ILE A 1 505 ? 28.479  2.767   6.219   1.00 16.00  ? 505  ILE A C   1 
ATOM   4107 O  O   . ILE A 1 505 ? 27.482  2.461   5.568   1.00 14.17  ? 505  ILE A O   1 
ATOM   4108 C  CB  . ILE A 1 505 ? 27.987  4.625   7.868   1.00 23.12  ? 505  ILE A CB  1 
ATOM   4109 C  CG1 . ILE A 1 505 ? 27.806  4.941   9.350   1.00 9.22   ? 505  ILE A CG1 1 
ATOM   4110 C  CG2 . ILE A 1 505 ? 26.713  5.003   7.052   1.00 2.00   ? 505  ILE A CG2 1 
ATOM   4111 C  CD1 . ILE A 1 505 ? 27.852  6.417   9.642   1.00 5.65   ? 505  ILE A CD1 1 
ATOM   4112 N  N   . ILE A 1 506 ? 29.681  2.846   5.670   1.00 10.68  ? 506  ILE A N   1 
ATOM   4113 C  CA  . ILE A 1 506 ? 29.868  2.510   4.263   1.00 18.94  ? 506  ILE A CA  1 
ATOM   4114 C  C   . ILE A 1 506 ? 29.693  1.017   4.062   1.00 15.25  ? 506  ILE A C   1 
ATOM   4115 O  O   . ILE A 1 506 ? 28.996  0.560   3.147   1.00 2.00   ? 506  ILE A O   1 
ATOM   4116 C  CB  . ILE A 1 506 ? 31.255  2.940   3.759   1.00 29.48  ? 506  ILE A CB  1 
ATOM   4117 C  CG1 . ILE A 1 506 ? 31.357  4.478   3.802   1.00 36.55  ? 506  ILE A CG1 1 
ATOM   4118 C  CG2 . ILE A 1 506 ? 31.478  2.400   2.347   1.00 22.06  ? 506  ILE A CG2 1 
ATOM   4119 C  CD1 . ILE A 1 506 ? 32.760  5.049   3.655   1.00 24.81  ? 506  ILE A CD1 1 
ATOM   4120 N  N   . GLN A 1 507 ? 30.289  0.267   4.975   1.00 29.14  ? 507  GLN A N   1 
ATOM   4121 C  CA  . GLN A 1 507 ? 30.231  -1.186  4.940   1.00 39.49  ? 507  GLN A CA  1 
ATOM   4122 C  C   . GLN A 1 507 ? 28.838  -1.687  5.341   1.00 36.12  ? 507  GLN A C   1 
ATOM   4123 O  O   . GLN A 1 507 ? 28.200  -2.417  4.594   1.00 34.28  ? 507  GLN A O   1 
ATOM   4124 C  CB  . GLN A 1 507 ? 31.308  -1.768  5.885   1.00 50.50  ? 507  GLN A CB  1 
ATOM   4125 C  CG  . GLN A 1 507 ? 31.648  -3.266  5.704   1.00 48.53  ? 507  GLN A CG  1 
ATOM   4126 C  CD  . GLN A 1 507 ? 32.659  -3.797  6.744   1.00 46.97  ? 507  GLN A CD  1 
ATOM   4127 O  OE1 . GLN A 1 507 ? 32.630  -3.414  7.912   1.00 52.95  ? 507  GLN A OE1 1 
ATOM   4128 N  NE2 . GLN A 1 507 ? 33.542  -4.691  6.314   1.00 44.50  ? 507  GLN A NE2 1 
ATOM   4129 N  N   . ALA A 1 508 ? 28.364  -1.265  6.508   1.00 39.39  ? 508  ALA A N   1 
ATOM   4130 C  CA  . ALA A 1 508 ? 27.073  -1.698  7.033   1.00 41.89  ? 508  ALA A CA  1 
ATOM   4131 C  C   . ALA A 1 508 ? 25.821  -1.043  6.455   1.00 44.75  ? 508  ALA A C   1 
ATOM   4132 O  O   . ALA A 1 508 ? 24.788  -1.704  6.336   1.00 51.78  ? 508  ALA A O   1 
ATOM   4133 C  CB  . ALA A 1 508 ? 27.066  -1.586  8.553   1.00 39.18  ? 508  ALA A CB  1 
ATOM   4134 N  N   . GLN A 1 509 ? 25.902  0.244   6.121   1.00 37.53  ? 509  GLN A N   1 
ATOM   4135 C  CA  . GLN A 1 509 ? 24.757  0.981   5.579   1.00 22.08  ? 509  GLN A CA  1 
ATOM   4136 C  C   . GLN A 1 509 ? 23.529  0.681   6.442   1.00 24.33  ? 509  GLN A C   1 
ATOM   4137 O  O   . GLN A 1 509 ? 22.511  0.151   5.969   1.00 19.50  ? 509  GLN A O   1 
ATOM   4138 C  CB  . GLN A 1 509 ? 24.533  0.622   4.100   1.00 2.00   ? 509  GLN A CB  1 
ATOM   4139 C  CG  . GLN A 1 509 ? 25.738  0.973   3.215   1.00 11.28  ? 509  GLN A CG  1 
ATOM   4140 C  CD  . GLN A 1 509 ? 25.464  0.852   1.727   1.00 36.01  ? 509  GLN A CD  1 
ATOM   4141 O  OE1 . GLN A 1 509 ? 24.423  1.296   1.226   1.00 48.08  ? 509  GLN A OE1 1 
ATOM   4142 N  NE2 . GLN A 1 509 ? 26.415  0.277   1.001   1.00 36.31  ? 509  GLN A NE2 1 
ATOM   4143 N  N   . PRO A 1 510 ? 23.635  0.972   7.751   1.00 26.52  ? 510  PRO A N   1 
ATOM   4144 C  CA  . PRO A 1 510 ? 22.503  0.706   8.640   1.00 21.69  ? 510  PRO A CA  1 
ATOM   4145 C  C   . PRO A 1 510 ? 21.364  1.683   8.374   1.00 18.00  ? 510  PRO A C   1 
ATOM   4146 O  O   . PRO A 1 510 ? 21.583  2.757   7.822   1.00 19.15  ? 510  PRO A O   1 
ATOM   4147 C  CB  . PRO A 1 510 ? 23.114  0.899   10.029  1.00 14.80  ? 510  PRO A CB  1 
ATOM   4148 C  CG  . PRO A 1 510 ? 24.083  2.040   9.797   1.00 19.59  ? 510  PRO A CG  1 
ATOM   4149 C  CD  . PRO A 1 510 ? 24.724  1.679   8.461   1.00 22.33  ? 510  PRO A CD  1 
ATOM   4150 N  N   . ASP A 1 511 ? 20.144  1.277   8.705   1.00 19.49  ? 511  ASP A N   1 
ATOM   4151 C  CA  . ASP A 1 511 ? 18.978  2.130   8.532   1.00 13.33  ? 511  ASP A CA  1 
ATOM   4152 C  C   . ASP A 1 511 ? 18.292  2.311   9.875   1.00 10.99  ? 511  ASP A C   1 
ATOM   4153 O  O   . ASP A 1 511 ? 17.082  2.525   9.964   1.00 6.90   ? 511  ASP A O   1 
ATOM   4154 C  CB  . ASP A 1 511 ? 18.016  1.596   7.451   1.00 19.98  ? 511  ASP A CB  1 
ATOM   4155 C  CG  . ASP A 1 511 ? 17.507  0.185   7.729   1.00 24.64  ? 511  ASP A CG  1 
ATOM   4156 O  OD1 . ASP A 1 511 ? 17.176  -0.158  8.895   1.00 2.00   ? 511  ASP A OD1 1 
ATOM   4157 O  OD2 . ASP A 1 511 ? 17.404  -0.573  6.741   1.00 38.24  ? 511  ASP A OD2 1 
ATOM   4158 N  N   . GLN A 1 512 ? 19.083  2.150   10.927  1.00 16.10  ? 512  GLN A N   1 
ATOM   4159 C  CA  . GLN A 1 512 ? 18.624  2.328   12.294  1.00 22.87  ? 512  GLN A CA  1 
ATOM   4160 C  C   . GLN A 1 512 ? 19.836  2.264   13.184  1.00 27.28  ? 512  GLN A C   1 
ATOM   4161 O  O   . GLN A 1 512 ? 20.781  1.535   12.889  1.00 32.47  ? 512  GLN A O   1 
ATOM   4162 C  CB  . GLN A 1 512 ? 17.602  1.273   12.689  1.00 28.10  ? 512  GLN A CB  1 
ATOM   4163 C  CG  . GLN A 1 512 ? 17.929  -0.138  12.260  1.00 28.67  ? 512  GLN A CG  1 
ATOM   4164 C  CD  . GLN A 1 512 ? 16.688  -0.991  12.251  1.00 31.43  ? 512  GLN A CD  1 
ATOM   4165 O  OE1 . GLN A 1 512 ? 16.253  -1.462  11.197  1.00 47.92  ? 512  GLN A OE1 1 
ATOM   4166 N  NE2 . GLN A 1 512 ? 16.067  -1.147  13.420  1.00 13.02  ? 512  GLN A NE2 1 
ATOM   4167 N  N   . SER A 1 513 ? 19.823  3.061   14.245  1.00 31.58  ? 513  SER A N   1 
ATOM   4168 C  CA  . SER A 1 513 ? 20.936  3.119   15.172  1.00 28.39  ? 513  SER A CA  1 
ATOM   4169 C  C   . SER A 1 513 ? 20.506  3.583   16.556  1.00 28.59  ? 513  SER A C   1 
ATOM   4170 O  O   . SER A 1 513 ? 19.431  4.162   16.733  1.00 22.63  ? 513  SER A O   1 
ATOM   4171 C  CB  . SER A 1 513 ? 22.000  4.069   14.620  1.00 40.41  ? 513  SER A CB  1 
ATOM   4172 O  OG  . SER A 1 513 ? 23.111  4.188   15.493  1.00 54.11  ? 513  SER A OG  1 
ATOM   4173 N  N   . GLU A 1 514 ? 21.369  3.325   17.531  1.00 41.93  ? 514  GLU A N   1 
ATOM   4174 C  CA  . GLU A 1 514 ? 21.134  3.711   18.917  1.00 54.45  ? 514  GLU A CA  1 
ATOM   4175 C  C   . GLU A 1 514 ? 21.335  5.221   19.041  1.00 60.23  ? 514  GLU A C   1 
ATOM   4176 O  O   . GLU A 1 514 ? 20.846  5.839   19.987  1.00 61.24  ? 514  GLU A O   1 
ATOM   4177 C  CB  . GLU A 1 514 ? 22.119  2.988   19.853  1.00 66.46  ? 514  GLU A CB  1 
ATOM   4178 C  CG  . GLU A 1 514 ? 23.605  3.324   19.598  1.00 79.88  ? 514  GLU A CG  1 
ATOM   4179 C  CD  . GLU A 1 514 ? 24.563  2.788   20.664  1.00 85.77  ? 514  GLU A CD  1 
ATOM   4180 O  OE1 . GLU A 1 514 ? 24.123  2.514   21.802  1.00 85.14  ? 514  GLU A OE1 1 
ATOM   4181 O  OE2 . GLU A 1 514 ? 25.770  2.660   20.359  1.00 95.78  ? 514  GLU A OE2 1 
ATOM   4182 N  N   . SER A 1 515 ? 22.071  5.799   18.086  1.00 63.22  ? 515  SER A N   1 
ATOM   4183 C  CA  . SER A 1 515 ? 22.374  7.230   18.062  1.00 66.55  ? 515  SER A CA  1 
ATOM   4184 C  C   . SER A 1 515 ? 21.414  8.047   17.209  1.00 65.48  ? 515  SER A C   1 
ATOM   4185 O  O   . SER A 1 515 ? 21.366  7.902   15.985  1.00 60.23  ? 515  SER A O   1 
ATOM   4186 C  CB  . SER A 1 515 ? 23.821  7.461   17.600  1.00 69.83  ? 515  SER A CB  1 
ATOM   4187 O  OG  . SER A 1 515 ? 23.966  8.640   16.817  1.00 64.97  ? 515  SER A OG  1 
ATOM   4188 N  N   . GLU A 1 516 ? 20.711  8.962   17.867  1.00 69.91  ? 516  GLU A N   1 
ATOM   4189 C  CA  . GLU A 1 516 ? 19.750  9.840   17.212  1.00 75.33  ? 516  GLU A CA  1 
ATOM   4190 C  C   . GLU A 1 516 ? 20.431  10.552  16.041  1.00 68.95  ? 516  GLU A C   1 
ATOM   4191 O  O   . GLU A 1 516 ? 19.880  10.649  14.945  1.00 60.51  ? 516  GLU A O   1 
ATOM   4192 C  CB  . GLU A 1 516 ? 19.237  10.870  18.227  1.00 90.79  ? 516  GLU A CB  1 
ATOM   4193 C  CG  . GLU A 1 516 ? 18.119  11.784  17.728  1.00 112.62 ? 516  GLU A CG  1 
ATOM   4194 C  CD  . GLU A 1 516 ? 16.724  11.244  18.015  1.00 130.34 ? 516  GLU A CD  1 
ATOM   4195 O  OE1 . GLU A 1 516 ? 16.389  11.051  19.207  1.00 135.42 ? 516  GLU A OE1 1 
ATOM   4196 O  OE2 . GLU A 1 516 ? 15.953  11.030  17.053  1.00 138.28 ? 516  GLU A OE2 1 
ATOM   4197 N  N   . LEU A 1 517 ? 21.656  11.007  16.287  1.00 67.06  ? 517  LEU A N   1 
ATOM   4198 C  CA  . LEU A 1 517 ? 22.455  11.720  15.295  1.00 59.88  ? 517  LEU A CA  1 
ATOM   4199 C  C   . LEU A 1 517 ? 22.543  10.925  14.000  1.00 45.84  ? 517  LEU A C   1 
ATOM   4200 O  O   . LEU A 1 517 ? 22.167  11.405  12.926  1.00 40.23  ? 517  LEU A O   1 
ATOM   4201 C  CB  . LEU A 1 517 ? 23.861  11.947  15.855  1.00 64.30  ? 517  LEU A CB  1 
ATOM   4202 C  CG  . LEU A 1 517 ? 24.630  13.188  15.406  1.00 66.78  ? 517  LEU A CG  1 
ATOM   4203 C  CD1 . LEU A 1 517 ? 26.027  13.132  16.012  1.00 62.33  ? 517  LEU A CD1 1 
ATOM   4204 C  CD2 . LEU A 1 517 ? 24.684  13.299  13.877  1.00 65.26  ? 517  LEU A CD2 1 
ATOM   4205 N  N   . VAL A 1 518 ? 23.063  9.709   14.129  1.00 37.19  ? 518  VAL A N   1 
ATOM   4206 C  CA  . VAL A 1 518 ? 23.224  8.793   13.013  1.00 34.89  ? 518  VAL A CA  1 
ATOM   4207 C  C   . VAL A 1 518 ? 21.897  8.675   12.277  1.00 27.92  ? 518  VAL A C   1 
ATOM   4208 O  O   . VAL A 1 518 ? 21.820  8.859   11.041  1.00 5.05   ? 518  VAL A O   1 
ATOM   4209 C  CB  . VAL A 1 518 ? 23.643  7.396   13.517  1.00 34.01  ? 518  VAL A CB  1 
ATOM   4210 C  CG1 . VAL A 1 518 ? 23.794  6.444   12.346  1.00 44.06  ? 518  VAL A CG1 1 
ATOM   4211 C  CG2 . VAL A 1 518 ? 24.946  7.486   14.295  1.00 33.77  ? 518  VAL A CG2 1 
ATOM   4212 N  N   . ASN A 1 519 ? 20.860  8.416   13.075  1.00 23.18  ? 519  ASN A N   1 
ATOM   4213 C  CA  . ASN A 1 519 ? 19.499  8.263   12.593  1.00 19.22  ? 519  ASN A CA  1 
ATOM   4214 C  C   . ASN A 1 519 ? 19.208  9.400   11.638  1.00 18.57  ? 519  ASN A C   1 
ATOM   4215 O  O   . ASN A 1 519 ? 18.843  9.182   10.480  1.00 12.31  ? 519  ASN A O   1 
ATOM   4216 C  CB  . ASN A 1 519 ? 18.518  8.325   13.771  1.00 24.69  ? 519  ASN A CB  1 
ATOM   4217 C  CG  . ASN A 1 519 ? 18.585  7.093   14.671  1.00 30.24  ? 519  ASN A CG  1 
ATOM   4218 O  OD1 . ASN A 1 519 ? 19.158  6.059   14.303  1.00 31.41  ? 519  ASN A OD1 1 
ATOM   4219 N  ND2 . ASN A 1 519 ? 17.969  7.188   15.847  1.00 2.00   ? 519  ASN A ND2 1 
ATOM   4220 N  N   . GLN A 1 520 ? 19.462  10.614  12.119  1.00 24.19  ? 520  GLN A N   1 
ATOM   4221 C  CA  . GLN A 1 520 ? 19.233  11.837  11.362  1.00 16.61  ? 520  GLN A CA  1 
ATOM   4222 C  C   . GLN A 1 520 ? 19.902  11.745  10.016  1.00 8.68   ? 520  GLN A C   1 
ATOM   4223 O  O   . GLN A 1 520 ? 19.259  11.936  8.962   1.00 2.00   ? 520  GLN A O   1 
ATOM   4224 C  CB  . GLN A 1 520 ? 19.779  13.028  12.136  1.00 14.09  ? 520  GLN A CB  1 
ATOM   4225 C  CG  . GLN A 1 520 ? 19.071  13.250  13.453  1.00 50.99  ? 520  GLN A CG  1 
ATOM   4226 C  CD  . GLN A 1 520 ? 19.739  14.308  14.310  1.00 81.06  ? 520  GLN A CD  1 
ATOM   4227 O  OE1 . GLN A 1 520 ? 20.840  14.763  14.007  1.00 96.71  ? 520  GLN A OE1 1 
ATOM   4228 N  NE2 . GLN A 1 520 ? 19.076  14.698  15.395  1.00 89.59  ? 520  GLN A NE2 1 
ATOM   4229 N  N   . ILE A 1 521 ? 21.183  11.404  10.067  1.00 2.00   ? 521  ILE A N   1 
ATOM   4230 C  CA  . ILE A 1 521 ? 21.992  11.260  8.866   1.00 14.55  ? 521  ILE A CA  1 
ATOM   4231 C  C   . ILE A 1 521 ? 21.318  10.277  7.918   1.00 8.24   ? 521  ILE A C   1 
ATOM   4232 O  O   . ILE A 1 521 ? 21.210  10.542  6.719   1.00 2.00   ? 521  ILE A O   1 
ATOM   4233 C  CB  . ILE A 1 521 ? 23.392  10.736  9.207   1.00 23.51  ? 521  ILE A CB  1 
ATOM   4234 C  CG1 . ILE A 1 521 ? 23.944  11.506  10.412  1.00 9.23   ? 521  ILE A CG1 1 
ATOM   4235 C  CG2 . ILE A 1 521 ? 24.310  10.829  7.959   1.00 4.75   ? 521  ILE A CG2 1 
ATOM   4236 C  CD1 . ILE A 1 521 ? 25.240  10.976  10.931  1.00 2.00   ? 521  ILE A CD1 1 
ATOM   4237 N  N   . ILE A 1 522 ? 20.851  9.163   8.483   1.00 2.00   ? 522  ILE A N   1 
ATOM   4238 C  CA  . ILE A 1 522 ? 20.142  8.137   7.730   1.00 10.97  ? 522  ILE A CA  1 
ATOM   4239 C  C   . ILE A 1 522 ? 18.961  8.805   7.022   1.00 13.76  ? 522  ILE A C   1 
ATOM   4240 O  O   . ILE A 1 522 ? 18.770  8.638   5.822   1.00 2.00   ? 522  ILE A O   1 
ATOM   4241 C  CB  . ILE A 1 522 ? 19.561  7.030   8.671   1.00 15.83  ? 522  ILE A CB  1 
ATOM   4242 C  CG1 . ILE A 1 522 ? 20.663  6.429   9.546   1.00 27.53  ? 522  ILE A CG1 1 
ATOM   4243 C  CG2 . ILE A 1 522 ? 18.922  5.918   7.857   1.00 9.16   ? 522  ILE A CG2 1 
ATOM   4244 C  CD1 . ILE A 1 522 ? 20.198  5.294   10.461  1.00 5.35   ? 522  ILE A CD1 1 
ATOM   4245 N  N   . GLU A 1 523 ? 18.187  9.585   7.771   1.00 23.49  ? 523  GLU A N   1 
ATOM   4246 C  CA  . GLU A 1 523 ? 17.030  10.264  7.202   1.00 34.22  ? 523  GLU A CA  1 
ATOM   4247 C  C   . GLU A 1 523 ? 17.432  11.102  6.007   1.00 27.25  ? 523  GLU A C   1 
ATOM   4248 O  O   . GLU A 1 523 ? 16.791  11.059  4.948   1.00 11.26  ? 523  GLU A O   1 
ATOM   4249 C  CB  . GLU A 1 523 ? 16.342  11.127  8.255   1.00 51.05  ? 523  GLU A CB  1 
ATOM   4250 C  CG  . GLU A 1 523 ? 15.807  10.332  9.456   1.00 77.35  ? 523  GLU A CG  1 
ATOM   4251 C  CD  . GLU A 1 523 ? 14.798  9.239   9.082   1.00 94.02  ? 523  GLU A CD  1 
ATOM   4252 O  OE1 . GLU A 1 523 ? 14.065  9.404   8.078   1.00 105.99 ? 523  GLU A OE1 1 
ATOM   4253 O  OE2 . GLU A 1 523 ? 14.732  8.216   9.805   1.00 88.54  ? 523  GLU A OE2 1 
ATOM   4254 N  N   . GLN A 1 524 ? 18.544  11.808  6.171   1.00 33.61  ? 524  GLN A N   1 
ATOM   4255 C  CA  . GLN A 1 524 ? 19.084  12.659  5.121   1.00 39.99  ? 524  GLN A CA  1 
ATOM   4256 C  C   . GLN A 1 524 ? 19.566  11.802  3.973   1.00 32.68  ? 524  GLN A C   1 
ATOM   4257 O  O   . GLN A 1 524 ? 19.325  12.112  2.803   1.00 29.35  ? 524  GLN A O   1 
ATOM   4258 C  CB  . GLN A 1 524 ? 20.246  13.483  5.662   1.00 54.02  ? 524  GLN A CB  1 
ATOM   4259 C  CG  . GLN A 1 524 ? 19.828  14.579  6.630   1.00 63.58  ? 524  GLN A CG  1 
ATOM   4260 C  CD  . GLN A 1 524 ? 19.020  15.672  5.959   1.00 60.98  ? 524  GLN A CD  1 
ATOM   4261 O  OE1 . GLN A 1 524 ? 19.546  16.452  5.174   1.00 56.06  ? 524  GLN A OE1 1 
ATOM   4262 N  NE2 . GLN A 1 524 ? 17.736  15.732  6.268   1.00 71.69  ? 524  GLN A NE2 1 
ATOM   4263 N  N   . LEU A 1 525 ? 20.224  10.707  4.325   1.00 28.89  ? 525  LEU A N   1 
ATOM   4264 C  CA  . LEU A 1 525 ? 20.741  9.779   3.340   1.00 32.08  ? 525  LEU A CA  1 
ATOM   4265 C  C   . LEU A 1 525 ? 19.571  9.324   2.495   1.00 34.75  ? 525  LEU A C   1 
ATOM   4266 O  O   . LEU A 1 525 ? 19.485  9.659   1.319   1.00 43.50  ? 525  LEU A O   1 
ATOM   4267 C  CB  . LEU A 1 525 ? 21.381  8.569   4.021   1.00 26.32  ? 525  LEU A CB  1 
ATOM   4268 C  CG  . LEU A 1 525 ? 22.677  8.781   4.808   1.00 27.37  ? 525  LEU A CG  1 
ATOM   4269 C  CD1 . LEU A 1 525 ? 22.989  7.518   5.573   1.00 25.05  ? 525  LEU A CD1 1 
ATOM   4270 C  CD2 . LEU A 1 525 ? 23.834  9.162   3.881   1.00 20.73  ? 525  LEU A CD2 1 
ATOM   4271 N  N   . ILE A 1 526 ? 18.628  8.646   3.139   1.00 32.40  ? 526  ILE A N   1 
ATOM   4272 C  CA  . ILE A 1 526 ? 17.442  8.126   2.485   1.00 24.75  ? 526  ILE A CA  1 
ATOM   4273 C  C   . ILE A 1 526 ? 16.831  9.158   1.571   1.00 29.78  ? 526  ILE A C   1 
ATOM   4274 O  O   . ILE A 1 526 ? 16.309  8.821   0.508   1.00 41.63  ? 526  ILE A O   1 
ATOM   4275 C  CB  . ILE A 1 526 ? 16.375  7.748   3.505   1.00 17.41  ? 526  ILE A CB  1 
ATOM   4276 C  CG1 . ILE A 1 526 ? 16.950  6.787   4.540   1.00 2.00   ? 526  ILE A CG1 1 
ATOM   4277 C  CG2 . ILE A 1 526 ? 15.168  7.138   2.796   1.00 5.65   ? 526  ILE A CG2 1 
ATOM   4278 C  CD1 . ILE A 1 526 ? 16.000  6.510   5.651   1.00 2.00   ? 526  ILE A CD1 1 
ATOM   4279 N  N   . LYS A 1 527 ? 16.889  10.415  1.990   1.00 28.28  ? 527  LYS A N   1 
ATOM   4280 C  CA  . LYS A 1 527 ? 16.318  11.485  1.195   1.00 35.13  ? 527  LYS A CA  1 
ATOM   4281 C  C   . LYS A 1 527 ? 17.040  11.808  -0.112  1.00 35.48  ? 527  LYS A C   1 
ATOM   4282 O  O   . LYS A 1 527 ? 16.402  12.108  -1.129  1.00 36.66  ? 527  LYS A O   1 
ATOM   4283 C  CB  . LYS A 1 527 ? 16.152  12.729  2.052   1.00 29.04  ? 527  LYS A CB  1 
ATOM   4284 C  CG  . LYS A 1 527 ? 15.045  12.566  3.059   1.00 24.99  ? 527  LYS A CG  1 
ATOM   4285 C  CD  . LYS A 1 527 ? 14.975  13.764  3.961   1.00 43.32  ? 527  LYS A CD  1 
ATOM   4286 C  CE  . LYS A 1 527 ? 13.857  13.626  4.966   1.00 43.16  ? 527  LYS A CE  1 
ATOM   4287 N  NZ  . LYS A 1 527 ? 13.941  14.720  5.963   1.00 47.66  ? 527  LYS A NZ  1 
ATOM   4288 N  N   . LYS A 1 528 ? 18.362  11.706  -0.098  1.00 36.65  ? 528  LYS A N   1 
ATOM   4289 C  CA  . LYS A 1 528 ? 19.167  12.009  -1.279  1.00 33.23  ? 528  LYS A CA  1 
ATOM   4290 C  C   . LYS A 1 528 ? 18.870  11.067  -2.435  1.00 28.82  ? 528  LYS A C   1 
ATOM   4291 O  O   . LYS A 1 528 ? 18.524  9.904   -2.221  1.00 28.77  ? 528  LYS A O   1 
ATOM   4292 C  CB  . LYS A 1 528 ? 20.648  11.911  -0.927  1.00 26.35  ? 528  LYS A CB  1 
ATOM   4293 C  CG  . LYS A 1 528 ? 21.083  12.830  0.189   1.00 19.90  ? 528  LYS A CG  1 
ATOM   4294 C  CD  . LYS A 1 528 ? 21.060  14.269  -0.282  1.00 29.59  ? 528  LYS A CD  1 
ATOM   4295 C  CE  . LYS A 1 528 ? 21.574  15.218  0.789   1.00 30.78  ? 528  LYS A CE  1 
ATOM   4296 N  NZ  . LYS A 1 528 ? 21.704  16.596  0.245   1.00 16.00  ? 528  LYS A NZ  1 
ATOM   4297 N  N   . GLU A 1 529 ? 18.968  11.578  -3.659  1.00 26.97  ? 529  GLU A N   1 
ATOM   4298 C  CA  . GLU A 1 529 ? 18.751  10.743  -4.836  1.00 34.46  ? 529  GLU A CA  1 
ATOM   4299 C  C   . GLU A 1 529 ? 19.981  9.870   -5.016  1.00 34.02  ? 529  GLU A C   1 
ATOM   4300 O  O   . GLU A 1 529 ? 19.891  8.742   -5.507  1.00 30.12  ? 529  GLU A O   1 
ATOM   4301 C  CB  . GLU A 1 529 ? 18.548  11.583  -6.091  1.00 44.07  ? 529  GLU A CB  1 
ATOM   4302 C  CG  . GLU A 1 529 ? 17.161  12.175  -6.206  1.00 74.02  ? 529  GLU A CG  1 
ATOM   4303 C  CD  . GLU A 1 529 ? 16.890  12.784  -7.573  1.00 94.89  ? 529  GLU A CD  1 
ATOM   4304 O  OE1 . GLU A 1 529 ? 17.845  13.272  -8.222  1.00 104.60 ? 529  GLU A OE1 1 
ATOM   4305 O  OE2 . GLU A 1 529 ? 15.714  12.775  -7.997  1.00 101.93 ? 529  GLU A OE2 1 
ATOM   4306 N  N   . LYS A 1 530 ? 21.129  10.419  -4.620  1.00 33.44  ? 530  LYS A N   1 
ATOM   4307 C  CA  . LYS A 1 530 ? 22.420  9.744   -4.699  1.00 26.81  ? 530  LYS A CA  1 
ATOM   4308 C  C   . LYS A 1 530 ? 23.359  10.299  -3.632  1.00 26.08  ? 530  LYS A C   1 
ATOM   4309 O  O   . LYS A 1 530 ? 23.313  11.493  -3.307  1.00 20.89  ? 530  LYS A O   1 
ATOM   4310 C  CB  . LYS A 1 530 ? 23.069  9.964   -6.065  1.00 21.74  ? 530  LYS A CB  1 
ATOM   4311 C  CG  . LYS A 1 530 ? 22.370  9.304   -7.222  1.00 17.73  ? 530  LYS A CG  1 
ATOM   4312 C  CD  . LYS A 1 530 ? 23.079  9.628   -8.514  1.00 12.35  ? 530  LYS A CD  1 
ATOM   4313 C  CE  . LYS A 1 530 ? 22.481  8.868   -9.689  1.00 7.54   ? 530  LYS A CE  1 
ATOM   4314 N  NZ  . LYS A 1 530 ? 23.311  9.040   -10.918 1.00 2.22   ? 530  LYS A NZ  1 
ATOM   4315 N  N   . VAL A 1 531 ? 24.183  9.420   -3.069  1.00 29.67  ? 531  VAL A N   1 
ATOM   4316 C  CA  . VAL A 1 531 ? 25.170  9.799   -2.055  1.00 31.56  ? 531  VAL A CA  1 
ATOM   4317 C  C   . VAL A 1 531 ? 26.370  8.882   -2.240  1.00 35.78  ? 531  VAL A C   1 
ATOM   4318 O  O   . VAL A 1 531 ? 26.210  7.661   -2.385  1.00 45.21  ? 531  VAL A O   1 
ATOM   4319 C  CB  . VAL A 1 531 ? 24.685  9.575   -0.574  1.00 21.71  ? 531  VAL A CB  1 
ATOM   4320 C  CG1 . VAL A 1 531 ? 25.734  10.098  0.400   1.00 2.00   ? 531  VAL A CG1 1 
ATOM   4321 C  CG2 . VAL A 1 531 ? 23.341  10.222  -0.309  1.00 17.94  ? 531  VAL A CG2 1 
ATOM   4322 N  N   . TYR A 1 532 ? 27.563  9.461   -2.278  1.00 26.53  ? 532  TYR A N   1 
ATOM   4323 C  CA  . TYR A 1 532 ? 28.760  8.652   -2.381  1.00 19.19  ? 532  TYR A CA  1 
ATOM   4324 C  C   . TYR A 1 532 ? 29.681  8.976   -1.219  1.00 11.09  ? 532  TYR A C   1 
ATOM   4325 O  O   . TYR A 1 532 ? 30.205  10.080  -1.115  1.00 6.01   ? 532  TYR A O   1 
ATOM   4326 C  CB  . TYR A 1 532 ? 29.512  8.848   -3.700  1.00 10.48  ? 532  TYR A CB  1 
ATOM   4327 C  CG  . TYR A 1 532 ? 30.803  8.051   -3.699  1.00 2.00   ? 532  TYR A CG  1 
ATOM   4328 C  CD1 . TYR A 1 532 ? 30.794  6.679   -3.938  1.00 2.00   ? 532  TYR A CD1 1 
ATOM   4329 C  CD2 . TYR A 1 532 ? 32.013  8.648   -3.371  1.00 4.85   ? 532  TYR A CD2 1 
ATOM   4330 C  CE1 . TYR A 1 532 ? 31.943  5.924   -3.848  1.00 2.00   ? 532  TYR A CE1 1 
ATOM   4331 C  CE2 . TYR A 1 532 ? 33.181  7.894   -3.270  1.00 12.30  ? 532  TYR A CE2 1 
ATOM   4332 C  CZ  . TYR A 1 532 ? 33.136  6.533   -3.511  1.00 6.34   ? 532  TYR A CZ  1 
ATOM   4333 O  OH  . TYR A 1 532 ? 34.283  5.783   -3.411  1.00 2.00   ? 532  TYR A OH  1 
ATOM   4334 N  N   . LEU A 1 533 ? 29.848  8.018   -0.327  1.00 16.72  ? 533  LEU A N   1 
ATOM   4335 C  CA  . LEU A 1 533 ? 30.728  8.222   0.801   1.00 26.80  ? 533  LEU A CA  1 
ATOM   4336 C  C   . LEU A 1 533 ? 32.078  7.699   0.438   1.00 20.58  ? 533  LEU A C   1 
ATOM   4337 O  O   . LEU A 1 533 ? 32.194  6.645   -0.178  1.00 16.99  ? 533  LEU A O   1 
ATOM   4338 C  CB  . LEU A 1 533 ? 30.251  7.456   2.031   1.00 40.88  ? 533  LEU A CB  1 
ATOM   4339 C  CG  . LEU A 1 533 ? 29.651  8.311   3.132   1.00 37.28  ? 533  LEU A CG  1 
ATOM   4340 C  CD1 . LEU A 1 533 ? 28.471  9.087   2.537   1.00 40.14  ? 533  LEU A CD1 1 
ATOM   4341 C  CD2 . LEU A 1 533 ? 29.214  7.408   4.298   1.00 43.97  ? 533  LEU A CD2 1 
ATOM   4342 N  N   . ALA A 1 534 ? 33.094  8.439   0.843   1.00 25.88  ? 534  ALA A N   1 
ATOM   4343 C  CA  . ALA A 1 534 ? 34.467  8.041   0.622   1.00 23.63  ? 534  ALA A CA  1 
ATOM   4344 C  C   . ALA A 1 534 ? 35.212  8.339   1.943   1.00 25.01  ? 534  ALA A C   1 
ATOM   4345 O  O   . ALA A 1 534 ? 34.940  9.339   2.631   1.00 18.52  ? 534  ALA A O   1 
ATOM   4346 C  CB  . ALA A 1 534 ? 35.061  8.810   -0.564  1.00 4.06   ? 534  ALA A CB  1 
ATOM   4347 N  N   . TRP A 1 535 ? 36.024  7.387   2.377   1.00 23.99  ? 535  TRP A N   1 
ATOM   4348 C  CA  . TRP A 1 535 ? 36.794  7.567   3.596   1.00 30.04  ? 535  TRP A CA  1 
ATOM   4349 C  C   . TRP A 1 535 ? 38.257  7.726   3.248   1.00 35.00  ? 535  TRP A C   1 
ATOM   4350 O  O   . TRP A 1 535 ? 38.765  7.125   2.296   1.00 35.35  ? 535  TRP A O   1 
ATOM   4351 C  CB  . TRP A 1 535 ? 36.631  6.381   4.547   1.00 22.98  ? 535  TRP A CB  1 
ATOM   4352 C  CG  . TRP A 1 535 ? 37.474  6.478   5.787   1.00 25.32  ? 535  TRP A CG  1 
ATOM   4353 C  CD1 . TRP A 1 535 ? 37.089  6.974   7.001   1.00 27.15  ? 535  TRP A CD1 1 
ATOM   4354 C  CD2 . TRP A 1 535 ? 38.827  6.010   5.955   1.00 32.74  ? 535  TRP A CD2 1 
ATOM   4355 N  NE1 . TRP A 1 535 ? 38.107  6.834   7.920   1.00 28.82  ? 535  TRP A NE1 1 
ATOM   4356 C  CE2 . TRP A 1 535 ? 39.186  6.245   7.311   1.00 32.65  ? 535  TRP A CE2 1 
ATOM   4357 C  CE3 . TRP A 1 535 ? 39.768  5.408   5.098   1.00 17.56  ? 535  TRP A CE3 1 
ATOM   4358 C  CZ2 . TRP A 1 535 ? 40.454  5.893   7.836   1.00 14.24  ? 535  TRP A CZ2 1 
ATOM   4359 C  CZ3 . TRP A 1 535 ? 41.033  5.057   5.621   1.00 6.41   ? 535  TRP A CZ3 1 
ATOM   4360 C  CH2 . TRP A 1 535 ? 41.357  5.303   6.978   1.00 2.00   ? 535  TRP A CH2 1 
ATOM   4361 N  N   . VAL A 1 536 ? 38.937  8.529   4.043   1.00 37.30  ? 536  VAL A N   1 
ATOM   4362 C  CA  . VAL A 1 536 ? 40.346  8.762   3.838   1.00 45.19  ? 536  VAL A CA  1 
ATOM   4363 C  C   . VAL A 1 536 ? 40.990  8.814   5.202   1.00 51.16  ? 536  VAL A C   1 
ATOM   4364 O  O   . VAL A 1 536 ? 40.371  9.253   6.171   1.00 51.92  ? 536  VAL A O   1 
ATOM   4365 C  CB  . VAL A 1 536 ? 40.601  10.086  3.109   1.00 45.26  ? 536  VAL A CB  1 
ATOM   4366 C  CG1 . VAL A 1 536 ? 40.169  9.972   1.666   1.00 40.09  ? 536  VAL A CG1 1 
ATOM   4367 C  CG2 . VAL A 1 536 ? 39.853  11.223  3.808   1.00 49.09  ? 536  VAL A CG2 1 
ATOM   4368 N  N   . PRO A 1 537 ? 42.213  8.289   5.313   1.00 58.46  ? 537  PRO A N   1 
ATOM   4369 C  CA  . PRO A 1 537 ? 42.930  8.293   6.590   1.00 62.79  ? 537  PRO A CA  1 
ATOM   4370 C  C   . PRO A 1 537 ? 43.102  9.716   7.112   1.00 66.72  ? 537  PRO A C   1 
ATOM   4371 O  O   . PRO A 1 537 ? 43.371  10.630  6.341   1.00 66.21  ? 537  PRO A O   1 
ATOM   4372 C  CB  . PRO A 1 537 ? 44.265  7.620   6.237   1.00 66.17  ? 537  PRO A CB  1 
ATOM   4373 C  CG  . PRO A 1 537 ? 44.393  7.808   4.735   1.00 59.27  ? 537  PRO A CG  1 
ATOM   4374 C  CD  . PRO A 1 537 ? 42.990  7.610   4.261   1.00 59.38  ? 537  PRO A CD  1 
ATOM   4375 N  N   . ALA A 1 538 ? 42.888  9.903   8.409   1.00 79.39  ? 538  ALA A N   1 
ATOM   4376 C  CA  . ALA A 1 538 ? 43.005  11.220  9.039   1.00 95.69  ? 538  ALA A CA  1 
ATOM   4377 C  C   . ALA A 1 538 ? 44.437  11.743  9.195   1.00 106.18 ? 538  ALA A C   1 
ATOM   4378 O  O   . ALA A 1 538 ? 45.386  10.960  9.269   1.00 112.14 ? 538  ALA A O   1 
ATOM   4379 C  CB  . ALA A 1 538 ? 42.313  11.206  10.401  1.00 98.96  ? 538  ALA A CB  1 
ATOM   4380 N  N   . HIS A 1 539 ? 44.550  13.067  9.342   1.00 112.37 ? 539  HIS A N   1 
ATOM   4381 C  CA  . HIS A 1 539 ? 45.820  13.787  9.527   1.00 115.64 ? 539  HIS A CA  1 
ATOM   4382 C  C   . HIS A 1 539 ? 46.587  14.016  8.229   1.00 114.71 ? 539  HIS A C   1 
ATOM   4383 O  O   . HIS A 1 539 ? 45.961  13.918  7.154   1.00 116.01 ? 539  HIS A O   1 
ATOM   4384 C  CB  . HIS A 1 539 ? 46.724  13.089  10.555  1.00 121.76 ? 539  HIS A CB  1 
ATOM   4385 C  CG  . HIS A 1 539 ? 46.058  12.827  11.869  1.00 128.66 ? 539  HIS A CG  1 
ATOM   4386 N  ND1 . HIS A 1 539 ? 44.991  13.570  12.327  1.00 130.96 ? 539  HIS A ND1 1 
ATOM   4387 C  CD2 . HIS A 1 539 ? 46.291  11.884  12.813  1.00 134.03 ? 539  HIS A CD2 1 
ATOM   4388 C  CE1 . HIS A 1 539 ? 44.593  13.096  13.494  1.00 134.81 ? 539  HIS A CE1 1 
ATOM   4389 N  NE2 . HIS A 1 539 ? 45.364  12.072  13.810  1.00 137.13 ? 539  HIS A NE2 1 
ATOM   4390 N  N   . GLU B 2 6   ? 43.410  -54.835 26.261  1.00 126.52 ? 6    GLU B N   1 
ATOM   4391 C  CA  . GLU B 2 6   ? 43.261  -54.272 27.635  1.00 127.62 ? 6    GLU B CA  1 
ATOM   4392 C  C   . GLU B 2 6   ? 42.927  -52.788 27.578  1.00 128.66 ? 6    GLU B C   1 
ATOM   4393 O  O   . GLU B 2 6   ? 42.893  -52.203 26.494  1.00 131.98 ? 6    GLU B O   1 
ATOM   4394 C  CB  . GLU B 2 6   ? 44.538  -54.487 28.453  1.00 127.11 ? 6    GLU B CB  1 
ATOM   4395 C  CG  . GLU B 2 6   ? 44.523  -55.746 29.307  1.00 127.03 ? 6    GLU B CG  1 
ATOM   4396 C  CD  . GLU B 2 6   ? 43.400  -55.744 30.334  1.00 123.96 ? 6    GLU B CD  1 
ATOM   4397 O  OE1 . GLU B 2 6   ? 43.571  -55.125 31.408  1.00 117.84 ? 6    GLU B OE1 1 
ATOM   4398 O  OE2 . GLU B 2 6   ? 42.346  -56.364 30.063  1.00 121.84 ? 6    GLU B OE2 1 
ATOM   4399 N  N   . THR B 2 7   ? 42.676  -52.195 28.742  1.00 125.26 ? 7    THR B N   1 
ATOM   4400 C  CA  . THR B 2 7   ? 42.337  -50.779 28.837  1.00 119.39 ? 7    THR B CA  1 
ATOM   4401 C  C   . THR B 2 7   ? 43.401  -49.993 29.594  1.00 115.31 ? 7    THR B C   1 
ATOM   4402 O  O   . THR B 2 7   ? 43.789  -50.350 30.709  1.00 116.57 ? 7    THR B O   1 
ATOM   4403 C  CB  . THR B 2 7   ? 40.974  -50.560 29.543  1.00 117.13 ? 7    THR B CB  1 
ATOM   4404 O  OG1 . THR B 2 7   ? 40.877  -51.423 30.682  1.00 114.03 ? 7    THR B OG1 1 
ATOM   4405 C  CG2 . THR B 2 7   ? 39.824  -50.844 28.605  1.00 115.49 ? 7    THR B CG2 1 
ATOM   4406 N  N   . VAL B 2 8   ? 43.898  -48.942 28.959  1.00 109.54 ? 8    VAL B N   1 
ATOM   4407 C  CA  . VAL B 2 8   ? 44.899  -48.084 29.568  1.00 104.30 ? 8    VAL B CA  1 
ATOM   4408 C  C   . VAL B 2 8   ? 44.167  -47.006 30.375  1.00 99.28  ? 8    VAL B C   1 
ATOM   4409 O  O   . VAL B 2 8   ? 43.190  -46.424 29.895  1.00 100.13 ? 8    VAL B O   1 
ATOM   4410 C  CB  . VAL B 2 8   ? 45.809  -47.455 28.483  1.00 107.46 ? 8    VAL B CB  1 
ATOM   4411 C  CG1 . VAL B 2 8   ? 44.968  -46.844 27.373  1.00 107.40 ? 8    VAL B CG1 1 
ATOM   4412 C  CG2 . VAL B 2 8   ? 46.738  -46.417 29.094  1.00 114.42 ? 8    VAL B CG2 1 
ATOM   4413 N  N   . PRO B 2 9   ? 44.586  -46.779 31.636  1.00 95.40  ? 9    PRO B N   1 
ATOM   4414 C  CA  . PRO B 2 9   ? 43.986  -45.781 32.535  1.00 94.26  ? 9    PRO B CA  1 
ATOM   4415 C  C   . PRO B 2 9   ? 44.113  -44.302 32.127  1.00 91.41  ? 9    PRO B C   1 
ATOM   4416 O  O   . PRO B 2 9   ? 45.091  -43.634 32.470  1.00 94.25  ? 9    PRO B O   1 
ATOM   4417 C  CB  . PRO B 2 9   ? 44.684  -46.064 33.872  1.00 95.10  ? 9    PRO B CB  1 
ATOM   4418 C  CG  . PRO B 2 9   ? 46.013  -46.647 33.456  1.00 91.48  ? 9    PRO B CG  1 
ATOM   4419 C  CD  . PRO B 2 9   ? 45.604  -47.574 32.348  1.00 93.30  ? 9    PRO B CD  1 
ATOM   4420 N  N   . VAL B 2 10  ? 43.117  -43.798 31.400  1.00 83.72  ? 10   VAL B N   1 
ATOM   4421 C  CA  . VAL B 2 10  ? 43.099  -42.400 30.962  1.00 72.51  ? 10   VAL B CA  1 
ATOM   4422 C  C   . VAL B 2 10  ? 42.470  -41.580 32.086  1.00 71.09  ? 10   VAL B C   1 
ATOM   4423 O  O   . VAL B 2 10  ? 41.673  -42.107 32.869  1.00 70.96  ? 10   VAL B O   1 
ATOM   4424 C  CB  . VAL B 2 10  ? 42.233  -42.200 29.682  1.00 61.02  ? 10   VAL B CB  1 
ATOM   4425 C  CG1 . VAL B 2 10  ? 42.431  -40.804 29.116  1.00 51.17  ? 10   VAL B CG1 1 
ATOM   4426 C  CG2 . VAL B 2 10  ? 42.566  -43.241 28.640  1.00 60.41  ? 10   VAL B CG2 1 
ATOM   4427 N  N   . LYS B 2 11  ? 42.818  -40.299 32.162  1.00 67.35  ? 11   LYS B N   1 
ATOM   4428 C  CA  . LYS B 2 11  ? 42.268  -39.417 33.185  1.00 63.58  ? 11   LYS B CA  1 
ATOM   4429 C  C   . LYS B 2 11  ? 42.034  -38.006 32.672  1.00 58.70  ? 11   LYS B C   1 
ATOM   4430 O  O   . LYS B 2 11  ? 42.235  -37.708 31.488  1.00 52.89  ? 11   LYS B O   1 
ATOM   4431 C  CB  . LYS B 2 11  ? 43.185  -39.351 34.406  1.00 61.71  ? 11   LYS B CB  1 
ATOM   4432 C  CG  . LYS B 2 11  ? 43.247  -40.629 35.207  1.00 72.88  ? 11   LYS B CG  1 
ATOM   4433 C  CD  . LYS B 2 11  ? 43.542  -40.336 36.661  1.00 84.67  ? 11   LYS B CD  1 
ATOM   4434 C  CE  . LYS B 2 11  ? 44.835  -39.553 36.828  1.00 96.24  ? 11   LYS B CE  1 
ATOM   4435 N  NZ  . LYS B 2 11  ? 45.114  -39.281 38.264  1.00 95.98  ? 11   LYS B NZ  1 
ATOM   4436 N  N   . LEU B 2 12  ? 41.556  -37.151 33.566  1.00 56.63  ? 12   LEU B N   1 
ATOM   4437 C  CA  . LEU B 2 12  ? 41.313  -35.762 33.232  1.00 58.23  ? 12   LEU B CA  1 
ATOM   4438 C  C   . LEU B 2 12  ? 42.446  -34.920 33.801  1.00 61.68  ? 12   LEU B C   1 
ATOM   4439 O  O   . LEU B 2 12  ? 43.070  -35.304 34.794  1.00 62.22  ? 12   LEU B O   1 
ATOM   4440 C  CB  . LEU B 2 12  ? 39.960  -35.301 33.787  1.00 51.91  ? 12   LEU B CB  1 
ATOM   4441 C  CG  . LEU B 2 12  ? 38.743  -35.827 33.006  1.00 39.58  ? 12   LEU B CG  1 
ATOM   4442 C  CD1 . LEU B 2 12  ? 37.435  -35.333 33.617  1.00 5.98   ? 12   LEU B CD1 1 
ATOM   4443 C  CD2 . LEU B 2 12  ? 38.850  -35.409 31.535  1.00 26.31  ? 12   LEU B CD2 1 
ATOM   4444 N  N   . LYS B 2 13  ? 42.746  -33.807 33.134  1.00 62.08  ? 13   LYS B N   1 
ATOM   4445 C  CA  . LYS B 2 13  ? 43.800  -32.898 33.577  1.00 55.57  ? 13   LYS B CA  1 
ATOM   4446 C  C   . LYS B 2 13  ? 43.515  -32.485 35.023  1.00 48.80  ? 13   LYS B C   1 
ATOM   4447 O  O   . LYS B 2 13  ? 42.360  -32.335 35.410  1.00 41.58  ? 13   LYS B O   1 
ATOM   4448 C  CB  . LYS B 2 13  ? 43.849  -31.676 32.654  1.00 56.33  ? 13   LYS B CB  1 
ATOM   4449 C  CG  . LYS B 2 13  ? 44.388  -31.988 31.269  1.00 47.33  ? 13   LYS B CG  1 
ATOM   4450 C  CD  . LYS B 2 13  ? 44.073  -30.898 30.251  1.00 45.18  ? 13   LYS B CD  1 
ATOM   4451 C  CE  . LYS B 2 13  ? 44.793  -31.175 28.926  1.00 33.23  ? 13   LYS B CE  1 
ATOM   4452 N  NZ  . LYS B 2 13  ? 44.167  -30.499 27.765  1.00 12.68  ? 13   LYS B NZ  1 
ATOM   4453 N  N   . PRO B 2 14  ? 44.566  -32.301 35.840  1.00 50.88  ? 14   PRO B N   1 
ATOM   4454 C  CA  . PRO B 2 14  ? 44.431  -31.912 37.249  1.00 54.22  ? 14   PRO B CA  1 
ATOM   4455 C  C   . PRO B 2 14  ? 43.339  -30.881 37.509  1.00 62.10  ? 14   PRO B C   1 
ATOM   4456 O  O   . PRO B 2 14  ? 43.369  -29.786 36.948  1.00 68.65  ? 14   PRO B O   1 
ATOM   4457 C  CB  . PRO B 2 14  ? 45.813  -31.354 37.573  1.00 48.56  ? 14   PRO B CB  1 
ATOM   4458 C  CG  . PRO B 2 14  ? 46.703  -32.236 36.768  1.00 49.18  ? 14   PRO B CG  1 
ATOM   4459 C  CD  . PRO B 2 14  ? 45.984  -32.303 35.437  1.00 49.40  ? 14   PRO B CD  1 
ATOM   4460 N  N   . GLY B 2 15  ? 42.358  -31.257 38.326  1.00 63.11  ? 15   GLY B N   1 
ATOM   4461 C  CA  . GLY B 2 15  ? 41.277  -30.347 38.659  1.00 66.84  ? 15   GLY B CA  1 
ATOM   4462 C  C   . GLY B 2 15  ? 40.192  -30.154 37.612  1.00 69.58  ? 15   GLY B C   1 
ATOM   4463 O  O   . GLY B 2 15  ? 39.312  -29.310 37.788  1.00 74.03  ? 15   GLY B O   1 
ATOM   4464 N  N   . MET B 2 16  ? 40.262  -30.888 36.507  1.00 68.70  ? 16   MET B N   1 
ATOM   4465 C  CA  . MET B 2 16  ? 39.240  -30.780 35.466  1.00 67.79  ? 16   MET B CA  1 
ATOM   4466 C  C   . MET B 2 16  ? 38.082  -31.740 35.734  1.00 65.01  ? 16   MET B C   1 
ATOM   4467 O  O   . MET B 2 16  ? 38.259  -32.812 36.335  1.00 66.04  ? 16   MET B O   1 
ATOM   4468 C  CB  . MET B 2 16  ? 39.820  -31.071 34.077  1.00 69.95  ? 16   MET B CB  1 
ATOM   4469 C  CG  . MET B 2 16  ? 40.823  -30.046 33.601  1.00 77.31  ? 16   MET B CG  1 
ATOM   4470 S  SD  . MET B 2 16  ? 40.135  -28.389 33.472  1.00 76.08  ? 16   MET B SD  1 
ATOM   4471 C  CE  . MET B 2 16  ? 40.313  -28.087 31.713  1.00 69.78  ? 16   MET B CE  1 
ATOM   4472 N  N   . ASP B 2 17  ? 36.894  -31.333 35.300  1.00 53.43  ? 17   ASP B N   1 
ATOM   4473 C  CA  . ASP B 2 17  ? 35.698  -32.139 35.454  1.00 38.85  ? 17   ASP B CA  1 
ATOM   4474 C  C   . ASP B 2 17  ? 35.226  -32.445 34.043  1.00 29.98  ? 17   ASP B C   1 
ATOM   4475 O  O   . ASP B 2 17  ? 35.716  -31.867 33.077  1.00 34.47  ? 17   ASP B O   1 
ATOM   4476 C  CB  . ASP B 2 17  ? 34.625  -31.365 36.215  1.00 43.27  ? 17   ASP B CB  1 
ATOM   4477 C  CG  . ASP B 2 17  ? 33.531  -32.261 36.755  1.00 36.28  ? 17   ASP B CG  1 
ATOM   4478 O  OD1 . ASP B 2 17  ? 33.762  -33.478 36.867  1.00 28.73  ? 17   ASP B OD1 1 
ATOM   4479 O  OD2 . ASP B 2 17  ? 32.447  -31.743 37.081  1.00 27.14  ? 17   ASP B OD2 1 
ATOM   4480 N  N   . GLY B 2 18  ? 34.320  -33.395 33.910  1.00 21.64  ? 18   GLY B N   1 
ATOM   4481 C  CA  . GLY B 2 18  ? 33.830  -33.732 32.591  1.00 27.43  ? 18   GLY B CA  1 
ATOM   4482 C  C   . GLY B 2 18  ? 32.929  -32.673 31.977  1.00 29.37  ? 18   GLY B C   1 
ATOM   4483 O  O   . GLY B 2 18  ? 32.320  -31.848 32.689  1.00 23.05  ? 18   GLY B O   1 
ATOM   4484 N  N   . PRO B 2 19  ? 32.811  -32.689 30.638  1.00 26.53  ? 19   PRO B N   1 
ATOM   4485 C  CA  . PRO B 2 19  ? 31.975  -31.727 29.931  1.00 21.84  ? 19   PRO B CA  1 
ATOM   4486 C  C   . PRO B 2 19  ? 30.556  -31.959 30.356  1.00 22.74  ? 19   PRO B C   1 
ATOM   4487 O  O   . PRO B 2 19  ? 30.213  -33.040 30.846  1.00 24.09  ? 19   PRO B O   1 
ATOM   4488 C  CB  . PRO B 2 19  ? 32.170  -32.120 28.465  1.00 26.22  ? 19   PRO B CB  1 
ATOM   4489 C  CG  . PRO B 2 19  ? 32.356  -33.597 28.539  1.00 18.11  ? 19   PRO B CG  1 
ATOM   4490 C  CD  . PRO B 2 19  ? 33.315  -33.717 29.708  1.00 26.31  ? 19   PRO B CD  1 
ATOM   4491 N  N   . LYS B 2 20  ? 29.738  -30.933 30.199  1.00 20.81  ? 20   LYS B N   1 
ATOM   4492 C  CA  . LYS B 2 20  ? 28.326  -31.029 30.543  1.00 16.54  ? 20   LYS B CA  1 
ATOM   4493 C  C   . LYS B 2 20  ? 27.654  -30.115 29.539  1.00 9.56   ? 20   LYS B C   1 
ATOM   4494 O  O   . LYS B 2 20  ? 26.906  -29.186 29.889  1.00 2.00   ? 20   LYS B O   1 
ATOM   4495 C  CB  . LYS B 2 20  ? 28.087  -30.547 31.974  1.00 9.19   ? 20   LYS B CB  1 
ATOM   4496 C  CG  . LYS B 2 20  ? 28.919  -31.245 33.003  1.00 2.00   ? 20   LYS B CG  1 
ATOM   4497 C  CD  . LYS B 2 20  ? 28.433  -30.917 34.381  1.00 23.94  ? 20   LYS B CD  1 
ATOM   4498 C  CE  . LYS B 2 20  ? 29.461  -31.310 35.427  1.00 41.74  ? 20   LYS B CE  1 
ATOM   4499 N  NZ  . LYS B 2 20  ? 28.912  -31.101 36.798  1.00 52.08  ? 20   LYS B NZ  1 
ATOM   4500 N  N   . VAL B 2 21  ? 27.966  -30.372 28.277  1.00 4.66   ? 21   VAL B N   1 
ATOM   4501 C  CA  . VAL B 2 21  ? 27.448  -29.554 27.206  1.00 16.33  ? 21   VAL B CA  1 
ATOM   4502 C  C   . VAL B 2 21  ? 26.083  -29.960 26.703  1.00 33.23  ? 21   VAL B C   1 
ATOM   4503 O  O   . VAL B 2 21  ? 25.837  -31.124 26.398  1.00 41.19  ? 21   VAL B O   1 
ATOM   4504 C  CB  . VAL B 2 21  ? 28.439  -29.491 26.076  1.00 2.00   ? 21   VAL B CB  1 
ATOM   4505 C  CG1 . VAL B 2 21  ? 28.038  -28.408 25.101  1.00 11.06  ? 21   VAL B CG1 1 
ATOM   4506 C  CG2 . VAL B 2 21  ? 29.821  -29.249 26.657  1.00 6.20   ? 21   VAL B CG2 1 
ATOM   4507 N  N   . LYS B 2 22  ? 25.212  -28.967 26.584  1.00 44.13  ? 22   LYS B N   1 
ATOM   4508 C  CA  . LYS B 2 22  ? 23.842  -29.178 26.145  1.00 51.03  ? 22   LYS B CA  1 
ATOM   4509 C  C   . LYS B 2 22  ? 23.714  -29.585 24.678  1.00 48.88  ? 22   LYS B C   1 
ATOM   4510 O  O   . LYS B 2 22  ? 24.420  -29.077 23.794  1.00 47.76  ? 22   LYS B O   1 
ATOM   4511 C  CB  . LYS B 2 22  ? 23.009  -27.925 26.438  1.00 58.78  ? 22   LYS B CB  1 
ATOM   4512 C  CG  . LYS B 2 22  ? 23.178  -27.402 27.875  1.00 62.47  ? 22   LYS B CG  1 
ATOM   4513 C  CD  . LYS B 2 22  ? 22.563  -28.333 28.923  1.00 60.64  ? 22   LYS B CD  1 
ATOM   4514 C  CE  . LYS B 2 22  ? 23.103  -28.023 30.323  1.00 68.07  ? 22   LYS B CE  1 
ATOM   4515 N  NZ  . LYS B 2 22  ? 22.312  -28.664 31.420  1.00 75.69  ? 22   LYS B NZ  1 
ATOM   4516 N  N   . GLN B 2 23  ? 22.815  -30.533 24.445  1.00 48.22  ? 23   GLN B N   1 
ATOM   4517 C  CA  . GLN B 2 23  ? 22.543  -31.039 23.112  1.00 38.61  ? 23   GLN B CA  1 
ATOM   4518 C  C   . GLN B 2 23  ? 21.758  -30.027 22.330  1.00 31.70  ? 23   GLN B C   1 
ATOM   4519 O  O   . GLN B 2 23  ? 20.654  -29.644 22.724  1.00 36.61  ? 23   GLN B O   1 
ATOM   4520 C  CB  . GLN B 2 23  ? 21.715  -32.325 23.174  1.00 28.55  ? 23   GLN B CB  1 
ATOM   4521 C  CG  . GLN B 2 23  ? 21.322  -32.849 21.806  1.00 19.64  ? 23   GLN B CG  1 
ATOM   4522 C  CD  . GLN B 2 23  ? 22.509  -32.940 20.839  1.00 18.20  ? 23   GLN B CD  1 
ATOM   4523 O  OE1 . GLN B 2 23  ? 23.650  -33.227 21.245  1.00 9.01   ? 23   GLN B OE1 1 
ATOM   4524 N  NE2 . GLN B 2 23  ? 22.248  -32.678 19.561  1.00 2.00   ? 23   GLN B NE2 1 
ATOM   4525 N  N   . TRP B 2 24  ? 22.317  -29.575 21.224  1.00 20.86  ? 24   TRP B N   1 
ATOM   4526 C  CA  . TRP B 2 24  ? 21.559  -28.646 20.438  1.00 29.28  ? 24   TRP B CA  1 
ATOM   4527 C  C   . TRP B 2 24  ? 20.443  -29.437 19.757  1.00 27.46  ? 24   TRP B C   1 
ATOM   4528 O  O   . TRP B 2 24  ? 20.533  -30.664 19.613  1.00 18.28  ? 24   TRP B O   1 
ATOM   4529 C  CB  . TRP B 2 24  ? 22.447  -27.875 19.438  1.00 48.01  ? 24   TRP B CB  1 
ATOM   4530 C  CG  . TRP B 2 24  ? 23.373  -28.675 18.538  1.00 66.29  ? 24   TRP B CG  1 
ATOM   4531 C  CD1 . TRP B 2 24  ? 23.027  -29.377 17.412  1.00 74.13  ? 24   TRP B CD1 1 
ATOM   4532 C  CD2 . TRP B 2 24  ? 24.807  -28.760 18.634  1.00 74.64  ? 24   TRP B CD2 1 
ATOM   4533 N  NE1 . TRP B 2 24  ? 24.154  -29.881 16.801  1.00 79.31  ? 24   TRP B NE1 1 
ATOM   4534 C  CE2 . TRP B 2 24  ? 25.258  -29.520 17.526  1.00 79.64  ? 24   TRP B CE2 1 
ATOM   4535 C  CE3 . TRP B 2 24  ? 25.752  -28.263 19.545  1.00 72.30  ? 24   TRP B CE3 1 
ATOM   4536 C  CZ2 . TRP B 2 24  ? 26.618  -29.796 17.304  1.00 76.73  ? 24   TRP B CZ2 1 
ATOM   4537 C  CZ3 . TRP B 2 24  ? 27.105  -28.538 19.321  1.00 78.37  ? 24   TRP B CZ3 1 
ATOM   4538 C  CH2 . TRP B 2 24  ? 27.522  -29.299 18.208  1.00 75.67  ? 24   TRP B CH2 1 
ATOM   4539 N  N   . PRO B 2 25  ? 19.312  -28.774 19.479  1.00 32.31  ? 25   PRO B N   1 
ATOM   4540 C  CA  . PRO B 2 25  ? 18.176  -29.420 18.815  1.00 31.13  ? 25   PRO B CA  1 
ATOM   4541 C  C   . PRO B 2 25  ? 18.596  -29.940 17.442  1.00 27.61  ? 25   PRO B C   1 
ATOM   4542 O  O   . PRO B 2 25  ? 19.407  -29.317 16.745  1.00 13.82  ? 25   PRO B O   1 
ATOM   4543 C  CB  . PRO B 2 25  ? 17.169  -28.278 18.673  1.00 30.76  ? 25   PRO B CB  1 
ATOM   4544 C  CG  . PRO B 2 25  ? 18.039  -27.038 18.673  1.00 35.34  ? 25   PRO B CG  1 
ATOM   4545 C  CD  . PRO B 2 25  ? 19.007  -27.365 19.774  1.00 31.94  ? 25   PRO B CD  1 
ATOM   4546 N  N   . LEU B 2 26  ? 18.025  -31.068 17.042  1.00 30.34  ? 26   LEU B N   1 
ATOM   4547 C  CA  . LEU B 2 26  ? 18.368  -31.652 15.757  1.00 27.86  ? 26   LEU B CA  1 
ATOM   4548 C  C   . LEU B 2 26  ? 17.156  -31.807 14.845  1.00 14.22  ? 26   LEU B C   1 
ATOM   4549 O  O   . LEU B 2 26  ? 16.021  -31.577 15.254  1.00 2.00   ? 26   LEU B O   1 
ATOM   4550 C  CB  . LEU B 2 26  ? 19.068  -33.002 15.972  1.00 37.37  ? 26   LEU B CB  1 
ATOM   4551 C  CG  . LEU B 2 26  ? 20.436  -32.981 16.681  1.00 39.68  ? 26   LEU B CG  1 
ATOM   4552 C  CD1 . LEU B 2 26  ? 20.864  -34.386 17.039  1.00 41.20  ? 26   LEU B CD1 1 
ATOM   4553 C  CD2 . LEU B 2 26  ? 21.494  -32.317 15.818  1.00 35.91  ? 26   LEU B CD2 1 
ATOM   4554 N  N   . THR B 2 27  ? 17.417  -32.139 13.588  1.00 14.61  ? 27   THR B N   1 
ATOM   4555 C  CA  . THR B 2 27  ? 16.349  -32.342 12.622  1.00 29.85  ? 27   THR B CA  1 
ATOM   4556 C  C   . THR B 2 27  ? 15.787  -33.755 12.821  1.00 40.95  ? 27   THR B C   1 
ATOM   4557 O  O   . THR B 2 27  ? 16.464  -34.625 13.386  1.00 40.82  ? 27   THR B O   1 
ATOM   4558 C  CB  . THR B 2 27  ? 16.877  -32.193 11.179  1.00 21.80  ? 27   THR B CB  1 
ATOM   4559 O  OG1 . THR B 2 27  ? 17.437  -30.890 11.018  1.00 4.19   ? 27   THR B OG1 1 
ATOM   4560 C  CG2 . THR B 2 27  ? 15.752  -32.377 10.160  1.00 29.62  ? 27   THR B CG2 1 
ATOM   4561 N  N   . GLU B 2 28  ? 14.559  -33.985 12.357  1.00 44.87  ? 28   GLU B N   1 
ATOM   4562 C  CA  . GLU B 2 28  ? 13.944  -35.298 12.491  1.00 47.82  ? 28   GLU B CA  1 
ATOM   4563 C  C   . GLU B 2 28  ? 14.818  -36.303 11.745  1.00 41.05  ? 28   GLU B C   1 
ATOM   4564 O  O   . GLU B 2 28  ? 15.306  -37.268 12.338  1.00 29.57  ? 28   GLU B O   1 
ATOM   4565 C  CB  . GLU B 2 28  ? 12.503  -35.299 11.936  1.00 59.96  ? 28   GLU B CB  1 
ATOM   4566 C  CG  . GLU B 2 28  ? 11.686  -36.560 12.320  1.00 76.11  ? 28   GLU B CG  1 
ATOM   4567 C  CD  . GLU B 2 28  ? 10.228  -36.552 11.837  1.00 77.47  ? 28   GLU B CD  1 
ATOM   4568 O  OE1 . GLU B 2 28  ? 9.940   -35.976 10.764  1.00 87.92  ? 28   GLU B OE1 1 
ATOM   4569 O  OE2 . GLU B 2 28  ? 9.370   -37.148 12.531  1.00 62.96  ? 28   GLU B OE2 1 
ATOM   4570 N  N   . GLU B 2 29  ? 15.077  -36.011 10.469  1.00 41.56  ? 29   GLU B N   1 
ATOM   4571 C  CA  . GLU B 2 29  ? 15.889  -36.868 9.605   1.00 42.57  ? 29   GLU B CA  1 
ATOM   4572 C  C   . GLU B 2 29  ? 17.106  -37.330 10.386  1.00 41.34  ? 29   GLU B C   1 
ATOM   4573 O  O   . GLU B 2 29  ? 17.400  -38.533 10.484  1.00 44.64  ? 29   GLU B O   1 
ATOM   4574 C  CB  . GLU B 2 29  ? 16.353  -36.073 8.379   1.00 48.24  ? 29   GLU B CB  1 
ATOM   4575 C  CG  . GLU B 2 29  ? 17.373  -34.983 8.702   1.00 68.32  ? 29   GLU B CG  1 
ATOM   4576 C  CD  . GLU B 2 29  ? 17.685  -34.056 7.551   1.00 88.69  ? 29   GLU B CD  1 
ATOM   4577 O  OE1 . GLU B 2 29  ? 17.592  -34.487 6.375   1.00 87.00  ? 29   GLU B OE1 1 
ATOM   4578 O  OE2 . GLU B 2 29  ? 18.038  -32.887 7.839   1.00 98.19  ? 29   GLU B OE2 1 
ATOM   4579 N  N   . LYS B 2 30  ? 17.720  -36.346 11.034  1.00 32.29  ? 30   LYS B N   1 
ATOM   4580 C  CA  . LYS B 2 30  ? 18.912  -36.528 11.824  1.00 28.00  ? 30   LYS B CA  1 
ATOM   4581 C  C   . LYS B 2 30  ? 18.675  -37.435 13.016  1.00 20.11  ? 30   LYS B C   1 
ATOM   4582 O  O   . LYS B 2 30  ? 19.415  -38.393 13.225  1.00 3.14   ? 30   LYS B O   1 
ATOM   4583 C  CB  . LYS B 2 30  ? 19.437  -35.168 12.300  1.00 30.22  ? 30   LYS B CB  1 
ATOM   4584 C  CG  . LYS B 2 30  ? 20.007  -34.277 11.205  1.00 36.40  ? 30   LYS B CG  1 
ATOM   4585 C  CD  . LYS B 2 30  ? 20.852  -33.162 11.814  1.00 41.01  ? 30   LYS B CD  1 
ATOM   4586 C  CE  . LYS B 2 30  ? 21.813  -32.584 10.797  1.00 49.47  ? 30   LYS B CE  1 
ATOM   4587 N  NZ  . LYS B 2 30  ? 22.984  -31.995 11.488  1.00 55.49  ? 30   LYS B NZ  1 
ATOM   4588 N  N   . ILE B 2 31  ? 17.630  -37.158 13.784  1.00 26.31  ? 31   ILE B N   1 
ATOM   4589 C  CA  . ILE B 2 31  ? 17.362  -37.968 14.966  1.00 29.05  ? 31   ILE B CA  1 
ATOM   4590 C  C   . ILE B 2 31  ? 17.057  -39.420 14.627  1.00 22.04  ? 31   ILE B C   1 
ATOM   4591 O  O   . ILE B 2 31  ? 17.473  -40.338 15.343  1.00 16.64  ? 31   ILE B O   1 
ATOM   4592 C  CB  . ILE B 2 31  ? 16.258  -37.372 15.843  1.00 26.92  ? 31   ILE B CB  1 
ATOM   4593 C  CG1 . ILE B 2 31  ? 16.520  -35.874 16.069  1.00 4.37   ? 31   ILE B CG1 1 
ATOM   4594 C  CG2 . ILE B 2 31  ? 16.261  -38.082 17.199  1.00 37.06  ? 31   ILE B CG2 1 
ATOM   4595 C  CD1 . ILE B 2 31  ? 15.393  -35.158 16.777  1.00 5.11   ? 31   ILE B CD1 1 
ATOM   4596 N  N   . LYS B 2 32  ? 16.393  -39.634 13.501  1.00 24.99  ? 32   LYS B N   1 
ATOM   4597 C  CA  . LYS B 2 32  ? 16.076  -40.988 13.085  1.00 31.59  ? 32   LYS B CA  1 
ATOM   4598 C  C   . LYS B 2 32  ? 17.367  -41.774 12.874  1.00 25.90  ? 32   LYS B C   1 
ATOM   4599 O  O   . LYS B 2 32  ? 17.607  -42.775 13.565  1.00 17.17  ? 32   LYS B O   1 
ATOM   4600 C  CB  . LYS B 2 32  ? 15.178  -40.970 11.847  1.00 39.39  ? 32   LYS B CB  1 
ATOM   4601 C  CG  . LYS B 2 32  ? 13.689  -40.895 12.221  1.00 44.78  ? 32   LYS B CG  1 
ATOM   4602 C  CD  . LYS B 2 32  ? 12.823  -40.359 11.092  1.00 68.00  ? 32   LYS B CD  1 
ATOM   4603 C  CE  . LYS B 2 32  ? 12.987  -41.170 9.811   1.00 82.65  ? 32   LYS B CE  1 
ATOM   4604 N  NZ  . LYS B 2 32  ? 12.168  -40.615 8.693   1.00 89.54  ? 32   LYS B NZ  1 
ATOM   4605 N  N   . ALA B 2 33  ? 18.241  -41.250 12.016  1.00 23.84  ? 33   ALA B N   1 
ATOM   4606 C  CA  . ALA B 2 33  ? 19.536  -41.882 11.739  1.00 20.39  ? 33   ALA B CA  1 
ATOM   4607 C  C   . ALA B 2 33  ? 20.376  -42.160 13.008  1.00 14.34  ? 33   ALA B C   1 
ATOM   4608 O  O   . ALA B 2 33  ? 20.909  -43.258 13.173  1.00 10.11  ? 33   ALA B O   1 
ATOM   4609 C  CB  . ALA B 2 33  ? 20.330  -41.027 10.773  1.00 15.86  ? 33   ALA B CB  1 
ATOM   4610 N  N   . LEU B 2 34  ? 20.479  -41.177 13.900  1.00 14.42  ? 34   LEU B N   1 
ATOM   4611 C  CA  . LEU B 2 34  ? 21.254  -41.330 15.137  1.00 30.34  ? 34   LEU B CA  1 
ATOM   4612 C  C   . LEU B 2 34  ? 20.754  -42.463 16.017  1.00 29.83  ? 34   LEU B C   1 
ATOM   4613 O  O   . LEU B 2 34  ? 21.554  -43.169 16.664  1.00 10.36  ? 34   LEU B O   1 
ATOM   4614 C  CB  . LEU B 2 34  ? 21.258  -40.036 15.964  1.00 45.14  ? 34   LEU B CB  1 
ATOM   4615 C  CG  . LEU B 2 34  ? 22.051  -38.808 15.493  1.00 50.26  ? 34   LEU B CG  1 
ATOM   4616 C  CD1 . LEU B 2 34  ? 22.355  -37.950 16.711  1.00 43.35  ? 34   LEU B CD1 1 
ATOM   4617 C  CD2 . LEU B 2 34  ? 23.363  -39.209 14.821  1.00 54.74  ? 34   LEU B CD2 1 
ATOM   4618 N  N   . VAL B 2 35  ? 19.427  -42.563 16.098  1.00 34.57  ? 35   VAL B N   1 
ATOM   4619 C  CA  . VAL B 2 35  ? 18.770  -43.607 16.871  1.00 37.04  ? 35   VAL B CA  1 
ATOM   4620 C  C   . VAL B 2 35  ? 19.226  -44.915 16.256  1.00 31.57  ? 35   VAL B C   1 
ATOM   4621 O  O   . VAL B 2 35  ? 19.856  -45.727 16.936  1.00 29.05  ? 35   VAL B O   1 
ATOM   4622 C  CB  . VAL B 2 35  ? 17.240  -43.512 16.758  1.00 48.43  ? 35   VAL B CB  1 
ATOM   4623 C  CG1 . VAL B 2 35  ? 16.593  -44.767 17.333  1.00 59.01  ? 35   VAL B CG1 1 
ATOM   4624 C  CG2 . VAL B 2 35  ? 16.736  -42.276 17.483  1.00 52.08  ? 35   VAL B CG2 1 
ATOM   4625 N  N   . GLU B 2 36  ? 18.945  -45.069 14.956  1.00 21.85  ? 36   GLU B N   1 
ATOM   4626 C  CA  . GLU B 2 36  ? 19.322  -46.247 14.191  1.00 13.29  ? 36   GLU B CA  1 
ATOM   4627 C  C   . GLU B 2 36  ? 20.749  -46.606 14.534  1.00 21.98  ? 36   GLU B C   1 
ATOM   4628 O  O   . GLU B 2 36  ? 21.052  -47.700 15.052  1.00 19.54  ? 36   GLU B O   1 
ATOM   4629 C  CB  . GLU B 2 36  ? 19.258  -45.946 12.703  1.00 2.00   ? 36   GLU B CB  1 
ATOM   4630 C  CG  . GLU B 2 36  ? 17.932  -46.254 12.075  1.00 40.37  ? 36   GLU B CG  1 
ATOM   4631 C  CD  . GLU B 2 36  ? 17.993  -46.201 10.563  1.00 64.75  ? 36   GLU B CD  1 
ATOM   4632 O  OE1 . GLU B 2 36  ? 18.685  -47.054 9.967   1.00 73.99  ? 36   GLU B OE1 1 
ATOM   4633 O  OE2 . GLU B 2 36  ? 17.354  -45.305 9.968   1.00 77.30  ? 36   GLU B OE2 1 
ATOM   4634 N  N   . ILE B 2 37  ? 21.626  -45.653 14.247  1.00 23.11  ? 37   ILE B N   1 
ATOM   4635 C  CA  . ILE B 2 37  ? 23.041  -45.806 14.508  1.00 18.87  ? 37   ILE B CA  1 
ATOM   4636 C  C   . ILE B 2 37  ? 23.281  -46.299 15.929  1.00 8.66   ? 37   ILE B C   1 
ATOM   4637 O  O   . ILE B 2 37  ? 23.766  -47.410 16.122  1.00 2.00   ? 37   ILE B O   1 
ATOM   4638 C  CB  . ILE B 2 37  ? 23.797  -44.483 14.244  1.00 17.01  ? 37   ILE B CB  1 
ATOM   4639 C  CG1 . ILE B 2 37  ? 23.726  -44.151 12.748  1.00 2.00   ? 37   ILE B CG1 1 
ATOM   4640 C  CG2 . ILE B 2 37  ? 25.238  -44.590 14.732  1.00 19.24  ? 37   ILE B CG2 1 
ATOM   4641 C  CD1 . ILE B 2 37  ? 24.664  -43.076 12.288  1.00 2.00   ? 37   ILE B CD1 1 
ATOM   4642 N  N   . CYS B 2 38  ? 22.824  -45.530 16.906  1.00 7.28   ? 38   CYS B N   1 
ATOM   4643 C  CA  . CYS B 2 38  ? 23.016  -45.886 18.299  1.00 13.22  ? 38   CYS B CA  1 
ATOM   4644 C  C   . CYS B 2 38  ? 22.547  -47.270 18.734  1.00 17.38  ? 38   CYS B C   1 
ATOM   4645 O  O   . CYS B 2 38  ? 23.265  -47.961 19.464  1.00 9.37   ? 38   CYS B O   1 
ATOM   4646 C  CB  . CYS B 2 38  ? 22.416  -44.822 19.198  1.00 22.39  ? 38   CYS B CB  1 
ATOM   4647 S  SG  . CYS B 2 38  ? 23.610  -43.566 19.626  1.00 25.80  ? 38   CYS B SG  1 
ATOM   4648 N  N   . THR B 2 39  ? 21.357  -47.684 18.305  1.00 27.40  ? 39   THR B N   1 
ATOM   4649 C  CA  . THR B 2 39  ? 20.845  -49.004 18.677  1.00 26.51  ? 39   THR B CA  1 
ATOM   4650 C  C   . THR B 2 39  ? 21.866  -50.045 18.234  1.00 19.82  ? 39   THR B C   1 
ATOM   4651 O  O   . THR B 2 39  ? 22.332  -50.844 19.051  1.00 23.00  ? 39   THR B O   1 
ATOM   4652 C  CB  . THR B 2 39  ? 19.474  -49.303 18.016  1.00 28.40  ? 39   THR B CB  1 
ATOM   4653 O  OG1 . THR B 2 39  ? 19.522  -48.955 16.627  1.00 24.94  ? 39   THR B OG1 1 
ATOM   4654 C  CG2 . THR B 2 39  ? 18.348  -48.536 18.708  1.00 15.11  ? 39   THR B CG2 1 
ATOM   4655 N  N   . GLU B 2 40  ? 22.268  -49.960 16.964  1.00 5.89   ? 40   GLU B N   1 
ATOM   4656 C  CA  . GLU B 2 40  ? 23.254  -50.861 16.370  1.00 10.97  ? 40   GLU B CA  1 
ATOM   4657 C  C   . GLU B 2 40  ? 24.497  -50.964 17.267  1.00 10.21  ? 40   GLU B C   1 
ATOM   4658 O  O   . GLU B 2 40  ? 24.838  -52.038 17.757  1.00 14.76  ? 40   GLU B O   1 
ATOM   4659 C  CB  . GLU B 2 40  ? 23.660  -50.343 14.979  1.00 19.27  ? 40   GLU B CB  1 
ATOM   4660 C  CG  . GLU B 2 40  ? 23.539  -51.357 13.834  1.00 37.46  ? 40   GLU B CG  1 
ATOM   4661 C  CD  . GLU B 2 40  ? 24.514  -52.541 13.948  1.00 61.21  ? 40   GLU B CD  1 
ATOM   4662 O  OE1 . GLU B 2 40  ? 24.247  -53.492 14.726  1.00 59.33  ? 40   GLU B OE1 1 
ATOM   4663 O  OE2 . GLU B 2 40  ? 25.546  -52.527 13.239  1.00 67.20  ? 40   GLU B OE2 1 
ATOM   4664 N  N   . MET B 2 41  ? 25.164  -49.839 17.478  1.00 8.85   ? 41   MET B N   1 
ATOM   4665 C  CA  . MET B 2 41  ? 26.356  -49.771 18.326  1.00 21.70  ? 41   MET B CA  1 
ATOM   4666 C  C   . MET B 2 41  ? 26.132  -50.327 19.729  1.00 21.49  ? 41   MET B C   1 
ATOM   4667 O  O   . MET B 2 41  ? 27.062  -50.819 20.372  1.00 22.17  ? 41   MET B O   1 
ATOM   4668 C  CB  . MET B 2 41  ? 26.788  -48.323 18.486  1.00 34.72  ? 41   MET B CB  1 
ATOM   4669 C  CG  . MET B 2 41  ? 27.104  -47.607 17.195  1.00 42.99  ? 41   MET B CG  1 
ATOM   4670 S  SD  . MET B 2 41  ? 27.352  -45.873 17.556  1.00 29.97  ? 41   MET B SD  1 
ATOM   4671 C  CE  . MET B 2 41  ? 28.630  -45.979 18.820  1.00 20.91  ? 41   MET B CE  1 
ATOM   4672 N  N   . GLU B 2 42  ? 24.932  -50.119 20.246  1.00 18.09  ? 42   GLU B N   1 
ATOM   4673 C  CA  . GLU B 2 42  ? 24.585  -50.607 21.555  1.00 22.47  ? 42   GLU B CA  1 
ATOM   4674 C  C   . GLU B 2 42  ? 24.570  -52.119 21.439  1.00 25.15  ? 42   GLU B C   1 
ATOM   4675 O  O   . GLU B 2 42  ? 25.165  -52.826 22.258  1.00 23.37  ? 42   GLU B O   1 
ATOM   4676 C  CB  . GLU B 2 42  ? 23.209  -50.083 21.935  1.00 32.60  ? 42   GLU B CB  1 
ATOM   4677 C  CG  . GLU B 2 42  ? 22.649  -50.622 23.235  1.00 37.32  ? 42   GLU B CG  1 
ATOM   4678 C  CD  . GLU B 2 42  ? 21.209  -50.206 23.428  1.00 44.51  ? 42   GLU B CD  1 
ATOM   4679 O  OE1 . GLU B 2 42  ? 20.543  -49.837 22.418  1.00 41.41  ? 42   GLU B OE1 1 
ATOM   4680 O  OE2 . GLU B 2 42  ? 20.751  -50.247 24.591  1.00 42.97  ? 42   GLU B OE2 1 
ATOM   4681 N  N   . LYS B 2 43  ? 23.943  -52.609 20.376  1.00 30.56  ? 43   LYS B N   1 
ATOM   4682 C  CA  . LYS B 2 43  ? 23.858  -54.047 20.148  1.00 47.10  ? 43   LYS B CA  1 
ATOM   4683 C  C   . LYS B 2 43  ? 25.265  -54.625 20.000  1.00 47.18  ? 43   LYS B C   1 
ATOM   4684 O  O   . LYS B 2 43  ? 25.618  -55.606 20.658  1.00 49.19  ? 43   LYS B O   1 
ATOM   4685 C  CB  . LYS B 2 43  ? 22.989  -54.362 18.920  1.00 51.06  ? 43   LYS B CB  1 
ATOM   4686 C  CG  . LYS B 2 43  ? 21.536  -53.875 19.049  1.00 67.82  ? 43   LYS B CG  1 
ATOM   4687 C  CD  . LYS B 2 43  ? 20.844  -54.389 20.333  1.00 78.62  ? 43   LYS B CD  1 
ATOM   4688 C  CE  . LYS B 2 43  ? 19.534  -53.640 20.645  1.00 75.86  ? 43   LYS B CE  1 
ATOM   4689 N  NZ  . LYS B 2 43  ? 19.754  -52.188 20.952  1.00 65.32  ? 43   LYS B NZ  1 
ATOM   4690 N  N   . GLU B 2 44  ? 26.093  -53.941 19.220  1.00 41.91  ? 44   GLU B N   1 
ATOM   4691 C  CA  . GLU B 2 44  ? 27.467  -54.355 18.993  1.00 34.17  ? 44   GLU B CA  1 
ATOM   4692 C  C   . GLU B 2 44  ? 28.305  -54.228 20.269  1.00 36.52  ? 44   GLU B C   1 
ATOM   4693 O  O   . GLU B 2 44  ? 29.478  -54.606 20.294  1.00 37.21  ? 44   GLU B O   1 
ATOM   4694 C  CB  . GLU B 2 44  ? 28.053  -53.532 17.859  1.00 19.44  ? 44   GLU B CB  1 
ATOM   4695 C  CG  . GLU B 2 44  ? 27.209  -53.639 16.607  1.00 24.31  ? 44   GLU B CG  1 
ATOM   4696 C  CD  . GLU B 2 44  ? 27.675  -52.721 15.494  1.00 31.00  ? 44   GLU B CD  1 
ATOM   4697 O  OE1 . GLU B 2 44  ? 27.521  -51.488 15.628  1.00 38.31  ? 44   GLU B OE1 1 
ATOM   4698 O  OE2 . GLU B 2 44  ? 28.176  -53.227 14.471  1.00 26.98  ? 44   GLU B OE2 1 
ATOM   4699 N  N   . GLY B 2 45  ? 27.692  -53.683 21.318  1.00 40.05  ? 45   GLY B N   1 
ATOM   4700 C  CA  . GLY B 2 45  ? 28.353  -53.533 22.604  1.00 41.70  ? 45   GLY B CA  1 
ATOM   4701 C  C   . GLY B 2 45  ? 29.234  -52.317 22.766  1.00 38.68  ? 45   GLY B C   1 
ATOM   4702 O  O   . GLY B 2 45  ? 29.772  -52.090 23.852  1.00 46.25  ? 45   GLY B O   1 
ATOM   4703 N  N   . LYS B 2 46  ? 29.335  -51.513 21.711  1.00 31.82  ? 46   LYS B N   1 
ATOM   4704 C  CA  . LYS B 2 46  ? 30.179  -50.312 21.706  1.00 34.24  ? 46   LYS B CA  1 
ATOM   4705 C  C   . LYS B 2 46  ? 29.748  -49.229 22.702  1.00 31.90  ? 46   LYS B C   1 
ATOM   4706 O  O   . LYS B 2 46  ? 30.592  -48.535 23.277  1.00 20.64  ? 46   LYS B O   1 
ATOM   4707 C  CB  . LYS B 2 46  ? 30.227  -49.724 20.296  1.00 20.36  ? 46   LYS B CB  1 
ATOM   4708 C  CG  . LYS B 2 46  ? 30.638  -50.720 19.251  1.00 14.17  ? 46   LYS B CG  1 
ATOM   4709 C  CD  . LYS B 2 46  ? 30.280  -50.236 17.868  1.00 18.90  ? 46   LYS B CD  1 
ATOM   4710 C  CE  . LYS B 2 46  ? 30.812  -51.168 16.785  1.00 27.42  ? 46   LYS B CE  1 
ATOM   4711 N  NZ  . LYS B 2 46  ? 30.741  -50.517 15.439  1.00 29.91  ? 46   LYS B NZ  1 
ATOM   4712 N  N   . ILE B 2 47  ? 28.437  -49.077 22.865  1.00 34.24  ? 47   ILE B N   1 
ATOM   4713 C  CA  . ILE B 2 47  ? 27.866  -48.089 23.769  1.00 36.82  ? 47   ILE B CA  1 
ATOM   4714 C  C   . ILE B 2 47  ? 26.727  -48.682 24.603  1.00 38.64  ? 47   ILE B C   1 
ATOM   4715 O  O   . ILE B 2 47  ? 26.071  -49.651 24.191  1.00 34.99  ? 47   ILE B O   1 
ATOM   4716 C  CB  . ILE B 2 47  ? 27.347  -46.843 22.992  1.00 42.38  ? 47   ILE B CB  1 
ATOM   4717 C  CG1 . ILE B 2 47  ? 26.394  -47.263 21.867  1.00 28.97  ? 47   ILE B CG1 1 
ATOM   4718 C  CG2 . ILE B 2 47  ? 28.519  -46.029 22.443  1.00 33.07  ? 47   ILE B CG2 1 
ATOM   4719 C  CD1 . ILE B 2 47  ? 25.710  -46.102 21.197  1.00 10.15  ? 47   ILE B CD1 1 
ATOM   4720 N  N   . SER B 2 48  ? 26.485  -48.081 25.767  1.00 49.20  ? 48   SER B N   1 
ATOM   4721 C  CA  . SER B 2 48  ? 25.439  -48.533 26.692  1.00 56.64  ? 48   SER B CA  1 
ATOM   4722 C  C   . SER B 2 48  ? 24.540  -47.371 27.128  1.00 59.70  ? 48   SER B C   1 
ATOM   4723 O  O   . SER B 2 48  ? 25.001  -46.232 27.226  1.00 71.82  ? 48   SER B O   1 
ATOM   4724 C  CB  . SER B 2 48  ? 26.076  -49.131 27.962  1.00 51.89  ? 48   SER B CB  1 
ATOM   4725 O  OG  . SER B 2 48  ? 27.067  -50.104 27.679  1.00 58.50  ? 48   SER B OG  1 
ATOM   4726 N  N   . LYS B 2 49  ? 23.263  -47.647 27.382  1.00 55.24  ? 49   LYS B N   1 
ATOM   4727 C  CA  . LYS B 2 49  ? 22.357  -46.604 27.865  1.00 51.77  ? 49   LYS B CA  1 
ATOM   4728 C  C   . LYS B 2 49  ? 22.852  -46.282 29.275  1.00 43.88  ? 49   LYS B C   1 
ATOM   4729 O  O   . LYS B 2 49  ? 23.400  -47.153 29.952  1.00 38.87  ? 49   LYS B O   1 
ATOM   4730 C  CB  . LYS B 2 49  ? 20.903  -47.091 27.877  1.00 48.60  ? 49   LYS B CB  1 
ATOM   4731 C  CG  . LYS B 2 49  ? 20.272  -47.129 26.487  1.00 50.68  ? 49   LYS B CG  1 
ATOM   4732 C  CD  . LYS B 2 49  ? 18.927  -47.847 26.481  1.00 69.23  ? 49   LYS B CD  1 
ATOM   4733 C  CE  . LYS B 2 49  ? 18.289  -47.844 25.083  1.00 73.52  ? 49   LYS B CE  1 
ATOM   4734 N  NZ  . LYS B 2 49  ? 17.046  -48.675 25.003  1.00 64.77  ? 49   LYS B NZ  1 
ATOM   4735 N  N   . ILE B 2 50  ? 22.713  -45.036 29.711  1.00 44.64  ? 50   ILE B N   1 
ATOM   4736 C  CA  . ILE B 2 50  ? 23.220  -44.673 31.031  1.00 43.19  ? 50   ILE B CA  1 
ATOM   4737 C  C   . ILE B 2 50  ? 22.216  -44.007 31.953  1.00 36.07  ? 50   ILE B C   1 
ATOM   4738 O  O   . ILE B 2 50  ? 21.184  -43.503 31.503  1.00 34.11  ? 50   ILE B O   1 
ATOM   4739 C  CB  . ILE B 2 50  ? 24.454  -43.791 30.901  1.00 44.63  ? 50   ILE B CB  1 
ATOM   4740 C  CG1 . ILE B 2 50  ? 24.102  -42.513 30.153  1.00 44.00  ? 50   ILE B CG1 1 
ATOM   4741 C  CG2 . ILE B 2 50  ? 25.512  -44.523 30.110  1.00 51.14  ? 50   ILE B CG2 1 
ATOM   4742 C  CD1 . ILE B 2 50  ? 25.261  -41.573 30.007  1.00 55.16  ? 50   ILE B CD1 1 
ATOM   4743 N  N   . GLY B 2 51  ? 22.541  -44.003 33.243  1.00 26.57  ? 51   GLY B N   1 
ATOM   4744 C  CA  . GLY B 2 51  ? 21.660  -43.417 34.231  1.00 29.87  ? 51   GLY B CA  1 
ATOM   4745 C  C   . GLY B 2 51  ? 21.819  -41.921 34.466  1.00 37.89  ? 51   GLY B C   1 
ATOM   4746 O  O   . GLY B 2 51  ? 22.742  -41.285 33.947  1.00 33.00  ? 51   GLY B O   1 
ATOM   4747 N  N   . PRO B 2 52  ? 20.937  -41.335 35.295  1.00 41.78  ? 52   PRO B N   1 
ATOM   4748 C  CA  . PRO B 2 52  ? 20.913  -39.911 35.652  1.00 41.48  ? 52   PRO B CA  1 
ATOM   4749 C  C   . PRO B 2 52  ? 21.989  -39.498 36.666  1.00 38.50  ? 52   PRO B C   1 
ATOM   4750 O  O   . PRO B 2 52  ? 22.216  -38.310 36.913  1.00 35.50  ? 52   PRO B O   1 
ATOM   4751 C  CB  . PRO B 2 52  ? 19.506  -39.742 36.219  1.00 41.15  ? 52   PRO B CB  1 
ATOM   4752 C  CG  . PRO B 2 52  ? 19.266  -41.054 36.893  1.00 37.87  ? 52   PRO B CG  1 
ATOM   4753 C  CD  . PRO B 2 52  ? 19.778  -42.041 35.877  1.00 39.04  ? 52   PRO B CD  1 
ATOM   4754 N  N   . GLU B 2 53  ? 22.635  -40.491 37.262  1.00 37.09  ? 53   GLU B N   1 
ATOM   4755 C  CA  . GLU B 2 53  ? 23.687  -40.243 38.235  1.00 40.42  ? 53   GLU B CA  1 
ATOM   4756 C  C   . GLU B 2 53  ? 24.933  -39.764 37.484  1.00 38.50  ? 53   GLU B C   1 
ATOM   4757 O  O   . GLU B 2 53  ? 25.917  -39.343 38.088  1.00 38.69  ? 53   GLU B O   1 
ATOM   4758 C  CB  . GLU B 2 53  ? 23.965  -41.501 39.076  1.00 41.05  ? 53   GLU B CB  1 
ATOM   4759 C  CG  . GLU B 2 53  ? 24.510  -42.717 38.316  1.00 34.78  ? 53   GLU B CG  1 
ATOM   4760 C  CD  . GLU B 2 53  ? 23.516  -43.359 37.344  1.00 25.02  ? 53   GLU B CD  1 
ATOM   4761 O  OE1 . GLU B 2 53  ? 22.291  -43.166 37.495  1.00 16.24  ? 53   GLU B OE1 1 
ATOM   4762 O  OE2 . GLU B 2 53  ? 23.970  -44.072 36.423  1.00 9.81   ? 53   GLU B OE2 1 
ATOM   4763 N  N   . ASN B 2 54  ? 24.877  -39.862 36.159  1.00 32.86  ? 54   ASN B N   1 
ATOM   4764 C  CA  . ASN B 2 54  ? 25.942  -39.401 35.288  1.00 29.22  ? 54   ASN B CA  1 
ATOM   4765 C  C   . ASN B 2 54  ? 25.447  -38.038 34.827  1.00 36.24  ? 54   ASN B C   1 
ATOM   4766 O  O   . ASN B 2 54  ? 24.529  -37.951 34.004  1.00 31.61  ? 54   ASN B O   1 
ATOM   4767 C  CB  . ASN B 2 54  ? 26.091  -40.331 34.082  1.00 21.42  ? 54   ASN B CB  1 
ATOM   4768 C  CG  . ASN B 2 54  ? 27.067  -39.798 33.052  1.00 17.89  ? 54   ASN B CG  1 
ATOM   4769 O  OD1 . ASN B 2 54  ? 27.136  -38.593 32.820  1.00 21.35  ? 54   ASN B OD1 1 
ATOM   4770 N  ND2 . ASN B 2 54  ? 27.838  -40.692 32.437  1.00 15.98  ? 54   ASN B ND2 1 
ATOM   4771 N  N   . PRO B 2 55  ? 26.000  -36.955 35.406  1.00 43.70  ? 55   PRO B N   1 
ATOM   4772 C  CA  . PRO B 2 55  ? 25.611  -35.585 35.057  1.00 37.97  ? 55   PRO B CA  1 
ATOM   4773 C  C   . PRO B 2 55  ? 26.303  -34.944 33.856  1.00 23.08  ? 55   PRO B C   1 
ATOM   4774 O  O   . PRO B 2 55  ? 25.955  -33.826 33.499  1.00 29.98  ? 55   PRO B O   1 
ATOM   4775 C  CB  . PRO B 2 55  ? 25.907  -34.820 36.343  1.00 33.07  ? 55   PRO B CB  1 
ATOM   4776 C  CG  . PRO B 2 55  ? 27.143  -35.484 36.814  1.00 39.36  ? 55   PRO B CG  1 
ATOM   4777 C  CD  . PRO B 2 55  ? 26.855  -36.957 36.609  1.00 40.17  ? 55   PRO B CD  1 
ATOM   4778 N  N   . TYR B 2 56  ? 27.257  -35.631 33.232  1.00 10.81  ? 56   TYR B N   1 
ATOM   4779 C  CA  . TYR B 2 56  ? 27.965  -35.062 32.071  1.00 19.43  ? 56   TYR B CA  1 
ATOM   4780 C  C   . TYR B 2 56  ? 27.186  -35.155 30.774  1.00 10.56  ? 56   TYR B C   1 
ATOM   4781 O  O   . TYR B 2 56  ? 26.132  -35.788 30.715  1.00 5.16   ? 56   TYR B O   1 
ATOM   4782 C  CB  . TYR B 2 56  ? 29.306  -35.760 31.858  1.00 24.36  ? 56   TYR B CB  1 
ATOM   4783 C  CG  . TYR B 2 56  ? 30.105  -35.832 33.111  1.00 37.56  ? 56   TYR B CG  1 
ATOM   4784 C  CD1 . TYR B 2 56  ? 30.617  -34.680 33.691  1.00 50.45  ? 56   TYR B CD1 1 
ATOM   4785 C  CD2 . TYR B 2 56  ? 30.318  -37.047 33.746  1.00 42.99  ? 56   TYR B CD2 1 
ATOM   4786 C  CE1 . TYR B 2 56  ? 31.322  -34.732 34.874  1.00 61.29  ? 56   TYR B CE1 1 
ATOM   4787 C  CE2 . TYR B 2 56  ? 31.017  -37.116 34.921  1.00 48.62  ? 56   TYR B CE2 1 
ATOM   4788 C  CZ  . TYR B 2 56  ? 31.521  -35.958 35.486  1.00 66.62  ? 56   TYR B CZ  1 
ATOM   4789 O  OH  . TYR B 2 56  ? 32.234  -36.027 36.662  1.00 83.87  ? 56   TYR B OH  1 
ATOM   4790 N  N   . ASN B 2 57  ? 27.733  -34.537 29.733  1.00 13.29  ? 57   ASN B N   1 
ATOM   4791 C  CA  . ASN B 2 57  ? 27.134  -34.565 28.400  1.00 11.48  ? 57   ASN B CA  1 
ATOM   4792 C  C   . ASN B 2 57  ? 27.977  -33.893 27.332  1.00 10.49  ? 57   ASN B C   1 
ATOM   4793 O  O   . ASN B 2 57  ? 28.700  -32.915 27.588  1.00 2.00   ? 57   ASN B O   1 
ATOM   4794 C  CB  . ASN B 2 57  ? 25.746  -33.942 28.374  1.00 2.00   ? 57   ASN B CB  1 
ATOM   4795 C  CG  . ASN B 2 57  ? 24.960  -34.350 27.151  1.00 11.09  ? 57   ASN B CG  1 
ATOM   4796 O  OD1 . ASN B 2 57  ? 24.616  -33.531 26.299  1.00 28.12  ? 57   ASN B OD1 1 
ATOM   4797 N  ND2 . ASN B 2 57  ? 24.670  -35.631 27.053  1.00 26.91  ? 57   ASN B ND2 1 
ATOM   4798 N  N   . THR B 2 58  ? 27.839  -34.428 26.126  1.00 11.57  ? 58   THR B N   1 
ATOM   4799 C  CA  . THR B 2 58  ? 28.520  -33.940 24.950  1.00 5.01   ? 58   THR B CA  1 
ATOM   4800 C  C   . THR B 2 58  ? 27.525  -33.927 23.814  1.00 2.00   ? 58   THR B C   1 
ATOM   4801 O  O   . THR B 2 58  ? 26.666  -34.818 23.694  1.00 2.00   ? 58   THR B O   1 
ATOM   4802 C  CB  . THR B 2 58  ? 29.714  -34.844 24.584  1.00 17.34  ? 58   THR B CB  1 
ATOM   4803 O  OG1 . THR B 2 58  ? 30.745  -34.686 25.573  1.00 32.01  ? 58   THR B OG1 1 
ATOM   4804 C  CG2 . THR B 2 58  ? 30.266  -34.510 23.188  1.00 9.05   ? 58   THR B CG2 1 
ATOM   4805 N  N   . PRO B 2 59  ? 27.548  -32.849 23.030  1.00 7.56   ? 59   PRO B N   1 
ATOM   4806 C  CA  . PRO B 2 59  ? 26.648  -32.700 21.881  1.00 13.10  ? 59   PRO B CA  1 
ATOM   4807 C  C   . PRO B 2 59  ? 26.972  -33.758 20.850  1.00 2.85   ? 59   PRO B C   1 
ATOM   4808 O  O   . PRO B 2 59  ? 28.075  -34.302 20.827  1.00 2.00   ? 59   PRO B O   1 
ATOM   4809 C  CB  . PRO B 2 59  ? 27.007  -31.325 21.333  1.00 9.27   ? 59   PRO B CB  1 
ATOM   4810 C  CG  . PRO B 2 59  ? 27.508  -30.591 22.537  1.00 19.02  ? 59   PRO B CG  1 
ATOM   4811 C  CD  . PRO B 2 59  ? 28.328  -31.621 23.264  1.00 2.86   ? 59   PRO B CD  1 
ATOM   4812 N  N   . VAL B 2 60  ? 26.016  -33.998 19.971  1.00 14.20  ? 60   VAL B N   1 
ATOM   4813 C  CA  . VAL B 2 60  ? 26.146  -34.981 18.901  1.00 22.20  ? 60   VAL B CA  1 
ATOM   4814 C  C   . VAL B 2 60  ? 25.305  -34.560 17.698  1.00 10.81  ? 60   VAL B C   1 
ATOM   4815 O  O   . VAL B 2 60  ? 24.444  -33.684 17.809  1.00 12.97  ? 60   VAL B O   1 
ATOM   4816 C  CB  . VAL B 2 60  ? 25.664  -36.370 19.371  1.00 32.27  ? 60   VAL B CB  1 
ATOM   4817 C  CG1 . VAL B 2 60  ? 26.647  -36.958 20.349  1.00 30.11  ? 60   VAL B CG1 1 
ATOM   4818 C  CG2 . VAL B 2 60  ? 24.297  -36.253 20.034  1.00 35.85  ? 60   VAL B CG2 1 
ATOM   4819 N  N   . PHE B 2 61  ? 25.580  -35.150 16.544  1.00 5.72   ? 61   PHE B N   1 
ATOM   4820 C  CA  . PHE B 2 61  ? 24.827  -34.835 15.329  1.00 8.66   ? 61   PHE B CA  1 
ATOM   4821 C  C   . PHE B 2 61  ? 25.194  -35.742 14.168  1.00 11.04  ? 61   PHE B C   1 
ATOM   4822 O  O   . PHE B 2 61  ? 26.214  -36.450 14.193  1.00 4.51   ? 61   PHE B O   1 
ATOM   4823 C  CB  . PHE B 2 61  ? 24.996  -33.372 14.904  1.00 3.74   ? 61   PHE B CB  1 
ATOM   4824 C  CG  . PHE B 2 61  ? 26.414  -32.987 14.599  1.00 31.12  ? 61   PHE B CG  1 
ATOM   4825 C  CD1 . PHE B 2 61  ? 27.369  -32.931 15.618  1.00 43.07  ? 61   PHE B CD1 1 
ATOM   4826 C  CD2 . PHE B 2 61  ? 26.793  -32.661 13.296  1.00 35.81  ? 61   PHE B CD2 1 
ATOM   4827 C  CE1 . PHE B 2 61  ? 28.674  -32.556 15.348  1.00 53.20  ? 61   PHE B CE1 1 
ATOM   4828 C  CE2 . PHE B 2 61  ? 28.098  -32.282 13.008  1.00 36.13  ? 61   PHE B CE2 1 
ATOM   4829 C  CZ  . PHE B 2 61  ? 29.041  -32.228 14.035  1.00 55.76  ? 61   PHE B CZ  1 
ATOM   4830 N  N   . ALA B 2 62  ? 24.369  -35.687 13.133  1.00 12.79  ? 62   ALA B N   1 
ATOM   4831 C  CA  . ALA B 2 62  ? 24.577  -36.510 11.965  1.00 20.78  ? 62   ALA B CA  1 
ATOM   4832 C  C   . ALA B 2 62  ? 25.077  -35.675 10.815  1.00 30.59  ? 62   ALA B C   1 
ATOM   4833 O  O   . ALA B 2 62  ? 24.648  -34.524 10.646  1.00 33.20  ? 62   ALA B O   1 
ATOM   4834 C  CB  . ALA B 2 62  ? 23.285  -37.190 11.590  1.00 23.70  ? 62   ALA B CB  1 
ATOM   4835 N  N   . ILE B 2 63  ? 26.008  -36.252 10.057  1.00 39.00  ? 63   ILE B N   1 
ATOM   4836 C  CA  . ILE B 2 63  ? 26.587  -35.609 8.882   1.00 52.58  ? 63   ILE B CA  1 
ATOM   4837 C  C   . ILE B 2 63  ? 26.413  -36.571 7.718   1.00 56.49  ? 63   ILE B C   1 
ATOM   4838 O  O   . ILE B 2 63  ? 25.960  -37.697 7.908   1.00 49.06  ? 63   ILE B O   1 
ATOM   4839 C  CB  . ILE B 2 63  ? 28.091  -35.287 9.073   1.00 59.25  ? 63   ILE B CB  1 
ATOM   4840 C  CG1 . ILE B 2 63  ? 28.888  -36.560 9.354   1.00 60.46  ? 63   ILE B CG1 1 
ATOM   4841 C  CG2 . ILE B 2 63  ? 28.277  -34.304 10.217  1.00 67.95  ? 63   ILE B CG2 1 
ATOM   4842 C  CD1 . ILE B 2 63  ? 30.356  -36.305 9.615   1.00 62.11  ? 63   ILE B CD1 1 
ATOM   4843 N  N   . LYS B 2 64  ? 26.766  -36.140 6.516   1.00 70.29  ? 64   LYS B N   1 
ATOM   4844 C  CA  . LYS B 2 64  ? 26.616  -37.003 5.351   1.00 84.57  ? 64   LYS B CA  1 
ATOM   4845 C  C   . LYS B 2 64  ? 27.909  -37.589 4.820   1.00 97.51  ? 64   LYS B C   1 
ATOM   4846 O  O   . LYS B 2 64  ? 28.847  -36.853 4.496   1.00 98.30  ? 64   LYS B O   1 
ATOM   4847 C  CB  . LYS B 2 64  ? 25.914  -36.264 4.215   1.00 77.59  ? 64   LYS B CB  1 
ATOM   4848 C  CG  . LYS B 2 64  ? 24.406  -36.341 4.251   1.00 73.93  ? 64   LYS B CG  1 
ATOM   4849 C  CD  . LYS B 2 64  ? 23.891  -37.752 3.976   1.00 68.30  ? 64   LYS B CD  1 
ATOM   4850 C  CE  . LYS B 2 64  ? 22.380  -37.718 3.782   1.00 64.97  ? 64   LYS B CE  1 
ATOM   4851 N  NZ  . LYS B 2 64  ? 21.776  -39.045 3.533   1.00 64.00  ? 64   LYS B NZ  1 
ATOM   4852 N  N   . LYS B 2 65  ? 27.959  -38.917 4.739   1.00 109.36 ? 65   LYS B N   1 
ATOM   4853 C  CA  . LYS B 2 65  ? 29.120  -39.603 4.185   1.00 116.53 ? 65   LYS B CA  1 
ATOM   4854 C  C   . LYS B 2 65  ? 28.942  -39.462 2.672   1.00 120.64 ? 65   LYS B C   1 
ATOM   4855 O  O   . LYS B 2 65  ? 28.003  -40.021 2.086   1.00 116.96 ? 65   LYS B O   1 
ATOM   4856 C  CB  . LYS B 2 65  ? 29.133  -41.082 4.600   1.00 116.74 ? 65   LYS B CB  1 
ATOM   4857 C  CG  . LYS B 2 65  ? 30.351  -41.498 5.421   1.00 117.74 ? 65   LYS B CG  1 
ATOM   4858 C  CD  . LYS B 2 65  ? 30.148  -42.860 6.095   1.00 118.69 ? 65   LYS B CD  1 
ATOM   4859 C  CE  . LYS B 2 65  ? 31.384  -43.342 6.868   1.00 116.26 ? 65   LYS B CE  1 
ATOM   4860 N  NZ  . LYS B 2 65  ? 32.282  -44.236 6.067   1.00 117.67 ? 65   LYS B NZ  1 
ATOM   4861 N  N   . LYS B 2 66  ? 29.797  -38.635 2.073   1.00 126.85 ? 66   LYS B N   1 
ATOM   4862 C  CA  . LYS B 2 66  ? 29.789  -38.355 0.633   1.00 133.11 ? 66   LYS B CA  1 
ATOM   4863 C  C   . LYS B 2 66  ? 29.531  -39.594 -0.219  1.00 140.54 ? 66   LYS B C   1 
ATOM   4864 O  O   . LYS B 2 66  ? 29.988  -40.687 0.112   1.00 144.24 ? 66   LYS B O   1 
ATOM   4865 C  CB  . LYS B 2 66  ? 31.122  -37.709 0.231   1.00 128.34 ? 66   LYS B CB  1 
ATOM   4866 C  CG  . LYS B 2 66  ? 32.354  -38.424 0.794   1.00 126.92 ? 66   LYS B CG  1 
ATOM   4867 C  CD  . LYS B 2 66  ? 33.618  -37.580 0.684   1.00 127.87 ? 66   LYS B CD  1 
ATOM   4868 C  CE  . LYS B 2 66  ? 34.779  -38.211 1.456   1.00 123.41 ? 66   LYS B CE  1 
ATOM   4869 N  NZ  . LYS B 2 66  ? 35.979  -37.320 1.482   1.00 120.39 ? 66   LYS B NZ  1 
ATOM   4870 N  N   . ASP B 2 67  ? 28.778  -39.406 -1.301  1.00 143.86 ? 67   ASP B N   1 
ATOM   4871 C  CA  . ASP B 2 67  ? 28.429  -40.482 -2.234  1.00 147.34 ? 67   ASP B CA  1 
ATOM   4872 C  C   . ASP B 2 67  ? 27.370  -41.444 -1.692  1.00 146.55 ? 67   ASP B C   1 
ATOM   4873 O  O   . ASP B 2 67  ? 26.831  -42.266 -2.440  1.00 150.75 ? 67   ASP B O   1 
ATOM   4874 C  CB  . ASP B 2 67  ? 29.700  -41.249 -2.680  1.00 153.22 ? 67   ASP B CB  1 
ATOM   4875 C  CG  . ASP B 2 67  ? 29.411  -42.398 -3.644  1.00 157.28 ? 67   ASP B CG  1 
ATOM   4876 O  OD1 . ASP B 2 67  ? 28.814  -42.164 -4.717  1.00 163.26 ? 67   ASP B OD1 1 
ATOM   4877 O  OD2 . ASP B 2 67  ? 29.806  -43.549 -3.339  1.00 154.78 ? 67   ASP B OD2 1 
ATOM   4878 N  N   . SER B 2 68  ? 27.074  -41.359 -0.400  1.00 140.43 ? 68   SER B N   1 
ATOM   4879 C  CA  . SER B 2 68  ? 26.082  -42.245 0.184   1.00 131.50 ? 68   SER B CA  1 
ATOM   4880 C  C   . SER B 2 68  ? 24.986  -41.541 0.954   1.00 122.72 ? 68   SER B C   1 
ATOM   4881 O  O   . SER B 2 68  ? 25.133  -40.396 1.381   1.00 116.34 ? 68   SER B O   1 
ATOM   4882 C  CB  . SER B 2 68  ? 26.759  -43.286 1.081   1.00 132.10 ? 68   SER B CB  1 
ATOM   4883 O  OG  . SER B 2 68  ? 26.887  -44.542 0.431   1.00 128.40 ? 68   SER B OG  1 
ATOM   4884 N  N   . THR B 2 69  ? 23.871  -42.251 1.086   1.00 119.07 ? 69   THR B N   1 
ATOM   4885 C  CA  . THR B 2 69  ? 22.700  -41.781 1.814   1.00 114.57 ? 69   THR B CA  1 
ATOM   4886 C  C   . THR B 2 69  ? 22.976  -42.068 3.287   1.00 108.68 ? 69   THR B C   1 
ATOM   4887 O  O   . THR B 2 69  ? 22.343  -41.513 4.181   1.00 109.85 ? 69   THR B O   1 
ATOM   4888 C  CB  . THR B 2 69  ? 21.443  -42.568 1.381   1.00 116.69 ? 69   THR B CB  1 
ATOM   4889 O  OG1 . THR B 2 69  ? 21.688  -43.977 1.506   1.00 118.74 ? 69   THR B OG1 1 
ATOM   4890 C  CG2 . THR B 2 69  ? 21.085  -42.248 -0.063  1.00 113.82 ? 69   THR B CG2 1 
ATOM   4891 N  N   . LYS B 2 70  ? 23.910  -42.987 3.509   1.00 100.60 ? 70   LYS B N   1 
ATOM   4892 C  CA  . LYS B 2 70  ? 24.299  -43.386 4.849   1.00 94.83  ? 70   LYS B CA  1 
ATOM   4893 C  C   . LYS B 2 70  ? 24.744  -42.154 5.631   1.00 90.35  ? 70   LYS B C   1 
ATOM   4894 O  O   . LYS B 2 70  ? 25.657  -41.430 5.222   1.00 92.65  ? 70   LYS B O   1 
ATOM   4895 C  CB  . LYS B 2 70  ? 25.439  -44.404 4.777   1.00 98.65  ? 70   LYS B CB  1 
ATOM   4896 C  CG  . LYS B 2 70  ? 25.180  -45.603 3.859   1.00 105.21 ? 70   LYS B CG  1 
ATOM   4897 C  CD  . LYS B 2 70  ? 24.130  -46.553 4.424   1.00 109.43 ? 70   LYS B CD  1 
ATOM   4898 C  CE  . LYS B 2 70  ? 24.029  -47.822 3.581   1.00 108.72 ? 70   LYS B CE  1 
ATOM   4899 N  NZ  . LYS B 2 70  ? 23.174  -48.856 4.229   1.00 107.57 ? 70   LYS B NZ  1 
ATOM   4900 N  N   . TRP B 2 71  ? 24.047  -41.891 6.725   1.00 84.68  ? 71   TRP B N   1 
ATOM   4901 C  CA  . TRP B 2 71  ? 24.367  -40.761 7.579   1.00 77.21  ? 71   TRP B CA  1 
ATOM   4902 C  C   . TRP B 2 71  ? 25.495  -41.181 8.500   1.00 67.89  ? 71   TRP B C   1 
ATOM   4903 O  O   . TRP B 2 71  ? 25.487  -42.303 9.005   1.00 70.78  ? 71   TRP B O   1 
ATOM   4904 C  CB  . TRP B 2 71  ? 23.160  -40.383 8.438   1.00 79.62  ? 71   TRP B CB  1 
ATOM   4905 C  CG  . TRP B 2 71  ? 22.103  -39.590 7.738   1.00 72.14  ? 71   TRP B CG  1 
ATOM   4906 C  CD1 . TRP B 2 71  ? 21.044  -40.078 7.036   1.00 64.37  ? 71   TRP B CD1 1 
ATOM   4907 C  CD2 . TRP B 2 71  ? 21.975  -38.165 7.726   1.00 74.52  ? 71   TRP B CD2 1 
ATOM   4908 N  NE1 . TRP B 2 71  ? 20.257  -39.046 6.594   1.00 73.41  ? 71   TRP B NE1 1 
ATOM   4909 C  CE2 . TRP B 2 71  ? 20.805  -37.859 7.002   1.00 76.98  ? 71   TRP B CE2 1 
ATOM   4910 C  CE3 . TRP B 2 71  ? 22.736  -37.116 8.259   1.00 80.18  ? 71   TRP B CE3 1 
ATOM   4911 C  CZ2 . TRP B 2 71  ? 20.373  -36.542 6.795   1.00 80.33  ? 71   TRP B CZ2 1 
ATOM   4912 C  CZ3 . TRP B 2 71  ? 22.310  -35.806 8.055   1.00 83.57  ? 71   TRP B CZ3 1 
ATOM   4913 C  CH2 . TRP B 2 71  ? 21.137  -35.533 7.328   1.00 85.98  ? 71   TRP B CH2 1 
ATOM   4914 N  N   . ARG B 2 72  ? 26.452  -40.286 8.730   1.00 60.69  ? 72   ARG B N   1 
ATOM   4915 C  CA  . ARG B 2 72  ? 27.574  -40.579 9.619   1.00 52.84  ? 72   ARG B CA  1 
ATOM   4916 C  C   . ARG B 2 72  ? 27.381  -39.886 10.974  1.00 42.09  ? 72   ARG B C   1 
ATOM   4917 O  O   . ARG B 2 72  ? 26.962  -38.721 11.048  1.00 37.22  ? 72   ARG B O   1 
ATOM   4918 C  CB  . ARG B 2 72  ? 28.907  -40.155 8.990   1.00 48.25  ? 72   ARG B CB  1 
ATOM   4919 C  CG  . ARG B 2 72  ? 30.124  -40.655 9.753   1.00 53.09  ? 72   ARG B CG  1 
ATOM   4920 C  CD  . ARG B 2 72  ? 31.406  -40.058 9.196   1.00 73.43  ? 72   ARG B CD  1 
ATOM   4921 N  NE  . ARG B 2 72  ? 32.621  -40.581 9.830   1.00 85.11  ? 72   ARG B NE  1 
ATOM   4922 C  CZ  . ARG B 2 72  ? 33.064  -40.235 11.040  1.00 89.83  ? 72   ARG B CZ  1 
ATOM   4923 N  NH1 . ARG B 2 72  ? 32.393  -39.362 11.786  1.00 87.29  ? 72   ARG B NH1 1 
ATOM   4924 N  NH2 . ARG B 2 72  ? 34.210  -40.737 11.488  1.00 91.92  ? 72   ARG B NH2 1 
ATOM   4925 N  N   . LYS B 2 73  ? 27.667  -40.615 12.044  1.00 28.59  ? 73   LYS B N   1 
ATOM   4926 C  CA  . LYS B 2 73  ? 27.520  -40.063 13.367  1.00 32.00  ? 73   LYS B CA  1 
ATOM   4927 C  C   . LYS B 2 73  ? 28.733  -39.226 13.676  1.00 28.08  ? 73   LYS B C   1 
ATOM   4928 O  O   . LYS B 2 73  ? 29.857  -39.610 13.356  1.00 27.69  ? 73   LYS B O   1 
ATOM   4929 C  CB  . LYS B 2 73  ? 27.378  -41.172 14.414  1.00 45.52  ? 73   LYS B CB  1 
ATOM   4930 C  CG  . LYS B 2 73  ? 26.841  -40.681 15.768  1.00 44.62  ? 73   LYS B CG  1 
ATOM   4931 C  CD  . LYS B 2 73  ? 27.928  -40.626 16.825  1.00 49.63  ? 73   LYS B CD  1 
ATOM   4932 C  CE  . LYS B 2 73  ? 28.146  -41.979 17.486  1.00 50.66  ? 73   LYS B CE  1 
ATOM   4933 N  NZ  . LYS B 2 73  ? 27.680  -41.980 18.915  1.00 50.64  ? 73   LYS B NZ  1 
ATOM   4934 N  N   . LEU B 2 74  ? 28.491  -38.078 14.291  1.00 28.04  ? 74   LEU B N   1 
ATOM   4935 C  CA  . LEU B 2 74  ? 29.555  -37.182 14.675  1.00 20.88  ? 74   LEU B CA  1 
ATOM   4936 C  C   . LEU B 2 74  ? 29.292  -36.575 16.060  1.00 10.42  ? 74   LEU B C   1 
ATOM   4937 O  O   . LEU B 2 74  ? 28.165  -36.219 16.424  1.00 2.33   ? 74   LEU B O   1 
ATOM   4938 C  CB  . LEU B 2 74  ? 29.748  -36.117 13.594  1.00 11.04  ? 74   LEU B CB  1 
ATOM   4939 C  CG  . LEU B 2 74  ? 30.826  -35.093 13.917  1.00 13.86  ? 74   LEU B CG  1 
ATOM   4940 C  CD1 . LEU B 2 74  ? 32.031  -35.728 14.585  1.00 2.00   ? 74   LEU B CD1 1 
ATOM   4941 C  CD2 . LEU B 2 74  ? 31.204  -34.397 12.633  1.00 40.52  ? 74   LEU B CD2 1 
ATOM   4942 N  N   . VAL B 2 75  ? 30.336  -36.553 16.867  1.00 7.56   ? 75   VAL B N   1 
ATOM   4943 C  CA  . VAL B 2 75  ? 30.235  -36.009 18.200  1.00 14.80  ? 75   VAL B CA  1 
ATOM   4944 C  C   . VAL B 2 75  ? 31.166  -34.819 18.348  1.00 22.90  ? 75   VAL B C   1 
ATOM   4945 O  O   . VAL B 2 75  ? 32.238  -34.767 17.746  1.00 28.95  ? 75   VAL B O   1 
ATOM   4946 C  CB  . VAL B 2 75  ? 30.618  -37.051 19.249  1.00 14.88  ? 75   VAL B CB  1 
ATOM   4947 C  CG1 . VAL B 2 75  ? 30.315  -36.539 20.643  1.00 21.87  ? 75   VAL B CG1 1 
ATOM   4948 C  CG2 . VAL B 2 75  ? 29.904  -38.343 18.982  1.00 26.69  ? 75   VAL B CG2 1 
ATOM   4949 N  N   . ASP B 2 76  ? 30.768  -33.883 19.194  1.00 33.36  ? 76   ASP B N   1 
ATOM   4950 C  CA  . ASP B 2 76  ? 31.564  -32.699 19.427  1.00 38.51  ? 76   ASP B CA  1 
ATOM   4951 C  C   . ASP B 2 76  ? 32.463  -32.857 20.651  1.00 33.46  ? 76   ASP B C   1 
ATOM   4952 O  O   . ASP B 2 76  ? 32.211  -32.277 21.717  1.00 19.93  ? 76   ASP B O   1 
ATOM   4953 C  CB  . ASP B 2 76  ? 30.654  -31.493 19.583  1.00 43.80  ? 76   ASP B CB  1 
ATOM   4954 C  CG  . ASP B 2 76  ? 31.377  -30.203 19.341  1.00 41.18  ? 76   ASP B CG  1 
ATOM   4955 O  OD1 . ASP B 2 76  ? 32.538  -30.248 18.869  1.00 40.86  ? 76   ASP B OD1 1 
ATOM   4956 O  OD2 . ASP B 2 76  ? 30.780  -29.148 19.622  1.00 31.61  ? 76   ASP B OD2 1 
ATOM   4957 N  N   . PHE B 2 77  ? 33.552  -33.594 20.463  1.00 35.09  ? 77   PHE B N   1 
ATOM   4958 C  CA  . PHE B 2 77  ? 34.491  -33.857 21.541  1.00 41.87  ? 77   PHE B CA  1 
ATOM   4959 C  C   . PHE B 2 77  ? 35.423  -32.721 21.877  1.00 35.41  ? 77   PHE B C   1 
ATOM   4960 O  O   . PHE B 2 77  ? 36.291  -32.865 22.751  1.00 18.78  ? 77   PHE B O   1 
ATOM   4961 C  CB  . PHE B 2 77  ? 35.297  -35.116 21.244  1.00 55.85  ? 77   PHE B CB  1 
ATOM   4962 C  CG  . PHE B 2 77  ? 34.557  -36.379 21.552  1.00 64.77  ? 77   PHE B CG  1 
ATOM   4963 C  CD1 . PHE B 2 77  ? 34.029  -36.590 22.826  1.00 71.38  ? 77   PHE B CD1 1 
ATOM   4964 C  CD2 . PHE B 2 77  ? 34.351  -37.341 20.570  1.00 53.35  ? 77   PHE B CD2 1 
ATOM   4965 C  CE1 . PHE B 2 77  ? 33.299  -37.739 23.120  1.00 63.96  ? 77   PHE B CE1 1 
ATOM   4966 C  CE2 . PHE B 2 77  ? 33.623  -38.494 20.851  1.00 36.69  ? 77   PHE B CE2 1 
ATOM   4967 C  CZ  . PHE B 2 77  ? 33.096  -38.691 22.128  1.00 54.88  ? 77   PHE B CZ  1 
ATOM   4968 N  N   . ARG B 2 78  ? 35.186  -31.574 21.242  1.00 35.30  ? 78   ARG B N   1 
ATOM   4969 C  CA  . ARG B 2 78  ? 36.016  -30.395 21.450  1.00 27.74  ? 78   ARG B CA  1 
ATOM   4970 C  C   . ARG B 2 78  ? 36.285  -30.074 22.902  1.00 14.28  ? 78   ARG B C   1 
ATOM   4971 O  O   . ARG B 2 78  ? 37.420  -29.800 23.247  1.00 13.02  ? 78   ARG B O   1 
ATOM   4972 C  CB  . ARG B 2 78  ? 35.470  -29.183 20.693  1.00 16.39  ? 78   ARG B CB  1 
ATOM   4973 C  CG  . ARG B 2 78  ? 35.863  -29.205 19.223  1.00 2.00   ? 78   ARG B CG  1 
ATOM   4974 C  CD  . ARG B 2 78  ? 35.473  -27.942 18.498  1.00 5.73   ? 78   ARG B CD  1 
ATOM   4975 N  NE  . ARG B 2 78  ? 34.027  -27.802 18.369  1.00 32.06  ? 78   ARG B NE  1 
ATOM   4976 C  CZ  . ARG B 2 78  ? 33.413  -26.715 17.907  1.00 40.97  ? 78   ARG B CZ  1 
ATOM   4977 N  NH1 . ARG B 2 78  ? 34.113  -25.658 17.531  1.00 56.14  ? 78   ARG B NH1 1 
ATOM   4978 N  NH2 . ARG B 2 78  ? 32.095  -26.690 17.806  1.00 33.69  ? 78   ARG B NH2 1 
ATOM   4979 N  N   . GLU B 2 79  ? 35.278  -30.205 23.758  1.00 11.84  ? 79   GLU B N   1 
ATOM   4980 C  CA  . GLU B 2 79  ? 35.460  -29.935 25.181  1.00 26.42  ? 79   GLU B CA  1 
ATOM   4981 C  C   . GLU B 2 79  ? 36.212  -31.041 25.913  1.00 24.21  ? 79   GLU B C   1 
ATOM   4982 O  O   . GLU B 2 79  ? 37.085  -30.780 26.751  1.00 13.32  ? 79   GLU B O   1 
ATOM   4983 C  CB  . GLU B 2 79  ? 34.112  -29.732 25.850  1.00 43.26  ? 79   GLU B CB  1 
ATOM   4984 C  CG  . GLU B 2 79  ? 33.428  -28.472 25.396  1.00 62.74  ? 79   GLU B CG  1 
ATOM   4985 C  CD  . GLU B 2 79  ? 34.206  -27.236 25.773  1.00 55.74  ? 79   GLU B CD  1 
ATOM   4986 O  OE1 . GLU B 2 79  ? 34.533  -27.111 26.975  1.00 39.59  ? 79   GLU B OE1 1 
ATOM   4987 O  OE2 . GLU B 2 79  ? 34.484  -26.406 24.870  1.00 61.01  ? 79   GLU B OE2 1 
ATOM   4988 N  N   . LEU B 2 80  ? 35.847  -32.279 25.610  1.00 23.36  ? 80   LEU B N   1 
ATOM   4989 C  CA  . LEU B 2 80  ? 36.483  -33.414 26.241  1.00 23.78  ? 80   LEU B CA  1 
ATOM   4990 C  C   . LEU B 2 80  ? 37.956  -33.382 25.898  1.00 17.66  ? 80   LEU B C   1 
ATOM   4991 O  O   . LEU B 2 80  ? 38.803  -33.419 26.784  1.00 22.68  ? 80   LEU B O   1 
ATOM   4992 C  CB  . LEU B 2 80  ? 35.848  -34.722 25.759  1.00 41.09  ? 80   LEU B CB  1 
ATOM   4993 C  CG  . LEU B 2 80  ? 36.208  -35.987 26.560  1.00 48.28  ? 80   LEU B CG  1 
ATOM   4994 C  CD1 . LEU B 2 80  ? 35.995  -35.755 28.052  1.00 41.45  ? 80   LEU B CD1 1 
ATOM   4995 C  CD2 . LEU B 2 80  ? 35.385  -37.182 26.084  1.00 47.03  ? 80   LEU B CD2 1 
ATOM   4996 N  N   . ASN B 2 81  ? 38.253  -33.259 24.613  1.00 13.38  ? 81   ASN B N   1 
ATOM   4997 C  CA  . ASN B 2 81  ? 39.627  -33.206 24.144  1.00 18.13  ? 81   ASN B CA  1 
ATOM   4998 C  C   . ASN B 2 81  ? 40.413  -32.210 24.962  1.00 24.90  ? 81   ASN B C   1 
ATOM   4999 O  O   . ASN B 2 81  ? 41.472  -32.536 25.497  1.00 27.82  ? 81   ASN B O   1 
ATOM   5000 C  CB  . ASN B 2 81  ? 39.669  -32.811 22.673  1.00 23.25  ? 81   ASN B CB  1 
ATOM   5001 C  CG  . ASN B 2 81  ? 38.957  -33.804 21.797  1.00 18.74  ? 81   ASN B CG  1 
ATOM   5002 O  OD1 . ASN B 2 81  ? 38.609  -34.890 22.250  1.00 25.87  ? 81   ASN B OD1 1 
ATOM   5003 N  ND2 . ASN B 2 81  ? 38.744  -33.452 20.538  1.00 12.53  ? 81   ASN B ND2 1 
ATOM   5004 N  N   . LYS B 2 82  ? 39.846  -31.019 25.121  1.00 28.37  ? 82   LYS B N   1 
ATOM   5005 C  CA  . LYS B 2 82  ? 40.488  -29.959 25.888  1.00 36.56  ? 82   LYS B CA  1 
ATOM   5006 C  C   . LYS B 2 82  ? 40.643  -30.294 27.368  1.00 44.37  ? 82   LYS B C   1 
ATOM   5007 O  O   . LYS B 2 82  ? 41.492  -29.727 28.055  1.00 46.30  ? 82   LYS B O   1 
ATOM   5008 C  CB  . LYS B 2 82  ? 39.726  -28.641 25.717  1.00 31.31  ? 82   LYS B CB  1 
ATOM   5009 C  CG  . LYS B 2 82  ? 39.722  -28.126 24.269  1.00 43.24  ? 82   LYS B CG  1 
ATOM   5010 C  CD  . LYS B 2 82  ? 39.357  -26.635 24.122  1.00 41.13  ? 82   LYS B CD  1 
ATOM   5011 C  CE  . LYS B 2 82  ? 37.953  -26.275 24.637  1.00 39.46  ? 82   LYS B CE  1 
ATOM   5012 N  NZ  . LYS B 2 82  ? 37.846  -26.116 26.136  1.00 37.33  ? 82   LYS B NZ  1 
ATOM   5013 N  N   . ARG B 2 83  ? 39.827  -31.216 27.858  1.00 49.75  ? 83   ARG B N   1 
ATOM   5014 C  CA  . ARG B 2 83  ? 39.885  -31.612 29.255  1.00 57.87  ? 83   ARG B CA  1 
ATOM   5015 C  C   . ARG B 2 83  ? 40.667  -32.899 29.469  1.00 60.74  ? 83   ARG B C   1 
ATOM   5016 O  O   . ARG B 2 83  ? 41.020  -33.243 30.609  1.00 61.94  ? 83   ARG B O   1 
ATOM   5017 C  CB  . ARG B 2 83  ? 38.471  -31.759 29.802  1.00 61.93  ? 83   ARG B CB  1 
ATOM   5018 C  CG  . ARG B 2 83  ? 37.701  -30.467 29.738  1.00 75.27  ? 83   ARG B CG  1 
ATOM   5019 C  CD  . ARG B 2 83  ? 36.202  -30.675 29.843  1.00 77.71  ? 83   ARG B CD  1 
ATOM   5020 N  NE  . ARG B 2 83  ? 35.487  -29.457 29.462  1.00 66.56  ? 83   ARG B NE  1 
ATOM   5021 C  CZ  . ARG B 2 83  ? 34.658  -28.784 30.256  1.00 53.91  ? 83   ARG B CZ  1 
ATOM   5022 N  NH1 . ARG B 2 83  ? 34.413  -29.196 31.497  1.00 42.12  ? 83   ARG B NH1 1 
ATOM   5023 N  NH2 . ARG B 2 83  ? 34.096  -27.669 29.815  1.00 48.67  ? 83   ARG B NH2 1 
ATOM   5024 N  N   . THR B 2 84  ? 40.958  -33.599 28.377  1.00 59.05  ? 84   THR B N   1 
ATOM   5025 C  CA  . THR B 2 84  ? 41.687  -34.856 28.462  1.00 64.65  ? 84   THR B CA  1 
ATOM   5026 C  C   . THR B 2 84  ? 43.186  -34.629 28.628  1.00 72.77  ? 84   THR B C   1 
ATOM   5027 O  O   . THR B 2 84  ? 43.778  -33.773 27.966  1.00 70.85  ? 84   THR B O   1 
ATOM   5028 C  CB  . THR B 2 84  ? 41.454  -35.741 27.221  1.00 57.53  ? 84   THR B CB  1 
ATOM   5029 O  OG1 . THR B 2 84  ? 40.050  -35.916 27.004  1.00 35.99  ? 84   THR B OG1 1 
ATOM   5030 C  CG2 . THR B 2 84  ? 42.077  -37.107 27.432  1.00 63.11  ? 84   THR B CG2 1 
ATOM   5031 N  N   . GLN B 2 85  ? 43.788  -35.411 29.520  1.00 82.00  ? 85   GLN B N   1 
ATOM   5032 C  CA  . GLN B 2 85  ? 45.218  -35.337 29.799  1.00 89.16  ? 85   GLN B CA  1 
ATOM   5033 C  C   . GLN B 2 85  ? 46.037  -35.419 28.510  1.00 94.75  ? 85   GLN B C   1 
ATOM   5034 O  O   . GLN B 2 85  ? 45.539  -35.850 27.468  1.00 90.81  ? 85   GLN B O   1 
ATOM   5035 C  CB  . GLN B 2 85  ? 45.621  -36.488 30.728  1.00 91.38  ? 85   GLN B CB  1 
ATOM   5036 C  CG  . GLN B 2 85  ? 45.449  -37.868 30.094  1.00 99.96  ? 85   GLN B CG  1 
ATOM   5037 C  CD  . GLN B 2 85  ? 45.714  -39.009 31.057  1.00 106.24 ? 85   GLN B CD  1 
ATOM   5038 O  OE1 . GLN B 2 85  ? 45.138  -39.066 32.143  1.00 105.13 ? 85   GLN B OE1 1 
ATOM   5039 N  NE2 . GLN B 2 85  ? 46.581  -39.933 30.657  1.00 111.88 ? 85   GLN B NE2 1 
ATOM   5040 N  N   . ASP B 2 86  ? 47.296  -35.002 28.588  1.00 106.58 ? 86   ASP B N   1 
ATOM   5041 C  CA  . ASP B 2 86  ? 48.182  -35.053 27.431  1.00 116.63 ? 86   ASP B CA  1 
ATOM   5042 C  C   . ASP B 2 86  ? 48.990  -36.339 27.456  1.00 119.18 ? 86   ASP B C   1 
ATOM   5043 O  O   . ASP B 2 86  ? 49.264  -36.893 28.524  1.00 116.50 ? 86   ASP B O   1 
ATOM   5044 C  CB  . ASP B 2 86  ? 49.133  -33.851 27.403  1.00 121.24 ? 86   ASP B CB  1 
ATOM   5045 C  CG  . ASP B 2 86  ? 48.426  -32.554 27.058  1.00 129.49 ? 86   ASP B CG  1 
ATOM   5046 O  OD1 . ASP B 2 86  ? 47.711  -32.508 26.030  1.00 132.57 ? 86   ASP B OD1 1 
ATOM   5047 O  OD2 . ASP B 2 86  ? 48.589  -31.579 27.818  1.00 134.11 ? 86   ASP B OD2 1 
ATOM   5048 N  N   . PHE B 2 87  ? 49.370  -36.805 26.273  1.00 123.96 ? 87   PHE B N   1 
ATOM   5049 C  CA  . PHE B 2 87  ? 50.158  -38.019 26.137  1.00 128.05 ? 87   PHE B CA  1 
ATOM   5050 C  C   . PHE B 2 87  ? 51.571  -37.606 25.746  1.00 132.16 ? 87   PHE B C   1 
ATOM   5051 O  O   . PHE B 2 87  ? 52.192  -38.156 24.828  1.00 130.76 ? 87   PHE B O   1 
ATOM   5052 C  CB  . PHE B 2 87  ? 49.484  -38.952 25.137  1.00 127.55 ? 87   PHE B CB  1 
ATOM   5053 C  CG  . PHE B 2 87  ? 48.071  -39.289 25.521  1.00 129.63 ? 87   PHE B CG  1 
ATOM   5054 C  CD1 . PHE B 2 87  ? 47.819  -40.159 26.577  1.00 132.60 ? 87   PHE B CD1 1 
ATOM   5055 C  CD2 . PHE B 2 87  ? 46.995  -38.678 24.884  1.00 130.32 ? 87   PHE B CD2 1 
ATOM   5056 C  CE1 . PHE B 2 87  ? 46.517  -40.412 26.997  1.00 135.01 ? 87   PHE B CE1 1 
ATOM   5057 C  CE2 . PHE B 2 87  ? 45.687  -38.924 25.296  1.00 130.41 ? 87   PHE B CE2 1 
ATOM   5058 C  CZ  . PHE B 2 87  ? 45.448  -39.792 26.355  1.00 134.12 ? 87   PHE B CZ  1 
ATOM   5059 N  N   . TRP B 2 88  ? 52.024  -36.605 26.505  1.00 136.19 ? 88   TRP B N   1 
ATOM   5060 C  CA  . TRP B 2 88  ? 53.325  -35.944 26.448  1.00 135.32 ? 88   TRP B CA  1 
ATOM   5061 C  C   . TRP B 2 88  ? 53.841  -35.328 25.146  1.00 132.25 ? 88   TRP B C   1 
ATOM   5062 O  O   . TRP B 2 88  ? 54.031  -34.090 25.153  1.00 130.76 ? 88   TRP B O   1 
ATOM   5063 C  CB  . TRP B 2 88  ? 54.379  -36.785 27.184  1.00 135.84 ? 88   TRP B CB  1 
ATOM   5064 C  CG  . TRP B 2 88  ? 54.214  -36.662 28.688  1.00 134.91 ? 88   TRP B CG  1 
ATOM   5065 C  CD1 . TRP B 2 88  ? 54.908  -35.826 29.517  1.00 135.59 ? 88   TRP B CD1 1 
ATOM   5066 C  CD2 . TRP B 2 88  ? 53.214  -37.296 29.512  1.00 134.81 ? 88   TRP B CD2 1 
ATOM   5067 N  NE1 . TRP B 2 88  ? 54.394  -35.883 30.792  1.00 135.48 ? 88   TRP B NE1 1 
ATOM   5068 C  CE2 . TRP B 2 88  ? 53.357  -36.776 30.818  1.00 134.82 ? 88   TRP B CE2 1 
ATOM   5069 C  CE3 . TRP B 2 88  ? 52.208  -38.242 29.267  1.00 134.80 ? 88   TRP B CE3 1 
ATOM   5070 C  CZ2 . TRP B 2 88  ? 52.531  -37.170 31.880  1.00 132.67 ? 88   TRP B CZ2 1 
ATOM   5071 C  CZ3 . TRP B 2 88  ? 51.384  -38.633 30.326  1.00 130.56 ? 88   TRP B CZ3 1 
ATOM   5072 C  CH2 . TRP B 2 88  ? 51.553  -38.096 31.614  1.00 130.54 ? 88   TRP B CH2 1 
ATOM   5073 N  N   . GLY B 2 93  ? 50.654  -38.278 19.721  1.00 102.32 ? 93   GLY B N   1 
ATOM   5074 C  CA  . GLY B 2 93  ? 50.588  -37.895 18.284  1.00 102.76 ? 93   GLY B CA  1 
ATOM   5075 C  C   . GLY B 2 93  ? 51.944  -38.095 17.641  1.00 105.91 ? 93   GLY B C   1 
ATOM   5076 O  O   . GLY B 2 93  ? 52.908  -38.420 18.333  1.00 107.26 ? 93   GLY B O   1 
ATOM   5077 N  N   . ILE B 2 94  ? 52.014  -37.927 16.324  1.00 107.46 ? 94   ILE B N   1 
ATOM   5078 C  CA  . ILE B 2 94  ? 53.267  -38.094 15.589  1.00 108.13 ? 94   ILE B CA  1 
ATOM   5079 C  C   . ILE B 2 94  ? 53.833  -36.739 15.153  1.00 107.11 ? 94   ILE B C   1 
ATOM   5080 O  O   . ILE B 2 94  ? 53.072  -35.802 14.898  1.00 110.85 ? 94   ILE B O   1 
ATOM   5081 C  CB  . ILE B 2 94  ? 53.075  -39.011 14.337  1.00 106.73 ? 94   ILE B CB  1 
ATOM   5082 C  CG1 . ILE B 2 94  ? 51.946  -38.483 13.439  1.00 97.71  ? 94   ILE B CG1 1 
ATOM   5083 C  CG2 . ILE B 2 94  ? 52.799  -40.449 14.774  1.00 109.24 ? 94   ILE B CG2 1 
ATOM   5084 C  CD1 . ILE B 2 94  ? 51.732  -39.289 12.160  1.00 81.12  ? 94   ILE B CD1 1 
ATOM   5085 N  N   . PRO B 2 95  ? 55.175  -36.604 15.105  1.00 103.26 ? 95   PRO B N   1 
ATOM   5086 C  CA  . PRO B 2 95  ? 55.826  -35.351 14.695  1.00 95.08  ? 95   PRO B CA  1 
ATOM   5087 C  C   . PRO B 2 95  ? 55.500  -35.058 13.237  1.00 86.68  ? 95   PRO B C   1 
ATOM   5088 O  O   . PRO B 2 95  ? 55.615  -35.932 12.376  1.00 84.05  ? 95   PRO B O   1 
ATOM   5089 C  CB  . PRO B 2 95  ? 57.311  -35.658 14.888  1.00 99.47  ? 95   PRO B CB  1 
ATOM   5090 C  CG  . PRO B 2 95  ? 57.385  -37.132 14.626  1.00 104.09 ? 95   PRO B CG  1 
ATOM   5091 C  CD  . PRO B 2 95  ? 56.182  -37.641 15.389  1.00 105.56 ? 95   PRO B CD  1 
ATOM   5092 N  N   . HIS B 2 96  ? 55.113  -33.820 12.958  1.00 82.07  ? 96   HIS B N   1 
ATOM   5093 C  CA  . HIS B 2 96  ? 54.731  -33.447 11.604  1.00 77.12  ? 96   HIS B CA  1 
ATOM   5094 C  C   . HIS B 2 96  ? 55.812  -33.570 10.535  1.00 71.86  ? 96   HIS B C   1 
ATOM   5095 O  O   . HIS B 2 96  ? 56.852  -32.901 10.592  1.00 65.71  ? 96   HIS B O   1 
ATOM   5096 C  CB  . HIS B 2 96  ? 54.119  -32.046 11.566  1.00 73.63  ? 96   HIS B CB  1 
ATOM   5097 C  CG  . HIS B 2 96  ? 53.254  -31.806 10.368  1.00 70.51  ? 96   HIS B CG  1 
ATOM   5098 N  ND1 . HIS B 2 96  ? 51.926  -32.171 10.329  1.00 70.22  ? 96   HIS B ND1 1 
ATOM   5099 C  CD2 . HIS B 2 96  ? 53.529  -31.262 9.156   1.00 72.61  ? 96   HIS B CD2 1 
ATOM   5100 C  CE1 . HIS B 2 96  ? 51.419  -31.866 9.150   1.00 71.31  ? 96   HIS B CE1 1 
ATOM   5101 N  NE2 . HIS B 2 96  ? 52.370  -31.312 8.419   1.00 72.69  ? 96   HIS B NE2 1 
ATOM   5102 N  N   . PRO B 2 97  ? 55.552  -34.416 9.522   1.00 68.39  ? 97   PRO B N   1 
ATOM   5103 C  CA  . PRO B 2 97  ? 56.460  -34.663 8.402   1.00 63.29  ? 97   PRO B CA  1 
ATOM   5104 C  C   . PRO B 2 97  ? 56.432  -33.464 7.472   1.00 58.03  ? 97   PRO B C   1 
ATOM   5105 O  O   . PRO B 2 97  ? 55.531  -33.327 6.636   1.00 55.10  ? 97   PRO B O   1 
ATOM   5106 C  CB  . PRO B 2 97  ? 55.849  -35.894 7.740   1.00 62.84  ? 97   PRO B CB  1 
ATOM   5107 C  CG  . PRO B 2 97  ? 54.388  -35.699 7.971   1.00 60.98  ? 97   PRO B CG  1 
ATOM   5108 C  CD  . PRO B 2 97  ? 54.349  -35.264 9.412   1.00 65.14  ? 97   PRO B CD  1 
ATOM   5109 N  N   . ALA B 2 98  ? 57.408  -32.582 7.640   1.00 54.43  ? 98   ALA B N   1 
ATOM   5110 C  CA  . ALA B 2 98  ? 57.494  -31.387 6.818   1.00 54.29  ? 98   ALA B CA  1 
ATOM   5111 C  C   . ALA B 2 98  ? 57.372  -31.705 5.317   1.00 49.75  ? 98   ALA B C   1 
ATOM   5112 O  O   . ALA B 2 98  ? 56.779  -30.938 4.560   1.00 49.00  ? 98   ALA B O   1 
ATOM   5113 C  CB  . ALA B 2 98  ? 58.793  -30.649 7.114   1.00 54.80  ? 98   ALA B CB  1 
ATOM   5114 N  N   . GLY B 2 99  ? 57.864  -32.870 4.905   1.00 46.23  ? 99   GLY B N   1 
ATOM   5115 C  CA  . GLY B 2 99  ? 57.806  -33.246 3.499   1.00 52.20  ? 99   GLY B CA  1 
ATOM   5116 C  C   . GLY B 2 99  ? 56.426  -33.280 2.865   1.00 51.21  ? 99   GLY B C   1 
ATOM   5117 O  O   . GLY B 2 99  ? 56.276  -33.042 1.663   1.00 39.50  ? 99   GLY B O   1 
ATOM   5118 N  N   . LEU B 2 100 ? 55.420  -33.554 3.687   1.00 60.09  ? 100  LEU B N   1 
ATOM   5119 C  CA  . LEU B 2 100 ? 54.038  -33.640 3.243   1.00 69.24  ? 100  LEU B CA  1 
ATOM   5120 C  C   . LEU B 2 100 ? 53.609  -32.452 2.370   1.00 66.49  ? 100  LEU B C   1 
ATOM   5121 O  O   . LEU B 2 100 ? 53.072  -32.643 1.277   1.00 69.80  ? 100  LEU B O   1 
ATOM   5122 C  CB  . LEU B 2 100 ? 53.112  -33.771 4.462   1.00 81.71  ? 100  LEU B CB  1 
ATOM   5123 C  CG  . LEU B 2 100 ? 51.680  -34.296 4.266   1.00 89.31  ? 100  LEU B CG  1 
ATOM   5124 C  CD1 . LEU B 2 100 ? 51.694  -35.733 3.743   1.00 94.09  ? 100  LEU B CD1 1 
ATOM   5125 C  CD2 . LEU B 2 100 ? 50.922  -34.228 5.585   1.00 85.43  ? 100  LEU B CD2 1 
ATOM   5126 N  N   . LYS B 2 101 ? 53.891  -31.235 2.824   1.00 57.74  ? 101  LYS B N   1 
ATOM   5127 C  CA  . LYS B 2 101 ? 53.505  -30.040 2.071   1.00 55.54  ? 101  LYS B CA  1 
ATOM   5128 C  C   . LYS B 2 101 ? 54.141  -29.930 0.685   1.00 54.98  ? 101  LYS B C   1 
ATOM   5129 O  O   . LYS B 2 101 ? 53.618  -29.236 -0.191  1.00 41.46  ? 101  LYS B O   1 
ATOM   5130 C  CB  . LYS B 2 101 ? 53.783  -28.773 2.887   1.00 48.78  ? 101  LYS B CB  1 
ATOM   5131 C  CG  . LYS B 2 101 ? 55.030  -28.856 3.724   1.00 34.66  ? 101  LYS B CG  1 
ATOM   5132 C  CD  . LYS B 2 101 ? 55.316  -27.570 4.448   1.00 32.33  ? 101  LYS B CD  1 
ATOM   5133 C  CE  . LYS B 2 101 ? 56.306  -27.801 5.593   1.00 37.28  ? 101  LYS B CE  1 
ATOM   5134 N  NZ  . LYS B 2 101 ? 55.685  -28.522 6.751   1.00 40.37  ? 101  LYS B NZ  1 
ATOM   5135 N  N   . LYS B 2 102 ? 55.252  -30.634 0.486   1.00 62.85  ? 102  LYS B N   1 
ATOM   5136 C  CA  . LYS B 2 102 ? 55.964  -30.617 -0.789  1.00 66.30  ? 102  LYS B CA  1 
ATOM   5137 C  C   . LYS B 2 102 ? 55.581  -31.791 -1.664  1.00 65.97  ? 102  LYS B C   1 
ATOM   5138 O  O   . LYS B 2 102 ? 56.363  -32.241 -2.496  1.00 69.04  ? 102  LYS B O   1 
ATOM   5139 C  CB  . LYS B 2 102 ? 57.471  -30.628 -0.552  1.00 65.70  ? 102  LYS B CB  1 
ATOM   5140 C  CG  . LYS B 2 102 ? 58.010  -29.313 -0.039  1.00 76.62  ? 102  LYS B CG  1 
ATOM   5141 C  CD  . LYS B 2 102 ? 59.374  -29.488 0.598   1.00 83.08  ? 102  LYS B CD  1 
ATOM   5142 C  CE  . LYS B 2 102 ? 59.270  -30.238 1.915   1.00 81.79  ? 102  LYS B CE  1 
ATOM   5143 N  NZ  . LYS B 2 102 ? 60.610  -30.497 2.515   1.00 78.78  ? 102  LYS B NZ  1 
ATOM   5144 N  N   . LYS B 2 103 ? 54.367  -32.282 -1.484  1.00 65.12  ? 103  LYS B N   1 
ATOM   5145 C  CA  . LYS B 2 103 ? 53.902  -33.404 -2.265  1.00 69.58  ? 103  LYS B CA  1 
ATOM   5146 C  C   . LYS B 2 103 ? 52.926  -32.930 -3.335  1.00 71.96  ? 103  LYS B C   1 
ATOM   5147 O  O   . LYS B 2 103 ? 52.144  -32.008 -3.106  1.00 66.87  ? 103  LYS B O   1 
ATOM   5148 C  CB  . LYS B 2 103 ? 53.273  -34.435 -1.338  1.00 74.57  ? 103  LYS B CB  1 
ATOM   5149 C  CG  . LYS B 2 103 ? 54.289  -35.105 -0.416  1.00 78.99  ? 103  LYS B CG  1 
ATOM   5150 C  CD  . LYS B 2 103 ? 55.244  -35.987 -1.212  1.00 85.49  ? 103  LYS B CD  1 
ATOM   5151 C  CE  . LYS B 2 103 ? 56.254  -36.680 -0.322  1.00 85.75  ? 103  LYS B CE  1 
ATOM   5152 N  NZ  . LYS B 2 103 ? 57.154  -35.696 0.330   1.00 94.86  ? 103  LYS B NZ  1 
ATOM   5153 N  N   . LYS B 2 104 ? 53.010  -33.533 -4.518  1.00 79.45  ? 104  LYS B N   1 
ATOM   5154 C  CA  . LYS B 2 104 ? 52.149  -33.163 -5.640  1.00 87.40  ? 104  LYS B CA  1 
ATOM   5155 C  C   . LYS B 2 104 ? 50.661  -33.389 -5.377  1.00 93.54  ? 104  LYS B C   1 
ATOM   5156 O  O   . LYS B 2 104 ? 49.835  -32.532 -5.711  1.00 101.32 ? 104  LYS B O   1 
ATOM   5157 C  CB  . LYS B 2 104 ? 52.563  -33.906 -6.917  1.00 87.08  ? 104  LYS B CB  1 
ATOM   5158 C  CG  . LYS B 2 104 ? 53.929  -33.528 -7.466  1.00 90.90  ? 104  LYS B CG  1 
ATOM   5159 C  CD  . LYS B 2 104 ? 54.279  -34.377 -8.679  1.00 92.77  ? 104  LYS B CD  1 
ATOM   5160 C  CE  . LYS B 2 104 ? 55.693  -34.109 -9.164  1.00 90.63  ? 104  LYS B CE  1 
ATOM   5161 N  NZ  . LYS B 2 104 ? 56.028  -34.971 -10.326 1.00 92.11  ? 104  LYS B NZ  1 
ATOM   5162 N  N   . SER B 2 105 ? 50.318  -34.525 -4.772  1.00 89.76  ? 105  SER B N   1 
ATOM   5163 C  CA  . SER B 2 105 ? 48.917  -34.836 -4.492  1.00 81.54  ? 105  SER B CA  1 
ATOM   5164 C  C   . SER B 2 105 ? 48.705  -35.642 -3.215  1.00 77.17  ? 105  SER B C   1 
ATOM   5165 O  O   . SER B 2 105 ? 49.300  -36.710 -3.036  1.00 77.64  ? 105  SER B O   1 
ATOM   5166 C  CB  . SER B 2 105 ? 48.310  -35.602 -5.668  1.00 79.00  ? 105  SER B CB  1 
ATOM   5167 O  OG  . SER B 2 105 ? 48.443  -34.881 -6.880  1.00 67.52  ? 105  SER B OG  1 
ATOM   5168 N  N   . VAL B 2 106 ? 47.843  -35.136 -2.337  1.00 71.46  ? 106  VAL B N   1 
ATOM   5169 C  CA  . VAL B 2 106 ? 47.534  -35.822 -1.088  1.00 63.72  ? 106  VAL B CA  1 
ATOM   5170 C  C   . VAL B 2 106 ? 46.073  -36.271 -1.113  1.00 52.97  ? 106  VAL B C   1 
ATOM   5171 O  O   . VAL B 2 106 ? 45.252  -35.741 -1.873  1.00 44.46  ? 106  VAL B O   1 
ATOM   5172 C  CB  . VAL B 2 106 ? 47.790  -34.916 0.148   1.00 64.86  ? 106  VAL B CB  1 
ATOM   5173 C  CG1 . VAL B 2 106 ? 47.553  -35.689 1.450   1.00 60.33  ? 106  VAL B CG1 1 
ATOM   5174 C  CG2 . VAL B 2 106 ? 49.207  -34.366 0.108   1.00 61.43  ? 106  VAL B CG2 1 
ATOM   5175 N  N   . THR B 2 107 ? 45.778  -37.294 -0.325  1.00 47.99  ? 107  THR B N   1 
ATOM   5176 C  CA  . THR B 2 107 ? 44.434  -37.830 -0.227  1.00 43.34  ? 107  THR B CA  1 
ATOM   5177 C  C   . THR B 2 107 ? 44.152  -38.115 1.239   1.00 37.83  ? 107  THR B C   1 
ATOM   5178 O  O   . THR B 2 107 ? 45.056  -38.477 1.992   1.00 29.74  ? 107  THR B O   1 
ATOM   5179 C  CB  . THR B 2 107 ? 44.291  -39.110 -1.079  1.00 33.81  ? 107  THR B CB  1 
ATOM   5180 O  OG1 . THR B 2 107 ? 44.626  -38.798 -2.437  1.00 28.85  ? 107  THR B OG1 1 
ATOM   5181 C  CG2 . THR B 2 107 ? 42.864  -39.648 -1.027  1.00 24.89  ? 107  THR B CG2 1 
ATOM   5182 N  N   . VAL B 2 108 ? 42.907  -37.913 1.647   1.00 37.87  ? 108  VAL B N   1 
ATOM   5183 C  CA  . VAL B 2 108 ? 42.532  -38.140 3.036   1.00 43.30  ? 108  VAL B CA  1 
ATOM   5184 C  C   . VAL B 2 108 ? 41.676  -39.386 3.179   1.00 45.75  ? 108  VAL B C   1 
ATOM   5185 O  O   . VAL B 2 108 ? 40.938  -39.746 2.258   1.00 52.77  ? 108  VAL B O   1 
ATOM   5186 C  CB  . VAL B 2 108 ? 41.734  -36.949 3.605   1.00 39.73  ? 108  VAL B CB  1 
ATOM   5187 C  CG1 . VAL B 2 108 ? 41.669  -37.045 5.136   1.00 27.28  ? 108  VAL B CG1 1 
ATOM   5188 C  CG2 . VAL B 2 108 ? 42.337  -35.633 3.130   1.00 21.48  ? 108  VAL B CG2 1 
ATOM   5189 N  N   . LEU B 2 109 ? 41.733  -40.002 4.354   1.00 43.75  ? 109  LEU B N   1 
ATOM   5190 C  CA  . LEU B 2 109 ? 40.960  -41.201 4.637   1.00 41.40  ? 109  LEU B CA  1 
ATOM   5191 C  C   . LEU B 2 109 ? 40.473  -41.187 6.077   1.00 30.25  ? 109  LEU B C   1 
ATOM   5192 O  O   . LEU B 2 109 ? 41.187  -40.765 6.998   1.00 2.00   ? 109  LEU B O   1 
ATOM   5193 C  CB  . LEU B 2 109 ? 41.806  -42.454 4.407   1.00 62.01  ? 109  LEU B CB  1 
ATOM   5194 C  CG  . LEU B 2 109 ? 42.413  -42.675 3.018   1.00 74.40  ? 109  LEU B CG  1 
ATOM   5195 C  CD1 . LEU B 2 109 ? 43.229  -43.955 3.025   1.00 77.71  ? 109  LEU B CD1 1 
ATOM   5196 C  CD2 . LEU B 2 109 ? 41.323  -42.745 1.958   1.00 75.86  ? 109  LEU B CD2 1 
ATOM   5197 N  N   . ASP B 2 110 ? 39.249  -41.662 6.262   1.00 37.56  ? 110  ASP B N   1 
ATOM   5198 C  CA  . ASP B 2 110 ? 38.662  -41.704 7.584   1.00 42.28  ? 110  ASP B CA  1 
ATOM   5199 C  C   . ASP B 2 110 ? 38.932  -43.041 8.225   1.00 42.87  ? 110  ASP B C   1 
ATOM   5200 O  O   . ASP B 2 110 ? 38.212  -44.014 8.003   1.00 46.38  ? 110  ASP B O   1 
ATOM   5201 C  CB  . ASP B 2 110 ? 37.159  -41.452 7.534   1.00 54.25  ? 110  ASP B CB  1 
ATOM   5202 C  CG  . ASP B 2 110 ? 36.516  -41.501 8.914   1.00 66.33  ? 110  ASP B CG  1 
ATOM   5203 O  OD1 . ASP B 2 110 ? 37.052  -40.869 9.852   1.00 68.35  ? 110  ASP B OD1 1 
ATOM   5204 O  OD2 . ASP B 2 110 ? 35.481  -42.184 9.066   1.00 70.45  ? 110  ASP B OD2 1 
ATOM   5205 N  N   . VAL B 2 111 ? 39.979  -43.077 9.026   1.00 41.90  ? 111  VAL B N   1 
ATOM   5206 C  CA  . VAL B 2 111 ? 40.364  -44.287 9.721   1.00 47.97  ? 111  VAL B CA  1 
ATOM   5207 C  C   . VAL B 2 111 ? 39.848  -44.306 11.161  1.00 43.18  ? 111  VAL B C   1 
ATOM   5208 O  O   . VAL B 2 111 ? 40.356  -45.045 12.008  1.00 48.51  ? 111  VAL B O   1 
ATOM   5209 C  CB  . VAL B 2 111 ? 41.888  -44.425 9.712   1.00 61.71  ? 111  VAL B CB  1 
ATOM   5210 C  CG1 . VAL B 2 111 ? 42.388  -44.341 8.275   1.00 61.09  ? 111  VAL B CG1 1 
ATOM   5211 C  CG2 . VAL B 2 111 ? 42.532  -43.335 10.590  1.00 71.04  ? 111  VAL B CG2 1 
ATOM   5212 N  N   . GLY B 2 112 ? 38.825  -43.509 11.434  1.00 31.73  ? 112  GLY B N   1 
ATOM   5213 C  CA  . GLY B 2 112 ? 38.283  -43.465 12.777  1.00 32.90  ? 112  GLY B CA  1 
ATOM   5214 C  C   . GLY B 2 112 ? 37.569  -44.745 13.164  1.00 34.38  ? 112  GLY B C   1 
ATOM   5215 O  O   . GLY B 2 112 ? 37.473  -45.090 14.344  1.00 29.77  ? 112  GLY B O   1 
ATOM   5216 N  N   . ASP B 2 113 ? 37.114  -45.476 12.157  1.00 40.39  ? 113  ASP B N   1 
ATOM   5217 C  CA  . ASP B 2 113 ? 36.380  -46.721 12.350  1.00 54.20  ? 113  ASP B CA  1 
ATOM   5218 C  C   . ASP B 2 113 ? 37.078  -47.814 13.167  1.00 62.22  ? 113  ASP B C   1 
ATOM   5219 O  O   . ASP B 2 113 ? 36.425  -48.590 13.865  1.00 64.56  ? 113  ASP B O   1 
ATOM   5220 C  CB  . ASP B 2 113 ? 35.959  -47.241 10.985  1.00 56.33  ? 113  ASP B CB  1 
ATOM   5221 C  CG  . ASP B 2 113 ? 35.302  -46.163 10.155  1.00 59.01  ? 113  ASP B CG  1 
ATOM   5222 O  OD1 . ASP B 2 113 ? 36.039  -45.341 9.557   1.00 29.81  ? 113  ASP B OD1 1 
ATOM   5223 O  OD2 . ASP B 2 113 ? 34.053  -46.109 10.149  1.00 73.28  ? 113  ASP B OD2 1 
ATOM   5224 N  N   . ALA B 2 114 ? 38.403  -47.835 13.128  1.00 65.26  ? 114  ALA B N   1 
ATOM   5225 C  CA  . ALA B 2 114 ? 39.172  -48.829 13.866  1.00 63.64  ? 114  ALA B CA  1 
ATOM   5226 C  C   . ALA B 2 114 ? 39.075  -48.722 15.398  1.00 62.01  ? 114  ALA B C   1 
ATOM   5227 O  O   . ALA B 2 114 ? 39.221  -49.721 16.101  1.00 62.97  ? 114  ALA B O   1 
ATOM   5228 C  CB  . ALA B 2 114 ? 40.619  -48.764 13.431  1.00 65.45  ? 114  ALA B CB  1 
ATOM   5229 N  N   . TYR B 2 115 ? 38.769  -47.532 15.905  1.00 63.60  ? 115  TYR B N   1 
ATOM   5230 C  CA  . TYR B 2 115 ? 38.691  -47.284 17.347  1.00 67.75  ? 115  TYR B CA  1 
ATOM   5231 C  C   . TYR B 2 115 ? 37.795  -48.201 18.170  1.00 72.06  ? 115  TYR B C   1 
ATOM   5232 O  O   . TYR B 2 115 ? 38.164  -48.601 19.276  1.00 70.38  ? 115  TYR B O   1 
ATOM   5233 C  CB  . TYR B 2 115 ? 38.311  -45.827 17.602  1.00 70.18  ? 115  TYR B CB  1 
ATOM   5234 C  CG  . TYR B 2 115 ? 39.276  -44.853 16.976  1.00 77.30  ? 115  TYR B CG  1 
ATOM   5235 C  CD1 . TYR B 2 115 ? 40.602  -45.215 16.744  1.00 75.70  ? 115  TYR B CD1 1 
ATOM   5236 C  CD2 . TYR B 2 115 ? 38.866  -43.581 16.591  1.00 78.61  ? 115  TYR B CD2 1 
ATOM   5237 C  CE1 . TYR B 2 115 ? 41.492  -44.340 16.147  1.00 73.79  ? 115  TYR B CE1 1 
ATOM   5238 C  CE2 . TYR B 2 115 ? 39.755  -42.696 15.989  1.00 80.98  ? 115  TYR B CE2 1 
ATOM   5239 C  CZ  . TYR B 2 115 ? 41.067  -43.085 15.771  1.00 75.98  ? 115  TYR B CZ  1 
ATOM   5240 O  OH  . TYR B 2 115 ? 41.962  -42.228 15.181  1.00 74.34  ? 115  TYR B OH  1 
ATOM   5241 N  N   . PHE B 2 116 ? 36.631  -48.543 17.625  1.00 77.19  ? 116  PHE B N   1 
ATOM   5242 C  CA  . PHE B 2 116 ? 35.676  -49.410 18.316  1.00 77.65  ? 116  PHE B CA  1 
ATOM   5243 C  C   . PHE B 2 116 ? 36.361  -50.672 18.829  1.00 67.97  ? 116  PHE B C   1 
ATOM   5244 O  O   . PHE B 2 116 ? 36.127  -51.120 19.943  1.00 64.56  ? 116  PHE B O   1 
ATOM   5245 C  CB  . PHE B 2 116 ? 34.514  -49.791 17.374  1.00 92.20  ? 116  PHE B CB  1 
ATOM   5246 C  CG  . PHE B 2 116 ? 34.798  -50.986 16.475  1.00 106.60 ? 116  PHE B CG  1 
ATOM   5247 C  CD1 . PHE B 2 116 ? 35.713  -50.898 15.426  1.00 111.81 ? 116  PHE B CD1 1 
ATOM   5248 C  CD2 . PHE B 2 116 ? 34.138  -52.199 16.681  1.00 110.12 ? 116  PHE B CD2 1 
ATOM   5249 C  CE1 . PHE B 2 116 ? 35.966  -51.996 14.595  1.00 115.03 ? 116  PHE B CE1 1 
ATOM   5250 C  CE2 . PHE B 2 116 ? 34.383  -53.302 15.858  1.00 113.64 ? 116  PHE B CE2 1 
ATOM   5251 C  CZ  . PHE B 2 116 ? 35.300  -53.199 14.813  1.00 117.38 ? 116  PHE B CZ  1 
ATOM   5252 N  N   . SER B 2 117 ? 37.256  -51.199 18.010  1.00 62.98  ? 117  SER B N   1 
ATOM   5253 C  CA  . SER B 2 117 ? 37.976  -52.413 18.322  1.00 60.81  ? 117  SER B CA  1 
ATOM   5254 C  C   . SER B 2 117 ? 38.621  -52.364 19.694  1.00 57.77  ? 117  SER B C   1 
ATOM   5255 O  O   . SER B 2 117 ? 38.688  -53.376 20.385  1.00 67.68  ? 117  SER B O   1 
ATOM   5256 C  CB  . SER B 2 117 ? 39.036  -52.647 17.251  1.00 63.64  ? 117  SER B CB  1 
ATOM   5257 O  OG  . SER B 2 117 ? 38.483  -52.412 15.965  1.00 58.99  ? 117  SER B OG  1 
ATOM   5258 N  N   . VAL B 2 118 ? 39.059  -51.180 20.100  1.00 48.68  ? 118  VAL B N   1 
ATOM   5259 C  CA  . VAL B 2 118 ? 39.720  -51.011 21.386  1.00 42.78  ? 118  VAL B CA  1 
ATOM   5260 C  C   . VAL B 2 118 ? 38.771  -50.505 22.464  1.00 42.67  ? 118  VAL B C   1 
ATOM   5261 O  O   . VAL B 2 118 ? 37.963  -49.598 22.226  1.00 40.86  ? 118  VAL B O   1 
ATOM   5262 C  CB  . VAL B 2 118 ? 40.897  -50.024 21.267  1.00 38.33  ? 118  VAL B CB  1 
ATOM   5263 C  CG1 . VAL B 2 118 ? 41.670  -49.928 22.587  1.00 2.00   ? 118  VAL B CG1 1 
ATOM   5264 C  CG2 . VAL B 2 118 ? 41.795  -50.420 20.104  1.00 41.71  ? 118  VAL B CG2 1 
ATOM   5265 N  N   . PRO B 2 119 ? 38.862  -51.091 23.668  1.00 40.53  ? 119  PRO B N   1 
ATOM   5266 C  CA  . PRO B 2 119 ? 38.027  -50.716 24.805  1.00 37.41  ? 119  PRO B CA  1 
ATOM   5267 C  C   . PRO B 2 119 ? 38.519  -49.423 25.419  1.00 35.54  ? 119  PRO B C   1 
ATOM   5268 O  O   . PRO B 2 119 ? 39.703  -49.088 25.336  1.00 39.39  ? 119  PRO B O   1 
ATOM   5269 C  CB  . PRO B 2 119 ? 38.245  -51.873 25.773  1.00 31.78  ? 119  PRO B CB  1 
ATOM   5270 C  CG  . PRO B 2 119 ? 39.689  -52.206 25.536  1.00 23.04  ? 119  PRO B CG  1 
ATOM   5271 C  CD  . PRO B 2 119 ? 39.742  -52.219 24.027  1.00 38.81  ? 119  PRO B CD  1 
ATOM   5272 N  N   . LEU B 2 120 ? 37.601  -48.714 26.052  1.00 32.93  ? 120  LEU B N   1 
ATOM   5273 C  CA  . LEU B 2 120 ? 37.918  -47.472 26.718  1.00 32.46  ? 120  LEU B CA  1 
ATOM   5274 C  C   . LEU B 2 120 ? 38.025  -47.781 28.207  1.00 28.99  ? 120  LEU B C   1 
ATOM   5275 O  O   . LEU B 2 120 ? 37.270  -48.605 28.721  1.00 24.12  ? 120  LEU B O   1 
ATOM   5276 C  CB  . LEU B 2 120 ? 36.796  -46.468 26.476  1.00 33.41  ? 120  LEU B CB  1 
ATOM   5277 C  CG  . LEU B 2 120 ? 36.789  -45.144 27.248  1.00 53.21  ? 120  LEU B CG  1 
ATOM   5278 C  CD1 . LEU B 2 120 ? 38.016  -44.301 26.936  1.00 49.02  ? 120  LEU B CD1 1 
ATOM   5279 C  CD2 . LEU B 2 120 ? 35.530  -44.382 26.894  1.00 64.03  ? 120  LEU B CD2 1 
ATOM   5280 N  N   . ASP B 2 121 ? 39.004  -47.183 28.884  1.00 29.13  ? 121  ASP B N   1 
ATOM   5281 C  CA  . ASP B 2 121 ? 39.141  -47.390 30.321  1.00 30.35  ? 121  ASP B CA  1 
ATOM   5282 C  C   . ASP B 2 121 ? 37.762  -47.149 30.946  1.00 28.89  ? 121  ASP B C   1 
ATOM   5283 O  O   . ASP B 2 121 ? 37.115  -46.123 30.699  1.00 11.22  ? 121  ASP B O   1 
ATOM   5284 C  CB  . ASP B 2 121 ? 40.169  -46.419 30.925  1.00 41.87  ? 121  ASP B CB  1 
ATOM   5285 C  CG  . ASP B 2 121 ? 40.085  -46.330 32.462  1.00 54.64  ? 121  ASP B CG  1 
ATOM   5286 O  OD1 . ASP B 2 121 ? 39.911  -47.372 33.136  1.00 59.87  ? 121  ASP B OD1 1 
ATOM   5287 O  OD2 . ASP B 2 121 ? 40.190  -45.206 33.001  1.00 55.61  ? 121  ASP B OD2 1 
ATOM   5288 N  N   . GLU B 2 122 ? 37.320  -48.116 31.738  1.00 37.75  ? 122  GLU B N   1 
ATOM   5289 C  CA  . GLU B 2 122 ? 36.033  -48.048 32.406  1.00 50.53  ? 122  GLU B CA  1 
ATOM   5290 C  C   . GLU B 2 122 ? 35.797  -46.747 33.183  1.00 49.34  ? 122  GLU B C   1 
ATOM   5291 O  O   . GLU B 2 122 ? 34.712  -46.166 33.115  1.00 50.16  ? 122  GLU B O   1 
ATOM   5292 C  CB  . GLU B 2 122 ? 35.873  -49.250 33.344  1.00 71.21  ? 122  GLU B CB  1 
ATOM   5293 C  CG  . GLU B 2 122 ? 36.930  -49.336 34.451  1.00 88.55  ? 122  GLU B CG  1 
ATOM   5294 C  CD  . GLU B 2 122 ? 36.561  -50.319 35.554  1.00 98.36  ? 122  GLU B CD  1 
ATOM   5295 O  OE1 . GLU B 2 122 ? 35.451  -50.198 36.122  1.00 102.87 ? 122  GLU B OE1 1 
ATOM   5296 O  OE2 . GLU B 2 122 ? 37.387  -51.205 35.865  1.00 101.33 ? 122  GLU B OE2 1 
ATOM   5297 N  N   . ASP B 2 123 ? 36.812  -46.269 33.894  1.00 47.57  ? 123  ASP B N   1 
ATOM   5298 C  CA  . ASP B 2 123 ? 36.652  -45.052 34.680  1.00 48.71  ? 123  ASP B CA  1 
ATOM   5299 C  C   . ASP B 2 123 ? 36.480  -43.777 33.895  1.00 44.73  ? 123  ASP B C   1 
ATOM   5300 O  O   . ASP B 2 123 ? 36.040  -42.769 34.438  1.00 39.88  ? 123  ASP B O   1 
ATOM   5301 C  CB  . ASP B 2 123 ? 37.791  -44.899 35.678  1.00 58.82  ? 123  ASP B CB  1 
ATOM   5302 C  CG  . ASP B 2 123 ? 37.569  -45.722 36.925  1.00 69.84  ? 123  ASP B CG  1 
ATOM   5303 O  OD1 . ASP B 2 123 ? 36.593  -45.434 37.660  1.00 58.66  ? 123  ASP B OD1 1 
ATOM   5304 O  OD2 . ASP B 2 123 ? 38.357  -46.666 37.154  1.00 82.10  ? 123  ASP B OD2 1 
ATOM   5305 N  N   . PHE B 2 124 ? 36.785  -43.833 32.605  1.00 53.49  ? 124  PHE B N   1 
ATOM   5306 C  CA  . PHE B 2 124 ? 36.672  -42.662 31.747  1.00 55.23  ? 124  PHE B CA  1 
ATOM   5307 C  C   . PHE B 2 124 ? 35.336  -42.558 31.003  1.00 55.95  ? 124  PHE B C   1 
ATOM   5308 O  O   . PHE B 2 124 ? 34.876  -41.460 30.686  1.00 65.36  ? 124  PHE B O   1 
ATOM   5309 C  CB  . PHE B 2 124 ? 37.824  -42.638 30.743  1.00 55.54  ? 124  PHE B CB  1 
ATOM   5310 C  CG  . PHE B 2 124 ? 38.106  -41.272 30.178  1.00 66.29  ? 124  PHE B CG  1 
ATOM   5311 C  CD1 . PHE B 2 124 ? 38.697  -40.287 30.969  1.00 60.26  ? 124  PHE B CD1 1 
ATOM   5312 C  CD2 . PHE B 2 124 ? 37.789  -40.967 28.855  1.00 69.79  ? 124  PHE B CD2 1 
ATOM   5313 C  CE1 . PHE B 2 124 ? 38.968  -39.023 30.451  1.00 54.63  ? 124  PHE B CE1 1 
ATOM   5314 C  CE2 . PHE B 2 124 ? 38.056  -39.703 28.328  1.00 60.25  ? 124  PHE B CE2 1 
ATOM   5315 C  CZ  . PHE B 2 124 ? 38.647  -38.731 29.129  1.00 60.19  ? 124  PHE B CZ  1 
ATOM   5316 N  N   . ARG B 2 125 ? 34.693  -43.692 30.768  1.00 48.57  ? 125  ARG B N   1 
ATOM   5317 C  CA  . ARG B 2 125 ? 33.427  -43.733 30.042  1.00 40.65  ? 125  ARG B CA  1 
ATOM   5318 C  C   . ARG B 2 125 ? 32.333  -42.727 30.436  1.00 35.61  ? 125  ARG B C   1 
ATOM   5319 O  O   . ARG B 2 125 ? 31.597  -42.258 29.570  1.00 27.40  ? 125  ARG B O   1 
ATOM   5320 C  CB  . ARG B 2 125 ? 32.875  -45.154 30.068  1.00 45.28  ? 125  ARG B CB  1 
ATOM   5321 C  CG  . ARG B 2 125 ? 33.843  -46.184 29.518  1.00 50.04  ? 125  ARG B CG  1 
ATOM   5322 C  CD  . ARG B 2 125 ? 33.275  -47.576 29.627  1.00 60.68  ? 125  ARG B CD  1 
ATOM   5323 N  NE  . ARG B 2 125 ? 34.138  -48.555 28.980  1.00 72.81  ? 125  ARG B NE  1 
ATOM   5324 C  CZ  . ARG B 2 125 ? 34.411  -49.750 29.486  1.00 84.79  ? 125  ARG B CZ  1 
ATOM   5325 N  NH1 . ARG B 2 125 ? 33.884  -50.106 30.650  1.00 95.21  ? 125  ARG B NH1 1 
ATOM   5326 N  NH2 . ARG B 2 125 ? 35.206  -50.586 28.832  1.00 85.67  ? 125  ARG B NH2 1 
ATOM   5327 N  N   . LYS B 2 126 ? 32.215  -42.383 31.719  1.00 33.55  ? 126  LYS B N   1 
ATOM   5328 C  CA  . LYS B 2 126 ? 31.174  -41.426 32.156  1.00 24.48  ? 126  LYS B CA  1 
ATOM   5329 C  C   . LYS B 2 126 ? 31.301  -40.107 31.403  1.00 16.48  ? 126  LYS B C   1 
ATOM   5330 O  O   . LYS B 2 126 ? 30.312  -39.492 31.011  1.00 10.93  ? 126  LYS B O   1 
ATOM   5331 C  CB  . LYS B 2 126 ? 31.280  -41.152 33.662  1.00 10.73  ? 126  LYS B CB  1 
ATOM   5332 C  CG  . LYS B 2 126 ? 32.629  -40.597 34.063  1.00 2.00   ? 126  LYS B CG  1 
ATOM   5333 C  CD  . LYS B 2 126 ? 32.897  -40.759 35.540  1.00 12.09  ? 126  LYS B CD  1 
ATOM   5334 C  CE  . LYS B 2 126 ? 32.119  -39.750 36.321  1.00 31.02  ? 126  LYS B CE  1 
ATOM   5335 N  NZ  . LYS B 2 126 ? 32.510  -39.709 37.747  1.00 40.48  ? 126  LYS B NZ  1 
ATOM   5336 N  N   . TYR B 2 127 ? 32.545  -39.719 31.165  1.00 14.39  ? 127  TYR B N   1 
ATOM   5337 C  CA  . TYR B 2 127 ? 32.881  -38.479 30.484  1.00 8.07   ? 127  TYR B CA  1 
ATOM   5338 C  C   . TYR B 2 127 ? 32.531  -38.517 29.007  1.00 6.11   ? 127  TYR B C   1 
ATOM   5339 O  O   . TYR B 2 127 ? 32.634  -37.514 28.316  1.00 5.20   ? 127  TYR B O   1 
ATOM   5340 C  CB  . TYR B 2 127 ? 34.383  -38.194 30.672  1.00 2.00   ? 127  TYR B CB  1 
ATOM   5341 C  CG  . TYR B 2 127 ? 34.801  -38.193 32.124  1.00 2.22   ? 127  TYR B CG  1 
ATOM   5342 C  CD1 . TYR B 2 127 ? 34.018  -37.557 33.092  1.00 2.00   ? 127  TYR B CD1 1 
ATOM   5343 C  CD2 . TYR B 2 127 ? 35.959  -38.853 32.541  1.00 15.38  ? 127  TYR B CD2 1 
ATOM   5344 C  CE1 . TYR B 2 127 ? 34.376  -37.573 34.431  1.00 7.99   ? 127  TYR B CE1 1 
ATOM   5345 C  CE2 . TYR B 2 127 ? 36.331  -38.883 33.896  1.00 20.36  ? 127  TYR B CE2 1 
ATOM   5346 C  CZ  . TYR B 2 127 ? 35.534  -38.232 34.832  1.00 25.49  ? 127  TYR B CZ  1 
ATOM   5347 O  OH  . TYR B 2 127 ? 35.910  -38.188 36.156  1.00 31.43  ? 127  TYR B OH  1 
ATOM   5348 N  N   . THR B 2 128 ? 32.075  -39.663 28.525  1.00 6.57   ? 128  THR B N   1 
ATOM   5349 C  CA  . THR B 2 128 ? 31.744  -39.790 27.120  1.00 12.08  ? 128  THR B CA  1 
ATOM   5350 C  C   . THR B 2 128 ? 30.240  -39.637 26.895  1.00 6.33   ? 128  THR B C   1 
ATOM   5351 O  O   . THR B 2 128 ? 29.731  -39.782 25.768  1.00 7.67   ? 128  THR B O   1 
ATOM   5352 C  CB  . THR B 2 128 ? 32.249  -41.157 26.594  1.00 25.57  ? 128  THR B CB  1 
ATOM   5353 O  OG1 . THR B 2 128 ? 31.445  -42.206 27.137  1.00 39.38  ? 128  THR B OG1 1 
ATOM   5354 C  CG2 . THR B 2 128 ? 33.694  -41.408 27.063  1.00 2.67   ? 128  THR B CG2 1 
ATOM   5355 N  N   . ALA B 2 129 ? 29.541  -39.340 27.983  1.00 2.00   ? 129  ALA B N   1 
ATOM   5356 C  CA  . ALA B 2 129 ? 28.093  -39.186 27.967  1.00 20.81  ? 129  ALA B CA  1 
ATOM   5357 C  C   . ALA B 2 129 ? 27.561  -38.218 26.907  1.00 28.26  ? 129  ALA B C   1 
ATOM   5358 O  O   . ALA B 2 129 ? 27.956  -37.048 26.881  1.00 35.47  ? 129  ALA B O   1 
ATOM   5359 C  CB  . ALA B 2 129 ? 27.584  -38.783 29.374  1.00 8.95   ? 129  ALA B CB  1 
ATOM   5360 N  N   . PHE B 2 130 ? 26.662  -38.710 26.049  1.00 29.79  ? 130  PHE B N   1 
ATOM   5361 C  CA  . PHE B 2 130 ? 26.030  -37.900 24.997  1.00 36.08  ? 130  PHE B CA  1 
ATOM   5362 C  C   . PHE B 2 130 ? 24.510  -38.152 24.960  1.00 39.56  ? 130  PHE B C   1 
ATOM   5363 O  O   . PHE B 2 130 ? 24.021  -39.057 25.640  1.00 41.87  ? 130  PHE B O   1 
ATOM   5364 C  CB  . PHE B 2 130 ? 26.651  -38.185 23.641  1.00 32.29  ? 130  PHE B CB  1 
ATOM   5365 C  CG  . PHE B 2 130 ? 26.377  -39.555 23.135  1.00 38.20  ? 130  PHE B CG  1 
ATOM   5366 C  CD1 . PHE B 2 130 ? 27.047  -40.649 23.664  1.00 44.40  ? 130  PHE B CD1 1 
ATOM   5367 C  CD2 . PHE B 2 130 ? 25.454  -39.755 22.115  1.00 36.81  ? 130  PHE B CD2 1 
ATOM   5368 C  CE1 . PHE B 2 130 ? 26.799  -41.920 23.183  1.00 50.72  ? 130  PHE B CE1 1 
ATOM   5369 C  CE2 . PHE B 2 130 ? 25.197  -41.024 21.626  1.00 36.88  ? 130  PHE B CE2 1 
ATOM   5370 C  CZ  . PHE B 2 130 ? 25.867  -42.108 22.156  1.00 48.71  ? 130  PHE B CZ  1 
ATOM   5371 N  N   . THR B 2 131 ? 23.768  -37.388 24.156  1.00 39.05  ? 131  THR B N   1 
ATOM   5372 C  CA  . THR B 2 131 ? 22.308  -37.532 24.130  1.00 37.90  ? 131  THR B CA  1 
ATOM   5373 C  C   . THR B 2 131 ? 21.562  -37.338 22.800  1.00 41.20  ? 131  THR B C   1 
ATOM   5374 O  O   . THR B 2 131 ? 21.908  -36.472 21.997  1.00 39.07  ? 131  THR B O   1 
ATOM   5375 C  CB  . THR B 2 131 ? 21.669  -36.562 25.171  1.00 31.65  ? 131  THR B CB  1 
ATOM   5376 O  OG1 . THR B 2 131 ? 22.018  -36.974 26.502  1.00 27.93  ? 131  THR B OG1 1 
ATOM   5377 C  CG2 . THR B 2 131 ? 20.147  -36.508 25.027  1.00 18.12  ? 131  THR B CG2 1 
ATOM   5378 N  N   . ILE B 2 132 ? 20.515  -38.144 22.600  1.00 42.05  ? 132  ILE B N   1 
ATOM   5379 C  CA  . ILE B 2 132 ? 19.665  -38.047 21.418  1.00 36.65  ? 132  ILE B CA  1 
ATOM   5380 C  C   . ILE B 2 132 ? 18.375  -37.345 21.867  1.00 39.16  ? 132  ILE B C   1 
ATOM   5381 O  O   . ILE B 2 132 ? 17.636  -37.864 22.716  1.00 33.70  ? 132  ILE B O   1 
ATOM   5382 C  CB  . ILE B 2 132 ? 19.277  -39.424 20.836  1.00 28.97  ? 132  ILE B CB  1 
ATOM   5383 C  CG1 . ILE B 2 132 ? 20.489  -40.360 20.775  1.00 37.76  ? 132  ILE B CG1 1 
ATOM   5384 C  CG2 . ILE B 2 132 ? 18.723  -39.242 19.420  1.00 32.40  ? 132  ILE B CG2 1 
ATOM   5385 C  CD1 . ILE B 2 132 ? 20.163  -41.792 20.283  1.00 20.18  ? 132  ILE B CD1 1 
ATOM   5386 N  N   . PRO B 2 133 ? 18.111  -36.140 21.325  1.00 39.80  ? 133  PRO B N   1 
ATOM   5387 C  CA  . PRO B 2 133 ? 16.933  -35.319 21.632  1.00 40.99  ? 133  PRO B CA  1 
ATOM   5388 C  C   . PRO B 2 133 ? 15.670  -35.798 20.913  1.00 39.15  ? 133  PRO B C   1 
ATOM   5389 O  O   . PRO B 2 133 ? 15.755  -36.458 19.868  1.00 33.15  ? 133  PRO B O   1 
ATOM   5390 C  CB  . PRO B 2 133 ? 17.350  -33.953 21.101  1.00 39.63  ? 133  PRO B CB  1 
ATOM   5391 C  CG  . PRO B 2 133 ? 18.075  -34.325 19.841  1.00 24.68  ? 133  PRO B CG  1 
ATOM   5392 C  CD  . PRO B 2 133 ? 18.966  -35.457 20.333  1.00 33.74  ? 133  PRO B CD  1 
ATOM   5393 N  N   . SER B 2 134 ? 14.506  -35.418 21.441  1.00 35.87  ? 134  SER B N   1 
ATOM   5394 C  CA  . SER B 2 134 ? 13.238  -35.799 20.824  1.00 28.44  ? 134  SER B CA  1 
ATOM   5395 C  C   . SER B 2 134 ? 12.500  -34.547 20.405  1.00 17.44  ? 134  SER B C   1 
ATOM   5396 O  O   . SER B 2 134 ? 12.448  -33.573 21.155  1.00 5.90   ? 134  SER B O   1 
ATOM   5397 C  CB  . SER B 2 134 ? 12.362  -36.593 21.794  1.00 16.76  ? 134  SER B CB  1 
ATOM   5398 O  OG  . SER B 2 134 ? 11.738  -35.731 22.721  1.00 17.56  ? 134  SER B OG  1 
ATOM   5399 N  N   . ILE B 2 135 ? 11.918  -34.575 19.213  1.00 13.90  ? 135  ILE B N   1 
ATOM   5400 C  CA  . ILE B 2 135 ? 11.181  -33.417 18.741  1.00 12.30  ? 135  ILE B CA  1 
ATOM   5401 C  C   . ILE B 2 135 ? 10.094  -33.027 19.734  1.00 10.07  ? 135  ILE B C   1 
ATOM   5402 O  O   . ILE B 2 135 ? 9.367   -33.874 20.275  1.00 3.66   ? 135  ILE B O   1 
ATOM   5403 C  CB  . ILE B 2 135 ? 10.537  -33.662 17.375  1.00 10.49  ? 135  ILE B CB  1 
ATOM   5404 C  CG1 . ILE B 2 135 ? 11.613  -34.089 16.372  1.00 16.14  ? 135  ILE B CG1 1 
ATOM   5405 C  CG2 . ILE B 2 135 ? 9.775   -32.424 16.937  1.00 2.00   ? 135  ILE B CG2 1 
ATOM   5406 C  CD1 . ILE B 2 135 ? 11.098  -34.385 15.000  1.00 4.18   ? 135  ILE B CD1 1 
ATOM   5407 N  N   . ASN B 2 136 ? 10.055  -31.735 20.017  1.00 9.90   ? 136  ASN B N   1 
ATOM   5408 C  CA  . ASN B 2 136 ? 9.082   -31.158 20.921  1.00 7.43   ? 136  ASN B CA  1 
ATOM   5409 C  C   . ASN B 2 136 ? 9.262   -31.747 22.304  1.00 4.17   ? 136  ASN B C   1 
ATOM   5410 O  O   . ASN B 2 136 ? 8.381   -31.657 23.168  1.00 2.00   ? 136  ASN B O   1 
ATOM   5411 C  CB  . ASN B 2 136 ? 7.668   -31.391 20.386  1.00 8.11   ? 136  ASN B CB  1 
ATOM   5412 C  CG  . ASN B 2 136 ? 6.696   -30.349 20.865  1.00 13.14  ? 136  ASN B CG  1 
ATOM   5413 O  OD1 . ASN B 2 136 ? 7.109   -29.287 21.317  1.00 19.81  ? 136  ASN B OD1 1 
ATOM   5414 N  ND2 . ASN B 2 136 ? 5.397   -30.640 20.773  1.00 8.14   ? 136  ASN B ND2 1 
ATOM   5415 N  N   . ASN B 2 137 ? 10.422  -32.360 22.499  1.00 7.57   ? 137  ASN B N   1 
ATOM   5416 C  CA  . ASN B 2 137 ? 10.781  -32.967 23.772  1.00 26.22  ? 137  ASN B CA  1 
ATOM   5417 C  C   . ASN B 2 137 ? 9.629   -33.708 24.385  1.00 28.70  ? 137  ASN B C   1 
ATOM   5418 O  O   . ASN B 2 137 ? 9.281   -33.486 25.549  1.00 34.48  ? 137  ASN B O   1 
ATOM   5419 C  CB  . ASN B 2 137 ? 11.255  -31.905 24.749  1.00 39.37  ? 137  ASN B CB  1 
ATOM   5420 C  CG  . ASN B 2 137 ? 12.495  -31.207 24.277  1.00 60.87  ? 137  ASN B CG  1 
ATOM   5421 O  OD1 . ASN B 2 137 ? 13.569  -31.805 24.201  1.00 76.13  ? 137  ASN B OD1 1 
ATOM   5422 N  ND2 . ASN B 2 137 ? 12.359  -29.936 23.936  1.00 66.61  ? 137  ASN B ND2 1 
ATOM   5423 N  N   . GLU B 2 138 ? 8.997   -34.544 23.575  1.00 23.93  ? 138  GLU B N   1 
ATOM   5424 C  CA  . GLU B 2 138 ? 7.872   -35.325 24.043  1.00 27.60  ? 138  GLU B CA  1 
ATOM   5425 C  C   . GLU B 2 138 ? 8.424   -36.548 24.797  1.00 37.08  ? 138  GLU B C   1 
ATOM   5426 O  O   . GLU B 2 138 ? 7.837   -37.030 25.782  1.00 36.16  ? 138  GLU B O   1 
ATOM   5427 C  CB  . GLU B 2 138 ? 6.994   -35.692 22.844  1.00 16.95  ? 138  GLU B CB  1 
ATOM   5428 C  CG  . GLU B 2 138 ? 6.454   -34.437 22.133  1.00 34.61  ? 138  GLU B CG  1 
ATOM   5429 C  CD  . GLU B 2 138 ? 5.626   -34.715 20.877  1.00 43.67  ? 138  GLU B CD  1 
ATOM   5430 O  OE1 . GLU B 2 138 ? 5.509   -35.888 20.470  1.00 54.04  ? 138  GLU B OE1 1 
ATOM   5431 O  OE2 . GLU B 2 138 ? 5.082   -33.748 20.295  1.00 33.71  ? 138  GLU B OE2 1 
ATOM   5432 N  N   . THR B 2 139 ? 9.642   -36.919 24.412  1.00 42.94  ? 139  THR B N   1 
ATOM   5433 C  CA  . THR B 2 139 ? 10.378  -38.058 24.961  1.00 45.56  ? 139  THR B CA  1 
ATOM   5434 C  C   . THR B 2 139 ? 11.666  -37.559 25.631  1.00 45.55  ? 139  THR B C   1 
ATOM   5435 O  O   . THR B 2 139 ? 12.170  -36.486 25.282  1.00 51.05  ? 139  THR B O   1 
ATOM   5436 C  CB  . THR B 2 139 ? 10.791  -38.996 23.792  1.00 49.82  ? 139  THR B CB  1 
ATOM   5437 O  OG1 . THR B 2 139 ? 9.621   -39.416 23.076  1.00 59.30  ? 139  THR B OG1 1 
ATOM   5438 C  CG2 . THR B 2 139 ? 11.561  -40.210 24.279  1.00 52.30  ? 139  THR B CG2 1 
ATOM   5439 N  N   . PRO B 2 140 ? 12.137  -38.249 26.686  1.00 43.77  ? 140  PRO B N   1 
ATOM   5440 C  CA  . PRO B 2 140 ? 13.380  -37.777 27.303  1.00 45.30  ? 140  PRO B CA  1 
ATOM   5441 C  C   . PRO B 2 140 ? 14.541  -38.110 26.350  1.00 49.97  ? 140  PRO B C   1 
ATOM   5442 O  O   . PRO B 2 140 ? 14.367  -38.816 25.342  1.00 52.03  ? 140  PRO B O   1 
ATOM   5443 C  CB  . PRO B 2 140 ? 13.470  -38.611 28.586  1.00 36.01  ? 140  PRO B CB  1 
ATOM   5444 C  CG  . PRO B 2 140 ? 12.065  -38.869 28.923  1.00 42.28  ? 140  PRO B CG  1 
ATOM   5445 C  CD  . PRO B 2 140 ? 11.458  -39.207 27.576  1.00 46.62  ? 140  PRO B CD  1 
ATOM   5446 N  N   . GLY B 2 141 ? 15.718  -37.586 26.651  1.00 45.66  ? 141  GLY B N   1 
ATOM   5447 C  CA  . GLY B 2 141 ? 16.843  -37.870 25.795  1.00 48.11  ? 141  GLY B CA  1 
ATOM   5448 C  C   . GLY B 2 141 ? 17.297  -39.301 25.981  1.00 43.51  ? 141  GLY B C   1 
ATOM   5449 O  O   . GLY B 2 141 ? 17.204  -39.857 27.079  1.00 39.65  ? 141  GLY B O   1 
ATOM   5450 N  N   . ILE B 2 142 ? 17.783  -39.902 24.903  1.00 40.97  ? 142  ILE B N   1 
ATOM   5451 C  CA  . ILE B 2 142 ? 18.281  -41.267 24.952  1.00 33.68  ? 142  ILE B CA  1 
ATOM   5452 C  C   . ILE B 2 142 ? 19.772  -41.227 25.298  1.00 31.90  ? 142  ILE B C   1 
ATOM   5453 O  O   . ILE B 2 142 ? 20.633  -41.052 24.426  1.00 24.93  ? 142  ILE B O   1 
ATOM   5454 C  CB  . ILE B 2 142 ? 18.068  -41.964 23.619  1.00 24.42  ? 142  ILE B CB  1 
ATOM   5455 C  CG1 . ILE B 2 142 ? 16.660  -41.657 23.104  1.00 20.66  ? 142  ILE B CG1 1 
ATOM   5456 C  CG2 . ILE B 2 142 ? 18.248  -43.451 23.796  1.00 26.97  ? 142  ILE B CG2 1 
ATOM   5457 C  CD1 . ILE B 2 142 ? 16.466  -41.950 21.635  1.00 22.14  ? 142  ILE B CD1 1 
ATOM   5458 N  N   . ARG B 2 143 ? 20.060  -41.381 26.584  1.00 33.15  ? 143  ARG B N   1 
ATOM   5459 C  CA  . ARG B 2 143 ? 21.424  -41.332 27.097  1.00 33.69  ? 143  ARG B CA  1 
ATOM   5460 C  C   . ARG B 2 143 ? 22.245  -42.597 26.851  1.00 34.89  ? 143  ARG B C   1 
ATOM   5461 O  O   . ARG B 2 143 ? 21.761  -43.721 26.998  1.00 30.14  ? 143  ARG B O   1 
ATOM   5462 C  CB  . ARG B 2 143 ? 21.399  -41.003 28.592  1.00 27.20  ? 143  ARG B CB  1 
ATOM   5463 C  CG  . ARG B 2 143 ? 20.584  -39.769 28.912  1.00 31.10  ? 143  ARG B CG  1 
ATOM   5464 C  CD  . ARG B 2 143 ? 21.432  -38.528 28.969  1.00 35.36  ? 143  ARG B CD  1 
ATOM   5465 N  NE  . ARG B 2 143 ? 22.158  -38.436 30.234  1.00 45.70  ? 143  ARG B NE  1 
ATOM   5466 C  CZ  . ARG B 2 143 ? 23.316  -37.799 30.388  1.00 50.48  ? 143  ARG B CZ  1 
ATOM   5467 N  NH1 . ARG B 2 143 ? 23.889  -37.199 29.349  1.00 48.58  ? 143  ARG B NH1 1 
ATOM   5468 N  NH2 . ARG B 2 143 ? 23.880  -37.728 31.588  1.00 47.15  ? 143  ARG B NH2 1 
ATOM   5469 N  N   . TYR B 2 144 ? 23.505  -42.381 26.500  1.00 38.04  ? 144  TYR B N   1 
ATOM   5470 C  CA  . TYR B 2 144 ? 24.460  -43.440 26.221  1.00 40.15  ? 144  TYR B CA  1 
ATOM   5471 C  C   . TYR B 2 144 ? 25.827  -42.956 26.687  1.00 49.62  ? 144  TYR B C   1 
ATOM   5472 O  O   . TYR B 2 144 ? 26.000  -41.778 27.000  1.00 59.07  ? 144  TYR B O   1 
ATOM   5473 C  CB  . TYR B 2 144 ? 24.595  -43.646 24.710  1.00 20.62  ? 144  TYR B CB  1 
ATOM   5474 C  CG  . TYR B 2 144 ? 23.441  -44.292 24.008  1.00 40.15  ? 144  TYR B CG  1 
ATOM   5475 C  CD1 . TYR B 2 144 ? 23.110  -45.629 24.244  1.00 40.00  ? 144  TYR B CD1 1 
ATOM   5476 C  CD2 . TYR B 2 144 ? 22.713  -43.589 23.053  1.00 49.76  ? 144  TYR B CD2 1 
ATOM   5477 C  CE1 . TYR B 2 144 ? 22.083  -46.251 23.537  1.00 51.71  ? 144  TYR B CE1 1 
ATOM   5478 C  CE2 . TYR B 2 144 ? 21.683  -44.199 22.342  1.00 59.60  ? 144  TYR B CE2 1 
ATOM   5479 C  CZ  . TYR B 2 144 ? 21.373  -45.531 22.584  1.00 56.65  ? 144  TYR B CZ  1 
ATOM   5480 O  OH  . TYR B 2 144 ? 20.366  -46.137 21.858  1.00 57.52  ? 144  TYR B OH  1 
ATOM   5481 N  N   . GLN B 2 145 ? 26.789  -43.874 26.728  1.00 47.08  ? 145  GLN B N   1 
ATOM   5482 C  CA  . GLN B 2 145 ? 28.181  -43.558 27.042  1.00 28.83  ? 145  GLN B CA  1 
ATOM   5483 C  C   . GLN B 2 145 ? 28.980  -44.589 26.271  1.00 29.32  ? 145  GLN B C   1 
ATOM   5484 O  O   . GLN B 2 145 ? 28.447  -45.628 25.873  1.00 26.19  ? 145  GLN B O   1 
ATOM   5485 C  CB  . GLN B 2 145 ? 28.496  -43.613 28.528  1.00 8.73   ? 145  GLN B CB  1 
ATOM   5486 C  CG  . GLN B 2 145 ? 28.711  -44.986 29.107  1.00 11.70  ? 145  GLN B CG  1 
ATOM   5487 C  CD  . GLN B 2 145 ? 29.051  -44.921 30.593  1.00 22.34  ? 145  GLN B CD  1 
ATOM   5488 O  OE1 . GLN B 2 145 ? 28.654  -43.995 31.304  1.00 4.75   ? 145  GLN B OE1 1 
ATOM   5489 N  NE2 . GLN B 2 145 ? 29.801  -45.898 31.063  1.00 44.28  ? 145  GLN B NE2 1 
ATOM   5490 N  N   . TYR B 2 146 ? 30.218  -44.252 25.960  1.00 34.58  ? 146  TYR B N   1 
ATOM   5491 C  CA  . TYR B 2 146 ? 31.089  -45.145 25.217  1.00 36.27  ? 146  TYR B CA  1 
ATOM   5492 C  C   . TYR B 2 146 ? 31.783  -46.202 26.080  1.00 36.53  ? 146  TYR B C   1 
ATOM   5493 O  O   . TYR B 2 146 ? 32.107  -45.966 27.250  1.00 31.16  ? 146  TYR B O   1 
ATOM   5494 C  CB  . TYR B 2 146 ? 32.140  -44.336 24.466  1.00 32.21  ? 146  TYR B CB  1 
ATOM   5495 C  CG  . TYR B 2 146 ? 31.783  -44.020 23.035  1.00 31.22  ? 146  TYR B CG  1 
ATOM   5496 C  CD1 . TYR B 2 146 ? 31.028  -42.892 22.708  1.00 28.26  ? 146  TYR B CD1 1 
ATOM   5497 C  CD2 . TYR B 2 146 ? 32.261  -44.816 21.996  1.00 33.49  ? 146  TYR B CD2 1 
ATOM   5498 C  CE1 . TYR B 2 146 ? 30.766  -42.559 21.369  1.00 7.42   ? 146  TYR B CE1 1 
ATOM   5499 C  CE2 . TYR B 2 146 ? 32.007  -44.496 20.659  1.00 30.07  ? 146  TYR B CE2 1 
ATOM   5500 C  CZ  . TYR B 2 146 ? 31.263  -43.371 20.348  1.00 19.82  ? 146  TYR B CZ  1 
ATOM   5501 O  OH  . TYR B 2 146 ? 31.027  -43.083 19.014  1.00 20.91  ? 146  TYR B OH  1 
ATOM   5502 N  N   . ASN B 2 147 ? 31.966  -47.378 25.486  1.00 38.57  ? 147  ASN B N   1 
ATOM   5503 C  CA  . ASN B 2 147 ? 32.635  -48.505 26.121  1.00 35.22  ? 147  ASN B CA  1 
ATOM   5504 C  C   . ASN B 2 147 ? 33.969  -48.704 25.406  1.00 34.75  ? 147  ASN B C   1 
ATOM   5505 O  O   . ASN B 2 147 ? 34.894  -49.321 25.942  1.00 31.62  ? 147  ASN B O   1 
ATOM   5506 C  CB  . ASN B 2 147 ? 31.797  -49.776 25.975  1.00 32.68  ? 147  ASN B CB  1 
ATOM   5507 C  CG  . ASN B 2 147 ? 30.478  -49.702 26.717  1.00 36.77  ? 147  ASN B CG  1 
ATOM   5508 O  OD1 . ASN B 2 147 ? 29.422  -49.895 26.122  1.00 28.39  ? 147  ASN B OD1 1 
ATOM   5509 N  ND2 . ASN B 2 147 ? 30.531  -49.434 28.027  1.00 37.85  ? 147  ASN B ND2 1 
ATOM   5510 N  N   . VAL B 2 148 ? 34.068  -48.137 24.207  1.00 33.21  ? 148  VAL B N   1 
ATOM   5511 C  CA  . VAL B 2 148 ? 35.264  -48.257 23.386  1.00 36.88  ? 148  VAL B CA  1 
ATOM   5512 C  C   . VAL B 2 148 ? 35.916  -46.915 23.092  1.00 39.28  ? 148  VAL B C   1 
ATOM   5513 O  O   . VAL B 2 148 ? 35.636  -45.917 23.758  1.00 36.48  ? 148  VAL B O   1 
ATOM   5514 C  CB  . VAL B 2 148 ? 34.920  -48.925 22.052  1.00 29.29  ? 148  VAL B CB  1 
ATOM   5515 C  CG1 . VAL B 2 148 ? 34.554  -50.357 22.288  1.00 36.79  ? 148  VAL B CG1 1 
ATOM   5516 C  CG2 . VAL B 2 148 ? 33.768  -48.190 21.381  1.00 22.37  ? 148  VAL B CG2 1 
ATOM   5517 N  N   . LEU B 2 149 ? 36.827  -46.912 22.123  1.00 38.44  ? 149  LEU B N   1 
ATOM   5518 C  CA  . LEU B 2 149 ? 37.491  -45.688 21.724  1.00 34.80  ? 149  LEU B CA  1 
ATOM   5519 C  C   . LEU B 2 149 ? 36.516  -44.903 20.859  1.00 30.01  ? 149  LEU B C   1 
ATOM   5520 O  O   . LEU B 2 149 ? 36.015  -45.400 19.845  1.00 23.11  ? 149  LEU B O   1 
ATOM   5521 C  CB  . LEU B 2 149 ? 38.766  -45.977 20.936  1.00 46.62  ? 149  LEU B CB  1 
ATOM   5522 C  CG  . LEU B 2 149 ? 39.915  -46.716 21.620  1.00 46.24  ? 149  LEU B CG  1 
ATOM   5523 C  CD1 . LEU B 2 149 ? 41.164  -46.543 20.763  1.00 41.36  ? 149  LEU B CD1 1 
ATOM   5524 C  CD2 . LEU B 2 149 ? 40.154  -46.174 23.023  1.00 40.24  ? 149  LEU B CD2 1 
ATOM   5525 N  N   . PRO B 2 150 ? 36.162  -43.694 21.306  1.00 32.86  ? 150  PRO B N   1 
ATOM   5526 C  CA  . PRO B 2 150 ? 35.231  -42.818 20.587  1.00 28.03  ? 150  PRO B CA  1 
ATOM   5527 C  C   . PRO B 2 150 ? 35.928  -42.068 19.453  1.00 30.22  ? 150  PRO B C   1 
ATOM   5528 O  O   . PRO B 2 150 ? 37.072  -41.659 19.601  1.00 33.64  ? 150  PRO B O   1 
ATOM   5529 C  CB  . PRO B 2 150 ? 34.767  -41.848 21.679  1.00 25.09  ? 150  PRO B CB  1 
ATOM   5530 C  CG  . PRO B 2 150 ? 35.173  -42.518 23.019  1.00 13.61  ? 150  PRO B CG  1 
ATOM   5531 C  CD  . PRO B 2 150 ? 36.467  -43.158 22.647  1.00 31.87  ? 150  PRO B CD  1 
ATOM   5532 N  N   . GLN B 2 151 ? 35.243  -41.874 18.331  1.00 30.86  ? 151  GLN B N   1 
ATOM   5533 C  CA  . GLN B 2 151 ? 35.832  -41.150 17.200  1.00 37.74  ? 151  GLN B CA  1 
ATOM   5534 C  C   . GLN B 2 151 ? 35.831  -39.640 17.446  1.00 38.38  ? 151  GLN B C   1 
ATOM   5535 O  O   . GLN B 2 151 ? 34.893  -39.112 18.038  1.00 49.54  ? 151  GLN B O   1 
ATOM   5536 C  CB  . GLN B 2 151 ? 35.038  -41.413 15.921  1.00 46.23  ? 151  GLN B CB  1 
ATOM   5537 C  CG  . GLN B 2 151 ? 35.138  -42.802 15.365  1.00 49.22  ? 151  GLN B CG  1 
ATOM   5538 C  CD  . GLN B 2 151 ? 34.285  -42.957 14.127  1.00 52.09  ? 151  GLN B CD  1 
ATOM   5539 O  OE1 . GLN B 2 151 ? 34.783  -42.913 12.998  1.00 50.30  ? 151  GLN B OE1 1 
ATOM   5540 N  NE2 . GLN B 2 151 ? 32.986  -43.114 14.329  1.00 52.97  ? 151  GLN B NE2 1 
ATOM   5541 N  N   . GLY B 2 152 ? 36.852  -38.940 16.962  1.00 30.88  ? 152  GLY B N   1 
ATOM   5542 C  CA  . GLY B 2 152 ? 36.895  -37.498 17.139  1.00 37.25  ? 152  GLY B CA  1 
ATOM   5543 C  C   . GLY B 2 152 ? 37.426  -37.052 18.489  1.00 42.11  ? 152  GLY B C   1 
ATOM   5544 O  O   . GLY B 2 152 ? 37.457  -35.859 18.809  1.00 47.98  ? 152  GLY B O   1 
ATOM   5545 N  N   . TRP B 2 153 ? 37.779  -38.022 19.316  1.00 35.92  ? 153  TRP B N   1 
ATOM   5546 C  CA  . TRP B 2 153 ? 38.351  -37.741 20.611  1.00 31.03  ? 153  TRP B CA  1 
ATOM   5547 C  C   . TRP B 2 153 ? 39.851  -37.808 20.365  1.00 35.99  ? 153  TRP B C   1 
ATOM   5548 O  O   . TRP B 2 153 ? 40.314  -38.654 19.593  1.00 34.48  ? 153  TRP B O   1 
ATOM   5549 C  CB  . TRP B 2 153 ? 37.932  -38.814 21.602  1.00 27.96  ? 153  TRP B CB  1 
ATOM   5550 C  CG  . TRP B 2 153 ? 38.530  -38.633 22.936  1.00 24.80  ? 153  TRP B CG  1 
ATOM   5551 C  CD1 . TRP B 2 153 ? 38.535  -37.497 23.676  1.00 19.84  ? 153  TRP B CD1 1 
ATOM   5552 C  CD2 . TRP B 2 153 ? 39.189  -39.630 23.717  1.00 43.82  ? 153  TRP B CD2 1 
ATOM   5553 N  NE1 . TRP B 2 153 ? 39.148  -37.720 24.881  1.00 42.66  ? 153  TRP B NE1 1 
ATOM   5554 C  CE2 . TRP B 2 153 ? 39.559  -39.025 24.936  1.00 49.08  ? 153  TRP B CE2 1 
ATOM   5555 C  CE3 . TRP B 2 153 ? 39.504  -40.982 23.507  1.00 52.53  ? 153  TRP B CE3 1 
ATOM   5556 C  CZ2 . TRP B 2 153 ? 40.229  -39.722 25.950  1.00 54.29  ? 153  TRP B CZ2 1 
ATOM   5557 C  CZ3 . TRP B 2 153 ? 40.174  -41.679 24.516  1.00 53.91  ? 153  TRP B CZ3 1 
ATOM   5558 C  CH2 . TRP B 2 153 ? 40.527  -41.044 25.723  1.00 56.28  ? 153  TRP B CH2 1 
ATOM   5559 N  N   . LYS B 2 154 ? 40.616  -36.933 21.009  1.00 42.12  ? 154  LYS B N   1 
ATOM   5560 C  CA  . LYS B 2 154 ? 42.065  -36.932 20.801  1.00 45.43  ? 154  LYS B CA  1 
ATOM   5561 C  C   . LYS B 2 154 ? 42.720  -38.211 21.303  1.00 42.48  ? 154  LYS B C   1 
ATOM   5562 O  O   . LYS B 2 154 ? 43.546  -38.805 20.616  1.00 41.60  ? 154  LYS B O   1 
ATOM   5563 C  CB  . LYS B 2 154 ? 42.732  -35.702 21.438  1.00 49.50  ? 154  LYS B CB  1 
ATOM   5564 C  CG  . LYS B 2 154 ? 42.843  -35.715 22.958  1.00 48.47  ? 154  LYS B CG  1 
ATOM   5565 C  CD  . LYS B 2 154 ? 43.620  -34.506 23.431  1.00 41.02  ? 154  LYS B CD  1 
ATOM   5566 C  CE  . LYS B 2 154 ? 43.764  -34.492 24.930  1.00 26.55  ? 154  LYS B CE  1 
ATOM   5567 N  NZ  . LYS B 2 154 ? 44.508  -33.277 25.372  1.00 32.98  ? 154  LYS B NZ  1 
ATOM   5568 N  N   . GLY B 2 155 ? 42.291  -38.671 22.471  1.00 39.48  ? 155  GLY B N   1 
ATOM   5569 C  CA  . GLY B 2 155 ? 42.867  -39.872 23.040  1.00 40.27  ? 155  GLY B CA  1 
ATOM   5570 C  C   . GLY B 2 155 ? 42.812  -41.098 22.145  1.00 36.11  ? 155  GLY B C   1 
ATOM   5571 O  O   . GLY B 2 155 ? 43.621  -42.017 22.299  1.00 27.04  ? 155  GLY B O   1 
ATOM   5572 N  N   . SER B 2 156 ? 41.884  -41.118 21.197  1.00 32.93  ? 156  SER B N   1 
ATOM   5573 C  CA  . SER B 2 156 ? 41.781  -42.273 20.327  1.00 37.96  ? 156  SER B CA  1 
ATOM   5574 C  C   . SER B 2 156 ? 42.975  -42.497 19.418  1.00 45.67  ? 156  SER B C   1 
ATOM   5575 O  O   . SER B 2 156 ? 43.697  -43.478 19.601  1.00 56.13  ? 156  SER B O   1 
ATOM   5576 C  CB  . SER B 2 156 ? 40.476  -42.272 19.551  1.00 33.99  ? 156  SER B CB  1 
ATOM   5577 O  OG  . SER B 2 156 ? 39.403  -42.499 20.442  1.00 41.09  ? 156  SER B OG  1 
ATOM   5578 N  N   . PRO B 2 157 ? 43.244  -41.583 18.464  1.00 47.73  ? 157  PRO B N   1 
ATOM   5579 C  CA  . PRO B 2 157 ? 44.407  -41.836 17.605  1.00 44.51  ? 157  PRO B CA  1 
ATOM   5580 C  C   . PRO B 2 157 ? 45.689  -42.119 18.398  1.00 35.27  ? 157  PRO B C   1 
ATOM   5581 O  O   . PRO B 2 157 ? 46.544  -42.890 17.955  1.00 27.17  ? 157  PRO B O   1 
ATOM   5582 C  CB  . PRO B 2 157 ? 44.501  -40.557 16.761  1.00 40.94  ? 157  PRO B CB  1 
ATOM   5583 C  CG  . PRO B 2 157 ? 43.788  -39.528 17.579  1.00 46.71  ? 157  PRO B CG  1 
ATOM   5584 C  CD  . PRO B 2 157 ? 42.621  -40.293 18.124  1.00 50.85  ? 157  PRO B CD  1 
ATOM   5585 N  N   . ALA B 2 158 ? 45.754  -41.576 19.612  1.00 33.96  ? 158  ALA B N   1 
ATOM   5586 C  CA  . ALA B 2 158 ? 46.907  -41.750 20.496  1.00 39.18  ? 158  ALA B CA  1 
ATOM   5587 C  C   . ALA B 2 158 ? 47.058  -43.186 21.009  1.00 41.05  ? 158  ALA B C   1 
ATOM   5588 O  O   . ALA B 2 158 ? 48.121  -43.814 20.839  1.00 38.26  ? 158  ALA B O   1 
ATOM   5589 C  CB  . ALA B 2 158 ? 46.826  -40.765 21.672  1.00 40.44  ? 158  ALA B CB  1 
ATOM   5590 N  N   . ILE B 2 159 ? 46.003  -43.688 21.654  1.00 42.09  ? 159  ILE B N   1 
ATOM   5591 C  CA  . ILE B 2 159 ? 45.998  -45.046 22.196  1.00 36.81  ? 159  ILE B CA  1 
ATOM   5592 C  C   . ILE B 2 159 ? 46.195  -46.029 21.057  1.00 33.81  ? 159  ILE B C   1 
ATOM   5593 O  O   . ILE B 2 159 ? 47.004  -46.957 21.139  1.00 41.68  ? 159  ILE B O   1 
ATOM   5594 C  CB  . ILE B 2 159 ? 44.678  -45.359 22.926  1.00 32.18  ? 159  ILE B CB  1 
ATOM   5595 C  CG1 . ILE B 2 159 ? 44.564  -44.501 24.185  1.00 37.49  ? 159  ILE B CG1 1 
ATOM   5596 C  CG2 . ILE B 2 159 ? 44.633  -46.806 23.323  1.00 42.69  ? 159  ILE B CG2 1 
ATOM   5597 C  CD1 . ILE B 2 159 ? 43.331  -44.785 25.011  1.00 35.98  ? 159  ILE B CD1 1 
ATOM   5598 N  N   . PHE B 2 160 ? 45.549  -45.728 19.944  1.00 24.68  ? 160  PHE B N   1 
ATOM   5599 C  CA  . PHE B 2 160 ? 45.614  -46.565 18.770  1.00 29.34  ? 160  PHE B CA  1 
ATOM   5600 C  C   . PHE B 2 160 ? 46.912  -46.435 17.973  1.00 34.02  ? 160  PHE B C   1 
ATOM   5601 O  O   . PHE B 2 160 ? 47.046  -47.018 16.896  1.00 36.52  ? 160  PHE B O   1 
ATOM   5602 C  CB  . PHE B 2 160 ? 44.439  -46.220 17.875  1.00 37.39  ? 160  PHE B CB  1 
ATOM   5603 C  CG  . PHE B 2 160 ? 44.179  -47.233 16.817  1.00 50.22  ? 160  PHE B CG  1 
ATOM   5604 C  CD1 . PHE B 2 160 ? 43.675  -48.486 17.157  1.00 62.01  ? 160  PHE B CD1 1 
ATOM   5605 C  CD2 . PHE B 2 160 ? 44.440  -46.946 15.481  1.00 44.23  ? 160  PHE B CD2 1 
ATOM   5606 C  CE1 . PHE B 2 160 ? 43.432  -49.445 16.179  1.00 68.21  ? 160  PHE B CE1 1 
ATOM   5607 C  CE2 . PHE B 2 160 ? 44.202  -47.894 14.497  1.00 52.07  ? 160  PHE B CE2 1 
ATOM   5608 C  CZ  . PHE B 2 160 ? 43.696  -49.149 14.845  1.00 61.35  ? 160  PHE B CZ  1 
ATOM   5609 N  N   . GLN B 2 161 ? 47.903  -45.752 18.526  1.00 39.48  ? 161  GLN B N   1 
ATOM   5610 C  CA  . GLN B 2 161 ? 49.140  -45.554 17.792  1.00 41.31  ? 161  GLN B CA  1 
ATOM   5611 C  C   . GLN B 2 161 ? 49.943  -46.805 17.470  1.00 36.97  ? 161  GLN B C   1 
ATOM   5612 O  O   . GLN B 2 161 ? 50.218  -47.093 16.296  1.00 22.42  ? 161  GLN B O   1 
ATOM   5613 C  CB  . GLN B 2 161 ? 50.003  -44.491 18.470  1.00 42.07  ? 161  GLN B CB  1 
ATOM   5614 C  CG  . GLN B 2 161 ? 50.713  -43.603 17.452  1.00 57.14  ? 161  GLN B CG  1 
ATOM   5615 C  CD  . GLN B 2 161 ? 49.877  -43.367 16.190  1.00 62.25  ? 161  GLN B CD  1 
ATOM   5616 O  OE1 . GLN B 2 161 ? 50.386  -43.440 15.072  1.00 60.16  ? 161  GLN B OE1 1 
ATOM   5617 N  NE2 . GLN B 2 161 ? 48.588  -43.104 16.369  1.00 66.01  ? 161  GLN B NE2 1 
ATOM   5618 N  N   . SER B 2 162 ? 50.291  -47.555 18.507  1.00 40.08  ? 162  SER B N   1 
ATOM   5619 C  CA  . SER B 2 162 ? 51.056  -48.789 18.348  1.00 41.28  ? 162  SER B CA  1 
ATOM   5620 C  C   . SER B 2 162 ? 50.485  -49.649 17.210  1.00 28.90  ? 162  SER B C   1 
ATOM   5621 O  O   . SER B 2 162 ? 51.155  -49.926 16.213  1.00 6.93   ? 162  SER B O   1 
ATOM   5622 C  CB  . SER B 2 162 ? 51.004  -49.584 19.657  1.00 41.35  ? 162  SER B CB  1 
ATOM   5623 O  OG  . SER B 2 162 ? 49.651  -49.829 20.030  1.00 31.92  ? 162  SER B OG  1 
ATOM   5624 N  N   . SER B 2 163 ? 49.212  -49.999 17.354  1.00 28.64  ? 163  SER B N   1 
ATOM   5625 C  CA  . SER B 2 163 ? 48.508  -50.838 16.390  1.00 29.04  ? 163  SER B CA  1 
ATOM   5626 C  C   . SER B 2 163 ? 48.511  -50.177 15.025  1.00 18.00  ? 163  SER B C   1 
ATOM   5627 O  O   . SER B 2 163 ? 48.743  -50.819 13.990  1.00 2.00   ? 163  SER B O   1 
ATOM   5628 C  CB  . SER B 2 163 ? 47.066  -51.051 16.860  1.00 27.49  ? 163  SER B CB  1 
ATOM   5629 O  OG  . SER B 2 163 ? 47.021  -51.221 18.269  1.00 34.61  ? 163  SER B OG  1 
ATOM   5630 N  N   . MET B 2 164 ? 48.309  -48.867 15.054  1.00 22.83  ? 164  MET B N   1 
ATOM   5631 C  CA  . MET B 2 164 ? 48.263  -48.089 13.841  1.00 24.41  ? 164  MET B CA  1 
ATOM   5632 C  C   . MET B 2 164 ? 49.563  -48.268 13.060  1.00 22.48  ? 164  MET B C   1 
ATOM   5633 O  O   . MET B 2 164 ? 49.600  -48.964 12.036  1.00 2.00   ? 164  MET B O   1 
ATOM   5634 C  CB  . MET B 2 164 ? 47.974  -46.619 14.164  1.00 2.00   ? 164  MET B CB  1 
ATOM   5635 C  CG  . MET B 2 164 ? 47.612  -45.845 12.924  1.00 25.18  ? 164  MET B CG  1 
ATOM   5636 S  SD  . MET B 2 164 ? 46.877  -46.911 11.615  1.00 25.85  ? 164  MET B SD  1 
ATOM   5637 C  CE  . MET B 2 164 ? 45.532  -45.873 11.032  1.00 24.65  ? 164  MET B CE  1 
ATOM   5638 N  N   . THR B 2 165 ? 50.639  -47.715 13.604  1.00 33.27  ? 165  THR B N   1 
ATOM   5639 C  CA  . THR B 2 165 ? 51.954  -47.812 12.992  1.00 41.78  ? 165  THR B CA  1 
ATOM   5640 C  C   . THR B 2 165 ? 52.203  -49.248 12.548  1.00 38.95  ? 165  THR B C   1 
ATOM   5641 O  O   . THR B 2 165 ? 52.598  -49.502 11.410  1.00 33.39  ? 165  THR B O   1 
ATOM   5642 C  CB  . THR B 2 165 ? 53.038  -47.395 14.007  1.00 56.80  ? 165  THR B CB  1 
ATOM   5643 O  OG1 . THR B 2 165 ? 52.731  -47.948 15.297  1.00 60.75  ? 165  THR B OG1 1 
ATOM   5644 C  CG2 . THR B 2 165 ? 53.108  -45.881 14.121  1.00 67.69  ? 165  THR B CG2 1 
ATOM   5645 N  N   . LYS B 2 166 ? 51.876  -50.177 13.437  1.00 42.97  ? 166  LYS B N   1 
ATOM   5646 C  CA  . LYS B 2 166 ? 52.050  -51.589 13.179  1.00 45.85  ? 166  LYS B CA  1 
ATOM   5647 C  C   . LYS B 2 166 ? 51.483  -52.004 11.838  1.00 43.58  ? 166  LYS B C   1 
ATOM   5648 O  O   . LYS B 2 166 ? 52.224  -52.420 10.946  1.00 43.04  ? 166  LYS B O   1 
ATOM   5649 C  CB  . LYS B 2 166 ? 51.411  -52.431 14.288  1.00 54.65  ? 166  LYS B CB  1 
ATOM   5650 C  CG  . LYS B 2 166 ? 52.299  -52.647 15.511  1.00 66.95  ? 166  LYS B CG  1 
ATOM   5651 C  CD  . LYS B 2 166 ? 51.909  -53.918 16.273  1.00 85.97  ? 166  LYS B CD  1 
ATOM   5652 C  CE  . LYS B 2 166 ? 52.132  -55.193 15.437  1.00 100.63 ? 166  LYS B CE  1 
ATOM   5653 N  NZ  . LYS B 2 166 ? 53.576  -55.547 15.191  1.00 113.08 ? 166  LYS B NZ  1 
ATOM   5654 N  N   . ILE B 2 167 ? 50.183  -51.824 11.664  1.00 45.52  ? 167  ILE B N   1 
ATOM   5655 C  CA  . ILE B 2 167 ? 49.552  -52.236 10.415  1.00 46.04  ? 167  ILE B CA  1 
ATOM   5656 C  C   . ILE B 2 167 ? 50.097  -51.459 9.222   1.00 39.36  ? 167  ILE B C   1 
ATOM   5657 O  O   . ILE B 2 167 ? 50.116  -51.959 8.096   1.00 40.17  ? 167  ILE B O   1 
ATOM   5658 C  CB  . ILE B 2 167 ? 47.994  -52.102 10.464  1.00 44.58  ? 167  ILE B CB  1 
ATOM   5659 C  CG1 . ILE B 2 167 ? 47.552  -50.695 10.076  1.00 44.49  ? 167  ILE B CG1 1 
ATOM   5660 C  CG2 . ILE B 2 167 ? 47.471  -52.427 11.861  1.00 45.48  ? 167  ILE B CG2 1 
ATOM   5661 C  CD1 . ILE B 2 167 ? 46.093  -50.606 9.770   1.00 52.77  ? 167  ILE B CD1 1 
ATOM   5662 N  N   . LEU B 2 168 ? 50.590  -50.260 9.490   1.00 36.15  ? 168  LEU B N   1 
ATOM   5663 C  CA  . LEU B 2 168 ? 51.100  -49.393 8.446   1.00 41.69  ? 168  LEU B CA  1 
ATOM   5664 C  C   . LEU B 2 168 ? 52.424  -49.747 7.780   1.00 41.59  ? 168  LEU B C   1 
ATOM   5665 O  O   . LEU B 2 168 ? 52.483  -49.858 6.546   1.00 44.59  ? 168  LEU B O   1 
ATOM   5666 C  CB  . LEU B 2 168 ? 51.121  -47.947 8.943   1.00 47.24  ? 168  LEU B CB  1 
ATOM   5667 C  CG  . LEU B 2 168 ? 49.743  -47.271 8.884   1.00 47.38  ? 168  LEU B CG  1 
ATOM   5668 C  CD1 . LEU B 2 168 ? 49.791  -45.909 9.543   1.00 33.87  ? 168  LEU B CD1 1 
ATOM   5669 C  CD2 . LEU B 2 168 ? 49.284  -47.153 7.429   1.00 39.36  ? 168  LEU B CD2 1 
ATOM   5670 N  N   . GLU B 2 169 ? 53.464  -49.950 8.585   1.00 34.67  ? 169  GLU B N   1 
ATOM   5671 C  CA  . GLU B 2 169 ? 54.803  -50.266 8.087   1.00 30.26  ? 169  GLU B CA  1 
ATOM   5672 C  C   . GLU B 2 169 ? 54.851  -50.958 6.726   1.00 29.76  ? 169  GLU B C   1 
ATOM   5673 O  O   . GLU B 2 169 ? 55.297  -50.356 5.746   1.00 20.06  ? 169  GLU B O   1 
ATOM   5674 C  CB  . GLU B 2 169 ? 55.583  -51.101 9.102   1.00 35.62  ? 169  GLU B CB  1 
ATOM   5675 C  CG  . GLU B 2 169 ? 55.559  -50.570 10.519  1.00 66.40  ? 169  GLU B CG  1 
ATOM   5676 C  CD  . GLU B 2 169 ? 56.150  -51.554 11.529  1.00 88.61  ? 169  GLU B CD  1 
ATOM   5677 O  OE1 . GLU B 2 169 ? 56.156  -52.779 11.255  1.00 98.72  ? 169  GLU B OE1 1 
ATOM   5678 O  OE2 . GLU B 2 169 ? 56.605  -51.103 12.605  1.00 91.60  ? 169  GLU B OE2 1 
ATOM   5679 N  N   . PRO B 2 170 ? 54.296  -52.187 6.625   1.00 36.52  ? 170  PRO B N   1 
ATOM   5680 C  CA  . PRO B 2 170 ? 54.261  -53.002 5.399   1.00 41.73  ? 170  PRO B CA  1 
ATOM   5681 C  C   . PRO B 2 170 ? 54.010  -52.255 4.087   1.00 49.79  ? 170  PRO B C   1 
ATOM   5682 O  O   . PRO B 2 170 ? 54.514  -52.644 3.034   1.00 48.30  ? 170  PRO B O   1 
ATOM   5683 C  CB  . PRO B 2 170 ? 53.123  -53.977 5.684   1.00 37.32  ? 170  PRO B CB  1 
ATOM   5684 C  CG  . PRO B 2 170 ? 53.228  -54.180 7.144   1.00 38.35  ? 170  PRO B CG  1 
ATOM   5685 C  CD  . PRO B 2 170 ? 53.425  -52.792 7.655   1.00 34.71  ? 170  PRO B CD  1 
ATOM   5686 N  N   . PHE B 2 171 ? 53.176  -51.226 4.142   1.00 57.69  ? 171  PHE B N   1 
ATOM   5687 C  CA  . PHE B 2 171 ? 52.867  -50.447 2.958   1.00 63.67  ? 171  PHE B CA  1 
ATOM   5688 C  C   . PHE B 2 171 ? 53.949  -49.382 2.791   1.00 64.08  ? 171  PHE B C   1 
ATOM   5689 O  O   . PHE B 2 171 ? 54.495  -49.202 1.692   1.00 59.48  ? 171  PHE B O   1 
ATOM   5690 C  CB  . PHE B 2 171 ? 51.487  -49.801 3.110   1.00 70.97  ? 171  PHE B CB  1 
ATOM   5691 C  CG  . PHE B 2 171 ? 50.958  -49.188 1.843   1.00 76.66  ? 171  PHE B CG  1 
ATOM   5692 C  CD1 . PHE B 2 171 ? 50.451  -49.992 0.822   1.00 75.30  ? 171  PHE B CD1 1 
ATOM   5693 C  CD2 . PHE B 2 171 ? 50.957  -47.804 1.673   1.00 72.75  ? 171  PHE B CD2 1 
ATOM   5694 C  CE1 . PHE B 2 171 ? 49.951  -49.422 -0.349  1.00 75.97  ? 171  PHE B CE1 1 
ATOM   5695 C  CE2 . PHE B 2 171 ? 50.459  -47.225 0.508   1.00 69.11  ? 171  PHE B CE2 1 
ATOM   5696 C  CZ  . PHE B 2 171 ? 49.955  -48.036 -0.504  1.00 75.49  ? 171  PHE B CZ  1 
ATOM   5697 N  N   . ARG B 2 172 ? 54.291  -48.737 3.907   1.00 61.86  ? 172  ARG B N   1 
ATOM   5698 C  CA  . ARG B 2 172 ? 55.301  -47.678 3.957   1.00 57.54  ? 172  ARG B CA  1 
ATOM   5699 C  C   . ARG B 2 172 ? 56.630  -48.086 3.373   1.00 54.83  ? 172  ARG B C   1 
ATOM   5700 O  O   . ARG B 2 172 ? 57.319  -47.283 2.755   1.00 51.00  ? 172  ARG B O   1 
ATOM   5701 C  CB  . ARG B 2 172 ? 55.518  -47.223 5.395   1.00 54.28  ? 172  ARG B CB  1 
ATOM   5702 C  CG  . ARG B 2 172 ? 54.424  -46.328 5.887   1.00 60.48  ? 172  ARG B CG  1 
ATOM   5703 C  CD  . ARG B 2 172 ? 54.676  -45.839 7.286   1.00 63.29  ? 172  ARG B CD  1 
ATOM   5704 N  NE  . ARG B 2 172 ? 53.765  -44.746 7.618   1.00 71.42  ? 172  ARG B NE  1 
ATOM   5705 C  CZ  . ARG B 2 172 ? 53.522  -44.319 8.854   1.00 84.85  ? 172  ARG B CZ  1 
ATOM   5706 N  NH1 . ARG B 2 172 ? 54.119  -44.898 9.891   1.00 93.18  ? 172  ARG B NH1 1 
ATOM   5707 N  NH2 . ARG B 2 172 ? 52.684  -43.308 9.052   1.00 84.80  ? 172  ARG B NH2 1 
ATOM   5708 N  N   . LYS B 2 173 ? 57.008  -49.329 3.622   1.00 57.43  ? 173  LYS B N   1 
ATOM   5709 C  CA  . LYS B 2 173 ? 58.260  -49.849 3.111   1.00 60.70  ? 173  LYS B CA  1 
ATOM   5710 C  C   . LYS B 2 173 ? 58.066  -50.229 1.657   1.00 60.53  ? 173  LYS B C   1 
ATOM   5711 O  O   . LYS B 2 173 ? 58.930  -49.970 0.825   1.00 55.76  ? 173  LYS B O   1 
ATOM   5712 C  CB  . LYS B 2 173 ? 58.709  -51.056 3.932   1.00 67.18  ? 173  LYS B CB  1 
ATOM   5713 C  CG  . LYS B 2 173 ? 59.259  -50.701 5.310   1.00 67.34  ? 173  LYS B CG  1 
ATOM   5714 C  CD  . LYS B 2 173 ? 58.255  -49.921 6.136   1.00 64.92  ? 173  LYS B CD  1 
ATOM   5715 C  CE  . LYS B 2 173 ? 58.738  -49.705 7.546   1.00 70.52  ? 173  LYS B CE  1 
ATOM   5716 N  NZ  . LYS B 2 173 ? 57.758  -48.893 8.303   1.00 75.74  ? 173  LYS B NZ  1 
ATOM   5717 N  N   . GLN B 2 174 ? 56.909  -50.806 1.349   1.00 67.03  ? 174  GLN B N   1 
ATOM   5718 C  CA  . GLN B 2 174 ? 56.601  -51.207 -0.016  1.00 78.39  ? 174  GLN B CA  1 
ATOM   5719 C  C   . GLN B 2 174 ? 56.647  -49.966 -0.895  1.00 81.07  ? 174  GLN B C   1 
ATOM   5720 O  O   . GLN B 2 174 ? 57.028  -50.034 -2.064  1.00 83.28  ? 174  GLN B O   1 
ATOM   5721 C  CB  . GLN B 2 174 ? 55.214  -51.854 -0.090  1.00 88.45  ? 174  GLN B CB  1 
ATOM   5722 C  CG  . GLN B 2 174 ? 55.207  -53.232 -0.745  1.00 106.30 ? 174  GLN B CG  1 
ATOM   5723 C  CD  . GLN B 2 174 ? 53.811  -53.830 -0.864  1.00 126.94 ? 174  GLN B CD  1 
ATOM   5724 O  OE1 . GLN B 2 174 ? 53.209  -53.817 -1.938  1.00 139.89 ? 174  GLN B OE1 1 
ATOM   5725 N  NE2 . GLN B 2 174 ? 53.293  -54.362 0.236   1.00 130.72 ? 174  GLN B NE2 1 
ATOM   5726 N  N   . ASN B 2 175 ? 56.298  -48.827 -0.303  1.00 80.91  ? 175  ASN B N   1 
ATOM   5727 C  CA  . ASN B 2 175 ? 56.283  -47.550 -1.004  1.00 83.50  ? 175  ASN B CA  1 
ATOM   5728 C  C   . ASN B 2 175 ? 56.840  -46.487 -0.055  1.00 89.16  ? 175  ASN B C   1 
ATOM   5729 O  O   . ASN B 2 175 ? 56.079  -45.809 0.633   1.00 90.41  ? 175  ASN B O   1 
ATOM   5730 C  CB  . ASN B 2 175 ? 54.843  -47.178 -1.387  1.00 83.04  ? 175  ASN B CB  1 
ATOM   5731 C  CG  . ASN B 2 175 ? 54.103  -48.306 -2.102  1.00 75.57  ? 175  ASN B CG  1 
ATOM   5732 O  OD1 . ASN B 2 175 ? 54.053  -48.350 -3.330  1.00 53.11  ? 175  ASN B OD1 1 
ATOM   5733 N  ND2 . ASN B 2 175 ? 53.506  -49.210 -1.330  1.00 81.17  ? 175  ASN B ND2 1 
ATOM   5734 N  N   . PRO B 2 176 ? 58.177  -46.331 0.002   1.00 93.63  ? 176  PRO B N   1 
ATOM   5735 C  CA  . PRO B 2 176 ? 58.817  -45.341 0.883   1.00 92.73  ? 176  PRO B CA  1 
ATOM   5736 C  C   . PRO B 2 176 ? 58.819  -43.898 0.358   1.00 93.68  ? 176  PRO B C   1 
ATOM   5737 O  O   . PRO B 2 176 ? 59.192  -42.970 1.079   1.00 90.71  ? 176  PRO B O   1 
ATOM   5738 C  CB  . PRO B 2 176 ? 60.232  -45.897 1.036   1.00 90.89  ? 176  PRO B CB  1 
ATOM   5739 C  CG  . PRO B 2 176 ? 60.495  -46.470 -0.319  1.00 93.34  ? 176  PRO B CG  1 
ATOM   5740 C  CD  . PRO B 2 176 ? 59.189  -47.176 -0.661  1.00 96.37  ? 176  PRO B CD  1 
ATOM   5741 N  N   . ASP B 2 177 ? 58.414  -43.718 -0.898  1.00 97.63  ? 177  ASP B N   1 
ATOM   5742 C  CA  . ASP B 2 177 ? 58.362  -42.394 -1.526  1.00 105.42 ? 177  ASP B CA  1 
ATOM   5743 C  C   . ASP B 2 177 ? 57.080  -41.648 -1.139  1.00 106.08 ? 177  ASP B C   1 
ATOM   5744 O  O   . ASP B 2 177 ? 56.888  -40.473 -1.478  1.00 106.08 ? 177  ASP B O   1 
ATOM   5745 C  CB  . ASP B 2 177 ? 58.432  -42.540 -3.053  1.00 118.20 ? 177  ASP B CB  1 
ATOM   5746 C  CG  . ASP B 2 177 ? 58.332  -41.202 -3.783  1.00 132.94 ? 177  ASP B CG  1 
ATOM   5747 O  OD1 . ASP B 2 177 ? 59.336  -40.457 -3.805  1.00 139.57 ? 177  ASP B OD1 1 
ATOM   5748 O  OD2 . ASP B 2 177 ? 57.249  -40.895 -4.333  1.00 135.92 ? 177  ASP B OD2 1 
ATOM   5749 N  N   . ILE B 2 178 ? 56.195  -42.346 -0.445  1.00 103.09 ? 178  ILE B N   1 
ATOM   5750 C  CA  . ILE B 2 178 ? 54.931  -41.765 -0.036  1.00 95.35  ? 178  ILE B CA  1 
ATOM   5751 C  C   . ILE B 2 178 ? 54.975  -41.436 1.449   1.00 85.17  ? 178  ILE B C   1 
ATOM   5752 O  O   . ILE B 2 178 ? 55.687  -42.080 2.219   1.00 84.09  ? 178  ILE B O   1 
ATOM   5753 C  CB  . ILE B 2 178 ? 53.767  -42.734 -0.355  1.00 99.96  ? 178  ILE B CB  1 
ATOM   5754 C  CG1 . ILE B 2 178 ? 53.853  -43.171 -1.825  1.00 103.38 ? 178  ILE B CG1 1 
ATOM   5755 C  CG2 . ILE B 2 178 ? 52.430  -42.062 -0.090  1.00 97.31  ? 178  ILE B CG2 1 
ATOM   5756 C  CD1 . ILE B 2 178 ? 52.825  -44.198 -2.244  1.00 104.02 ? 178  ILE B CD1 1 
ATOM   5757 N  N   . VAL B 2 179 ? 54.240  -40.402 1.835   1.00 76.90  ? 179  VAL B N   1 
ATOM   5758 C  CA  . VAL B 2 179 ? 54.185  -39.980 3.221   1.00 65.84  ? 179  VAL B CA  1 
ATOM   5759 C  C   . VAL B 2 179 ? 52.756  -40.118 3.728   1.00 57.89  ? 179  VAL B C   1 
ATOM   5760 O  O   . VAL B 2 179 ? 51.797  -39.789 3.026   1.00 46.94  ? 179  VAL B O   1 
ATOM   5761 C  CB  . VAL B 2 179 ? 54.656  -38.519 3.380   1.00 60.22  ? 179  VAL B CB  1 
ATOM   5762 C  CG1 . VAL B 2 179 ? 54.770  -38.160 4.849   1.00 45.34  ? 179  VAL B CG1 1 
ATOM   5763 C  CG2 . VAL B 2 179 ? 55.993  -38.319 2.681   1.00 60.90  ? 179  VAL B CG2 1 
ATOM   5764 N  N   . ILE B 2 180 ? 52.629  -40.632 4.943   1.00 54.46  ? 180  ILE B N   1 
ATOM   5765 C  CA  . ILE B 2 180 ? 51.333  -40.821 5.565   1.00 54.63  ? 180  ILE B CA  1 
ATOM   5766 C  C   . ILE B 2 180 ? 51.244  -40.048 6.877   1.00 47.32  ? 180  ILE B C   1 
ATOM   5767 O  O   . ILE B 2 180 ? 52.117  -40.175 7.744   1.00 43.87  ? 180  ILE B O   1 
ATOM   5768 C  CB  . ILE B 2 180 ? 51.086  -42.321 5.856   1.00 71.79  ? 180  ILE B CB  1 
ATOM   5769 C  CG1 . ILE B 2 180 ? 50.973  -43.102 4.543   1.00 81.44  ? 180  ILE B CG1 1 
ATOM   5770 C  CG2 . ILE B 2 180 ? 49.842  -42.507 6.724   1.00 72.21  ? 180  ILE B CG2 1 
ATOM   5771 C  CD1 . ILE B 2 180 ? 50.629  -44.576 4.722   1.00 85.49  ? 180  ILE B CD1 1 
ATOM   5772 N  N   . TYR B 2 181 ? 50.191  -39.254 7.028   1.00 41.46  ? 181  TYR B N   1 
ATOM   5773 C  CA  . TYR B 2 181 ? 50.001  -38.505 8.262   1.00 37.19  ? 181  TYR B CA  1 
ATOM   5774 C  C   . TYR B 2 181 ? 48.628  -38.734 8.889   1.00 32.95  ? 181  TYR B C   1 
ATOM   5775 O  O   . TYR B 2 181 ? 47.601  -38.670 8.214   1.00 12.37  ? 181  TYR B O   1 
ATOM   5776 C  CB  . TYR B 2 181 ? 50.241  -37.022 8.043   1.00 33.65  ? 181  TYR B CB  1 
ATOM   5777 C  CG  . TYR B 2 181 ? 50.118  -36.214 9.309   1.00 24.75  ? 181  TYR B CG  1 
ATOM   5778 C  CD1 . TYR B 2 181 ? 50.730  -36.629 10.497  1.00 29.23  ? 181  TYR B CD1 1 
ATOM   5779 C  CD2 . TYR B 2 181 ? 49.385  -35.040 9.323   1.00 26.11  ? 181  TYR B CD2 1 
ATOM   5780 C  CE1 . TYR B 2 181 ? 50.608  -35.886 11.670  1.00 31.03  ? 181  TYR B CE1 1 
ATOM   5781 C  CE2 . TYR B 2 181 ? 49.256  -34.290 10.481  1.00 41.45  ? 181  TYR B CE2 1 
ATOM   5782 C  CZ  . TYR B 2 181 ? 49.869  -34.713 11.652  1.00 39.23  ? 181  TYR B CZ  1 
ATOM   5783 O  OH  . TYR B 2 181 ? 49.732  -33.935 12.777  1.00 35.32  ? 181  TYR B OH  1 
ATOM   5784 N  N   . GLN B 2 182 ? 48.625  -38.987 10.195  1.00 44.32  ? 182  GLN B N   1 
ATOM   5785 C  CA  . GLN B 2 182 ? 47.391  -39.247 10.928  1.00 49.76  ? 182  GLN B CA  1 
ATOM   5786 C  C   . GLN B 2 182 ? 46.981  -38.100 11.831  1.00 49.37  ? 182  GLN B C   1 
ATOM   5787 O  O   . GLN B 2 182 ? 47.732  -37.721 12.741  1.00 46.29  ? 182  GLN B O   1 
ATOM   5788 C  CB  . GLN B 2 182 ? 47.549  -40.511 11.780  1.00 58.71  ? 182  GLN B CB  1 
ATOM   5789 C  CG  . GLN B 2 182 ? 46.348  -40.877 12.674  1.00 66.90  ? 182  GLN B CG  1 
ATOM   5790 C  CD  . GLN B 2 182 ? 46.644  -42.053 13.622  1.00 69.47  ? 182  GLN B CD  1 
ATOM   5791 O  OE1 . GLN B 2 182 ? 45.808  -42.440 14.439  1.00 55.18  ? 182  GLN B OE1 1 
ATOM   5792 N  NE2 . GLN B 2 182 ? 47.851  -42.601 13.531  1.00 80.13  ? 182  GLN B NE2 1 
ATOM   5793 N  N   . TYR B 2 183 ? 45.817  -37.522 11.542  1.00 49.66  ? 183  TYR B N   1 
ATOM   5794 C  CA  . TYR B 2 183 ? 45.262  -36.452 12.365  1.00 43.35  ? 183  TYR B CA  1 
ATOM   5795 C  C   . TYR B 2 183 ? 43.858  -36.900 12.742  1.00 32.77  ? 183  TYR B C   1 
ATOM   5796 O  O   . TYR B 2 183 ? 42.990  -37.068 11.872  1.00 10.48  ? 183  TYR B O   1 
ATOM   5797 C  CB  . TYR B 2 183 ? 45.216  -35.082 11.658  1.00 47.25  ? 183  TYR B CB  1 
ATOM   5798 C  CG  . TYR B 2 183 ? 44.887  -33.928 12.615  1.00 51.76  ? 183  TYR B CG  1 
ATOM   5799 C  CD1 . TYR B 2 183 ? 45.895  -33.276 13.334  1.00 57.35  ? 183  TYR B CD1 1 
ATOM   5800 C  CD2 . TYR B 2 183 ? 43.566  -33.560 12.876  1.00 56.98  ? 183  TYR B CD2 1 
ATOM   5801 C  CE1 . TYR B 2 183 ? 45.593  -32.293 14.301  1.00 61.57  ? 183  TYR B CE1 1 
ATOM   5802 C  CE2 . TYR B 2 183 ? 43.256  -32.581 13.841  1.00 61.87  ? 183  TYR B CE2 1 
ATOM   5803 C  CZ  . TYR B 2 183 ? 44.272  -31.954 14.553  1.00 57.78  ? 183  TYR B CZ  1 
ATOM   5804 O  OH  . TYR B 2 183 ? 43.966  -31.019 15.531  1.00 40.19  ? 183  TYR B OH  1 
ATOM   5805 N  N   . MET B 2 184 ? 43.656  -37.084 14.046  1.00 33.99  ? 184  MET B N   1 
ATOM   5806 C  CA  . MET B 2 184 ? 42.384  -37.520 14.596  1.00 41.21  ? 184  MET B CA  1 
ATOM   5807 C  C   . MET B 2 184 ? 41.932  -38.806 13.934  1.00 41.73  ? 184  MET B C   1 
ATOM   5808 O  O   . MET B 2 184 ? 42.608  -39.823 14.026  1.00 43.63  ? 184  MET B O   1 
ATOM   5809 C  CB  . MET B 2 184 ? 41.312  -36.429 14.468  1.00 40.53  ? 184  MET B CB  1 
ATOM   5810 C  CG  . MET B 2 184 ? 41.440  -35.325 15.498  1.00 54.45  ? 184  MET B CG  1 
ATOM   5811 S  SD  . MET B 2 184 ? 41.599  -35.968 17.184  1.00 66.08  ? 184  MET B SD  1 
ATOM   5812 C  CE  . MET B 2 184 ? 43.354  -35.714 17.457  1.00 70.82  ? 184  MET B CE  1 
ATOM   5813 N  N   . ASP B 2 185 ? 40.813  -38.744 13.227  1.00 41.63  ? 185  ASP B N   1 
ATOM   5814 C  CA  . ASP B 2 185 ? 40.270  -39.913 12.562  1.00 38.04  ? 185  ASP B CA  1 
ATOM   5815 C  C   . ASP B 2 185 ? 40.787  -39.997 11.140  1.00 26.02  ? 185  ASP B C   1 
ATOM   5816 O  O   . ASP B 2 185 ? 40.503  -40.954 10.433  1.00 28.71  ? 185  ASP B O   1 
ATOM   5817 C  CB  . ASP B 2 185 ? 38.737  -39.816 12.510  1.00 47.63  ? 185  ASP B CB  1 
ATOM   5818 C  CG  . ASP B 2 185 ? 38.085  -39.711 13.889  1.00 47.24  ? 185  ASP B CG  1 
ATOM   5819 O  OD1 . ASP B 2 185 ? 38.801  -39.612 14.916  1.00 40.00  ? 185  ASP B OD1 1 
ATOM   5820 O  OD2 . ASP B 2 185 ? 36.831  -39.725 13.931  1.00 44.84  ? 185  ASP B OD2 1 
ATOM   5821 N  N   . ASP B 2 186 ? 41.535  -38.994 10.713  1.00 20.91  ? 186  ASP B N   1 
ATOM   5822 C  CA  . ASP B 2 186 ? 42.006  -38.976 9.345   1.00 26.15  ? 186  ASP B CA  1 
ATOM   5823 C  C   . ASP B 2 186 ? 43.390  -39.465 9.040   1.00 22.83  ? 186  ASP B C   1 
ATOM   5824 O  O   . ASP B 2 186 ? 44.256  -39.586 9.913   1.00 25.23  ? 186  ASP B O   1 
ATOM   5825 C  CB  . ASP B 2 186 ? 41.820  -37.594 8.741   1.00 34.89  ? 186  ASP B CB  1 
ATOM   5826 C  CG  . ASP B 2 186 ? 40.368  -37.211 8.618   1.00 46.72  ? 186  ASP B CG  1 
ATOM   5827 O  OD1 . ASP B 2 186 ? 39.535  -38.097 8.312   1.00 53.00  ? 186  ASP B OD1 1 
ATOM   5828 O  OD2 . ASP B 2 186 ? 40.060  -36.021 8.830   1.00 42.45  ? 186  ASP B OD2 1 
ATOM   5829 N  N   . LEU B 2 187 ? 43.578  -39.739 7.760   1.00 19.89  ? 187  LEU B N   1 
ATOM   5830 C  CA  . LEU B 2 187 ? 44.845  -40.203 7.256   1.00 23.82  ? 187  LEU B CA  1 
ATOM   5831 C  C   . LEU B 2 187 ? 45.030  -39.497 5.938   1.00 16.33  ? 187  LEU B C   1 
ATOM   5832 O  O   . LEU B 2 187 ? 44.144  -39.538 5.091   1.00 5.86   ? 187  LEU B O   1 
ATOM   5833 C  CB  . LEU B 2 187 ? 44.812  -41.711 7.048   1.00 39.34  ? 187  LEU B CB  1 
ATOM   5834 C  CG  . LEU B 2 187 ? 46.025  -42.438 7.640   1.00 55.73  ? 187  LEU B CG  1 
ATOM   5835 C  CD1 . LEU B 2 187 ? 46.184  -42.091 9.113   1.00 52.66  ? 187  LEU B CD1 1 
ATOM   5836 C  CD2 . LEU B 2 187 ? 45.881  -43.944 7.457   1.00 64.14  ? 187  LEU B CD2 1 
ATOM   5837 N  N   . TYR B 2 188 ? 46.155  -38.800 5.810   1.00 22.24  ? 188  TYR B N   1 
ATOM   5838 C  CA  . TYR B 2 188 ? 46.493  -38.041 4.614   1.00 31.37  ? 188  TYR B CA  1 
ATOM   5839 C  C   . TYR B 2 188 ? 47.712  -38.686 4.020   1.00 34.04  ? 188  TYR B C   1 
ATOM   5840 O  O   . TYR B 2 188 ? 48.745  -38.835 4.680   1.00 34.15  ? 188  TYR B O   1 
ATOM   5841 C  CB  . TYR B 2 188 ? 46.800  -36.588 4.962   1.00 40.13  ? 188  TYR B CB  1 
ATOM   5842 C  CG  . TYR B 2 188 ? 45.796  -36.002 5.912   1.00 45.98  ? 188  TYR B CG  1 
ATOM   5843 C  CD1 . TYR B 2 188 ? 45.892  -36.246 7.291   1.00 59.16  ? 188  TYR B CD1 1 
ATOM   5844 C  CD2 . TYR B 2 188 ? 44.716  -35.261 5.442   1.00 34.72  ? 188  TYR B CD2 1 
ATOM   5845 C  CE1 . TYR B 2 188 ? 44.933  -35.776 8.178   1.00 60.74  ? 188  TYR B CE1 1 
ATOM   5846 C  CE2 . TYR B 2 188 ? 43.746  -34.782 6.323   1.00 54.75  ? 188  TYR B CE2 1 
ATOM   5847 C  CZ  . TYR B 2 188 ? 43.859  -35.048 7.688   1.00 62.55  ? 188  TYR B CZ  1 
ATOM   5848 O  OH  . TYR B 2 188 ? 42.885  -34.623 8.560   1.00 63.76  ? 188  TYR B OH  1 
ATOM   5849 N  N   . VAL B 2 189 ? 47.586  -39.061 2.761   1.00 43.25  ? 189  VAL B N   1 
ATOM   5850 C  CA  . VAL B 2 189 ? 48.658  -39.733 2.064   1.00 57.57  ? 189  VAL B CA  1 
ATOM   5851 C  C   . VAL B 2 189 ? 49.159  -38.905 0.889   1.00 63.62  ? 189  VAL B C   1 
ATOM   5852 O  O   . VAL B 2 189 ? 48.402  -38.610 -0.048  1.00 58.17  ? 189  VAL B O   1 
ATOM   5853 C  CB  . VAL B 2 189 ? 48.186  -41.104 1.561   1.00 61.24  ? 189  VAL B CB  1 
ATOM   5854 C  CG1 . VAL B 2 189 ? 49.351  -42.061 1.513   1.00 67.69  ? 189  VAL B CG1 1 
ATOM   5855 C  CG2 . VAL B 2 189 ? 47.073  -41.649 2.452   1.00 61.58  ? 189  VAL B CG2 1 
ATOM   5856 N  N   . GLY B 2 190 ? 50.430  -38.520 0.958   1.00 69.35  ? 190  GLY B N   1 
ATOM   5857 C  CA  . GLY B 2 190 ? 51.033  -37.728 -0.099  1.00 73.21  ? 190  GLY B CA  1 
ATOM   5858 C  C   . GLY B 2 190 ? 52.157  -38.440 -0.832  1.00 72.95  ? 190  GLY B C   1 
ATOM   5859 O  O   . GLY B 2 190 ? 53.071  -38.980 -0.209  1.00 75.41  ? 190  GLY B O   1 
ATOM   5860 N  N   . SER B 2 191 ? 52.104  -38.406 -2.159  1.00 70.73  ? 191  SER B N   1 
ATOM   5861 C  CA  . SER B 2 191 ? 53.106  -39.043 -3.003  1.00 71.12  ? 191  SER B CA  1 
ATOM   5862 C  C   . SER B 2 191 ? 53.428  -38.128 -4.172  1.00 72.15  ? 191  SER B C   1 
ATOM   5863 O  O   . SER B 2 191 ? 52.732  -37.141 -4.408  1.00 75.58  ? 191  SER B O   1 
ATOM   5864 C  CB  . SER B 2 191 ? 52.569  -40.365 -3.554  1.00 70.82  ? 191  SER B CB  1 
ATOM   5865 O  OG  . SER B 2 191 ? 51.479  -40.150 -4.442  1.00 69.82  ? 191  SER B OG  1 
ATOM   5866 N  N   . ASP B 2 192 ? 54.462  -38.473 -4.925  1.00 73.32  ? 192  ASP B N   1 
ATOM   5867 C  CA  . ASP B 2 192 ? 54.845  -37.680 -6.084  1.00 73.69  ? 192  ASP B CA  1 
ATOM   5868 C  C   . ASP B 2 192 ? 54.465  -38.411 -7.361  1.00 72.29  ? 192  ASP B C   1 
ATOM   5869 O  O   . ASP B 2 192 ? 54.923  -38.066 -8.450  1.00 70.12  ? 192  ASP B O   1 
ATOM   5870 C  CB  . ASP B 2 192 ? 56.342  -37.390 -6.050  1.00 75.23  ? 192  ASP B CB  1 
ATOM   5871 C  CG  . ASP B 2 192 ? 56.764  -36.721 -4.762  1.00 79.68  ? 192  ASP B CG  1 
ATOM   5872 O  OD1 . ASP B 2 192 ? 56.706  -35.474 -4.703  1.00 79.31  ? 192  ASP B OD1 1 
ATOM   5873 O  OD2 . ASP B 2 192 ? 57.121  -37.444 -3.802  1.00 78.07  ? 192  ASP B OD2 1 
ATOM   5874 N  N   . LEU B 2 193 ? 53.630  -39.435 -7.214  1.00 73.79  ? 193  LEU B N   1 
ATOM   5875 C  CA  . LEU B 2 193 ? 53.181  -40.222 -8.356  1.00 79.91  ? 193  LEU B CA  1 
ATOM   5876 C  C   . LEU B 2 193 ? 52.083  -39.467 -9.085  1.00 87.42  ? 193  LEU B C   1 
ATOM   5877 O  O   . LEU B 2 193 ? 51.384  -38.649 -8.478  1.00 90.40  ? 193  LEU B O   1 
ATOM   5878 C  CB  . LEU B 2 193 ? 52.645  -41.577 -7.894  1.00 68.69  ? 193  LEU B CB  1 
ATOM   5879 C  CG  . LEU B 2 193 ? 53.555  -42.390 -6.977  1.00 66.98  ? 193  LEU B CG  1 
ATOM   5880 C  CD1 . LEU B 2 193 ? 52.911  -43.734 -6.703  1.00 62.67  ? 193  LEU B CD1 1 
ATOM   5881 C  CD2 . LEU B 2 193 ? 54.932  -42.570 -7.610  1.00 65.02  ? 193  LEU B CD2 1 
ATOM   5882 N  N   . GLU B 2 194 ? 51.923  -39.748 -10.377 1.00 89.49  ? 194  GLU B N   1 
ATOM   5883 C  CA  . GLU B 2 194 ? 50.893  -39.087 -11.170 1.00 93.09  ? 194  GLU B CA  1 
ATOM   5884 C  C   . GLU B 2 194 ? 49.521  -39.632 -10.768 1.00 99.32  ? 194  GLU B C   1 
ATOM   5885 O  O   . GLU B 2 194 ? 49.394  -40.811 -10.424 1.00 101.70 ? 194  GLU B O   1 
ATOM   5886 C  CB  . GLU B 2 194 ? 51.158  -39.280 -12.666 1.00 90.50  ? 194  GLU B CB  1 
ATOM   5887 C  CG  . GLU B 2 194 ? 50.721  -40.618 -13.244 1.00 95.15  ? 194  GLU B CG  1 
ATOM   5888 C  CD  . GLU B 2 194 ? 49.284  -40.609 -13.745 1.00 92.75  ? 194  GLU B CD  1 
ATOM   5889 O  OE1 . GLU B 2 194 ? 48.822  -39.550 -14.226 1.00 91.41  ? 194  GLU B OE1 1 
ATOM   5890 O  OE2 . GLU B 2 194 ? 48.621  -41.666 -13.664 1.00 91.88  ? 194  GLU B OE2 1 
ATOM   5891 N  N   . ILE B 2 195 ? 48.505  -38.773 -10.846 1.00 104.34 ? 195  ILE B N   1 
ATOM   5892 C  CA  . ILE B 2 195 ? 47.120  -39.092 -10.469 1.00 106.37 ? 195  ILE B CA  1 
ATOM   5893 C  C   . ILE B 2 195 ? 46.703  -40.569 -10.432 1.00 106.01 ? 195  ILE B C   1 
ATOM   5894 O  O   . ILE B 2 195 ? 46.372  -41.086 -9.364  1.00 104.88 ? 195  ILE B O   1 
ATOM   5895 C  CB  . ILE B 2 195 ? 46.087  -38.248 -11.295 1.00 108.41 ? 195  ILE B CB  1 
ATOM   5896 C  CG1 . ILE B 2 195 ? 44.680  -38.403 -10.716 1.00 103.50 ? 195  ILE B CG1 1 
ATOM   5897 C  CG2 . ILE B 2 195 ? 46.105  -38.625 -12.770 1.00 111.26 ? 195  ILE B CG2 1 
ATOM   5898 C  CD1 . ILE B 2 195 ? 44.512  -37.754 -9.359  1.00 101.97 ? 195  ILE B CD1 1 
ATOM   5899 N  N   . GLY B 2 196 ? 46.762  -41.251 -11.573 1.00 105.80 ? 196  GLY B N   1 
ATOM   5900 C  CA  . GLY B 2 196 ? 46.376  -42.653 -11.634 1.00 103.12 ? 196  GLY B CA  1 
ATOM   5901 C  C   . GLY B 2 196 ? 47.215  -43.549 -10.744 1.00 99.52  ? 196  GLY B C   1 
ATOM   5902 O  O   . GLY B 2 196 ? 46.703  -44.150 -9.799  1.00 96.76  ? 196  GLY B O   1 
ATOM   5903 N  N   . GLN B 2 197 ? 48.512  -43.622 -11.032 1.00 96.79  ? 197  GLN B N   1 
ATOM   5904 C  CA  . GLN B 2 197 ? 49.436  -44.442 -10.252 1.00 92.54  ? 197  GLN B CA  1 
ATOM   5905 C  C   . GLN B 2 197 ? 49.294  -44.096 -8.776  1.00 89.11  ? 197  GLN B C   1 
ATOM   5906 O  O   . GLN B 2 197 ? 49.436  -44.954 -7.906  1.00 83.72  ? 197  GLN B O   1 
ATOM   5907 C  CB  . GLN B 2 197 ? 50.867  -44.200 -10.719 1.00 94.97  ? 197  GLN B CB  1 
ATOM   5908 C  CG  . GLN B 2 197 ? 51.108  -44.633 -12.155 1.00 103.00 ? 197  GLN B CG  1 
ATOM   5909 C  CD  . GLN B 2 197 ? 52.236  -43.875 -12.842 1.00 110.43 ? 197  GLN B CD  1 
ATOM   5910 O  OE1 . GLN B 2 197 ? 52.377  -43.944 -14.060 1.00 115.19 ? 197  GLN B OE1 1 
ATOM   5911 N  NE2 . GLN B 2 197 ? 53.034  -43.139 -12.069 1.00 115.06 ? 197  GLN B NE2 1 
ATOM   5912 N  N   . HIS B 2 198 ? 48.969  -42.832 -8.520  1.00 91.59  ? 198  HIS B N   1 
ATOM   5913 C  CA  . HIS B 2 198 ? 48.764  -42.326 -7.171  1.00 96.25  ? 198  HIS B CA  1 
ATOM   5914 C  C   . HIS B 2 198 ? 47.563  -43.030 -6.548  1.00 93.24  ? 198  HIS B C   1 
ATOM   5915 O  O   . HIS B 2 198 ? 47.712  -43.852 -5.644  1.00 89.13  ? 198  HIS B O   1 
ATOM   5916 C  CB  . HIS B 2 198 ? 48.543  -40.798 -7.214  1.00 103.34 ? 198  HIS B CB  1 
ATOM   5917 C  CG  . HIS B 2 198 ? 47.933  -40.218 -5.968  1.00 112.83 ? 198  HIS B CG  1 
ATOM   5918 N  ND1 . HIS B 2 198 ? 48.591  -40.175 -4.756  1.00 116.78 ? 198  HIS B ND1 1 
ATOM   5919 C  CD2 . HIS B 2 198 ? 46.726  -39.640 -5.757  1.00 118.74 ? 198  HIS B CD2 1 
ATOM   5920 C  CE1 . HIS B 2 198 ? 47.818  -39.597 -3.854  1.00 116.44 ? 198  HIS B CE1 1 
ATOM   5921 N  NE2 . HIS B 2 198 ? 46.680  -39.263 -4.434  1.00 120.04 ? 198  HIS B NE2 1 
ATOM   5922 N  N   . ARG B 2 199 ? 46.380  -42.753 -7.081  1.00 95.84  ? 199  ARG B N   1 
ATOM   5923 C  CA  . ARG B 2 199 ? 45.154  -43.336 -6.549  1.00 99.99  ? 199  ARG B CA  1 
ATOM   5924 C  C   . ARG B 2 199 ? 45.129  -44.867 -6.541  1.00 95.11  ? 199  ARG B C   1 
ATOM   5925 O  O   . ARG B 2 199 ? 44.558  -45.473 -5.631  1.00 94.47  ? 199  ARG B O   1 
ATOM   5926 C  CB  . ARG B 2 199 ? 43.917  -42.729 -7.239  1.00 108.43 ? 199  ARG B CB  1 
ATOM   5927 C  CG  . ARG B 2 199 ? 43.722  -41.229 -6.920  1.00 112.71 ? 199  ARG B CG  1 
ATOM   5928 C  CD  . ARG B 2 199 ? 42.358  -40.668 -7.343  1.00 114.32 ? 199  ARG B CD  1 
ATOM   5929 N  NE  . ARG B 2 199 ? 42.235  -40.459 -8.786  1.00 116.55 ? 199  ARG B NE  1 
ATOM   5930 C  CZ  . ARG B 2 199 ? 41.356  -39.636 -9.356  1.00 114.93 ? 199  ARG B CZ  1 
ATOM   5931 N  NH1 . ARG B 2 199 ? 40.515  -38.927 -8.612  1.00 111.02 ? 199  ARG B NH1 1 
ATOM   5932 N  NH2 . ARG B 2 199 ? 41.312  -39.525 -10.678 1.00 117.40 ? 199  ARG B NH2 1 
ATOM   5933 N  N   . THR B 2 200 ? 45.785  -45.492 -7.516  1.00 89.44  ? 200  THR B N   1 
ATOM   5934 C  CA  . THR B 2 200 ? 45.833  -46.952 -7.564  1.00 82.33  ? 200  THR B CA  1 
ATOM   5935 C  C   . THR B 2 200 ? 46.580  -47.403 -6.320  1.00 75.04  ? 200  THR B C   1 
ATOM   5936 O  O   . THR B 2 200 ? 46.132  -48.293 -5.594  1.00 75.48  ? 200  THR B O   1 
ATOM   5937 C  CB  . THR B 2 200 ? 46.582  -47.484 -8.816  1.00 84.09  ? 200  THR B CB  1 
ATOM   5938 O  OG1 . THR B 2 200 ? 47.833  -46.804 -8.957  1.00 85.37  ? 200  THR B OG1 1 
ATOM   5939 C  CG2 . THR B 2 200 ? 45.752  -47.287 -10.075 1.00 83.48  ? 200  THR B CG2 1 
ATOM   5940 N  N   . LYS B 2 201 ? 47.682  -46.714 -6.046  1.00 68.05  ? 201  LYS B N   1 
ATOM   5941 C  CA  . LYS B 2 201 ? 48.517  -47.013 -4.897  1.00 61.64  ? 201  LYS B CA  1 
ATOM   5942 C  C   . LYS B 2 201 ? 47.763  -46.745 -3.597  1.00 54.73  ? 201  LYS B C   1 
ATOM   5943 O  O   . LYS B 2 201 ? 47.960  -47.440 -2.599  1.00 48.39  ? 201  LYS B O   1 
ATOM   5944 C  CB  . LYS B 2 201 ? 49.801  -46.185 -4.955  1.00 59.50  ? 201  LYS B CB  1 
ATOM   5945 C  CG  . LYS B 2 201 ? 50.984  -46.842 -4.272  1.00 61.01  ? 201  LYS B CG  1 
ATOM   5946 C  CD  . LYS B 2 201 ? 51.381  -48.136 -4.983  1.00 69.79  ? 201  LYS B CD  1 
ATOM   5947 C  CE  . LYS B 2 201 ? 52.006  -47.878 -6.350  1.00 78.28  ? 201  LYS B CE  1 
ATOM   5948 N  NZ  . LYS B 2 201 ? 53.373  -47.274 -6.237  1.00 87.95  ? 201  LYS B NZ  1 
ATOM   5949 N  N   . ILE B 2 202 ? 46.889  -45.746 -3.615  1.00 59.50  ? 202  ILE B N   1 
ATOM   5950 C  CA  . ILE B 2 202 ? 46.095  -45.402 -2.435  1.00 67.20  ? 202  ILE B CA  1 
ATOM   5951 C  C   . ILE B 2 202 ? 45.092  -46.516 -2.151  1.00 65.77  ? 202  ILE B C   1 
ATOM   5952 O  O   . ILE B 2 202 ? 44.927  -46.954 -1.007  1.00 56.14  ? 202  ILE B O   1 
ATOM   5953 C  CB  . ILE B 2 202 ? 45.313  -44.080 -2.635  1.00 74.47  ? 202  ILE B CB  1 
ATOM   5954 C  CG1 . ILE B 2 202 ? 46.280  -42.898 -2.781  1.00 86.40  ? 202  ILE B CG1 1 
ATOM   5955 C  CG2 . ILE B 2 202 ? 44.371  -43.844 -1.465  1.00 78.64  ? 202  ILE B CG2 1 
ATOM   5956 C  CD1 . ILE B 2 202 ? 47.158  -42.631 -1.559  1.00 81.49  ? 202  ILE B CD1 1 
ATOM   5957 N  N   . GLU B 2 203 ? 44.413  -46.956 -3.205  1.00 67.67  ? 203  GLU B N   1 
ATOM   5958 C  CA  . GLU B 2 203 ? 43.432  -48.018 -3.087  1.00 62.31  ? 203  GLU B CA  1 
ATOM   5959 C  C   . GLU B 2 203 ? 44.174  -49.244 -2.579  1.00 54.91  ? 203  GLU B C   1 
ATOM   5960 O  O   . GLU B 2 203 ? 43.700  -49.936 -1.680  1.00 50.64  ? 203  GLU B O   1 
ATOM   5961 C  CB  . GLU B 2 203 ? 42.779  -48.294 -4.441  1.00 68.07  ? 203  GLU B CB  1 
ATOM   5962 C  CG  . GLU B 2 203 ? 41.311  -48.740 -4.342  1.00 80.69  ? 203  GLU B CG  1 
ATOM   5963 C  CD  . GLU B 2 203 ? 41.123  -50.061 -3.597  1.00 78.16  ? 203  GLU B CD  1 
ATOM   5964 O  OE1 . GLU B 2 203 ? 41.898  -51.005 -3.862  1.00 90.61  ? 203  GLU B OE1 1 
ATOM   5965 O  OE2 . GLU B 2 203 ? 40.199  -50.159 -2.756  1.00 49.40  ? 203  GLU B OE2 1 
ATOM   5966 N  N   . GLU B 2 204 ? 45.362  -49.474 -3.127  1.00 51.35  ? 204  GLU B N   1 
ATOM   5967 C  CA  . GLU B 2 204 ? 46.202  -50.591 -2.716  1.00 50.67  ? 204  GLU B CA  1 
ATOM   5968 C  C   . GLU B 2 204 ? 46.363  -50.470 -1.199  1.00 49.28  ? 204  GLU B C   1 
ATOM   5969 O  O   . GLU B 2 204 ? 46.365  -51.469 -0.475  1.00 51.06  ? 204  GLU B O   1 
ATOM   5970 C  CB  . GLU B 2 204 ? 47.561  -50.493 -3.416  1.00 53.14  ? 204  GLU B CB  1 
ATOM   5971 C  CG  . GLU B 2 204 ? 48.559  -51.607 -3.100  1.00 61.47  ? 204  GLU B CG  1 
ATOM   5972 C  CD  . GLU B 2 204 ? 49.920  -51.386 -3.766  1.00 59.83  ? 204  GLU B CD  1 
ATOM   5973 O  OE1 . GLU B 2 204 ? 49.957  -51.197 -5.000  1.00 55.69  ? 204  GLU B OE1 1 
ATOM   5974 O  OE2 . GLU B 2 204 ? 50.954  -51.396 -3.058  1.00 58.22  ? 204  GLU B OE2 1 
ATOM   5975 N  N   . LEU B 2 205 ? 46.447  -49.233 -0.722  1.00 51.03  ? 205  LEU B N   1 
ATOM   5976 C  CA  . LEU B 2 205 ? 46.573  -48.974 0.702   1.00 59.27  ? 205  LEU B CA  1 
ATOM   5977 C  C   . LEU B 2 205 ? 45.285  -49.344 1.416   1.00 58.28  ? 205  LEU B C   1 
ATOM   5978 O  O   . LEU B 2 205 ? 45.314  -49.980 2.479   1.00 55.87  ? 205  LEU B O   1 
ATOM   5979 C  CB  . LEU B 2 205 ? 46.913  -47.503 0.958   1.00 63.84  ? 205  LEU B CB  1 
ATOM   5980 C  CG  . LEU B 2 205 ? 46.951  -46.987 2.404   1.00 75.69  ? 205  LEU B CG  1 
ATOM   5981 C  CD1 . LEU B 2 205 ? 45.549  -46.659 2.892   1.00 79.13  ? 205  LEU B CD1 1 
ATOM   5982 C  CD2 . LEU B 2 205 ? 47.649  -47.977 3.341   1.00 76.64  ? 205  LEU B CD2 1 
ATOM   5983 N  N   . ARG B 2 206 ? 44.160  -48.924 0.851   1.00 59.46  ? 206  ARG B N   1 
ATOM   5984 C  CA  . ARG B 2 206 ? 42.872  -49.224 1.455   1.00 64.80  ? 206  ARG B CA  1 
ATOM   5985 C  C   . ARG B 2 206 ? 42.679  -50.737 1.581   1.00 66.14  ? 206  ARG B C   1 
ATOM   5986 O  O   . ARG B 2 206 ? 42.400  -51.230 2.672   1.00 59.12  ? 206  ARG B O   1 
ATOM   5987 C  CB  . ARG B 2 206 ? 41.728  -48.580 0.666   1.00 67.37  ? 206  ARG B CB  1 
ATOM   5988 C  CG  . ARG B 2 206 ? 40.383  -48.626 1.396   1.00 71.56  ? 206  ARG B CG  1 
ATOM   5989 C  CD  . ARG B 2 206 ? 39.463  -47.462 1.030   1.00 70.17  ? 206  ARG B CD  1 
ATOM   5990 N  NE  . ARG B 2 206 ? 38.893  -47.577 -0.307  1.00 76.92  ? 206  ARG B NE  1 
ATOM   5991 C  CZ  . ARG B 2 206 ? 39.481  -47.139 -1.418  1.00 91.26  ? 206  ARG B CZ  1 
ATOM   5992 N  NH1 . ARG B 2 206 ? 40.670  -46.548 -1.369  1.00 87.89  ? 206  ARG B NH1 1 
ATOM   5993 N  NH2 . ARG B 2 206 ? 38.873  -47.290 -2.587  1.00 99.98  ? 206  ARG B NH2 1 
ATOM   5994 N  N   . GLN B 2 207 ? 42.876  -51.471 0.484   1.00 67.04  ? 207  GLN B N   1 
ATOM   5995 C  CA  . GLN B 2 207 ? 42.746  -52.929 0.500   1.00 62.56  ? 207  GLN B CA  1 
ATOM   5996 C  C   . GLN B 2 207 ? 43.509  -53.410 1.710   1.00 55.80  ? 207  GLN B C   1 
ATOM   5997 O  O   . GLN B 2 207 ? 42.988  -54.160 2.538   1.00 55.44  ? 207  GLN B O   1 
ATOM   5998 C  CB  . GLN B 2 207 ? 43.392  -53.552 -0.735  1.00 67.72  ? 207  GLN B CB  1 
ATOM   5999 C  CG  . GLN B 2 207 ? 42.579  -53.479 -1.998  1.00 73.59  ? 207  GLN B CG  1 
ATOM   6000 C  CD  . GLN B 2 207 ? 43.301  -54.125 -3.162  1.00 81.07  ? 207  GLN B CD  1 
ATOM   6001 O  OE1 . GLN B 2 207 ? 44.076  -55.066 -2.981  1.00 81.85  ? 207  GLN B OE1 1 
ATOM   6002 N  NE2 . GLN B 2 207 ? 43.055  -53.623 -4.366  1.00 83.37  ? 207  GLN B NE2 1 
ATOM   6003 N  N   . HIS B 2 208 ? 44.737  -52.912 1.817   1.00 50.87  ? 208  HIS B N   1 
ATOM   6004 C  CA  . HIS B 2 208 ? 45.626  -53.242 2.912   1.00 50.86  ? 208  HIS B CA  1 
ATOM   6005 C  C   . HIS B 2 208 ? 44.949  -52.941 4.240   1.00 48.01  ? 208  HIS B C   1 
ATOM   6006 O  O   . HIS B 2 208 ? 45.012  -53.738 5.171   1.00 39.35  ? 208  HIS B O   1 
ATOM   6007 C  CB  . HIS B 2 208 ? 46.933  -52.453 2.776   1.00 58.52  ? 208  HIS B CB  1 
ATOM   6008 C  CG  . HIS B 2 208 ? 47.739  -52.378 4.039   1.00 82.39  ? 208  HIS B CG  1 
ATOM   6009 N  ND1 . HIS B 2 208 ? 48.377  -51.226 4.445   1.00 91.89  ? 208  HIS B ND1 1 
ATOM   6010 C  CD2 . HIS B 2 208 ? 48.008  -53.307 4.989   1.00 83.80  ? 208  HIS B CD2 1 
ATOM   6011 C  CE1 . HIS B 2 208 ? 49.001  -51.445 5.587   1.00 85.15  ? 208  HIS B CE1 1 
ATOM   6012 N  NE2 . HIS B 2 208 ? 48.794  -52.702 5.941   1.00 78.29  ? 208  HIS B NE2 1 
ATOM   6013 N  N   . LEU B 2 209 ? 44.287  -51.798 4.324   1.00 54.84  ? 209  LEU B N   1 
ATOM   6014 C  CA  . LEU B 2 209 ? 43.612  -51.414 5.555   1.00 64.97  ? 209  LEU B CA  1 
ATOM   6015 C  C   . LEU B 2 209 ? 42.320  -52.176 5.801   1.00 66.80  ? 209  LEU B C   1 
ATOM   6016 O  O   . LEU B 2 209 ? 41.899  -52.370 6.950   1.00 58.90  ? 209  LEU B O   1 
ATOM   6017 C  CB  . LEU B 2 209 ? 43.330  -49.916 5.542   1.00 72.29  ? 209  LEU B CB  1 
ATOM   6018 C  CG  . LEU B 2 209 ? 44.147  -49.099 6.540   1.00 82.82  ? 209  LEU B CG  1 
ATOM   6019 C  CD1 . LEU B 2 209 ? 45.606  -49.531 6.519   1.00 90.73  ? 209  LEU B CD1 1 
ATOM   6020 C  CD2 . LEU B 2 209 ? 44.011  -47.624 6.212   1.00 90.41  ? 209  LEU B CD2 1 
ATOM   6021 N  N   . LEU B 2 210 ? 41.707  -52.638 4.720   1.00 74.89  ? 210  LEU B N   1 
ATOM   6022 C  CA  . LEU B 2 210 ? 40.450  -53.349 4.818   1.00 82.09  ? 210  LEU B CA  1 
ATOM   6023 C  C   . LEU B 2 210 ? 40.594  -54.731 5.435   1.00 77.57  ? 210  LEU B C   1 
ATOM   6024 O  O   . LEU B 2 210 ? 39.662  -55.218 6.083   1.00 77.73  ? 210  LEU B O   1 
ATOM   6025 C  CB  . LEU B 2 210 ? 39.752  -53.414 3.458   1.00 93.84  ? 210  LEU B CB  1 
ATOM   6026 C  CG  . LEU B 2 210 ? 38.265  -53.794 3.490   1.00 106.19 ? 210  LEU B CG  1 
ATOM   6027 C  CD1 . LEU B 2 210 ? 37.517  -52.973 4.539   1.00 109.12 ? 210  LEU B CD1 1 
ATOM   6028 C  CD2 . LEU B 2 210 ? 37.656  -53.582 2.118   1.00 110.17 ? 210  LEU B CD2 1 
ATOM   6029 N  N   . ARG B 2 211 ? 41.765  -55.344 5.303   1.00 73.18  ? 211  ARG B N   1 
ATOM   6030 C  CA  . ARG B 2 211 ? 41.943  -56.659 5.898   1.00 73.17  ? 211  ARG B CA  1 
ATOM   6031 C  C   . ARG B 2 211 ? 42.145  -56.595 7.414   1.00 72.51  ? 211  ARG B C   1 
ATOM   6032 O  O   . ARG B 2 211 ? 42.864  -57.396 7.997   1.00 72.08  ? 211  ARG B O   1 
ATOM   6033 C  CB  . ARG B 2 211 ? 43.047  -57.465 5.206   1.00 73.11  ? 211  ARG B CB  1 
ATOM   6034 C  CG  . ARG B 2 211 ? 44.427  -56.849 5.190   1.00 76.52  ? 211  ARG B CG  1 
ATOM   6035 C  CD  . ARG B 2 211 ? 45.495  -57.946 5.208   1.00 78.59  ? 211  ARG B CD  1 
ATOM   6036 N  NE  . ARG B 2 211 ? 45.861  -58.323 6.577   1.00 87.20  ? 211  ARG B NE  1 
ATOM   6037 C  CZ  . ARG B 2 211 ? 45.994  -59.573 7.028   1.00 85.01  ? 211  ARG B CZ  1 
ATOM   6038 N  NH1 . ARG B 2 211 ? 45.786  -60.615 6.232   1.00 80.67  ? 211  ARG B NH1 1 
ATOM   6039 N  NH2 . ARG B 2 211 ? 46.371  -59.781 8.285   1.00 80.98  ? 211  ARG B NH2 1 
ATOM   6040 N  N   . TRP B 2 212 ? 41.504  -55.613 8.035   1.00 76.48  ? 212  TRP B N   1 
ATOM   6041 C  CA  . TRP B 2 212 ? 41.533  -55.402 9.476   1.00 80.90  ? 212  TRP B CA  1 
ATOM   6042 C  C   . TRP B 2 212 ? 40.128  -54.872 9.753   1.00 88.17  ? 212  TRP B C   1 
ATOM   6043 O  O   . TRP B 2 212 ? 39.403  -55.399 10.604  1.00 83.50  ? 212  TRP B O   1 
ATOM   6044 C  CB  . TRP B 2 212 ? 42.562  -54.336 9.859   1.00 78.17  ? 212  TRP B CB  1 
ATOM   6045 C  CG  . TRP B 2 212 ? 43.910  -54.574 9.293   1.00 80.81  ? 212  TRP B CG  1 
ATOM   6046 C  CD1 . TRP B 2 212 ? 44.336  -54.260 8.035   1.00 79.45  ? 212  TRP B CD1 1 
ATOM   6047 C  CD2 . TRP B 2 212 ? 45.017  -55.198 9.951   1.00 84.75  ? 212  TRP B CD2 1 
ATOM   6048 N  NE1 . TRP B 2 212 ? 45.638  -54.656 7.864   1.00 85.67  ? 212  TRP B NE1 1 
ATOM   6049 C  CE2 . TRP B 2 212 ? 46.085  -55.235 9.023   1.00 86.54  ? 212  TRP B CE2 1 
ATOM   6050 C  CE3 . TRP B 2 212 ? 45.215  -55.730 11.234  1.00 84.01  ? 212  TRP B CE3 1 
ATOM   6051 C  CZ2 . TRP B 2 212 ? 47.336  -55.786 9.337   1.00 87.28  ? 212  TRP B CZ2 1 
ATOM   6052 C  CZ3 . TRP B 2 212 ? 46.461  -56.277 11.548  1.00 84.80  ? 212  TRP B CZ3 1 
ATOM   6053 C  CH2 . TRP B 2 212 ? 47.504  -56.300 10.600  1.00 86.47  ? 212  TRP B CH2 1 
ATOM   6054 N  N   . GLY B 2 213 ? 39.754  -53.836 8.998   1.00 95.30  ? 213  GLY B N   1 
ATOM   6055 C  CA  . GLY B 2 213 ? 38.438  -53.237 9.127   1.00 99.46  ? 213  GLY B CA  1 
ATOM   6056 C  C   . GLY B 2 213 ? 38.390  -51.722 8.998   1.00 105.25 ? 213  GLY B C   1 
ATOM   6057 O  O   . GLY B 2 213 ? 38.137  -51.037 9.990   1.00 106.73 ? 213  GLY B O   1 
ATOM   6058 N  N   . LEU B 2 214 ? 38.627  -51.194 7.794   1.00 110.63 ? 214  LEU B N   1 
ATOM   6059 C  CA  . LEU B 2 214 ? 38.587  -49.743 7.543   1.00 115.34 ? 214  LEU B CA  1 
ATOM   6060 C  C   . LEU B 2 214 ? 38.101  -49.392 6.124   1.00 116.19 ? 214  LEU B C   1 
ATOM   6061 O  O   . LEU B 2 214 ? 38.520  -50.023 5.154   1.00 116.80 ? 214  LEU B O   1 
ATOM   6062 C  CB  . LEU B 2 214 ? 39.948  -49.104 7.841   1.00 117.46 ? 214  LEU B CB  1 
ATOM   6063 C  CG  . LEU B 2 214 ? 40.250  -48.971 9.340   1.00 120.17 ? 214  LEU B CG  1 
ATOM   6064 C  CD1 . LEU B 2 214 ? 41.698  -48.600 9.576   1.00 123.15 ? 214  LEU B CD1 1 
ATOM   6065 C  CD2 . LEU B 2 214 ? 39.316  -47.946 9.964   1.00 119.03 ? 214  LEU B CD2 1 
ATOM   6066 N  N   . THR B 2 215 ? 37.267  -48.349 6.035   1.00 115.55 ? 215  THR B N   1 
ATOM   6067 C  CA  . THR B 2 215 ? 36.620  -47.863 4.800   1.00 114.99 ? 215  THR B CA  1 
ATOM   6068 C  C   . THR B 2 215 ? 36.324  -48.869 3.681   1.00 119.47 ? 215  THR B C   1 
ATOM   6069 O  O   . THR B 2 215 ? 37.146  -49.024 2.753   1.00 126.03 ? 215  THR B O   1 
ATOM   6070 C  CB  . THR B 2 215 ? 37.247  -46.543 4.223   1.00 106.97 ? 215  THR B CB  1 
ATOM   6071 O  OG1 . THR B 2 215 ? 38.677  -46.631 4.171   1.00 95.82  ? 215  THR B OG1 1 
ATOM   6072 C  CG2 . THR B 2 215 ? 36.832  -45.345 5.062   1.00 98.15  ? 215  THR B CG2 1 
ATOM   6073 N  N   . TYR B 2 232 ? 39.496  -36.912 -0.154  1.00 121.46 ? 232  TYR B N   1 
ATOM   6074 C  CA  . TYR B 2 232 ? 39.823  -35.549 -0.671  1.00 122.43 ? 232  TYR B CA  1 
ATOM   6075 C  C   . TYR B 2 232 ? 41.114  -35.656 -1.493  1.00 116.51 ? 232  TYR B C   1 
ATOM   6076 O  O   . TYR B 2 232 ? 42.003  -36.429 -1.137  1.00 115.31 ? 232  TYR B O   1 
ATOM   6077 C  CB  . TYR B 2 232 ? 39.998  -34.574 0.505   1.00 132.76 ? 232  TYR B CB  1 
ATOM   6078 C  CG  . TYR B 2 232 ? 39.912  -33.093 0.156   1.00 145.46 ? 232  TYR B CG  1 
ATOM   6079 C  CD1 . TYR B 2 232 ? 39.795  -32.661 -1.171  1.00 151.51 ? 232  TYR B CD1 1 
ATOM   6080 C  CD2 . TYR B 2 232 ? 39.950  -32.121 1.160   1.00 148.90 ? 232  TYR B CD2 1 
ATOM   6081 C  CE1 . TYR B 2 232 ? 39.718  -31.300 -1.490  1.00 154.57 ? 232  TYR B CE1 1 
ATOM   6082 C  CE2 . TYR B 2 232 ? 39.873  -30.755 0.852   1.00 153.60 ? 232  TYR B CE2 1 
ATOM   6083 C  CZ  . TYR B 2 232 ? 39.757  -30.354 -0.475  1.00 155.46 ? 232  TYR B CZ  1 
ATOM   6084 O  OH  . TYR B 2 232 ? 39.679  -29.014 -0.787  1.00 151.49 ? 232  TYR B OH  1 
ATOM   6085 N  N   . GLU B 2 233 ? 41.182  -34.901 -2.593  1.00 109.76 ? 233  GLU B N   1 
ATOM   6086 C  CA  . GLU B 2 233 ? 42.324  -34.881 -3.517  1.00 98.70  ? 233  GLU B CA  1 
ATOM   6087 C  C   . GLU B 2 233 ? 43.101  -33.561 -3.483  1.00 89.74  ? 233  GLU B C   1 
ATOM   6088 O  O   . GLU B 2 233 ? 42.980  -32.743 -4.396  1.00 90.86  ? 233  GLU B O   1 
ATOM   6089 C  CB  . GLU B 2 233 ? 41.816  -35.114 -4.942  1.00 97.63  ? 233  GLU B CB  1 
ATOM   6090 C  CG  . GLU B 2 233 ? 41.468  -36.544 -5.251  1.00 102.88 ? 233  GLU B CG  1 
ATOM   6091 C  CD  . GLU B 2 233 ? 42.706  -37.398 -5.391  1.00 112.61 ? 233  GLU B CD  1 
ATOM   6092 O  OE1 . GLU B 2 233 ? 43.520  -37.104 -6.291  1.00 111.66 ? 233  GLU B OE1 1 
ATOM   6093 O  OE2 . GLU B 2 233 ? 42.873  -38.350 -4.601  1.00 119.41 ? 233  GLU B OE2 1 
ATOM   6094 N  N   . LEU B 2 234 ? 43.945  -33.380 -2.477  1.00 79.94  ? 234  LEU B N   1 
ATOM   6095 C  CA  . LEU B 2 234 ? 44.708  -32.144 -2.343  1.00 73.39  ? 234  LEU B CA  1 
ATOM   6096 C  C   . LEU B 2 234 ? 45.956  -32.118 -3.219  1.00 71.09  ? 234  LEU B C   1 
ATOM   6097 O  O   . LEU B 2 234 ? 46.392  -33.157 -3.712  1.00 69.42  ? 234  LEU B O   1 
ATOM   6098 C  CB  . LEU B 2 234 ? 45.114  -31.930 -0.886  1.00 76.24  ? 234  LEU B CB  1 
ATOM   6099 C  CG  . LEU B 2 234 ? 44.019  -31.980 0.181   1.00 89.67  ? 234  LEU B CG  1 
ATOM   6100 C  CD1 . LEU B 2 234 ? 43.702  -33.425 0.522   1.00 94.38  ? 234  LEU B CD1 1 
ATOM   6101 C  CD2 . LEU B 2 234 ? 44.479  -31.244 1.435   1.00 97.11  ? 234  LEU B CD2 1 
ATOM   6102 N  N   . HIS B 2 235 ? 46.518  -30.921 -3.407  1.00 67.55  ? 235  HIS B N   1 
ATOM   6103 C  CA  . HIS B 2 235 ? 47.738  -30.704 -4.197  1.00 63.06  ? 235  HIS B CA  1 
ATOM   6104 C  C   . HIS B 2 235 ? 48.531  -29.552 -3.563  1.00 62.83  ? 235  HIS B C   1 
ATOM   6105 O  O   . HIS B 2 235 ? 48.611  -28.470 -4.131  1.00 68.60  ? 235  HIS B O   1 
ATOM   6106 C  CB  . HIS B 2 235 ? 47.378  -30.336 -5.642  1.00 68.41  ? 235  HIS B CB  1 
ATOM   6107 C  CG  . HIS B 2 235 ? 46.547  -31.368 -6.337  1.00 81.25  ? 235  HIS B CG  1 
ATOM   6108 N  ND1 . HIS B 2 235 ? 45.170  -31.366 -6.304  1.00 87.44  ? 235  HIS B ND1 1 
ATOM   6109 C  CD2 . HIS B 2 235 ? 46.905  -32.465 -7.044  1.00 88.66  ? 235  HIS B CD2 1 
ATOM   6110 C  CE1 . HIS B 2 235 ? 44.713  -32.422 -6.954  1.00 92.31  ? 235  HIS B CE1 1 
ATOM   6111 N  NE2 . HIS B 2 235 ? 45.746  -33.105 -7.412  1.00 94.43  ? 235  HIS B NE2 1 
ATOM   6112 N  N   . PRO B 2 236 ? 49.147  -29.778 -2.387  1.00 61.63  ? 236  PRO B N   1 
ATOM   6113 C  CA  . PRO B 2 236 ? 49.931  -28.777 -1.647  1.00 59.26  ? 236  PRO B CA  1 
ATOM   6114 C  C   . PRO B 2 236 ? 50.961  -27.942 -2.404  1.00 59.25  ? 236  PRO B C   1 
ATOM   6115 O  O   . PRO B 2 236 ? 51.065  -26.737 -2.177  1.00 48.63  ? 236  PRO B O   1 
ATOM   6116 C  CB  . PRO B 2 236 ? 50.581  -29.606 -0.540  1.00 60.21  ? 236  PRO B CB  1 
ATOM   6117 C  CG  . PRO B 2 236 ? 49.551  -30.642 -0.267  1.00 59.72  ? 236  PRO B CG  1 
ATOM   6118 C  CD  . PRO B 2 236 ? 49.162  -31.064 -1.668  1.00 66.37  ? 236  PRO B CD  1 
ATOM   6119 N  N   . ASP B 2 237 ? 51.713  -28.566 -3.303  1.00 72.62  ? 237  ASP B N   1 
ATOM   6120 C  CA  . ASP B 2 237 ? 52.729  -27.836 -4.056  1.00 84.70  ? 237  ASP B CA  1 
ATOM   6121 C  C   . ASP B 2 237 ? 52.154  -26.736 -4.961  1.00 87.75  ? 237  ASP B C   1 
ATOM   6122 O  O   . ASP B 2 237 ? 52.896  -25.898 -5.466  1.00 90.38  ? 237  ASP B O   1 
ATOM   6123 C  CB  . ASP B 2 237 ? 53.630  -28.802 -4.851  1.00 95.44  ? 237  ASP B CB  1 
ATOM   6124 C  CG  . ASP B 2 237 ? 52.956  -29.364 -6.095  1.00 106.53 ? 237  ASP B CG  1 
ATOM   6125 O  OD1 . ASP B 2 237 ? 51.725  -29.582 -6.078  1.00 118.40 ? 237  ASP B OD1 1 
ATOM   6126 O  OD2 . ASP B 2 237 ? 53.667  -29.594 -7.097  1.00 108.03 ? 237  ASP B OD2 1 
ATOM   6127 N  N   . LYS B 2 238 ? 50.839  -26.743 -5.172  1.00 90.15  ? 238  LYS B N   1 
ATOM   6128 C  CA  . LYS B 2 238 ? 50.203  -25.721 -6.004  1.00 89.47  ? 238  LYS B CA  1 
ATOM   6129 C  C   . LYS B 2 238 ? 49.777  -24.522 -5.162  1.00 87.52  ? 238  LYS B C   1 
ATOM   6130 O  O   . LYS B 2 238 ? 49.400  -23.485 -5.708  1.00 87.89  ? 238  LYS B O   1 
ATOM   6131 C  CB  . LYS B 2 238 ? 48.968  -26.272 -6.728  1.00 89.27  ? 238  LYS B CB  1 
ATOM   6132 C  CG  . LYS B 2 238 ? 47.759  -26.490 -5.821  1.00 94.43  ? 238  LYS B CG  1 
ATOM   6133 C  CD  . LYS B 2 238 ? 46.464  -25.950 -6.412  1.00 102.00 ? 238  LYS B CD  1 
ATOM   6134 C  CE  . LYS B 2 238 ? 46.236  -24.482 -6.061  1.00 103.22 ? 238  LYS B CE  1 
ATOM   6135 N  NZ  . LYS B 2 238 ? 46.004  -24.258 -4.598  1.00 106.07 ? 238  LYS B NZ  1 
ATOM   6136 N  N   . TRP B 2 239 ? 49.802  -24.680 -3.840  1.00 85.04  ? 239  TRP B N   1 
ATOM   6137 C  CA  . TRP B 2 239 ? 49.402  -23.616 -2.923  1.00 85.36  ? 239  TRP B CA  1 
ATOM   6138 C  C   . TRP B 2 239 ? 50.376  -22.453 -2.974  1.00 93.14  ? 239  TRP B C   1 
ATOM   6139 O  O   . TRP B 2 239 ? 51.250  -22.311 -2.110  1.00 94.72  ? 239  TRP B O   1 
ATOM   6140 C  CB  . TRP B 2 239 ? 49.311  -24.141 -1.491  1.00 76.33  ? 239  TRP B CB  1 
ATOM   6141 C  CG  . TRP B 2 239 ? 48.326  -25.251 -1.307  1.00 58.56  ? 239  TRP B CG  1 
ATOM   6142 C  CD1 . TRP B 2 239 ? 47.445  -25.745 -2.237  1.00 54.45  ? 239  TRP B CD1 1 
ATOM   6143 C  CD2 . TRP B 2 239 ? 48.123  -26.013 -0.116  1.00 40.22  ? 239  TRP B CD2 1 
ATOM   6144 N  NE1 . TRP B 2 239 ? 46.708  -26.767 -1.692  1.00 40.40  ? 239  TRP B NE1 1 
ATOM   6145 C  CE2 . TRP B 2 239 ? 47.104  -26.955 -0.391  1.00 41.06  ? 239  TRP B CE2 1 
ATOM   6146 C  CE3 . TRP B 2 239 ? 48.697  -25.992 1.165   1.00 34.32  ? 239  TRP B CE3 1 
ATOM   6147 C  CZ2 . TRP B 2 239 ? 46.652  -27.869 0.571   1.00 39.91  ? 239  TRP B CZ2 1 
ATOM   6148 C  CZ3 . TRP B 2 239 ? 48.246  -26.900 2.125   1.00 24.18  ? 239  TRP B CZ3 1 
ATOM   6149 C  CH2 . TRP B 2 239 ? 47.233  -27.825 1.819   1.00 31.76  ? 239  TRP B CH2 1 
ATOM   6150 N  N   . THR B 2 240 ? 50.205  -21.616 -3.989  1.00 98.33  ? 240  THR B N   1 
ATOM   6151 C  CA  . THR B 2 240 ? 51.055  -20.458 -4.194  1.00 101.03 ? 240  THR B CA  1 
ATOM   6152 C  C   . THR B 2 240 ? 50.824  -19.354 -3.170  1.00 103.72 ? 240  THR B C   1 
ATOM   6153 O  O   . THR B 2 240 ? 49.702  -19.135 -2.701  1.00 104.96 ? 240  THR B O   1 
ATOM   6154 C  CB  . THR B 2 240 ? 50.865  -19.874 -5.615  1.00 101.64 ? 240  THR B CB  1 
ATOM   6155 O  OG1 . THR B 2 240 ? 49.466  -19.743 -5.903  1.00 103.98 ? 240  THR B OG1 1 
ATOM   6156 C  CG2 . THR B 2 240 ? 51.506  -20.778 -6.656  1.00 105.99 ? 240  THR B CG2 1 
ATOM   6157 N  N   . VAL B 2 241 ? 51.915  -18.710 -2.774  1.00 105.61 ? 241  VAL B N   1 
ATOM   6158 C  CA  . VAL B 2 241 ? 51.851  -17.595 -1.843  1.00 105.76 ? 241  VAL B CA  1 
ATOM   6159 C  C   . VAL B 2 241 ? 51.525  -16.440 -2.781  1.00 101.69 ? 241  VAL B C   1 
ATOM   6160 O  O   . VAL B 2 241 ? 52.291  -16.161 -3.707  1.00 99.12  ? 241  VAL B O   1 
ATOM   6161 C  CB  . VAL B 2 241 ? 53.222  -17.331 -1.180  1.00 110.46 ? 241  VAL B CB  1 
ATOM   6162 C  CG1 . VAL B 2 241 ? 53.109  -16.187 -0.188  1.00 113.98 ? 241  VAL B CG1 1 
ATOM   6163 C  CG2 . VAL B 2 241 ? 53.737  -18.592 -0.494  1.00 110.19 ? 241  VAL B CG2 1 
ATOM   6164 N  N   . GLN B 2 242 ? 50.371  -15.812 -2.592  1.00 100.22 ? 242  GLN B N   1 
ATOM   6165 C  CA  . GLN B 2 242 ? 49.988  -14.718 -3.474  1.00 100.95 ? 242  GLN B CA  1 
ATOM   6166 C  C   . GLN B 2 242 ? 50.190  -13.314 -2.898  1.00 103.61 ? 242  GLN B C   1 
ATOM   6167 O  O   . GLN B 2 242 ? 49.952  -13.068 -1.707  1.00 103.60 ? 242  GLN B O   1 
ATOM   6168 C  CB  . GLN B 2 242 ? 48.570  -14.927 -4.010  1.00 97.16  ? 242  GLN B CB  1 
ATOM   6169 C  CG  . GLN B 2 242 ? 48.480  -16.018 -5.082  1.00 87.45  ? 242  GLN B CG  1 
ATOM   6170 C  CD  . GLN B 2 242 ? 49.268  -15.679 -6.346  1.00 78.58  ? 242  GLN B CD  1 
ATOM   6171 O  OE1 . GLN B 2 242 ? 50.160  -16.423 -6.763  1.00 72.34  ? 242  GLN B OE1 1 
ATOM   6172 N  NE2 . GLN B 2 242 ? 48.924  -14.565 -6.972  1.00 75.86  ? 242  GLN B NE2 1 
ATOM   6173 N  N   . PRO B 2 243 ? 50.681  -12.385 -3.743  1.00 101.79 ? 243  PRO B N   1 
ATOM   6174 C  CA  . PRO B 2 243 ? 50.970  -10.981 -3.432  1.00 97.69  ? 243  PRO B CA  1 
ATOM   6175 C  C   . PRO B 2 243 ? 49.807  -10.004 -3.582  1.00 89.36  ? 243  PRO B C   1 
ATOM   6176 O  O   . PRO B 2 243 ? 48.714  -10.371 -4.028  1.00 89.74  ? 243  PRO B O   1 
ATOM   6177 C  CB  . PRO B 2 243 ? 52.066  -10.651 -4.438  1.00 103.24 ? 243  PRO B CB  1 
ATOM   6178 C  CG  . PRO B 2 243 ? 51.571  -11.356 -5.664  1.00 102.92 ? 243  PRO B CG  1 
ATOM   6179 C  CD  . PRO B 2 243 ? 51.129  -12.709 -5.115  1.00 104.12 ? 243  PRO B CD  1 
ATOM   6180 N  N   . ILE B 2 244 ? 50.081  -8.748  -3.240  1.00 74.45  ? 244  ILE B N   1 
ATOM   6181 C  CA  . ILE B 2 244 ? 49.108  -7.674  -3.330  1.00 59.79  ? 244  ILE B CA  1 
ATOM   6182 C  C   . ILE B 2 244 ? 49.438  -6.851  -4.566  1.00 61.33  ? 244  ILE B C   1 
ATOM   6183 O  O   . ILE B 2 244 ? 50.545  -6.327  -4.686  1.00 59.71  ? 244  ILE B O   1 
ATOM   6184 C  CB  . ILE B 2 244 ? 49.182  -6.746  -2.099  1.00 44.35  ? 244  ILE B CB  1 
ATOM   6185 C  CG1 . ILE B 2 244 ? 48.963  -7.543  -0.806  1.00 30.76  ? 244  ILE B CG1 1 
ATOM   6186 C  CG2 . ILE B 2 244 ? 48.175  -5.608  -2.241  1.00 37.60  ? 244  ILE B CG2 1 
ATOM   6187 C  CD1 . ILE B 2 244 ? 47.557  -8.095  -0.622  1.00 22.83  ? 244  ILE B CD1 1 
ATOM   6188 N  N   . VAL B 2 245 ? 48.489  -6.751  -5.491  1.00 64.19  ? 245  VAL B N   1 
ATOM   6189 C  CA  . VAL B 2 245 ? 48.697  -5.974  -6.709  1.00 63.20  ? 245  VAL B CA  1 
ATOM   6190 C  C   . VAL B 2 245 ? 47.968  -4.642  -6.649  1.00 57.69  ? 245  VAL B C   1 
ATOM   6191 O  O   . VAL B 2 245 ? 46.777  -4.586  -6.365  1.00 62.06  ? 245  VAL B O   1 
ATOM   6192 C  CB  . VAL B 2 245 ? 48.269  -6.750  -7.971  1.00 72.86  ? 245  VAL B CB  1 
ATOM   6193 C  CG1 . VAL B 2 245 ? 49.235  -7.891  -8.217  1.00 79.35  ? 245  VAL B CG1 1 
ATOM   6194 C  CG2 . VAL B 2 245 ? 46.833  -7.273  -7.834  1.00 78.48  ? 245  VAL B CG2 1 
ATOM   6195 N  N   . LEU B 2 246 ? 48.705  -3.567  -6.884  1.00 55.24  ? 246  LEU B N   1 
ATOM   6196 C  CA  . LEU B 2 246 ? 48.142  -2.225  -6.856  1.00 51.71  ? 246  LEU B CA  1 
ATOM   6197 C  C   . LEU B 2 246 ? 47.530  -1.853  -8.192  1.00 50.23  ? 246  LEU B C   1 
ATOM   6198 O  O   . LEU B 2 246 ? 48.039  -2.233  -9.258  1.00 47.97  ? 246  LEU B O   1 
ATOM   6199 C  CB  . LEU B 2 246 ? 49.214  -1.208  -6.472  1.00 54.49  ? 246  LEU B CB  1 
ATOM   6200 C  CG  . LEU B 2 246 ? 49.750  -1.420  -5.058  1.00 61.04  ? 246  LEU B CG  1 
ATOM   6201 C  CD1 . LEU B 2 246 ? 50.952  -0.536  -4.810  1.00 58.05  ? 246  LEU B CD1 1 
ATOM   6202 C  CD2 . LEU B 2 246 ? 48.646  -1.150  -4.047  1.00 62.84  ? 246  LEU B CD2 1 
ATOM   6203 N  N   . PRO B 2 247 ? 46.421  -1.100  -8.154  1.00 48.23  ? 247  PRO B N   1 
ATOM   6204 C  CA  . PRO B 2 247 ? 45.725  -0.669  -9.369  1.00 49.60  ? 247  PRO B CA  1 
ATOM   6205 C  C   . PRO B 2 247 ? 46.609  0.181   -10.263 1.00 45.59  ? 247  PRO B C   1 
ATOM   6206 O  O   . PRO B 2 247 ? 47.520  0.872   -9.799  1.00 41.57  ? 247  PRO B O   1 
ATOM   6207 C  CB  . PRO B 2 247 ? 44.543  0.136   -8.818  1.00 46.91  ? 247  PRO B CB  1 
ATOM   6208 C  CG  . PRO B 2 247 ? 45.069  0.670   -7.512  1.00 34.18  ? 247  PRO B CG  1 
ATOM   6209 C  CD  . PRO B 2 247 ? 45.786  -0.531  -6.953  1.00 39.52  ? 247  PRO B CD  1 
ATOM   6210 N  N   . GLU B 2 248 ? 46.365  0.091   -11.554 1.00 44.78  ? 248  GLU B N   1 
ATOM   6211 C  CA  . GLU B 2 248 ? 47.126  0.873   -12.502 1.00 53.62  ? 248  GLU B CA  1 
ATOM   6212 C  C   . GLU B 2 248 ? 46.097  1.505   -13.406 1.00 52.77  ? 248  GLU B C   1 
ATOM   6213 O  O   . GLU B 2 248 ? 45.095  0.875   -13.765 1.00 52.55  ? 248  GLU B O   1 
ATOM   6214 C  CB  . GLU B 2 248 ? 48.120  -0.007  -13.258 1.00 64.29  ? 248  GLU B CB  1 
ATOM   6215 C  CG  . GLU B 2 248 ? 49.241  -0.509  -12.344 1.00 74.58  ? 248  GLU B CG  1 
ATOM   6216 C  CD  . GLU B 2 248 ? 50.245  -1.424  -13.021 1.00 78.86  ? 248  GLU B CD  1 
ATOM   6217 O  OE1 . GLU B 2 248 ? 49.901  -2.064  -14.043 1.00 89.18  ? 248  GLU B OE1 1 
ATOM   6218 O  OE2 . GLU B 2 248 ? 51.384  -1.512  -12.506 1.00 67.05  ? 248  GLU B OE2 1 
ATOM   6219 N  N   . LYS B 2 249 ? 46.294  2.780   -13.701 1.00 48.39  ? 249  LYS B N   1 
ATOM   6220 C  CA  . LYS B 2 249 ? 45.350  3.501   -14.525 1.00 50.17  ? 249  LYS B CA  1 
ATOM   6221 C  C   . LYS B 2 249 ? 46.031  4.450   -15.473 1.00 58.65  ? 249  LYS B C   1 
ATOM   6222 O  O   . LYS B 2 249 ? 47.201  4.808   -15.296 1.00 57.43  ? 249  LYS B O   1 
ATOM   6223 C  CB  . LYS B 2 249 ? 44.389  4.292   -13.645 1.00 47.19  ? 249  LYS B CB  1 
ATOM   6224 C  CG  . LYS B 2 249 ? 43.023  3.674   -13.489 1.00 55.35  ? 249  LYS B CG  1 
ATOM   6225 C  CD  . LYS B 2 249 ? 42.293  4.287   -12.312 1.00 59.72  ? 249  LYS B CD  1 
ATOM   6226 C  CE  . LYS B 2 249 ? 42.994  3.945   -10.999 1.00 61.22  ? 249  LYS B CE  1 
ATOM   6227 N  NZ  . LYS B 2 249 ? 42.948  2.481   -10.718 1.00 75.07  ? 249  LYS B NZ  1 
ATOM   6228 N  N   . ASP B 2 250 ? 45.287  4.822   -16.507 1.00 66.73  ? 250  ASP B N   1 
ATOM   6229 C  CA  . ASP B 2 250 ? 45.766  5.763   -17.504 1.00 73.39  ? 250  ASP B CA  1 
ATOM   6230 C  C   . ASP B 2 250 ? 45.854  7.083   -16.744 1.00 76.16  ? 250  ASP B C   1 
ATOM   6231 O  O   . ASP B 2 250 ? 46.909  7.721   -16.693 1.00 75.71  ? 250  ASP B O   1 
ATOM   6232 C  CB  . ASP B 2 250 ? 44.750  5.875   -18.652 1.00 71.47  ? 250  ASP B CB  1 
ATOM   6233 C  CG  . ASP B 2 250 ? 44.542  4.560   -19.389 1.00 61.08  ? 250  ASP B CG  1 
ATOM   6234 O  OD1 . ASP B 2 250 ? 44.953  3.500   -18.877 1.00 58.55  ? 250  ASP B OD1 1 
ATOM   6235 O  OD2 . ASP B 2 250 ? 43.964  4.588   -20.493 1.00 60.17  ? 250  ASP B OD2 1 
ATOM   6236 N  N   . SER B 2 251 ? 44.747  7.425   -16.088 1.00 75.25  ? 251  SER B N   1 
ATOM   6237 C  CA  . SER B 2 251 ? 44.633  8.635   -15.292 1.00 69.54  ? 251  SER B CA  1 
ATOM   6238 C  C   . SER B 2 251 ? 44.117  8.230   -13.926 1.00 58.75  ? 251  SER B C   1 
ATOM   6239 O  O   . SER B 2 251 ? 43.486  7.179   -13.785 1.00 50.21  ? 251  SER B O   1 
ATOM   6240 C  CB  . SER B 2 251 ? 43.654  9.616   -15.941 1.00 78.02  ? 251  SER B CB  1 
ATOM   6241 O  OG  . SER B 2 251 ? 44.134  10.071  -17.197 1.00 96.33  ? 251  SER B OG  1 
ATOM   6242 N  N   . TRP B 2 252 ? 44.399  9.061   -12.926 1.00 55.81  ? 252  TRP B N   1 
ATOM   6243 C  CA  . TRP B 2 252 ? 43.968  8.814   -11.555 1.00 49.99  ? 252  TRP B CA  1 
ATOM   6244 C  C   . TRP B 2 252 ? 43.134  9.988   -11.067 1.00 44.33  ? 252  TRP B C   1 
ATOM   6245 O  O   . TRP B 2 252 ? 43.446  11.129  -11.384 1.00 50.95  ? 252  TRP B O   1 
ATOM   6246 C  CB  . TRP B 2 252 ? 45.187  8.626   -10.657 1.00 50.44  ? 252  TRP B CB  1 
ATOM   6247 C  CG  . TRP B 2 252 ? 46.014  7.415   -11.027 1.00 68.47  ? 252  TRP B CG  1 
ATOM   6248 C  CD1 . TRP B 2 252 ? 46.775  7.243   -12.156 1.00 65.23  ? 252  TRP B CD1 1 
ATOM   6249 C  CD2 . TRP B 2 252 ? 46.141  6.208   -10.270 1.00 72.78  ? 252  TRP B CD2 1 
ATOM   6250 N  NE1 . TRP B 2 252 ? 47.364  6.002   -12.145 1.00 57.40  ? 252  TRP B NE1 1 
ATOM   6251 C  CE2 . TRP B 2 252 ? 46.995  5.343   -11.002 1.00 64.46  ? 252  TRP B CE2 1 
ATOM   6252 C  CE3 . TRP B 2 252 ? 45.620  5.766   -9.046  1.00 76.30  ? 252  TRP B CE3 1 
ATOM   6253 C  CZ2 . TRP B 2 252 ? 47.334  4.069   -10.546 1.00 71.94  ? 252  TRP B CZ2 1 
ATOM   6254 C  CZ3 . TRP B 2 252 ? 45.957  4.501   -8.594  1.00 82.10  ? 252  TRP B CZ3 1 
ATOM   6255 C  CH2 . TRP B 2 252 ? 46.808  3.666   -9.345  1.00 80.85  ? 252  TRP B CH2 1 
ATOM   6256 N  N   . THR B 2 253 ? 42.042  9.707   -10.360 1.00 40.21  ? 253  THR B N   1 
ATOM   6257 C  CA  . THR B 2 253 ? 41.173  10.762  -9.841  1.00 30.37  ? 253  THR B CA  1 
ATOM   6258 C  C   . THR B 2 253 ? 41.452  10.983  -8.380  1.00 26.43  ? 253  THR B C   1 
ATOM   6259 O  O   . THR B 2 253 ? 42.053  10.132  -7.712  1.00 22.13  ? 253  THR B O   1 
ATOM   6260 C  CB  . THR B 2 253 ? 39.668  10.413  -9.942  1.00 39.81  ? 253  THR B CB  1 
ATOM   6261 O  OG1 . THR B 2 253 ? 39.384  9.254   -9.139  1.00 38.99  ? 253  THR B OG1 1 
ATOM   6262 C  CG2 . THR B 2 253 ? 39.251  10.180  -11.399 1.00 38.83  ? 253  THR B CG2 1 
ATOM   6263 N  N   . VAL B 2 254 ? 40.930  12.093  -7.876  1.00 33.92  ? 254  VAL B N   1 
ATOM   6264 C  CA  . VAL B 2 254 ? 41.069  12.474  -6.476  1.00 37.37  ? 254  VAL B CA  1 
ATOM   6265 C  C   . VAL B 2 254 ? 40.645  11.302  -5.588  1.00 32.67  ? 254  VAL B C   1 
ATOM   6266 O  O   . VAL B 2 254 ? 41.333  10.953  -4.636  1.00 34.91  ? 254  VAL B O   1 
ATOM   6267 C  CB  . VAL B 2 254 ? 40.173  13.701  -6.139  1.00 44.75  ? 254  VAL B CB  1 
ATOM   6268 C  CG1 . VAL B 2 254 ? 40.373  14.121  -4.692  1.00 52.55  ? 254  VAL B CG1 1 
ATOM   6269 C  CG2 . VAL B 2 254 ? 40.467  14.867  -7.079  1.00 36.23  ? 254  VAL B CG2 1 
ATOM   6270 N  N   . ASN B 2 255 ? 39.526  10.675  -5.927  1.00 31.80  ? 255  ASN B N   1 
ATOM   6271 C  CA  . ASN B 2 255 ? 39.037  9.549   -5.148  1.00 35.60  ? 255  ASN B CA  1 
ATOM   6272 C  C   . ASN B 2 255 ? 39.955  8.349   -5.279  1.00 34.05  ? 255  ASN B C   1 
ATOM   6273 O  O   . ASN B 2 255 ? 40.370  7.771   -4.273  1.00 34.76  ? 255  ASN B O   1 
ATOM   6274 C  CB  . ASN B 2 255 ? 37.626  9.156   -5.583  1.00 46.96  ? 255  ASN B CB  1 
ATOM   6275 C  CG  . ASN B 2 255 ? 37.078  7.975   -4.792  1.00 52.72  ? 255  ASN B CG  1 
ATOM   6276 O  OD1 . ASN B 2 255 ? 36.588  7.009   -5.376  1.00 66.32  ? 255  ASN B OD1 1 
ATOM   6277 N  ND2 . ASN B 2 255 ? 37.155  8.049   -3.461  1.00 48.56  ? 255  ASN B ND2 1 
ATOM   6278 N  N   . ASP B 2 256 ? 40.274  7.988   -6.521  1.00 29.73  ? 256  ASP B N   1 
ATOM   6279 C  CA  . ASP B 2 256 ? 41.135  6.844   -6.802  1.00 19.84  ? 256  ASP B CA  1 
ATOM   6280 C  C   . ASP B 2 256 ? 42.310  6.842   -5.860  1.00 11.94  ? 256  ASP B C   1 
ATOM   6281 O  O   . ASP B 2 256 ? 42.538  5.877   -5.100  1.00 5.77   ? 256  ASP B O   1 
ATOM   6282 C  CB  . ASP B 2 256 ? 41.660  6.909   -8.239  1.00 19.23  ? 256  ASP B CB  1 
ATOM   6283 C  CG  . ASP B 2 256 ? 40.762  6.192   -9.225  1.00 33.70  ? 256  ASP B CG  1 
ATOM   6284 O  OD1 . ASP B 2 256 ? 40.213  5.119   -8.870  1.00 53.95  ? 256  ASP B OD1 1 
ATOM   6285 O  OD2 . ASP B 2 256 ? 40.627  6.691   -10.367 1.00 23.00  ? 256  ASP B OD2 1 
ATOM   6286 N  N   . ILE B 2 257 ? 43.035  7.955   -5.905  1.00 2.00   ? 257  ILE B N   1 
ATOM   6287 C  CA  . ILE B 2 257 ? 44.212  8.133   -5.083  1.00 5.24   ? 257  ILE B CA  1 
ATOM   6288 C  C   . ILE B 2 257 ? 43.829  7.954   -3.624  1.00 3.88   ? 257  ILE B C   1 
ATOM   6289 O  O   . ILE B 2 257 ? 44.409  7.106   -2.937  1.00 4.20   ? 257  ILE B O   1 
ATOM   6290 C  CB  . ILE B 2 257 ? 44.850  9.504   -5.357  1.00 10.46  ? 257  ILE B CB  1 
ATOM   6291 C  CG1 . ILE B 2 257 ? 45.255  9.563   -6.838  1.00 2.75   ? 257  ILE B CG1 1 
ATOM   6292 C  CG2 . ILE B 2 257 ? 46.029  9.780   -4.380  1.00 12.02  ? 257  ILE B CG2 1 
ATOM   6293 C  CD1 . ILE B 2 257 ? 45.793  10.919  -7.330  1.00 2.00   ? 257  ILE B CD1 1 
ATOM   6294 N  N   . GLN B 2 258 ? 42.780  8.665   -3.206  1.00 3.19   ? 258  GLN B N   1 
ATOM   6295 C  CA  . GLN B 2 258 ? 42.263  8.619   -1.835  1.00 12.76  ? 258  GLN B CA  1 
ATOM   6296 C  C   . GLN B 2 258 ? 42.115  7.193   -1.287  1.00 7.56   ? 258  GLN B C   1 
ATOM   6297 O  O   . GLN B 2 258 ? 42.574  6.880   -0.179  1.00 2.00   ? 258  GLN B O   1 
ATOM   6298 C  CB  . GLN B 2 258 ? 40.909  9.325   -1.773  1.00 16.60  ? 258  GLN B CB  1 
ATOM   6299 C  CG  . GLN B 2 258 ? 40.969  10.834  -1.718  1.00 14.53  ? 258  GLN B CG  1 
ATOM   6300 C  CD  . GLN B 2 258 ? 39.582  11.449  -1.604  1.00 45.53  ? 258  GLN B CD  1 
ATOM   6301 O  OE1 . GLN B 2 258 ? 38.583  10.738  -1.456  1.00 65.83  ? 258  GLN B OE1 1 
ATOM   6302 N  NE2 . GLN B 2 258 ? 39.511  12.769  -1.673  1.00 53.58  ? 258  GLN B NE2 1 
ATOM   6303 N  N   . LYS B 2 259 ? 41.457  6.348   -2.071  1.00 6.94   ? 259  LYS B N   1 
ATOM   6304 C  CA  . LYS B 2 259 ? 41.262  4.963   -1.695  1.00 23.83  ? 259  LYS B CA  1 
ATOM   6305 C  C   . LYS B 2 259 ? 42.654  4.342   -1.550  1.00 28.00  ? 259  LYS B C   1 
ATOM   6306 O  O   . LYS B 2 259 ? 43.032  3.827   -0.477  1.00 15.59  ? 259  LYS B O   1 
ATOM   6307 C  CB  . LYS B 2 259 ? 40.438  4.228   -2.773  1.00 30.52  ? 259  LYS B CB  1 
ATOM   6308 C  CG  . LYS B 2 259 ? 38.986  4.729   -2.878  1.00 49.05  ? 259  LYS B CG  1 
ATOM   6309 C  CD  . LYS B 2 259 ? 38.020  3.709   -3.500  1.00 57.62  ? 259  LYS B CD  1 
ATOM   6310 C  CE  . LYS B 2 259 ? 38.121  3.642   -5.023  1.00 66.50  ? 259  LYS B CE  1 
ATOM   6311 N  NZ  . LYS B 2 259 ? 37.099  2.710   -5.597  1.00 71.83  ? 259  LYS B NZ  1 
ATOM   6312 N  N   . LEU B 2 260 ? 43.450  4.514   -2.603  1.00 29.48  ? 260  LEU B N   1 
ATOM   6313 C  CA  . LEU B 2 260 ? 44.791  3.978   -2.650  1.00 26.65  ? 260  LEU B CA  1 
ATOM   6314 C  C   . LEU B 2 260 ? 45.607  4.313   -1.408  1.00 23.14  ? 260  LEU B C   1 
ATOM   6315 O  O   . LEU B 2 260 ? 46.190  3.421   -0.779  1.00 15.21  ? 260  LEU B O   1 
ATOM   6316 C  CB  . LEU B 2 260 ? 45.488  4.473   -3.904  1.00 31.21  ? 260  LEU B CB  1 
ATOM   6317 C  CG  . LEU B 2 260 ? 46.770  3.702   -4.196  1.00 51.31  ? 260  LEU B CG  1 
ATOM   6318 C  CD1 . LEU B 2 260 ? 46.525  2.196   -4.072  1.00 50.24  ? 260  LEU B CD1 1 
ATOM   6319 C  CD2 . LEU B 2 260 ? 47.260  4.059   -5.581  1.00 58.65  ? 260  LEU B CD2 1 
ATOM   6320 N  N   . VAL B 2 261 ? 45.595  5.590   -1.037  1.00 23.04  ? 261  VAL B N   1 
ATOM   6321 C  CA  . VAL B 2 261 ? 46.323  6.081   0.127   1.00 25.06  ? 261  VAL B CA  1 
ATOM   6322 C  C   . VAL B 2 261 ? 45.854  5.403   1.418   1.00 26.11  ? 261  VAL B C   1 
ATOM   6323 O  O   . VAL B 2 261 ? 46.670  5.006   2.255   1.00 24.72  ? 261  VAL B O   1 
ATOM   6324 C  CB  . VAL B 2 261 ? 46.192  7.636   0.264   1.00 25.69  ? 261  VAL B CB  1 
ATOM   6325 C  CG1 . VAL B 2 261 ? 46.431  8.073   1.708   1.00 44.20  ? 261  VAL B CG1 1 
ATOM   6326 C  CG2 . VAL B 2 261 ? 47.210  8.340   -0.626  1.00 3.75   ? 261  VAL B CG2 1 
ATOM   6327 N  N   . GLY B 2 262 ? 44.544  5.274   1.581   1.00 21.71  ? 262  GLY B N   1 
ATOM   6328 C  CA  . GLY B 2 262 ? 44.030  4.651   2.781   1.00 17.81  ? 262  GLY B CA  1 
ATOM   6329 C  C   . GLY B 2 262 ? 44.542  3.233   2.918   1.00 21.32  ? 262  GLY B C   1 
ATOM   6330 O  O   . GLY B 2 262 ? 44.947  2.804   4.002   1.00 21.74  ? 262  GLY B O   1 
ATOM   6331 N  N   . LYS B 2 263 ? 44.547  2.514   1.799   1.00 28.38  ? 263  LYS B N   1 
ATOM   6332 C  CA  . LYS B 2 263 ? 44.984  1.121   1.754   1.00 20.99  ? 263  LYS B CA  1 
ATOM   6333 C  C   . LYS B 2 263 ? 46.451  0.968   2.117   1.00 12.45  ? 263  LYS B C   1 
ATOM   6334 O  O   . LYS B 2 263 ? 46.818  0.212   3.017   1.00 5.96   ? 263  LYS B O   1 
ATOM   6335 C  CB  . LYS B 2 263 ? 44.680  0.531   0.368   1.00 18.08  ? 263  LYS B CB  1 
ATOM   6336 C  CG  . LYS B 2 263 ? 43.174  0.367   0.140   1.00 31.19  ? 263  LYS B CG  1 
ATOM   6337 C  CD  . LYS B 2 263 ? 42.802  0.180   -1.317  1.00 39.08  ? 263  LYS B CD  1 
ATOM   6338 C  CE  . LYS B 2 263 ? 41.293  0.271   -1.486  1.00 40.79  ? 263  LYS B CE  1 
ATOM   6339 N  NZ  . LYS B 2 263 ? 40.882  0.251   -2.917  1.00 47.78  ? 263  LYS B NZ  1 
ATOM   6340 N  N   . LEU B 2 264 ? 47.291  1.734   1.454   1.00 4.56   ? 264  LEU B N   1 
ATOM   6341 C  CA  . LEU B 2 264 ? 48.701  1.664   1.735   1.00 6.98   ? 264  LEU B CA  1 
ATOM   6342 C  C   . LEU B 2 264 ? 49.005  2.128   3.150   1.00 6.37   ? 264  LEU B C   1 
ATOM   6343 O  O   . LEU B 2 264 ? 49.860  1.556   3.824   1.00 3.90   ? 264  LEU B O   1 
ATOM   6344 C  CB  . LEU B 2 264 ? 49.446  2.511   0.732   1.00 11.14  ? 264  LEU B CB  1 
ATOM   6345 C  CG  . LEU B 2 264 ? 49.100  2.046   -0.661  1.00 8.16   ? 264  LEU B CG  1 
ATOM   6346 C  CD1 . LEU B 2 264 ? 49.626  3.045   -1.665  1.00 24.97  ? 264  LEU B CD1 1 
ATOM   6347 C  CD2 . LEU B 2 264 ? 49.667  0.653   -0.868  1.00 13.96  ? 264  LEU B CD2 1 
ATOM   6348 N  N   . ASN B 2 265 ? 48.318  3.175   3.590   1.00 17.13  ? 265  ASN B N   1 
ATOM   6349 C  CA  . ASN B 2 265 ? 48.511  3.704   4.936   1.00 28.42  ? 265  ASN B CA  1 
ATOM   6350 C  C   . ASN B 2 265 ? 48.231  2.592   5.952   1.00 27.12  ? 265  ASN B C   1 
ATOM   6351 O  O   . ASN B 2 265 ? 48.872  2.514   7.004   1.00 27.38  ? 265  ASN B O   1 
ATOM   6352 C  CB  . ASN B 2 265 ? 47.586  4.904   5.187   1.00 40.81  ? 265  ASN B CB  1 
ATOM   6353 C  CG  . ASN B 2 265 ? 47.882  5.596   6.507   1.00 62.62  ? 265  ASN B CG  1 
ATOM   6354 O  OD1 . ASN B 2 265 ? 48.936  6.205   6.672   1.00 62.10  ? 265  ASN B OD1 1 
ATOM   6355 N  ND2 . ASN B 2 265 ? 46.959  5.492   7.459   1.00 78.63  ? 265  ASN B ND2 1 
ATOM   6356 N  N   . TRP B 2 266 ? 47.248  1.752   5.649   1.00 18.72  ? 266  TRP B N   1 
ATOM   6357 C  CA  . TRP B 2 266 ? 46.931  0.646   6.526   1.00 28.34  ? 266  TRP B CA  1 
ATOM   6358 C  C   . TRP B 2 266 ? 48.077  -0.350  6.346   1.00 26.46  ? 266  TRP B C   1 
ATOM   6359 O  O   . TRP B 2 266 ? 48.723  -0.786  7.309   1.00 21.68  ? 266  TRP B O   1 
ATOM   6360 C  CB  . TRP B 2 266 ? 45.595  0.018   6.107   1.00 50.32  ? 266  TRP B CB  1 
ATOM   6361 C  CG  . TRP B 2 266 ? 45.165  -1.159  6.962   1.00 73.70  ? 266  TRP B CG  1 
ATOM   6362 C  CD1 . TRP B 2 266 ? 44.540  -1.114  8.185   1.00 80.91  ? 266  TRP B CD1 1 
ATOM   6363 C  CD2 . TRP B 2 266 ? 45.353  -2.547  6.661   1.00 75.54  ? 266  TRP B CD2 1 
ATOM   6364 N  NE1 . TRP B 2 266 ? 44.337  -2.390  8.661   1.00 79.77  ? 266  TRP B NE1 1 
ATOM   6365 C  CE2 . TRP B 2 266 ? 44.825  -3.289  7.749   1.00 78.28  ? 266  TRP B CE2 1 
ATOM   6366 C  CE3 . TRP B 2 266 ? 45.919  -3.239  5.582   1.00 73.70  ? 266  TRP B CE3 1 
ATOM   6367 C  CZ2 . TRP B 2 266 ? 44.848  -4.688  7.785   1.00 79.48  ? 266  TRP B CZ2 1 
ATOM   6368 C  CZ3 . TRP B 2 266 ? 45.942  -4.629  5.621   1.00 80.91  ? 266  TRP B CZ3 1 
ATOM   6369 C  CH2 . TRP B 2 266 ? 45.409  -5.339  6.716   1.00 81.41  ? 266  TRP B CH2 1 
ATOM   6370 N  N   . ALA B 2 267 ? 48.380  -0.614  5.079   1.00 26.43  ? 267  ALA B N   1 
ATOM   6371 C  CA  . ALA B 2 267 ? 49.423  -1.542  4.672   1.00 15.08  ? 267  ALA B CA  1 
ATOM   6372 C  C   . ALA B 2 267 ? 50.747  -1.315  5.361   1.00 10.17  ? 267  ALA B C   1 
ATOM   6373 O  O   . ALA B 2 267 ? 51.498  -2.263  5.562   1.00 16.25  ? 267  ALA B O   1 
ATOM   6374 C  CB  . ALA B 2 267 ? 49.609  -1.484  3.170   1.00 2.00   ? 267  ALA B CB  1 
ATOM   6375 N  N   . SER B 2 268 ? 51.017  -0.079  5.767   1.00 22.17  ? 268  SER B N   1 
ATOM   6376 C  CA  . SER B 2 268 ? 52.279  0.272   6.433   1.00 36.02  ? 268  SER B CA  1 
ATOM   6377 C  C   . SER B 2 268 ? 52.540  -0.454  7.762   1.00 39.39  ? 268  SER B C   1 
ATOM   6378 O  O   . SER B 2 268 ? 53.670  -0.467  8.258   1.00 38.25  ? 268  SER B O   1 
ATOM   6379 C  CB  . SER B 2 268 ? 52.351  1.780   6.660   1.00 32.49  ? 268  SER B CB  1 
ATOM   6380 O  OG  . SER B 2 268 ? 51.348  2.194   7.571   1.00 34.66  ? 268  SER B OG  1 
ATOM   6381 N  N   . GLN B 2 269 ? 51.496  -1.031  8.348   1.00 43.02  ? 269  GLN B N   1 
ATOM   6382 C  CA  . GLN B 2 269 ? 51.637  -1.757  9.605   1.00 49.45  ? 269  GLN B CA  1 
ATOM   6383 C  C   . GLN B 2 269 ? 52.410  -3.067  9.384   1.00 55.26  ? 269  GLN B C   1 
ATOM   6384 O  O   . GLN B 2 269 ? 52.914  -3.676  10.336  1.00 59.06  ? 269  GLN B O   1 
ATOM   6385 C  CB  . GLN B 2 269 ? 50.253  -2.057  10.185  1.00 50.32  ? 269  GLN B CB  1 
ATOM   6386 C  CG  . GLN B 2 269 ? 49.388  -0.833  10.440  1.00 49.88  ? 269  GLN B CG  1 
ATOM   6387 C  CD  . GLN B 2 269 ? 47.929  -1.195  10.650  1.00 49.83  ? 269  GLN B CD  1 
ATOM   6388 O  OE1 . GLN B 2 269 ? 47.184  -1.392  9.692   1.00 39.44  ? 269  GLN B OE1 1 
ATOM   6389 N  NE2 . GLN B 2 269 ? 47.516  -1.294  11.910  1.00 48.05  ? 269  GLN B NE2 1 
ATOM   6390 N  N   . ILE B 2 270 ? 52.479  -3.492  8.121   1.00 54.71  ? 270  ILE B N   1 
ATOM   6391 C  CA  . ILE B 2 270 ? 53.161  -4.726  7.718   1.00 56.07  ? 270  ILE B CA  1 
ATOM   6392 C  C   . ILE B 2 270 ? 54.540  -4.431  7.122   1.00 50.73  ? 270  ILE B C   1 
ATOM   6393 O  O   . ILE B 2 270 ? 55.547  -4.980  7.568   1.00 48.17  ? 270  ILE B O   1 
ATOM   6394 C  CB  . ILE B 2 270 ? 52.311  -5.506  6.680   1.00 68.83  ? 270  ILE B CB  1 
ATOM   6395 C  CG1 . ILE B 2 270 ? 50.943  -5.858  7.275   1.00 67.17  ? 270  ILE B CG1 1 
ATOM   6396 C  CG2 . ILE B 2 270 ? 53.040  -6.769  6.231   1.00 75.46  ? 270  ILE B CG2 1 
ATOM   6397 C  CD1 . ILE B 2 270 ? 49.969  -6.430  6.268   1.00 66.60  ? 270  ILE B CD1 1 
ATOM   6398 N  N   . TYR B 2 271 ? 54.565  -3.631  6.060   1.00 46.31  ? 271  TYR B N   1 
ATOM   6399 C  CA  . TYR B 2 271 ? 55.817  -3.235  5.428   1.00 45.81  ? 271  TYR B CA  1 
ATOM   6400 C  C   . TYR B 2 271 ? 55.964  -1.752  5.748   1.00 41.15  ? 271  TYR B C   1 
ATOM   6401 O  O   . TYR B 2 271 ? 55.349  -0.907  5.083   1.00 33.63  ? 271  TYR B O   1 
ATOM   6402 C  CB  . TYR B 2 271 ? 55.754  -3.398  3.910   1.00 58.80  ? 271  TYR B CB  1 
ATOM   6403 C  CG  . TYR B 2 271 ? 55.410  -4.779  3.413   1.00 69.38  ? 271  TYR B CG  1 
ATOM   6404 C  CD1 . TYR B 2 271 ? 54.087  -5.183  3.299   1.00 77.36  ? 271  TYR B CD1 1 
ATOM   6405 C  CD2 . TYR B 2 271 ? 56.409  -5.671  3.025   1.00 76.01  ? 271  TYR B CD2 1 
ATOM   6406 C  CE1 . TYR B 2 271 ? 53.760  -6.439  2.810   1.00 89.06  ? 271  TYR B CE1 1 
ATOM   6407 C  CE2 . TYR B 2 271 ? 56.094  -6.932  2.534   1.00 84.18  ? 271  TYR B CE2 1 
ATOM   6408 C  CZ  . TYR B 2 271 ? 54.766  -7.310  2.431   1.00 89.53  ? 271  TYR B CZ  1 
ATOM   6409 O  OH  . TYR B 2 271 ? 54.434  -8.563  1.969   1.00 90.64  ? 271  TYR B OH  1 
ATOM   6410 N  N   . PRO B 2 272 ? 56.729  -1.417  6.806   1.00 40.66  ? 272  PRO B N   1 
ATOM   6411 C  CA  . PRO B 2 272 ? 56.953  -0.024  7.221   1.00 34.31  ? 272  PRO B CA  1 
ATOM   6412 C  C   . PRO B 2 272 ? 57.698  0.824   6.187   1.00 23.71  ? 272  PRO B C   1 
ATOM   6413 O  O   . PRO B 2 272 ? 57.817  2.030   6.346   1.00 26.26  ? 272  PRO B O   1 
ATOM   6414 C  CB  . PRO B 2 272 ? 57.750  -0.180  8.516   1.00 31.85  ? 272  PRO B CB  1 
ATOM   6415 C  CG  . PRO B 2 272 ? 57.239  -1.499  9.055   1.00 29.06  ? 272  PRO B CG  1 
ATOM   6416 C  CD  . PRO B 2 272 ? 57.274  -2.344  7.813   1.00 34.56  ? 272  PRO B CD  1 
ATOM   6417 N  N   . GLY B 2 273 ? 58.192  0.190   5.131   1.00 18.27  ? 273  GLY B N   1 
ATOM   6418 C  CA  . GLY B 2 273 ? 58.898  0.922   4.099   1.00 23.51  ? 273  GLY B CA  1 
ATOM   6419 C  C   . GLY B 2 273 ? 57.960  1.599   3.119   1.00 24.80  ? 273  GLY B C   1 
ATOM   6420 O  O   . GLY B 2 273 ? 58.375  2.440   2.327   1.00 22.13  ? 273  GLY B O   1 
ATOM   6421 N  N   . ILE B 2 274 ? 56.699  1.197   3.137   1.00 30.28  ? 274  ILE B N   1 
ATOM   6422 C  CA  . ILE B 2 274 ? 55.703  1.780   2.255   1.00 38.53  ? 274  ILE B CA  1 
ATOM   6423 C  C   . ILE B 2 274 ? 55.514  3.249   2.653   1.00 37.16  ? 274  ILE B C   1 
ATOM   6424 O  O   . ILE B 2 274 ? 55.500  3.571   3.848   1.00 31.68  ? 274  ILE B O   1 
ATOM   6425 C  CB  . ILE B 2 274 ? 54.362  1.024   2.380   1.00 52.04  ? 274  ILE B CB  1 
ATOM   6426 C  CG1 . ILE B 2 274 ? 54.556  -0.447  2.012   1.00 66.83  ? 274  ILE B CG1 1 
ATOM   6427 C  CG2 . ILE B 2 274 ? 53.313  1.647   1.472   1.00 53.97  ? 274  ILE B CG2 1 
ATOM   6428 C  CD1 . ILE B 2 274 ? 53.294  -1.278  2.130   1.00 80.08  ? 274  ILE B CD1 1 
ATOM   6429 N  N   . LYS B 2 275 ? 55.377  4.131   1.659   1.00 40.54  ? 275  LYS B N   1 
ATOM   6430 C  CA  . LYS B 2 275 ? 55.202  5.570   1.908   1.00 48.09  ? 275  LYS B CA  1 
ATOM   6431 C  C   . LYS B 2 275 ? 54.155  6.249   1.019   1.00 47.13  ? 275  LYS B C   1 
ATOM   6432 O  O   . LYS B 2 275 ? 54.068  5.970   -0.174  1.00 47.55  ? 275  LYS B O   1 
ATOM   6433 C  CB  . LYS B 2 275 ? 56.552  6.296   1.803   1.00 55.29  ? 275  LYS B CB  1 
ATOM   6434 C  CG  . LYS B 2 275 ? 57.380  6.181   3.075   1.00 54.40  ? 275  LYS B CG  1 
ATOM   6435 C  CD  . LYS B 2 275 ? 58.849  6.427   2.835   1.00 60.52  ? 275  LYS B CD  1 
ATOM   6436 C  CE  . LYS B 2 275 ? 59.638  6.191   4.123   1.00 69.53  ? 275  LYS B CE  1 
ATOM   6437 N  NZ  . LYS B 2 275 ? 61.114  6.296   3.927   1.00 63.43  ? 275  LYS B NZ  1 
ATOM   6438 N  N   . VAL B 2 276 ? 53.365  7.147   1.607   1.00 47.01  ? 276  VAL B N   1 
ATOM   6439 C  CA  . VAL B 2 276 ? 52.311  7.848   0.867   1.00 58.50  ? 276  VAL B CA  1 
ATOM   6440 C  C   . VAL B 2 276 ? 52.449  9.372   0.879   1.00 64.43  ? 276  VAL B C   1 
ATOM   6441 O  O   . VAL B 2 276 ? 51.548  10.081  0.423   1.00 66.64  ? 276  VAL B O   1 
ATOM   6442 C  CB  . VAL B 2 276 ? 50.902  7.521   1.437   1.00 65.26  ? 276  VAL B CB  1 
ATOM   6443 C  CG1 . VAL B 2 276 ? 50.567  6.050   1.264   1.00 63.77  ? 276  VAL B CG1 1 
ATOM   6444 C  CG2 . VAL B 2 276 ? 50.822  7.923   2.906   1.00 65.91  ? 276  VAL B CG2 1 
ATOM   6445 N  N   . ARG B 2 277 ? 53.581  9.874   1.363   1.00 63.31  ? 277  ARG B N   1 
ATOM   6446 C  CA  . ARG B 2 277 ? 53.799  11.315  1.457   1.00 55.17  ? 277  ARG B CA  1 
ATOM   6447 C  C   . ARG B 2 277 ? 53.565  12.072  0.165   1.00 42.15  ? 277  ARG B C   1 
ATOM   6448 O  O   . ARG B 2 277 ? 52.697  12.945  0.103   1.00 32.12  ? 277  ARG B O   1 
ATOM   6449 C  CB  . ARG B 2 277 ? 55.189  11.609  2.017   1.00 64.55  ? 277  ARG B CB  1 
ATOM   6450 C  CG  . ARG B 2 277 ? 55.427  10.987  3.393   1.00 89.55  ? 277  ARG B CG  1 
ATOM   6451 C  CD  . ARG B 2 277 ? 54.135  10.941  4.213   1.00 112.62 ? 277  ARG B CD  1 
ATOM   6452 N  NE  . ARG B 2 277 ? 54.357  10.699  5.639   1.00 139.32 ? 277  ARG B NE  1 
ATOM   6453 C  CZ  . ARG B 2 277 ? 54.612  9.514   6.192   1.00 156.83 ? 277  ARG B CZ  1 
ATOM   6454 N  NH1 . ARG B 2 277 ? 54.659  8.404   5.460   1.00 163.16 ? 277  ARG B NH1 1 
ATOM   6455 N  NH2 . ARG B 2 277 ? 54.794  9.435   7.506   1.00 165.02 ? 277  ARG B NH2 1 
ATOM   6456 N  N   . GLN B 2 278 ? 54.298  11.696  -0.875  1.00 41.94  ? 278  GLN B N   1 
ATOM   6457 C  CA  . GLN B 2 278 ? 54.170  12.336  -2.181  1.00 48.29  ? 278  GLN B CA  1 
ATOM   6458 C  C   . GLN B 2 278 ? 52.744  12.355  -2.699  1.00 52.91  ? 278  GLN B C   1 
ATOM   6459 O  O   . GLN B 2 278 ? 52.259  13.367  -3.209  1.00 52.94  ? 278  GLN B O   1 
ATOM   6460 C  CB  . GLN B 2 278 ? 55.101  11.669  -3.184  1.00 46.14  ? 278  GLN B CB  1 
ATOM   6461 C  CG  . GLN B 2 278 ? 56.550  11.898  -2.817  1.00 64.83  ? 278  GLN B CG  1 
ATOM   6462 C  CD  . GLN B 2 278 ? 56.769  13.304  -2.278  1.00 69.72  ? 278  GLN B CD  1 
ATOM   6463 O  OE1 . GLN B 2 278 ? 56.996  13.495  -1.079  1.00 60.99  ? 278  GLN B OE1 1 
ATOM   6464 N  NE2 . GLN B 2 278 ? 56.629  14.301  -3.152  1.00 75.40  ? 278  GLN B NE2 1 
ATOM   6465 N  N   . LEU B 2 279 ? 52.073  11.224  -2.551  1.00 57.44  ? 279  LEU B N   1 
ATOM   6466 C  CA  . LEU B 2 279 ? 50.690  11.095  -2.966  1.00 57.18  ? 279  LEU B CA  1 
ATOM   6467 C  C   . LEU B 2 279 ? 49.825  12.079  -2.174  1.00 51.06  ? 279  LEU B C   1 
ATOM   6468 O  O   . LEU B 2 279 ? 49.036  12.832  -2.750  1.00 40.63  ? 279  LEU B O   1 
ATOM   6469 C  CB  . LEU B 2 279 ? 50.216  9.664   -2.713  1.00 64.82  ? 279  LEU B CB  1 
ATOM   6470 C  CG  . LEU B 2 279 ? 50.954  8.572   -3.482  1.00 62.81  ? 279  LEU B CG  1 
ATOM   6471 C  CD1 . LEU B 2 279 ? 50.519  7.220   -2.957  1.00 68.10  ? 279  LEU B CD1 1 
ATOM   6472 C  CD2 . LEU B 2 279 ? 50.689  8.704   -4.982  1.00 62.91  ? 279  LEU B CD2 1 
ATOM   6473 N  N   . CYS B 2 280 ? 50.002  12.083  -0.854  1.00 50.32  ? 280  CYS B N   1 
ATOM   6474 C  CA  . CYS B 2 280 ? 49.249  12.969  0.021   1.00 47.86  ? 280  CYS B CA  1 
ATOM   6475 C  C   . CYS B 2 280 ? 49.395  14.444  -0.321  1.00 51.43  ? 280  CYS B C   1 
ATOM   6476 O  O   . CYS B 2 280 ? 48.587  15.273  0.103   1.00 55.25  ? 280  CYS B O   1 
ATOM   6477 C  CB  . CYS B 2 280 ? 49.592  12.704  1.476   1.00 48.58  ? 280  CYS B CB  1 
ATOM   6478 S  SG  . CYS B 2 280 ? 48.618  11.337  2.118   1.00 61.22  ? 280  CYS B SG  1 
ATOM   6479 N  N   . LYS B 2 281 ? 50.440  14.785  -1.061  1.00 51.10  ? 281  LYS B N   1 
ATOM   6480 C  CA  . LYS B 2 281 ? 50.597  16.162  -1.490  1.00 52.30  ? 281  LYS B CA  1 
ATOM   6481 C  C   . LYS B 2 281 ? 49.652  16.392  -2.681  1.00 46.31  ? 281  LYS B C   1 
ATOM   6482 O  O   . LYS B 2 281 ? 49.105  17.483  -2.849  1.00 46.84  ? 281  LYS B O   1 
ATOM   6483 C  CB  . LYS B 2 281 ? 52.048  16.460  -1.864  1.00 61.85  ? 281  LYS B CB  1 
ATOM   6484 C  CG  . LYS B 2 281 ? 52.997  16.370  -0.682  1.00 64.08  ? 281  LYS B CG  1 
ATOM   6485 C  CD  . LYS B 2 281 ? 54.357  16.980  -0.995  1.00 56.68  ? 281  LYS B CD  1 
ATOM   6486 C  CE  . LYS B 2 281 ? 55.328  16.721  0.145   1.00 60.42  ? 281  LYS B CE  1 
ATOM   6487 N  NZ  . LYS B 2 281 ? 54.739  17.143  1.444   1.00 71.82  ? 281  LYS B NZ  1 
ATOM   6488 N  N   . LEU B 2 282 ? 49.431  15.347  -3.478  1.00 34.34  ? 282  LEU B N   1 
ATOM   6489 C  CA  . LEU B 2 282 ? 48.529  15.416  -4.625  1.00 28.44  ? 282  LEU B CA  1 
ATOM   6490 C  C   . LEU B 2 282 ? 47.073  15.519  -4.148  1.00 33.43  ? 282  LEU B C   1 
ATOM   6491 O  O   . LEU B 2 282 ? 46.143  15.740  -4.942  1.00 25.48  ? 282  LEU B O   1 
ATOM   6492 C  CB  . LEU B 2 282 ? 48.700  14.171  -5.485  1.00 18.13  ? 282  LEU B CB  1 
ATOM   6493 C  CG  . LEU B 2 282 ? 50.099  14.001  -6.055  1.00 20.76  ? 282  LEU B CG  1 
ATOM   6494 C  CD1 . LEU B 2 282 ? 50.343  12.549  -6.345  1.00 19.83  ? 282  LEU B CD1 1 
ATOM   6495 C  CD2 . LEU B 2 282 ? 50.271  14.860  -7.305  1.00 36.40  ? 282  LEU B CD2 1 
ATOM   6496 N  N   . LEU B 2 283 ? 46.885  15.300  -2.851  1.00 41.64  ? 283  LEU B N   1 
ATOM   6497 C  CA  . LEU B 2 283 ? 45.572  15.376  -2.228  1.00 53.30  ? 283  LEU B CA  1 
ATOM   6498 C  C   . LEU B 2 283 ? 45.409  16.693  -1.480  1.00 61.05  ? 283  LEU B C   1 
ATOM   6499 O  O   . LEU B 2 283 ? 44.560  16.824  -0.601  1.00 63.75  ? 283  LEU B O   1 
ATOM   6500 C  CB  . LEU B 2 283 ? 45.350  14.176  -1.298  1.00 55.96  ? 283  LEU B CB  1 
ATOM   6501 C  CG  . LEU B 2 283 ? 44.444  13.041  -1.811  1.00 65.60  ? 283  LEU B CG  1 
ATOM   6502 C  CD1 . LEU B 2 283 ? 44.326  13.044  -3.333  1.00 68.78  ? 283  LEU B CD1 1 
ATOM   6503 C  CD2 . LEU B 2 283 ? 44.955  11.694  -1.314  1.00 67.34  ? 283  LEU B CD2 1 
ATOM   6504 N  N   . ARG B 2 284 ? 46.269  17.653  -1.799  1.00 71.63  ? 284  ARG B N   1 
ATOM   6505 C  CA  . ARG B 2 284 ? 46.199  18.974  -1.193  1.00 78.12  ? 284  ARG B CA  1 
ATOM   6506 C  C   . ARG B 2 284 ? 45.291  19.811  -2.097  1.00 73.63  ? 284  ARG B C   1 
ATOM   6507 O  O   . ARG B 2 284 ? 45.592  20.030  -3.278  1.00 66.04  ? 284  ARG B O   1 
ATOM   6508 C  CB  . ARG B 2 284 ? 47.595  19.596  -1.092  1.00 87.87  ? 284  ARG B CB  1 
ATOM   6509 C  CG  . ARG B 2 284 ? 47.598  21.054  -0.677  1.00 98.11  ? 284  ARG B CG  1 
ATOM   6510 C  CD  . ARG B 2 284 ? 48.964  21.672  -0.906  1.00 110.40 ? 284  ARG B CD  1 
ATOM   6511 N  NE  . ARG B 2 284 ? 48.871  23.105  -1.173  1.00 119.35 ? 284  ARG B NE  1 
ATOM   6512 C  CZ  . ARG B 2 284 ? 49.785  23.802  -1.842  1.00 122.87 ? 284  ARG B CZ  1 
ATOM   6513 N  NH1 . ARG B 2 284 ? 50.871  23.205  -2.317  1.00 123.52 ? 284  ARG B NH1 1 
ATOM   6514 N  NH2 . ARG B 2 284 ? 49.600  25.096  -2.058  1.00 126.97 ? 284  ARG B NH2 1 
ATOM   6515 N  N   . GLY B 2 285 ? 44.152  20.218  -1.546  1.00 69.87  ? 285  GLY B N   1 
ATOM   6516 C  CA  . GLY B 2 285 ? 43.201  21.008  -2.301  1.00 63.72  ? 285  GLY B CA  1 
ATOM   6517 C  C   . GLY B 2 285 ? 41.818  20.383  -2.278  1.00 61.34  ? 285  GLY B C   1 
ATOM   6518 O  O   . GLY B 2 285 ? 41.659  19.166  -2.412  1.00 58.77  ? 285  GLY B O   1 
ATOM   6519 N  N   . THR B 2 286 ? 40.810  21.226  -2.102  1.00 57.65  ? 286  THR B N   1 
ATOM   6520 C  CA  . THR B 2 286 ? 39.428  20.777  -2.056  1.00 50.92  ? 286  THR B CA  1 
ATOM   6521 C  C   . THR B 2 286 ? 38.842  20.708  -3.459  1.00 44.20  ? 286  THR B C   1 
ATOM   6522 O  O   . THR B 2 286 ? 38.094  21.598  -3.871  1.00 42.60  ? 286  THR B O   1 
ATOM   6523 C  CB  . THR B 2 286 ? 38.584  21.729  -1.188  1.00 56.19  ? 286  THR B CB  1 
ATOM   6524 O  OG1 . THR B 2 286 ? 38.727  23.071  -1.671  1.00 67.25  ? 286  THR B OG1 1 
ATOM   6525 C  CG2 . THR B 2 286 ? 39.060  21.678  0.257   1.00 55.77  ? 286  THR B CG2 1 
ATOM   6526 N  N   . LYS B 2 287 ? 39.192  19.659  -4.197  1.00 40.22  ? 287  LYS B N   1 
ATOM   6527 C  CA  . LYS B 2 287 ? 38.694  19.498  -5.563  1.00 44.99  ? 287  LYS B CA  1 
ATOM   6528 C  C   . LYS B 2 287 ? 37.626  18.417  -5.736  1.00 37.82  ? 287  LYS B C   1 
ATOM   6529 O  O   . LYS B 2 287 ? 37.228  17.754  -4.777  1.00 26.32  ? 287  LYS B O   1 
ATOM   6530 C  CB  . LYS B 2 287 ? 39.859  19.278  -6.533  1.00 50.60  ? 287  LYS B CB  1 
ATOM   6531 C  CG  . LYS B 2 287 ? 40.925  18.341  -5.999  1.00 64.18  ? 287  LYS B CG  1 
ATOM   6532 C  CD  . LYS B 2 287 ? 42.317  18.956  -6.099  1.00 72.10  ? 287  LYS B CD  1 
ATOM   6533 C  CE  . LYS B 2 287 ? 42.703  19.221  -7.545  1.00 74.61  ? 287  LYS B CE  1 
ATOM   6534 N  NZ  . LYS B 2 287 ? 44.120  19.667  -7.671  1.00 80.78  ? 287  LYS B NZ  1 
ATOM   6535 N  N   . ALA B 2 288 ? 37.116  18.293  -6.957  1.00 36.69  ? 288  ALA B N   1 
ATOM   6536 C  CA  . ALA B 2 288 ? 36.089  17.302  -7.252  1.00 36.41  ? 288  ALA B CA  1 
ATOM   6537 C  C   . ALA B 2 288 ? 36.677  15.902  -7.230  1.00 36.83  ? 288  ALA B C   1 
ATOM   6538 O  O   . ALA B 2 288 ? 37.692  15.636  -7.876  1.00 29.89  ? 288  ALA B O   1 
ATOM   6539 C  CB  . ALA B 2 288 ? 35.455  17.578  -8.599  1.00 36.78  ? 288  ALA B CB  1 
ATOM   6540 N  N   . LEU B 2 289 ? 36.008  15.006  -6.510  1.00 38.38  ? 289  LEU B N   1 
ATOM   6541 C  CA  . LEU B 2 289 ? 36.451  13.623  -6.381  1.00 32.26  ? 289  LEU B CA  1 
ATOM   6542 C  C   . LEU B 2 289 ? 36.761  12.977  -7.715  1.00 25.95  ? 289  LEU B C   1 
ATOM   6543 O  O   . LEU B 2 289 ? 37.723  12.216  -7.837  1.00 14.06  ? 289  LEU B O   1 
ATOM   6544 C  CB  . LEU B 2 289 ? 35.408  12.794  -5.622  1.00 24.81  ? 289  LEU B CB  1 
ATOM   6545 C  CG  . LEU B 2 289 ? 35.865  12.345  -4.224  1.00 22.28  ? 289  LEU B CG  1 
ATOM   6546 C  CD1 . LEU B 2 289 ? 36.259  13.555  -3.382  1.00 19.72  ? 289  LEU B CD1 1 
ATOM   6547 C  CD2 . LEU B 2 289 ? 34.772  11.539  -3.536  1.00 25.94  ? 289  LEU B CD2 1 
ATOM   6548 N  N   . THR B 2 290 ? 35.949  13.304  -8.712  1.00 31.04  ? 290  THR B N   1 
ATOM   6549 C  CA  . THR B 2 290 ? 36.108  12.761  -10.055 1.00 38.66  ? 290  THR B CA  1 
ATOM   6550 C  C   . THR B 2 290 ? 37.221  13.421  -10.865 1.00 46.01  ? 290  THR B C   1 
ATOM   6551 O  O   . THR B 2 290 ? 37.660  12.868  -11.874 1.00 47.58  ? 290  THR B O   1 
ATOM   6552 C  CB  . THR B 2 290 ? 34.792  12.858  -10.840 1.00 39.50  ? 290  THR B CB  1 
ATOM   6553 O  OG1 . THR B 2 290 ? 34.194  14.146  -10.630 1.00 47.50  ? 290  THR B OG1 1 
ATOM   6554 C  CG2 . THR B 2 290 ? 33.832  11.798  -10.376 1.00 52.20  ? 290  THR B CG2 1 
ATOM   6555 N  N   . GLU B 2 291 ? 37.687  14.586  -10.412 1.00 52.03  ? 291  GLU B N   1 
ATOM   6556 C  CA  . GLU B 2 291 ? 38.739  15.322  -11.106 1.00 59.45  ? 291  GLU B CA  1 
ATOM   6557 C  C   . GLU B 2 291 ? 40.040  14.532  -11.181 1.00 60.78  ? 291  GLU B C   1 
ATOM   6558 O  O   . GLU B 2 291 ? 40.433  13.862  -10.221 1.00 57.65  ? 291  GLU B O   1 
ATOM   6559 C  CB  . GLU B 2 291 ? 38.994  16.672  -10.438 1.00 66.10  ? 291  GLU B CB  1 
ATOM   6560 C  CG  . GLU B 2 291 ? 39.794  17.640  -11.300 1.00 69.82  ? 291  GLU B CG  1 
ATOM   6561 C  CD  . GLU B 2 291 ? 40.081  18.946  -10.596 1.00 76.78  ? 291  GLU B CD  1 
ATOM   6562 O  OE1 . GLU B 2 291 ? 39.192  19.460  -9.883  1.00 80.29  ? 291  GLU B OE1 1 
ATOM   6563 O  OE2 . GLU B 2 291 ? 41.204  19.459  -10.754 1.00 86.09  ? 291  GLU B OE2 1 
ATOM   6564 N  N   . VAL B 2 292 ? 40.701  14.635  -12.331 1.00 62.81  ? 292  VAL B N   1 
ATOM   6565 C  CA  . VAL B 2 292 ? 41.955  13.941  -12.603 1.00 64.29  ? 292  VAL B CA  1 
ATOM   6566 C  C   . VAL B 2 292 ? 43.179  14.720  -12.115 1.00 69.32  ? 292  VAL B C   1 
ATOM   6567 O  O   . VAL B 2 292 ? 43.273  15.937  -12.313 1.00 78.76  ? 292  VAL B O   1 
ATOM   6568 C  CB  . VAL B 2 292 ? 42.104  13.677  -14.116 1.00 60.11  ? 292  VAL B CB  1 
ATOM   6569 C  CG1 . VAL B 2 292 ? 43.380  12.907  -14.404 1.00 64.55  ? 292  VAL B CG1 1 
ATOM   6570 C  CG2 . VAL B 2 292 ? 40.890  12.934  -14.635 1.00 60.70  ? 292  VAL B CG2 1 
ATOM   6571 N  N   . ILE B 2 293 ? 44.110  14.016  -11.475 1.00 63.75  ? 293  ILE B N   1 
ATOM   6572 C  CA  . ILE B 2 293 ? 45.334  14.630  -10.972 1.00 58.43  ? 293  ILE B CA  1 
ATOM   6573 C  C   . ILE B 2 293 ? 46.512  14.069  -11.763 1.00 66.09  ? 293  ILE B C   1 
ATOM   6574 O  O   . ILE B 2 293 ? 46.543  12.875  -12.074 1.00 64.15  ? 293  ILE B O   1 
ATOM   6575 C  CB  . ILE B 2 293 ? 45.556  14.311  -9.468  1.00 46.64  ? 293  ILE B CB  1 
ATOM   6576 C  CG1 . ILE B 2 293 ? 44.302  14.657  -8.659  1.00 33.76  ? 293  ILE B CG1 1 
ATOM   6577 C  CG2 . ILE B 2 293 ? 46.778  15.067  -8.922  1.00 37.20  ? 293  ILE B CG2 1 
ATOM   6578 C  CD1 . ILE B 2 293 ? 43.899  16.103  -8.735  1.00 31.28  ? 293  ILE B CD1 1 
ATOM   6579 N  N   . PRO B 2 294 ? 47.424  14.947  -12.219 1.00 71.76  ? 294  PRO B N   1 
ATOM   6580 C  CA  . PRO B 2 294 ? 48.603  14.511  -12.978 1.00 71.62  ? 294  PRO B CA  1 
ATOM   6581 C  C   . PRO B 2 294 ? 49.681  14.074  -11.979 1.00 69.80  ? 294  PRO B C   1 
ATOM   6582 O  O   . PRO B 2 294 ? 50.018  14.811  -11.039 1.00 65.49  ? 294  PRO B O   1 
ATOM   6583 C  CB  . PRO B 2 294 ? 49.000  15.770  -13.742 1.00 75.21  ? 294  PRO B CB  1 
ATOM   6584 C  CG  . PRO B 2 294 ? 48.627  16.862  -12.789 1.00 82.20  ? 294  PRO B CG  1 
ATOM   6585 C  CD  . PRO B 2 294 ? 47.278  16.414  -12.265 1.00 77.96  ? 294  PRO B CD  1 
ATOM   6586 N  N   . LEU B 2 295 ? 50.182  12.856  -12.153 1.00 69.39  ? 295  LEU B N   1 
ATOM   6587 C  CA  . LEU B 2 295 ? 51.184  12.322  -11.245 1.00 67.61  ? 295  LEU B CA  1 
ATOM   6588 C  C   . LEU B 2 295 ? 52.570  12.903  -11.371 1.00 59.80  ? 295  LEU B C   1 
ATOM   6589 O  O   . LEU B 2 295 ? 53.156  12.952  -12.458 1.00 52.94  ? 295  LEU B O   1 
ATOM   6590 C  CB  . LEU B 2 295 ? 51.262  10.800  -11.336 1.00 78.87  ? 295  LEU B CB  1 
ATOM   6591 C  CG  . LEU B 2 295 ? 50.106  10.023  -10.701 1.00 96.79  ? 295  LEU B CG  1 
ATOM   6592 C  CD1 . LEU B 2 295 ? 50.460  8.546   -10.650 1.00 104.89 ? 295  LEU B CD1 1 
ATOM   6593 C  CD2 . LEU B 2 295 ? 49.824  10.542  -9.293  1.00 100.03 ? 295  LEU B CD2 1 
ATOM   6594 N  N   . THR B 2 296 ? 53.079  13.364  -10.238 1.00 54.03  ? 296  THR B N   1 
ATOM   6595 C  CA  . THR B 2 296 ? 54.411  13.913  -10.190 1.00 44.92  ? 296  THR B CA  1 
ATOM   6596 C  C   . THR B 2 296 ? 55.338  12.693  -10.230 1.00 44.23  ? 296  THR B C   1 
ATOM   6597 O  O   . THR B 2 296 ? 54.963  11.609  -9.774  1.00 37.06  ? 296  THR B O   1 
ATOM   6598 C  CB  . THR B 2 296 ? 54.621  14.770  -8.896  1.00 36.04  ? 296  THR B CB  1 
ATOM   6599 O  OG1 . THR B 2 296 ? 54.457  13.968  -7.719  1.00 20.81  ? 296  THR B OG1 1 
ATOM   6600 C  CG2 . THR B 2 296 ? 53.617  15.900  -8.851  1.00 34.65  ? 296  THR B CG2 1 
ATOM   6601 N  N   . GLU B 2 297 ? 56.506  12.844  -10.846 1.00 49.81  ? 297  GLU B N   1 
ATOM   6602 C  CA  . GLU B 2 297 ? 57.473  11.749  -10.923 1.00 54.51  ? 297  GLU B CA  1 
ATOM   6603 C  C   . GLU B 2 297 ? 57.819  11.274  -9.506  1.00 58.51  ? 297  GLU B C   1 
ATOM   6604 O  O   . GLU B 2 297 ? 58.018  10.079  -9.269  1.00 56.86  ? 297  GLU B O   1 
ATOM   6605 C  CB  . GLU B 2 297 ? 58.742  12.214  -11.636 1.00 53.18  ? 297  GLU B CB  1 
ATOM   6606 C  CG  . GLU B 2 297 ? 58.538  12.635  -13.080 1.00 53.74  ? 297  GLU B CG  1 
ATOM   6607 C  CD  . GLU B 2 297 ? 58.645  11.478  -14.048 1.00 51.63  ? 297  GLU B CD  1 
ATOM   6608 O  OE1 . GLU B 2 297 ? 59.707  10.809  -14.051 1.00 29.43  ? 297  GLU B OE1 1 
ATOM   6609 O  OE2 . GLU B 2 297 ? 57.677  11.251  -14.811 1.00 56.13  ? 297  GLU B OE2 1 
ATOM   6610 N  N   . GLU B 2 298 ? 57.850  12.221  -8.568  1.00 59.72  ? 298  GLU B N   1 
ATOM   6611 C  CA  . GLU B 2 298 ? 58.153  11.938  -7.165  1.00 64.14  ? 298  GLU B CA  1 
ATOM   6612 C  C   . GLU B 2 298 ? 57.114  10.977  -6.593  1.00 58.76  ? 298  GLU B C   1 
ATOM   6613 O  O   . GLU B 2 298 ? 57.439  10.044  -5.847  1.00 57.42  ? 298  GLU B O   1 
ATOM   6614 C  CB  . GLU B 2 298 ? 58.171  13.234  -6.334  1.00 71.03  ? 298  GLU B CB  1 
ATOM   6615 C  CG  . GLU B 2 298 ? 59.260  14.244  -6.718  1.00 80.85  ? 298  GLU B CG  1 
ATOM   6616 C  CD  . GLU B 2 298 ? 58.852  15.164  -7.864  1.00 92.42  ? 298  GLU B CD  1 
ATOM   6617 O  OE1 . GLU B 2 298 ? 59.028  14.786  -9.043  1.00 91.00  ? 298  GLU B OE1 1 
ATOM   6618 O  OE2 . GLU B 2 298 ? 58.361  16.279  -7.584  1.00 101.57 ? 298  GLU B OE2 1 
ATOM   6619 N  N   . ALA B 2 299 ? 55.857  11.223  -6.939  1.00 49.53  ? 299  ALA B N   1 
ATOM   6620 C  CA  . ALA B 2 299 ? 54.781  10.375  -6.476  1.00 44.73  ? 299  ALA B CA  1 
ATOM   6621 C  C   . ALA B 2 299 ? 54.885  9.037   -7.198  1.00 41.34  ? 299  ALA B C   1 
ATOM   6622 O  O   . ALA B 2 299 ? 54.772  7.981   -6.565  1.00 34.87  ? 299  ALA B O   1 
ATOM   6623 C  CB  . ALA B 2 299 ? 53.445  11.028  -6.752  1.00 47.70  ? 299  ALA B CB  1 
ATOM   6624 N  N   . GLU B 2 300 ? 55.179  9.092   -8.502  1.00 38.50  ? 300  GLU B N   1 
ATOM   6625 C  CA  . GLU B 2 300 ? 55.302  7.897   -9.340  1.00 34.20  ? 300  GLU B CA  1 
ATOM   6626 C  C   . GLU B 2 300 ? 56.386  6.936   -8.904  1.00 28.47  ? 300  GLU B C   1 
ATOM   6627 O  O   . GLU B 2 300 ? 56.232  5.722   -9.037  1.00 28.74  ? 300  GLU B O   1 
ATOM   6628 C  CB  . GLU B 2 300 ? 55.506  8.268   -10.796 1.00 33.91  ? 300  GLU B CB  1 
ATOM   6629 C  CG  . GLU B 2 300 ? 54.285  8.872   -11.413 1.00 41.41  ? 300  GLU B CG  1 
ATOM   6630 C  CD  . GLU B 2 300 ? 54.384  8.931   -12.911 1.00 60.79  ? 300  GLU B CD  1 
ATOM   6631 O  OE1 . GLU B 2 300 ? 55.392  9.473   -13.417 1.00 72.59  ? 300  GLU B OE1 1 
ATOM   6632 O  OE2 . GLU B 2 300 ? 53.461  8.421   -13.583 1.00 68.18  ? 300  GLU B OE2 1 
ATOM   6633 N  N   . LEU B 2 301 ? 57.498  7.476   -8.426  1.00 27.54  ? 301  LEU B N   1 
ATOM   6634 C  CA  . LEU B 2 301 ? 58.574  6.631   -7.935  1.00 34.70  ? 301  LEU B CA  1 
ATOM   6635 C  C   . LEU B 2 301 ? 58.052  5.966   -6.667  1.00 27.67  ? 301  LEU B C   1 
ATOM   6636 O  O   . LEU B 2 301 ? 58.116  4.745   -6.521  1.00 22.37  ? 301  LEU B O   1 
ATOM   6637 C  CB  . LEU B 2 301 ? 59.821  7.456   -7.588  1.00 49.16  ? 301  LEU B CB  1 
ATOM   6638 C  CG  . LEU B 2 301 ? 60.829  6.722   -6.684  1.00 58.55  ? 301  LEU B CG  1 
ATOM   6639 C  CD1 . LEU B 2 301 ? 61.491  5.562   -7.441  1.00 50.36  ? 301  LEU B CD1 1 
ATOM   6640 C  CD2 . LEU B 2 301 ? 61.866  7.700   -6.134  1.00 61.65  ? 301  LEU B CD2 1 
ATOM   6641 N  N   . GLU B 2 302 ? 57.509  6.786   -5.772  1.00 26.05  ? 302  GLU B N   1 
ATOM   6642 C  CA  . GLU B 2 302 ? 56.977  6.310   -4.507  1.00 37.71  ? 302  GLU B CA  1 
ATOM   6643 C  C   . GLU B 2 302 ? 56.090  5.068   -4.715  1.00 43.61  ? 302  GLU B C   1 
ATOM   6644 O  O   . GLU B 2 302 ? 56.169  4.094   -3.957  1.00 44.49  ? 302  GLU B O   1 
ATOM   6645 C  CB  . GLU B 2 302 ? 56.191  7.438   -3.833  1.00 33.09  ? 302  GLU B CB  1 
ATOM   6646 C  CG  . GLU B 2 302 ? 55.865  7.187   -2.374  1.00 19.38  ? 302  GLU B CG  1 
ATOM   6647 C  CD  . GLU B 2 302 ? 55.021  8.285   -1.784  1.00 30.34  ? 302  GLU B CD  1 
ATOM   6648 O  OE1 . GLU B 2 302 ? 53.851  8.401   -2.186  1.00 39.07  ? 302  GLU B OE1 1 
ATOM   6649 O  OE2 . GLU B 2 302 ? 55.519  9.031   -0.914  1.00 48.14  ? 302  GLU B OE2 1 
ATOM   6650 N  N   . LEU B 2 303 ? 55.291  5.095   -5.777  1.00 40.44  ? 303  LEU B N   1 
ATOM   6651 C  CA  . LEU B 2 303 ? 54.405  3.989   -6.107  1.00 39.87  ? 303  LEU B CA  1 
ATOM   6652 C  C   . LEU B 2 303 ? 55.189  2.738   -6.501  1.00 42.04  ? 303  LEU B C   1 
ATOM   6653 O  O   . LEU B 2 303 ? 54.911  1.642   -6.002  1.00 41.94  ? 303  LEU B O   1 
ATOM   6654 C  CB  . LEU B 2 303 ? 53.464  4.386   -7.247  1.00 39.73  ? 303  LEU B CB  1 
ATOM   6655 C  CG  . LEU B 2 303 ? 51.977  4.053   -7.067  1.00 39.71  ? 303  LEU B CG  1 
ATOM   6656 C  CD1 . LEU B 2 303 ? 51.176  4.602   -8.235  1.00 37.38  ? 303  LEU B CD1 1 
ATOM   6657 C  CD2 . LEU B 2 303 ? 51.764  2.555   -6.940  1.00 45.09  ? 303  LEU B CD2 1 
ATOM   6658 N  N   . ALA B 2 304 ? 56.155  2.891   -7.403  1.00 37.31  ? 304  ALA B N   1 
ATOM   6659 C  CA  . ALA B 2 304 ? 56.954  1.752   -7.838  1.00 33.45  ? 304  ALA B CA  1 
ATOM   6660 C  C   . ALA B 2 304 ? 57.715  1.161   -6.649  1.00 30.32  ? 304  ALA B C   1 
ATOM   6661 O  O   . ALA B 2 304 ? 57.776  -0.060  -6.496  1.00 29.48  ? 304  ALA B O   1 
ATOM   6662 C  CB  . ALA B 2 304 ? 57.905  2.153   -8.948  1.00 32.70  ? 304  ALA B CB  1 
ATOM   6663 N  N   . GLU B 2 305 ? 58.222  2.023   -5.770  1.00 28.89  ? 305  GLU B N   1 
ATOM   6664 C  CA  . GLU B 2 305 ? 58.947  1.565   -4.585  1.00 31.24  ? 305  GLU B CA  1 
ATOM   6665 C  C   . GLU B 2 305 ? 58.032  0.702   -3.741  1.00 33.17  ? 305  GLU B C   1 
ATOM   6666 O  O   . GLU B 2 305 ? 58.463  -0.281  -3.140  1.00 44.90  ? 305  GLU B O   1 
ATOM   6667 C  CB  . GLU B 2 305 ? 59.465  2.734   -3.734  1.00 27.49  ? 305  GLU B CB  1 
ATOM   6668 C  CG  . GLU B 2 305 ? 60.842  3.245   -4.143  1.00 34.32  ? 305  GLU B CG  1 
ATOM   6669 C  CD  . GLU B 2 305 ? 61.617  3.911   -3.004  1.00 44.42  ? 305  GLU B CD  1 
ATOM   6670 O  OE1 . GLU B 2 305 ? 61.517  3.447   -1.841  1.00 41.59  ? 305  GLU B OE1 1 
ATOM   6671 O  OE2 . GLU B 2 305 ? 62.355  4.887   -3.281  1.00 43.15  ? 305  GLU B OE2 1 
ATOM   6672 N  N   . ASN B 2 306 ? 56.760  1.066   -3.698  1.00 27.83  ? 306  ASN B N   1 
ATOM   6673 C  CA  . ASN B 2 306 ? 55.795  0.299   -2.932  1.00 32.20  ? 306  ASN B CA  1 
ATOM   6674 C  C   . ASN B 2 306 ? 55.492  -1.041  -3.612  1.00 30.70  ? 306  ASN B C   1 
ATOM   6675 O  O   . ASN B 2 306 ? 55.468  -2.089  -2.953  1.00 22.54  ? 306  ASN B O   1 
ATOM   6676 C  CB  . ASN B 2 306 ? 54.515  1.109   -2.728  1.00 39.51  ? 306  ASN B CB  1 
ATOM   6677 C  CG  . ASN B 2 306 ? 54.717  2.287   -1.792  1.00 48.43  ? 306  ASN B CG  1 
ATOM   6678 O  OD1 . ASN B 2 306 ? 55.573  2.257   -0.906  1.00 52.67  ? 306  ASN B OD1 1 
ATOM   6679 N  ND2 . ASN B 2 306 ? 53.912  3.325   -1.972  1.00 50.73  ? 306  ASN B ND2 1 
ATOM   6680 N  N   . ARG B 2 307 ? 55.300  -1.013  -4.932  1.00 28.32  ? 307  ARG B N   1 
ATOM   6681 C  CA  . ARG B 2 307 ? 55.011  -2.225  -5.695  1.00 23.92  ? 307  ARG B CA  1 
ATOM   6682 C  C   . ARG B 2 307 ? 56.119  -3.240  -5.432  1.00 21.59  ? 307  ARG B C   1 
ATOM   6683 O  O   . ARG B 2 307 ? 55.859  -4.433  -5.262  1.00 17.77  ? 307  ARG B O   1 
ATOM   6684 C  CB  . ARG B 2 307 ? 54.896  -1.903  -7.196  1.00 32.51  ? 307  ARG B CB  1 
ATOM   6685 C  CG  . ARG B 2 307 ? 53.837  -0.839  -7.518  1.00 40.27  ? 307  ARG B CG  1 
ATOM   6686 C  CD  . ARG B 2 307 ? 53.560  -0.683  -9.014  1.00 48.55  ? 307  ARG B CD  1 
ATOM   6687 N  NE  . ARG B 2 307 ? 52.630  0.418   -9.295  1.00 54.56  ? 307  ARG B NE  1 
ATOM   6688 C  CZ  . ARG B 2 307 ? 51.313  0.287   -9.478  1.00 57.37  ? 307  ARG B CZ  1 
ATOM   6689 N  NH1 . ARG B 2 307 ? 50.727  -0.902  -9.411  1.00 57.13  ? 307  ARG B NH1 1 
ATOM   6690 N  NH2 . ARG B 2 307 ? 50.575  1.356   -9.742  1.00 55.88  ? 307  ARG B NH2 1 
ATOM   6691 N  N   . GLU B 2 308 ? 57.348  -2.733  -5.347  1.00 25.25  ? 308  GLU B N   1 
ATOM   6692 C  CA  . GLU B 2 308 ? 58.535  -3.542  -5.082  1.00 18.24  ? 308  GLU B CA  1 
ATOM   6693 C  C   . GLU B 2 308 ? 58.485  -4.152  -3.708  1.00 9.66   ? 308  GLU B C   1 
ATOM   6694 O  O   . GLU B 2 308 ? 58.772  -5.331  -3.544  1.00 10.71  ? 308  GLU B O   1 
ATOM   6695 C  CB  . GLU B 2 308 ? 59.798  -2.700  -5.210  1.00 19.55  ? 308  GLU B CB  1 
ATOM   6696 C  CG  . GLU B 2 308 ? 60.226  -2.502  -6.637  1.00 30.19  ? 308  GLU B CG  1 
ATOM   6697 C  CD  . GLU B 2 308 ? 60.505  -3.812  -7.328  1.00 28.01  ? 308  GLU B CD  1 
ATOM   6698 O  OE1 . GLU B 2 308 ? 61.351  -4.578  -6.820  1.00 19.39  ? 308  GLU B OE1 1 
ATOM   6699 O  OE2 . GLU B 2 308 ? 59.869  -4.075  -8.369  1.00 40.63  ? 308  GLU B OE2 1 
ATOM   6700 N  N   . ILE B 2 309 ? 58.145  -3.345  -2.713  1.00 9.68   ? 309  ILE B N   1 
ATOM   6701 C  CA  . ILE B 2 309 ? 58.044  -3.860  -1.356  1.00 26.80  ? 309  ILE B CA  1 
ATOM   6702 C  C   . ILE B 2 309 ? 56.991  -4.995  -1.318  1.00 28.45  ? 309  ILE B C   1 
ATOM   6703 O  O   . ILE B 2 309 ? 57.289  -6.138  -0.963  1.00 18.43  ? 309  ILE B O   1 
ATOM   6704 C  CB  . ILE B 2 309 ? 57.640  -2.748  -0.363  1.00 31.15  ? 309  ILE B CB  1 
ATOM   6705 C  CG1 . ILE B 2 309 ? 58.589  -1.548  -0.490  1.00 31.54  ? 309  ILE B CG1 1 
ATOM   6706 C  CG2 . ILE B 2 309 ? 57.661  -3.294  1.061   1.00 32.96  ? 309  ILE B CG2 1 
ATOM   6707 C  CD1 . ILE B 2 309 ? 58.142  -0.293  0.293   1.00 25.41  ? 309  ILE B CD1 1 
ATOM   6708 N  N   . LEU B 2 310 ? 55.796  -4.687  -1.805  1.00 34.25  ? 310  LEU B N   1 
ATOM   6709 C  CA  . LEU B 2 310 ? 54.682  -5.624  -1.830  1.00 33.88  ? 310  LEU B CA  1 
ATOM   6710 C  C   . LEU B 2 310 ? 54.945  -6.920  -2.583  1.00 37.27  ? 310  LEU B C   1 
ATOM   6711 O  O   . LEU B 2 310 ? 54.338  -7.949  -2.267  1.00 38.31  ? 310  LEU B O   1 
ATOM   6712 C  CB  . LEU B 2 310 ? 53.459  -4.943  -2.436  1.00 33.17  ? 310  LEU B CB  1 
ATOM   6713 C  CG  . LEU B 2 310 ? 52.893  -3.759  -1.662  1.00 34.52  ? 310  LEU B CG  1 
ATOM   6714 C  CD1 . LEU B 2 310 ? 51.751  -3.134  -2.452  1.00 9.80   ? 310  LEU B CD1 1 
ATOM   6715 C  CD2 . LEU B 2 310 ? 52.436  -4.229  -0.272  1.00 48.03  ? 310  LEU B CD2 1 
ATOM   6716 N  N   . LYS B 2 311 ? 55.843  -6.867  -3.566  1.00 39.89  ? 311  LYS B N   1 
ATOM   6717 C  CA  . LYS B 2 311 ? 56.188  -8.025  -4.396  1.00 42.01  ? 311  LYS B CA  1 
ATOM   6718 C  C   . LYS B 2 311 ? 56.537  -9.322  -3.651  1.00 37.04  ? 311  LYS B C   1 
ATOM   6719 O  O   . LYS B 2 311 ? 56.591  -10.390 -4.267  1.00 22.62  ? 311  LYS B O   1 
ATOM   6720 C  CB  . LYS B 2 311 ? 57.317  -7.657  -5.367  1.00 49.18  ? 311  LYS B CB  1 
ATOM   6721 C  CG  . LYS B 2 311 ? 56.866  -7.400  -6.803  1.00 60.69  ? 311  LYS B CG  1 
ATOM   6722 C  CD  . LYS B 2 311 ? 57.969  -6.727  -7.607  1.00 69.59  ? 311  LYS B CD  1 
ATOM   6723 C  CE  . LYS B 2 311 ? 57.721  -6.817  -9.106  1.00 80.61  ? 311  LYS B CE  1 
ATOM   6724 N  NZ  . LYS B 2 311 ? 57.996  -8.188  -9.629  1.00 85.99  ? 311  LYS B NZ  1 
ATOM   6725 N  N   . GLU B 2 312 ? 56.744  -9.234  -2.336  1.00 45.19  ? 312  GLU B N   1 
ATOM   6726 C  CA  . GLU B 2 312 ? 57.089  -10.394 -1.510  1.00 48.05  ? 312  GLU B CA  1 
ATOM   6727 C  C   . GLU B 2 312 ? 56.596  -10.264 -0.072  1.00 44.11  ? 312  GLU B C   1 
ATOM   6728 O  O   . GLU B 2 312 ? 56.435  -9.159  0.444   1.00 38.37  ? 312  GLU B O   1 
ATOM   6729 C  CB  . GLU B 2 312 ? 58.611  -10.592 -1.472  1.00 60.28  ? 312  GLU B CB  1 
ATOM   6730 C  CG  . GLU B 2 312 ? 59.192  -11.381 -2.638  1.00 73.63  ? 312  GLU B CG  1 
ATOM   6731 C  CD  . GLU B 2 312 ? 60.712  -11.282 -2.720  1.00 84.66  ? 312  GLU B CD  1 
ATOM   6732 O  OE1 . GLU B 2 312 ? 61.373  -11.275 -1.657  1.00 93.21  ? 312  GLU B OE1 1 
ATOM   6733 O  OE2 . GLU B 2 312 ? 61.244  -11.209 -3.853  1.00 83.32  ? 312  GLU B OE2 1 
ATOM   6734 N  N   . PRO B 2 313 ? 56.376  -11.408 0.596   1.00 46.07  ? 313  PRO B N   1 
ATOM   6735 C  CA  . PRO B 2 313 ? 55.911  -11.546 1.984   1.00 43.11  ? 313  PRO B CA  1 
ATOM   6736 C  C   . PRO B 2 313 ? 56.929  -10.964 2.976   1.00 33.98  ? 313  PRO B C   1 
ATOM   6737 O  O   . PRO B 2 313 ? 58.136  -11.117 2.783   1.00 30.70  ? 313  PRO B O   1 
ATOM   6738 C  CB  . PRO B 2 313 ? 55.809  -13.065 2.154   1.00 43.03  ? 313  PRO B CB  1 
ATOM   6739 C  CG  . PRO B 2 313 ? 55.496  -13.543 0.782   1.00 50.21  ? 313  PRO B CG  1 
ATOM   6740 C  CD  . PRO B 2 313 ? 56.432  -12.726 -0.062  1.00 50.27  ? 313  PRO B CD  1 
ATOM   6741 N  N   . VAL B 2 314 ? 56.442  -10.363 4.059   1.00 30.37  ? 314  VAL B N   1 
ATOM   6742 C  CA  . VAL B 2 314 ? 57.330  -9.761  5.052   1.00 44.47  ? 314  VAL B CA  1 
ATOM   6743 C  C   . VAL B 2 314 ? 58.326  -10.749 5.683   1.00 55.45  ? 314  VAL B C   1 
ATOM   6744 O  O   . VAL B 2 314 ? 58.039  -11.938 5.860   1.00 57.58  ? 314  VAL B O   1 
ATOM   6745 C  CB  . VAL B 2 314 ? 56.543  -8.963  6.144   1.00 45.21  ? 314  VAL B CB  1 
ATOM   6746 C  CG1 . VAL B 2 314 ? 55.966  -9.886  7.217   1.00 40.55  ? 314  VAL B CG1 1 
ATOM   6747 C  CG2 . VAL B 2 314 ? 57.432  -7.895  6.752   1.00 40.09  ? 314  VAL B CG2 1 
ATOM   6748 N  N   . HIS B 2 315 ? 59.515  -10.242 5.990   1.00 62.87  ? 315  HIS B N   1 
ATOM   6749 C  CA  . HIS B 2 315 ? 60.583  -11.050 6.571   1.00 66.38  ? 315  HIS B CA  1 
ATOM   6750 C  C   . HIS B 2 315 ? 60.356  -11.405 8.043   1.00 70.27  ? 315  HIS B C   1 
ATOM   6751 O  O   . HIS B 2 315 ? 59.507  -10.821 8.720   1.00 75.60  ? 315  HIS B O   1 
ATOM   6752 C  CB  . HIS B 2 315 ? 61.924  -10.306 6.459   1.00 68.11  ? 315  HIS B CB  1 
ATOM   6753 C  CG  . HIS B 2 315 ? 62.326  -9.962  5.057   1.00 67.88  ? 315  HIS B CG  1 
ATOM   6754 N  ND1 . HIS B 2 315 ? 62.953  -8.778  4.734   1.00 70.24  ? 315  HIS B ND1 1 
ATOM   6755 C  CD2 . HIS B 2 315 ? 62.203  -10.648 3.897   1.00 63.99  ? 315  HIS B CD2 1 
ATOM   6756 C  CE1 . HIS B 2 315 ? 63.205  -8.750  3.438   1.00 68.39  ? 315  HIS B CE1 1 
ATOM   6757 N  NE2 . HIS B 2 315 ? 62.757  -9.872  2.906   1.00 63.94  ? 315  HIS B NE2 1 
ATOM   6758 N  N   . GLY B 2 316 ? 61.140  -12.366 8.524   1.00 65.80  ? 316  GLY B N   1 
ATOM   6759 C  CA  . GLY B 2 316 ? 61.097  -12.770 9.920   1.00 60.86  ? 316  GLY B CA  1 
ATOM   6760 C  C   . GLY B 2 316 ? 59.864  -13.453 10.462  1.00 58.61  ? 316  GLY B C   1 
ATOM   6761 O  O   . GLY B 2 316 ? 59.606  -13.405 11.669  1.00 48.98  ? 316  GLY B O   1 
ATOM   6762 N  N   . VAL B 2 317 ? 59.113  -14.113 9.590   1.00 64.78  ? 317  VAL B N   1 
ATOM   6763 C  CA  . VAL B 2 317 ? 57.914  -14.809 10.032  1.00 65.41  ? 317  VAL B CA  1 
ATOM   6764 C  C   . VAL B 2 317 ? 58.146  -16.319 10.016  1.00 61.53  ? 317  VAL B C   1 
ATOM   6765 O  O   . VAL B 2 317 ? 58.392  -16.911 8.962   1.00 58.48  ? 317  VAL B O   1 
ATOM   6766 C  CB  . VAL B 2 317 ? 56.696  -14.450 9.155   1.00 70.28  ? 317  VAL B CB  1 
ATOM   6767 C  CG1 . VAL B 2 317 ? 55.416  -14.859 9.859   1.00 73.49  ? 317  VAL B CG1 1 
ATOM   6768 C  CG2 . VAL B 2 317 ? 56.675  -12.958 8.857   1.00 73.96  ? 317  VAL B CG2 1 
ATOM   6769 N  N   . TYR B 2 318 ? 58.101  -16.926 11.200  1.00 61.87  ? 318  TYR B N   1 
ATOM   6770 C  CA  . TYR B 2 318 ? 58.308  -18.366 11.361  1.00 65.18  ? 318  TYR B CA  1 
ATOM   6771 C  C   . TYR B 2 318 ? 57.225  -18.932 12.280  1.00 57.87  ? 318  TYR B C   1 
ATOM   6772 O  O   . TYR B 2 318 ? 56.809  -18.272 13.229  1.00 60.53  ? 318  TYR B O   1 
ATOM   6773 C  CB  . TYR B 2 318 ? 59.700  -18.640 11.949  1.00 79.24  ? 318  TYR B CB  1 
ATOM   6774 C  CG  . TYR B 2 318 ? 60.837  -18.093 11.107  1.00 93.12  ? 318  TYR B CG  1 
ATOM   6775 C  CD1 . TYR B 2 318 ? 61.160  -18.668 9.872   1.00 99.36  ? 318  TYR B CD1 1 
ATOM   6776 C  CD2 . TYR B 2 318 ? 61.564  -16.976 11.525  1.00 97.01  ? 318  TYR B CD2 1 
ATOM   6777 C  CE1 . TYR B 2 318 ? 62.176  -18.140 9.074   1.00 100.01 ? 318  TYR B CE1 1 
ATOM   6778 C  CE2 . TYR B 2 318 ? 62.582  -16.439 10.735  1.00 97.60  ? 318  TYR B CE2 1 
ATOM   6779 C  CZ  . TYR B 2 318 ? 62.881  -17.025 9.512   1.00 101.02 ? 318  TYR B CZ  1 
ATOM   6780 O  OH  . TYR B 2 318 ? 63.878  -16.487 8.728   1.00 105.52 ? 318  TYR B OH  1 
ATOM   6781 N  N   . TYR B 2 319 ? 56.774  -20.151 12.001  1.00 49.87  ? 319  TYR B N   1 
ATOM   6782 C  CA  . TYR B 2 319 ? 55.722  -20.777 12.802  1.00 45.30  ? 319  TYR B CA  1 
ATOM   6783 C  C   . TYR B 2 319 ? 56.139  -21.237 14.194  1.00 30.50  ? 319  TYR B C   1 
ATOM   6784 O  O   . TYR B 2 319 ? 57.058  -22.028 14.349  1.00 26.59  ? 319  TYR B O   1 
ATOM   6785 C  CB  . TYR B 2 319 ? 55.104  -21.951 12.044  1.00 50.97  ? 319  TYR B CB  1 
ATOM   6786 C  CG  . TYR B 2 319 ? 54.420  -22.960 12.937  1.00 54.29  ? 319  TYR B CG  1 
ATOM   6787 C  CD1 . TYR B 2 319 ? 53.117  -22.761 13.388  1.00 55.42  ? 319  TYR B CD1 1 
ATOM   6788 C  CD2 . TYR B 2 319 ? 55.077  -24.128 13.314  1.00 54.50  ? 319  TYR B CD2 1 
ATOM   6789 C  CE1 . TYR B 2 319 ? 52.487  -23.709 14.191  1.00 63.40  ? 319  TYR B CE1 1 
ATOM   6790 C  CE2 . TYR B 2 319 ? 54.461  -25.073 14.107  1.00 54.66  ? 319  TYR B CE2 1 
ATOM   6791 C  CZ  . TYR B 2 319 ? 53.169  -24.866 14.542  1.00 61.84  ? 319  TYR B CZ  1 
ATOM   6792 O  OH  . TYR B 2 319 ? 52.567  -25.835 15.310  1.00 70.23  ? 319  TYR B OH  1 
ATOM   6793 N  N   . ASP B 2 320 ? 55.414  -20.785 15.202  1.00 20.97  ? 320  ASP B N   1 
ATOM   6794 C  CA  . ASP B 2 320 ? 55.722  -21.180 16.554  1.00 25.00  ? 320  ASP B CA  1 
ATOM   6795 C  C   . ASP B 2 320 ? 54.788  -22.306 16.977  1.00 20.40  ? 320  ASP B C   1 
ATOM   6796 O  O   . ASP B 2 320 ? 53.581  -22.121 17.117  1.00 6.89   ? 320  ASP B O   1 
ATOM   6797 C  CB  . ASP B 2 320 ? 55.613  -19.989 17.506  1.00 30.43  ? 320  ASP B CB  1 
ATOM   6798 C  CG  . ASP B 2 320 ? 56.194  -20.281 18.875  1.00 38.71  ? 320  ASP B CG  1 
ATOM   6799 O  OD1 . ASP B 2 320 ? 56.099  -21.432 19.337  1.00 33.27  ? 320  ASP B OD1 1 
ATOM   6800 O  OD2 . ASP B 2 320 ? 56.754  -19.354 19.496  1.00 57.47  ? 320  ASP B OD2 1 
ATOM   6801 N  N   . PRO B 2 321 ? 55.349  -23.497 17.197  1.00 28.29  ? 321  PRO B N   1 
ATOM   6802 C  CA  . PRO B 2 321 ? 54.603  -24.687 17.610  1.00 40.08  ? 321  PRO B CA  1 
ATOM   6803 C  C   . PRO B 2 321 ? 53.985  -24.559 18.999  1.00 40.39  ? 321  PRO B C   1 
ATOM   6804 O  O   . PRO B 2 321 ? 53.076  -25.318 19.350  1.00 32.02  ? 321  PRO B O   1 
ATOM   6805 C  CB  . PRO B 2 321 ? 55.672  -25.777 17.587  1.00 43.41  ? 321  PRO B CB  1 
ATOM   6806 C  CG  . PRO B 2 321 ? 56.625  -25.295 16.539  1.00 40.93  ? 321  PRO B CG  1 
ATOM   6807 C  CD  . PRO B 2 321 ? 56.742  -23.844 16.889  1.00 31.47  ? 321  PRO B CD  1 
ATOM   6808 N  N   . SER B 2 322 ? 54.527  -23.646 19.801  1.00 38.14  ? 322  SER B N   1 
ATOM   6809 C  CA  . SER B 2 322 ? 54.029  -23.424 21.147  1.00 42.11  ? 322  SER B CA  1 
ATOM   6810 C  C   . SER B 2 322 ? 53.078  -22.236 21.195  1.00 48.85  ? 322  SER B C   1 
ATOM   6811 O  O   . SER B 2 322 ? 52.900  -21.613 22.247  1.00 56.70  ? 322  SER B O   1 
ATOM   6812 C  CB  . SER B 2 322 ? 55.193  -23.195 22.109  1.00 38.27  ? 322  SER B CB  1 
ATOM   6813 O  OG  . SER B 2 322 ? 55.850  -21.975 21.820  1.00 25.16  ? 322  SER B OG  1 
ATOM   6814 N  N   . LYS B 2 323 ? 52.486  -21.906 20.055  1.00 44.54  ? 323  LYS B N   1 
ATOM   6815 C  CA  . LYS B 2 323 ? 51.559  -20.793 19.990  1.00 45.78  ? 323  LYS B CA  1 
ATOM   6816 C  C   . LYS B 2 323 ? 50.332  -21.206 19.237  1.00 43.97  ? 323  LYS B C   1 
ATOM   6817 O  O   . LYS B 2 323 ? 50.415  -22.005 18.307  1.00 48.30  ? 323  LYS B O   1 
ATOM   6818 C  CB  . LYS B 2 323 ? 52.203  -19.599 19.307  1.00 49.15  ? 323  LYS B CB  1 
ATOM   6819 C  CG  . LYS B 2 323 ? 52.817  -18.648 20.283  1.00 62.75  ? 323  LYS B CG  1 
ATOM   6820 C  CD  . LYS B 2 323 ? 53.590  -17.577 19.570  1.00 82.05  ? 323  LYS B CD  1 
ATOM   6821 C  CE  . LYS B 2 323 ? 54.124  -16.554 20.554  1.00 91.29  ? 323  LYS B CE  1 
ATOM   6822 N  NZ  . LYS B 2 323 ? 54.689  -17.193 21.775  1.00 92.78  ? 323  LYS B NZ  1 
ATOM   6823 N  N   . ASP B 2 324 ? 49.191  -20.659 19.630  1.00 41.73  ? 324  ASP B N   1 
ATOM   6824 C  CA  . ASP B 2 324 ? 47.938  -21.002 18.964  1.00 40.52  ? 324  ASP B CA  1 
ATOM   6825 C  C   . ASP B 2 324 ? 47.948  -20.500 17.532  1.00 29.21  ? 324  ASP B C   1 
ATOM   6826 O  O   . ASP B 2 324 ? 48.456  -19.417 17.236  1.00 29.45  ? 324  ASP B O   1 
ATOM   6827 C  CB  . ASP B 2 324 ? 46.731  -20.437 19.723  1.00 48.01  ? 324  ASP B CB  1 
ATOM   6828 C  CG  . ASP B 2 324 ? 46.631  -20.970 21.150  1.00 43.02  ? 324  ASP B CG  1 
ATOM   6829 O  OD1 . ASP B 2 324 ? 46.615  -22.205 21.330  1.00 58.14  ? 324  ASP B OD1 1 
ATOM   6830 O  OD2 . ASP B 2 324 ? 46.566  -20.154 22.092  1.00 24.53  ? 324  ASP B OD2 1 
ATOM   6831 N  N   . LEU B 2 325 ? 47.436  -21.327 16.639  1.00 23.80  ? 325  LEU B N   1 
ATOM   6832 C  CA  . LEU B 2 325 ? 47.387  -20.981 15.235  1.00 25.19  ? 325  LEU B CA  1 
ATOM   6833 C  C   . LEU B 2 325 ? 46.074  -20.241 14.999  1.00 25.64  ? 325  LEU B C   1 
ATOM   6834 O  O   . LEU B 2 325 ? 45.037  -20.632 15.533  1.00 28.71  ? 325  LEU B O   1 
ATOM   6835 C  CB  . LEU B 2 325 ? 47.466  -22.258 14.406  1.00 19.72  ? 325  LEU B CB  1 
ATOM   6836 C  CG  . LEU B 2 325 ? 48.047  -22.129 13.008  1.00 25.60  ? 325  LEU B CG  1 
ATOM   6837 C  CD1 . LEU B 2 325 ? 49.274  -21.267 13.060  1.00 42.33  ? 325  LEU B CD1 1 
ATOM   6838 C  CD2 . LEU B 2 325 ? 48.399  -23.506 12.491  1.00 38.12  ? 325  LEU B CD2 1 
ATOM   6839 N  N   . ILE B 2 326 ? 46.108  -19.160 14.233  1.00 25.34  ? 326  ILE B N   1 
ATOM   6840 C  CA  . ILE B 2 326 ? 44.890  -18.403 13.995  1.00 26.05  ? 326  ILE B CA  1 
ATOM   6841 C  C   . ILE B 2 326 ? 44.543  -18.261 12.531  1.00 25.19  ? 326  ILE B C   1 
ATOM   6842 O  O   . ILE B 2 326 ? 45.417  -18.246 11.657  1.00 22.11  ? 326  ILE B O   1 
ATOM   6843 C  CB  . ILE B 2 326 ? 44.927  -17.013 14.682  1.00 30.59  ? 326  ILE B CB  1 
ATOM   6844 C  CG1 . ILE B 2 326 ? 45.017  -17.199 16.202  1.00 33.62  ? 326  ILE B CG1 1 
ATOM   6845 C  CG2 . ILE B 2 326 ? 43.673  -16.204 14.337  1.00 31.62  ? 326  ILE B CG2 1 
ATOM   6846 C  CD1 . ILE B 2 326 ? 44.997  -15.914 16.986  1.00 35.55  ? 326  ILE B CD1 1 
ATOM   6847 N  N   . ALA B 2 327 ? 43.243  -18.192 12.283  1.00 24.55  ? 327  ALA B N   1 
ATOM   6848 C  CA  . ALA B 2 327 ? 42.708  -18.070 10.950  1.00 22.38  ? 327  ALA B CA  1 
ATOM   6849 C  C   . ALA B 2 327 ? 41.566  -17.066 10.976  1.00 25.94  ? 327  ALA B C   1 
ATOM   6850 O  O   . ALA B 2 327 ? 40.628  -17.190 11.764  1.00 28.58  ? 327  ALA B O   1 
ATOM   6851 C  CB  . ALA B 2 327 ? 42.207  -19.443 10.466  1.00 4.06   ? 327  ALA B CB  1 
ATOM   6852 N  N   . GLU B 2 328 ? 41.691  -16.024 10.169  1.00 29.89  ? 328  GLU B N   1 
ATOM   6853 C  CA  . GLU B 2 328 ? 40.645  -15.020 10.067  1.00 28.88  ? 328  GLU B CA  1 
ATOM   6854 C  C   . GLU B 2 328 ? 40.133  -15.126 8.629   1.00 20.42  ? 328  GLU B C   1 
ATOM   6855 O  O   . GLU B 2 328 ? 40.852  -15.609 7.738   1.00 5.03   ? 328  GLU B O   1 
ATOM   6856 C  CB  . GLU B 2 328 ? 41.203  -13.619 10.366  1.00 39.75  ? 328  GLU B CB  1 
ATOM   6857 C  CG  . GLU B 2 328 ? 40.149  -12.509 10.442  1.00 52.21  ? 328  GLU B CG  1 
ATOM   6858 C  CD  . GLU B 2 328 ? 40.681  -11.208 11.050  1.00 60.70  ? 328  GLU B CD  1 
ATOM   6859 O  OE1 . GLU B 2 328 ? 41.497  -11.280 11.997  1.00 53.10  ? 328  GLU B OE1 1 
ATOM   6860 O  OE2 . GLU B 2 328 ? 40.266  -10.115 10.594  1.00 62.30  ? 328  GLU B OE2 1 
ATOM   6861 N  N   . ILE B 2 329 ? 38.858  -14.795 8.443   1.00 18.95  ? 329  ILE B N   1 
ATOM   6862 C  CA  . ILE B 2 329 ? 38.213  -14.824 7.134   1.00 6.33   ? 329  ILE B CA  1 
ATOM   6863 C  C   . ILE B 2 329 ? 37.382  -13.559 7.002   1.00 11.07  ? 329  ILE B C   1 
ATOM   6864 O  O   . ILE B 2 329 ? 36.913  -12.989 8.002   1.00 9.45   ? 329  ILE B O   1 
ATOM   6865 C  CB  . ILE B 2 329 ? 37.245  -16.006 6.977   1.00 2.49   ? 329  ILE B CB  1 
ATOM   6866 C  CG1 . ILE B 2 329 ? 37.936  -17.329 7.320   1.00 36.00  ? 329  ILE B CG1 1 
ATOM   6867 C  CG2 . ILE B 2 329 ? 36.704  -16.043 5.573   1.00 2.00   ? 329  ILE B CG2 1 
ATOM   6868 C  CD1 . ILE B 2 329 ? 37.003  -18.561 7.290   1.00 42.92  ? 329  ILE B CD1 1 
ATOM   6869 N  N   . GLN B 2 330 ? 37.253  -13.096 5.766   1.00 15.11  ? 330  GLN B N   1 
ATOM   6870 C  CA  . GLN B 2 330 ? 36.475  -11.915 5.458   1.00 11.95  ? 330  GLN B CA  1 
ATOM   6871 C  C   . GLN B 2 330 ? 35.656  -12.286 4.246   1.00 16.39  ? 330  GLN B C   1 
ATOM   6872 O  O   . GLN B 2 330 ? 36.158  -12.923 3.305   1.00 2.00   ? 330  GLN B O   1 
ATOM   6873 C  CB  . GLN B 2 330 ? 37.365  -10.717 5.097   1.00 16.67  ? 330  GLN B CB  1 
ATOM   6874 C  CG  . GLN B 2 330 ? 38.399  -10.318 6.134   1.00 12.59  ? 330  GLN B CG  1 
ATOM   6875 C  CD  . GLN B 2 330 ? 39.618  -11.210 6.096   1.00 35.34  ? 330  GLN B CD  1 
ATOM   6876 O  OE1 . GLN B 2 330 ? 39.983  -11.739 5.037   1.00 41.36  ? 330  GLN B OE1 1 
ATOM   6877 N  NE2 . GLN B 2 330 ? 40.257  -11.392 7.249   1.00 31.74  ? 330  GLN B NE2 1 
ATOM   6878 N  N   . LYS B 2 331 ? 34.378  -11.924 4.303   1.00 30.66  ? 331  LYS B N   1 
ATOM   6879 C  CA  . LYS B 2 331 ? 33.432  -12.170 3.219   1.00 24.33  ? 331  LYS B CA  1 
ATOM   6880 C  C   . LYS B 2 331 ? 33.727  -11.119 2.177   1.00 13.68  ? 331  LYS B C   1 
ATOM   6881 O  O   . LYS B 2 331 ? 33.648  -9.925  2.463   1.00 11.37  ? 331  LYS B O   1 
ATOM   6882 C  CB  . LYS B 2 331 ? 32.010  -11.982 3.749   1.00 24.66  ? 331  LYS B CB  1 
ATOM   6883 C  CG  . LYS B 2 331 ? 30.913  -12.141 2.716   1.00 35.54  ? 331  LYS B CG  1 
ATOM   6884 C  CD  . LYS B 2 331 ? 29.552  -11.963 3.383   1.00 26.03  ? 331  LYS B CD  1 
ATOM   6885 C  CE  . LYS B 2 331 ? 28.403  -12.072 2.395   1.00 6.19   ? 331  LYS B CE  1 
ATOM   6886 N  NZ  . LYS B 2 331 ? 27.074  -11.839 3.039   1.00 2.00   ? 331  LYS B NZ  1 
ATOM   6887 N  N   . GLN B 2 332 ? 34.156  -11.537 0.999   1.00 12.27  ? 332  GLN B N   1 
ATOM   6888 C  CA  . GLN B 2 332 ? 34.442  -10.541 -0.021  1.00 28.95  ? 332  GLN B CA  1 
ATOM   6889 C  C   . GLN B 2 332 ? 33.244  -10.254 -0.923  1.00 34.05  ? 332  GLN B C   1 
ATOM   6890 O  O   . GLN B 2 332 ? 33.217  -9.233  -1.605  1.00 37.30  ? 332  GLN B O   1 
ATOM   6891 C  CB  . GLN B 2 332 ? 35.671  -10.924 -0.850  1.00 38.62  ? 332  GLN B CB  1 
ATOM   6892 C  CG  . GLN B 2 332 ? 37.016  -10.678 -0.154  1.00 54.83  ? 332  GLN B CG  1 
ATOM   6893 C  CD  . GLN B 2 332 ? 37.412  -9.201  -0.053  1.00 53.20  ? 332  GLN B CD  1 
ATOM   6894 O  OE1 . GLN B 2 332 ? 38.184  -8.808  0.828   1.00 50.72  ? 332  GLN B OE1 1 
ATOM   6895 N  NE2 . GLN B 2 332 ? 36.899  -8.385  -0.962  1.00 48.46  ? 332  GLN B NE2 1 
ATOM   6896 N  N   . GLY B 2 333 ? 32.241  -11.127 -0.893  1.00 37.52  ? 333  GLY B N   1 
ATOM   6897 C  CA  . GLY B 2 333 ? 31.074  -10.924 -1.733  1.00 41.11  ? 333  GLY B CA  1 
ATOM   6898 C  C   . GLY B 2 333 ? 31.181  -11.701 -3.034  1.00 40.18  ? 333  GLY B C   1 
ATOM   6899 O  O   . GLY B 2 333 ? 32.257  -12.190 -3.374  1.00 35.66  ? 333  GLY B O   1 
ATOM   6900 N  N   . GLN B 2 334 ? 30.069  -11.788 -3.764  1.00 38.45  ? 334  GLN B N   1 
ATOM   6901 C  CA  . GLN B 2 334 ? 29.984  -12.539 -5.019  1.00 39.65  ? 334  GLN B CA  1 
ATOM   6902 C  C   . GLN B 2 334 ? 30.485  -13.990 -4.911  1.00 34.73  ? 334  GLN B C   1 
ATOM   6903 O  O   . GLN B 2 334 ? 30.923  -14.592 -5.883  1.00 30.68  ? 334  GLN B O   1 
ATOM   6904 C  CB  . GLN B 2 334 ? 30.661  -11.792 -6.180  1.00 46.55  ? 334  GLN B CB  1 
ATOM   6905 C  CG  . GLN B 2 334 ? 29.674  -11.009 -7.057  1.00 63.74  ? 334  GLN B CG  1 
ATOM   6906 C  CD  . GLN B 2 334 ? 28.448  -11.836 -7.465  1.00 77.30  ? 334  GLN B CD  1 
ATOM   6907 O  OE1 . GLN B 2 334 ? 28.479  -12.583 -8.448  1.00 80.69  ? 334  GLN B OE1 1 
ATOM   6908 N  NE2 . GLN B 2 334 ? 27.358  -11.686 -6.717  1.00 78.28  ? 334  GLN B NE2 1 
ATOM   6909 N  N   . GLY B 2 335 ? 30.332  -14.572 -3.730  1.00 36.61  ? 335  GLY B N   1 
ATOM   6910 C  CA  . GLY B 2 335 ? 30.774  -15.933 -3.517  1.00 38.43  ? 335  GLY B CA  1 
ATOM   6911 C  C   . GLY B 2 335 ? 32.244  -15.987 -3.155  1.00 45.61  ? 335  GLY B C   1 
ATOM   6912 O  O   . GLY B 2 335 ? 32.771  -17.063 -2.885  1.00 51.69  ? 335  GLY B O   1 
ATOM   6913 N  N   . GLN B 2 336 ? 32.906  -14.831 -3.143  1.00 45.63  ? 336  GLN B N   1 
ATOM   6914 C  CA  . GLN B 2 336 ? 34.326  -14.758 -2.824  1.00 41.08  ? 336  GLN B CA  1 
ATOM   6915 C  C   . GLN B 2 336 ? 34.616  -14.480 -1.360  1.00 41.56  ? 336  GLN B C   1 
ATOM   6916 O  O   . GLN B 2 336 ? 33.823  -13.841 -0.656  1.00 41.13  ? 336  GLN B O   1 
ATOM   6917 C  CB  . GLN B 2 336 ? 35.037  -13.738 -3.714  1.00 37.18  ? 336  GLN B CB  1 
ATOM   6918 C  CG  . GLN B 2 336 ? 35.247  -14.207 -5.156  1.00 44.15  ? 336  GLN B CG  1 
ATOM   6919 C  CD  . GLN B 2 336 ? 33.951  -14.325 -5.954  1.00 41.12  ? 336  GLN B CD  1 
ATOM   6920 O  OE1 . GLN B 2 336 ? 33.357  -13.325 -6.359  1.00 53.63  ? 336  GLN B OE1 1 
ATOM   6921 N  NE2 . GLN B 2 336 ? 33.520  -15.545 -6.193  1.00 36.65  ? 336  GLN B NE2 1 
ATOM   6922 N  N   . TRP B 2 337 ? 35.758  -14.991 -0.908  1.00 44.37  ? 337  TRP B N   1 
ATOM   6923 C  CA  . TRP B 2 337 ? 36.200  -14.856 0.475   1.00 45.14  ? 337  TRP B CA  1 
ATOM   6924 C  C   . TRP B 2 337 ? 37.724  -14.782 0.510   1.00 45.81  ? 337  TRP B C   1 
ATOM   6925 O  O   . TRP B 2 337 ? 38.386  -15.105 -0.480  1.00 51.36  ? 337  TRP B O   1 
ATOM   6926 C  CB  . TRP B 2 337 ? 35.780  -16.097 1.269   1.00 44.43  ? 337  TRP B CB  1 
ATOM   6927 C  CG  . TRP B 2 337 ? 34.337  -16.445 1.151   1.00 35.34  ? 337  TRP B CG  1 
ATOM   6928 C  CD1 . TRP B 2 337 ? 33.711  -17.025 0.082   1.00 27.81  ? 337  TRP B CD1 1 
ATOM   6929 C  CD2 . TRP B 2 337 ? 33.318  -16.174 2.116   1.00 32.47  ? 337  TRP B CD2 1 
ATOM   6930 N  NE1 . TRP B 2 337 ? 32.360  -17.110 0.319   1.00 42.76  ? 337  TRP B NE1 1 
ATOM   6931 C  CE2 . TRP B 2 337 ? 32.095  -16.596 1.562   1.00 42.97  ? 337  TRP B CE2 1 
ATOM   6932 C  CE3 . TRP B 2 337 ? 33.325  -15.610 3.399   1.00 13.38  ? 337  TRP B CE3 1 
ATOM   6933 C  CZ2 . TRP B 2 337 ? 30.885  -16.468 2.251   1.00 44.25  ? 337  TRP B CZ2 1 
ATOM   6934 C  CZ3 . TRP B 2 337 ? 32.131  -15.487 4.077   1.00 2.00   ? 337  TRP B CZ3 1 
ATOM   6935 C  CH2 . TRP B 2 337 ? 30.929  -15.910 3.506   1.00 25.12  ? 337  TRP B CH2 1 
ATOM   6936 N  N   . THR B 2 338 ? 38.269  -14.366 1.652   1.00 39.17  ? 338  THR B N   1 
ATOM   6937 C  CA  . THR B 2 338 ? 39.715  -14.285 1.854   1.00 29.18  ? 338  THR B CA  1 
ATOM   6938 C  C   . THR B 2 338 ? 40.041  -14.694 3.279   1.00 18.16  ? 338  THR B C   1 
ATOM   6939 O  O   . THR B 2 338 ? 39.242  -14.479 4.189   1.00 2.00   ? 338  THR B O   1 
ATOM   6940 C  CB  . THR B 2 338 ? 40.291  -12.854 1.633   1.00 38.19  ? 338  THR B CB  1 
ATOM   6941 O  OG1 . THR B 2 338 ? 39.473  -11.873 2.295   1.00 43.83  ? 338  THR B OG1 1 
ATOM   6942 C  CG2 . THR B 2 338 ? 40.407  -12.541 0.150   1.00 39.92  ? 338  THR B CG2 1 
ATOM   6943 N  N   . TYR B 2 339 ? 41.231  -15.250 3.472   1.00 23.97  ? 339  TYR B N   1 
ATOM   6944 C  CA  . TYR B 2 339 ? 41.677  -15.670 4.788   1.00 20.19  ? 339  TYR B CA  1 
ATOM   6945 C  C   . TYR B 2 339 ? 43.157  -15.375 4.990   1.00 23.54  ? 339  TYR B C   1 
ATOM   6946 O  O   . TYR B 2 339 ? 43.904  -15.161 4.020   1.00 24.15  ? 339  TYR B O   1 
ATOM   6947 C  CB  . TYR B 2 339 ? 41.427  -17.161 4.976   1.00 21.84  ? 339  TYR B CB  1 
ATOM   6948 C  CG  . TYR B 2 339 ? 42.196  -18.044 4.018   1.00 25.44  ? 339  TYR B CG  1 
ATOM   6949 C  CD1 . TYR B 2 339 ? 41.696  -18.321 2.749   1.00 19.47  ? 339  TYR B CD1 1 
ATOM   6950 C  CD2 . TYR B 2 339 ? 43.427  -18.608 4.388   1.00 26.33  ? 339  TYR B CD2 1 
ATOM   6951 C  CE1 . TYR B 2 339 ? 42.394  -19.134 1.868   1.00 25.70  ? 339  TYR B CE1 1 
ATOM   6952 C  CE2 . TYR B 2 339 ? 44.137  -19.419 3.515   1.00 18.24  ? 339  TYR B CE2 1 
ATOM   6953 C  CZ  . TYR B 2 339 ? 43.614  -19.679 2.250   1.00 19.07  ? 339  TYR B CZ  1 
ATOM   6954 O  OH  . TYR B 2 339 ? 44.308  -20.462 1.348   1.00 9.23   ? 339  TYR B OH  1 
ATOM   6955 N  N   . GLN B 2 340 ? 43.564  -15.338 6.258   1.00 26.96  ? 340  GLN B N   1 
ATOM   6956 C  CA  . GLN B 2 340 ? 44.958  -15.102 6.647   1.00 28.00  ? 340  GLN B CA  1 
ATOM   6957 C  C   . GLN B 2 340 ? 45.285  -15.932 7.886   1.00 19.62  ? 340  GLN B C   1 
ATOM   6958 O  O   . GLN B 2 340 ? 44.714  -15.711 8.953   1.00 23.37  ? 340  GLN B O   1 
ATOM   6959 C  CB  . GLN B 2 340 ? 45.218  -13.625 6.986   1.00 32.86  ? 340  GLN B CB  1 
ATOM   6960 C  CG  . GLN B 2 340 ? 44.834  -12.617 5.925   1.00 31.23  ? 340  GLN B CG  1 
ATOM   6961 C  CD  . GLN B 2 340 ? 43.397  -12.176 6.058   1.00 37.42  ? 340  GLN B CD  1 
ATOM   6962 O  OE1 . GLN B 2 340 ? 42.972  -11.694 7.117   1.00 29.15  ? 340  GLN B OE1 1 
ATOM   6963 N  NE2 . GLN B 2 340 ? 42.634  -12.343 4.988   1.00 38.41  ? 340  GLN B NE2 1 
ATOM   6964 N  N   . ILE B 2 341 ? 46.156  -16.918 7.744   1.00 16.70  ? 341  ILE B N   1 
ATOM   6965 C  CA  . ILE B 2 341 ? 46.526  -17.729 8.888   1.00 19.47  ? 341  ILE B CA  1 
ATOM   6966 C  C   . ILE B 2 341 ? 47.760  -17.054 9.437   1.00 19.66  ? 341  ILE B C   1 
ATOM   6967 O  O   . ILE B 2 341 ? 48.690  -16.733 8.690   1.00 15.61  ? 341  ILE B O   1 
ATOM   6968 C  CB  . ILE B 2 341 ? 46.842  -19.174 8.484   1.00 22.10  ? 341  ILE B CB  1 
ATOM   6969 C  CG1 . ILE B 2 341 ? 45.669  -19.736 7.692   1.00 35.90  ? 341  ILE B CG1 1 
ATOM   6970 C  CG2 . ILE B 2 341 ? 47.072  -20.029 9.722   1.00 20.69  ? 341  ILE B CG2 1 
ATOM   6971 C  CD1 . ILE B 2 341 ? 46.036  -20.888 6.810   1.00 52.69  ? 341  ILE B CD1 1 
ATOM   6972 N  N   . TYR B 2 342 ? 47.763  -16.820 10.738  1.00 24.81  ? 342  TYR B N   1 
ATOM   6973 C  CA  . TYR B 2 342 ? 48.875  -16.145 11.378  1.00 37.68  ? 342  TYR B CA  1 
ATOM   6974 C  C   . TYR B 2 342 ? 48.847  -16.483 12.845  1.00 44.58  ? 342  TYR B C   1 
ATOM   6975 O  O   . TYR B 2 342 ? 47.882  -17.073 13.331  1.00 48.79  ? 342  TYR B O   1 
ATOM   6976 C  CB  . TYR B 2 342 ? 48.731  -14.626 11.207  1.00 49.97  ? 342  TYR B CB  1 
ATOM   6977 C  CG  . TYR B 2 342 ? 47.486  -14.024 11.844  1.00 54.92  ? 342  TYR B CG  1 
ATOM   6978 C  CD1 . TYR B 2 342 ? 47.471  -13.665 13.195  1.00 63.71  ? 342  TYR B CD1 1 
ATOM   6979 C  CD2 . TYR B 2 342 ? 46.330  -13.799 11.094  1.00 51.90  ? 342  TYR B CD2 1 
ATOM   6980 C  CE1 . TYR B 2 342 ? 46.337  -13.094 13.784  1.00 66.27  ? 342  TYR B CE1 1 
ATOM   6981 C  CE2 . TYR B 2 342 ? 45.188  -13.228 11.675  1.00 55.83  ? 342  TYR B CE2 1 
ATOM   6982 C  CZ  . TYR B 2 342 ? 45.201  -12.877 13.019  1.00 56.97  ? 342  TYR B CZ  1 
ATOM   6983 O  OH  . TYR B 2 342 ? 44.100  -12.287 13.598  1.00 43.16  ? 342  TYR B OH  1 
ATOM   6984 N  N   . GLN B 2 343 ? 49.904  -16.108 13.553  1.00 48.84  ? 343  GLN B N   1 
ATOM   6985 C  CA  . GLN B 2 343 ? 49.972  -16.366 14.984  1.00 53.34  ? 343  GLN B CA  1 
ATOM   6986 C  C   . GLN B 2 343 ? 50.161  -15.043 15.689  1.00 51.80  ? 343  GLN B C   1 
ATOM   6987 O  O   . GLN B 2 343 ? 49.823  -14.907 16.863  1.00 56.09  ? 343  GLN B O   1 
ATOM   6988 C  CB  . GLN B 2 343 ? 51.096  -17.345 15.327  1.00 63.67  ? 343  GLN B CB  1 
ATOM   6989 C  CG  . GLN B 2 343 ? 50.901  -18.722 14.719  1.00 67.20  ? 343  GLN B CG  1 
ATOM   6990 C  CD  . GLN B 2 343 ? 51.894  -19.735 15.228  1.00 68.76  ? 343  GLN B CD  1 
ATOM   6991 O  OE1 . GLN B 2 343 ? 52.926  -19.982 14.602  1.00 67.74  ? 343  GLN B OE1 1 
ATOM   6992 N  NE2 . GLN B 2 343 ? 51.586  -20.338 16.364  1.00 65.35  ? 343  GLN B NE2 1 
ATOM   6993 N  N   . GLU B 2 344 ? 50.705  -14.071 14.960  1.00 46.74  ? 344  GLU B N   1 
ATOM   6994 C  CA  . GLU B 2 344 ? 50.913  -12.722 15.481  1.00 49.10  ? 344  GLU B CA  1 
ATOM   6995 C  C   . GLU B 2 344 ? 50.242  -11.801 14.478  1.00 42.53  ? 344  GLU B C   1 
ATOM   6996 O  O   . GLU B 2 344 ? 50.355  -12.019 13.277  1.00 39.44  ? 344  GLU B O   1 
ATOM   6997 C  CB  . GLU B 2 344 ? 52.400  -12.394 15.592  1.00 61.12  ? 344  GLU B CB  1 
ATOM   6998 C  CG  . GLU B 2 344 ? 53.132  -13.098 16.745  1.00 71.45  ? 344  GLU B CG  1 
ATOM   6999 C  CD  . GLU B 2 344 ? 52.775  -12.548 18.119  1.00 73.99  ? 344  GLU B CD  1 
ATOM   7000 O  OE1 . GLU B 2 344 ? 52.231  -11.423 18.191  1.00 78.25  ? 344  GLU B OE1 1 
ATOM   7001 O  OE2 . GLU B 2 344 ? 53.052  -13.240 19.128  1.00 67.22  ? 344  GLU B OE2 1 
ATOM   7002 N  N   . PRO B 2 345 ? 49.521  -10.770 14.955  1.00 41.37  ? 345  PRO B N   1 
ATOM   7003 C  CA  . PRO B 2 345 ? 48.828  -9.833  14.064  1.00 35.48  ? 345  PRO B CA  1 
ATOM   7004 C  C   . PRO B 2 345 ? 49.753  -9.279  12.994  1.00 29.30  ? 345  PRO B C   1 
ATOM   7005 O  O   . PRO B 2 345 ? 50.852  -8.796  13.294  1.00 27.06  ? 345  PRO B O   1 
ATOM   7006 C  CB  . PRO B 2 345 ? 48.354  -8.740  15.021  1.00 42.82  ? 345  PRO B CB  1 
ATOM   7007 C  CG  . PRO B 2 345 ? 48.170  -9.475  16.315  1.00 35.15  ? 345  PRO B CG  1 
ATOM   7008 C  CD  . PRO B 2 345 ? 49.415  -10.326 16.356  1.00 39.56  ? 345  PRO B CD  1 
ATOM   7009 N  N   . PHE B 2 346 ? 49.303  -9.387  11.746  1.00 23.59  ? 346  PHE B N   1 
ATOM   7010 C  CA  . PHE B 2 346 ? 50.042  -8.925  10.568  1.00 27.41  ? 346  PHE B CA  1 
ATOM   7011 C  C   . PHE B 2 346 ? 51.181  -9.856  10.127  1.00 22.56  ? 346  PHE B C   1 
ATOM   7012 O  O   . PHE B 2 346 ? 51.651  -9.772  8.986   1.00 22.42  ? 346  PHE B O   1 
ATOM   7013 C  CB  . PHE B 2 346 ? 50.562  -7.485  10.753  1.00 38.74  ? 346  PHE B CB  1 
ATOM   7014 C  CG  . PHE B 2 346 ? 49.497  -6.497  11.153  1.00 36.80  ? 346  PHE B CG  1 
ATOM   7015 C  CD1 . PHE B 2 346 ? 48.468  -6.170  10.276  1.00 33.81  ? 346  PHE B CD1 1 
ATOM   7016 C  CD2 . PHE B 2 346 ? 49.511  -5.920  12.422  1.00 48.20  ? 346  PHE B CD2 1 
ATOM   7017 C  CE1 . PHE B 2 346 ? 47.461  -5.284  10.653  1.00 43.46  ? 346  PHE B CE1 1 
ATOM   7018 C  CE2 . PHE B 2 346 ? 48.515  -5.035  12.813  1.00 55.67  ? 346  PHE B CE2 1 
ATOM   7019 C  CZ  . PHE B 2 346 ? 47.481  -4.714  11.924  1.00 55.94  ? 346  PHE B CZ  1 
ATOM   7020 N  N   . LYS B 2 347 ? 51.596  -10.766 11.005  1.00 20.86  ? 347  LYS B N   1 
ATOM   7021 C  CA  . LYS B 2 347 ? 52.671  -11.716 10.696  1.00 15.73  ? 347  LYS B CA  1 
ATOM   7022 C  C   . LYS B 2 347 ? 52.057  -13.015 10.178  1.00 14.28  ? 347  LYS B C   1 
ATOM   7023 O  O   . LYS B 2 347 ? 51.953  -14.022 10.895  1.00 6.76   ? 347  LYS B O   1 
ATOM   7024 C  CB  . LYS B 2 347 ? 53.523  -11.939 11.939  1.00 11.96  ? 347  LYS B CB  1 
ATOM   7025 C  CG  . LYS B 2 347 ? 54.229  -10.665 12.384  1.00 17.57  ? 347  LYS B CG  1 
ATOM   7026 C  CD  . LYS B 2 347 ? 54.953  -10.844 13.696  1.00 21.41  ? 347  LYS B CD  1 
ATOM   7027 C  CE  . LYS B 2 347 ? 54.732  -9.660  14.627  1.00 23.42  ? 347  LYS B CE  1 
ATOM   7028 N  NZ  . LYS B 2 347 ? 55.424  -9.879  15.926  1.00 43.48  ? 347  LYS B NZ  1 
ATOM   7029 N  N   . ASN B 2 348 ? 51.652  -12.970 8.915   1.00 18.59  ? 348  ASN B N   1 
ATOM   7030 C  CA  . ASN B 2 348 ? 50.982  -14.088 8.269   1.00 34.09  ? 348  ASN B CA  1 
ATOM   7031 C  C   . ASN B 2 348 ? 51.836  -15.239 7.811   1.00 41.14  ? 348  ASN B C   1 
ATOM   7032 O  O   . ASN B 2 348 ? 52.833  -15.038 7.121   1.00 45.75  ? 348  ASN B O   1 
ATOM   7033 C  CB  . ASN B 2 348 ? 50.177  -13.606 7.066   1.00 40.04  ? 348  ASN B CB  1 
ATOM   7034 C  CG  . ASN B 2 348 ? 49.066  -12.675 7.448   1.00 46.09  ? 348  ASN B CG  1 
ATOM   7035 O  OD1 . ASN B 2 348 ? 48.557  -12.708 8.580   1.00 40.06  ? 348  ASN B OD1 1 
ATOM   7036 N  ND2 . ASN B 2 348 ? 48.680  -11.823 6.508   1.00 50.58  ? 348  ASN B ND2 1 
ATOM   7037 N  N   . LEU B 2 349 ? 51.385  -16.450 8.129   1.00 42.66  ? 349  LEU B N   1 
ATOM   7038 C  CA  . LEU B 2 349 ? 52.065  -17.671 7.719   1.00 37.04  ? 349  LEU B CA  1 
ATOM   7039 C  C   . LEU B 2 349 ? 51.580  -17.997 6.304   1.00 36.48  ? 349  LEU B C   1 
ATOM   7040 O  O   . LEU B 2 349 ? 52.306  -18.596 5.513   1.00 35.42  ? 349  LEU B O   1 
ATOM   7041 C  CB  . LEU B 2 349 ? 51.741  -18.806 8.691   1.00 36.22  ? 349  LEU B CB  1 
ATOM   7042 C  CG  . LEU B 2 349 ? 52.252  -18.551 10.114  1.00 44.79  ? 349  LEU B CG  1 
ATOM   7043 C  CD1 . LEU B 2 349 ? 51.664  -19.538 11.100  1.00 47.96  ? 349  LEU B CD1 1 
ATOM   7044 C  CD2 . LEU B 2 349 ? 53.764  -18.610 10.134  1.00 42.83  ? 349  LEU B CD2 1 
ATOM   7045 N  N   . LYS B 2 350 ? 50.357  -17.568 5.990   1.00 35.57  ? 350  LYS B N   1 
ATOM   7046 C  CA  . LYS B 2 350 ? 49.765  -17.772 4.675   1.00 31.81  ? 350  LYS B CA  1 
ATOM   7047 C  C   . LYS B 2 350 ? 48.456  -17.001 4.553   1.00 30.93  ? 350  LYS B C   1 
ATOM   7048 O  O   . LYS B 2 350 ? 47.734  -16.777 5.533   1.00 12.59  ? 350  LYS B O   1 
ATOM   7049 C  CB  . LYS B 2 350 ? 49.529  -19.266 4.391   1.00 38.64  ? 350  LYS B CB  1 
ATOM   7050 C  CG  . LYS B 2 350 ? 48.835  -19.578 3.054   1.00 34.61  ? 350  LYS B CG  1 
ATOM   7051 C  CD  . LYS B 2 350 ? 48.421  -21.052 2.967   1.00 39.50  ? 350  LYS B CD  1 
ATOM   7052 C  CE  . LYS B 2 350 ? 47.503  -21.346 1.763   1.00 57.04  ? 350  LYS B CE  1 
ATOM   7053 N  NZ  . LYS B 2 350 ? 48.058  -21.003 0.411   1.00 63.86  ? 350  LYS B NZ  1 
ATOM   7054 N  N   . THR B 2 351 ? 48.169  -16.615 3.318   1.00 38.43  ? 351  THR B N   1 
ATOM   7055 C  CA  . THR B 2 351 ? 46.977  -15.879 2.950   1.00 30.47  ? 351  THR B CA  1 
ATOM   7056 C  C   . THR B 2 351 ? 46.469  -16.561 1.676   1.00 36.32  ? 351  THR B C   1 
ATOM   7057 O  O   . THR B 2 351 ? 47.251  -17.172 0.921   1.00 37.13  ? 351  THR B O   1 
ATOM   7058 C  CB  . THR B 2 351 ? 47.327  -14.389 2.648   1.00 25.90  ? 351  THR B CB  1 
ATOM   7059 O  OG1 . THR B 2 351 ? 48.365  -14.311 1.654   1.00 26.00  ? 351  THR B OG1 1 
ATOM   7060 C  CG2 . THR B 2 351 ? 47.810  -13.697 3.910   1.00 19.00  ? 351  THR B CG2 1 
ATOM   7061 N  N   . GLY B 2 352 ? 45.165  -16.486 1.447   1.00 33.16  ? 352  GLY B N   1 
ATOM   7062 C  CA  . GLY B 2 352 ? 44.608  -17.099 0.259   1.00 29.04  ? 352  GLY B CA  1 
ATOM   7063 C  C   . GLY B 2 352 ? 43.163  -16.713 0.082   1.00 23.96  ? 352  GLY B C   1 
ATOM   7064 O  O   . GLY B 2 352 ? 42.571  -16.057 0.933   1.00 17.27  ? 352  GLY B O   1 
ATOM   7065 N  N   . LYS B 2 353 ? 42.571  -17.174 -1.002  1.00 30.69  ? 353  LYS B N   1 
ATOM   7066 C  CA  . LYS B 2 353 ? 41.192  -16.853 -1.268  1.00 45.19  ? 353  LYS B CA  1 
ATOM   7067 C  C   . LYS B 2 353 ? 40.384  -18.146 -1.461  1.00 56.75  ? 353  LYS B C   1 
ATOM   7068 O  O   . LYS B 2 353 ? 40.955  -19.239 -1.591  1.00 57.50  ? 353  LYS B O   1 
ATOM   7069 C  CB  . LYS B 2 353 ? 41.117  -15.956 -2.508  1.00 46.99  ? 353  LYS B CB  1 
ATOM   7070 C  CG  . LYS B 2 353 ? 41.171  -16.708 -3.828  1.00 57.58  ? 353  LYS B CG  1 
ATOM   7071 C  CD  . LYS B 2 353 ? 39.769  -16.907 -4.366  1.00 59.88  ? 353  LYS B CD  1 
ATOM   7072 C  CE  . LYS B 2 353 ? 39.737  -17.869 -5.522  1.00 62.00  ? 353  LYS B CE  1 
ATOM   7073 N  NZ  . LYS B 2 353 ? 38.430  -17.722 -6.184  1.00 66.32  ? 353  LYS B NZ  1 
ATOM   7074 N  N   . TYR B 2 354 ? 39.061  -18.009 -1.471  1.00 60.85  ? 354  TYR B N   1 
ATOM   7075 C  CA  . TYR B 2 354 ? 38.156  -19.134 -1.660  1.00 59.48  ? 354  TYR B CA  1 
ATOM   7076 C  C   . TYR B 2 354 ? 36.965  -18.682 -2.499  1.00 58.42  ? 354  TYR B C   1 
ATOM   7077 O  O   . TYR B 2 354 ? 36.393  -17.611 -2.265  1.00 49.61  ? 354  TYR B O   1 
ATOM   7078 C  CB  . TYR B 2 354 ? 37.674  -19.667 -0.303  1.00 68.72  ? 354  TYR B CB  1 
ATOM   7079 C  CG  . TYR B 2 354 ? 36.651  -20.798 -0.364  1.00 84.12  ? 354  TYR B CG  1 
ATOM   7080 C  CD1 . TYR B 2 354 ? 37.040  -22.112 -0.637  1.00 94.23  ? 354  TYR B CD1 1 
ATOM   7081 C  CD2 . TYR B 2 354 ? 35.296  -20.554 -0.128  1.00 85.84  ? 354  TYR B CD2 1 
ATOM   7082 C  CE1 . TYR B 2 354 ? 36.100  -23.155 -0.673  1.00 96.99  ? 354  TYR B CE1 1 
ATOM   7083 C  CE2 . TYR B 2 354 ? 34.353  -21.588 -0.163  1.00 89.22  ? 354  TYR B CE2 1 
ATOM   7084 C  CZ  . TYR B 2 354 ? 34.762  -22.881 -0.436  1.00 92.08  ? 354  TYR B CZ  1 
ATOM   7085 O  OH  . TYR B 2 354 ? 33.831  -23.891 -0.488  1.00 91.19  ? 354  TYR B OH  1 
ATOM   7086 N  N   . ALA B 2 355 ? 36.672  -19.465 -3.533  1.00 61.20  ? 355  ALA B N   1 
ATOM   7087 C  CA  . ALA B 2 355 ? 35.544  -19.227 -4.424  1.00 65.38  ? 355  ALA B CA  1 
ATOM   7088 C  C   . ALA B 2 355 ? 34.507  -20.286 -4.056  1.00 76.08  ? 355  ALA B C   1 
ATOM   7089 O  O   . ALA B 2 355 ? 34.871  -21.432 -3.755  1.00 78.93  ? 355  ALA B O   1 
ATOM   7090 C  CB  . ALA B 2 355 ? 35.967  -19.407 -5.861  1.00 61.15  ? 355  ALA B CB  1 
ATOM   7091 N  N   . ARG B 2 356 ? 33.230  -19.904 -4.049  1.00 78.67  ? 356  ARG B N   1 
ATOM   7092 C  CA  . ARG B 2 356 ? 32.151  -20.832 -3.704  1.00 75.37  ? 356  ARG B CA  1 
ATOM   7093 C  C   . ARG B 2 356 ? 32.110  -22.051 -4.627  1.00 80.30  ? 356  ARG B C   1 
ATOM   7094 O  O   . ARG B 2 356 ? 32.359  -21.949 -5.831  1.00 78.71  ? 356  ARG B O   1 
ATOM   7095 C  CB  . ARG B 2 356 ? 30.790  -20.124 -3.727  1.00 65.61  ? 356  ARG B CB  1 
ATOM   7096 C  CG  . ARG B 2 356 ? 30.267  -19.776 -5.109  1.00 44.89  ? 356  ARG B CG  1 
ATOM   7097 C  CD  . ARG B 2 356 ? 28.751  -19.858 -5.154  1.00 38.08  ? 356  ARG B CD  1 
ATOM   7098 N  NE  . ARG B 2 356 ? 28.209  -19.789 -6.515  1.00 25.46  ? 356  ARG B NE  1 
ATOM   7099 C  CZ  . ARG B 2 356 ? 27.736  -20.827 -7.207  1.00 34.20  ? 356  ARG B CZ  1 
ATOM   7100 N  NH1 . ARG B 2 356 ? 27.716  -22.050 -6.687  1.00 32.41  ? 356  ARG B NH1 1 
ATOM   7101 N  NH2 . ARG B 2 356 ? 27.267  -20.639 -8.431  1.00 50.19  ? 356  ARG B NH2 1 
ATOM   7102 N  N   . MET B 2 357 ? 31.794  -23.207 -4.055  1.00 84.70  ? 357  MET B N   1 
ATOM   7103 C  CA  . MET B 2 357 ? 31.720  -24.435 -4.833  1.00 90.64  ? 357  MET B CA  1 
ATOM   7104 C  C   . MET B 2 357 ? 30.377  -24.553 -5.538  1.00 92.31  ? 357  MET B C   1 
ATOM   7105 O  O   . MET B 2 357 ? 29.339  -24.200 -4.970  1.00 93.87  ? 357  MET B O   1 
ATOM   7106 C  CB  . MET B 2 357 ? 31.958  -25.648 -3.939  1.00 97.95  ? 357  MET B CB  1 
ATOM   7107 C  CG  . MET B 2 357 ? 33.426  -25.906 -3.634  1.00 108.57 ? 357  MET B CG  1 
ATOM   7108 S  SD  . MET B 2 357 ? 33.661  -27.259 -2.466  1.00 115.41 ? 357  MET B SD  1 
ATOM   7109 C  CE  . MET B 2 357 ? 32.431  -28.429 -3.047  1.00 117.01 ? 357  MET B CE  1 
ATOM   7110 N  N   . ARG B 2 358 ? 30.412  -25.041 -6.777  1.00 91.16  ? 358  ARG B N   1 
ATOM   7111 C  CA  . ARG B 2 358 ? 29.217  -25.217 -7.599  1.00 89.21  ? 358  ARG B CA  1 
ATOM   7112 C  C   . ARG B 2 358 ? 28.058  -25.764 -6.774  1.00 86.26  ? 358  ARG B C   1 
ATOM   7113 O  O   . ARG B 2 358 ? 28.169  -26.822 -6.163  1.00 81.62  ? 358  ARG B O   1 
ATOM   7114 C  CB  . ARG B 2 358 ? 29.524  -26.169 -8.751  1.00 96.47  ? 358  ARG B CB  1 
ATOM   7115 C  CG  . ARG B 2 358 ? 29.181  -25.631 -10.124 1.00 109.09 ? 358  ARG B CG  1 
ATOM   7116 C  CD  . ARG B 2 358 ? 29.486  -26.682 -11.182 1.00 127.79 ? 358  ARG B CD  1 
ATOM   7117 N  NE  . ARG B 2 358 ? 29.138  -26.243 -12.533 1.00 146.33 ? 358  ARG B NE  1 
ATOM   7118 C  CZ  . ARG B 2 358 ? 29.833  -26.552 -13.627 1.00 154.62 ? 358  ARG B CZ  1 
ATOM   7119 N  NH1 . ARG B 2 358 ? 30.925  -27.304 -13.536 1.00 159.14 ? 358  ARG B NH1 1 
ATOM   7120 N  NH2 . ARG B 2 358 ? 29.441  -26.104 -14.815 1.00 155.60 ? 358  ARG B NH2 1 
ATOM   7121 N  N   . GLY B 2 359 ? 26.962  -25.017 -6.734  1.00 89.76  ? 359  GLY B N   1 
ATOM   7122 C  CA  . GLY B 2 359 ? 25.810  -25.449 -5.964  1.00 93.25  ? 359  GLY B CA  1 
ATOM   7123 C  C   . GLY B 2 359 ? 25.500  -24.574 -4.758  1.00 94.76  ? 359  GLY B C   1 
ATOM   7124 O  O   . GLY B 2 359 ? 24.326  -24.391 -4.419  1.00 96.18  ? 359  GLY B O   1 
ATOM   7125 N  N   . ALA B 2 360 ? 26.527  -23.986 -4.144  1.00 91.62  ? 360  ALA B N   1 
ATOM   7126 C  CA  . ALA B 2 360 ? 26.348  -23.121 -2.966  1.00 87.59  ? 360  ALA B CA  1 
ATOM   7127 C  C   . ALA B 2 360 ? 25.903  -21.671 -3.264  1.00 83.26  ? 360  ALA B C   1 
ATOM   7128 O  O   . ALA B 2 360 ? 25.803  -20.845 -2.355  1.00 81.55  ? 360  ALA B O   1 
ATOM   7129 C  CB  . ALA B 2 360 ? 27.631  -23.118 -2.125  1.00 82.17  ? 360  ALA B CB  1 
ATOM   7130 N  N   . HIS B 2 361 ? 25.576  -21.397 -4.524  1.00 80.85  ? 361  HIS B N   1 
ATOM   7131 C  CA  . HIS B 2 361 ? 25.158  -20.067 -4.998  1.00 77.56  ? 361  HIS B CA  1 
ATOM   7132 C  C   . HIS B 2 361 ? 24.265  -19.153 -4.153  1.00 72.45  ? 361  HIS B C   1 
ATOM   7133 O  O   . HIS B 2 361 ? 24.413  -17.935 -4.206  1.00 73.36  ? 361  HIS B O   1 
ATOM   7134 C  CB  . HIS B 2 361 ? 24.574  -20.169 -6.416  1.00 81.04  ? 361  HIS B CB  1 
ATOM   7135 C  CG  . HIS B 2 361 ? 23.657  -21.336 -6.615  1.00 83.28  ? 361  HIS B CG  1 
ATOM   7136 N  ND1 . HIS B 2 361 ? 23.607  -22.049 -7.795  1.00 80.98  ? 361  HIS B ND1 1 
ATOM   7137 C  CD2 . HIS B 2 361 ? 22.759  -21.921 -5.785  1.00 82.14  ? 361  HIS B CD2 1 
ATOM   7138 C  CE1 . HIS B 2 361 ? 22.720  -23.020 -7.682  1.00 81.40  ? 361  HIS B CE1 1 
ATOM   7139 N  NE2 . HIS B 2 361 ? 22.192  -22.965 -6.471  1.00 80.45  ? 361  HIS B NE2 1 
ATOM   7140 N  N   . THR B 2 362 ? 23.325  -19.717 -3.408  1.00 67.15  ? 362  THR B N   1 
ATOM   7141 C  CA  . THR B 2 362 ? 22.425  -18.894 -2.608  1.00 59.76  ? 362  THR B CA  1 
ATOM   7142 C  C   . THR B 2 362 ? 22.599  -19.107 -1.110  1.00 50.14  ? 362  THR B C   1 
ATOM   7143 O  O   . THR B 2 362 ? 21.795  -18.619 -0.303  1.00 37.65  ? 362  THR B O   1 
ATOM   7144 C  CB  . THR B 2 362 ? 20.941  -19.159 -2.987  1.00 64.08  ? 362  THR B CB  1 
ATOM   7145 O  OG1 . THR B 2 362 ? 20.664  -20.563 -2.883  1.00 66.76  ? 362  THR B OG1 1 
ATOM   7146 C  CG2 . THR B 2 362 ? 20.652  -18.684 -4.413  1.00 58.73  ? 362  THR B CG2 1 
ATOM   7147 N  N   . ASN B 2 363 ? 23.657  -19.818 -0.736  1.00 46.12  ? 363  ASN B N   1 
ATOM   7148 C  CA  . ASN B 2 363 ? 23.889  -20.106 0.667   1.00 39.82  ? 363  ASN B CA  1 
ATOM   7149 C  C   . ASN B 2 363 ? 25.232  -19.600 1.168   1.00 28.89  ? 363  ASN B C   1 
ATOM   7150 O  O   . ASN B 2 363 ? 26.292  -20.040 0.725   1.00 7.29   ? 363  ASN B O   1 
ATOM   7151 C  CB  . ASN B 2 363 ? 23.743  -21.614 0.934   1.00 39.82  ? 363  ASN B CB  1 
ATOM   7152 C  CG  . ASN B 2 363 ? 23.513  -21.932 2.413   1.00 41.50  ? 363  ASN B CG  1 
ATOM   7153 O  OD1 . ASN B 2 363 ? 24.124  -21.325 3.308   1.00 23.01  ? 363  ASN B OD1 1 
ATOM   7154 N  ND2 . ASN B 2 363 ? 22.632  -22.890 2.674   1.00 43.70  ? 363  ASN B ND2 1 
ATOM   7155 N  N   . ASP B 2 364 ? 25.172  -18.667 2.107   1.00 34.92  ? 364  ASP B N   1 
ATOM   7156 C  CA  . ASP B 2 364 ? 26.381  -18.115 2.692   1.00 42.60  ? 364  ASP B CA  1 
ATOM   7157 C  C   . ASP B 2 364 ? 27.025  -19.131 3.637   1.00 36.34  ? 364  ASP B C   1 
ATOM   7158 O  O   . ASP B 2 364 ? 28.196  -19.485 3.460   1.00 36.57  ? 364  ASP B O   1 
ATOM   7159 C  CB  . ASP B 2 364 ? 26.063  -16.828 3.472   1.00 60.58  ? 364  ASP B CB  1 
ATOM   7160 C  CG  . ASP B 2 364 ? 26.455  -15.551 2.723   1.00 56.38  ? 364  ASP B CG  1 
ATOM   7161 O  OD1 . ASP B 2 364 ? 27.165  -15.632 1.693   1.00 59.41  ? 364  ASP B OD1 1 
ATOM   7162 O  OD2 . ASP B 2 364 ? 26.060  -14.456 3.194   1.00 39.60  ? 364  ASP B OD2 1 
ATOM   7163 N  N   . VAL B 2 365 ? 26.246  -19.633 4.601   1.00 22.79  ? 365  VAL B N   1 
ATOM   7164 C  CA  . VAL B 2 365 ? 26.772  -20.580 5.592   1.00 26.69  ? 365  VAL B CA  1 
ATOM   7165 C  C   . VAL B 2 365 ? 27.531  -21.741 4.939   1.00 27.67  ? 365  VAL B C   1 
ATOM   7166 O  O   . VAL B 2 365 ? 28.641  -22.076 5.352   1.00 23.89  ? 365  VAL B O   1 
ATOM   7167 C  CB  . VAL B 2 365 ? 25.662  -21.146 6.570   1.00 18.25  ? 365  VAL B CB  1 
ATOM   7168 C  CG1 . VAL B 2 365 ? 26.296  -22.030 7.632   1.00 2.35   ? 365  VAL B CG1 1 
ATOM   7169 C  CG2 . VAL B 2 365 ? 24.902  -20.025 7.256   1.00 8.06   ? 365  VAL B CG2 1 
ATOM   7170 N  N   . LYS B 2 366 ? 26.948  -22.309 3.889   1.00 28.37  ? 366  LYS B N   1 
ATOM   7171 C  CA  . LYS B 2 366 ? 27.554  -23.422 3.174   1.00 25.79  ? 366  LYS B CA  1 
ATOM   7172 C  C   . LYS B 2 366 ? 28.977  -23.014 2.742   1.00 23.69  ? 366  LYS B C   1 
ATOM   7173 O  O   . LYS B 2 366 ? 29.971  -23.577 3.238   1.00 5.10   ? 366  LYS B O   1 
ATOM   7174 C  CB  . LYS B 2 366 ? 26.678  -23.780 1.960   1.00 32.90  ? 366  LYS B CB  1 
ATOM   7175 C  CG  . LYS B 2 366 ? 26.724  -25.240 1.514   1.00 34.27  ? 366  LYS B CG  1 
ATOM   7176 C  CD  . LYS B 2 366 ? 25.793  -25.478 0.328   1.00 38.15  ? 366  LYS B CD  1 
ATOM   7177 C  CE  . LYS B 2 366 ? 25.996  -26.857 -0.300  1.00 48.20  ? 366  LYS B CE  1 
ATOM   7178 N  NZ  . LYS B 2 366 ? 25.635  -26.887 -1.760  1.00 53.31  ? 366  LYS B NZ  1 
ATOM   7179 N  N   . GLN B 2 367 ? 29.072  -21.984 1.894   1.00 27.11  ? 367  GLN B N   1 
ATOM   7180 C  CA  . GLN B 2 367 ? 30.372  -21.496 1.399   1.00 29.60  ? 367  GLN B CA  1 
ATOM   7181 C  C   . GLN B 2 367 ? 31.367  -21.309 2.554   1.00 20.61  ? 367  GLN B C   1 
ATOM   7182 O  O   . GLN B 2 367 ? 32.531  -21.698 2.462   1.00 2.00   ? 367  GLN B O   1 
ATOM   7183 C  CB  . GLN B 2 367 ? 30.195  -20.174 0.649   1.00 23.98  ? 367  GLN B CB  1 
ATOM   7184 C  CG  . GLN B 2 367 ? 29.201  -20.254 -0.492  1.00 47.49  ? 367  GLN B CG  1 
ATOM   7185 C  CD  . GLN B 2 367 ? 28.928  -18.903 -1.143  1.00 57.46  ? 367  GLN B CD  1 
ATOM   7186 O  OE1 . GLN B 2 367 ? 29.826  -18.069 -1.271  1.00 65.87  ? 367  GLN B OE1 1 
ATOM   7187 N  NE2 . GLN B 2 367 ? 27.688  -18.689 -1.569  1.00 55.31  ? 367  GLN B NE2 1 
ATOM   7188 N  N   . LEU B 2 368 ? 30.865  -20.769 3.659   1.00 25.29  ? 368  LEU B N   1 
ATOM   7189 C  CA  . LEU B 2 368 ? 31.662  -20.535 4.847   1.00 22.62  ? 368  LEU B CA  1 
ATOM   7190 C  C   . LEU B 2 368 ? 32.173  -21.864 5.404   1.00 18.63  ? 368  LEU B C   1 
ATOM   7191 O  O   . LEU B 2 368 ? 33.373  -22.104 5.417   1.00 13.82  ? 368  LEU B O   1 
ATOM   7192 C  CB  . LEU B 2 368 ? 30.816  -19.826 5.901   1.00 32.03  ? 368  LEU B CB  1 
ATOM   7193 C  CG  . LEU B 2 368 ? 31.483  -18.766 6.774   1.00 38.16  ? 368  LEU B CG  1 
ATOM   7194 C  CD1 . LEU B 2 368 ? 30.773  -18.720 8.109   1.00 45.21  ? 368  LEU B CD1 1 
ATOM   7195 C  CD2 . LEU B 2 368 ? 32.946  -19.075 6.988   1.00 40.92  ? 368  LEU B CD2 1 
ATOM   7196 N  N   . THR B 2 369 ? 31.264  -22.726 5.855   1.00 20.51  ? 369  THR B N   1 
ATOM   7197 C  CA  . THR B 2 369 ? 31.644  -24.024 6.409   1.00 19.93  ? 369  THR B CA  1 
ATOM   7198 C  C   . THR B 2 369 ? 32.616  -24.717 5.461   1.00 14.16  ? 369  THR B C   1 
ATOM   7199 O  O   . THR B 2 369 ? 33.653  -25.220 5.890   1.00 20.09  ? 369  THR B O   1 
ATOM   7200 C  CB  . THR B 2 369 ? 30.421  -24.961 6.635   1.00 24.79  ? 369  THR B CB  1 
ATOM   7201 O  OG1 . THR B 2 369 ? 29.765  -25.215 5.386   1.00 33.71  ? 369  THR B OG1 1 
ATOM   7202 C  CG2 . THR B 2 369 ? 29.428  -24.352 7.616   1.00 10.85  ? 369  THR B CG2 1 
ATOM   7203 N  N   . GLU B 2 370 ? 32.316  -24.671 4.168   1.00 6.74   ? 370  GLU B N   1 
ATOM   7204 C  CA  . GLU B 2 370 ? 33.164  -25.300 3.166   1.00 13.00  ? 370  GLU B CA  1 
ATOM   7205 C  C   . GLU B 2 370 ? 34.593  -24.750 3.231   1.00 12.86  ? 370  GLU B C   1 
ATOM   7206 O  O   . GLU B 2 370 ? 35.590  -25.491 3.203   1.00 8.15   ? 370  GLU B O   1 
ATOM   7207 C  CB  . GLU B 2 370 ? 32.557  -25.095 1.785   1.00 14.58  ? 370  GLU B CB  1 
ATOM   7208 C  CG  . GLU B 2 370 ? 31.247  -25.857 1.581   1.00 44.04  ? 370  GLU B CG  1 
ATOM   7209 C  CD  . GLU B 2 370 ? 30.767  -25.892 0.122   1.00 62.78  ? 370  GLU B CD  1 
ATOM   7210 O  OE1 . GLU B 2 370 ? 31.206  -25.042 -0.693  1.00 71.66  ? 370  GLU B OE1 1 
ATOM   7211 O  OE2 . GLU B 2 370 ? 29.942  -26.780 -0.206  1.00 54.07  ? 370  GLU B OE2 1 
ATOM   7212 N  N   . ALA B 2 371 ? 34.676  -23.443 3.388   1.00 12.18  ? 371  ALA B N   1 
ATOM   7213 C  CA  . ALA B 2 371 ? 35.951  -22.782 3.479   1.00 13.02  ? 371  ALA B CA  1 
ATOM   7214 C  C   . ALA B 2 371 ? 36.661  -23.178 4.771   1.00 9.58   ? 371  ALA B C   1 
ATOM   7215 O  O   . ALA B 2 371 ? 37.806  -23.609 4.732   1.00 9.92   ? 371  ALA B O   1 
ATOM   7216 C  CB  . ALA B 2 371 ? 35.756  -21.271 3.414   1.00 18.02  ? 371  ALA B CB  1 
ATOM   7217 N  N   . VAL B 2 372 ? 35.980  -23.041 5.905   1.00 2.00   ? 372  VAL B N   1 
ATOM   7218 C  CA  . VAL B 2 372 ? 36.573  -23.361 7.196   1.00 7.24   ? 372  VAL B CA  1 
ATOM   7219 C  C   . VAL B 2 372 ? 37.203  -24.712 7.143   1.00 17.76  ? 372  VAL B C   1 
ATOM   7220 O  O   . VAL B 2 372 ? 38.296  -24.910 7.672   1.00 25.77  ? 372  VAL B O   1 
ATOM   7221 C  CB  . VAL B 2 372 ? 35.545  -23.404 8.328   1.00 5.84   ? 372  VAL B CB  1 
ATOM   7222 C  CG1 . VAL B 2 372 ? 36.200  -23.947 9.618   1.00 2.00   ? 372  VAL B CG1 1 
ATOM   7223 C  CG2 . VAL B 2 372 ? 34.982  -22.027 8.558   1.00 11.30  ? 372  VAL B CG2 1 
ATOM   7224 N  N   . GLN B 2 373 ? 36.493  -25.642 6.513   1.00 15.81  ? 373  GLN B N   1 
ATOM   7225 C  CA  . GLN B 2 373 ? 36.986  -26.999 6.370   1.00 19.04  ? 373  GLN B CA  1 
ATOM   7226 C  C   . GLN B 2 373 ? 38.264  -26.982 5.516   1.00 10.87  ? 373  GLN B C   1 
ATOM   7227 O  O   . GLN B 2 373 ? 39.339  -27.389 6.000   1.00 2.00   ? 373  GLN B O   1 
ATOM   7228 C  CB  . GLN B 2 373 ? 35.903  -27.910 5.754   1.00 34.10  ? 373  GLN B CB  1 
ATOM   7229 C  CG  . GLN B 2 373 ? 34.606  -28.028 6.588   1.00 20.35  ? 373  GLN B CG  1 
ATOM   7230 C  CD  . GLN B 2 373 ? 33.677  -29.157 6.133   1.00 20.57  ? 373  GLN B CD  1 
ATOM   7231 O  OE1 . GLN B 2 373 ? 33.660  -30.231 6.730   1.00 20.35  ? 373  GLN B OE1 1 
ATOM   7232 N  NE2 . GLN B 2 373 ? 32.867  -28.898 5.113   1.00 32.84  ? 373  GLN B NE2 1 
ATOM   7233 N  N   . LYS B 2 374 ? 38.159  -26.422 4.301   1.00 5.98   ? 374  LYS B N   1 
ATOM   7234 C  CA  . LYS B 2 374 ? 39.291  -26.337 3.365   1.00 11.79  ? 374  LYS B CA  1 
ATOM   7235 C  C   . LYS B 2 374 ? 40.537  -25.732 3.995   1.00 18.37  ? 374  LYS B C   1 
ATOM   7236 O  O   . LYS B 2 374 ? 41.654  -26.210 3.786   1.00 29.78  ? 374  LYS B O   1 
ATOM   7237 C  CB  . LYS B 2 374 ? 38.921  -25.529 2.137   1.00 8.14   ? 374  LYS B CB  1 
ATOM   7238 C  CG  . LYS B 2 374 ? 40.119  -25.229 1.247   1.00 25.58  ? 374  LYS B CG  1 
ATOM   7239 C  CD  . LYS B 2 374 ? 40.108  -26.072 -0.022  1.00 33.01  ? 374  LYS B CD  1 
ATOM   7240 C  CE  . LYS B 2 374 ? 41.261  -25.705 -0.964  1.00 30.88  ? 374  LYS B CE  1 
ATOM   7241 N  NZ  . LYS B 2 374 ? 41.406  -24.222 -1.201  1.00 24.17  ? 374  LYS B NZ  1 
ATOM   7242 N  N   . ILE B 2 375 ? 40.347  -24.632 4.705   1.00 17.20  ? 375  ILE B N   1 
ATOM   7243 C  CA  . ILE B 2 375 ? 41.442  -23.987 5.400   1.00 18.43  ? 375  ILE B CA  1 
ATOM   7244 C  C   . ILE B 2 375 ? 41.977  -24.980 6.407   1.00 6.18   ? 375  ILE B C   1 
ATOM   7245 O  O   . ILE B 2 375 ? 43.138  -25.368 6.335   1.00 5.45   ? 375  ILE B O   1 
ATOM   7246 C  CB  . ILE B 2 375 ? 40.964  -22.729 6.183   1.00 28.75  ? 375  ILE B CB  1 
ATOM   7247 C  CG1 . ILE B 2 375 ? 40.691  -21.583 5.211   1.00 33.60  ? 375  ILE B CG1 1 
ATOM   7248 C  CG2 . ILE B 2 375 ? 41.995  -22.313 7.250   1.00 4.49   ? 375  ILE B CG2 1 
ATOM   7249 C  CD1 . ILE B 2 375 ? 39.828  -20.507 5.804   1.00 54.55  ? 375  ILE B CD1 1 
ATOM   7250 N  N   . THR B 2 376 ? 41.097  -25.458 7.279   1.00 3.75   ? 376  THR B N   1 
ATOM   7251 C  CA  . THR B 2 376 ? 41.501  -26.370 8.331   1.00 15.36  ? 376  THR B CA  1 
ATOM   7252 C  C   . THR B 2 376 ? 42.322  -27.521 7.794   1.00 18.04  ? 376  THR B C   1 
ATOM   7253 O  O   . THR B 2 376 ? 43.402  -27.806 8.326   1.00 18.68  ? 376  THR B O   1 
ATOM   7254 C  CB  . THR B 2 376 ? 40.298  -26.883 9.146   1.00 14.42  ? 376  THR B CB  1 
ATOM   7255 O  OG1 . THR B 2 376 ? 39.541  -25.770 9.633   1.00 28.53  ? 376  THR B OG1 1 
ATOM   7256 C  CG2 . THR B 2 376 ? 40.779  -27.650 10.352  1.00 4.76   ? 376  THR B CG2 1 
ATOM   7257 N  N   . THR B 2 377 ? 41.867  -28.121 6.697   1.00 20.21  ? 377  THR B N   1 
ATOM   7258 C  CA  . THR B 2 377 ? 42.603  -29.234 6.113   1.00 24.65  ? 377  THR B CA  1 
ATOM   7259 C  C   . THR B 2 377 ? 44.022  -28.791 5.826   1.00 22.60  ? 377  THR B C   1 
ATOM   7260 O  O   . THR B 2 377 ? 44.962  -29.423 6.300   1.00 27.58  ? 377  THR B O   1 
ATOM   7261 C  CB  . THR B 2 377 ? 41.937  -29.841 4.807   1.00 31.63  ? 377  THR B CB  1 
ATOM   7262 O  OG1 . THR B 2 377 ? 41.789  -28.848 3.773   1.00 3.34   ? 377  THR B OG1 1 
ATOM   7263 C  CG2 . THR B 2 377 ? 40.579  -30.460 5.138   1.00 33.65  ? 377  THR B CG2 1 
ATOM   7264 N  N   . GLU B 2 378 ? 44.177  -27.651 5.150   1.00 16.68  ? 378  GLU B N   1 
ATOM   7265 C  CA  . GLU B 2 378 ? 45.510  -27.146 4.815   1.00 13.22  ? 378  GLU B CA  1 
ATOM   7266 C  C   . GLU B 2 378 ? 46.362  -26.932 6.052   1.00 5.92   ? 378  GLU B C   1 
ATOM   7267 O  O   . GLU B 2 378 ? 47.523  -27.332 6.077   1.00 2.00   ? 378  GLU B O   1 
ATOM   7268 C  CB  . GLU B 2 378 ? 45.421  -25.849 4.035   1.00 16.62  ? 378  GLU B CB  1 
ATOM   7269 C  CG  . GLU B 2 378 ? 44.671  -25.977 2.739   1.00 26.33  ? 378  GLU B CG  1 
ATOM   7270 C  CD  . GLU B 2 378 ? 44.783  -24.727 1.893   1.00 39.39  ? 378  GLU B CD  1 
ATOM   7271 O  OE1 . GLU B 2 378 ? 45.087  -23.654 2.462   1.00 48.08  ? 378  GLU B OE1 1 
ATOM   7272 O  OE2 . GLU B 2 378 ? 44.581  -24.820 0.660   1.00 29.56  ? 378  GLU B OE2 1 
ATOM   7273 N  N   . SER B 2 379 ? 45.767  -26.311 7.069   1.00 3.13   ? 379  SER B N   1 
ATOM   7274 C  CA  . SER B 2 379 ? 46.419  -26.038 8.346   1.00 13.61  ? 379  SER B CA  1 
ATOM   7275 C  C   . SER B 2 379 ? 47.032  -27.319 8.916   1.00 10.54  ? 379  SER B C   1 
ATOM   7276 O  O   . SER B 2 379 ? 48.153  -27.323 9.437   1.00 2.00   ? 379  SER B O   1 
ATOM   7277 C  CB  . SER B 2 379 ? 45.384  -25.484 9.324   1.00 29.44  ? 379  SER B CB  1 
ATOM   7278 O  OG  . SER B 2 379 ? 45.961  -25.190 10.586  1.00 47.11  ? 379  SER B OG  1 
ATOM   7279 N  N   . ILE B 2 380 ? 46.250  -28.389 8.853   1.00 16.56  ? 380  ILE B N   1 
ATOM   7280 C  CA  . ILE B 2 380 ? 46.666  -29.710 9.302   1.00 21.21  ? 380  ILE B CA  1 
ATOM   7281 C  C   . ILE B 2 380 ? 47.827  -30.138 8.397   1.00 19.00  ? 380  ILE B C   1 
ATOM   7282 O  O   . ILE B 2 380 ? 48.952  -30.350 8.861   1.00 15.15  ? 380  ILE B O   1 
ATOM   7283 C  CB  . ILE B 2 380 ? 45.489  -30.701 9.155   1.00 23.81  ? 380  ILE B CB  1 
ATOM   7284 C  CG1 . ILE B 2 380 ? 44.425  -30.404 10.211  1.00 27.03  ? 380  ILE B CG1 1 
ATOM   7285 C  CG2 . ILE B 2 380 ? 45.967  -32.134 9.230   1.00 17.19  ? 380  ILE B CG2 1 
ATOM   7286 C  CD1 . ILE B 2 380 ? 43.110  -31.054 9.914   1.00 28.31  ? 380  ILE B CD1 1 
ATOM   7287 N  N   . VAL B 2 381 ? 47.561  -30.167 7.096   1.00 18.90  ? 381  VAL B N   1 
ATOM   7288 C  CA  . VAL B 2 381 ? 48.556  -30.538 6.091   1.00 28.55  ? 381  VAL B CA  1 
ATOM   7289 C  C   . VAL B 2 381 ? 49.893  -29.810 6.260   1.00 28.44  ? 381  VAL B C   1 
ATOM   7290 O  O   . VAL B 2 381 ? 50.953  -30.413 6.099   1.00 34.46  ? 381  VAL B O   1 
ATOM   7291 C  CB  . VAL B 2 381 ? 48.038  -30.259 4.635   1.00 32.58  ? 381  VAL B CB  1 
ATOM   7292 C  CG1 . VAL B 2 381 ? 49.156  -30.477 3.607   1.00 35.09  ? 381  VAL B CG1 1 
ATOM   7293 C  CG2 . VAL B 2 381 ? 46.858  -31.145 4.302   1.00 5.86   ? 381  VAL B CG2 1 
ATOM   7294 N  N   . ILE B 2 382 ? 49.849  -28.532 6.615   1.00 27.41  ? 382  ILE B N   1 
ATOM   7295 C  CA  . ILE B 2 382 ? 51.075  -27.770 6.757   1.00 25.86  ? 382  ILE B CA  1 
ATOM   7296 C  C   . ILE B 2 382 ? 51.756  -27.798 8.127   1.00 22.03  ? 382  ILE B C   1 
ATOM   7297 O  O   . ILE B 2 382 ? 52.940  -28.110 8.216   1.00 6.89   ? 382  ILE B O   1 
ATOM   7298 C  CB  . ILE B 2 382 ? 50.881  -26.327 6.277   1.00 26.30  ? 382  ILE B CB  1 
ATOM   7299 C  CG1 . ILE B 2 382 ? 50.372  -26.334 4.822   1.00 15.94  ? 382  ILE B CG1 1 
ATOM   7300 C  CG2 . ILE B 2 382 ? 52.199  -25.545 6.420   1.00 20.07  ? 382  ILE B CG2 1 
ATOM   7301 C  CD1 . ILE B 2 382 ? 50.056  -24.951 4.259   1.00 2.00   ? 382  ILE B CD1 1 
ATOM   7302 N  N   . TRP B 2 383 ? 51.022  -27.502 9.193   1.00 33.38  ? 383  TRP B N   1 
ATOM   7303 C  CA  . TRP B 2 383 ? 51.630  -27.492 10.524  1.00 39.56  ? 383  TRP B CA  1 
ATOM   7304 C  C   . TRP B 2 383 ? 51.146  -28.629 11.386  1.00 45.01  ? 383  TRP B C   1 
ATOM   7305 O  O   . TRP B 2 383 ? 51.678  -28.837 12.474  1.00 57.00  ? 383  TRP B O   1 
ATOM   7306 C  CB  . TRP B 2 383 ? 51.400  -26.154 11.241  1.00 45.96  ? 383  TRP B CB  1 
ATOM   7307 C  CG  . TRP B 2 383 ? 51.925  -24.977 10.459  1.00 51.66  ? 383  TRP B CG  1 
ATOM   7308 C  CD1 . TRP B 2 383 ? 53.204  -24.515 10.440  1.00 56.66  ? 383  TRP B CD1 1 
ATOM   7309 C  CD2 . TRP B 2 383 ? 51.202  -24.193 9.503   1.00 49.80  ? 383  TRP B CD2 1 
ATOM   7310 N  NE1 . TRP B 2 383 ? 53.333  -23.504 9.520   1.00 49.30  ? 383  TRP B NE1 1 
ATOM   7311 C  CE2 . TRP B 2 383 ? 52.120  -23.288 8.929   1.00 50.41  ? 383  TRP B CE2 1 
ATOM   7312 C  CE3 . TRP B 2 383 ? 49.873  -24.176 9.066   1.00 49.26  ? 383  TRP B CE3 1 
ATOM   7313 C  CZ2 . TRP B 2 383 ? 51.750  -22.378 7.936   1.00 54.43  ? 383  TRP B CZ2 1 
ATOM   7314 C  CZ3 . TRP B 2 383 ? 49.506  -23.274 8.080   1.00 47.68  ? 383  TRP B CZ3 1 
ATOM   7315 C  CH2 . TRP B 2 383 ? 50.443  -22.386 7.524   1.00 49.83  ? 383  TRP B CH2 1 
ATOM   7316 N  N   . GLY B 2 384 ? 50.145  -29.360 10.903  1.00 40.44  ? 384  GLY B N   1 
ATOM   7317 C  CA  . GLY B 2 384 ? 49.625  -30.493 11.650  1.00 45.98  ? 384  GLY B CA  1 
ATOM   7318 C  C   . GLY B 2 384 ? 48.799  -30.138 12.863  1.00 50.93  ? 384  GLY B C   1 
ATOM   7319 O  O   . GLY B 2 384 ? 49.018  -30.664 13.956  1.00 53.48  ? 384  GLY B O   1 
ATOM   7320 N  N   . LYS B 2 385 ? 47.865  -29.215 12.675  1.00 53.98  ? 385  LYS B N   1 
ATOM   7321 C  CA  . LYS B 2 385 ? 46.968  -28.783 13.739  1.00 49.88  ? 385  LYS B CA  1 
ATOM   7322 C  C   . LYS B 2 385 ? 45.912  -27.925 13.086  1.00 42.56  ? 385  LYS B C   1 
ATOM   7323 O  O   . LYS B 2 385 ? 45.983  -27.639 11.881  1.00 26.19  ? 385  LYS B O   1 
ATOM   7324 C  CB  . LYS B 2 385 ? 47.709  -28.005 14.845  1.00 48.58  ? 385  LYS B CB  1 
ATOM   7325 C  CG  . LYS B 2 385 ? 48.531  -26.824 14.359  1.00 54.75  ? 385  LYS B CG  1 
ATOM   7326 C  CD  . LYS B 2 385 ? 49.465  -26.290 15.448  1.00 68.27  ? 385  LYS B CD  1 
ATOM   7327 C  CE  . LYS B 2 385 ? 48.741  -25.504 16.553  1.00 69.43  ? 385  LYS B CE  1 
ATOM   7328 N  NZ  . LYS B 2 385 ? 49.710  -24.749 17.426  1.00 59.99  ? 385  LYS B NZ  1 
ATOM   7329 N  N   . THR B 2 386 ? 44.889  -27.597 13.863  1.00 43.27  ? 386  THR B N   1 
ATOM   7330 C  CA  . THR B 2 386 ? 43.808  -26.771 13.371  1.00 33.17  ? 386  THR B CA  1 
ATOM   7331 C  C   . THR B 2 386 ? 43.951  -25.357 13.879  1.00 26.14  ? 386  THR B C   1 
ATOM   7332 O  O   . THR B 2 386 ? 44.424  -25.118 15.002  1.00 27.63  ? 386  THR B O   1 
ATOM   7333 C  CB  . THR B 2 386 ? 42.439  -27.283 13.845  1.00 31.40  ? 386  THR B CB  1 
ATOM   7334 O  OG1 . THR B 2 386 ? 42.461  -27.469 15.270  1.00 31.70  ? 386  THR B OG1 1 
ATOM   7335 C  CG2 . THR B 2 386 ? 42.092  -28.582 13.156  1.00 38.22  ? 386  THR B CG2 1 
ATOM   7336 N  N   . PRO B 2 387 ? 43.616  -24.390 13.023  1.00 18.60  ? 387  PRO B N   1 
ATOM   7337 C  CA  . PRO B 2 387 ? 43.719  -23.007 13.479  1.00 10.42  ? 387  PRO B CA  1 
ATOM   7338 C  C   . PRO B 2 387 ? 42.478  -22.690 14.332  1.00 11.85  ? 387  PRO B C   1 
ATOM   7339 O  O   . PRO B 2 387 ? 41.596  -23.554 14.550  1.00 2.00   ? 387  PRO B O   1 
ATOM   7340 C  CB  . PRO B 2 387 ? 43.713  -22.228 12.170  1.00 3.83   ? 387  PRO B CB  1 
ATOM   7341 C  CG  . PRO B 2 387 ? 42.834  -23.093 11.262  1.00 5.07   ? 387  PRO B CG  1 
ATOM   7342 C  CD  . PRO B 2 387 ? 43.233  -24.486 11.596  1.00 9.35   ? 387  PRO B CD  1 
ATOM   7343 N  N   . LYS B 2 388 ? 42.448  -21.481 14.878  1.00 15.84  ? 388  LYS B N   1 
ATOM   7344 C  CA  . LYS B 2 388 ? 41.302  -21.031 15.664  1.00 18.78  ? 388  LYS B CA  1 
ATOM   7345 C  C   . LYS B 2 388 ? 40.672  -19.973 14.763  1.00 15.97  ? 388  LYS B C   1 
ATOM   7346 O  O   . LYS B 2 388 ? 41.341  -19.023 14.353  1.00 23.77  ? 388  LYS B O   1 
ATOM   7347 C  CB  . LYS B 2 388 ? 41.750  -20.450 17.017  1.00 2.00   ? 388  LYS B CB  1 
ATOM   7348 C  CG  . LYS B 2 388 ? 40.626  -20.240 18.036  1.00 19.38  ? 388  LYS B CG  1 
ATOM   7349 C  CD  . LYS B 2 388 ? 39.689  -19.057 17.713  1.00 39.61  ? 388  LYS B CD  1 
ATOM   7350 C  CE  . LYS B 2 388 ? 38.583  -18.880 18.774  1.00 51.57  ? 388  LYS B CE  1 
ATOM   7351 N  NZ  . LYS B 2 388 ? 39.091  -18.545 20.148  1.00 66.18  ? 388  LYS B NZ  1 
ATOM   7352 N  N   . PHE B 2 389 ? 39.411  -20.154 14.407  1.00 13.15  ? 389  PHE B N   1 
ATOM   7353 C  CA  . PHE B 2 389 ? 38.761  -19.202 13.512  1.00 20.39  ? 389  PHE B CA  1 
ATOM   7354 C  C   . PHE B 2 389 ? 38.057  -17.963 14.057  1.00 17.15  ? 389  PHE B C   1 
ATOM   7355 O  O   . PHE B 2 389 ? 37.383  -17.992 15.078  1.00 24.82  ? 389  PHE B O   1 
ATOM   7356 C  CB  . PHE B 2 389 ? 37.793  -19.929 12.582  1.00 15.06  ? 389  PHE B CB  1 
ATOM   7357 C  CG  . PHE B 2 389 ? 38.463  -20.805 11.582  1.00 19.61  ? 389  PHE B CG  1 
ATOM   7358 C  CD1 . PHE B 2 389 ? 39.114  -21.973 11.984  1.00 15.64  ? 389  PHE B CD1 1 
ATOM   7359 C  CD2 . PHE B 2 389 ? 38.403  -20.491 10.224  1.00 20.20  ? 389  PHE B CD2 1 
ATOM   7360 C  CE1 . PHE B 2 389 ? 39.692  -22.823 11.040  1.00 27.11  ? 389  PHE B CE1 1 
ATOM   7361 C  CE2 . PHE B 2 389 ? 38.979  -21.336 9.262   1.00 25.67  ? 389  PHE B CE2 1 
ATOM   7362 C  CZ  . PHE B 2 389 ? 39.623  -22.505 9.671   1.00 33.44  ? 389  PHE B CZ  1 
ATOM   7363 N  N   . LYS B 2 390 ? 38.215  -16.876 13.319  1.00 21.47  ? 390  LYS B N   1 
ATOM   7364 C  CA  . LYS B 2 390 ? 37.558  -15.608 13.598  1.00 21.49  ? 390  LYS B CA  1 
ATOM   7365 C  C   . LYS B 2 390 ? 36.620  -15.549 12.385  1.00 20.98  ? 390  LYS B C   1 
ATOM   7366 O  O   . LYS B 2 390 ? 37.056  -15.432 11.213  1.00 2.00   ? 390  LYS B O   1 
ATOM   7367 C  CB  . LYS B 2 390 ? 38.554  -14.457 13.582  1.00 23.68  ? 390  LYS B CB  1 
ATOM   7368 C  CG  . LYS B 2 390 ? 39.312  -14.303 14.876  1.00 28.03  ? 390  LYS B CG  1 
ATOM   7369 C  CD  . LYS B 2 390 ? 40.675  -13.661 14.649  1.00 26.68  ? 390  LYS B CD  1 
ATOM   7370 C  CE  . LYS B 2 390 ? 41.096  -12.780 15.826  1.00 29.79  ? 390  LYS B CE  1 
ATOM   7371 N  NZ  . LYS B 2 390 ? 40.431  -11.438 15.760  1.00 32.83  ? 390  LYS B NZ  1 
ATOM   7372 N  N   . LEU B 2 391 ? 35.344  -15.770 12.672  1.00 15.36  ? 391  LEU B N   1 
ATOM   7373 C  CA  . LEU B 2 391 ? 34.331  -15.813 11.647  1.00 20.68  ? 391  LEU B CA  1 
ATOM   7374 C  C   . LEU B 2 391 ? 33.494  -14.549 11.484  1.00 15.42  ? 391  LEU B C   1 
ATOM   7375 O  O   . LEU B 2 391 ? 32.913  -14.050 12.439  1.00 9.91   ? 391  LEU B O   1 
ATOM   7376 C  CB  . LEU B 2 391 ? 33.420  -17.010 11.918  1.00 35.42  ? 391  LEU B CB  1 
ATOM   7377 C  CG  . LEU B 2 391 ? 34.083  -18.382 12.089  1.00 38.56  ? 391  LEU B CG  1 
ATOM   7378 C  CD1 . LEU B 2 391 ? 33.045  -19.416 12.540  1.00 43.80  ? 391  LEU B CD1 1 
ATOM   7379 C  CD2 . LEU B 2 391 ? 34.741  -18.805 10.783  1.00 35.15  ? 391  LEU B CD2 1 
ATOM   7380 N  N   . PRO B 2 392 ? 33.408  -14.034 10.249  1.00 15.20  ? 392  PRO B N   1 
ATOM   7381 C  CA  . PRO B 2 392 ? 32.640  -12.834 9.911   1.00 19.34  ? 392  PRO B CA  1 
ATOM   7382 C  C   . PRO B 2 392 ? 31.156  -13.207 9.833   1.00 22.12  ? 392  PRO B C   1 
ATOM   7383 O  O   . PRO B 2 392 ? 30.502  -12.964 8.817   1.00 18.11  ? 392  PRO B O   1 
ATOM   7384 C  CB  . PRO B 2 392 ? 33.157  -12.501 8.518   1.00 26.19  ? 392  PRO B CB  1 
ATOM   7385 C  CG  . PRO B 2 392 ? 33.346  -13.882 7.913   1.00 12.13  ? 392  PRO B CG  1 
ATOM   7386 C  CD  . PRO B 2 392 ? 34.071  -14.590 9.052   1.00 9.59   ? 392  PRO B CD  1 
ATOM   7387 N  N   . ILE B 2 393 ? 30.631  -13.828 10.883  1.00 22.87  ? 393  ILE B N   1 
ATOM   7388 C  CA  . ILE B 2 393 ? 29.235  -14.242 10.886  1.00 27.94  ? 393  ILE B CA  1 
ATOM   7389 C  C   . ILE B 2 393 ? 28.703  -14.231 12.317  1.00 26.96  ? 393  ILE B C   1 
ATOM   7390 O  O   . ILE B 2 393 ? 29.477  -14.338 13.282  1.00 3.14   ? 393  ILE B O   1 
ATOM   7391 C  CB  . ILE B 2 393 ? 29.073  -15.691 10.319  1.00 33.60  ? 393  ILE B CB  1 
ATOM   7392 C  CG1 . ILE B 2 393 ? 27.597  -15.990 10.030  1.00 28.55  ? 393  ILE B CG1 1 
ATOM   7393 C  CG2 . ILE B 2 393 ? 29.619  -16.733 11.327  1.00 34.33  ? 393  ILE B CG2 1 
ATOM   7394 C  CD1 . ILE B 2 393 ? 27.314  -17.453 9.762   1.00 21.41  ? 393  ILE B CD1 1 
ATOM   7395 N  N   . GLN B 2 394 ? 27.380  -14.119 12.443  1.00 28.63  ? 394  GLN B N   1 
ATOM   7396 C  CA  . GLN B 2 394 ? 26.749  -14.121 13.747  1.00 24.33  ? 394  GLN B CA  1 
ATOM   7397 C  C   . GLN B 2 394 ? 26.682  -15.544 14.296  1.00 23.47  ? 394  GLN B C   1 
ATOM   7398 O  O   . GLN B 2 394 ? 26.461  -16.506 13.536  1.00 19.31  ? 394  GLN B O   1 
ATOM   7399 C  CB  . GLN B 2 394 ? 25.346  -13.515 13.685  1.00 26.09  ? 394  GLN B CB  1 
ATOM   7400 C  CG  . GLN B 2 394 ? 24.699  -13.413 15.073  1.00 41.93  ? 394  GLN B CG  1 
ATOM   7401 C  CD  . GLN B 2 394 ? 23.320  -12.772 15.088  1.00 46.61  ? 394  GLN B CD  1 
ATOM   7402 O  OE1 . GLN B 2 394 ? 22.701  -12.666 16.147  1.00 36.58  ? 394  GLN B OE1 1 
ATOM   7403 N  NE2 . GLN B 2 394 ? 22.837  -12.333 13.927  1.00 53.83  ? 394  GLN B NE2 1 
ATOM   7404 N  N   . LYS B 2 395 ? 26.832  -15.647 15.620  1.00 18.48  ? 395  LYS B N   1 
ATOM   7405 C  CA  . LYS B 2 395 ? 26.802  -16.911 16.370  1.00 14.03  ? 395  LYS B CA  1 
ATOM   7406 C  C   . LYS B 2 395 ? 25.569  -17.739 16.033  1.00 26.00  ? 395  LYS B C   1 
ATOM   7407 O  O   . LYS B 2 395 ? 25.672  -18.903 15.602  1.00 24.43  ? 395  LYS B O   1 
ATOM   7408 C  CB  . LYS B 2 395 ? 26.809  -16.599 17.868  1.00 2.39   ? 395  LYS B CB  1 
ATOM   7409 C  CG  . LYS B 2 395 ? 26.766  -17.782 18.815  1.00 7.23   ? 395  LYS B CG  1 
ATOM   7410 C  CD  . LYS B 2 395 ? 26.705  -17.294 20.269  1.00 23.12  ? 395  LYS B CD  1 
ATOM   7411 C  CE  . LYS B 2 395 ? 26.625  -18.422 21.308  1.00 29.82  ? 395  LYS B CE  1 
ATOM   7412 N  NZ  . LYS B 2 395 ? 27.908  -19.145 21.517  1.00 34.69  ? 395  LYS B NZ  1 
ATOM   7413 N  N   . GLU B 2 396 ? 24.409  -17.107 16.206  1.00 27.38  ? 396  GLU B N   1 
ATOM   7414 C  CA  . GLU B 2 396 ? 23.127  -17.735 15.947  1.00 21.09  ? 396  GLU B CA  1 
ATOM   7415 C  C   . GLU B 2 396 ? 22.987  -18.250 14.519  1.00 18.34  ? 396  GLU B C   1 
ATOM   7416 O  O   . GLU B 2 396 ? 22.442  -19.329 14.297  1.00 21.57  ? 396  GLU B O   1 
ATOM   7417 C  CB  . GLU B 2 396 ? 21.992  -16.773 16.296  1.00 28.58  ? 396  GLU B CB  1 
ATOM   7418 C  CG  . GLU B 2 396 ? 21.660  -16.686 17.805  1.00 40.19  ? 396  GLU B CG  1 
ATOM   7419 C  CD  . GLU B 2 396 ? 22.594  -15.775 18.609  1.00 55.29  ? 396  GLU B CD  1 
ATOM   7420 O  OE1 . GLU B 2 396 ? 23.214  -14.855 18.026  1.00 63.13  ? 396  GLU B OE1 1 
ATOM   7421 O  OE2 . GLU B 2 396 ? 22.688  -15.967 19.842  1.00 55.87  ? 396  GLU B OE2 1 
ATOM   7422 N  N   . THR B 2 397 ? 23.518  -17.515 13.553  1.00 16.01  ? 397  THR B N   1 
ATOM   7423 C  CA  . THR B 2 397 ? 23.421  -17.959 12.171  1.00 23.86  ? 397  THR B CA  1 
ATOM   7424 C  C   . THR B 2 397 ? 24.267  -19.212 11.985  1.00 28.85  ? 397  THR B C   1 
ATOM   7425 O  O   . THR B 2 397 ? 23.815  -20.210 11.412  1.00 27.75  ? 397  THR B O   1 
ATOM   7426 C  CB  . THR B 2 397 ? 23.918  -16.882 11.204  1.00 36.02  ? 397  THR B CB  1 
ATOM   7427 O  OG1 . THR B 2 397 ? 23.436  -15.600 11.630  1.00 55.85  ? 397  THR B OG1 1 
ATOM   7428 C  CG2 . THR B 2 397 ? 23.404  -17.167 9.785   1.00 33.10  ? 397  THR B CG2 1 
ATOM   7429 N  N   . TRP B 2 398 ? 25.481  -19.168 12.528  1.00 36.46  ? 398  TRP B N   1 
ATOM   7430 C  CA  . TRP B 2 398 ? 26.426  -20.281 12.435  1.00 36.73  ? 398  TRP B CA  1 
ATOM   7431 C  C   . TRP B 2 398 ? 25.887  -21.541 13.085  1.00 34.41  ? 398  TRP B C   1 
ATOM   7432 O  O   . TRP B 2 398 ? 25.659  -22.553 12.414  1.00 36.35  ? 398  TRP B O   1 
ATOM   7433 C  CB  . TRP B 2 398 ? 27.758  -19.907 13.102  1.00 31.02  ? 398  TRP B CB  1 
ATOM   7434 C  CG  . TRP B 2 398 ? 28.810  -20.973 13.004  1.00 18.96  ? 398  TRP B CG  1 
ATOM   7435 C  CD1 . TRP B 2 398 ? 29.352  -21.696 14.035  1.00 22.35  ? 398  TRP B CD1 1 
ATOM   7436 C  CD2 . TRP B 2 398 ? 29.458  -21.439 11.811  1.00 23.91  ? 398  TRP B CD2 1 
ATOM   7437 N  NE1 . TRP B 2 398 ? 30.295  -22.580 13.557  1.00 14.94  ? 398  TRP B NE1 1 
ATOM   7438 C  CE2 . TRP B 2 398 ? 30.380  -22.443 12.198  1.00 22.22  ? 398  TRP B CE2 1 
ATOM   7439 C  CE3 . TRP B 2 398 ? 29.346  -21.099 10.451  1.00 11.05  ? 398  TRP B CE3 1 
ATOM   7440 C  CZ2 . TRP B 2 398 ? 31.190  -23.115 11.276  1.00 23.35  ? 398  TRP B CZ2 1 
ATOM   7441 C  CZ3 . TRP B 2 398 ? 30.157  -21.773 9.529   1.00 20.01  ? 398  TRP B CZ3 1 
ATOM   7442 C  CH2 . TRP B 2 398 ? 31.066  -22.769 9.949   1.00 19.24  ? 398  TRP B CH2 1 
ATOM   7443 N  N   . GLU B 2 399 ? 25.673  -21.453 14.393  1.00 24.42  ? 399  GLU B N   1 
ATOM   7444 C  CA  . GLU B 2 399 ? 25.192  -22.566 15.189  1.00 26.15  ? 399  GLU B CA  1 
ATOM   7445 C  C   . GLU B 2 399 ? 23.951  -23.295 14.634  1.00 26.98  ? 399  GLU B C   1 
ATOM   7446 O  O   . GLU B 2 399 ? 23.864  -24.540 14.632  1.00 23.07  ? 399  GLU B O   1 
ATOM   7447 C  CB  . GLU B 2 399 ? 24.981  -22.065 16.609  1.00 25.26  ? 399  GLU B CB  1 
ATOM   7448 C  CG  . GLU B 2 399 ? 26.250  -21.427 17.155  1.00 22.75  ? 399  GLU B CG  1 
ATOM   7449 C  CD  . GLU B 2 399 ? 26.232  -21.213 18.656  1.00 37.57  ? 399  GLU B CD  1 
ATOM   7450 O  OE1 . GLU B 2 399 ? 25.140  -21.231 19.271  1.00 49.42  ? 399  GLU B OE1 1 
ATOM   7451 O  OE2 . GLU B 2 399 ? 27.326  -21.018 19.226  1.00 39.31  ? 399  GLU B OE2 1 
ATOM   7452 N  N   . THR B 2 400 ? 23.030  -22.514 14.099  1.00 21.93  ? 400  THR B N   1 
ATOM   7453 C  CA  . THR B 2 400 ? 21.806  -23.048 13.538  1.00 22.11  ? 400  THR B CA  1 
ATOM   7454 C  C   . THR B 2 400 ? 21.982  -23.837 12.235  1.00 16.32  ? 400  THR B C   1 
ATOM   7455 O  O   . THR B 2 400 ? 21.234  -24.785 11.988  1.00 10.14  ? 400  THR B O   1 
ATOM   7456 C  CB  . THR B 2 400 ? 20.784  -21.896 13.369  1.00 21.18  ? 400  THR B CB  1 
ATOM   7457 O  OG1 . THR B 2 400 ? 20.371  -21.477 14.671  1.00 39.73  ? 400  THR B OG1 1 
ATOM   7458 C  CG2 . THR B 2 400 ? 19.564  -22.308 12.566  1.00 2.00   ? 400  THR B CG2 1 
ATOM   7459 N  N   . TRP B 2 401 ? 22.992  -23.514 11.434  1.00 8.44   ? 401  TRP B N   1 
ATOM   7460 C  CA  . TRP B 2 401 ? 23.133  -24.223 10.169  1.00 15.63  ? 401  TRP B CA  1 
ATOM   7461 C  C   . TRP B 2 401 ? 24.472  -24.835 9.745   1.00 17.33  ? 401  TRP B C   1 
ATOM   7462 O  O   . TRP B 2 401 ? 24.532  -25.502 8.705   1.00 15.04  ? 401  TRP B O   1 
ATOM   7463 C  CB  . TRP B 2 401 ? 22.608  -23.334 9.035   1.00 16.45  ? 401  TRP B CB  1 
ATOM   7464 C  CG  . TRP B 2 401 ? 21.143  -23.082 9.104   1.00 26.07  ? 401  TRP B CG  1 
ATOM   7465 C  CD1 . TRP B 2 401 ? 20.156  -24.019 9.077   1.00 30.61  ? 401  TRP B CD1 1 
ATOM   7466 C  CD2 . TRP B 2 401 ? 20.490  -21.810 9.205   1.00 38.66  ? 401  TRP B CD2 1 
ATOM   7467 N  NE1 . TRP B 2 401 ? 18.928  -23.414 9.153   1.00 34.00  ? 401  TRP B NE1 1 
ATOM   7468 C  CE2 . TRP B 2 401 ? 19.100  -22.057 9.230   1.00 46.63  ? 401  TRP B CE2 1 
ATOM   7469 C  CE3 . TRP B 2 401 ? 20.939  -20.487 9.277   1.00 45.11  ? 401  TRP B CE3 1 
ATOM   7470 C  CZ2 . TRP B 2 401 ? 18.151  -21.021 9.321   1.00 46.55  ? 401  TRP B CZ2 1 
ATOM   7471 C  CZ3 . TRP B 2 401 ? 19.994  -19.460 9.369   1.00 41.17  ? 401  TRP B CZ3 1 
ATOM   7472 C  CH2 . TRP B 2 401 ? 18.618  -19.737 9.390   1.00 36.71  ? 401  TRP B CH2 1 
ATOM   7473 N  N   . TRP B 2 402 ? 25.529  -24.663 10.532  1.00 15.92  ? 402  TRP B N   1 
ATOM   7474 C  CA  . TRP B 2 402 ? 26.834  -25.195 10.135  1.00 22.22  ? 402  TRP B CA  1 
ATOM   7475 C  C   . TRP B 2 402 ? 26.909  -26.715 9.956   1.00 19.42  ? 402  TRP B C   1 
ATOM   7476 O  O   . TRP B 2 402 ? 27.468  -27.200 8.971   1.00 23.24  ? 402  TRP B O   1 
ATOM   7477 C  CB  . TRP B 2 402 ? 27.942  -24.698 11.078  1.00 30.73  ? 402  TRP B CB  1 
ATOM   7478 C  CG  . TRP B 2 402 ? 27.969  -25.327 12.436  1.00 27.36  ? 402  TRP B CG  1 
ATOM   7479 C  CD1 . TRP B 2 402 ? 27.373  -24.862 13.571  1.00 23.67  ? 402  TRP B CD1 1 
ATOM   7480 C  CD2 . TRP B 2 402 ? 28.669  -26.516 12.805  1.00 22.66  ? 402  TRP B CD2 1 
ATOM   7481 N  NE1 . TRP B 2 402 ? 27.666  -25.686 14.635  1.00 30.52  ? 402  TRP B NE1 1 
ATOM   7482 C  CE2 . TRP B 2 402 ? 28.462  -26.710 14.195  1.00 33.64  ? 402  TRP B CE2 1 
ATOM   7483 C  CE3 . TRP B 2 402 ? 29.452  -27.439 12.101  1.00 2.00   ? 402  TRP B CE3 1 
ATOM   7484 C  CZ2 . TRP B 2 402 ? 29.015  -27.792 14.895  1.00 37.80  ? 402  TRP B CZ2 1 
ATOM   7485 C  CZ3 . TRP B 2 402 ? 30.001  -28.516 12.794  1.00 9.37   ? 402  TRP B CZ3 1 
ATOM   7486 C  CH2 . TRP B 2 402 ? 29.780  -28.682 14.180  1.00 30.85  ? 402  TRP B CH2 1 
ATOM   7487 N  N   . THR B 2 403 ? 26.321  -27.450 10.894  1.00 14.78  ? 403  THR B N   1 
ATOM   7488 C  CA  . THR B 2 403 ? 26.309  -28.907 10.869  1.00 14.82  ? 403  THR B CA  1 
ATOM   7489 C  C   . THR B 2 403 ? 25.753  -29.436 9.552   1.00 18.04  ? 403  THR B C   1 
ATOM   7490 O  O   . THR B 2 403 ? 26.272  -30.387 8.981   1.00 22.30  ? 403  THR B O   1 
ATOM   7491 C  CB  . THR B 2 403 ? 25.430  -29.446 11.998  1.00 14.39  ? 403  THR B CB  1 
ATOM   7492 O  OG1 . THR B 2 403 ? 24.173  -28.758 11.970  1.00 38.87  ? 403  THR B OG1 1 
ATOM   7493 C  CG2 . THR B 2 403 ? 26.090  -29.237 13.362  1.00 4.74   ? 403  THR B CG2 1 
ATOM   7494 N  N   . GLU B 2 404 ? 24.719  -28.771 9.057   1.00 23.37  ? 404  GLU B N   1 
ATOM   7495 C  CA  . GLU B 2 404 ? 24.065  -29.157 7.819   1.00 29.59  ? 404  GLU B CA  1 
ATOM   7496 C  C   . GLU B 2 404 ? 25.037  -29.322 6.672   1.00 30.37  ? 404  GLU B C   1 
ATOM   7497 O  O   . GLU B 2 404 ? 24.770  -30.094 5.748   1.00 35.47  ? 404  GLU B O   1 
ATOM   7498 C  CB  . GLU B 2 404 ? 23.013  -28.119 7.410   1.00 37.50  ? 404  GLU B CB  1 
ATOM   7499 C  CG  . GLU B 2 404 ? 21.967  -27.807 8.467   1.00 52.46  ? 404  GLU B CG  1 
ATOM   7500 C  CD  . GLU B 2 404 ? 21.130  -29.017 8.842   1.00 69.92  ? 404  GLU B CD  1 
ATOM   7501 O  OE1 . GLU B 2 404 ? 20.577  -29.684 7.931   1.00 71.45  ? 404  GLU B OE1 1 
ATOM   7502 O  OE2 . GLU B 2 404 ? 21.025  -29.295 10.057  1.00 71.61  ? 404  GLU B OE2 1 
ATOM   7503 N  N   . TYR B 2 405 ? 26.153  -28.601 6.708   1.00 23.05  ? 405  TYR B N   1 
ATOM   7504 C  CA  . TYR B 2 405 ? 27.092  -28.706 5.601   1.00 35.52  ? 405  TYR B CA  1 
ATOM   7505 C  C   . TYR B 2 405 ? 28.485  -29.210 5.959   1.00 41.10  ? 405  TYR B C   1 
ATOM   7506 O  O   . TYR B 2 405 ? 29.347  -29.350 5.076   1.00 40.20  ? 405  TYR B O   1 
ATOM   7507 C  CB  . TYR B 2 405 ? 27.162  -27.371 4.875   1.00 43.55  ? 405  TYR B CB  1 
ATOM   7508 C  CG  . TYR B 2 405 ? 25.814  -26.688 4.789   1.00 49.72  ? 405  TYR B CG  1 
ATOM   7509 C  CD1 . TYR B 2 405 ? 24.934  -26.959 3.738   1.00 36.40  ? 405  TYR B CD1 1 
ATOM   7510 C  CD2 . TYR B 2 405 ? 25.416  -25.771 5.770   1.00 47.82  ? 405  TYR B CD2 1 
ATOM   7511 C  CE1 . TYR B 2 405 ? 23.692  -26.330 3.661   1.00 39.62  ? 405  TYR B CE1 1 
ATOM   7512 C  CE2 . TYR B 2 405 ? 24.175  -25.135 5.705   1.00 43.00  ? 405  TYR B CE2 1 
ATOM   7513 C  CZ  . TYR B 2 405 ? 23.317  -25.416 4.648   1.00 41.51  ? 405  TYR B CZ  1 
ATOM   7514 O  OH  . TYR B 2 405 ? 22.094  -24.773 4.576   1.00 24.99  ? 405  TYR B OH  1 
ATOM   7515 N  N   . TRP B 2 406 ? 28.683  -29.537 7.238   1.00 37.55  ? 406  TRP B N   1 
ATOM   7516 C  CA  . TRP B 2 406 ? 29.968  -30.031 7.731   1.00 29.95  ? 406  TRP B CA  1 
ATOM   7517 C  C   . TRP B 2 406 ? 30.276  -31.389 7.104   1.00 35.52  ? 406  TRP B C   1 
ATOM   7518 O  O   . TRP B 2 406 ? 29.355  -32.119 6.711   1.00 39.41  ? 406  TRP B O   1 
ATOM   7519 C  CB  . TRP B 2 406 ? 29.918  -30.166 9.247   1.00 18.63  ? 406  TRP B CB  1 
ATOM   7520 C  CG  . TRP B 2 406 ? 31.256  -30.293 9.902   1.00 31.64  ? 406  TRP B CG  1 
ATOM   7521 C  CD1 . TRP B 2 406 ? 31.695  -31.327 10.685  1.00 38.08  ? 406  TRP B CD1 1 
ATOM   7522 C  CD2 . TRP B 2 406 ? 32.298  -29.306 9.924   1.00 44.49  ? 406  TRP B CD2 1 
ATOM   7523 N  NE1 . TRP B 2 406 ? 32.937  -31.036 11.205  1.00 43.71  ? 406  TRP B NE1 1 
ATOM   7524 C  CE2 . TRP B 2 406 ? 33.330  -29.803 10.756  1.00 48.25  ? 406  TRP B CE2 1 
ATOM   7525 C  CE3 . TRP B 2 406 ? 32.456  -28.043 9.329   1.00 41.28  ? 406  TRP B CE3 1 
ATOM   7526 C  CZ2 . TRP B 2 406 ? 34.505  -29.078 11.007  1.00 45.40  ? 406  TRP B CZ2 1 
ATOM   7527 C  CZ3 . TRP B 2 406 ? 33.625  -27.322 9.580   1.00 34.43  ? 406  TRP B CZ3 1 
ATOM   7528 C  CH2 . TRP B 2 406 ? 34.633  -27.845 10.413  1.00 41.02  ? 406  TRP B CH2 1 
ATOM   7529 N  N   . GLN B 2 407 ? 31.562  -31.732 7.025   1.00 30.13  ? 407  GLN B N   1 
ATOM   7530 C  CA  . GLN B 2 407 ? 32.000  -33.008 6.446   1.00 27.31  ? 407  GLN B CA  1 
ATOM   7531 C  C   . GLN B 2 407 ? 33.268  -33.582 7.083   1.00 25.55  ? 407  GLN B C   1 
ATOM   7532 O  O   . GLN B 2 407 ? 33.615  -34.743 6.873   1.00 21.03  ? 407  GLN B O   1 
ATOM   7533 C  CB  . GLN B 2 407 ? 32.206  -32.866 4.940   1.00 20.87  ? 407  GLN B CB  1 
ATOM   7534 C  CG  . GLN B 2 407 ? 30.921  -32.800 4.160   1.00 23.41  ? 407  GLN B CG  1 
ATOM   7535 C  CD  . GLN B 2 407 ? 31.048  -31.932 2.934   1.00 37.61  ? 407  GLN B CD  1 
ATOM   7536 O  OE1 . GLN B 2 407 ? 31.655  -30.853 2.982   1.00 36.34  ? 407  GLN B OE1 1 
ATOM   7537 N  NE2 . GLN B 2 407 ? 30.477  -32.390 1.821   1.00 37.44  ? 407  GLN B NE2 1 
ATOM   7538 N  N   . ALA B 2 408 ? 33.946  -32.788 7.893   1.00 22.44  ? 408  ALA B N   1 
ATOM   7539 C  CA  . ALA B 2 408 ? 35.162  -33.258 8.516   1.00 17.57  ? 408  ALA B CA  1 
ATOM   7540 C  C   . ALA B 2 408 ? 34.890  -33.972 9.826   1.00 16.88  ? 408  ALA B C   1 
ATOM   7541 O  O   . ALA B 2 408 ? 33.962  -33.627 10.548  1.00 9.74   ? 408  ALA B O   1 
ATOM   7542 C  CB  . ALA B 2 408 ? 36.057  -32.127 8.739   1.00 20.96  ? 408  ALA B CB  1 
ATOM   7543 N  N   . THR B 2 409 ? 35.711  -34.968 10.130  1.00 17.27  ? 409  THR B N   1 
ATOM   7544 C  CA  . THR B 2 409 ? 35.553  -35.732 11.356  1.00 28.77  ? 409  THR B CA  1 
ATOM   7545 C  C   . THR B 2 409 ? 35.853  -34.866 12.571  1.00 32.13  ? 409  THR B C   1 
ATOM   7546 O  O   . THR B 2 409 ? 35.380  -35.134 13.682  1.00 28.65  ? 409  THR B O   1 
ATOM   7547 C  CB  . THR B 2 409 ? 36.501  -36.957 11.369  1.00 48.54  ? 409  THR B CB  1 
ATOM   7548 O  OG1 . THR B 2 409 ? 37.860  -36.533 11.179  1.00 59.81  ? 409  THR B OG1 1 
ATOM   7549 C  CG2 . THR B 2 409 ? 36.133  -37.917 10.258  1.00 57.17  ? 409  THR B CG2 1 
ATOM   7550 N  N   . TRP B 2 410 ? 36.714  -33.876 12.357  1.00 32.22  ? 410  TRP B N   1 
ATOM   7551 C  CA  . TRP B 2 410 ? 37.115  -32.952 13.406  1.00 31.97  ? 410  TRP B CA  1 
ATOM   7552 C  C   . TRP B 2 410 ? 36.281  -31.696 13.291  1.00 31.83  ? 410  TRP B C   1 
ATOM   7553 O  O   . TRP B 2 410 ? 35.566  -31.502 12.310  1.00 23.13  ? 410  TRP B O   1 
ATOM   7554 C  CB  . TRP B 2 410 ? 38.609  -32.598 13.284  1.00 38.14  ? 410  TRP B CB  1 
ATOM   7555 C  CG  . TRP B 2 410 ? 39.138  -32.599 11.855  1.00 37.87  ? 410  TRP B CG  1 
ATOM   7556 C  CD1 . TRP B 2 410 ? 39.931  -33.553 11.289  1.00 37.55  ? 410  TRP B CD1 1 
ATOM   7557 C  CD2 . TRP B 2 410 ? 38.832  -31.659 10.802  1.00 35.77  ? 410  TRP B CD2 1 
ATOM   7558 N  NE1 . TRP B 2 410 ? 40.122  -33.287 9.956   1.00 36.31  ? 410  TRP B NE1 1 
ATOM   7559 C  CE2 . TRP B 2 410 ? 39.463  -32.134 9.624   1.00 30.86  ? 410  TRP B CE2 1 
ATOM   7560 C  CE3 . TRP B 2 410 ? 38.083  -30.471 10.737  1.00 26.01  ? 410  TRP B CE3 1 
ATOM   7561 C  CZ2 . TRP B 2 410 ? 39.369  -31.465 8.386   1.00 20.97  ? 410  TRP B CZ2 1 
ATOM   7562 C  CZ3 . TRP B 2 410 ? 37.988  -29.799 9.498   1.00 19.16  ? 410  TRP B CZ3 1 
ATOM   7563 C  CH2 . TRP B 2 410 ? 38.630  -30.306 8.342   1.00 17.04  ? 410  TRP B CH2 1 
ATOM   7564 N  N   . ILE B 2 411 ? 36.364  -30.864 14.322  1.00 42.33  ? 411  ILE B N   1 
ATOM   7565 C  CA  . ILE B 2 411 ? 35.659  -29.589 14.379  1.00 42.97  ? 411  ILE B CA  1 
ATOM   7566 C  C   . ILE B 2 411 ? 36.666  -28.606 14.998  1.00 38.43  ? 411  ILE B C   1 
ATOM   7567 O  O   . ILE B 2 411 ? 37.187  -28.861 16.088  1.00 34.03  ? 411  ILE B O   1 
ATOM   7568 C  CB  . ILE B 2 411 ? 34.408  -29.667 15.291  1.00 43.21  ? 411  ILE B CB  1 
ATOM   7569 C  CG1 . ILE B 2 411 ? 33.548  -30.888 14.933  1.00 51.49  ? 411  ILE B CG1 1 
ATOM   7570 C  CG2 . ILE B 2 411 ? 33.587  -28.403 15.132  1.00 49.03  ? 411  ILE B CG2 1 
ATOM   7571 C  CD1 . ILE B 2 411 ? 32.410  -31.180 15.919  1.00 42.88  ? 411  ILE B CD1 1 
ATOM   7572 N  N   . PRO B 2 412 ? 37.037  -27.536 14.264  1.00 33.08  ? 412  PRO B N   1 
ATOM   7573 C  CA  . PRO B 2 412 ? 37.994  -26.555 14.787  1.00 28.77  ? 412  PRO B CA  1 
ATOM   7574 C  C   . PRO B 2 412 ? 37.337  -25.599 15.779  1.00 26.96  ? 412  PRO B C   1 
ATOM   7575 O  O   . PRO B 2 412 ? 36.115  -25.608 15.918  1.00 16.92  ? 412  PRO B O   1 
ATOM   7576 C  CB  . PRO B 2 412 ? 38.444  -25.825 13.519  1.00 19.44  ? 412  PRO B CB  1 
ATOM   7577 C  CG  . PRO B 2 412 ? 37.207  -25.804 12.700  1.00 14.54  ? 412  PRO B CG  1 
ATOM   7578 C  CD  . PRO B 2 412 ? 36.680  -27.217 12.867  1.00 27.13  ? 412  PRO B CD  1 
ATOM   7579 N  N   . GLU B 2 413 ? 38.157  -24.823 16.495  1.00 32.56  ? 413  GLU B N   1 
ATOM   7580 C  CA  . GLU B 2 413 ? 37.666  -23.829 17.456  1.00 36.33  ? 413  GLU B CA  1 
ATOM   7581 C  C   . GLU B 2 413 ? 37.290  -22.571 16.687  1.00 37.19  ? 413  GLU B C   1 
ATOM   7582 O  O   . GLU B 2 413 ? 37.867  -22.287 15.631  1.00 34.76  ? 413  GLU B O   1 
ATOM   7583 C  CB  . GLU B 2 413 ? 38.737  -23.473 18.484  1.00 36.71  ? 413  GLU B CB  1 
ATOM   7584 C  CG  . GLU B 2 413 ? 39.008  -24.570 19.489  1.00 63.15  ? 413  GLU B CG  1 
ATOM   7585 C  CD  . GLU B 2 413 ? 37.795  -24.895 20.352  1.00 69.57  ? 413  GLU B CD  1 
ATOM   7586 O  OE1 . GLU B 2 413 ? 36.912  -24.020 20.510  1.00 80.18  ? 413  GLU B OE1 1 
ATOM   7587 O  OE2 . GLU B 2 413 ? 37.733  -26.025 20.884  1.00 60.56  ? 413  GLU B OE2 1 
ATOM   7588 N  N   . TRP B 2 414 ? 36.345  -21.803 17.218  1.00 40.09  ? 414  TRP B N   1 
ATOM   7589 C  CA  . TRP B 2 414 ? 35.912  -20.597 16.535  1.00 38.60  ? 414  TRP B CA  1 
ATOM   7590 C  C   . TRP B 2 414 ? 35.378  -19.503 17.445  1.00 40.45  ? 414  TRP B C   1 
ATOM   7591 O  O   . TRP B 2 414 ? 35.017  -19.748 18.607  1.00 32.34  ? 414  TRP B O   1 
ATOM   7592 C  CB  . TRP B 2 414 ? 34.876  -20.931 15.445  1.00 34.98  ? 414  TRP B CB  1 
ATOM   7593 C  CG  . TRP B 2 414 ? 33.652  -21.728 15.908  1.00 46.46  ? 414  TRP B CG  1 
ATOM   7594 C  CD1 . TRP B 2 414 ? 32.790  -21.408 16.928  1.00 48.16  ? 414  TRP B CD1 1 
ATOM   7595 C  CD2 . TRP B 2 414 ? 33.157  -22.956 15.340  1.00 45.91  ? 414  TRP B CD2 1 
ATOM   7596 N  NE1 . TRP B 2 414 ? 31.796  -22.356 17.025  1.00 45.19  ? 414  TRP B NE1 1 
ATOM   7597 C  CE2 . TRP B 2 414 ? 31.995  -23.315 16.067  1.00 36.22  ? 414  TRP B CE2 1 
ATOM   7598 C  CE3 . TRP B 2 414 ? 33.580  -23.785 14.288  1.00 46.87  ? 414  TRP B CE3 1 
ATOM   7599 C  CZ2 . TRP B 2 414 ? 31.260  -24.462 15.777  1.00 27.79  ? 414  TRP B CZ2 1 
ATOM   7600 C  CZ3 . TRP B 2 414 ? 32.848  -24.924 14.001  1.00 40.38  ? 414  TRP B CZ3 1 
ATOM   7601 C  CH2 . TRP B 2 414 ? 31.698  -25.251 14.744  1.00 40.55  ? 414  TRP B CH2 1 
ATOM   7602 N  N   . GLU B 2 415 ? 35.385  -18.291 16.895  1.00 47.51  ? 415  GLU B N   1 
ATOM   7603 C  CA  . GLU B 2 415 ? 34.889  -17.082 17.543  1.00 52.12  ? 415  GLU B CA  1 
ATOM   7604 C  C   . GLU B 2 415 ? 34.254  -16.258 16.413  1.00 48.34  ? 415  GLU B C   1 
ATOM   7605 O  O   . GLU B 2 415 ? 34.663  -16.357 15.250  1.00 42.51  ? 415  GLU B O   1 
ATOM   7606 C  CB  . GLU B 2 415 ? 36.018  -16.307 18.239  1.00 61.05  ? 415  GLU B CB  1 
ATOM   7607 C  CG  . GLU B 2 415 ? 37.071  -15.696 17.314  1.00 70.96  ? 415  GLU B CG  1 
ATOM   7608 C  CD  . GLU B 2 415 ? 38.166  -14.966 18.078  1.00 72.34  ? 415  GLU B CD  1 
ATOM   7609 O  OE1 . GLU B 2 415 ? 37.928  -13.819 18.522  1.00 75.82  ? 415  GLU B OE1 1 
ATOM   7610 O  OE2 . GLU B 2 415 ? 39.264  -15.542 18.234  1.00 60.67  ? 415  GLU B OE2 1 
ATOM   7611 N  N   . PHE B 2 416 ? 33.219  -15.498 16.749  1.00 45.43  ? 416  PHE B N   1 
ATOM   7612 C  CA  . PHE B 2 416 ? 32.494  -14.694 15.771  1.00 36.50  ? 416  PHE B CA  1 
ATOM   7613 C  C   . PHE B 2 416 ? 32.921  -13.248 15.893  1.00 39.46  ? 416  PHE B C   1 
ATOM   7614 O  O   . PHE B 2 416 ? 32.959  -12.689 16.996  1.00 41.93  ? 416  PHE B O   1 
ATOM   7615 C  CB  . PHE B 2 416 ? 30.997  -14.861 16.009  1.00 33.17  ? 416  PHE B CB  1 
ATOM   7616 C  CG  . PHE B 2 416 ? 30.588  -16.296 16.199  1.00 36.10  ? 416  PHE B CG  1 
ATOM   7617 C  CD1 . PHE B 2 416 ? 30.469  -17.150 15.093  1.00 29.99  ? 416  PHE B CD1 1 
ATOM   7618 C  CD2 . PHE B 2 416 ? 30.421  -16.824 17.487  1.00 22.51  ? 416  PHE B CD2 1 
ATOM   7619 C  CE1 . PHE B 2 416 ? 30.200  -18.511 15.267  1.00 25.46  ? 416  PHE B CE1 1 
ATOM   7620 C  CE2 . PHE B 2 416 ? 30.150  -18.189 17.674  1.00 17.79  ? 416  PHE B CE2 1 
ATOM   7621 C  CZ  . PHE B 2 416 ? 30.043  -19.035 16.561  1.00 17.72  ? 416  PHE B CZ  1 
ATOM   7622 N  N   . VAL B 2 417 ? 33.227  -12.638 14.755  1.00 39.01  ? 417  VAL B N   1 
ATOM   7623 C  CA  . VAL B 2 417 ? 33.707  -11.270 14.743  1.00 40.16  ? 417  VAL B CA  1 
ATOM   7624 C  C   . VAL B 2 417 ? 33.047  -10.325 13.748  1.00 40.30  ? 417  VAL B C   1 
ATOM   7625 O  O   . VAL B 2 417 ? 32.203  -10.726 12.920  1.00 23.24  ? 417  VAL B O   1 
ATOM   7626 C  CB  . VAL B 2 417 ? 35.221  -11.246 14.462  1.00 52.65  ? 417  VAL B CB  1 
ATOM   7627 C  CG1 . VAL B 2 417 ? 35.974  -12.059 15.522  1.00 57.44  ? 417  VAL B CG1 1 
ATOM   7628 C  CG2 . VAL B 2 417 ? 35.505  -11.778 13.044  1.00 51.62  ? 417  VAL B CG2 1 
ATOM   7629 N  N   . ASN B 2 418 ? 33.479  -9.063  13.856  1.00 45.96  ? 418  ASN B N   1 
ATOM   7630 C  CA  . ASN B 2 418 ? 33.040  -7.951  13.015  1.00 46.55  ? 418  ASN B CA  1 
ATOM   7631 C  C   . ASN B 2 418 ? 34.252  -7.583  12.178  1.00 43.94  ? 418  ASN B C   1 
ATOM   7632 O  O   . ASN B 2 418 ? 35.301  -7.214  12.718  1.00 42.96  ? 418  ASN B O   1 
ATOM   7633 C  CB  . ASN B 2 418 ? 32.648  -6.740  13.862  1.00 50.52  ? 418  ASN B CB  1 
ATOM   7634 C  CG  . ASN B 2 418 ? 31.555  -7.051  14.865  1.00 55.41  ? 418  ASN B CG  1 
ATOM   7635 O  OD1 . ASN B 2 418 ? 30.804  -8.013  14.711  1.00 63.65  ? 418  ASN B OD1 1 
ATOM   7636 N  ND2 . ASN B 2 418 ? 31.464  -6.234  15.906  1.00 57.36  ? 418  ASN B ND2 1 
ATOM   7637 N  N   . THR B 2 419 ? 34.092  -7.668  10.864  1.00 39.04  ? 419  THR B N   1 
ATOM   7638 C  CA  . THR B 2 419 ? 35.157  -7.388  9.915   1.00 39.27  ? 419  THR B CA  1 
ATOM   7639 C  C   . THR B 2 419 ? 35.542  -5.926  9.685   1.00 37.32  ? 419  THR B C   1 
ATOM   7640 O  O   . THR B 2 419 ? 34.733  -5.141  9.184   1.00 39.63  ? 419  THR B O   1 
ATOM   7641 C  CB  . THR B 2 419 ? 34.806  -8.008  8.554   1.00 44.11  ? 419  THR B CB  1 
ATOM   7642 O  OG1 . THR B 2 419 ? 34.669  -9.427  8.704   1.00 47.21  ? 419  THR B OG1 1 
ATOM   7643 C  CG2 . THR B 2 419 ? 35.872  -7.683  7.503   1.00 43.26  ? 419  THR B CG2 1 
ATOM   7644 N  N   . PRO B 2 420 ? 36.778  -5.537  10.073  1.00 33.90  ? 420  PRO B N   1 
ATOM   7645 C  CA  . PRO B 2 420 ? 37.236  -4.161  9.870   1.00 41.76  ? 420  PRO B CA  1 
ATOM   7646 C  C   . PRO B 2 420 ? 37.326  -3.965  8.349   1.00 44.54  ? 420  PRO B C   1 
ATOM   7647 O  O   . PRO B 2 420 ? 38.092  -4.659  7.665   1.00 49.07  ? 420  PRO B O   1 
ATOM   7648 C  CB  . PRO B 2 420 ? 38.618  -4.165  10.530  1.00 39.97  ? 420  PRO B CB  1 
ATOM   7649 C  CG  . PRO B 2 420 ? 38.452  -5.166  11.638  1.00 23.52  ? 420  PRO B CG  1 
ATOM   7650 C  CD  . PRO B 2 420 ? 37.731  -6.273  10.923  1.00 29.69  ? 420  PRO B CD  1 
ATOM   7651 N  N   . PRO B 2 421 ? 36.545  -3.014  7.810   1.00 40.21  ? 421  PRO B N   1 
ATOM   7652 C  CA  . PRO B 2 421 ? 36.423  -2.630  6.393   1.00 39.83  ? 421  PRO B CA  1 
ATOM   7653 C  C   . PRO B 2 421 ? 37.726  -2.494  5.607   1.00 39.77  ? 421  PRO B C   1 
ATOM   7654 O  O   . PRO B 2 421 ? 37.769  -2.727  4.393   1.00 27.89  ? 421  PRO B O   1 
ATOM   7655 C  CB  . PRO B 2 421 ? 35.690  -1.293  6.469   1.00 43.47  ? 421  PRO B CB  1 
ATOM   7656 C  CG  . PRO B 2 421 ? 34.877  -1.422  7.712   1.00 33.93  ? 421  PRO B CG  1 
ATOM   7657 C  CD  . PRO B 2 421 ? 35.824  -2.062  8.673   1.00 32.05  ? 421  PRO B CD  1 
ATOM   7658 N  N   . LEU B 2 422 ? 38.780  -2.084  6.303   1.00 46.86  ? 422  LEU B N   1 
ATOM   7659 C  CA  . LEU B 2 422 ? 40.082  -1.913  5.682   1.00 46.30  ? 422  LEU B CA  1 
ATOM   7660 C  C   . LEU B 2 422 ? 40.753  -3.235  5.399   1.00 40.53  ? 422  LEU B C   1 
ATOM   7661 O  O   . LEU B 2 422 ? 41.205  -3.478  4.284   1.00 36.41  ? 422  LEU B O   1 
ATOM   7662 C  CB  . LEU B 2 422 ? 40.982  -1.065  6.573   1.00 51.41  ? 422  LEU B CB  1 
ATOM   7663 C  CG  . LEU B 2 422 ? 40.825  0.431   6.315   1.00 52.93  ? 422  LEU B CG  1 
ATOM   7664 C  CD1 . LEU B 2 422 ? 41.856  1.177   7.145   1.00 34.89  ? 422  LEU B CD1 1 
ATOM   7665 C  CD2 . LEU B 2 422 ? 40.980  0.726   4.798   1.00 42.07  ? 422  LEU B CD2 1 
ATOM   7666 N  N   . VAL B 2 423 ? 40.790  -4.095  6.415   1.00 38.31  ? 423  VAL B N   1 
ATOM   7667 C  CA  . VAL B 2 423 ? 41.414  -5.406  6.297   1.00 36.49  ? 423  VAL B CA  1 
ATOM   7668 C  C   . VAL B 2 423 ? 40.877  -6.102  5.032   1.00 35.27  ? 423  VAL B C   1 
ATOM   7669 O  O   . VAL B 2 423 ? 41.650  -6.597  4.203   1.00 31.69  ? 423  VAL B O   1 
ATOM   7670 C  CB  . VAL B 2 423 ? 41.167  -6.252  7.585   1.00 22.94  ? 423  VAL B CB  1 
ATOM   7671 C  CG1 . VAL B 2 423 ? 41.928  -7.559  7.504   1.00 24.81  ? 423  VAL B CG1 1 
ATOM   7672 C  CG2 . VAL B 2 423 ? 41.625  -5.480  8.817   1.00 2.00   ? 423  VAL B CG2 1 
ATOM   7673 N  N   . LYS B 2 424 ? 39.561  -6.015  4.848   1.00 29.77  ? 424  LYS B N   1 
ATOM   7674 C  CA  . LYS B 2 424 ? 38.871  -6.590  3.703   1.00 27.75  ? 424  LYS B CA  1 
ATOM   7675 C  C   . LYS B 2 424 ? 39.377  -5.928  2.428   1.00 28.83  ? 424  LYS B C   1 
ATOM   7676 O  O   . LYS B 2 424 ? 39.828  -6.592  1.481   1.00 25.73  ? 424  LYS B O   1 
ATOM   7677 C  CB  . LYS B 2 424 ? 37.365  -6.331  3.862   1.00 35.82  ? 424  LYS B CB  1 
ATOM   7678 C  CG  . LYS B 2 424 ? 36.455  -6.882  2.754   1.00 29.89  ? 424  LYS B CG  1 
ATOM   7679 C  CD  . LYS B 2 424 ? 36.414  -5.995  1.507   1.00 11.68  ? 424  LYS B CD  1 
ATOM   7680 C  CE  . LYS B 2 424 ? 35.305  -6.440  0.583   1.00 14.23  ? 424  LYS B CE  1 
ATOM   7681 N  NZ  . LYS B 2 424 ? 35.291  -5.649  -0.673  1.00 40.48  ? 424  LYS B NZ  1 
ATOM   7682 N  N   . LEU B 2 425 ? 39.277  -4.604  2.414   1.00 27.32  ? 425  LEU B N   1 
ATOM   7683 C  CA  . LEU B 2 425 ? 39.700  -3.797  1.277   1.00 25.41  ? 425  LEU B CA  1 
ATOM   7684 C  C   . LEU B 2 425 ? 41.117  -4.127  0.828   1.00 16.88  ? 425  LEU B C   1 
ATOM   7685 O  O   . LEU B 2 425 ? 41.402  -4.211  -0.370  1.00 21.76  ? 425  LEU B O   1 
ATOM   7686 C  CB  . LEU B 2 425 ? 39.610  -2.317  1.648   1.00 25.47  ? 425  LEU B CB  1 
ATOM   7687 C  CG  . LEU B 2 425 ? 38.493  -1.478  1.033   1.00 11.20  ? 425  LEU B CG  1 
ATOM   7688 C  CD1 . LEU B 2 425 ? 37.389  -2.343  0.397   1.00 8.38   ? 425  LEU B CD1 1 
ATOM   7689 C  CD2 . LEU B 2 425 ? 37.954  -0.584  2.122   1.00 21.52  ? 425  LEU B CD2 1 
ATOM   7690 N  N   . TRP B 2 426 ? 41.985  -4.350  1.802   1.00 2.00   ? 426  TRP B N   1 
ATOM   7691 C  CA  . TRP B 2 426 ? 43.358  -4.656  1.524   1.00 21.80  ? 426  TRP B CA  1 
ATOM   7692 C  C   . TRP B 2 426 ? 43.541  -5.981  0.788   1.00 24.44  ? 426  TRP B C   1 
ATOM   7693 O  O   . TRP B 2 426 ? 44.081  -6.037  -0.335  1.00 11.29  ? 426  TRP B O   1 
ATOM   7694 C  CB  . TRP B 2 426 ? 44.163  -4.680  2.823   1.00 43.19  ? 426  TRP B CB  1 
ATOM   7695 C  CG  . TRP B 2 426 ? 45.589  -5.017  2.554   1.00 67.78  ? 426  TRP B CG  1 
ATOM   7696 C  CD1 . TRP B 2 426 ? 46.224  -6.189  2.840   1.00 64.16  ? 426  TRP B CD1 1 
ATOM   7697 C  CD2 . TRP B 2 426 ? 46.531  -4.211  1.835   1.00 88.41  ? 426  TRP B CD2 1 
ATOM   7698 N  NE1 . TRP B 2 426 ? 47.498  -6.170  2.329   1.00 82.41  ? 426  TRP B NE1 1 
ATOM   7699 C  CE2 . TRP B 2 426 ? 47.715  -4.969  1.707   1.00 92.29  ? 426  TRP B CE2 1 
ATOM   7700 C  CE3 . TRP B 2 426 ? 46.486  -2.924  1.276   1.00 100.05 ? 426  TRP B CE3 1 
ATOM   7701 C  CZ2 . TRP B 2 426 ? 48.850  -4.484  1.042   1.00 101.11 ? 426  TRP B CZ2 1 
ATOM   7702 C  CZ3 . TRP B 2 426 ? 47.613  -2.440  0.614   1.00 109.54 ? 426  TRP B CZ3 1 
ATOM   7703 C  CH2 . TRP B 2 426 ? 48.780  -3.222  0.503   1.00 110.55 ? 426  TRP B CH2 1 
ATOM   7704 N  N   . TYR B 2 427 ? 43.105  -7.051  1.435   1.00 23.38  ? 427  TYR B N   1 
ATOM   7705 C  CA  . TYR B 2 427 ? 43.261  -8.364  0.862   1.00 29.25  ? 427  TYR B CA  1 
ATOM   7706 C  C   . TYR B 2 427 ? 42.496  -8.548  -0.415  1.00 39.82  ? 427  TYR B C   1 
ATOM   7707 O  O   . TYR B 2 427 ? 42.830  -9.420  -1.215  1.00 49.02  ? 427  TYR B O   1 
ATOM   7708 C  CB  . TYR B 2 427 ? 42.941  -9.416  1.888   1.00 29.96  ? 427  TYR B CB  1 
ATOM   7709 C  CG  . TYR B 2 427 ? 43.918  -9.332  3.017   1.00 37.19  ? 427  TYR B CG  1 
ATOM   7710 C  CD1 . TYR B 2 427 ? 45.235  -9.748  2.844   1.00 36.24  ? 427  TYR B CD1 1 
ATOM   7711 C  CD2 . TYR B 2 427 ? 43.539  -8.815  4.254   1.00 37.43  ? 427  TYR B CD2 1 
ATOM   7712 C  CE1 . TYR B 2 427 ? 46.148  -9.655  3.875   1.00 31.03  ? 427  TYR B CE1 1 
ATOM   7713 C  CE2 . TYR B 2 427 ? 44.443  -8.717  5.292   1.00 30.53  ? 427  TYR B CE2 1 
ATOM   7714 C  CZ  . TYR B 2 427 ? 45.746  -9.142  5.100   1.00 30.83  ? 427  TYR B CZ  1 
ATOM   7715 O  OH  . TYR B 2 427 ? 46.641  -9.092  6.149   1.00 47.87  ? 427  TYR B OH  1 
ATOM   7716 N  N   . GLN B 2 428 ? 41.519  -7.678  -0.640  1.00 43.35  ? 428  GLN B N   1 
ATOM   7717 C  CA  . GLN B 2 428 ? 40.748  -7.718  -1.871  1.00 53.68  ? 428  GLN B CA  1 
ATOM   7718 C  C   . GLN B 2 428 ? 41.709  -7.450  -3.024  1.00 58.11  ? 428  GLN B C   1 
ATOM   7719 O  O   . GLN B 2 428 ? 41.409  -7.737  -4.182  1.00 57.53  ? 428  GLN B O   1 
ATOM   7720 C  CB  . GLN B 2 428 ? 39.674  -6.638  -1.848  1.00 57.50  ? 428  GLN B CB  1 
ATOM   7721 C  CG  . GLN B 2 428 ? 38.871  -6.542  -3.138  1.00 64.93  ? 428  GLN B CG  1 
ATOM   7722 C  CD  . GLN B 2 428 ? 37.757  -5.513  -3.065  1.00 67.77  ? 428  GLN B CD  1 
ATOM   7723 O  OE1 . GLN B 2 428 ? 36.889  -5.468  -3.935  1.00 69.36  ? 428  GLN B OE1 1 
ATOM   7724 N  NE2 . GLN B 2 428 ? 37.764  -4.692  -2.017  1.00 55.69  ? 428  GLN B NE2 1 
ATOM   7725 N  N   . LEU B 2 429 ? 42.868  -6.896  -2.680  1.00 65.84  ? 429  LEU B N   1 
ATOM   7726 C  CA  . LEU B 2 429 ? 43.901  -6.559  -3.642  1.00 71.91  ? 429  LEU B CA  1 
ATOM   7727 C  C   . LEU B 2 429 ? 44.812  -7.703  -4.036  1.00 69.55  ? 429  LEU B C   1 
ATOM   7728 O  O   . LEU B 2 429 ? 45.709  -7.515  -4.856  1.00 70.43  ? 429  LEU B O   1 
ATOM   7729 C  CB  . LEU B 2 429 ? 44.742  -5.396  -3.115  1.00 79.29  ? 429  LEU B CB  1 
ATOM   7730 C  CG  . LEU B 2 429 ? 44.408  -3.998  -3.647  1.00 83.63  ? 429  LEU B CG  1 
ATOM   7731 C  CD1 . LEU B 2 429 ? 42.920  -3.709  -3.534  1.00 83.50  ? 429  LEU B CD1 1 
ATOM   7732 C  CD2 . LEU B 2 429 ? 45.215  -2.961  -2.896  1.00 87.52  ? 429  LEU B CD2 1 
ATOM   7733 N  N   . GLU B 2 430 ? 44.598  -8.883  -3.466  1.00 70.88  ? 430  GLU B N   1 
ATOM   7734 C  CA  . GLU B 2 430 ? 45.447  -10.023 -3.799  1.00 81.46  ? 430  GLU B CA  1 
ATOM   7735 C  C   . GLU B 2 430 ? 45.419  -10.373 -5.290  1.00 87.51  ? 430  GLU B C   1 
ATOM   7736 O  O   . GLU B 2 430 ? 44.380  -10.278 -5.951  1.00 87.30  ? 430  GLU B O   1 
ATOM   7737 C  CB  . GLU B 2 430 ? 45.105  -11.237 -2.932  1.00 86.20  ? 430  GLU B CB  1 
ATOM   7738 C  CG  . GLU B 2 430 ? 46.290  -11.715 -2.092  1.00 94.66  ? 430  GLU B CG  1 
ATOM   7739 C  CD  . GLU B 2 430 ? 45.919  -12.742 -1.030  1.00 95.55  ? 430  GLU B CD  1 
ATOM   7740 O  OE1 . GLU B 2 430 ? 45.649  -13.911 -1.393  1.00 93.72  ? 430  GLU B OE1 1 
ATOM   7741 O  OE2 . GLU B 2 430 ? 45.922  -12.379 0.170   1.00 86.75  ? 430  GLU B OE2 1 
ATOM   7742 N  N   . LYS B 2 431 ? 46.587  -10.739 -5.813  1.00 93.34  ? 431  LYS B N   1 
ATOM   7743 C  CA  . LYS B 2 431 ? 46.756  -11.086 -7.222  1.00 98.48  ? 431  LYS B CA  1 
ATOM   7744 C  C   . LYS B 2 431 ? 46.119  -12.408 -7.613  1.00 98.88  ? 431  LYS B C   1 
ATOM   7745 O  O   . LYS B 2 431 ? 46.246  -13.417 -6.910  1.00 99.25  ? 431  LYS B O   1 
ATOM   7746 C  CB  . LYS B 2 431 ? 48.244  -11.127 -7.590  1.00 104.27 ? 431  LYS B CB  1 
ATOM   7747 C  CG  . LYS B 2 431 ? 48.529  -11.493 -9.048  1.00 110.98 ? 431  LYS B CG  1 
ATOM   7748 C  CD  . LYS B 2 431 ? 50.025  -11.478 -9.339  1.00 121.10 ? 431  LYS B CD  1 
ATOM   7749 C  CE  . LYS B 2 431 ? 50.312  -11.612 -10.831 1.00 128.24 ? 431  LYS B CE  1 
ATOM   7750 N  NZ  . LYS B 2 431 ? 51.745  -11.325 -11.147 1.00 132.98 ? 431  LYS B NZ  1 
ATOM   7751 N  N   . GLU B 2 432 ? 45.473  -12.400 -8.768  1.00 97.61  ? 432  GLU B N   1 
ATOM   7752 C  CA  . GLU B 2 432 ? 44.836  -13.591 -9.291  1.00 96.42  ? 432  GLU B CA  1 
ATOM   7753 C  C   . GLU B 2 432 ? 45.551  -13.954 -10.580 1.00 94.15  ? 432  GLU B C   1 
ATOM   7754 O  O   . GLU B 2 432 ? 46.255  -13.119 -11.158 1.00 95.56  ? 432  GLU B O   1 
ATOM   7755 C  CB  . GLU B 2 432 ? 43.354  -13.337 -9.535  1.00 100.72 ? 432  GLU B CB  1 
ATOM   7756 C  CG  . GLU B 2 432 ? 42.582  -13.045 -8.260  1.00 103.82 ? 432  GLU B CG  1 
ATOM   7757 C  CD  . GLU B 2 432 ? 41.096  -13.281 -8.418  1.00 108.93 ? 432  GLU B CD  1 
ATOM   7758 O  OE1 . GLU B 2 432 ? 40.486  -12.676 -9.326  1.00 114.12 ? 432  GLU B OE1 1 
ATOM   7759 O  OE2 . GLU B 2 432 ? 40.541  -14.083 -7.636  1.00 105.97 ? 432  GLU B OE2 1 
ATOM   7760 N  N   . PRO B 2 433 ? 45.415  -15.213 -11.030 1.00 91.68  ? 433  PRO B N   1 
ATOM   7761 C  CA  . PRO B 2 433 ? 46.068  -15.661 -12.259 1.00 92.91  ? 433  PRO B CA  1 
ATOM   7762 C  C   . PRO B 2 433 ? 45.787  -14.804 -13.479 1.00 98.67  ? 433  PRO B C   1 
ATOM   7763 O  O   . PRO B 2 433 ? 44.881  -13.969 -13.495 1.00 94.63  ? 433  PRO B O   1 
ATOM   7764 C  CB  . PRO B 2 433 ? 45.521  -17.073 -12.437 1.00 82.98  ? 433  PRO B CB  1 
ATOM   7765 C  CG  . PRO B 2 433 ? 45.336  -17.530 -11.049 1.00 84.96  ? 433  PRO B CG  1 
ATOM   7766 C  CD  . PRO B 2 433 ? 44.682  -16.327 -10.410 1.00 89.03  ? 433  PRO B CD  1 
ATOM   7767 N  N   . ILE B 2 434 ? 46.619  -15.012 -14.490 1.00 110.04 ? 434  ILE B N   1 
ATOM   7768 C  CA  . ILE B 2 434 ? 46.517  -14.315 -15.759 1.00 123.51 ? 434  ILE B CA  1 
ATOM   7769 C  C   . ILE B 2 434 ? 45.193  -14.771 -16.364 1.00 129.98 ? 434  ILE B C   1 
ATOM   7770 O  O   . ILE B 2 434 ? 44.320  -13.961 -16.681 1.00 132.77 ? 434  ILE B O   1 
ATOM   7771 C  CB  . ILE B 2 434 ? 47.685  -14.736 -16.680 1.00 126.30 ? 434  ILE B CB  1 
ATOM   7772 C  CG1 . ILE B 2 434 ? 49.021  -14.472 -15.976 1.00 122.30 ? 434  ILE B CG1 1 
ATOM   7773 C  CG2 . ILE B 2 434 ? 47.606  -14.005 -18.009 1.00 130.20 ? 434  ILE B CG2 1 
ATOM   7774 C  CD1 . ILE B 2 434 ? 50.202  -15.130 -16.637 1.00 116.87 ? 434  ILE B CD1 1 
ATOM   7775 N  N   . VAL B 2 435 ? 45.074  -16.088 -16.519 1.00 134.37 ? 435  VAL B N   1 
ATOM   7776 C  CA  . VAL B 2 435 ? 43.876  -16.732 -17.050 1.00 135.94 ? 435  VAL B CA  1 
ATOM   7777 C  C   . VAL B 2 435 ? 43.298  -17.633 -15.954 1.00 136.21 ? 435  VAL B C   1 
ATOM   7778 O  O   . VAL B 2 435 ? 42.087  -17.661 -15.728 1.00 136.03 ? 435  VAL B O   1 
ATOM   7779 C  CB  . VAL B 2 435 ? 44.180  -17.588 -18.327 1.00 134.65 ? 435  VAL B CB  1 
ATOM   7780 C  CG1 . VAL B 2 435 ? 44.231  -16.704 -19.556 1.00 132.37 ? 435  VAL B CG1 1 
ATOM   7781 C  CG2 . VAL B 2 435 ? 45.502  -18.347 -18.179 1.00 134.55 ? 435  VAL B CG2 1 
ATOM   7782 N  N   . GLY B 2 436 ? 44.189  -18.337 -15.259 1.00 135.64 ? 436  GLY B N   1 
ATOM   7783 C  CA  . GLY B 2 436 ? 43.796  -19.242 -14.193 1.00 133.43 ? 436  GLY B CA  1 
ATOM   7784 C  C   . GLY B 2 436 ? 44.572  -20.535 -14.355 1.00 131.92 ? 436  GLY B C   1 
ATOM   7785 O  O   . GLY B 2 436 ? 45.435  -20.624 -15.232 1.00 133.73 ? 436  GLY B O   1 
ATOM   7786 N  N   . ALA B 2 437 ? 44.312  -21.519 -13.500 1.00 130.31 ? 437  ALA B N   1 
ATOM   7787 C  CA  . ALA B 2 437 ? 44.992  -22.814 -13.602 1.00 128.62 ? 437  ALA B CA  1 
ATOM   7788 C  C   . ALA B 2 437 ? 44.351  -23.579 -14.763 1.00 128.50 ? 437  ALA B C   1 
ATOM   7789 O  O   . ALA B 2 437 ? 43.373  -24.304 -14.578 1.00 126.38 ? 437  ALA B O   1 
ATOM   7790 C  CB  . ALA B 2 437 ? 44.856  -23.598 -12.297 1.00 124.09 ? 437  ALA B CB  1 
ATOM   7791 N  N   . GLU B 2 438 ? 44.901  -23.386 -15.961 1.00 130.83 ? 438  GLU B N   1 
ATOM   7792 C  CA  . GLU B 2 438 ? 44.398  -24.002 -17.192 1.00 132.55 ? 438  GLU B CA  1 
ATOM   7793 C  C   . GLU B 2 438 ? 44.146  -25.511 -17.177 1.00 134.88 ? 438  GLU B C   1 
ATOM   7794 O  O   . GLU B 2 438 ? 45.044  -26.308 -17.464 1.00 134.98 ? 438  GLU B O   1 
ATOM   7795 C  CB  . GLU B 2 438 ? 45.299  -23.629 -18.384 1.00 131.50 ? 438  GLU B CB  1 
ATOM   7796 C  CG  . GLU B 2 438 ? 44.733  -24.017 -19.759 1.00 132.44 ? 438  GLU B CG  1 
ATOM   7797 C  CD  . GLU B 2 438 ? 45.539  -23.472 -20.939 1.00 133.27 ? 438  GLU B CD  1 
ATOM   7798 O  OE1 . GLU B 2 438 ? 46.224  -22.436 -20.791 1.00 135.60 ? 438  GLU B OE1 1 
ATOM   7799 O  OE2 . GLU B 2 438 ? 45.471  -24.077 -22.031 1.00 132.23 ? 438  GLU B OE2 1 
ATOM   7800 N  N   . THR B 2 439 ? 42.910  -25.889 -16.866 1.00 136.69 ? 439  THR B N   1 
ATOM   7801 C  CA  . THR B 2 439 ? 42.502  -27.290 -16.849 1.00 135.77 ? 439  THR B CA  1 
ATOM   7802 C  C   . THR B 2 439 ? 41.908  -27.551 -18.247 1.00 140.57 ? 439  THR B C   1 
ATOM   7803 O  O   . THR B 2 439 ? 40.692  -27.547 -18.437 1.00 141.06 ? 439  THR B O   1 
ATOM   7804 C  CB  . THR B 2 439 ? 41.520  -27.594 -15.645 1.00 126.16 ? 439  THR B CB  1 
ATOM   7805 O  OG1 . THR B 2 439 ? 40.687  -28.724 -15.928 1.00 119.47 ? 439  THR B OG1 1 
ATOM   7806 C  CG2 . THR B 2 439 ? 40.670  -26.390 -15.295 1.00 124.05 ? 439  THR B CG2 1 
ATOM   7807 N  N   . PHE B 2 440 ? 42.822  -27.635 -19.220 1.00 144.74 ? 440  PHE B N   1 
ATOM   7808 C  CA  . PHE B 2 440 ? 42.556  -27.863 -20.652 1.00 147.12 ? 440  PHE B CA  1 
ATOM   7809 C  C   . PHE B 2 440 ? 41.303  -28.700 -20.922 1.00 149.93 ? 440  PHE B C   1 
ATOM   7810 O  O   . PHE B 2 440 ? 40.334  -28.128 -21.462 1.00 153.09 ? 440  PHE B O   1 
ATOM   7811 C  CB  . PHE B 2 440 ? 43.790  -28.534 -21.293 1.00 144.91 ? 440  PHE B CB  1 
ATOM   7812 C  CG  . PHE B 2 440 ? 43.950  -28.287 -22.782 1.00 138.49 ? 440  PHE B CG  1 
ATOM   7813 C  CD1 . PHE B 2 440 ? 42.935  -28.600 -23.683 1.00 137.49 ? 440  PHE B CD1 1 
ATOM   7814 C  CD2 . PHE B 2 440 ? 45.149  -27.781 -23.282 1.00 135.66 ? 440  PHE B CD2 1 
ATOM   7815 C  CE1 . PHE B 2 440 ? 43.114  -28.416 -25.057 1.00 137.30 ? 440  PHE B CE1 1 
ATOM   7816 C  CE2 . PHE B 2 440 ? 45.336  -27.595 -24.650 1.00 135.09 ? 440  PHE B CE2 1 
ATOM   7817 C  CZ  . PHE B 2 440 ? 44.317  -27.914 -25.539 1.00 136.26 ? 440  PHE B CZ  1 
HETATM 7818 P  P   . PO4 C 3 .   ? 3.910   -24.336 27.017  1.00 123.75 ? 1000 PO4 A P   1 
HETATM 7819 O  O1  . PO4 C 3 .   ? 2.529   -24.352 27.541  1.00 121.73 ? 1000 PO4 A O1  1 
HETATM 7820 O  O2  . PO4 C 3 .   ? 4.536   -25.673 27.134  1.00 125.48 ? 1000 PO4 A O2  1 
HETATM 7821 O  O3  . PO4 C 3 .   ? 3.929   -23.946 25.571  1.00 119.19 ? 1000 PO4 A O3  1 
HETATM 7822 O  O4  . PO4 C 3 .   ? 4.687   -23.360 27.806  1.00 127.21 ? 1000 PO4 A O4  1 
HETATM 7823 CL CL  . UC4 D 4 .   ? -4.423  -32.908 25.781  1.00 40.33  ? 999  UC4 A CL  1 
HETATM 7824 C  C1  . UC4 D 4 .   ? -2.013  -34.024 24.841  1.00 26.93  ? 999  UC4 A C1  1 
HETATM 7825 C  C2  . UC4 D 4 .   ? -3.292  -33.477 24.556  1.00 25.31  ? 999  UC4 A C2  1 
HETATM 7826 C  C3  . UC4 D 4 .   ? -3.725  -33.385 23.231  1.00 23.09  ? 999  UC4 A C3  1 
HETATM 7827 C  C4  . UC4 D 4 .   ? -2.944  -33.826 22.207  1.00 28.50  ? 999  UC4 A C4  1 
HETATM 7828 C  C5  . UC4 D 4 .   ? -1.684  -34.379 22.461  1.00 27.28  ? 999  UC4 A C5  1 
HETATM 7829 C  C6  . UC4 D 4 .   ? -1.228  -34.459 23.778  1.00 14.85  ? 999  UC4 A C6  1 
HETATM 7830 O  O7  . UC4 D 4 .   ? -0.939  -35.291 26.558  1.00 53.79  ? 999  UC4 A O7  1 
HETATM 7831 C  C7  . UC4 D 4 .   ? -1.383  -34.234 26.204  1.00 47.09  ? 999  UC4 A C7  1 
HETATM 7832 O  O8  . UC4 D 4 .   ? -1.372  -33.153 26.937  1.00 56.97  ? 999  UC4 A O8  1 
HETATM 7833 C  C8  . UC4 D 4 .   ? -0.081  -32.538 27.219  1.00 49.62  ? 999  UC4 A C8  1 
HETATM 7834 C  C9  . UC4 D 4 .   ? -0.127  -31.185 26.604  1.00 35.72  ? 999  UC4 A C9  1 
HETATM 7835 C  C10 . UC4 D 4 .   ? 0.061   -32.545 28.700  1.00 40.74  ? 999  UC4 A C10 1 
HETATM 7836 O  OA  . UC4 D 4 .   ? -0.615  -38.054 24.313  1.00 15.15  ? 999  UC4 A OA  1 
HETATM 7837 C  CB  . UC4 D 4 .   ? -0.707  -37.362 23.140  1.00 14.99  ? 999  UC4 A CB  1 
HETATM 7838 C  CC  . UC4 D 4 .   ? 0.334   -36.746 22.549  1.00 27.43  ? 999  UC4 A CC  1 
HETATM 7839 S  S   . UC4 D 4 .   ? 2.007   -37.037 23.055  1.00 58.33  ? 999  UC4 A S   1 
HETATM 7840 C  CD  . UC4 D 4 .   ? 1.754   -37.840 24.645  1.00 40.98  ? 999  UC4 A CD  1 
HETATM 7841 C  CE  . UC4 D 4 .   ? 0.581   -38.720 24.634  1.00 26.73  ? 999  UC4 A CE  1 
HETATM 7842 C  CF  . UC4 D 4 .   ? -2.083  -37.426 22.676  1.00 18.18  ? 999  UC4 A CF  1 
HETATM 7843 O  OG  . UC4 D 4 .   ? 0.998   -35.720 20.459  1.00 20.08  ? 999  UC4 A OG  1 
HETATM 7844 C  CG  . UC4 D 4 .   ? 0.189   -35.757 21.372  1.00 23.99  ? 999  UC4 A CG  1 
HETATM 7845 N  N   . UC4 D 4 .   ? -0.909  -34.894 21.383  1.00 19.97  ? 999  UC4 A N   1 
HETATM 7846 O  O   . HOH E 5 .   ? -2.498  -38.002 42.719  1.00 2.00   ? 1001 HOH A O   1 
HETATM 7847 O  O   . HOH E 5 .   ? -4.805  -38.655 36.728  1.00 2.79   ? 1002 HOH A O   1 
HETATM 7848 O  O   . HOH E 5 .   ? 5.444   -42.968 24.474  1.00 2.00   ? 1003 HOH A O   1 
HETATM 7849 O  O   . HOH E 5 .   ? 7.446   -44.336 21.966  1.00 2.00   ? 1004 HOH A O   1 
HETATM 7850 O  O   . HOH E 5 .   ? 8.713   -41.245 30.483  1.00 17.89  ? 1005 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 GLN 258 258 258 GLN GLN A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 CSD 280 280 280 CSD CSD A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 ASN 447 447 447 ASN ASN A . n 
A 1 448 ARG 448 448 448 ARG ARG A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 ARG 461 461 461 ARG ARG A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 TYR 483 483 483 TYR TYR A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 GLN 512 512 512 GLN GLN A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 LYS 540 540 ?   ?   ?   A . n 
A 1 541 GLY 541 541 ?   ?   ?   A . n 
A 1 542 ILE 542 542 ?   ?   ?   A . n 
A 1 543 GLY 543 543 ?   ?   ?   A . n 
A 1 544 GLY 544 544 ?   ?   ?   A . n 
A 1 545 ASN 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 GLN 547 547 ?   ?   ?   A . n 
A 1 548 VAL 548 548 ?   ?   ?   A . n 
A 1 549 ASP 549 549 ?   ?   ?   A . n 
A 1 550 LYS 550 550 ?   ?   ?   A . n 
A 1 551 LEU 551 551 ?   ?   ?   A . n 
A 1 552 VAL 552 552 ?   ?   ?   A . n 
A 1 553 SER 553 553 ?   ?   ?   A . n 
A 1 554 ALA 554 554 ?   ?   ?   A . n 
A 1 555 GLY 555 555 ?   ?   ?   A . n 
A 1 556 ILE 556 556 ?   ?   ?   A . n 
A 1 557 ARG 557 557 ?   ?   ?   A . n 
A 1 558 LYS 558 558 ?   ?   ?   A . n 
A 1 559 VAL 559 559 ?   ?   ?   A . n 
A 1 560 LEU 560 560 ?   ?   ?   A . n 
B 2 1   PRO 1   1   ?   ?   ?   B . n 
B 2 2   ILE 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   ?   ?   ?   B . n 
B 2 5   ILE 5   5   ?   ?   ?   B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  85  GLN GLN B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  PHE 87  87  87  PHE PHE B . n 
B 2 88  TRP 88  88  88  TRP TRP B . n 
B 2 89  GLU 89  89  ?   ?   ?   B . n 
B 2 90  VAL 90  90  ?   ?   ?   B . n 
B 2 91  GLN 91  91  ?   ?   ?   B . n 
B 2 92  LEU 92  92  ?   ?   ?   B . n 
B 2 93  GLY 93  93  93  GLY GLY B . n 
B 2 94  ILE 94  94  94  ILE ILE B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 ARG 172 172 172 ARG ARG B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 213 GLY GLY B . n 
B 2 214 LEU 214 214 214 LEU LEU B . n 
B 2 215 THR 215 215 215 THR THR B . n 
B 2 216 THR 216 216 ?   ?   ?   B . n 
B 2 217 PRO 217 217 ?   ?   ?   B . n 
B 2 218 ASP 218 218 ?   ?   ?   B . n 
B 2 219 LYS 219 219 ?   ?   ?   B . n 
B 2 220 LYS 220 220 ?   ?   ?   B . n 
B 2 221 HIS 221 221 ?   ?   ?   B . n 
B 2 222 GLN 222 222 ?   ?   ?   B . n 
B 2 223 LYS 223 223 ?   ?   ?   B . n 
B 2 224 GLU 224 224 ?   ?   ?   B . n 
B 2 225 PRO 225 225 ?   ?   ?   B . n 
B 2 226 PRO 226 226 ?   ?   ?   B . n 
B 2 227 PHE 227 227 ?   ?   ?   B . n 
B 2 228 LEU 228 228 ?   ?   ?   B . n 
B 2 229 TRP 229 229 ?   ?   ?   B . n 
B 2 230 MET 230 230 ?   ?   ?   B . n 
B 2 231 GLY 231 231 ?   ?   ?   B . n 
B 2 232 TYR 232 232 232 TYR TYR B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 CYS 280 280 280 CYS CYS B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 ARG 358 358 358 ARG ARG B . n 
B 2 359 GLY 359 359 359 GLY GLY B . n 
B 2 360 ALA 360 360 360 ALA ALA B . n 
B 2 361 HIS 361 361 361 HIS HIS B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
B 2 428 GLN 428 428 428 GLN GLN B . n 
B 2 429 LEU 429 429 429 LEU LEU B . n 
B 2 430 GLU 430 430 430 GLU GLU B . n 
B 2 431 LYS 431 431 431 LYS LYS B . n 
B 2 432 GLU 432 432 432 GLU GLU B . n 
B 2 433 PRO 433 433 433 PRO PRO B . n 
B 2 434 ILE 434 434 434 ILE ILE B . n 
B 2 435 VAL 435 435 435 VAL VAL B . n 
B 2 436 GLY 436 436 436 GLY GLY B . n 
B 2 437 ALA 437 437 437 ALA ALA B . n 
B 2 438 GLU 438 438 438 GLU GLU B . n 
B 2 439 THR 439 439 439 THR THR B . n 
B 2 440 PHE 440 440 440 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PO4 1 1000 1000 PO4 PO4 A . 
D 4 UC4 1 999  999  UC4 UC4 A . 
E 5 HOH 1 1001 1001 HOH HOH A . 
E 5 HOH 2 1002 1002 HOH HOH A . 
E 5 HOH 3 1003 1003 HOH HOH A . 
E 5 HOH 4 1004 1004 HOH HOH A . 
E 5 HOH 5 1005 1005 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    CSD 
_pdbx_struct_mod_residue.label_seq_id     280 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     CSD 
_pdbx_struct_mod_residue.auth_seq_id      280 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          3-SULFINOALANINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5850  ? 
1 MORE         -36   ? 
1 'SSA (A^2)'  47060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-29 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.1 ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A LYS 13  ? ? CA A LYS 13  ? ? C  A LYS 13  ? ? 127.56 111.00 16.56  2.70 N 
2 1 C A LYS 13  ? ? N  A PRO 14  ? ? CA A PRO 14  ? ? 151.56 127.00 24.56  2.40 Y 
3 1 C A LYS 13  ? ? N  A PRO 14  ? ? CD A PRO 14  ? ? 99.03  120.60 -21.57 2.20 Y 
4 1 N A PRO 217 ? ? CA A PRO 217 ? ? C  A PRO 217 ? ? 128.53 112.10 16.43  2.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 13  ? ? 33.90   -91.55  
2  1 PRO A 14  ? ? 18.98   120.02  
3  1 MET A 16  ? ? -99.43  -158.49 
4  1 ILE A 50  ? ? -116.23 -169.51 
5  1 ASN A 54  ? ? 177.77  116.22  
6  1 ASN A 57  ? ? -175.92 147.80  
7  1 ASP A 67  ? ? -33.44  -38.71  
8  1 THR A 69  ? ? 56.86   9.69    
9  1 ARG A 72  ? ? -116.22 -160.58 
10 1 GLN A 91  ? ? -50.69  106.23  
11 1 ASP A 113 ? ? -76.93  43.37   
12 1 GLU A 122 ? ? -30.50  -35.70  
13 1 ARG A 125 ? ? -39.76  -38.75  
14 1 ILE A 135 ? ? -58.33  104.17  
15 1 PRO A 140 ? ? -26.22  126.02  
16 1 SER A 156 ? ? -28.15  -61.97  
17 1 ASP A 177 ? ? -78.16  31.24   
18 1 MET A 184 ? ? 57.08   -131.56 
19 1 PRO A 217 ? ? -26.68  153.58  
20 1 LYS A 219 ? ? -39.81  -25.23  
21 1 TRP A 229 ? ? -113.75 75.41   
22 1 MET A 230 ? ? 40.31   90.92   
23 1 PRO A 321 ? ? -46.75  -15.08  
24 1 PRO A 345 ? ? -34.63  135.85  
25 1 ARG A 356 ? ? -60.61  94.28   
26 1 HIS A 361 ? ? 174.51  119.30  
27 1 THR A 362 ? ? -149.14 -151.88 
28 1 PRO A 412 ? ? -48.74  -166.75 
29 1 PRO A 420 ? ? -48.36  153.03  
30 1 TYR A 427 ? ? -174.82 -176.75 
31 1 GLN A 428 ? ? -161.09 113.82  
32 1 ASP A 443 ? ? -171.67 132.37  
33 1 GLN A 512 ? ? -171.74 144.51  
34 1 PRO B 9   ? ? -64.68  91.76   
35 1 PRO B 14  ? ? -39.62  119.37  
36 1 LYS B 20  ? ? -147.49 52.81   
37 1 ASN B 57  ? ? -175.23 148.86  
38 1 ASP B 67  ? ? 74.50   -11.90  
39 1 PHE B 87  ? ? -107.25 46.71   
40 1 VAL B 148 ? ? -118.76 -165.87 
41 1 GLU B 169 ? ? -26.59  -63.71  
42 1 PRO B 170 ? ? -38.89  -35.81  
43 1 MET B 184 ? ? 54.50   -115.98 
44 1 ILE B 195 ? ? -21.22  -62.04  
45 1 ARG B 211 ? ? -76.60  32.62   
46 1 TRP B 212 ? ? -145.58 -52.22  
47 1 GLU B 233 ? ? -111.08 78.73   
48 1 TRP B 239 ? ? -67.33  80.48   
49 1 PHE B 346 ? ? 77.54   -16.31  
50 1 HIS B 361 ? ? -38.39  -35.45  
51 1 GLN B 407 ? ? -147.74 -11.33  
52 1 GLU B 438 ? ? -49.93  92.90   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 1   ? A PRO 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A LYS 540 ? A LYS 540 
5  1 Y 1 A GLY 541 ? A GLY 541 
6  1 Y 1 A ILE 542 ? A ILE 542 
7  1 Y 1 A GLY 543 ? A GLY 543 
8  1 Y 1 A GLY 544 ? A GLY 544 
9  1 Y 1 A ASN 545 ? A ASN 545 
10 1 Y 1 A GLU 546 ? A GLU 546 
11 1 Y 1 A GLN 547 ? A GLN 547 
12 1 Y 1 A VAL 548 ? A VAL 548 
13 1 Y 1 A ASP 549 ? A ASP 549 
14 1 Y 1 A LYS 550 ? A LYS 550 
15 1 Y 1 A LEU 551 ? A LEU 551 
16 1 Y 1 A VAL 552 ? A VAL 552 
17 1 Y 1 A SER 553 ? A SER 553 
18 1 Y 1 A ALA 554 ? A ALA 554 
19 1 Y 1 A GLY 555 ? A GLY 555 
20 1 Y 1 A ILE 556 ? A ILE 556 
21 1 Y 1 A ARG 557 ? A ARG 557 
22 1 Y 1 A LYS 558 ? A LYS 558 
23 1 Y 1 A VAL 559 ? A VAL 559 
24 1 Y 1 A LEU 560 ? A LEU 560 
25 1 Y 1 B PRO 1   ? B PRO 1   
26 1 Y 1 B ILE 2   ? B ILE 2   
27 1 Y 1 B SER 3   ? B SER 3   
28 1 Y 1 B PRO 4   ? B PRO 4   
29 1 Y 1 B ILE 5   ? B ILE 5   
30 1 Y 1 B GLU 89  ? B GLU 89  
31 1 Y 1 B VAL 90  ? B VAL 90  
32 1 Y 1 B GLN 91  ? B GLN 91  
33 1 Y 1 B LEU 92  ? B LEU 92  
34 1 Y 1 B THR 216 ? B THR 216 
35 1 Y 1 B PRO 217 ? B PRO 217 
36 1 Y 1 B ASP 218 ? B ASP 218 
37 1 Y 1 B LYS 219 ? B LYS 219 
38 1 Y 1 B LYS 220 ? B LYS 220 
39 1 Y 1 B HIS 221 ? B HIS 221 
40 1 Y 1 B GLN 222 ? B GLN 222 
41 1 Y 1 B LYS 223 ? B LYS 223 
42 1 Y 1 B GLU 224 ? B GLU 224 
43 1 Y 1 B PRO 225 ? B PRO 225 
44 1 Y 1 B PRO 226 ? B PRO 226 
45 1 Y 1 B PHE 227 ? B PHE 227 
46 1 Y 1 B LEU 228 ? B LEU 228 
47 1 Y 1 B TRP 229 ? B TRP 229 
48 1 Y 1 B MET 230 ? B MET 230 
49 1 Y 1 B GLY 231 ? B GLY 231 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHATE ION'                                                                              PO4 
4 '1-METHYL ETHYL 1-CHLORO-5-[[(5,6DIHYDRO-2-METHYL-1,4-OXATHIIN-3-YL)CARBONYL]AMINO]BENZOATE' UC4 
5 water                                                                                        HOH 
#