data_1RTG
# 
_entry.id   1RTG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RTG         
WWPDB D_1000176217 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RTG 
_pdbx_database_status.recvd_initial_deposition_date   1995-12-21 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gohlke, U.' 1 
'Bode, W.'   2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'The C-terminal (haemopexin-like) domain structure of human gelatinase A (MMP2): structural implications for its function.' 
'FEBS Lett.' 378 126 130 1996 FEBLAL NE 0014-5793 0165 ? 8549817 '10.1016/0014-5793(95)01435-7' 
1       'A Helping Hand for Collagenases: The Haemopexin-Like Domain' Structure    3   527 ?   1995 STRUE6 UK 0969-2126 2005 ? ? ? 
2       
;Structure of Full-Length Porcine Synovial Collagenase Reveals a C-Terminal Domain Containing a Calcium-Linked, Four-Bladed Beta-Propeller
;
Structure    3   541 ?   1995 STRUE6 UK 0969-2126 2005 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gohlke, U.'       1  
primary 'Gomis-Ruth, F.X.' 2  
primary 'Crabbe, T.'       3  
primary 'Murphy, G.'       4  
primary 'Docherty, A.J.'   5  
primary 'Bode, W.'         6  
1       'Bode, W.'         7  
2       'Li, J.'           8  
2       'Brick, P.'        9  
2       
;O'Hare, M.C.
;
10 
2       'Skarzynski, T.'   11 
2       'Lloyd, L.F.'      12 
2       'Curry, V.A.'      13 
2       'Clark, I.M.'      14 
2       'Bigg, H.F.'       15 
2       'Hazleman, B.L.'   16 
2       'Cawston, T.E.'    17 
2       'al., et'          18 
# 
_cell.entry_id           1RTG 
_cell.length_a           55.780 
_cell.length_b           58.850 
_cell.length_c           93.140 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RTG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'HUMAN GELATINASE A' 23826.221 1  3.4.24.24 ? 'C-TERMINAL RESIDUES 451 - 660, HAEMOPEXIN-LIKE DOMAIN' ? 
2 non-polymer syn 'CHLORIDE ION'       35.453    1  ?         ? ?                                                       ? 
3 non-polymer syn 'CALCIUM ION'        40.078    2  ?         ? ?                                                       ? 
4 water       nat water                18.015    76 ?         ? ?                                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN MATRIX METALLOPROTEINASE-2, MMP-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEE
KAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAW
NAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEE
KAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAW
NAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   ASP n 
1 3   LEU n 
1 4   GLY n 
1 5   THR n 
1 6   GLY n 
1 7   PRO n 
1 8   THR n 
1 9   PRO n 
1 10  THR n 
1 11  LEU n 
1 12  GLY n 
1 13  PRO n 
1 14  VAL n 
1 15  THR n 
1 16  PRO n 
1 17  GLU n 
1 18  ILE n 
1 19  CYS n 
1 20  LYS n 
1 21  GLN n 
1 22  ASP n 
1 23  ILE n 
1 24  VAL n 
1 25  PHE n 
1 26  ASP n 
1 27  GLY n 
1 28  ILE n 
1 29  ALA n 
1 30  GLN n 
1 31  ILE n 
1 32  ARG n 
1 33  GLY n 
1 34  GLU n 
1 35  ILE n 
1 36  PHE n 
1 37  PHE n 
1 38  PHE n 
1 39  LYS n 
1 40  ASP n 
1 41  ARG n 
1 42  PHE n 
1 43  ILE n 
1 44  TRP n 
1 45  ARG n 
1 46  THR n 
1 47  VAL n 
1 48  THR n 
1 49  PRO n 
1 50  ARG n 
1 51  ASP n 
1 52  LYS n 
1 53  PRO n 
1 54  MET n 
1 55  GLY n 
1 56  PRO n 
1 57  LEU n 
1 58  LEU n 
1 59  VAL n 
1 60  ALA n 
1 61  THR n 
1 62  PHE n 
1 63  TRP n 
1 64  PRO n 
1 65  GLU n 
1 66  LEU n 
1 67  PRO n 
1 68  GLU n 
1 69  LYS n 
1 70  ILE n 
1 71  ASP n 
1 72  ALA n 
1 73  VAL n 
1 74  TYR n 
1 75  GLU n 
1 76  ALA n 
1 77  PRO n 
1 78  GLN n 
1 79  GLU n 
1 80  GLU n 
1 81  LYS n 
1 82  ALA n 
1 83  VAL n 
1 84  PHE n 
1 85  PHE n 
1 86  ALA n 
1 87  GLY n 
1 88  ASN n 
1 89  GLU n 
1 90  TYR n 
1 91  TRP n 
1 92  ILE n 
1 93  TYR n 
1 94  SER n 
1 95  ALA n 
1 96  SER n 
1 97  THR n 
1 98  LEU n 
1 99  GLU n 
1 100 ARG n 
1 101 GLY n 
1 102 TYR n 
1 103 PRO n 
1 104 LYS n 
1 105 PRO n 
1 106 LEU n 
1 107 THR n 
1 108 SER n 
1 109 LEU n 
1 110 GLY n 
1 111 LEU n 
1 112 PRO n 
1 113 PRO n 
1 114 ASP n 
1 115 VAL n 
1 116 GLN n 
1 117 ARG n 
1 118 VAL n 
1 119 ASP n 
1 120 ALA n 
1 121 ALA n 
1 122 PHE n 
1 123 ASN n 
1 124 TRP n 
1 125 SER n 
1 126 LYS n 
1 127 ASN n 
1 128 LYS n 
1 129 LYS n 
1 130 THR n 
1 131 TYR n 
1 132 ILE n 
1 133 PHE n 
1 134 ALA n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 PHE n 
1 139 TRP n 
1 140 ARG n 
1 141 TYR n 
1 142 ASN n 
1 143 GLU n 
1 144 VAL n 
1 145 LYS n 
1 146 LYS n 
1 147 LYS n 
1 148 MET n 
1 149 ASP n 
1 150 PRO n 
1 151 GLY n 
1 152 PHE n 
1 153 PRO n 
1 154 LYS n 
1 155 LEU n 
1 156 ILE n 
1 157 ALA n 
1 158 ASP n 
1 159 ALA n 
1 160 TRP n 
1 161 ASN n 
1 162 ALA n 
1 163 ILE n 
1 164 PRO n 
1 165 ASP n 
1 166 ASN n 
1 167 LEU n 
1 168 ASP n 
1 169 ALA n 
1 170 VAL n 
1 171 VAL n 
1 172 ASP n 
1 173 LEU n 
1 174 GLN n 
1 175 GLY n 
1 176 GLY n 
1 177 GLY n 
1 178 HIS n 
1 179 SER n 
1 180 TYR n 
1 181 PHE n 
1 182 PHE n 
1 183 LYS n 
1 184 GLY n 
1 185 ALA n 
1 186 TYR n 
1 187 TYR n 
1 188 LEU n 
1 189 LYS n 
1 190 LEU n 
1 191 GLU n 
1 192 ASN n 
1 193 GLN n 
1 194 SER n 
1 195 LEU n 
1 196 LYS n 
1 197 SER n 
1 198 VAL n 
1 199 LYS n 
1 200 PHE n 
1 201 GLY n 
1 202 SER n 
1 203 ILE n 
1 204 LYS n 
1 205 SER n 
1 206 ASP n 
1 207 TRP n 
1 208 LEU n 
1 209 GLY n 
1 210 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MMP2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08253 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKF
FGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFS
RIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTT
EDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLV
AAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLG
LPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKL
ENQSLKSVKFGSIKSDWLGC
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RTG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 210 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08253 
_struct_ref_seq.db_align_beg                  451 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  660 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       451 
_struct_ref_seq.pdbx_auth_seq_align_end       660 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1RTG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.21 
_exptl_crystal.density_percent_sol   61.63 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RTG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   9618 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1RTG 
_refine.ls_number_reflns_obs                     8574 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.179 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.179 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1642 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             73 
_refine_hist.number_atoms_total               1716 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RTG 
_struct.title                     'C-TERMINAL DOMAIN (HAEMOPEXIN-LIKE DOMAIN) OF HUMAN MATRIX METALLOPROTEINASE-2' 
_struct.pdbx_descriptor           'HUMAN GELATINASE A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RTG 
_struct_keywords.pdbx_keywords   METALLOPROTEASE 
_struct_keywords.text            'MATRIX METALLO PROTEINASE (MMP), GELATINASE, METZINCINS, METALLOPROTEASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THERE IS ONE OLIGOTRIMER PRESENT IN THE ASYMMETRIC UNIT,
I.E., ONE PROCARBOXYPEPTIDASE A MOLECULE, ONE
PRO-PROTEINASE E MOLECULE, AND ONE CHYMOTRYPSINOGEN.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 59  ? PHE A 62  ? VAL A 509 PHE A 512 1 ? 4 
HELX_P HELX_P2 2 LEU A 106 ? LEU A 109 ? LEU A 556 LEU A 559 5 ? 4 
HELX_P HELX_P3 3 ILE A 156 ? ALA A 159 ? ILE A 606 ALA A 609 1 ? 4 
HELX_P HELX_P4 4 ILE A 203 ? ASP A 206 ? ILE A 653 ASP A 656 1 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 469 A CYS 660 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc1  metalc ? ? D CA  .  CA ? ? ? 1_555 A ASP 168 O  ? ? A CA  5   A ASP 618 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc2  metalc ? ? C CA  .  CA ? ? ? 1_555 A VAL 170 O  ? ? A CA  2   A VAL 620 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc3  metalc ? ? C CA  .  CA ? ? ? 1_555 E HOH .   O  ? ? A CA  2   A HOH 33  1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc4  metalc ? ? C CA  .  CA ? ? ? 1_555 A ILE 28  O  ? ? A CA  2   A ILE 478 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc5  metalc ? ? C CA  .  CA ? ? ? 1_555 B CL  .   CL ? ? A CA  2   A CL  1   1_555 ? ? ? ? ? ? ? 3.079 ? 
metalc6  metalc ? ? C CA  .  CA ? ? ? 1_555 A VAL 73  O  ? ? A CA  2   A VAL 523 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc7  metalc ? ? C CA  .  CA ? ? ? 1_555 A ALA 121 O  ? ? A CA  2   A ALA 571 1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc8  metalc ? ? D CA  .  CA ? ? ? 1_555 A ASP 119 O  ? ? A CA  5   A ASP 569 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc9  metalc ? ? D CA  .  CA ? ? ? 1_555 E HOH .   O  ? ? A CA  5   A HOH 28  1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc10 metalc ? ? D CA  .  CA ? ? ? 1_555 A ASP 71  O  ? ? A CA  5   A ASP 521 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc11 metalc ? ? D CA  .  CA ? ? ? 1_555 A ASP 26  O  ? ? A CA  5   A ASP 476 1_555 ? ? ? ? ? ? ? 2.514 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 55  A . ? GLY 505 A PRO 56  A ? PRO 506 A 1 0.44 
2 TYR 102 A . ? TYR 552 A PRO 103 A ? PRO 553 A 1 0.12 
3 PHE 152 A . ? PHE 602 A PRO 153 A ? PRO 603 A 1 0.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 27  ? ILE A 31  ? GLY A 477 ILE A 481 
A 2 GLU A 34  ? LYS A 39  ? GLU A 484 LYS A 489 
A 3 PHE A 42  ? THR A 46  ? PHE A 492 THR A 496 
B 1 ALA A 72  ? ALA A 76  ? ALA A 522 ALA A 526 
B 2 LYS A 81  ? ALA A 86  ? LYS A 531 ALA A 536 
B 3 GLU A 89  ? TYR A 93  ? GLU A 539 TYR A 543 
C 1 ALA A 120 ? TRP A 124 ? ALA A 570 TRP A 574 
C 2 LYS A 129 ? ALA A 134 ? LYS A 579 ALA A 584 
C 3 LYS A 137 ? TYR A 141 ? LYS A 587 TYR A 591 
D 1 ALA A 169 ? ASP A 172 ? ALA A 619 ASP A 622 
D 2 HIS A 178 ? LYS A 183 ? HIS A 628 LYS A 633 
D 3 TYR A 186 ? GLU A 191 ? TYR A 636 GLU A 641 
D 4 SER A 197 ? SER A 202 ? SER A 647 SER A 652 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 27  ? O GLY A 477 N PHE A 38  ? N PHE A 488 
A 2 3 O ILE A 35  ? O ILE A 485 N THR A 46  ? N THR A 496 
B 1 2 O ALA A 72  ? O ALA A 522 N PHE A 85  ? N PHE A 535 
B 2 3 O ALA A 82  ? O ALA A 532 N TYR A 93  ? N TYR A 543 
C 1 2 O ALA A 120 ? O ALA A 570 N PHE A 133 ? N PHE A 583 
C 2 3 O THR A 130 ? O THR A 580 N TYR A 141 ? N TYR A 591 
D 1 2 O ALA A 169 ? O ALA A 619 N PHE A 182 ? N PHE A 632 
D 2 3 O SER A 179 ? O SER A 629 N LEU A 190 ? N LEU A 640 
D 3 4 O TYR A 187 ? O TYR A 637 N GLY A 201 ? N GLY A 651 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 1' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 2' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 5' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 CA  C .   ? CA  A 2   . ? 1_555 ? 
2  AC1 3 ILE A 28  ? ILE A 478 . ? 1_555 ? 
3  AC1 3 ALA A 169 ? ALA A 619 . ? 1_555 ? 
4  AC2 6 CL  B .   ? CL  A 1   . ? 1_555 ? 
5  AC2 6 HOH E .   ? HOH A 33  . ? 1_555 ? 
6  AC2 6 ILE A 28  ? ILE A 478 . ? 1_555 ? 
7  AC2 6 VAL A 73  ? VAL A 523 . ? 1_555 ? 
8  AC2 6 ALA A 121 ? ALA A 571 . ? 1_555 ? 
9  AC2 6 VAL A 170 ? VAL A 620 . ? 1_555 ? 
10 AC3 5 HOH E .   ? HOH A 28  . ? 1_555 ? 
11 AC3 5 ASP A 26  ? ASP A 476 . ? 1_555 ? 
12 AC3 5 ASP A 71  ? ASP A 521 . ? 1_555 ? 
13 AC3 5 ASP A 119 ? ASP A 569 . ? 1_555 ? 
14 AC3 5 ASP A 168 ? ASP A 618 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RTG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RTG 
_atom_sites.fract_transf_matrix[1][1]   0.017928 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016992 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010737 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 8   ? 55.342 8.946  10.246 1.00 50.09  ? 458 THR A N   1 
ATOM   2    C  CA  . THR A 1 8   ? 53.922 8.864  10.572 1.00 52.01  ? 458 THR A CA  1 
ATOM   3    C  C   . THR A 1 8   ? 52.889 9.512  9.627  1.00 46.85  ? 458 THR A C   1 
ATOM   4    O  O   . THR A 1 8   ? 51.758 9.036  9.567  1.00 48.98  ? 458 THR A O   1 
ATOM   5    C  CB  . THR A 1 8   ? 53.640 9.351  12.010 1.00 58.06  ? 458 THR A CB  1 
ATOM   6    O  OG1 . THR A 1 8   ? 54.201 10.659 12.207 1.00 63.13  ? 458 THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 8   ? 54.232 8.378  13.021 1.00 67.45  ? 458 THR A CG2 1 
ATOM   8    N  N   . PRO A 1 9   ? 53.229 10.627 8.932  1.00 39.28  ? 459 PRO A N   1 
ATOM   9    C  CA  . PRO A 1 9   ? 52.230 11.223 8.037  1.00 36.93  ? 459 PRO A CA  1 
ATOM   10   C  C   . PRO A 1 9   ? 51.744 10.162 7.055  1.00 36.38  ? 459 PRO A C   1 
ATOM   11   O  O   . PRO A 1 9   ? 52.559 9.370  6.550  1.00 36.60  ? 459 PRO A O   1 
ATOM   12   C  CB  . PRO A 1 9   ? 53.027 12.303 7.307  1.00 35.29  ? 459 PRO A CB  1 
ATOM   13   C  CG  . PRO A 1 9   ? 54.007 12.720 8.297  1.00 36.97  ? 459 PRO A CG  1 
ATOM   14   C  CD  . PRO A 1 9   ? 54.477 11.405 8.881  1.00 38.77  ? 459 PRO A CD  1 
ATOM   15   N  N   . THR A 1 10  ? 50.433 10.115 6.819  1.00 30.82  ? 460 THR A N   1 
ATOM   16   C  CA  . THR A 1 10  ? 49.863 9.135  5.901  1.00 25.28  ? 460 THR A CA  1 
ATOM   17   C  C   . THR A 1 10  ? 49.070 9.788  4.793  1.00 24.08  ? 460 THR A C   1 
ATOM   18   O  O   . THR A 1 10  ? 48.783 10.965 4.860  1.00 25.61  ? 460 THR A O   1 
ATOM   19   C  CB  . THR A 1 10  ? 48.953 8.111  6.632  1.00 28.04  ? 460 THR A CB  1 
ATOM   20   O  OG1 . THR A 1 10  ? 47.920 8.777  7.387  1.00 29.04  ? 460 THR A OG1 1 
ATOM   21   C  CG2 . THR A 1 10  ? 49.783 7.247  7.541  1.00 28.01  ? 460 THR A CG2 1 
ATOM   22   N  N   . LEU A 1 11  ? 48.754 9.020  3.755  1.00 25.04  ? 461 LEU A N   1 
ATOM   23   C  CA  . LEU A 1 11  ? 47.961 9.518  2.638  1.00 25.74  ? 461 LEU A CA  1 
ATOM   24   C  C   . LEU A 1 11  ? 46.475 9.317  2.961  1.00 24.76  ? 461 LEU A C   1 
ATOM   25   O  O   . LEU A 1 11  ? 46.133 8.418  3.721  1.00 27.50  ? 461 LEU A O   1 
ATOM   26   C  CB  . LEU A 1 11  ? 48.318 8.756  1.355  1.00 26.56  ? 461 LEU A CB  1 
ATOM   27   C  CG  . LEU A 1 11  ? 49.532 9.182  0.524  1.00 25.13  ? 461 LEU A CG  1 
ATOM   28   C  CD1 . LEU A 1 11  ? 50.164 10.443 1.093  1.00 25.52  ? 461 LEU A CD1 1 
ATOM   29   C  CD2 . LEU A 1 11  ? 50.531 8.047  0.459  1.00 22.47  ? 461 LEU A CD2 1 
ATOM   30   N  N   . GLY A 1 12  ? 45.601 10.150 2.397  1.00 24.33  ? 462 GLY A N   1 
ATOM   31   C  CA  . GLY A 1 12  ? 44.173 10.007 2.640  1.00 22.98  ? 462 GLY A CA  1 
ATOM   32   C  C   . GLY A 1 12  ? 43.672 8.622  2.241  1.00 24.18  ? 462 GLY A C   1 
ATOM   33   O  O   . GLY A 1 12  ? 44.422 7.827  1.719  1.00 30.64  ? 462 GLY A O   1 
ATOM   34   N  N   . PRO A 1 13  ? 42.401 8.303  2.471  1.00 25.41  ? 463 PRO A N   1 
ATOM   35   C  CA  . PRO A 1 13  ? 41.826 7.002  2.128  1.00 25.92  ? 463 PRO A CA  1 
ATOM   36   C  C   . PRO A 1 13  ? 41.444 6.854  0.660  1.00 30.13  ? 463 PRO A C   1 
ATOM   37   O  O   . PRO A 1 13  ? 41.314 7.846  -0.074 1.00 34.95  ? 463 PRO A O   1 
ATOM   38   C  CB  . PRO A 1 13  ? 40.542 6.978  2.957  1.00 28.08  ? 463 PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 13  ? 40.711 8.066  3.974  1.00 31.15  ? 463 PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 13  ? 41.431 9.112  3.214  1.00 27.48  ? 463 PRO A CD  1 
ATOM   41   N  N   . VAL A 1 14  ? 41.173 5.614  0.264  1.00 28.75  ? 464 VAL A N   1 
ATOM   42   C  CA  . VAL A 1 14  ? 40.727 5.322  -1.090 1.00 26.24  ? 464 VAL A CA  1 
ATOM   43   C  C   . VAL A 1 14  ? 39.199 5.356  -1.064 1.00 25.32  ? 464 VAL A C   1 
ATOM   44   O  O   . VAL A 1 14  ? 38.590 5.224  0.003  1.00 25.40  ? 464 VAL A O   1 
ATOM   45   C  CB  . VAL A 1 14  ? 41.208 3.931  -1.587 1.00 25.80  ? 464 VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 14  ? 42.707 3.894  -1.631 1.00 33.64  ? 464 VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 14  ? 40.712 2.833  -0.689 1.00 28.53  ? 464 VAL A CG2 1 
ATOM   48   N  N   . THR A 1 15  ? 38.591 5.560  -2.229 1.00 23.27  ? 465 THR A N   1 
ATOM   49   C  CA  . THR A 1 15  ? 37.140 5.604  -2.357 1.00 21.13  ? 465 THR A CA  1 
ATOM   50   C  C   . THR A 1 15  ? 36.555 4.227  -2.005 1.00 24.15  ? 465 THR A C   1 
ATOM   51   O  O   . THR A 1 15  ? 36.999 3.209  -2.542 1.00 27.72  ? 465 THR A O   1 
ATOM   52   C  CB  . THR A 1 15  ? 36.742 6.005  -3.803 1.00 11.46  ? 465 THR A CB  1 
ATOM   53   O  OG1 . THR A 1 15  ? 37.323 7.270  -4.107 1.00 18.97  ? 465 THR A OG1 1 
ATOM   54   C  CG2 . THR A 1 15  ? 35.248 6.143  -3.948 1.00 11.80  ? 465 THR A CG2 1 
ATOM   55   N  N   . PRO A 1 16  ? 35.594 4.180  -1.057 1.00 24.96  ? 466 PRO A N   1 
ATOM   56   C  CA  . PRO A 1 16  ? 34.917 2.960  -0.589 1.00 22.30  ? 466 PRO A CA  1 
ATOM   57   C  C   . PRO A 1 16  ? 33.773 2.489  -1.484 1.00 23.10  ? 466 PRO A C   1 
ATOM   58   O  O   . PRO A 1 16  ? 33.114 3.301  -2.137 1.00 25.66  ? 466 PRO A O   1 
ATOM   59   C  CB  . PRO A 1 16  ? 34.359 3.381  0.774  1.00 25.26  ? 466 PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 16  ? 35.130 4.647  1.131  1.00 28.80  ? 466 PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 16  ? 35.261 5.319  -0.185 1.00 24.38  ? 466 PRO A CD  1 
ATOM   62   N  N   . GLU A 1 17  ? 33.541 1.177  -1.496 1.00 23.09  ? 467 GLU A N   1 
ATOM   63   C  CA  . GLU A 1 17  ? 32.458 0.553  -2.260 1.00 26.17  ? 467 GLU A CA  1 
ATOM   64   C  C   . GLU A 1 17  ? 31.415 0.145  -1.236 1.00 24.98  ? 467 GLU A C   1 
ATOM   65   O  O   . GLU A 1 17  ? 31.589 -0.858 -0.559 1.00 21.57  ? 467 GLU A O   1 
ATOM   66   C  CB  . GLU A 1 17  ? 32.953 -0.698 -2.970 1.00 35.01  ? 467 GLU A CB  1 
ATOM   67   C  CG  . GLU A 1 17  ? 33.439 -0.484 -4.380 1.00 49.59  ? 467 GLU A CG  1 
ATOM   68   C  CD  . GLU A 1 17  ? 33.472 -1.790 -5.161 1.00 60.20  ? 467 GLU A CD  1 
ATOM   69   O  OE1 . GLU A 1 17  ? 34.247 -2.696 -4.780 1.00 68.12  ? 467 GLU A OE1 1 
ATOM   70   O  OE2 . GLU A 1 17  ? 32.704 -1.924 -6.141 1.00 63.49  ? 467 GLU A OE2 1 
ATOM   71   N  N   . ILE A 1 18  ? 30.294 0.861  -1.204 1.00 28.37  ? 468 ILE A N   1 
ATOM   72   C  CA  . ILE A 1 18  ? 29.251 0.638  -0.201 1.00 33.77  ? 468 ILE A CA  1 
ATOM   73   C  C   . ILE A 1 18  ? 28.776 -0.749 0.149  1.00 38.30  ? 468 ILE A C   1 
ATOM   74   O  O   . ILE A 1 18  ? 28.613 -1.058 1.352  1.00 45.46  ? 468 ILE A O   1 
ATOM   75   C  CB  . ILE A 1 18  ? 27.990 1.532  -0.380 1.00 31.53  ? 468 ILE A CB  1 
ATOM   76   C  CG1 . ILE A 1 18  ? 27.501 1.511  -1.820 1.00 32.81  ? 468 ILE A CG1 1 
ATOM   77   C  CG2 . ILE A 1 18  ? 28.253 2.938  0.135  1.00 35.28  ? 468 ILE A CG2 1 
ATOM   78   C  CD1 . ILE A 1 18  ? 26.227 2.270  -2.020 1.00 35.03  ? 468 ILE A CD1 1 
ATOM   79   N  N   . CYS A 1 19  ? 28.540 -1.587 -0.850 1.00 30.67  ? 469 CYS A N   1 
ATOM   80   C  CA  . CYS A 1 19  ? 28.044 -2.911 -0.530 1.00 27.81  ? 469 CYS A CA  1 
ATOM   81   C  C   . CYS A 1 19  ? 29.095 -3.996 -0.464 1.00 30.73  ? 469 CYS A C   1 
ATOM   82   O  O   . CYS A 1 19  ? 28.918 -4.979 0.245  1.00 27.30  ? 469 CYS A O   1 
ATOM   83   C  CB  . CYS A 1 19  ? 26.920 -3.286 -1.480 1.00 25.26  ? 469 CYS A CB  1 
ATOM   84   S  SG  . CYS A 1 19  ? 25.419 -2.301 -1.196 1.00 23.18  ? 469 CYS A SG  1 
ATOM   85   N  N   . LYS A 1 20  ? 30.199 -3.795 -1.185 1.00 38.11  ? 470 LYS A N   1 
ATOM   86   C  CA  . LYS A 1 20  ? 31.296 -4.767 -1.239 1.00 40.60  ? 470 LYS A CA  1 
ATOM   87   C  C   . LYS A 1 20  ? 32.073 -4.818 0.059  1.00 41.39  ? 470 LYS A C   1 
ATOM   88   O  O   . LYS A 1 20  ? 32.528 -5.886 0.474  1.00 42.29  ? 470 LYS A O   1 
ATOM   89   C  CB  . LYS A 1 20  ? 32.265 -4.464 -2.397 1.00 45.84  ? 470 LYS A CB  1 
ATOM   90   C  CG  . LYS A 1 20  ? 31.763 -4.848 -3.790 1.00 51.93  ? 470 LYS A CG  1 
ATOM   91   C  CD  . LYS A 1 20  ? 30.638 -3.926 -4.251 1.00 63.96  ? 470 LYS A CD  1 
ATOM   92   C  CE  . LYS A 1 20  ? 29.998 -4.375 -5.566 1.00 70.90  ? 470 LYS A CE  1 
ATOM   93   N  NZ  . LYS A 1 20  ? 30.918 -4.279 -6.738 1.00 77.57  ? 470 LYS A NZ  1 
ATOM   94   N  N   . GLN A 1 21  ? 32.238 -3.660 0.690  1.00 41.77  ? 471 GLN A N   1 
ATOM   95   C  CA  . GLN A 1 21  ? 32.976 -3.582 1.941  1.00 40.60  ? 471 GLN A CA  1 
ATOM   96   C  C   . GLN A 1 21  ? 32.137 -3.087 3.104  1.00 34.68  ? 471 GLN A C   1 
ATOM   97   O  O   . GLN A 1 21  ? 31.088 -2.503 2.907  1.00 35.42  ? 471 GLN A O   1 
ATOM   98   C  CB  . GLN A 1 21  ? 34.238 -2.730 1.766  1.00 44.47  ? 471 GLN A CB  1 
ATOM   99   C  CG  . GLN A 1 21  ? 34.030 -1.464 0.967  1.00 51.96  ? 471 GLN A CG  1 
ATOM   100  C  CD  . GLN A 1 21  ? 35.332 -0.875 0.470  1.00 56.47  ? 471 GLN A CD  1 
ATOM   101  O  OE1 . GLN A 1 21  ? 35.738 -1.111 -0.665 1.00 59.04  ? 471 GLN A OE1 1 
ATOM   102  N  NE2 . GLN A 1 21  ? 35.990 -0.093 1.316  1.00 59.38  ? 471 GLN A NE2 1 
ATOM   103  N  N   . ASP A 1 22  ? 32.607 -3.370 4.315  1.00 34.57  ? 472 ASP A N   1 
ATOM   104  C  CA  . ASP A 1 22  ? 31.931 -2.978 5.545  1.00 33.63  ? 472 ASP A CA  1 
ATOM   105  C  C   . ASP A 1 22  ? 32.325 -1.548 5.844  1.00 31.45  ? 472 ASP A C   1 
ATOM   106  O  O   . ASP A 1 22  ? 33.491 -1.255 6.107  1.00 34.54  ? 472 ASP A O   1 
ATOM   107  C  CB  . ASP A 1 22  ? 32.379 -3.852 6.712  1.00 40.16  ? 472 ASP A CB  1 
ATOM   108  C  CG  . ASP A 1 22  ? 32.541 -5.304 6.326  1.00 48.38  ? 472 ASP A CG  1 
ATOM   109  O  OD1 . ASP A 1 22  ? 31.711 -5.819 5.539  1.00 55.96  ? 472 ASP A OD1 1 
ATOM   110  O  OD2 . ASP A 1 22  ? 33.511 -5.931 6.812  1.00 55.47  ? 472 ASP A OD2 1 
ATOM   111  N  N   . ILE A 1 23  ? 31.356 -0.654 5.787  1.00 25.60  ? 473 ILE A N   1 
ATOM   112  C  CA  . ILE A 1 23  ? 31.634 0.730  6.041  1.00 21.83  ? 473 ILE A CA  1 
ATOM   113  C  C   . ILE A 1 23  ? 30.828 1.161  7.253  1.00 24.33  ? 473 ILE A C   1 
ATOM   114  O  O   . ILE A 1 23  ? 29.648 0.785  7.383  1.00 25.16  ? 473 ILE A O   1 
ATOM   115  C  CB  . ILE A 1 23  ? 31.245 1.609  4.824  1.00 19.22  ? 473 ILE A CB  1 
ATOM   116  C  CG1 . ILE A 1 23  ? 31.910 1.092  3.550  1.00 19.26  ? 473 ILE A CG1 1 
ATOM   117  C  CG2 . ILE A 1 23  ? 31.686 3.047  5.044  1.00 24.03  ? 473 ILE A CG2 1 
ATOM   118  C  CD1 . ILE A 1 23  ? 31.463 1.826  2.331  1.00 16.46  ? 473 ILE A CD1 1 
ATOM   119  N  N   . VAL A 1 24  ? 31.509 1.825  8.189  1.00 17.83  ? 474 VAL A N   1 
ATOM   120  C  CA  . VAL A 1 24  ? 30.878 2.390  9.373  1.00 15.67  ? 474 VAL A CA  1 
ATOM   121  C  C   . VAL A 1 24  ? 30.919 3.865  9.011  1.00 14.10  ? 474 VAL A C   1 
ATOM   122  O  O   . VAL A 1 24  ? 31.993 4.439  8.868  1.00 13.78  ? 474 VAL A O   1 
ATOM   123  C  CB  . VAL A 1 24  ? 31.715 2.155  10.642 1.00 16.80  ? 474 VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 24  ? 31.111 2.894  11.799 1.00 11.98  ? 474 VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 24  ? 31.755 0.687  10.964 1.00 11.26  ? 474 VAL A CG2 1 
ATOM   126  N  N   . PHE A 1 25  ? 29.752 4.456  8.801  1.00 16.23  ? 475 PHE A N   1 
ATOM   127  C  CA  . PHE A 1 25  ? 29.675 5.857  8.393  1.00 14.90  ? 475 PHE A CA  1 
ATOM   128  C  C   . PHE A 1 25  ? 29.957 6.825  9.540  1.00 14.83  ? 475 PHE A C   1 
ATOM   129  O  O   . PHE A 1 25  ? 29.762 6.482  10.719 1.00 11.71  ? 475 PHE A O   1 
ATOM   130  C  CB  . PHE A 1 25  ? 28.306 6.151  7.739  1.00 10.26  ? 475 PHE A CB  1 
ATOM   131  C  CG  . PHE A 1 25  ? 28.042 5.352  6.479  1.00 11.85  ? 475 PHE A CG  1 
ATOM   132  C  CD1 . PHE A 1 25  ? 28.713 5.645  5.293  1.00 10.17  ? 475 PHE A CD1 1 
ATOM   133  C  CD2 . PHE A 1 25  ? 27.121 4.306  6.476  1.00 12.12  ? 475 PHE A CD2 1 
ATOM   134  C  CE1 . PHE A 1 25  ? 28.471 4.907  4.122  1.00 7.78   ? 475 PHE A CE1 1 
ATOM   135  C  CE2 . PHE A 1 25  ? 26.875 3.564  5.308  1.00 8.92   ? 475 PHE A CE2 1 
ATOM   136  C  CZ  . PHE A 1 25  ? 27.555 3.870  4.131  1.00 6.94   ? 475 PHE A CZ  1 
ATOM   137  N  N   . ASP A 1 26  ? 30.425 8.026  9.190  1.00 9.15   ? 476 ASP A N   1 
ATOM   138  C  CA  . ASP A 1 26  ? 30.733 9.058  10.175 1.00 5.37   ? 476 ASP A CA  1 
ATOM   139  C  C   . ASP A 1 26  ? 29.463 9.791  10.629 1.00 8.45   ? 476 ASP A C   1 
ATOM   140  O  O   . ASP A 1 26  ? 29.397 10.323 11.742 1.00 18.59  ? 476 ASP A O   1 
ATOM   141  C  CB  . ASP A 1 26  ? 31.712 10.066 9.586  1.00 4.67   ? 476 ASP A CB  1 
ATOM   142  C  CG  . ASP A 1 26  ? 33.033 9.444  9.205  1.00 11.15  ? 476 ASP A CG  1 
ATOM   143  O  OD1 . ASP A 1 26  ? 33.509 8.553  9.930  1.00 12.69  ? 476 ASP A OD1 1 
ATOM   144  O  OD2 . ASP A 1 26  ? 33.610 9.861  8.182  1.00 10.03  ? 476 ASP A OD2 1 
ATOM   145  N  N   . GLY A 1 27  ? 28.454 9.813  9.770  1.00 7.98   ? 477 GLY A N   1 
ATOM   146  C  CA  . GLY A 1 27  ? 27.206 10.475 10.084 1.00 8.27   ? 477 GLY A CA  1 
ATOM   147  C  C   . GLY A 1 27  ? 26.156 10.092 9.061  1.00 9.61   ? 477 GLY A C   1 
ATOM   148  O  O   . GLY A 1 27  ? 26.494 9.665  7.946  1.00 12.29  ? 477 GLY A O   1 
ATOM   149  N  N   . ILE A 1 28  ? 24.892 10.151 9.471  1.00 6.38   ? 478 ILE A N   1 
ATOM   150  C  CA  . ILE A 1 28  ? 23.759 9.844  8.605  1.00 4.13   ? 478 ILE A CA  1 
ATOM   151  C  C   . ILE A 1 28  ? 22.700 10.868 8.965  1.00 5.86   ? 478 ILE A C   1 
ATOM   152  O  O   . ILE A 1 28  ? 22.505 11.185 10.155 1.00 4.23   ? 478 ILE A O   1 
ATOM   153  C  CB  . ILE A 1 28  ? 23.195 8.427  8.843  1.00 7.29   ? 478 ILE A CB  1 
ATOM   154  C  CG1 . ILE A 1 28  ? 24.256 7.361  8.566  1.00 2.00   ? 478 ILE A CG1 1 
ATOM   155  C  CG2 . ILE A 1 28  ? 22.015 8.184  7.932  1.00 4.32   ? 478 ILE A CG2 1 
ATOM   156  C  CD1 . ILE A 1 28  ? 23.744 5.952  8.768  1.00 4.38   ? 478 ILE A CD1 1 
ATOM   157  N  N   . ALA A 1 29  ? 22.051 11.431 7.949  1.00 13.64  ? 479 ALA A N   1 
ATOM   158  C  CA  . ALA A 1 29  ? 21.026 12.455 8.161  1.00 8.13   ? 479 ALA A CA  1 
ATOM   159  C  C   . ALA A 1 29  ? 20.164 12.699 6.942  1.00 9.51   ? 479 ALA A C   1 
ATOM   160  O  O   . ALA A 1 29  ? 20.598 12.464 5.816  1.00 10.33  ? 479 ALA A O   1 
ATOM   161  C  CB  . ALA A 1 29  ? 21.676 13.754 8.560  1.00 3.56   ? 479 ALA A CB  1 
ATOM   162  N  N   . GLN A 1 30  ? 18.929 13.142 7.190  1.00 13.78  ? 480 GLN A N   1 
ATOM   163  C  CA  . GLN A 1 30  ? 17.983 13.497 6.136  1.00 15.74  ? 480 GLN A CA  1 
ATOM   164  C  C   . GLN A 1 30  ? 18.003 15.023 5.983  1.00 15.14  ? 480 GLN A C   1 
ATOM   165  O  O   . GLN A 1 30  ? 17.555 15.771 6.870  1.00 11.59  ? 480 GLN A O   1 
ATOM   166  C  CB  . GLN A 1 30  ? 16.565 13.019 6.456  1.00 18.40  ? 480 GLN A CB  1 
ATOM   167  C  CG  . GLN A 1 30  ? 15.537 13.447 5.406  1.00 19.21  ? 480 GLN A CG  1 
ATOM   168  C  CD  . GLN A 1 30  ? 14.268 12.632 5.473  1.00 21.85  ? 480 GLN A CD  1 
ATOM   169  O  OE1 . GLN A 1 30  ? 13.531 12.705 6.445  1.00 22.39  ? 480 GLN A OE1 1 
ATOM   170  N  NE2 . GLN A 1 30  ? 13.999 11.863 4.427  1.00 21.99  ? 480 GLN A NE2 1 
ATOM   171  N  N   . ILE A 1 31  ? 18.547 15.470 4.858  1.00 15.61  ? 481 ILE A N   1 
ATOM   172  C  CA  . ILE A 1 31  ? 18.672 16.893 4.549  1.00 15.98  ? 481 ILE A CA  1 
ATOM   173  C  C   . ILE A 1 31  ? 17.796 17.257 3.340  1.00 16.57  ? 481 ILE A C   1 
ATOM   174  O  O   . ILE A 1 31  ? 17.989 16.734 2.232  1.00 19.76  ? 481 ILE A O   1 
ATOM   175  C  CB  . ILE A 1 31  ? 20.152 17.246 4.318  1.00 7.71   ? 481 ILE A CB  1 
ATOM   176  C  CG1 . ILE A 1 31  ? 20.888 17.177 5.661  1.00 4.98   ? 481 ILE A CG1 1 
ATOM   177  C  CG2 . ILE A 1 31  ? 20.284 18.614 3.701  1.00 8.86   ? 481 ILE A CG2 1 
ATOM   178  C  CD1 . ILE A 1 31  ? 22.245 16.602 5.568  1.00 8.76   ? 481 ILE A CD1 1 
ATOM   179  N  N   . ARG A 1 32  ? 16.770 18.071 3.591  1.00 15.71  ? 482 ARG A N   1 
ATOM   180  C  CA  . ARG A 1 32  ? 15.829 18.493 2.554  1.00 20.18  ? 482 ARG A CA  1 
ATOM   181  C  C   . ARG A 1 32  ? 15.287 17.341 1.703  1.00 22.51  ? 482 ARG A C   1 
ATOM   182  O  O   . ARG A 1 32  ? 15.429 17.337 0.481  1.00 28.35  ? 482 ARG A O   1 
ATOM   183  C  CB  . ARG A 1 32  ? 16.452 19.575 1.674  1.00 16.58  ? 482 ARG A CB  1 
ATOM   184  C  CG  . ARG A 1 32  ? 16.584 20.882 2.404  1.00 25.03  ? 482 ARG A CG  1 
ATOM   185  C  CD  . ARG A 1 32  ? 17.788 21.639 1.939  1.00 35.94  ? 482 ARG A CD  1 
ATOM   186  N  NE  . ARG A 1 32  ? 17.484 22.493 0.800  1.00 47.10  ? 482 ARG A NE  1 
ATOM   187  C  CZ  . ARG A 1 32  ? 17.944 23.731 0.648  1.00 48.91  ? 482 ARG A CZ  1 
ATOM   188  N  NH1 . ARG A 1 32  ? 18.729 24.267 1.572  1.00 52.12  ? 482 ARG A NH1 1 
ATOM   189  N  NH2 . ARG A 1 32  ? 17.629 24.428 -0.437 1.00 52.57  ? 482 ARG A NH2 1 
ATOM   190  N  N   . GLY A 1 33  ? 14.685 16.359 2.369  1.00 21.86  ? 483 GLY A N   1 
ATOM   191  C  CA  . GLY A 1 33  ? 14.110 15.220 1.677  1.00 22.15  ? 483 GLY A CA  1 
ATOM   192  C  C   . GLY A 1 33  ? 15.001 13.998 1.556  1.00 27.31  ? 483 GLY A C   1 
ATOM   193  O  O   . GLY A 1 33  ? 14.568 12.875 1.835  1.00 28.54  ? 483 GLY A O   1 
ATOM   194  N  N   . GLU A 1 34  ? 16.268 14.222 1.227  1.00 27.90  ? 484 GLU A N   1 
ATOM   195  C  CA  . GLU A 1 34  ? 17.225 13.132 1.022  1.00 25.47  ? 484 GLU A CA  1 
ATOM   196  C  C   . GLU A 1 34  ? 17.998 12.643 2.231  1.00 18.94  ? 484 GLU A C   1 
ATOM   197  O  O   . GLU A 1 34  ? 18.331 13.408 3.122  1.00 18.42  ? 484 GLU A O   1 
ATOM   198  C  CB  . GLU A 1 34  ? 18.228 13.538 -0.058 1.00 29.64  ? 484 GLU A CB  1 
ATOM   199  C  CG  . GLU A 1 34  ? 17.572 14.113 -1.284 1.00 26.46  ? 484 GLU A CG  1 
ATOM   200  C  CD  . GLU A 1 34  ? 18.562 14.582 -2.297 1.00 24.81  ? 484 GLU A CD  1 
ATOM   201  O  OE1 . GLU A 1 34  ? 19.345 15.499 -1.984 1.00 19.65  ? 484 GLU A OE1 1 
ATOM   202  O  OE2 . GLU A 1 34  ? 18.543 14.035 -3.416 1.00 33.31  ? 484 GLU A OE2 1 
ATOM   203  N  N   . ILE A 1 35  ? 18.337 11.363 2.205  1.00 15.44  ? 485 ILE A N   1 
ATOM   204  C  CA  . ILE A 1 35  ? 19.102 10.754 3.271  1.00 14.82  ? 485 ILE A CA  1 
ATOM   205  C  C   . ILE A 1 35  ? 20.542 10.738 2.778  1.00 14.76  ? 485 ILE A C   1 
ATOM   206  O  O   . ILE A 1 35  ? 20.805 10.234 1.689  1.00 15.02  ? 485 ILE A O   1 
ATOM   207  C  CB  . ILE A 1 35  ? 18.645 9.301  3.521  1.00 16.73  ? 485 ILE A CB  1 
ATOM   208  C  CG1 . ILE A 1 35  ? 17.152 9.259  3.901  1.00 19.77  ? 485 ILE A CG1 1 
ATOM   209  C  CG2 . ILE A 1 35  ? 19.497 8.662  4.613  1.00 15.73  ? 485 ILE A CG2 1 
ATOM   210  C  CD1 . ILE A 1 35  ? 16.553 7.845  3.914  1.00 9.13   ? 485 ILE A CD1 1 
ATOM   211  N  N   . PHE A 1 36  ? 21.447 11.335 3.550  1.00 12.98  ? 486 PHE A N   1 
ATOM   212  C  CA  . PHE A 1 36  ? 22.871 11.389 3.216  1.00 9.96   ? 486 PHE A CA  1 
ATOM   213  C  C   . PHE A 1 36  ? 23.718 10.504 4.158  1.00 11.88  ? 486 PHE A C   1 
ATOM   214  O  O   . PHE A 1 36  ? 23.491 10.495 5.377  1.00 13.65  ? 486 PHE A O   1 
ATOM   215  C  CB  . PHE A 1 36  ? 23.378 12.830 3.319  1.00 10.23  ? 486 PHE A CB  1 
ATOM   216  C  CG  . PHE A 1 36  ? 22.892 13.731 2.231  1.00 11.93  ? 486 PHE A CG  1 
ATOM   217  C  CD1 . PHE A 1 36  ? 21.563 14.105 2.150  1.00 13.85  ? 486 PHE A CD1 1 
ATOM   218  C  CD2 . PHE A 1 36  ? 23.778 14.233 1.293  1.00 13.67  ? 486 PHE A CD2 1 
ATOM   219  C  CE1 . PHE A 1 36  ? 21.129 14.976 1.143  1.00 11.70  ? 486 PHE A CE1 1 
ATOM   220  C  CE2 . PHE A 1 36  ? 23.359 15.101 0.285  1.00 14.71  ? 486 PHE A CE2 1 
ATOM   221  C  CZ  . PHE A 1 36  ? 22.037 15.471 0.212  1.00 15.86  ? 486 PHE A CZ  1 
ATOM   222  N  N   . PHE A 1 37  ? 24.657 9.745  3.582  1.00 9.44   ? 487 PHE A N   1 
ATOM   223  C  CA  . PHE A 1 37  ? 25.572 8.872  4.328  1.00 6.64   ? 487 PHE A CA  1 
ATOM   224  C  C   . PHE A 1 37  ? 26.958 9.491  4.150  1.00 10.55  ? 487 PHE A C   1 
ATOM   225  O  O   . PHE A 1 37  ? 27.402 9.676  3.018  1.00 12.27  ? 487 PHE A O   1 
ATOM   226  C  CB  . PHE A 1 37  ? 25.591 7.454  3.736  1.00 8.50   ? 487 PHE A CB  1 
ATOM   227  C  CG  . PHE A 1 37  ? 24.264 6.723  3.825  1.00 14.43  ? 487 PHE A CG  1 
ATOM   228  C  CD1 . PHE A 1 37  ? 23.313 6.847  2.817  1.00 12.65  ? 487 PHE A CD1 1 
ATOM   229  C  CD2 . PHE A 1 37  ? 23.964 5.917  4.930  1.00 16.40  ? 487 PHE A CD2 1 
ATOM   230  C  CE1 . PHE A 1 37  ? 22.075 6.186  2.903  1.00 12.11  ? 487 PHE A CE1 1 
ATOM   231  C  CE2 . PHE A 1 37  ? 22.737 5.253  5.029  1.00 14.16  ? 487 PHE A CE2 1 
ATOM   232  C  CZ  . PHE A 1 37  ? 21.790 5.391  4.013  1.00 14.00  ? 487 PHE A CZ  1 
ATOM   233  N  N   . PHE A 1 38  ? 27.623 9.854  5.248  1.00 11.75  ? 488 PHE A N   1 
ATOM   234  C  CA  . PHE A 1 38  ? 28.951 10.464 5.159  1.00 5.81   ? 488 PHE A CA  1 
ATOM   235  C  C   . PHE A 1 38  ? 30.058 9.489  5.565  1.00 8.20   ? 488 PHE A C   1 
ATOM   236  O  O   . PHE A 1 38  ? 29.929 8.745  6.549  1.00 7.27   ? 488 PHE A O   1 
ATOM   237  C  CB  . PHE A 1 38  ? 29.051 11.731 6.034  1.00 2.00   ? 488 PHE A CB  1 
ATOM   238  C  CG  . PHE A 1 38  ? 28.065 12.826 5.672  1.00 4.01   ? 488 PHE A CG  1 
ATOM   239  C  CD1 . PHE A 1 38  ? 26.700 12.687 5.953  1.00 8.98   ? 488 PHE A CD1 1 
ATOM   240  C  CD2 . PHE A 1 38  ? 28.501 14.008 5.082  1.00 2.44   ? 488 PHE A CD2 1 
ATOM   241  C  CE1 . PHE A 1 38  ? 25.790 13.713 5.650  1.00 8.98   ? 488 PHE A CE1 1 
ATOM   242  C  CE2 . PHE A 1 38  ? 27.606 15.035 4.775  1.00 2.00   ? 488 PHE A CE2 1 
ATOM   243  C  CZ  . PHE A 1 38  ? 26.244 14.883 5.063  1.00 5.75   ? 488 PHE A CZ  1 
ATOM   244  N  N   . LYS A 1 39  ? 31.151 9.516  4.811  1.00 7.05   ? 489 LYS A N   1 
ATOM   245  C  CA  . LYS A 1 39  ? 32.318 8.690  5.077  1.00 6.02   ? 489 LYS A CA  1 
ATOM   246  C  C   . LYS A 1 39  ? 33.502 9.450  4.509  1.00 12.21  ? 489 LYS A C   1 
ATOM   247  O  O   . LYS A 1 39  ? 33.643 9.530  3.290  1.00 19.10  ? 489 LYS A O   1 
ATOM   248  C  CB  . LYS A 1 39  ? 32.193 7.353  4.365  1.00 9.61   ? 489 LYS A CB  1 
ATOM   249  C  CG  . LYS A 1 39  ? 33.259 6.376  4.739  1.00 3.76   ? 489 LYS A CG  1 
ATOM   250  C  CD  . LYS A 1 39  ? 33.342 6.267  6.218  1.00 8.04   ? 489 LYS A CD  1 
ATOM   251  C  CE  . LYS A 1 39  ? 34.492 5.380  6.624  1.00 15.81  ? 489 LYS A CE  1 
ATOM   252  N  NZ  . LYS A 1 39  ? 34.644 5.355  8.112  1.00 15.74  ? 489 LYS A NZ  1 
ATOM   253  N  N   . ASP A 1 40  ? 34.307 10.058 5.383  1.00 12.08  ? 490 ASP A N   1 
ATOM   254  C  CA  . ASP A 1 40  ? 35.485 10.830 4.981  1.00 9.16   ? 490 ASP A CA  1 
ATOM   255  C  C   . ASP A 1 40  ? 35.028 12.007 4.140  1.00 8.98   ? 490 ASP A C   1 
ATOM   256  O  O   . ASP A 1 40  ? 34.109 12.719 4.527  1.00 15.43  ? 490 ASP A O   1 
ATOM   257  C  CB  . ASP A 1 40  ? 36.445 9.953  4.181  1.00 15.93  ? 490 ASP A CB  1 
ATOM   258  C  CG  . ASP A 1 40  ? 36.955 8.774  4.974  1.00 23.70  ? 490 ASP A CG  1 
ATOM   259  O  OD1 . ASP A 1 40  ? 37.233 8.958  6.181  1.00 26.03  ? 490 ASP A OD1 1 
ATOM   260  O  OD2 . ASP A 1 40  ? 37.094 7.670  4.389  1.00 29.89  ? 490 ASP A OD2 1 
ATOM   261  N  N   . ARG A 1 41  ? 35.638 12.200 2.980  1.00 10.85  ? 491 ARG A N   1 
ATOM   262  C  CA  . ARG A 1 41  ? 35.248 13.286 2.088  1.00 12.12  ? 491 ARG A CA  1 
ATOM   263  C  C   . ARG A 1 41  ? 34.130 12.872 1.125  1.00 10.65  ? 491 ARG A C   1 
ATOM   264  O  O   . ARG A 1 41  ? 33.759 13.642 0.244  1.00 16.58  ? 491 ARG A O   1 
ATOM   265  C  CB  . ARG A 1 41  ? 36.468 13.754 1.288  1.00 14.20  ? 491 ARG A CB  1 
ATOM   266  C  CG  . ARG A 1 41  ? 36.974 12.743 0.267  1.00 12.64  ? 491 ARG A CG  1 
ATOM   267  C  CD  . ARG A 1 41  ? 38.415 13.017 -0.125 1.00 16.40  ? 491 ARG A CD  1 
ATOM   268  N  NE  . ARG A 1 41  ? 38.624 13.037 -1.576 1.00 21.92  ? 491 ARG A NE  1 
ATOM   269  C  CZ  . ARG A 1 41  ? 39.051 12.008 -2.308 1.00 22.02  ? 491 ARG A CZ  1 
ATOM   270  N  NH1 . ARG A 1 41  ? 39.333 10.835 -1.757 1.00 29.05  ? 491 ARG A NH1 1 
ATOM   271  N  NH2 . ARG A 1 41  ? 39.177 12.150 -3.609 1.00 16.06  ? 491 ARG A NH2 1 
ATOM   272  N  N   . PHE A 1 42  ? 33.580 11.673 1.294  1.00 10.85  ? 492 PHE A N   1 
ATOM   273  C  CA  . PHE A 1 42  ? 32.546 11.185 0.382  1.00 9.38   ? 492 PHE A CA  1 
ATOM   274  C  C   . PHE A 1 42  ? 31.177 11.242 0.990  1.00 7.75   ? 492 PHE A C   1 
ATOM   275  O  O   . PHE A 1 42  ? 31.032 11.243 2.199  1.00 7.54   ? 492 PHE A O   1 
ATOM   276  C  CB  . PHE A 1 42  ? 32.833 9.748  -0.071 1.00 9.29   ? 492 PHE A CB  1 
ATOM   277  C  CG  . PHE A 1 42  ? 34.264 9.511  -0.435 1.00 13.20  ? 492 PHE A CG  1 
ATOM   278  C  CD1 . PHE A 1 42  ? 34.778 9.987  -1.637 1.00 11.39  ? 492 PHE A CD1 1 
ATOM   279  C  CD2 . PHE A 1 42  ? 35.126 8.872  0.463  1.00 13.93  ? 492 PHE A CD2 1 
ATOM   280  C  CE1 . PHE A 1 42  ? 36.140 9.830  -1.931 1.00 9.14   ? 492 PHE A CE1 1 
ATOM   281  C  CE2 . PHE A 1 42  ? 36.491 8.713  0.174  1.00 10.21  ? 492 PHE A CE2 1 
ATOM   282  C  CZ  . PHE A 1 42  ? 36.990 9.191  -1.015 1.00 5.61   ? 492 PHE A CZ  1 
ATOM   283  N  N   . ILE A 1 43  ? 30.184 11.147 0.113  1.00 7.80   ? 493 ILE A N   1 
ATOM   284  C  CA  . ILE A 1 43  ? 28.776 11.212 0.468  1.00 11.80  ? 493 ILE A CA  1 
ATOM   285  C  C   . ILE A 1 43  ? 28.000 10.328 -0.543 1.00 13.45  ? 493 ILE A C   1 
ATOM   286  O  O   . ILE A 1 43  ? 28.494 10.045 -1.624 1.00 15.21  ? 493 ILE A O   1 
ATOM   287  C  CB  . ILE A 1 43  ? 28.362 12.693 0.377  1.00 13.50  ? 493 ILE A CB  1 
ATOM   288  C  CG1 . ILE A 1 43  ? 26.901 12.916 0.627  1.00 20.42  ? 493 ILE A CG1 1 
ATOM   289  C  CG2 . ILE A 1 43  ? 28.648 13.228 -1.012 1.00 21.11  ? 493 ILE A CG2 1 
ATOM   290  C  CD1 . ILE A 1 43  ? 26.522 14.306 0.143  1.00 30.47  ? 493 ILE A CD1 1 
ATOM   291  N  N   . TRP A 1 44  ? 26.851 9.805  -0.138 1.00 13.00  ? 494 TRP A N   1 
ATOM   292  C  CA  . TRP A 1 44  ? 25.997 8.974  -0.991 1.00 12.53  ? 494 TRP A CA  1 
ATOM   293  C  C   . TRP A 1 44  ? 24.625 9.475  -0.616 1.00 11.68  ? 494 TRP A C   1 
ATOM   294  O  O   . TRP A 1 44  ? 24.401 9.759  0.542  1.00 16.27  ? 494 TRP A O   1 
ATOM   295  C  CB  . TRP A 1 44  ? 26.066 7.487  -0.588 1.00 14.36  ? 494 TRP A CB  1 
ATOM   296  C  CG  . TRP A 1 44  ? 27.297 6.758  -1.007 1.00 15.55  ? 494 TRP A CG  1 
ATOM   297  C  CD1 . TRP A 1 44  ? 27.470 6.047  -2.161 1.00 18.96  ? 494 TRP A CD1 1 
ATOM   298  C  CD2 . TRP A 1 44  ? 28.548 6.707  -0.315 1.00 16.19  ? 494 TRP A CD2 1 
ATOM   299  N  NE1 . TRP A 1 44  ? 28.756 5.568  -2.238 1.00 17.24  ? 494 TRP A NE1 1 
ATOM   300  C  CE2 . TRP A 1 44  ? 29.441 5.958  -1.118 1.00 17.71  ? 494 TRP A CE2 1 
ATOM   301  C  CE3 . TRP A 1 44  ? 29.009 7.224  0.904  1.00 21.12  ? 494 TRP A CE3 1 
ATOM   302  C  CZ2 . TRP A 1 44  ? 30.771 5.716  -0.743 1.00 17.65  ? 494 TRP A CZ2 1 
ATOM   303  C  CZ3 . TRP A 1 44  ? 30.344 6.977  1.281  1.00 16.60  ? 494 TRP A CZ3 1 
ATOM   304  C  CH2 . TRP A 1 44  ? 31.201 6.232  0.454  1.00 17.82  ? 494 TRP A CH2 1 
ATOM   305  N  N   . ARG A 1 45  ? 23.714 9.598  -1.568 1.00 13.87  ? 495 ARG A N   1 
ATOM   306  C  CA  . ARG A 1 45  ? 22.369 10.065 -1.256 1.00 15.70  ? 495 ARG A CA  1 
ATOM   307  C  C   . ARG A 1 45  ? 21.304 9.196  -1.892 1.00 22.74  ? 495 ARG A C   1 
ATOM   308  O  O   . ARG A 1 45  ? 21.441 8.748  -3.025 1.00 21.87  ? 495 ARG A O   1 
ATOM   309  C  CB  . ARG A 1 45  ? 22.138 11.525 -1.674 1.00 13.64  ? 495 ARG A CB  1 
ATOM   310  C  CG  . ARG A 1 45  ? 23.147 12.088 -2.643 1.00 23.39  ? 495 ARG A CG  1 
ATOM   311  C  CD  . ARG A 1 45  ? 22.509 12.728 -3.871 1.00 26.52  ? 495 ARG A CD  1 
ATOM   312  N  NE  . ARG A 1 45  ? 21.764 13.960 -3.606 1.00 23.66  ? 495 ARG A NE  1 
ATOM   313  C  CZ  . ARG A 1 45  ? 21.827 15.057 -4.366 1.00 23.16  ? 495 ARG A CZ  1 
ATOM   314  N  NH1 . ARG A 1 45  ? 22.607 15.108 -5.434 1.00 18.86  ? 495 ARG A NH1 1 
ATOM   315  N  NH2 . ARG A 1 45  ? 21.063 16.098 -4.093 1.00 22.44  ? 495 ARG A NH2 1 
ATOM   316  N  N   . THR A 1 46  ? 20.259 8.936  -1.119 1.00 26.65  ? 496 THR A N   1 
ATOM   317  C  CA  . THR A 1 46  ? 19.123 8.156  -1.563 1.00 28.13  ? 496 THR A CA  1 
ATOM   318  C  C   . THR A 1 46  ? 17.897 8.964  -1.150 1.00 32.27  ? 496 THR A C   1 
ATOM   319  O  O   . THR A 1 46  ? 17.904 9.627  -0.109 1.00 29.07  ? 496 THR A O   1 
ATOM   320  C  CB  . THR A 1 46  ? 19.122 6.751  -0.942 1.00 27.68  ? 496 THR A CB  1 
ATOM   321  O  OG1 . THR A 1 46  ? 18.023 6.013  -1.470 1.00 34.85  ? 496 THR A OG1 1 
ATOM   322  C  CG2 . THR A 1 46  ? 19.026 6.799  0.569  1.00 24.57  ? 496 THR A CG2 1 
ATOM   323  N  N   . VAL A 1 47  ? 16.852 8.956  -1.968 1.00 40.24  ? 497 VAL A N   1 
ATOM   324  C  CA  . VAL A 1 47  ? 15.703 9.755  -1.613 1.00 45.91  ? 497 VAL A CA  1 
ATOM   325  C  C   . VAL A 1 47  ? 14.656 9.065  -0.775 1.00 54.54  ? 497 VAL A C   1 
ATOM   326  O  O   . VAL A 1 47  ? 13.825 8.317  -1.268 1.00 53.94  ? 497 VAL A O   1 
ATOM   327  C  CB  . VAL A 1 47  ? 15.106 10.474 -2.809 1.00 43.09  ? 497 VAL A CB  1 
ATOM   328  C  CG1 . VAL A 1 47  ? 14.246 9.564  -3.633 1.00 43.91  ? 497 VAL A CG1 1 
ATOM   329  C  CG2 . VAL A 1 47  ? 14.357 11.669 -2.322 1.00 46.11  ? 497 VAL A CG2 1 
ATOM   330  N  N   . THR A 1 48  ? 14.823 9.239  0.534  0.00 68.33  ? 498 THR A N   1 
ATOM   331  C  CA  . THR A 1 48  ? 13.951 8.691  1.579  0.00 80.49  ? 498 THR A CA  1 
ATOM   332  C  C   . THR A 1 48  ? 13.609 7.175  1.524  0.00 87.31  ? 498 THR A C   1 
ATOM   333  O  O   . THR A 1 48  ? 12.465 6.788  1.813  0.00 92.88  ? 498 THR A O   1 
ATOM   334  C  CB  . THR A 1 48  ? 12.630 9.535  1.694  0.00 81.48  ? 498 THR A CB  1 
ATOM   335  O  OG1 . THR A 1 48  ? 12.922 10.928 1.495  0.00 83.00  ? 498 THR A OG1 1 
ATOM   336  C  CG2 . THR A 1 48  ? 11.990 9.370  3.084  0.00 78.23  ? 498 THR A CG2 1 
ATOM   337  N  N   . PRO A 1 49  ? 14.579 6.296  1.171  0.00 89.15  ? 499 PRO A N   1 
ATOM   338  C  CA  . PRO A 1 49  ? 14.137 4.905  1.157  0.00 87.59  ? 499 PRO A CA  1 
ATOM   339  C  C   . PRO A 1 49  ? 15.009 3.892  1.917  0.00 84.22  ? 499 PRO A C   1 
ATOM   340  O  O   . PRO A 1 49  ? 15.505 4.144  3.018  0.00 78.44  ? 499 PRO A O   1 
ATOM   341  C  CB  . PRO A 1 49  ? 14.130 4.605  -0.341 0.00 90.36  ? 499 PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 49  ? 15.381 5.339  -0.825 0.00 89.88  ? 499 PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 49  ? 15.700 6.426  0.230  0.00 90.36  ? 499 PRO A CD  1 
ATOM   344  N  N   . ARG A 1 50  ? 15.136 2.728  1.289  0.00 83.81  ? 500 ARG A N   1 
ATOM   345  C  CA  . ARG A 1 50  ? 15.877 1.584  1.777  0.00 85.47  ? 500 ARG A CA  1 
ATOM   346  C  C   . ARG A 1 50  ? 16.637 1.049  0.560  0.00 83.31  ? 500 ARG A C   1 
ATOM   347  O  O   . ARG A 1 50  ? 17.254 -0.011 0.613  0.00 82.69  ? 500 ARG A O   1 
ATOM   348  C  CB  . ARG A 1 50  ? 14.853 0.538  2.264  0.00 90.67  ? 500 ARG A CB  1 
ATOM   349  C  CG  . ARG A 1 50  ? 15.361 -0.893 2.445  0.00 97.62  ? 500 ARG A CG  1 
ATOM   350  C  CD  . ARG A 1 50  ? 14.242 -1.898 2.712  0.00 103.02 ? 500 ARG A CD  1 
ATOM   351  N  NE  . ARG A 1 50  ? 13.452 -2.190 1.514  0.00 111.84 ? 500 ARG A NE  1 
ATOM   352  C  CZ  . ARG A 1 50  ? 13.880 -2.910 0.475  0.00 115.85 ? 500 ARG A CZ  1 
ATOM   353  N  NH1 . ARG A 1 50  ? 15.105 -3.431 0.464  0.00 116.52 ? 500 ARG A NH1 1 
ATOM   354  N  NH2 . ARG A 1 50  ? 13.076 -3.111 -0.566 0.00 117.78 ? 500 ARG A NH2 1 
ATOM   355  N  N   . ASP A 1 51  ? 16.640 1.812  -0.528 0.00 81.42  ? 501 ASP A N   1 
ATOM   356  C  CA  . ASP A 1 51  ? 17.288 1.341  -1.743 0.00 79.02  ? 501 ASP A CA  1 
ATOM   357  C  C   . ASP A 1 51  ? 18.455 2.147  -2.301 0.00 74.64  ? 501 ASP A C   1 
ATOM   358  O  O   . ASP A 1 51  ? 18.492 3.375  -2.197 0.00 77.36  ? 501 ASP A O   1 
ATOM   359  C  CB  . ASP A 1 51  ? 16.227 1.086  -2.808 0.00 82.58  ? 501 ASP A CB  1 
ATOM   360  C  CG  . ASP A 1 51  ? 15.198 0.065  -2.351 0.00 85.90  ? 501 ASP A CG  1 
ATOM   361  O  OD1 . ASP A 1 51  ? 15.487 -1.147 -2.452 0.00 87.41  ? 501 ASP A OD1 1 
ATOM   362  O  OD2 . ASP A 1 51  ? 14.124 0.473  -1.850 0.00 86.59  ? 501 ASP A OD2 1 
ATOM   363  N  N   . LYS A 1 52  ? 19.406 1.405  -2.867 1.00 65.67  ? 502 LYS A N   1 
ATOM   364  C  CA  . LYS A 1 52  ? 20.643 1.905  -3.466 1.00 54.91  ? 502 LYS A CA  1 
ATOM   365  C  C   . LYS A 1 52  ? 20.896 3.402  -3.543 1.00 49.05  ? 502 LYS A C   1 
ATOM   366  O  O   . LYS A 1 52  ? 20.241 4.118  -4.294 1.00 49.83  ? 502 LYS A O   1 
ATOM   367  C  CB  . LYS A 1 52  ? 20.856 1.263  -4.835 1.00 56.14  ? 502 LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 52  ? 21.735 0.014  -4.809 1.00 53.73  ? 502 LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 52  ? 23.176 0.370  -4.497 1.00 49.84  ? 502 LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 52  ? 24.065 -0.845 -4.563 1.00 50.72  ? 502 LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 52  ? 25.479 -0.446 -4.378 1.00 54.59  ? 502 LYS A NZ  1 
ATOM   372  N  N   . PRO A 1 53  ? 21.870 3.890  -2.759 1.00 42.20  ? 503 PRO A N   1 
ATOM   373  C  CA  . PRO A 1 53  ? 22.220 5.302  -2.733 1.00 35.67  ? 503 PRO A CA  1 
ATOM   374  C  C   . PRO A 1 53  ? 23.011 5.669  -3.957 1.00 32.17  ? 503 PRO A C   1 
ATOM   375  O  O   . PRO A 1 53  ? 23.833 4.892  -4.412 1.00 34.51  ? 503 PRO A O   1 
ATOM   376  C  CB  . PRO A 1 53  ? 23.113 5.410  -1.493 1.00 33.08  ? 503 PRO A CB  1 
ATOM   377  C  CG  . PRO A 1 53  ? 22.718 4.267  -0.662 1.00 37.72  ? 503 PRO A CG  1 
ATOM   378  C  CD  . PRO A 1 53  ? 22.574 3.181  -1.681 1.00 41.15  ? 503 PRO A CD  1 
ATOM   379  N  N   . MET A 1 54  ? 22.764 6.867  -4.469 1.00 32.60  ? 504 MET A N   1 
ATOM   380  C  CA  . MET A 1 54  ? 23.483 7.398  -5.612 1.00 31.00  ? 504 MET A CA  1 
ATOM   381  C  C   . MET A 1 54  ? 24.731 8.019  -5.005 1.00 26.74  ? 504 MET A C   1 
ATOM   382  O  O   . MET A 1 54  ? 24.650 8.751  -4.020 1.00 31.96  ? 504 MET A O   1 
ATOM   383  C  CB  . MET A 1 54  ? 22.657 8.487  -6.298 1.00 44.94  ? 504 MET A CB  1 
ATOM   384  C  CG  . MET A 1 54  ? 22.115 8.110  -7.684 1.00 66.70  ? 504 MET A CG  1 
ATOM   385  S  SD  . MET A 1 54  ? 20.910 6.733  -7.735 1.00 83.50  ? 504 MET A SD  1 
ATOM   386  C  CE  . MET A 1 54  ? 19.340 7.633  -7.480 1.00 82.20  ? 504 MET A CE  1 
ATOM   387  N  N   . GLY A 1 55  ? 25.887 7.693  -5.555 1.00 20.07  ? 505 GLY A N   1 
ATOM   388  C  CA  . GLY A 1 55  ? 27.128 8.226  -5.037 1.00 16.47  ? 505 GLY A CA  1 
ATOM   389  C  C   . GLY A 1 55  ? 28.245 7.332  -5.520 1.00 20.40  ? 505 GLY A C   1 
ATOM   390  O  O   . GLY A 1 55  ? 27.974 6.360  -6.219 1.00 25.80  ? 505 GLY A O   1 
ATOM   391  N  N   . PRO A 1 56  ? 29.491 7.545  -5.075 1.00 19.94  ? 506 PRO A N   1 
ATOM   392  C  CA  . PRO A 1 56  ? 29.831 8.600  -4.131 1.00 14.97  ? 506 PRO A CA  1 
ATOM   393  C  C   . PRO A 1 56  ? 30.063 9.915  -4.815 1.00 15.54  ? 506 PRO A C   1 
ATOM   394  O  O   . PRO A 1 56  ? 30.477 9.962  -5.956 1.00 20.55  ? 506 PRO A O   1 
ATOM   395  C  CB  . PRO A 1 56  ? 31.132 8.084  -3.521 1.00 15.76  ? 506 PRO A CB  1 
ATOM   396  C  CG  . PRO A 1 56  ? 31.799 7.480  -4.698 1.00 14.41  ? 506 PRO A CG  1 
ATOM   397  C  CD  . PRO A 1 56  ? 30.682 6.736  -5.402 1.00 13.65  ? 506 PRO A CD  1 
ATOM   398  N  N   . LEU A 1 57  ? 29.752 10.981 -4.099 1.00 15.78  ? 507 LEU A N   1 
ATOM   399  C  CA  . LEU A 1 57  ? 29.978 12.329 -4.566 1.00 14.88  ? 507 LEU A CA  1 
ATOM   400  C  C   . LEU A 1 57  ? 30.978 12.839 -3.534 1.00 14.47  ? 507 LEU A C   1 
ATOM   401  O  O   . LEU A 1 57  ? 31.414 12.073 -2.681 1.00 24.68  ? 507 LEU A O   1 
ATOM   402  C  CB  . LEU A 1 57  ? 28.684 13.135 -4.503 1.00 16.00  ? 507 LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 57  ? 27.469 12.551 -5.228 1.00 20.49  ? 507 LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 57  ? 26.297 13.485 -5.058 1.00 18.81  ? 507 LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 57  ? 27.773 12.353 -6.712 1.00 24.08  ? 507 LEU A CD2 1 
ATOM   406  N  N   . LEU A 1 58  ? 31.366 14.104 -3.609 1.00 13.22  ? 508 LEU A N   1 
ATOM   407  C  CA  . LEU A 1 58  ? 32.290 14.662 -2.631 1.00 8.05   ? 508 LEU A CA  1 
ATOM   408  C  C   . LEU A 1 58  ? 31.499 15.628 -1.749 1.00 12.47  ? 508 LEU A C   1 
ATOM   409  O  O   . LEU A 1 58  ? 30.640 16.371 -2.242 1.00 12.10  ? 508 LEU A O   1 
ATOM   410  C  CB  . LEU A 1 58  ? 33.415 15.433 -3.324 1.00 10.34  ? 508 LEU A CB  1 
ATOM   411  C  CG  . LEU A 1 58  ? 34.381 14.701 -4.246 1.00 9.97   ? 508 LEU A CG  1 
ATOM   412  C  CD1 . LEU A 1 58  ? 35.499 15.628 -4.578 1.00 13.45  ? 508 LEU A CD1 1 
ATOM   413  C  CD2 . LEU A 1 58  ? 34.930 13.450 -3.586 1.00 14.94  ? 508 LEU A CD2 1 
ATOM   414  N  N   . VAL A 1 59  ? 31.810 15.640 -0.456 1.00 13.24  ? 509 VAL A N   1 
ATOM   415  C  CA  . VAL A 1 59  ? 31.156 16.522 0.512  1.00 7.03   ? 509 VAL A CA  1 
ATOM   416  C  C   . VAL A 1 59  ? 31.431 17.972 0.092  1.00 11.79  ? 509 VAL A C   1 
ATOM   417  O  O   . VAL A 1 59  ? 30.633 18.877 0.346  1.00 11.38  ? 509 VAL A O   1 
ATOM   418  C  CB  . VAL A 1 59  ? 31.723 16.260 1.922  1.00 10.48  ? 509 VAL A CB  1 
ATOM   419  C  CG1 . VAL A 1 59  ? 31.224 17.295 2.921  1.00 12.17  ? 509 VAL A CG1 1 
ATOM   420  C  CG2 . VAL A 1 59  ? 31.374 14.831 2.381  1.00 12.87  ? 509 VAL A CG2 1 
ATOM   421  N  N   . ALA A 1 60  ? 32.555 18.166 -0.592 1.00 14.38  ? 510 ALA A N   1 
ATOM   422  C  CA  . ALA A 1 60  ? 32.973 19.475 -1.086 1.00 18.49  ? 510 ALA A CA  1 
ATOM   423  C  C   . ALA A 1 60  ? 32.075 20.044 -2.185 1.00 16.31  ? 510 ALA A C   1 
ATOM   424  O  O   . ALA A 1 60  ? 32.085 21.230 -2.437 1.00 22.31  ? 510 ALA A O   1 
ATOM   425  C  CB  . ALA A 1 60  ? 34.396 19.408 -1.574 1.00 16.12  ? 510 ALA A CB  1 
ATOM   426  N  N   . THR A 1 61  ? 31.327 19.194 -2.865 1.00 17.51  ? 511 THR A N   1 
ATOM   427  C  CA  . THR A 1 61  ? 30.426 19.664 -3.915 1.00 22.24  ? 511 THR A CA  1 
ATOM   428  C  C   . THR A 1 61  ? 29.274 20.493 -3.293 1.00 21.96  ? 511 THR A C   1 
ATOM   429  O  O   . THR A 1 61  ? 28.787 21.455 -3.894 1.00 23.91  ? 511 THR A O   1 
ATOM   430  C  CB  . THR A 1 61  ? 29.834 18.455 -4.700 1.00 21.79  ? 511 THR A CB  1 
ATOM   431  O  OG1 . THR A 1 61  ? 30.893 17.719 -5.322 1.00 24.81  ? 511 THR A OG1 1 
ATOM   432  C  CG2 . THR A 1 61  ? 28.856 18.907 -5.761 1.00 20.45  ? 511 THR A CG2 1 
ATOM   433  N  N   . PHE A 1 62  ? 28.864 20.134 -2.078 1.00 18.91  ? 512 PHE A N   1 
ATOM   434  C  CA  . PHE A 1 62  ? 27.767 20.827 -1.409 1.00 17.37  ? 512 PHE A CA  1 
ATOM   435  C  C   . PHE A 1 62  ? 28.224 21.774 -0.290 1.00 17.43  ? 512 PHE A C   1 
ATOM   436  O  O   . PHE A 1 62  ? 27.690 22.852 -0.151 1.00 16.47  ? 512 PHE A O   1 
ATOM   437  C  CB  . PHE A 1 62  ? 26.769 19.816 -0.819 1.00 19.29  ? 512 PHE A CB  1 
ATOM   438  C  CG  . PHE A 1 62  ? 26.268 18.773 -1.801 1.00 19.47  ? 512 PHE A CG  1 
ATOM   439  C  CD1 . PHE A 1 62  ? 25.199 19.049 -2.656 1.00 17.66  ? 512 PHE A CD1 1 
ATOM   440  C  CD2 . PHE A 1 62  ? 26.837 17.498 -1.833 1.00 19.85  ? 512 PHE A CD2 1 
ATOM   441  C  CE1 . PHE A 1 62  ? 24.704 18.070 -3.528 1.00 17.51  ? 512 PHE A CE1 1 
ATOM   442  C  CE2 . PHE A 1 62  ? 26.350 16.512 -2.701 1.00 21.08  ? 512 PHE A CE2 1 
ATOM   443  C  CZ  . PHE A 1 62  ? 25.280 16.803 -3.548 1.00 21.62  ? 512 PHE A CZ  1 
ATOM   444  N  N   . TRP A 1 63  ? 29.203 21.354 0.508  1.00 17.56  ? 513 TRP A N   1 
ATOM   445  C  CA  . TRP A 1 63  ? 29.692 22.150 1.633  1.00 14.58  ? 513 TRP A CA  1 
ATOM   446  C  C   . TRP A 1 63  ? 31.208 22.177 1.571  1.00 19.05  ? 513 TRP A C   1 
ATOM   447  O  O   . TRP A 1 63  ? 31.887 21.342 2.155  1.00 22.68  ? 513 TRP A O   1 
ATOM   448  C  CB  . TRP A 1 63  ? 29.233 21.532 2.962  1.00 8.82   ? 513 TRP A CB  1 
ATOM   449  C  CG  . TRP A 1 63  ? 27.764 21.304 3.030  1.00 3.53   ? 513 TRP A CG  1 
ATOM   450  C  CD1 . TRP A 1 63  ? 26.800 22.252 3.193  1.00 6.39   ? 513 TRP A CD1 1 
ATOM   451  C  CD2 . TRP A 1 63  ? 27.079 20.069 2.800  1.00 5.56   ? 513 TRP A CD2 1 
ATOM   452  N  NE1 . TRP A 1 63  ? 25.554 21.694 3.048  1.00 9.97   ? 513 TRP A NE1 1 
ATOM   453  C  CE2 . TRP A 1 63  ? 25.693 20.351 2.811  1.00 6.63   ? 513 TRP A CE2 1 
ATOM   454  C  CE3 . TRP A 1 63  ? 27.503 18.748 2.571  1.00 12.69  ? 513 TRP A CE3 1 
ATOM   455  C  CZ2 . TRP A 1 63  ? 24.719 19.363 2.604  1.00 8.29   ? 513 TRP A CZ2 1 
ATOM   456  C  CZ3 . TRP A 1 63  ? 26.534 17.754 2.358  1.00 12.58  ? 513 TRP A CZ3 1 
ATOM   457  C  CH2 . TRP A 1 63  ? 25.154 18.075 2.379  1.00 14.86  ? 513 TRP A CH2 1 
ATOM   458  N  N   . PRO A 1 64  ? 31.757 23.145 0.838  1.00 21.36  ? 514 PRO A N   1 
ATOM   459  C  CA  . PRO A 1 64  ? 33.199 23.308 0.663  1.00 20.88  ? 514 PRO A CA  1 
ATOM   460  C  C   . PRO A 1 64  ? 34.060 23.714 1.860  1.00 22.69  ? 514 PRO A C   1 
ATOM   461  O  O   . PRO A 1 64  ? 35.266 23.506 1.827  1.00 26.18  ? 514 PRO A O   1 
ATOM   462  C  CB  . PRO A 1 64  ? 33.282 24.332 -0.465 1.00 19.86  ? 514 PRO A CB  1 
ATOM   463  C  CG  . PRO A 1 64  ? 32.022 25.135 -0.301 1.00 21.56  ? 514 PRO A CG  1 
ATOM   464  C  CD  . PRO A 1 64  ? 31.008 24.076 -0.026 1.00 22.33  ? 514 PRO A CD  1 
ATOM   465  N  N   . GLU A 1 65  ? 33.468 24.288 2.908  1.00 22.07  ? 515 GLU A N   1 
ATOM   466  C  CA  . GLU A 1 65  ? 34.252 24.730 4.067  1.00 17.05  ? 515 GLU A CA  1 
ATOM   467  C  C   . GLU A 1 65  ? 34.584 23.624 5.080  1.00 21.53  ? 515 GLU A C   1 
ATOM   468  O  O   . GLU A 1 65  ? 35.555 23.731 5.821  1.00 27.25  ? 515 GLU A O   1 
ATOM   469  C  CB  . GLU A 1 65  ? 33.551 25.884 4.792  1.00 15.86  ? 515 GLU A CB  1 
ATOM   470  C  CG  . GLU A 1 65  ? 33.358 27.158 3.979  1.00 12.63  ? 515 GLU A CG  1 
ATOM   471  C  CD  . GLU A 1 65  ? 32.211 27.090 2.976  1.00 19.84  ? 515 GLU A CD  1 
ATOM   472  O  OE1 . GLU A 1 65  ? 31.386 26.159 3.025  1.00 22.27  ? 515 GLU A OE1 1 
ATOM   473  O  OE2 . GLU A 1 65  ? 32.125 27.983 2.115  1.00 27.53  ? 515 GLU A OE2 1 
ATOM   474  N  N   . LEU A 1 66  ? 33.755 22.584 5.127  1.00 22.44  ? 516 LEU A N   1 
ATOM   475  C  CA  . LEU A 1 66  ? 33.921 21.452 6.045  1.00 20.07  ? 516 LEU A CA  1 
ATOM   476  C  C   . LEU A 1 66  ? 35.277 20.723 5.962  1.00 20.99  ? 516 LEU A C   1 
ATOM   477  O  O   . LEU A 1 66  ? 35.863 20.601 4.879  1.00 26.80  ? 516 LEU A O   1 
ATOM   478  C  CB  . LEU A 1 66  ? 32.797 20.437 5.796  1.00 13.44  ? 516 LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 66  ? 31.529 20.406 6.647  1.00 9.07   ? 516 LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 66  ? 31.197 21.721 7.271  1.00 2.40   ? 516 LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 66  ? 30.404 19.946 5.758  1.00 13.10  ? 516 LEU A CD2 1 
ATOM   482  N  N   . PRO A 1 67  ? 35.813 20.268 7.116  1.00 17.59  ? 517 PRO A N   1 
ATOM   483  C  CA  . PRO A 1 67  ? 37.093 19.551 7.122  1.00 14.03  ? 517 PRO A CA  1 
ATOM   484  C  C   . PRO A 1 67  ? 36.904 18.207 6.409  1.00 17.87  ? 517 PRO A C   1 
ATOM   485  O  O   . PRO A 1 67  ? 35.776 17.832 6.081  1.00 18.00  ? 517 PRO A O   1 
ATOM   486  C  CB  . PRO A 1 67  ? 37.374 19.368 8.613  1.00 5.82   ? 517 PRO A CB  1 
ATOM   487  C  CG  . PRO A 1 67  ? 36.004 19.342 9.220  1.00 12.90  ? 517 PRO A CG  1 
ATOM   488  C  CD  . PRO A 1 67  ? 35.323 20.460 8.492  1.00 13.67  ? 517 PRO A CD  1 
ATOM   489  N  N   . GLU A 1 68  ? 37.973 17.429 6.272  1.00 19.35  ? 518 GLU A N   1 
ATOM   490  C  CA  . GLU A 1 68  ? 37.863 16.170 5.551  1.00 23.12  ? 518 GLU A CA  1 
ATOM   491  C  C   . GLU A 1 68  ? 37.181 14.974 6.219  1.00 21.83  ? 518 GLU A C   1 
ATOM   492  O  O   . GLU A 1 68  ? 37.266 13.859 5.722  1.00 27.24  ? 518 GLU A O   1 
ATOM   493  C  CB  . GLU A 1 68  ? 39.224 15.788 4.994  1.00 32.04  ? 518 GLU A CB  1 
ATOM   494  C  CG  . GLU A 1 68  ? 39.830 16.877 4.092  1.00 50.91  ? 518 GLU A CG  1 
ATOM   495  C  CD  . GLU A 1 68  ? 39.025 17.207 2.798  1.00 58.07  ? 518 GLU A CD  1 
ATOM   496  O  OE1 . GLU A 1 68  ? 39.015 16.381 1.847  1.00 59.98  ? 518 GLU A OE1 1 
ATOM   497  O  OE2 . GLU A 1 68  ? 38.457 18.327 2.712  1.00 58.44  ? 518 GLU A OE2 1 
ATOM   498  N  N   . LYS A 1 69  ? 36.484 15.217 7.322  1.00 19.62  ? 519 LYS A N   1 
ATOM   499  C  CA  . LYS A 1 69  ? 35.766 14.183 8.054  1.00 14.10  ? 519 LYS A CA  1 
ATOM   500  C  C   . LYS A 1 69  ? 34.890 14.847 9.121  1.00 15.86  ? 519 LYS A C   1 
ATOM   501  O  O   . LYS A 1 69  ? 35.363 15.717 9.860  1.00 17.02  ? 519 LYS A O   1 
ATOM   502  C  CB  . LYS A 1 69  ? 36.730 13.215 8.739  1.00 13.85  ? 519 LYS A CB  1 
ATOM   503  C  CG  . LYS A 1 69  ? 35.984 12.135 9.517  1.00 20.78  ? 519 LYS A CG  1 
ATOM   504  C  CD  . LYS A 1 69  ? 36.829 11.454 10.577 1.00 19.71  ? 519 LYS A CD  1 
ATOM   505  C  CE  . LYS A 1 69  ? 36.198 11.590 11.978 1.00 27.37  ? 519 LYS A CE  1 
ATOM   506  N  NZ  . LYS A 1 69  ? 34.796 11.049 12.174 1.00 19.56  ? 519 LYS A NZ  1 
ATOM   507  N  N   . ILE A 1 70  ? 33.623 14.442 9.194  1.00 13.70  ? 520 ILE A N   1 
ATOM   508  C  CA  . ILE A 1 70  ? 32.680 14.981 10.179 1.00 8.31   ? 520 ILE A CA  1 
ATOM   509  C  C   . ILE A 1 70  ? 32.384 13.900 11.237 1.00 11.29  ? 520 ILE A C   1 
ATOM   510  O  O   . ILE A 1 70  ? 32.639 12.713 11.014 1.00 10.65  ? 520 ILE A O   1 
ATOM   511  C  CB  . ILE A 1 70  ? 31.325 15.407 9.523  1.00 7.73   ? 520 ILE A CB  1 
ATOM   512  C  CG1 . ILE A 1 70  ? 30.636 14.210 8.892  1.00 3.40   ? 520 ILE A CG1 1 
ATOM   513  C  CG2 . ILE A 1 70  ? 31.528 16.450 8.446  1.00 5.32   ? 520 ILE A CG2 1 
ATOM   514  C  CD1 . ILE A 1 70  ? 29.247 14.506 8.528  1.00 16.58  ? 520 ILE A CD1 1 
ATOM   515  N  N   . ASP A 1 71  ? 31.848 14.314 12.381 1.00 10.57  ? 521 ASP A N   1 
ATOM   516  C  CA  . ASP A 1 71  ? 31.505 13.392 13.459 1.00 8.43   ? 521 ASP A CA  1 
ATOM   517  C  C   . ASP A 1 71  ? 29.987 13.209 13.563 1.00 6.17   ? 521 ASP A C   1 
ATOM   518  O  O   . ASP A 1 71  ? 29.493 12.144 13.948 1.00 6.52   ? 521 ASP A O   1 
ATOM   519  C  CB  . ASP A 1 71  ? 32.060 13.902 14.784 1.00 11.85  ? 521 ASP A CB  1 
ATOM   520  C  CG  . ASP A 1 71  ? 33.570 13.843 14.843 1.00 12.78  ? 521 ASP A CG  1 
ATOM   521  O  OD1 . ASP A 1 71  ? 34.174 12.895 14.303 1.00 22.20  ? 521 ASP A OD1 1 
ATOM   522  O  OD2 . ASP A 1 71  ? 34.160 14.744 15.443 1.00 11.83  ? 521 ASP A OD2 1 
ATOM   523  N  N   . ALA A 1 72  ? 29.240 14.240 13.211 1.00 2.00   ? 522 ALA A N   1 
ATOM   524  C  CA  . ALA A 1 72  ? 27.794 14.139 13.252 1.00 4.06   ? 522 ALA A CA  1 
ATOM   525  C  C   . ALA A 1 72  ? 27.155 15.239 12.403 1.00 5.23   ? 522 ALA A C   1 
ATOM   526  O  O   . ALA A 1 72  ? 27.799 16.248 12.074 1.00 3.00   ? 522 ALA A O   1 
ATOM   527  C  CB  . ALA A 1 72  ? 27.303 14.204 14.689 1.00 7.49   ? 522 ALA A CB  1 
ATOM   528  N  N   . VAL A 1 73  ? 25.899 15.022 12.035 1.00 5.03   ? 523 VAL A N   1 
ATOM   529  C  CA  . VAL A 1 73  ? 25.149 15.966 11.223 1.00 8.09   ? 523 VAL A CA  1 
ATOM   530  C  C   . VAL A 1 73  ? 23.656 15.752 11.397 1.00 8.48   ? 523 VAL A C   1 
ATOM   531  O  O   . VAL A 1 73  ? 23.184 14.615 11.572 1.00 14.77  ? 523 VAL A O   1 
ATOM   532  C  CB  . VAL A 1 73  ? 25.532 15.865 9.685  1.00 5.76   ? 523 VAL A CB  1 
ATOM   533  C  CG1 . VAL A 1 73  ? 25.448 14.462 9.202  1.00 6.55   ? 523 VAL A CG1 1 
ATOM   534  C  CG2 . VAL A 1 73  ? 24.625 16.753 8.825  1.00 3.17   ? 523 VAL A CG2 1 
ATOM   535  N  N   . TYR A 1 74  ? 22.931 16.855 11.484 1.00 9.93   ? 524 TYR A N   1 
ATOM   536  C  CA  . TYR A 1 74  ? 21.478 16.815 11.585 1.00 12.83  ? 524 TYR A CA  1 
ATOM   537  C  C   . TYR A 1 74  ? 20.949 18.078 10.952 1.00 15.51  ? 524 TYR A C   1 
ATOM   538  O  O   . TYR A 1 74  ? 21.719 18.978 10.597 1.00 21.89  ? 524 TYR A O   1 
ATOM   539  C  CB  . TYR A 1 74  ? 20.994 16.711 13.024 1.00 7.79   ? 524 TYR A CB  1 
ATOM   540  C  CG  . TYR A 1 74  ? 21.048 17.985 13.824 1.00 8.04   ? 524 TYR A CG  1 
ATOM   541  C  CD1 . TYR A 1 74  ? 22.220 18.378 14.455 1.00 7.39   ? 524 TYR A CD1 1 
ATOM   542  C  CD2 . TYR A 1 74  ? 19.907 18.781 13.985 1.00 6.90   ? 524 TYR A CD2 1 
ATOM   543  C  CE1 . TYR A 1 74  ? 22.262 19.539 15.235 1.00 9.84   ? 524 TYR A CE1 1 
ATOM   544  C  CE2 . TYR A 1 74  ? 19.936 19.941 14.756 1.00 5.42   ? 524 TYR A CE2 1 
ATOM   545  C  CZ  . TYR A 1 74  ? 21.122 20.309 15.378 1.00 10.07  ? 524 TYR A CZ  1 
ATOM   546  O  OH  . TYR A 1 74  ? 21.179 21.440 16.145 1.00 14.49  ? 524 TYR A OH  1 
ATOM   547  N  N   . GLU A 1 75  ? 19.643 18.141 10.787 1.00 13.68  ? 525 GLU A N   1 
ATOM   548  C  CA  . GLU A 1 75  ? 19.035 19.314 10.205 1.00 16.51  ? 525 GLU A CA  1 
ATOM   549  C  C   . GLU A 1 75  ? 18.035 19.894 11.209 1.00 15.90  ? 525 GLU A C   1 
ATOM   550  O  O   . GLU A 1 75  ? 17.173 19.182 11.731 1.00 19.93  ? 525 GLU A O   1 
ATOM   551  C  CB  . GLU A 1 75  ? 18.371 18.963 8.859  1.00 14.73  ? 525 GLU A CB  1 
ATOM   552  C  CG  . GLU A 1 75  ? 17.356 20.004 8.368  1.00 18.88  ? 525 GLU A CG  1 
ATOM   553  C  CD  . GLU A 1 75  ? 17.019 19.867 6.916  1.00 14.49  ? 525 GLU A CD  1 
ATOM   554  O  OE1 . GLU A 1 75  ? 16.082 19.114 6.578  1.00 15.78  ? 525 GLU A OE1 1 
ATOM   555  O  OE2 . GLU A 1 75  ? 17.707 20.528 6.111  1.00 26.66  ? 525 GLU A OE2 1 
ATOM   556  N  N   . ALA A 1 76  ? 18.199 21.170 11.527 1.00 16.08  ? 526 ALA A N   1 
ATOM   557  C  CA  . ALA A 1 76  ? 17.306 21.853 12.457 1.00 19.91  ? 526 ALA A CA  1 
ATOM   558  C  C   . ALA A 1 76  ? 15.991 22.114 11.717 1.00 23.39  ? 526 ALA A C   1 
ATOM   559  O  O   . ALA A 1 76  ? 15.989 22.751 10.665 1.00 26.77  ? 526 ALA A O   1 
ATOM   560  C  CB  . ALA A 1 76  ? 17.939 23.153 12.881 1.00 21.57  ? 526 ALA A CB  1 
ATOM   561  N  N   . PRO A 1 77  ? 14.854 21.657 12.262 1.00 26.26  ? 527 PRO A N   1 
ATOM   562  C  CA  . PRO A 1 77  ? 13.539 21.843 11.632 1.00 30.83  ? 527 PRO A CA  1 
ATOM   563  C  C   . PRO A 1 77  ? 13.064 23.292 11.522 1.00 38.00  ? 527 PRO A C   1 
ATOM   564  O  O   . PRO A 1 77  ? 12.483 23.672 10.512 1.00 38.91  ? 527 PRO A O   1 
ATOM   565  C  CB  . PRO A 1 77  ? 12.602 21.061 12.551 1.00 24.65  ? 527 PRO A CB  1 
ATOM   566  C  CG  . PRO A 1 77  ? 13.478 20.107 13.204 1.00 26.91  ? 527 PRO A CG  1 
ATOM   567  C  CD  . PRO A 1 77  ? 14.699 20.914 13.511 1.00 29.43  ? 527 PRO A CD  1 
ATOM   568  N  N   . GLN A 1 78  ? 13.295 24.092 12.563 1.00 44.18  ? 528 GLN A N   1 
ATOM   569  C  CA  . GLN A 1 78  ? 12.847 25.476 12.553 1.00 47.84  ? 528 GLN A CA  1 
ATOM   570  C  C   . GLN A 1 78  ? 13.071 26.207 11.233 1.00 48.31  ? 528 GLN A C   1 
ATOM   571  O  O   . GLN A 1 78  ? 12.135 26.787 10.680 1.00 51.02  ? 528 GLN A O   1 
ATOM   572  C  CB  . GLN A 1 78  ? 13.450 26.260 13.720 1.00 56.49  ? 528 GLN A CB  1 
ATOM   573  C  CG  . GLN A 1 78  ? 12.564 26.262 14.979 1.00 70.33  ? 528 GLN A CG  1 
ATOM   574  C  CD  . GLN A 1 78  ? 12.368 27.665 15.592 1.00 78.69  ? 528 GLN A CD  1 
ATOM   575  O  OE1 . GLN A 1 78  ? 11.235 28.169 15.694 1.00 77.03  ? 528 GLN A OE1 1 
ATOM   576  N  NE2 . GLN A 1 78  ? 13.467 28.288 16.019 1.00 82.07  ? 528 GLN A NE2 1 
ATOM   577  N  N   . GLU A 1 79  ? 14.276 26.116 10.681 1.00 46.61  ? 529 GLU A N   1 
ATOM   578  C  CA  . GLU A 1 79  ? 14.555 26.801 9.425  1.00 43.21  ? 529 GLU A CA  1 
ATOM   579  C  C   . GLU A 1 79  ? 15.252 25.943 8.360  1.00 38.73  ? 529 GLU A C   1 
ATOM   580  O  O   . GLU A 1 79  ? 15.835 26.473 7.404  1.00 37.74  ? 529 GLU A O   1 
ATOM   581  C  CB  . GLU A 1 79  ? 15.373 28.051 9.717  1.00 50.97  ? 529 GLU A CB  1 
ATOM   582  C  CG  . GLU A 1 79  ? 14.905 29.271 8.940  1.00 67.40  ? 529 GLU A CG  1 
ATOM   583  C  CD  . GLU A 1 79  ? 15.654 30.534 9.329  1.00 75.50  ? 529 GLU A CD  1 
ATOM   584  O  OE1 . GLU A 1 79  ? 15.932 30.706 10.539 1.00 79.97  ? 529 GLU A OE1 1 
ATOM   585  O  OE2 . GLU A 1 79  ? 15.966 31.350 8.427  1.00 81.40  ? 529 GLU A OE2 1 
ATOM   586  N  N   . GLU A 1 80  ? 15.143 24.622 8.497  1.00 30.04  ? 530 GLU A N   1 
ATOM   587  C  CA  . GLU A 1 80  ? 15.779 23.693 7.575  1.00 25.39  ? 530 GLU A CA  1 
ATOM   588  C  C   . GLU A 1 80  ? 17.246 24.079 7.347  1.00 23.94  ? 530 GLU A C   1 
ATOM   589  O  O   . GLU A 1 80  ? 17.648 24.424 6.248  1.00 27.96  ? 530 GLU A O   1 
ATOM   590  C  CB  . GLU A 1 80  ? 15.023 23.630 6.243  1.00 27.71  ? 530 GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 80  ? 13.669 22.924 6.296  1.00 30.86  ? 530 GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 80  ? 12.957 22.909 4.938  1.00 36.39  ? 530 GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 80  ? 12.481 23.988 4.491  1.00 30.88  ? 530 GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 80  ? 12.877 21.821 4.315  1.00 37.88  ? 530 GLU A OE2 1 
ATOM   595  N  N   . LYS A 1 81  ? 18.020 24.088 8.425  1.00 21.84  ? 531 LYS A N   1 
ATOM   596  C  CA  . LYS A 1 81  ? 19.442 24.404 8.366  1.00 16.94  ? 531 LYS A CA  1 
ATOM   597  C  C   . LYS A 1 81  ? 20.192 23.128 8.678  1.00 17.03  ? 531 LYS A C   1 
ATOM   598  O  O   . LYS A 1 81  ? 19.686 22.270 9.409  1.00 18.68  ? 531 LYS A O   1 
ATOM   599  C  CB  . LYS A 1 81  ? 19.809 25.483 9.382  1.00 19.47  ? 531 LYS A CB  1 
ATOM   600  C  CG  . LYS A 1 81  ? 19.441 26.866 8.930  1.00 22.39  ? 531 LYS A CG  1 
ATOM   601  C  CD  . LYS A 1 81  ? 19.808 27.905 9.938  1.00 26.00  ? 531 LYS A CD  1 
ATOM   602  C  CE  . LYS A 1 81  ? 19.373 29.266 9.437  1.00 32.95  ? 531 LYS A CE  1 
ATOM   603  N  NZ  . LYS A 1 81  ? 19.464 30.325 10.492 1.00 35.82  ? 531 LYS A NZ  1 
ATOM   604  N  N   . ALA A 1 82  ? 21.381 22.988 8.107  1.00 14.60  ? 532 ALA A N   1 
ATOM   605  C  CA  . ALA A 1 82  ? 22.192 21.802 8.326  1.00 10.94  ? 532 ALA A CA  1 
ATOM   606  C  C   . ALA A 1 82  ? 23.258 22.142 9.367  1.00 12.31  ? 532 ALA A C   1 
ATOM   607  O  O   . ALA A 1 82  ? 23.907 23.185 9.267  1.00 9.39   ? 532 ALA A O   1 
ATOM   608  C  CB  . ALA A 1 82  ? 22.821 21.359 7.019  1.00 13.53  ? 532 ALA A CB  1 
ATOM   609  N  N   . VAL A 1 83  ? 23.398 21.289 10.383 1.00 11.94  ? 533 VAL A N   1 
ATOM   610  C  CA  . VAL A 1 83  ? 24.372 21.500 11.462 1.00 10.33  ? 533 VAL A CA  1 
ATOM   611  C  C   . VAL A 1 83  ? 25.446 20.426 11.450 1.00 7.41   ? 533 VAL A C   1 
ATOM   612  O  O   . VAL A 1 83  ? 25.147 19.259 11.666 1.00 10.94  ? 533 VAL A O   1 
ATOM   613  C  CB  . VAL A 1 83  ? 23.671 21.484 12.821 1.00 10.16  ? 533 VAL A CB  1 
ATOM   614  C  CG1 . VAL A 1 83  ? 24.650 21.868 13.934 1.00 6.58   ? 533 VAL A CG1 1 
ATOM   615  C  CG2 . VAL A 1 83  ? 22.468 22.431 12.789 1.00 9.75   ? 533 VAL A CG2 1 
ATOM   616  N  N   . PHE A 1 84  ? 26.694 20.821 11.239 1.00 4.15   ? 534 PHE A N   1 
ATOM   617  C  CA  . PHE A 1 84  ? 27.783 19.849 11.165 1.00 8.32   ? 534 PHE A CA  1 
ATOM   618  C  C   . PHE A 1 84  ? 28.757 19.923 12.331 1.00 12.91  ? 534 PHE A C   1 
ATOM   619  O  O   . PHE A 1 84  ? 29.251 21.002 12.652 1.00 15.66  ? 534 PHE A O   1 
ATOM   620  C  CB  . PHE A 1 84  ? 28.569 20.039 9.877  1.00 8.46   ? 534 PHE A CB  1 
ATOM   621  C  CG  . PHE A 1 84  ? 27.805 19.689 8.634  1.00 13.66  ? 534 PHE A CG  1 
ATOM   622  C  CD1 . PHE A 1 84  ? 27.052 20.654 7.971  1.00 11.94  ? 534 PHE A CD1 1 
ATOM   623  C  CD2 . PHE A 1 84  ? 27.852 18.390 8.117  1.00 15.27  ? 534 PHE A CD2 1 
ATOM   624  C  CE1 . PHE A 1 84  ? 26.354 20.336 6.818  1.00 11.73  ? 534 PHE A CE1 1 
ATOM   625  C  CE2 . PHE A 1 84  ? 27.168 18.058 6.975  1.00 11.55  ? 534 PHE A CE2 1 
ATOM   626  C  CZ  . PHE A 1 84  ? 26.411 19.037 6.317  1.00 17.94  ? 534 PHE A CZ  1 
ATOM   627  N  N   . PHE A 1 85  ? 29.070 18.768 12.919 1.00 13.29  ? 535 PHE A N   1 
ATOM   628  C  CA  . PHE A 1 85  ? 30.000 18.677 14.048 1.00 8.99   ? 535 PHE A CA  1 
ATOM   629  C  C   . PHE A 1 85  ? 31.297 18.063 13.562 1.00 9.30   ? 535 PHE A C   1 
ATOM   630  O  O   . PHE A 1 85  ? 31.284 17.117 12.785 1.00 14.75  ? 535 PHE A O   1 
ATOM   631  C  CB  . PHE A 1 85  ? 29.416 17.804 15.173 1.00 9.44   ? 535 PHE A CB  1 
ATOM   632  C  CG  . PHE A 1 85  ? 28.177 18.393 15.831 1.00 14.62  ? 535 PHE A CG  1 
ATOM   633  C  CD1 . PHE A 1 85  ? 28.295 19.281 16.917 1.00 14.51  ? 535 PHE A CD1 1 
ATOM   634  C  CD2 . PHE A 1 85  ? 26.901 18.105 15.336 1.00 8.10   ? 535 PHE A CD2 1 
ATOM   635  C  CE1 . PHE A 1 85  ? 27.162 19.880 17.498 1.00 16.13  ? 535 PHE A CE1 1 
ATOM   636  C  CE2 . PHE A 1 85  ? 25.760 18.696 15.906 1.00 15.14  ? 535 PHE A CE2 1 
ATOM   637  C  CZ  . PHE A 1 85  ? 25.892 19.593 16.997 1.00 13.52  ? 535 PHE A CZ  1 
ATOM   638  N  N   . ALA A 1 86  ? 32.419 18.614 13.988 1.00 8.42   ? 536 ALA A N   1 
ATOM   639  C  CA  . ALA A 1 86  ? 33.704 18.071 13.585 1.00 10.75  ? 536 ALA A CA  1 
ATOM   640  C  C   . ALA A 1 86  ? 34.732 18.516 14.611 1.00 14.13  ? 536 ALA A C   1 
ATOM   641  O  O   . ALA A 1 86  ? 35.081 19.685 14.680 1.00 20.20  ? 536 ALA A O   1 
ATOM   642  C  CB  . ALA A 1 86  ? 34.070 18.547 12.191 1.00 7.30   ? 536 ALA A CB  1 
ATOM   643  N  N   . GLY A 1 87  ? 35.190 17.569 15.424 1.00 17.41  ? 537 GLY A N   1 
ATOM   644  C  CA  . GLY A 1 87  ? 36.142 17.869 16.476 1.00 18.80  ? 537 GLY A CA  1 
ATOM   645  C  C   . GLY A 1 87  ? 35.397 18.632 17.559 1.00 20.28  ? 537 GLY A C   1 
ATOM   646  O  O   . GLY A 1 87  ? 34.296 18.234 17.964 1.00 17.56  ? 537 GLY A O   1 
ATOM   647  N  N   . ASN A 1 88  ? 35.982 19.743 17.999 1.00 19.27  ? 538 ASN A N   1 
ATOM   648  C  CA  . ASN A 1 88  ? 35.366 20.597 19.007 1.00 19.23  ? 538 ASN A CA  1 
ATOM   649  C  C   . ASN A 1 88  ? 34.740 21.830 18.334 1.00 15.67  ? 538 ASN A C   1 
ATOM   650  O  O   . ASN A 1 88  ? 34.745 22.915 18.893 1.00 18.10  ? 538 ASN A O   1 
ATOM   651  C  CB  . ASN A 1 88  ? 36.389 21.015 20.078 1.00 22.49  ? 538 ASN A CB  1 
ATOM   652  C  CG  . ASN A 1 88  ? 37.591 21.735 19.490 1.00 33.86  ? 538 ASN A CG  1 
ATOM   653  O  OD1 . ASN A 1 88  ? 38.494 21.101 18.956 1.00 42.24  ? 538 ASN A OD1 1 
ATOM   654  N  ND2 . ASN A 1 88  ? 37.593 23.067 19.560 1.00 40.26  ? 538 ASN A ND2 1 
ATOM   655  N  N   . GLU A 1 89  ? 34.210 21.663 17.124 1.00 12.18  ? 539 GLU A N   1 
ATOM   656  C  CA  . GLU A 1 89  ? 33.571 22.768 16.419 1.00 8.62   ? 539 GLU A CA  1 
ATOM   657  C  C   . GLU A 1 89  ? 32.333 22.346 15.638 1.00 7.05   ? 539 GLU A C   1 
ATOM   658  O  O   . GLU A 1 89  ? 32.125 21.161 15.366 1.00 5.43   ? 539 GLU A O   1 
ATOM   659  C  CB  . GLU A 1 89  ? 34.536 23.423 15.445 1.00 5.88   ? 539 GLU A CB  1 
ATOM   660  C  CG  . GLU A 1 89  ? 35.905 23.658 15.986 1.00 13.48  ? 539 GLU A CG  1 
ATOM   661  C  CD  . GLU A 1 89  ? 36.758 24.472 15.058 1.00 15.49  ? 539 GLU A CD  1 
ATOM   662  O  OE1 . GLU A 1 89  ? 37.357 23.897 14.125 1.00 24.66  ? 539 GLU A OE1 1 
ATOM   663  O  OE2 . GLU A 1 89  ? 36.827 25.698 15.263 1.00 23.87  ? 539 GLU A OE2 1 
ATOM   664  N  N   . TYR A 1 90  ? 31.504 23.331 15.302 1.00 4.56   ? 540 TYR A N   1 
ATOM   665  C  CA  . TYR A 1 90  ? 30.319 23.086 14.500 1.00 7.97   ? 540 TYR A CA  1 
ATOM   666  C  C   . TYR A 1 90  ? 30.098 24.240 13.511 1.00 9.40   ? 540 TYR A C   1 
ATOM   667  O  O   . TYR A 1 90  ? 30.512 25.375 13.751 1.00 11.16  ? 540 TYR A O   1 
ATOM   668  C  CB  . TYR A 1 90  ? 29.076 22.814 15.368 1.00 6.58   ? 540 TYR A CB  1 
ATOM   669  C  CG  . TYR A 1 90  ? 28.564 24.001 16.146 1.00 8.44   ? 540 TYR A CG  1 
ATOM   670  C  CD1 . TYR A 1 90  ? 29.289 24.530 17.222 1.00 9.24   ? 540 TYR A CD1 1 
ATOM   671  C  CD2 . TYR A 1 90  ? 27.363 24.610 15.804 1.00 7.05   ? 540 TYR A CD2 1 
ATOM   672  C  CE1 . TYR A 1 90  ? 28.827 25.635 17.927 1.00 4.29   ? 540 TYR A CE1 1 
ATOM   673  C  CE2 . TYR A 1 90  ? 26.889 25.720 16.508 1.00 3.73   ? 540 TYR A CE2 1 
ATOM   674  C  CZ  . TYR A 1 90  ? 27.630 26.220 17.562 1.00 2.44   ? 540 TYR A CZ  1 
ATOM   675  O  OH  . TYR A 1 90  ? 27.178 27.313 18.241 1.00 10.20  ? 540 TYR A OH  1 
ATOM   676  N  N   . TRP A 1 91  ? 29.562 23.887 12.349 1.00 10.96  ? 541 TRP A N   1 
ATOM   677  C  CA  . TRP A 1 91  ? 29.258 24.808 11.259 1.00 7.05   ? 541 TRP A CA  1 
ATOM   678  C  C   . TRP A 1 91  ? 27.749 24.723 11.049 1.00 8.79   ? 541 TRP A C   1 
ATOM   679  O  O   . TRP A 1 91  ? 27.167 23.665 11.286 1.00 10.06  ? 541 TRP A O   1 
ATOM   680  C  CB  . TRP A 1 91  ? 29.899 24.314 9.954  1.00 9.57   ? 541 TRP A CB  1 
ATOM   681  C  CG  . TRP A 1 91  ? 31.390 24.354 9.835  1.00 3.84   ? 541 TRP A CG  1 
ATOM   682  C  CD1 . TRP A 1 91  ? 32.116 25.214 9.068  1.00 9.76   ? 541 TRP A CD1 1 
ATOM   683  C  CD2 . TRP A 1 91  ? 32.337 23.508 10.497 1.00 3.97   ? 541 TRP A CD2 1 
ATOM   684  N  NE1 . TRP A 1 91  ? 33.460 24.970 9.220  1.00 7.95   ? 541 TRP A NE1 1 
ATOM   685  C  CE2 . TRP A 1 91  ? 33.623 23.924 10.090 1.00 7.03   ? 541 TRP A CE2 1 
ATOM   686  C  CE3 . TRP A 1 91  ? 32.228 22.442 11.395 1.00 5.31   ? 541 TRP A CE3 1 
ATOM   687  C  CZ2 . TRP A 1 91  ? 34.793 23.308 10.554 1.00 6.87   ? 541 TRP A CZ2 1 
ATOM   688  C  CZ3 . TRP A 1 91  ? 33.398 21.830 11.857 1.00 8.26   ? 541 TRP A CZ3 1 
ATOM   689  C  CH2 . TRP A 1 91  ? 34.659 22.266 11.437 1.00 2.00   ? 541 TRP A CH2 1 
ATOM   690  N  N   . ILE A 1 92  ? 27.126 25.820 10.608 1.00 10.87  ? 542 ILE A N   1 
ATOM   691  C  CA  . ILE A 1 92  ? 25.683 25.849 10.311 1.00 13.62  ? 542 ILE A CA  1 
ATOM   692  C  C   . ILE A 1 92  ? 25.496 26.466 8.919  1.00 15.10  ? 542 ILE A C   1 
ATOM   693  O  O   . ILE A 1 92  ? 26.030 27.541 8.622  1.00 19.22  ? 542 ILE A O   1 
ATOM   694  C  CB  . ILE A 1 92  ? 24.862 26.615 11.370 1.00 11.11  ? 542 ILE A CB  1 
ATOM   695  C  CG1 . ILE A 1 92  ? 24.848 25.847 12.679 1.00 9.50   ? 542 ILE A CG1 1 
ATOM   696  C  CG2 . ILE A 1 92  ? 23.429 26.772 10.928 1.00 5.79   ? 542 ILE A CG2 1 
ATOM   697  C  CD1 . ILE A 1 92  ? 23.990 26.492 13.726 1.00 11.24  ? 542 ILE A CD1 1 
ATOM   698  N  N   . TYR A 1 93  ? 24.779 25.750 8.061  1.00 16.54  ? 543 TYR A N   1 
ATOM   699  C  CA  . TYR A 1 93  ? 24.556 26.156 6.671  1.00 16.48  ? 543 TYR A CA  1 
ATOM   700  C  C   . TYR A 1 93  ? 23.105 26.345 6.328  1.00 15.91  ? 543 TYR A C   1 
ATOM   701  O  O   . TYR A 1 93  ? 22.256 25.653 6.859  1.00 15.42  ? 543 TYR A O   1 
ATOM   702  C  CB  . TYR A 1 93  ? 25.032 25.054 5.723  1.00 14.63  ? 543 TYR A CB  1 
ATOM   703  C  CG  . TYR A 1 93  ? 26.506 24.950 5.504  1.00 17.34  ? 543 TYR A CG  1 
ATOM   704  C  CD1 . TYR A 1 93  ? 27.303 24.198 6.359  1.00 21.36  ? 543 TYR A CD1 1 
ATOM   705  C  CD2 . TYR A 1 93  ? 27.111 25.580 4.415  1.00 18.34  ? 543 TYR A CD2 1 
ATOM   706  C  CE1 . TYR A 1 93  ? 28.680 24.075 6.134  1.00 22.00  ? 543 TYR A CE1 1 
ATOM   707  C  CE2 . TYR A 1 93  ? 28.476 25.464 4.182  1.00 18.08  ? 543 TYR A CE2 1 
ATOM   708  C  CZ  . TYR A 1 93  ? 29.253 24.716 5.045  1.00 19.91  ? 543 TYR A CZ  1 
ATOM   709  O  OH  . TYR A 1 93  ? 30.603 24.640 4.850  1.00 22.67  ? 543 TYR A OH  1 
ATOM   710  N  N   . SER A 1 94  ? 22.827 27.261 5.410  1.00 24.59  ? 544 SER A N   1 
ATOM   711  C  CA  . SER A 1 94  ? 21.461 27.434 4.951  1.00 34.75  ? 544 SER A CA  1 
ATOM   712  C  C   . SER A 1 94  ? 21.294 26.297 3.932  1.00 38.24  ? 544 SER A C   1 
ATOM   713  O  O   . SER A 1 94  ? 20.503 25.362 4.138  1.00 44.70  ? 544 SER A O   1 
ATOM   714  C  CB  . SER A 1 94  ? 21.267 28.775 4.274  1.00 40.53  ? 544 SER A CB  1 
ATOM   715  O  OG  . SER A 1 94  ? 19.943 28.865 3.767  1.00 55.78  ? 544 SER A OG  1 
ATOM   716  N  N   . ALA A 1 95  ? 22.016 26.380 2.822  1.00 34.66  ? 545 ALA A N   1 
ATOM   717  C  CA  . ALA A 1 95  ? 21.971 25.298 1.840  1.00 35.26  ? 545 ALA A CA  1 
ATOM   718  C  C   . ALA A 1 95  ? 23.425 24.894 1.695  1.00 34.22  ? 545 ALA A C   1 
ATOM   719  O  O   . ALA A 1 95  ? 23.886 23.955 2.350  1.00 32.91  ? 545 ALA A O   1 
ATOM   720  C  CB  . ALA A 1 95  ? 21.400 25.776 0.518  1.00 32.94  ? 545 ALA A CB  1 
ATOM   721  N  N   . SER A 1 96  ? 24.148 25.661 0.887  1.00 31.91  ? 546 SER A N   1 
ATOM   722  C  CA  . SER A 1 96  ? 25.572 25.460 0.668  1.00 31.86  ? 546 SER A CA  1 
ATOM   723  C  C   . SER A 1 96  ? 26.208 26.782 1.096  1.00 33.37  ? 546 SER A C   1 
ATOM   724  O  O   . SER A 1 96  ? 27.402 27.041 0.850  1.00 28.59  ? 546 SER A O   1 
ATOM   725  C  CB  . SER A 1 96  ? 25.854 25.173 -0.807 1.00 30.98  ? 546 SER A CB  1 
ATOM   726  O  OG  . SER A 1 96  ? 25.210 23.977 -1.217 1.00 32.85  ? 546 SER A OG  1 
ATOM   727  N  N   . THR A 1 97  ? 25.379 27.603 1.750  1.00 30.78  ? 547 THR A N   1 
ATOM   728  C  CA  . THR A 1 97  ? 25.768 28.914 2.251  1.00 29.67  ? 547 THR A CA  1 
ATOM   729  C  C   . THR A 1 97  ? 26.087 28.882 3.751  1.00 26.28  ? 547 THR A C   1 
ATOM   730  O  O   . THR A 1 97  ? 25.174 28.756 4.601  1.00 23.13  ? 547 THR A O   1 
ATOM   731  C  CB  . THR A 1 97  ? 24.640 29.932 2.025  1.00 29.01  ? 547 THR A CB  1 
ATOM   732  O  OG1 . THR A 1 97  ? 24.148 29.808 0.684  1.00 35.04  ? 547 THR A OG1 1 
ATOM   733  C  CG2 . THR A 1 97  ? 25.144 31.341 2.263  1.00 22.88  ? 547 THR A CG2 1 
ATOM   734  N  N   . LEU A 1 98  ? 27.370 29.001 4.072  1.00 19.16  ? 548 LEU A N   1 
ATOM   735  C  CA  . LEU A 1 98  ? 27.805 29.003 5.455  1.00 17.78  ? 548 LEU A CA  1 
ATOM   736  C  C   . LEU A 1 98  ? 27.297 30.270 6.142  1.00 20.46  ? 548 LEU A C   1 
ATOM   737  O  O   . LEU A 1 98  ? 27.363 31.365 5.575  1.00 22.73  ? 548 LEU A O   1 
ATOM   738  C  CB  . LEU A 1 98  ? 29.327 28.933 5.537  1.00 11.07  ? 548 LEU A CB  1 
ATOM   739  C  CG  . LEU A 1 98  ? 29.881 28.665 6.936  1.00 11.92  ? 548 LEU A CG  1 
ATOM   740  C  CD1 . LEU A 1 98  ? 29.325 27.370 7.453  1.00 15.17  ? 548 LEU A CD1 1 
ATOM   741  C  CD2 . LEU A 1 98  ? 31.390 28.614 6.901  1.00 13.63  ? 548 LEU A CD2 1 
ATOM   742  N  N   . GLU A 1 99  ? 26.753 30.107 7.346  1.00 20.28  ? 549 GLU A N   1 
ATOM   743  C  CA  . GLU A 1 99  ? 26.237 31.229 8.118  1.00 19.08  ? 549 GLU A CA  1 
ATOM   744  C  C   . GLU A 1 99  ? 27.346 32.094 8.681  1.00 17.73  ? 549 GLU A C   1 
ATOM   745  O  O   . GLU A 1 99  ? 28.457 31.633 8.875  1.00 20.11  ? 549 GLU A O   1 
ATOM   746  C  CB  . GLU A 1 99  ? 25.373 30.708 9.246  1.00 23.34  ? 549 GLU A CB  1 
ATOM   747  C  CG  . GLU A 1 99  ? 24.173 29.937 8.760  1.00 31.66  ? 549 GLU A CG  1 
ATOM   748  C  CD  . GLU A 1 99  ? 22.891 30.613 9.148  1.00 38.38  ? 549 GLU A CD  1 
ATOM   749  O  OE1 . GLU A 1 99  ? 22.554 30.572 10.353 1.00 48.33  ? 549 GLU A OE1 1 
ATOM   750  O  OE2 . GLU A 1 99  ? 22.236 31.204 8.262  1.00 43.46  ? 549 GLU A OE2 1 
ATOM   751  N  N   . ARG A 1 100 ? 27.027 33.344 8.984  1.00 23.52  ? 550 ARG A N   1 
ATOM   752  C  CA  . ARG A 1 100 ? 28.012 34.285 9.514  1.00 26.19  ? 550 ARG A CA  1 
ATOM   753  C  C   . ARG A 1 100 ? 28.417 33.933 10.957 1.00 24.49  ? 550 ARG A C   1 
ATOM   754  O  O   . ARG A 1 100 ? 27.552 33.714 11.823 1.00 21.32  ? 550 ARG A O   1 
ATOM   755  C  CB  . ARG A 1 100 ? 27.437 35.701 9.431  1.00 38.09  ? 550 ARG A CB  1 
ATOM   756  C  CG  . ARG A 1 100 ? 28.345 36.827 9.935  1.00 57.26  ? 550 ARG A CG  1 
ATOM   757  C  CD  . ARG A 1 100 ? 27.514 37.973 10.533 1.00 67.59  ? 550 ARG A CD  1 
ATOM   758  N  NE  . ARG A 1 100 ? 26.554 37.468 11.527 1.00 78.64  ? 550 ARG A NE  1 
ATOM   759  C  CZ  . ARG A 1 100 ? 25.928 38.211 12.440 1.00 83.71  ? 550 ARG A CZ  1 
ATOM   760  N  NH1 . ARG A 1 100 ? 26.150 39.522 12.515 1.00 86.91  ? 550 ARG A NH1 1 
ATOM   761  N  NH2 . ARG A 1 100 ? 25.053 37.642 13.267 1.00 83.83  ? 550 ARG A NH2 1 
ATOM   762  N  N   . GLY A 1 101 ? 29.728 33.843 11.192 1.00 18.37  ? 551 GLY A N   1 
ATOM   763  C  CA  . GLY A 1 101 ? 30.240 33.520 12.515 1.00 18.25  ? 551 GLY A CA  1 
ATOM   764  C  C   . GLY A 1 101 ? 30.569 32.064 12.835 1.00 20.95  ? 551 GLY A C   1 
ATOM   765  O  O   . GLY A 1 101 ? 30.861 31.764 13.990 1.00 23.18  ? 551 GLY A O   1 
ATOM   766  N  N   . TYR A 1 102 ? 30.514 31.170 11.839 1.00 21.01  ? 552 TYR A N   1 
ATOM   767  C  CA  . TYR A 1 102 ? 30.821 29.737 12.006 1.00 16.79  ? 552 TYR A CA  1 
ATOM   768  C  C   . TYR A 1 102 ? 32.110 29.353 11.255 1.00 17.51  ? 552 TYR A C   1 
ATOM   769  O  O   . TYR A 1 102 ? 32.432 29.959 10.221 1.00 21.78  ? 552 TYR A O   1 
ATOM   770  C  CB  . TYR A 1 102 ? 29.645 28.877 11.511 1.00 16.74  ? 552 TYR A CB  1 
ATOM   771  C  CG  . TYR A 1 102 ? 28.370 29.053 12.320 1.00 10.88  ? 552 TYR A CG  1 
ATOM   772  C  CD1 . TYR A 1 102 ? 27.461 30.057 12.014 1.00 10.54  ? 552 TYR A CD1 1 
ATOM   773  C  CD2 . TYR A 1 102 ? 28.111 28.253 13.430 1.00 10.60  ? 552 TYR A CD2 1 
ATOM   774  C  CE1 . TYR A 1 102 ? 26.330 30.270 12.798 1.00 10.24  ? 552 TYR A CE1 1 
ATOM   775  C  CE2 . TYR A 1 102 ? 26.986 28.454 14.217 1.00 10.21  ? 552 TYR A CE2 1 
ATOM   776  C  CZ  . TYR A 1 102 ? 26.105 29.465 13.900 1.00 13.44  ? 552 TYR A CZ  1 
ATOM   777  O  OH  . TYR A 1 102 ? 25.012 29.692 14.702 1.00 14.32  ? 552 TYR A OH  1 
ATOM   778  N  N   . PRO A 1 103 ? 32.857 28.339 11.749 1.00 13.64  ? 553 PRO A N   1 
ATOM   779  C  CA  . PRO A 1 103 ? 32.678 27.476 12.925 1.00 13.79  ? 553 PRO A CA  1 
ATOM   780  C  C   . PRO A 1 103 ? 32.744 28.160 14.297 1.00 16.74  ? 553 PRO A C   1 
ATOM   781  O  O   . PRO A 1 103 ? 33.415 29.182 14.479 1.00 23.45  ? 553 PRO A O   1 
ATOM   782  C  CB  . PRO A 1 103 ? 33.807 26.452 12.769 1.00 7.07   ? 553 PRO A CB  1 
ATOM   783  C  CG  . PRO A 1 103 ? 34.887 27.229 12.123 1.00 2.47   ? 553 PRO A CG  1 
ATOM   784  C  CD  . PRO A 1 103 ? 34.145 28.051 11.088 1.00 6.32   ? 553 PRO A CD  1 
ATOM   785  N  N   . LYS A 1 104 ? 31.995 27.605 15.238 1.00 12.24  ? 554 LYS A N   1 
ATOM   786  C  CA  . LYS A 1 104 ? 31.972 28.085 16.601 1.00 11.61  ? 554 LYS A CA  1 
ATOM   787  C  C   . LYS A 1 104 ? 32.371 26.912 17.500 1.00 14.56  ? 554 LYS A C   1 
ATOM   788  O  O   . LYS A 1 104 ? 32.094 25.762 17.155 1.00 17.22  ? 554 LYS A O   1 
ATOM   789  C  CB  . LYS A 1 104 ? 30.557 28.528 16.977 1.00 8.60   ? 554 LYS A CB  1 
ATOM   790  C  CG  . LYS A 1 104 ? 30.114 29.806 16.321 1.00 5.75   ? 554 LYS A CG  1 
ATOM   791  C  CD  . LYS A 1 104 ? 28.732 30.192 16.810 1.00 8.79   ? 554 LYS A CD  1 
ATOM   792  C  CE  . LYS A 1 104 ? 28.179 31.359 16.032 1.00 2.48   ? 554 LYS A CE  1 
ATOM   793  N  NZ  . LYS A 1 104 ? 29.117 32.492 16.047 1.00 8.29   ? 554 LYS A NZ  1 
ATOM   794  N  N   . PRO A 1 105 ? 33.097 27.172 18.613 1.00 12.99  ? 555 PRO A N   1 
ATOM   795  C  CA  . PRO A 1 105 ? 33.471 26.066 19.499 1.00 12.82  ? 555 PRO A CA  1 
ATOM   796  C  C   . PRO A 1 105 ? 32.192 25.457 20.118 1.00 14.19  ? 555 PRO A C   1 
ATOM   797  O  O   . PRO A 1 105 ? 31.215 26.177 20.396 1.00 14.61  ? 555 PRO A O   1 
ATOM   798  C  CB  . PRO A 1 105 ? 34.359 26.757 20.551 1.00 10.11  ? 555 PRO A CB  1 
ATOM   799  C  CG  . PRO A 1 105 ? 33.883 28.163 20.555 1.00 2.00   ? 555 PRO A CG  1 
ATOM   800  C  CD  . PRO A 1 105 ? 33.703 28.431 19.084 1.00 13.33  ? 555 PRO A CD  1 
ATOM   801  N  N   . LEU A 1 106 ? 32.200 24.150 20.360 1.00 10.64  ? 556 LEU A N   1 
ATOM   802  C  CA  . LEU A 1 106 ? 31.029 23.469 20.907 1.00 10.18  ? 556 LEU A CA  1 
ATOM   803  C  C   . LEU A 1 106 ? 30.415 24.152 22.116 1.00 9.21   ? 556 LEU A C   1 
ATOM   804  O  O   . LEU A 1 106 ? 29.216 23.992 22.391 1.00 11.50  ? 556 LEU A O   1 
ATOM   805  C  CB  . LEU A 1 106 ? 31.352 22.014 21.263 1.00 9.10   ? 556 LEU A CB  1 
ATOM   806  C  CG  . LEU A 1 106 ? 31.906 21.109 20.161 1.00 14.54  ? 556 LEU A CG  1 
ATOM   807  C  CD1 . LEU A 1 106 ? 32.127 19.699 20.728 1.00 9.07   ? 556 LEU A CD1 1 
ATOM   808  C  CD2 . LEU A 1 106 ? 30.971 21.091 18.937 1.00 11.21  ? 556 LEU A CD2 1 
ATOM   809  N  N   . THR A 1 107 ? 31.233 24.887 22.860 1.00 8.41   ? 557 THR A N   1 
ATOM   810  C  CA  . THR A 1 107 ? 30.759 25.582 24.050 1.00 5.18   ? 557 THR A CA  1 
ATOM   811  C  C   . THR A 1 107 ? 29.759 26.673 23.727 1.00 7.07   ? 557 THR A C   1 
ATOM   812  O  O   . THR A 1 107 ? 28.974 27.039 24.579 1.00 13.03  ? 557 THR A O   1 
ATOM   813  C  CB  . THR A 1 107 ? 31.916 26.141 24.903 1.00 5.54   ? 557 THR A CB  1 
ATOM   814  O  OG1 . THR A 1 107 ? 32.775 26.958 24.101 1.00 9.60   ? 557 THR A OG1 1 
ATOM   815  C  CG2 . THR A 1 107 ? 32.728 25.016 25.478 1.00 2.00   ? 557 THR A CG2 1 
ATOM   816  N  N   . SER A 1 108 ? 29.731 27.148 22.483 1.00 7.07   ? 558 SER A N   1 
ATOM   817  C  CA  . SER A 1 108 ? 28.761 28.169 22.128 1.00 9.61   ? 558 SER A CA  1 
ATOM   818  C  C   . SER A 1 108 ? 27.360 27.603 22.079 1.00 12.32  ? 558 SER A C   1 
ATOM   819  O  O   . SER A 1 108 ? 26.389 28.346 22.052 1.00 23.27  ? 558 SER A O   1 
ATOM   820  C  CB  . SER A 1 108 ? 29.104 28.807 20.807 1.00 3.62   ? 558 SER A CB  1 
ATOM   821  O  OG  . SER A 1 108 ? 30.320 29.509 20.943 1.00 20.60  ? 558 SER A OG  1 
ATOM   822  N  N   . LEU A 1 109 ? 27.270 26.279 22.128 1.00 16.11  ? 559 LEU A N   1 
ATOM   823  C  CA  . LEU A 1 109 ? 26.006 25.545 22.095 1.00 13.03  ? 559 LEU A CA  1 
ATOM   824  C  C   . LEU A 1 109 ? 25.591 25.181 23.540 1.00 11.43  ? 559 LEU A C   1 
ATOM   825  O  O   . LEU A 1 109 ? 24.480 24.702 23.782 1.00 13.00  ? 559 LEU A O   1 
ATOM   826  C  CB  . LEU A 1 109 ? 26.210 24.282 21.231 1.00 14.50  ? 559 LEU A CB  1 
ATOM   827  C  CG  . LEU A 1 109 ? 25.168 23.536 20.383 1.00 12.33  ? 559 LEU A CG  1 
ATOM   828  C  CD1 . LEU A 1 109 ? 24.541 24.435 19.349 1.00 5.51   ? 559 LEU A CD1 1 
ATOM   829  C  CD2 . LEU A 1 109 ? 25.869 22.374 19.682 1.00 7.75   ? 559 LEU A CD2 1 
ATOM   830  N  N   . GLY A 1 110 ? 26.459 25.482 24.501 1.00 8.74   ? 560 GLY A N   1 
ATOM   831  C  CA  . GLY A 1 110 ? 26.169 25.162 25.885 1.00 10.67  ? 560 GLY A CA  1 
ATOM   832  C  C   . GLY A 1 110 ? 26.744 23.827 26.362 1.00 16.70  ? 560 GLY A C   1 
ATOM   833  O  O   . GLY A 1 110 ? 26.370 23.330 27.428 1.00 16.24  ? 560 GLY A O   1 
ATOM   834  N  N   . LEU A 1 111 ? 27.599 23.210 25.555 1.00 14.85  ? 561 LEU A N   1 
ATOM   835  C  CA  . LEU A 1 111 ? 28.231 21.953 25.925 1.00 13.66  ? 561 LEU A CA  1 
ATOM   836  C  C   . LEU A 1 111 ? 29.430 22.302 26.812 1.00 17.45  ? 561 LEU A C   1 
ATOM   837  O  O   . LEU A 1 111 ? 30.043 23.353 26.629 1.00 22.80  ? 561 LEU A O   1 
ATOM   838  C  CB  . LEU A 1 111 ? 28.700 21.217 24.664 1.00 17.01  ? 561 LEU A CB  1 
ATOM   839  C  CG  . LEU A 1 111 ? 27.679 20.489 23.777 1.00 14.50  ? 561 LEU A CG  1 
ATOM   840  C  CD1 . LEU A 1 111 ? 28.338 20.053 22.471 1.00 11.42  ? 561 LEU A CD1 1 
ATOM   841  C  CD2 . LEU A 1 111 ? 27.104 19.280 24.513 1.00 4.88   ? 561 LEU A CD2 1 
ATOM   842  N  N   . PRO A 1 112 ? 29.778 21.440 27.793 1.00 19.08  ? 562 PRO A N   1 
ATOM   843  C  CA  . PRO A 1 112 ? 30.919 21.733 28.671 1.00 18.65  ? 562 PRO A CA  1 
ATOM   844  C  C   . PRO A 1 112 ? 32.262 21.634 27.928 1.00 17.87  ? 562 PRO A C   1 
ATOM   845  O  O   . PRO A 1 112 ? 32.402 20.834 27.011 1.00 23.49  ? 562 PRO A O   1 
ATOM   846  C  CB  . PRO A 1 112 ? 30.762 20.687 29.779 1.00 17.09  ? 562 PRO A CB  1 
ATOM   847  C  CG  . PRO A 1 112 ? 30.192 19.531 29.052 1.00 21.45  ? 562 PRO A CG  1 
ATOM   848  C  CD  . PRO A 1 112 ? 29.152 20.157 28.164 1.00 19.72  ? 562 PRO A CD  1 
ATOM   849  N  N   . PRO A 1 113 ? 33.292 22.369 28.391 1.00 15.16  ? 563 PRO A N   1 
ATOM   850  C  CA  . PRO A 1 113 ? 34.641 22.421 27.810 1.00 12.75  ? 563 PRO A CA  1 
ATOM   851  C  C   . PRO A 1 113 ? 35.330 21.079 27.628 1.00 15.71  ? 563 PRO A C   1 
ATOM   852  O  O   . PRO A 1 113 ? 36.223 20.942 26.812 1.00 14.58  ? 563 PRO A O   1 
ATOM   853  C  CB  . PRO A 1 113 ? 35.418 23.265 28.821 1.00 11.40  ? 563 PRO A CB  1 
ATOM   854  C  CG  . PRO A 1 113 ? 34.397 24.048 29.508 1.00 13.39  ? 563 PRO A CG  1 
ATOM   855  C  CD  . PRO A 1 113 ? 33.283 23.064 29.684 1.00 14.13  ? 563 PRO A CD  1 
ATOM   856  N  N   . ASP A 1 114 ? 34.957 20.117 28.458 1.00 20.71  ? 564 ASP A N   1 
ATOM   857  C  CA  . ASP A 1 114 ? 35.549 18.790 28.421 1.00 23.28  ? 564 ASP A CA  1 
ATOM   858  C  C   . ASP A 1 114 ? 35.126 17.957 27.210 1.00 24.16  ? 564 ASP A C   1 
ATOM   859  O  O   . ASP A 1 114 ? 35.875 17.087 26.768 1.00 28.20  ? 564 ASP A O   1 
ATOM   860  C  CB  . ASP A 1 114 ? 35.229 18.057 29.727 1.00 22.59  ? 564 ASP A CB  1 
ATOM   861  C  CG  . ASP A 1 114 ? 33.811 18.304 30.193 1.00 33.04  ? 564 ASP A CG  1 
ATOM   862  O  OD1 . ASP A 1 114 ? 32.903 17.590 29.726 1.00 40.56  ? 564 ASP A OD1 1 
ATOM   863  O  OD2 . ASP A 1 114 ? 33.589 19.237 31.000 1.00 45.44  ? 564 ASP A OD2 1 
ATOM   864  N  N   . VAL A 1 115 ? 33.934 18.223 26.678 1.00 21.46  ? 565 VAL A N   1 
ATOM   865  C  CA  . VAL A 1 115 ? 33.426 17.485 25.532 1.00 15.72  ? 565 VAL A CA  1 
ATOM   866  C  C   . VAL A 1 115 ? 34.252 17.923 24.334 1.00 19.59  ? 565 VAL A C   1 
ATOM   867  O  O   . VAL A 1 115 ? 34.218 19.085 23.948 1.00 25.58  ? 565 VAL A O   1 
ATOM   868  C  CB  . VAL A 1 115 ? 31.915 17.760 25.318 1.00 10.89  ? 565 VAL A CB  1 
ATOM   869  C  CG1 . VAL A 1 115 ? 31.432 17.159 24.010 1.00 15.61  ? 565 VAL A CG1 1 
ATOM   870  C  CG2 . VAL A 1 115 ? 31.111 17.151 26.452 1.00 11.93  ? 565 VAL A CG2 1 
ATOM   871  N  N   . GLN A 1 116 ? 35.012 16.992 23.763 1.00 23.22  ? 566 GLN A N   1 
ATOM   872  C  CA  . GLN A 1 116 ? 35.885 17.290 22.620 1.00 25.12  ? 566 GLN A CA  1 
ATOM   873  C  C   . GLN A 1 116 ? 35.484 16.665 21.271 1.00 22.98  ? 566 GLN A C   1 
ATOM   874  O  O   . GLN A 1 116 ? 36.111 16.920 20.244 1.00 20.32  ? 566 GLN A O   1 
ATOM   875  C  CB  . GLN A 1 116 ? 37.316 16.880 22.974 1.00 33.46  ? 566 GLN A CB  1 
ATOM   876  C  CG  . GLN A 1 116 ? 37.900 17.605 24.207 1.00 44.25  ? 566 GLN A CG  1 
ATOM   877  C  CD  . GLN A 1 116 ? 38.398 19.017 23.902 1.00 46.33  ? 566 GLN A CD  1 
ATOM   878  O  OE1 . GLN A 1 116 ? 39.592 19.279 23.964 1.00 50.53  ? 566 GLN A OE1 1 
ATOM   879  N  NE2 . GLN A 1 116 ? 37.482 19.928 23.580 1.00 46.49  ? 566 GLN A NE2 1 
ATOM   880  N  N   . ARG A 1 117 ? 34.417 15.876 21.282 1.00 22.18  ? 567 ARG A N   1 
ATOM   881  C  CA  . ARG A 1 117 ? 33.926 15.195 20.093 1.00 20.18  ? 567 ARG A CA  1 
ATOM   882  C  C   . ARG A 1 117 ? 32.486 14.753 20.356 1.00 15.03  ? 567 ARG A C   1 
ATOM   883  O  O   . ARG A 1 117 ? 32.147 14.435 21.472 1.00 20.16  ? 567 ARG A O   1 
ATOM   884  C  CB  . ARG A 1 117 ? 34.838 13.994 19.802 1.00 21.46  ? 567 ARG A CB  1 
ATOM   885  C  CG  . ARG A 1 117 ? 34.281 12.922 18.891 1.00 34.32  ? 567 ARG A CG  1 
ATOM   886  C  CD  . ARG A 1 117 ? 35.412 12.197 18.174 1.00 45.27  ? 567 ARG A CD  1 
ATOM   887  N  NE  . ARG A 1 117 ? 36.089 13.082 17.221 1.00 57.44  ? 567 ARG A NE  1 
ATOM   888  C  CZ  . ARG A 1 117 ? 37.281 13.647 17.414 1.00 59.64  ? 567 ARG A CZ  1 
ATOM   889  N  NH1 . ARG A 1 117 ? 37.962 13.420 18.534 1.00 63.10  ? 567 ARG A NH1 1 
ATOM   890  N  NH2 . ARG A 1 117 ? 37.767 14.492 16.509 1.00 56.86  ? 567 ARG A NH2 1 
ATOM   891  N  N   . VAL A 1 118 ? 31.641 14.818 19.335 1.00 11.13  ? 568 VAL A N   1 
ATOM   892  C  CA  . VAL A 1 118 ? 30.244 14.421 19.430 1.00 9.68   ? 568 VAL A CA  1 
ATOM   893  C  C   . VAL A 1 118 ? 30.080 13.091 18.666 1.00 10.83  ? 568 VAL A C   1 
ATOM   894  O  O   . VAL A 1 118 ? 30.812 12.843 17.694 1.00 17.28  ? 568 VAL A O   1 
ATOM   895  C  CB  . VAL A 1 118 ? 29.341 15.556 18.853 1.00 11.73  ? 568 VAL A CB  1 
ATOM   896  C  CG1 . VAL A 1 118 ? 27.969 15.057 18.518 1.00 14.92  ? 568 VAL A CG1 1 
ATOM   897  C  CG2 . VAL A 1 118 ? 29.212 16.677 19.871 1.00 13.51  ? 568 VAL A CG2 1 
ATOM   898  N  N   . ASP A 1 119 ? 29.152 12.233 19.098 1.00 5.00   ? 569 ASP A N   1 
ATOM   899  C  CA  . ASP A 1 119 ? 28.934 10.937 18.448 1.00 5.48   ? 569 ASP A CA  1 
ATOM   900  C  C   . ASP A 1 119 ? 27.786 10.941 17.454 1.00 7.15   ? 569 ASP A C   1 
ATOM   901  O  O   . ASP A 1 119 ? 27.890 10.391 16.349 1.00 8.67   ? 569 ASP A O   1 
ATOM   902  C  CB  . ASP A 1 119 ? 28.622 9.844  19.478 1.00 9.54   ? 569 ASP A CB  1 
ATOM   903  C  CG  . ASP A 1 119 ? 29.804 9.491  20.356 1.00 12.11  ? 569 ASP A CG  1 
ATOM   904  O  OD1 . ASP A 1 119 ? 30.935 9.950  20.092 1.00 22.70  ? 569 ASP A OD1 1 
ATOM   905  O  OD2 . ASP A 1 119 ? 29.592 8.736  21.326 1.00 10.00  ? 569 ASP A OD2 1 
ATOM   906  N  N   . ALA A 1 120 ? 26.657 11.482 17.884 1.00 5.69   ? 570 ALA A N   1 
ATOM   907  C  CA  . ALA A 1 120 ? 25.489 11.512 17.040 1.00 3.56   ? 570 ALA A CA  1 
ATOM   908  C  C   . ALA A 1 120 ? 24.595 12.688 17.425 1.00 7.96   ? 570 ALA A C   1 
ATOM   909  O  O   . ALA A 1 120 ? 24.773 13.302 18.491 1.00 8.86   ? 570 ALA A O   1 
ATOM   910  C  CB  . ALA A 1 120 ? 24.752 10.209 17.170 1.00 2.00   ? 570 ALA A CB  1 
ATOM   911  N  N   . ALA A 1 121 ? 23.608 12.971 16.585 1.00 6.86   ? 571 ALA A N   1 
ATOM   912  C  CA  . ALA A 1 121 ? 22.714 14.085 16.823 1.00 6.78   ? 571 ALA A CA  1 
ATOM   913  C  C   . ALA A 1 121 ? 21.514 14.042 15.884 1.00 12.75  ? 571 ALA A C   1 
ATOM   914  O  O   . ALA A 1 121 ? 21.635 13.630 14.710 1.00 20.97  ? 571 ALA A O   1 
ATOM   915  C  CB  . ALA A 1 121 ? 23.477 15.394 16.622 1.00 6.20   ? 571 ALA A CB  1 
ATOM   916  N  N   . PHE A 1 122 ? 20.350 14.424 16.396 1.00 12.64  ? 572 PHE A N   1 
ATOM   917  C  CA  . PHE A 1 122 ? 19.140 14.491 15.586 1.00 9.58   ? 572 PHE A CA  1 
ATOM   918  C  C   . PHE A 1 122 ? 18.120 15.341 16.303 1.00 12.67  ? 572 PHE A C   1 
ATOM   919  O  O   . PHE A 1 122 ? 18.315 15.711 17.476 1.00 14.98  ? 572 PHE A O   1 
ATOM   920  C  CB  . PHE A 1 122 ? 18.569 13.097 15.263 1.00 9.37   ? 572 PHE A CB  1 
ATOM   921  C  CG  . PHE A 1 122 ? 17.772 12.469 16.374 1.00 14.01  ? 572 PHE A CG  1 
ATOM   922  C  CD1 . PHE A 1 122 ? 18.324 12.266 17.636 1.00 16.29  ? 572 PHE A CD1 1 
ATOM   923  C  CD2 . PHE A 1 122 ? 16.458 12.051 16.147 1.00 13.80  ? 572 PHE A CD2 1 
ATOM   924  C  CE1 . PHE A 1 122 ? 17.570 11.653 18.660 1.00 16.04  ? 572 PHE A CE1 1 
ATOM   925  C  CE2 . PHE A 1 122 ? 15.704 11.439 17.161 1.00 10.25  ? 572 PHE A CE2 1 
ATOM   926  C  CZ  . PHE A 1 122 ? 16.262 11.242 18.415 1.00 6.78   ? 572 PHE A CZ  1 
ATOM   927  N  N   . ASN A 1 123 ? 17.066 15.700 15.581 1.00 14.23  ? 573 ASN A N   1 
ATOM   928  C  CA  . ASN A 1 123 ? 15.983 16.493 16.137 1.00 14.78  ? 573 ASN A CA  1 
ATOM   929  C  C   . ASN A 1 123 ? 14.799 15.529 16.361 1.00 17.03  ? 573 ASN A C   1 
ATOM   930  O  O   . ASN A 1 123 ? 14.357 14.842 15.431 1.00 19.91  ? 573 ASN A O   1 
ATOM   931  C  CB  . ASN A 1 123 ? 15.635 17.651 15.188 1.00 13.54  ? 573 ASN A CB  1 
ATOM   932  C  CG  . ASN A 1 123 ? 14.622 18.606 15.791 1.00 17.36  ? 573 ASN A CG  1 
ATOM   933  O  OD1 . ASN A 1 123 ? 13.423 18.477 15.548 1.00 19.43  ? 573 ASN A OD1 1 
ATOM   934  N  ND2 . ASN A 1 123 ? 15.094 19.554 16.602 1.00 8.35   ? 573 ASN A ND2 1 
ATOM   935  N  N   . TRP A 1 124 ? 14.356 15.435 17.613 1.00 18.21  ? 574 TRP A N   1 
ATOM   936  C  CA  . TRP A 1 124 ? 13.272 14.548 18.063 1.00 18.57  ? 574 TRP A CA  1 
ATOM   937  C  C   . TRP A 1 124 ? 11.970 15.171 17.594 1.00 18.58  ? 574 TRP A C   1 
ATOM   938  O  O   . TRP A 1 124 ? 11.559 16.187 18.124 1.00 23.37  ? 574 TRP A O   1 
ATOM   939  C  CB  . TRP A 1 124 ? 13.315 14.498 19.605 1.00 26.21  ? 574 TRP A CB  1 
ATOM   940  C  CG  . TRP A 1 124 ? 12.631 13.347 20.364 1.00 28.72  ? 574 TRP A CG  1 
ATOM   941  C  CD1 . TRP A 1 124 ? 12.454 13.252 21.739 1.00 35.24  ? 574 TRP A CD1 1 
ATOM   942  C  CD2 . TRP A 1 124 ? 12.102 12.145 19.828 1.00 19.55  ? 574 TRP A CD2 1 
ATOM   943  N  NE1 . TRP A 1 124 ? 11.856 12.061 22.071 1.00 23.52  ? 574 TRP A NE1 1 
ATOM   944  C  CE2 . TRP A 1 124 ? 11.628 11.365 20.917 1.00 22.65  ? 574 TRP A CE2 1 
ATOM   945  C  CE3 . TRP A 1 124 ? 11.984 11.641 18.540 1.00 20.30  ? 574 TRP A CE3 1 
ATOM   946  C  CZ2 . TRP A 1 124 ? 11.060 10.134 20.740 1.00 25.07  ? 574 TRP A CZ2 1 
ATOM   947  C  CZ3 . TRP A 1 124 ? 11.428 10.430 18.370 1.00 23.64  ? 574 TRP A CZ3 1 
ATOM   948  C  CH2 . TRP A 1 124 ? 10.967 9.678  19.460 1.00 32.68  ? 574 TRP A CH2 1 
ATOM   949  N  N   . SER A 1 125 ? 11.315 14.558 16.613 1.00 17.92  ? 575 SER A N   1 
ATOM   950  C  CA  . SER A 1 125 ? 10.054 15.087 16.070 1.00 20.45  ? 575 SER A CA  1 
ATOM   951  C  C   . SER A 1 125 ? 8.897  15.073 17.065 1.00 21.45  ? 575 SER A C   1 
ATOM   952  O  O   . SER A 1 125 ? 7.912  15.771 16.881 1.00 25.01  ? 575 SER A O   1 
ATOM   953  C  CB  . SER A 1 125 ? 9.626  14.297 14.830 1.00 24.13  ? 575 SER A CB  1 
ATOM   954  O  OG  . SER A 1 125 ? 9.146  12.999 15.180 1.00 25.68  ? 575 SER A OG  1 
ATOM   955  N  N   . LYS A 1 126 ? 9.013  14.253 18.104 1.00 24.56  ? 576 LYS A N   1 
ATOM   956  C  CA  . LYS A 1 126 ? 7.972  14.146 19.108 1.00 21.89  ? 576 LYS A CA  1 
ATOM   957  C  C   . LYS A 1 126 ? 7.829  15.420 19.940 1.00 22.72  ? 576 LYS A C   1 
ATOM   958  O  O   . LYS A 1 126 ? 6.774  15.692 20.482 1.00 29.74  ? 576 LYS A O   1 
ATOM   959  C  CB  . LYS A 1 126 ? 8.215  12.933 20.014 1.00 22.58  ? 576 LYS A CB  1 
ATOM   960  C  CG  . LYS A 1 126 ? 6.975  12.555 20.816 1.00 33.90  ? 576 LYS A CG  1 
ATOM   961  C  CD  . LYS A 1 126 ? 7.050  11.197 21.484 1.00 38.96  ? 576 LYS A CD  1 
ATOM   962  C  CE  . LYS A 1 126 ? 7.888  11.210 22.748 1.00 41.90  ? 576 LYS A CE  1 
ATOM   963  N  NZ  . LYS A 1 126 ? 7.711  9.905  23.454 1.00 42.50  ? 576 LYS A NZ  1 
ATOM   964  N  N   . ASN A 1 127 ? 8.871  16.237 19.973 1.00 21.48  ? 577 ASN A N   1 
ATOM   965  C  CA  . ASN A 1 127 ? 8.842  17.453 20.765 1.00 17.03  ? 577 ASN A CA  1 
ATOM   966  C  C   . ASN A 1 127 ? 9.703  18.538 20.160 1.00 19.57  ? 577 ASN A C   1 
ATOM   967  O  O   . ASN A 1 127 ? 9.915  19.572 20.774 1.00 26.47  ? 577 ASN A O   1 
ATOM   968  C  CB  . ASN A 1 127 ? 9.315  17.154 22.192 1.00 14.39  ? 577 ASN A CB  1 
ATOM   969  C  CG  . ASN A 1 127 ? 10.701 16.529 22.242 1.00 16.11  ? 577 ASN A CG  1 
ATOM   970  O  OD1 . ASN A 1 127 ? 11.386 16.393 21.223 1.00 26.18  ? 577 ASN A OD1 1 
ATOM   971  N  ND2 . ASN A 1 127 ? 11.125 16.155 23.433 1.00 15.50  ? 577 ASN A ND2 1 
ATOM   972  N  N   . LYS A 1 128 ? 10.228 18.268 18.970 1.00 23.26  ? 578 LYS A N   1 
ATOM   973  C  CA  . LYS A 1 128 ? 11.076 19.195 18.218 1.00 26.42  ? 578 LYS A CA  1 
ATOM   974  C  C   . LYS A 1 128 ? 12.390 19.571 18.909 1.00 28.15  ? 578 LYS A C   1 
ATOM   975  O  O   . LYS A 1 128 ? 13.055 20.525 18.485 1.00 30.00  ? 578 LYS A O   1 
ATOM   976  C  CB  . LYS A 1 128 ? 10.309 20.469 17.839 1.00 29.17  ? 578 LYS A CB  1 
ATOM   977  C  CG  . LYS A 1 128 ? 8.855  20.272 17.418 1.00 32.93  ? 578 LYS A CG  1 
ATOM   978  C  CD  . LYS A 1 128 ? 8.681  20.133 15.920 1.00 45.80  ? 578 LYS A CD  1 
ATOM   979  C  CE  . LYS A 1 128 ? 9.224  18.814 15.368 1.00 54.91  ? 578 LYS A CE  1 
ATOM   980  N  NZ  . LYS A 1 128 ? 10.688 18.849 15.056 1.00 62.90  ? 578 LYS A NZ  1 
ATOM   981  N  N   . LYS A 1 129 ? 12.785 18.820 19.938 1.00 26.73  ? 579 LYS A N   1 
ATOM   982  C  CA  . LYS A 1 129 ? 14.036 19.101 20.650 1.00 21.65  ? 579 LYS A CA  1 
ATOM   983  C  C   . LYS A 1 129 ? 15.210 18.418 19.972 1.00 19.01  ? 579 LYS A C   1 
ATOM   984  O  O   . LYS A 1 129 ? 15.041 17.418 19.272 1.00 18.39  ? 579 LYS A O   1 
ATOM   985  C  CB  . LYS A 1 129 ? 13.972 18.605 22.093 1.00 30.23  ? 579 LYS A CB  1 
ATOM   986  C  CG  . LYS A 1 129 ? 12.906 19.245 22.948 1.00 29.81  ? 579 LYS A CG  1 
ATOM   987  C  CD  . LYS A 1 129 ? 12.933 20.736 22.797 1.00 33.20  ? 579 LYS A CD  1 
ATOM   988  C  CE  . LYS A 1 129 ? 12.188 21.379 23.928 1.00 39.01  ? 579 LYS A CE  1 
ATOM   989  N  NZ  . LYS A 1 129 ? 12.813 21.011 25.221 1.00 43.04  ? 579 LYS A NZ  1 
ATOM   990  N  N   . THR A 1 130 ? 16.409 18.923 20.217 1.00 10.57  ? 580 THR A N   1 
ATOM   991  C  CA  . THR A 1 130 ? 17.589 18.328 19.620 1.00 10.68  ? 580 THR A CA  1 
ATOM   992  C  C   . THR A 1 130 ? 18.365 17.549 20.654 1.00 13.32  ? 580 THR A C   1 
ATOM   993  O  O   . THR A 1 130 ? 18.560 18.036 21.760 1.00 19.68  ? 580 THR A O   1 
ATOM   994  C  CB  . THR A 1 130 ? 18.476 19.395 19.013 1.00 5.54   ? 580 THR A CB  1 
ATOM   995  O  OG1 . THR A 1 130 ? 17.767 20.000 17.931 1.00 12.87  ? 580 THR A OG1 1 
ATOM   996  C  CG2 . THR A 1 130 ? 19.784 18.802 18.518 1.00 2.00   ? 580 THR A CG2 1 
ATOM   997  N  N   . TYR A 1 131 ? 18.831 16.360 20.285 1.00 14.72  ? 581 TYR A N   1 
ATOM   998  C  CA  . TYR A 1 131 ? 19.582 15.502 21.204 1.00 12.21  ? 581 TYR A CA  1 
ATOM   999  C  C   . TYR A 1 131 ? 20.990 15.270 20.706 1.00 12.50  ? 581 TYR A C   1 
ATOM   1000 O  O   . TYR A 1 131 ? 21.172 14.762 19.603 1.00 16.52  ? 581 TYR A O   1 
ATOM   1001 C  CB  . TYR A 1 131 ? 18.880 14.152 21.351 1.00 10.84  ? 581 TYR A CB  1 
ATOM   1002 C  CG  . TYR A 1 131 ? 17.554 14.241 22.058 1.00 9.25   ? 581 TYR A CG  1 
ATOM   1003 C  CD1 . TYR A 1 131 ? 16.459 14.853 21.448 1.00 7.03   ? 581 TYR A CD1 1 
ATOM   1004 C  CD2 . TYR A 1 131 ? 17.406 13.762 23.361 1.00 9.40   ? 581 TYR A CD2 1 
ATOM   1005 C  CE1 . TYR A 1 131 ? 15.260 14.994 22.117 1.00 10.08  ? 581 TYR A CE1 1 
ATOM   1006 C  CE2 . TYR A 1 131 ? 16.208 13.895 24.036 1.00 4.09   ? 581 TYR A CE2 1 
ATOM   1007 C  CZ  . TYR A 1 131 ? 15.143 14.511 23.415 1.00 11.56  ? 581 TYR A CZ  1 
ATOM   1008 O  OH  . TYR A 1 131 ? 13.957 14.668 24.088 1.00 15.23  ? 581 TYR A OH  1 
ATOM   1009 N  N   . ILE A 1 132 ? 21.976 15.655 21.510 1.00 6.66   ? 582 ILE A N   1 
ATOM   1010 C  CA  . ILE A 1 132 ? 23.381 15.477 21.154 1.00 9.90   ? 582 ILE A CA  1 
ATOM   1011 C  C   . ILE A 1 132 ? 23.967 14.357 22.017 1.00 12.70  ? 582 ILE A C   1 
ATOM   1012 O  O   . ILE A 1 132 ? 23.946 14.422 23.253 1.00 17.85  ? 582 ILE A O   1 
ATOM   1013 C  CB  . ILE A 1 132 ? 24.170 16.790 21.349 1.00 8.93   ? 582 ILE A CB  1 
ATOM   1014 C  CG1 . ILE A 1 132 ? 23.527 17.892 20.506 1.00 10.43  ? 582 ILE A CG1 1 
ATOM   1015 C  CG2 . ILE A 1 132 ? 25.604 16.613 20.902 1.00 6.46   ? 582 ILE A CG2 1 
ATOM   1016 C  CD1 . ILE A 1 132 ? 23.492 19.245 21.175 1.00 13.89  ? 582 ILE A CD1 1 
ATOM   1017 N  N   . PHE A 1 133 ? 24.451 13.308 21.369 1.00 11.54  ? 583 PHE A N   1 
ATOM   1018 C  CA  . PHE A 1 133 ? 24.997 12.164 22.086 1.00 8.99   ? 583 PHE A CA  1 
ATOM   1019 C  C   . PHE A 1 133 ? 26.521 12.151 22.024 1.00 14.97  ? 583 PHE A C   1 
ATOM   1020 O  O   . PHE A 1 133 ? 27.113 12.361 20.944 1.00 16.99  ? 583 PHE A O   1 
ATOM   1021 C  CB  . PHE A 1 133 ? 24.463 10.853 21.480 1.00 5.64   ? 583 PHE A CB  1 
ATOM   1022 C  CG  . PHE A 1 133 ? 22.966 10.707 21.552 1.00 6.60   ? 583 PHE A CG  1 
ATOM   1023 C  CD1 . PHE A 1 133 ? 22.142 11.335 20.622 1.00 6.49   ? 583 PHE A CD1 1 
ATOM   1024 C  CD2 . PHE A 1 133 ? 22.374 9.974  22.565 1.00 6.03   ? 583 PHE A CD2 1 
ATOM   1025 C  CE1 . PHE A 1 133 ? 20.748 11.238 20.708 1.00 2.49   ? 583 PHE A CE1 1 
ATOM   1026 C  CE2 . PHE A 1 133 ? 20.980 9.875  22.656 1.00 6.06   ? 583 PHE A CE2 1 
ATOM   1027 C  CZ  . PHE A 1 133 ? 20.172 10.506 21.734 1.00 2.31   ? 583 PHE A CZ  1 
ATOM   1028 N  N   . ALA A 1 134 ? 27.153 11.903 23.172 1.00 12.10  ? 584 ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 134 ? 28.604 11.802 23.267 1.00 10.29  ? 584 ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 134 ? 28.925 10.762 24.337 1.00 12.85  ? 584 ALA A C   1 
ATOM   1031 O  O   . ALA A 1 134 ? 28.612 10.955 25.515 1.00 18.89  ? 584 ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 134 ? 29.217 13.128 23.615 1.00 2.00   ? 584 ALA A CB  1 
ATOM   1033 N  N   . GLY A 1 135 ? 29.516 9.644  23.924 1.00 8.97   ? 585 GLY A N   1 
ATOM   1034 C  CA  . GLY A 1 135 ? 29.858 8.595  24.864 1.00 6.76   ? 585 GLY A CA  1 
ATOM   1035 C  C   . GLY A 1 135 ? 28.648 7.922  25.497 1.00 13.95  ? 585 GLY A C   1 
ATOM   1036 O  O   . GLY A 1 135 ? 27.778 7.366  24.792 1.00 14.75  ? 585 GLY A O   1 
ATOM   1037 N  N   . ASP A 1 136 ? 28.578 7.990  26.826 1.00 12.91  ? 586 ASP A N   1 
ATOM   1038 C  CA  . ASP A 1 136 ? 27.494 7.377  27.589 1.00 11.00  ? 586 ASP A CA  1 
ATOM   1039 C  C   . ASP A 1 136 ? 26.466 8.382  28.087 1.00 10.57  ? 586 ASP A C   1 
ATOM   1040 O  O   . ASP A 1 136 ? 25.565 8.033  28.849 1.00 7.40   ? 586 ASP A O   1 
ATOM   1041 C  CB  . ASP A 1 136 ? 28.054 6.571  28.759 1.00 9.75   ? 586 ASP A CB  1 
ATOM   1042 C  CG  . ASP A 1 136 ? 28.910 7.404  29.704 1.00 13.79  ? 586 ASP A CG  1 
ATOM   1043 O  OD1 . ASP A 1 136 ? 29.018 8.630  29.545 1.00 15.72  ? 586 ASP A OD1 1 
ATOM   1044 O  OD2 . ASP A 1 136 ? 29.480 6.823  30.643 1.00 22.64  ? 586 ASP A OD2 1 
ATOM   1045 N  N   . LYS A 1 137 ? 26.583 9.621  27.630 1.00 10.68  ? 587 LYS A N   1 
ATOM   1046 C  CA  . LYS A 1 137 ? 25.640 10.647 28.033 1.00 15.00  ? 587 LYS A CA  1 
ATOM   1047 C  C   . LYS A 1 137 ? 25.150 11.482 26.862 1.00 12.99  ? 587 LYS A C   1 
ATOM   1048 O  O   . LYS A 1 137 ? 25.736 11.448 25.791 1.00 15.53  ? 587 LYS A O   1 
ATOM   1049 C  CB  . LYS A 1 137 ? 26.229 11.523 29.136 1.00 18.28  ? 587 LYS A CB  1 
ATOM   1050 C  CG  . LYS A 1 137 ? 27.628 12.005 28.895 1.00 22.12  ? 587 LYS A CG  1 
ATOM   1051 C  CD  . LYS A 1 137 ? 28.131 12.773 30.114 1.00 30.20  ? 587 LYS A CD  1 
ATOM   1052 C  CE  . LYS A 1 137 ? 28.136 11.916 31.362 1.00 32.65  ? 587 LYS A CE  1 
ATOM   1053 N  NZ  . LYS A 1 137 ? 29.254 10.937 31.329 1.00 43.57  ? 587 LYS A NZ  1 
ATOM   1054 N  N   . PHE A 1 138 ? 24.024 12.163 27.059 1.00 13.20  ? 588 PHE A N   1 
ATOM   1055 C  CA  . PHE A 1 138 ? 23.432 13.006 26.031 1.00 11.60  ? 588 PHE A CA  1 
ATOM   1056 C  C   . PHE A 1 138 ? 22.902 14.334 26.576 1.00 14.89  ? 588 PHE A C   1 
ATOM   1057 O  O   . PHE A 1 138 ? 22.682 14.472 27.762 1.00 14.71  ? 588 PHE A O   1 
ATOM   1058 C  CB  . PHE A 1 138 ? 22.303 12.259 25.339 1.00 16.54  ? 588 PHE A CB  1 
ATOM   1059 C  CG  . PHE A 1 138 ? 21.096 12.021 26.204 1.00 9.56   ? 588 PHE A CG  1 
ATOM   1060 C  CD1 . PHE A 1 138 ? 21.054 10.956 27.084 1.00 10.12  ? 588 PHE A CD1 1 
ATOM   1061 C  CD2 . PHE A 1 138 ? 19.975 12.841 26.094 1.00 14.76  ? 588 PHE A CD2 1 
ATOM   1062 C  CE1 . PHE A 1 138 ? 19.911 10.701 27.844 1.00 10.53  ? 588 PHE A CE1 1 
ATOM   1063 C  CE2 . PHE A 1 138 ? 18.831 12.593 26.850 1.00 10.64  ? 588 PHE A CE2 1 
ATOM   1064 C  CZ  . PHE A 1 138 ? 18.804 11.517 27.727 1.00 7.68   ? 588 PHE A CZ  1 
ATOM   1065 N  N   . TRP A 1 139 ? 22.690 15.295 25.682 1.00 16.88  ? 589 TRP A N   1 
ATOM   1066 C  CA  . TRP A 1 139 ? 22.187 16.621 26.027 1.00 7.83   ? 589 TRP A CA  1 
ATOM   1067 C  C   . TRP A 1 139 ? 20.940 16.955 25.217 1.00 7.03   ? 589 TRP A C   1 
ATOM   1068 O  O   . TRP A 1 139 ? 20.792 16.511 24.083 1.00 6.85   ? 589 TRP A O   1 
ATOM   1069 C  CB  . TRP A 1 139 ? 23.246 17.667 25.701 1.00 7.79   ? 589 TRP A CB  1 
ATOM   1070 C  CG  . TRP A 1 139 ? 24.362 17.745 26.667 1.00 15.48  ? 589 TRP A CG  1 
ATOM   1071 C  CD1 . TRP A 1 139 ? 24.470 18.600 27.744 1.00 9.05   ? 589 TRP A CD1 1 
ATOM   1072 C  CD2 . TRP A 1 139 ? 25.551 16.952 26.661 1.00 18.03  ? 589 TRP A CD2 1 
ATOM   1073 N  NE1 . TRP A 1 139 ? 25.658 18.377 28.398 1.00 11.49  ? 589 TRP A NE1 1 
ATOM   1074 C  CE2 . TRP A 1 139 ? 26.339 17.370 27.758 1.00 15.66  ? 589 TRP A CE2 1 
ATOM   1075 C  CE3 . TRP A 1 139 ? 26.030 15.925 25.835 1.00 19.14  ? 589 TRP A CE3 1 
ATOM   1076 C  CZ2 . TRP A 1 139 ? 27.574 16.797 28.045 1.00 13.19  ? 589 TRP A CZ2 1 
ATOM   1077 C  CZ3 . TRP A 1 139 ? 27.265 15.356 26.126 1.00 14.45  ? 589 TRP A CZ3 1 
ATOM   1078 C  CH2 . TRP A 1 139 ? 28.018 15.794 27.220 1.00 11.94  ? 589 TRP A CH2 1 
ATOM   1079 N  N   . ARG A 1 140 ? 20.062 17.768 25.784 1.00 6.74   ? 590 ARG A N   1 
ATOM   1080 C  CA  . ARG A 1 140 ? 18.854 18.170 25.074 1.00 11.37  ? 590 ARG A CA  1 
ATOM   1081 C  C   . ARG A 1 140 ? 18.943 19.668 24.808 1.00 13.93  ? 590 ARG A C   1 
ATOM   1082 O  O   . ARG A 1 140 ? 19.019 20.470 25.754 1.00 19.01  ? 590 ARG A O   1 
ATOM   1083 C  CB  . ARG A 1 140 ? 17.600 17.834 25.876 1.00 8.31   ? 590 ARG A CB  1 
ATOM   1084 C  CG  . ARG A 1 140 ? 16.367 17.740 25.023 1.00 9.11   ? 590 ARG A CG  1 
ATOM   1085 C  CD  . ARG A 1 140 ? 15.227 17.229 25.817 1.00 12.05  ? 590 ARG A CD  1 
ATOM   1086 N  NE  . ARG A 1 140 ? 14.762 18.264 26.720 1.00 24.13  ? 590 ARG A NE  1 
ATOM   1087 C  CZ  . ARG A 1 140 ? 14.065 18.033 27.821 1.00 26.45  ? 590 ARG A CZ  1 
ATOM   1088 N  NH1 . ARG A 1 140 ? 13.753 16.793 28.159 1.00 29.33  ? 590 ARG A NH1 1 
ATOM   1089 N  NH2 . ARG A 1 140 ? 13.686 19.045 28.583 1.00 30.29  ? 590 ARG A NH2 1 
ATOM   1090 N  N   . TYR A 1 141 ? 18.965 20.029 23.527 1.00 7.83   ? 591 TYR A N   1 
ATOM   1091 C  CA  . TYR A 1 141 ? 19.096 21.412 23.090 1.00 7.13   ? 591 TYR A CA  1 
ATOM   1092 C  C   . TYR A 1 141 ? 17.739 21.951 22.625 1.00 11.34  ? 591 TYR A C   1 
ATOM   1093 O  O   . TYR A 1 141 ? 17.018 21.253 21.902 1.00 14.52  ? 591 TYR A O   1 
ATOM   1094 C  CB  . TYR A 1 141 ? 20.120 21.460 21.949 1.00 8.75   ? 591 TYR A CB  1 
ATOM   1095 C  CG  . TYR A 1 141 ? 20.472 22.844 21.483 1.00 9.54   ? 591 TYR A CG  1 
ATOM   1096 C  CD1 . TYR A 1 141 ? 21.362 23.622 22.206 1.00 15.09  ? 591 TYR A CD1 1 
ATOM   1097 C  CD2 . TYR A 1 141 ? 19.877 23.397 20.358 1.00 9.39   ? 591 TYR A CD2 1 
ATOM   1098 C  CE1 . TYR A 1 141 ? 21.650 24.909 21.836 1.00 11.85  ? 591 TYR A CE1 1 
ATOM   1099 C  CE2 . TYR A 1 141 ? 20.155 24.695 19.973 1.00 7.00   ? 591 TYR A CE2 1 
ATOM   1100 C  CZ  . TYR A 1 141 ? 21.046 25.443 20.722 1.00 16.22  ? 591 TYR A CZ  1 
ATOM   1101 O  OH  . TYR A 1 141 ? 21.360 26.730 20.367 1.00 26.85  ? 591 TYR A OH  1 
ATOM   1102 N  N   . ASN A 1 142 ? 17.361 23.146 23.100 1.00 15.09  ? 592 ASN A N   1 
ATOM   1103 C  CA  . ASN A 1 142 ? 16.089 23.798 22.732 1.00 12.91  ? 592 ASN A CA  1 
ATOM   1104 C  C   . ASN A 1 142 ? 16.414 24.731 21.574 1.00 13.94  ? 592 ASN A C   1 
ATOM   1105 O  O   . ASN A 1 142 ? 17.000 25.796 21.760 1.00 14.33  ? 592 ASN A O   1 
ATOM   1106 C  CB  . ASN A 1 142 ? 15.500 24.600 23.900 1.00 10.47  ? 592 ASN A CB  1 
ATOM   1107 C  CG  . ASN A 1 142 ? 14.143 25.218 23.561 1.00 13.03  ? 592 ASN A CG  1 
ATOM   1108 O  OD1 . ASN A 1 142 ? 14.008 25.965 22.604 1.00 16.83  ? 592 ASN A OD1 1 
ATOM   1109 N  ND2 . ASN A 1 142 ? 13.136 24.895 24.344 1.00 14.46  ? 592 ASN A ND2 1 
ATOM   1110 N  N   . GLU A 1 143 ? 16.001 24.316 20.387 1.00 15.38  ? 593 GLU A N   1 
ATOM   1111 C  CA  . GLU A 1 143 ? 16.267 25.017 19.137 1.00 19.42  ? 593 GLU A CA  1 
ATOM   1112 C  C   . GLU A 1 143 ? 15.605 26.393 19.003 1.00 22.43  ? 593 GLU A C   1 
ATOM   1113 O  O   . GLU A 1 143 ? 16.093 27.258 18.269 1.00 21.25  ? 593 GLU A O   1 
ATOM   1114 C  CB  . GLU A 1 143 ? 15.846 24.100 17.986 1.00 22.37  ? 593 GLU A CB  1 
ATOM   1115 C  CG  . GLU A 1 143 ? 16.720 24.155 16.748 1.00 28.47  ? 593 GLU A CG  1 
ATOM   1116 C  CD  . GLU A 1 143 ? 18.054 23.486 16.938 1.00 26.59  ? 593 GLU A CD  1 
ATOM   1117 O  OE1 . GLU A 1 143 ? 18.110 22.251 17.060 1.00 24.66  ? 593 GLU A OE1 1 
ATOM   1118 O  OE2 . GLU A 1 143 ? 19.065 24.203 16.940 1.00 41.29  ? 593 GLU A OE2 1 
ATOM   1119 N  N   . VAL A 1 144 ? 14.515 26.590 19.742 1.00 26.23  ? 594 VAL A N   1 
ATOM   1120 C  CA  . VAL A 1 144 ? 13.757 27.837 19.731 1.00 23.49  ? 594 VAL A CA  1 
ATOM   1121 C  C   . VAL A 1 144 ? 14.442 28.877 20.599 1.00 22.35  ? 594 VAL A C   1 
ATOM   1122 O  O   . VAL A 1 144 ? 14.762 29.958 20.141 1.00 26.99  ? 594 VAL A O   1 
ATOM   1123 C  CB  . VAL A 1 144 ? 12.310 27.619 20.234 1.00 21.72  ? 594 VAL A CB  1 
ATOM   1124 C  CG1 . VAL A 1 144 ? 11.571 28.922 20.264 1.00 19.19  ? 594 VAL A CG1 1 
ATOM   1125 C  CG2 . VAL A 1 144 ? 11.575 26.640 19.317 1.00 26.78  ? 594 VAL A CG2 1 
ATOM   1126 N  N   . LYS A 1 145 ? 14.674 28.533 21.858 1.00 22.83  ? 595 LYS A N   1 
ATOM   1127 C  CA  . LYS A 1 145 ? 15.332 29.434 22.790 1.00 18.07  ? 595 LYS A CA  1 
ATOM   1128 C  C   . LYS A 1 145 ? 16.790 29.497 22.428 1.00 23.24  ? 595 LYS A C   1 
ATOM   1129 O  O   . LYS A 1 145 ? 17.525 30.321 22.962 1.00 25.02  ? 595 LYS A O   1 
ATOM   1130 C  CB  . LYS A 1 145 ? 15.233 28.893 24.202 1.00 22.82  ? 595 LYS A CB  1 
ATOM   1131 C  CG  . LYS A 1 145 ? 13.827 28.781 24.743 1.00 37.79  ? 595 LYS A CG  1 
ATOM   1132 C  CD  . LYS A 1 145 ? 13.840 28.145 26.134 1.00 46.01  ? 595 LYS A CD  1 
ATOM   1133 C  CE  . LYS A 1 145 ? 12.507 28.335 26.862 1.00 50.89  ? 595 LYS A CE  1 
ATOM   1134 N  NZ  . LYS A 1 145 ? 12.521 27.722 28.227 1.00 59.24  ? 595 LYS A NZ  1 
ATOM   1135 N  N   . LYS A 1 146 ? 17.210 28.573 21.562 1.00 26.17  ? 596 LYS A N   1 
ATOM   1136 C  CA  . LYS A 1 146 ? 18.596 28.462 21.129 1.00 22.97  ? 596 LYS A CA  1 
ATOM   1137 C  C   . LYS A 1 146 ? 19.477 28.351 22.363 1.00 22.86  ? 596 LYS A C   1 
ATOM   1138 O  O   . LYS A 1 146 ? 20.399 29.152 22.560 1.00 28.47  ? 596 LYS A O   1 
ATOM   1139 C  CB  . LYS A 1 146 ? 18.994 29.655 20.271 1.00 21.28  ? 596 LYS A CB  1 
ATOM   1140 C  CG  . LYS A 1 146 ? 18.280 29.685 18.935 1.00 38.35  ? 596 LYS A CG  1 
ATOM   1141 C  CD  . LYS A 1 146 ? 18.835 30.775 18.021 1.00 52.83  ? 596 LYS A CD  1 
ATOM   1142 C  CE  . LYS A 1 146 ? 18.626 32.184 18.607 1.00 61.75  ? 596 LYS A CE  1 
ATOM   1143 N  NZ  . LYS A 1 146 ? 19.237 33.279 17.778 1.00 64.97  ? 596 LYS A NZ  1 
ATOM   1144 N  N   . LYS A 1 147 ? 19.160 27.361 23.202 1.00 20.73  ? 597 LYS A N   1 
ATOM   1145 C  CA  . LYS A 1 147 ? 19.887 27.102 24.444 1.00 20.51  ? 597 LYS A CA  1 
ATOM   1146 C  C   . LYS A 1 147 ? 19.632 25.688 24.945 1.00 20.62  ? 597 LYS A C   1 
ATOM   1147 O  O   . LYS A 1 147 ? 18.654 25.047 24.561 1.00 16.97  ? 597 LYS A O   1 
ATOM   1148 C  CB  . LYS A 1 147 ? 19.478 28.098 25.543 1.00 27.97  ? 597 LYS A CB  1 
ATOM   1149 C  CG  . LYS A 1 147 ? 18.154 27.795 26.249 1.00 35.46  ? 597 LYS A CG  1 
ATOM   1150 C  CD  . LYS A 1 147 ? 17.953 28.708 27.460 1.00 47.94  ? 597 LYS A CD  1 
ATOM   1151 C  CE  . LYS A 1 147 ? 17.400 27.953 28.696 1.00 58.20  ? 597 LYS A CE  1 
ATOM   1152 N  NZ  . LYS A 1 147 ? 16.010 27.383 28.574 1.00 60.63  ? 597 LYS A NZ  1 
ATOM   1153 N  N   . MET A 1 148 ? 20.509 25.224 25.827 1.00 21.03  ? 598 MET A N   1 
ATOM   1154 C  CA  . MET A 1 148 ? 20.400 23.896 26.414 1.00 20.78  ? 598 MET A CA  1 
ATOM   1155 C  C   . MET A 1 148 ? 19.357 23.869 27.502 1.00 19.96  ? 598 MET A C   1 
ATOM   1156 O  O   . MET A 1 148 ? 19.184 24.836 28.224 1.00 23.94  ? 598 MET A O   1 
ATOM   1157 C  CB  . MET A 1 148 ? 21.733 23.462 27.037 1.00 19.24  ? 598 MET A CB  1 
ATOM   1158 C  CG  . MET A 1 148 ? 22.794 22.992 26.042 1.00 26.37  ? 598 MET A CG  1 
ATOM   1159 S  SD  . MET A 1 148 ? 22.441 21.369 25.346 1.00 19.84  ? 598 MET A SD  1 
ATOM   1160 C  CE  . MET A 1 148 ? 23.928 21.066 24.417 1.00 14.66  ? 598 MET A CE  1 
ATOM   1161 N  N   . ASP A 1 149 ? 18.689 22.734 27.633 1.00 20.50  ? 599 ASP A N   1 
ATOM   1162 C  CA  . ASP A 1 149 ? 17.707 22.555 28.679 1.00 23.85  ? 599 ASP A CA  1 
ATOM   1163 C  C   . ASP A 1 149 ? 18.383 22.219 30.034 1.00 25.79  ? 599 ASP A C   1 
ATOM   1164 O  O   . ASP A 1 149 ? 19.580 21.879 30.110 1.00 20.83  ? 599 ASP A O   1 
ATOM   1165 C  CB  . ASP A 1 149 ? 16.696 21.470 28.284 1.00 28.89  ? 599 ASP A CB  1 
ATOM   1166 C  CG  . ASP A 1 149 ? 15.555 22.000 27.411 1.00 25.71  ? 599 ASP A CG  1 
ATOM   1167 O  OD1 . ASP A 1 149 ? 15.412 23.231 27.212 1.00 31.66  ? 599 ASP A OD1 1 
ATOM   1168 O  OD2 . ASP A 1 149 ? 14.781 21.155 26.930 1.00 21.05  ? 599 ASP A OD2 1 
ATOM   1169 N  N   . PRO A 1 150 ? 17.631 22.367 31.132 1.00 29.61  ? 600 PRO A N   1 
ATOM   1170 C  CA  . PRO A 1 150 ? 18.140 22.088 32.476 1.00 28.08  ? 600 PRO A CA  1 
ATOM   1171 C  C   . PRO A 1 150 ? 17.980 20.625 32.865 1.00 23.75  ? 600 PRO A C   1 
ATOM   1172 O  O   . PRO A 1 150 ? 16.970 20.000 32.569 1.00 24.79  ? 600 PRO A O   1 
ATOM   1173 C  CB  . PRO A 1 150 ? 17.262 22.982 33.363 1.00 33.23  ? 600 PRO A CB  1 
ATOM   1174 C  CG  . PRO A 1 150 ? 16.599 23.967 32.390 1.00 34.69  ? 600 PRO A CG  1 
ATOM   1175 C  CD  . PRO A 1 150 ? 16.354 23.095 31.211 1.00 33.44  ? 600 PRO A CD  1 
ATOM   1176 N  N   . GLY A 1 151 ? 18.968 20.100 33.571 1.00 22.18  ? 601 GLY A N   1 
ATOM   1177 C  CA  . GLY A 1 151 ? 18.910 18.714 33.985 1.00 27.50  ? 601 GLY A CA  1 
ATOM   1178 C  C   . GLY A 1 151 ? 19.693 17.762 33.089 1.00 29.46  ? 601 GLY A C   1 
ATOM   1179 O  O   . GLY A 1 151 ? 19.428 16.559 33.080 1.00 36.54  ? 601 GLY A O   1 
ATOM   1180 N  N   . PHE A 1 152 ? 20.675 18.283 32.360 1.00 23.43  ? 602 PHE A N   1 
ATOM   1181 C  CA  . PHE A 1 152 ? 21.482 17.469 31.467 1.00 16.77  ? 602 PHE A CA  1 
ATOM   1182 C  C   . PHE A 1 152 ? 22.931 17.788 31.739 1.00 16.63  ? 602 PHE A C   1 
ATOM   1183 O  O   . PHE A 1 152 ? 23.239 18.840 32.278 1.00 16.52  ? 602 PHE A O   1 
ATOM   1184 C  CB  . PHE A 1 152 ? 21.126 17.769 30.012 1.00 9.85   ? 602 PHE A CB  1 
ATOM   1185 C  CG  . PHE A 1 152 ? 19.709 17.424 29.671 1.00 9.30   ? 602 PHE A CG  1 
ATOM   1186 C  CD1 . PHE A 1 152 ? 19.365 16.133 29.299 1.00 9.25   ? 602 PHE A CD1 1 
ATOM   1187 C  CD2 . PHE A 1 152 ? 18.715 18.376 29.746 1.00 7.69   ? 602 PHE A CD2 1 
ATOM   1188 C  CE1 . PHE A 1 152 ? 18.041 15.796 29.007 1.00 6.14   ? 602 PHE A CE1 1 
ATOM   1189 C  CE2 . PHE A 1 152 ? 17.384 18.048 29.457 1.00 12.88  ? 602 PHE A CE2 1 
ATOM   1190 C  CZ  . PHE A 1 152 ? 17.055 16.751 29.087 1.00 8.24   ? 602 PHE A CZ  1 
ATOM   1191 N  N   . PRO A 1 153 ? 23.846 16.917 31.306 1.00 12.88  ? 603 PRO A N   1 
ATOM   1192 C  CA  . PRO A 1 153 ? 23.548 15.689 30.589 1.00 12.55  ? 603 PRO A CA  1 
ATOM   1193 C  C   . PRO A 1 153 ? 23.019 14.605 31.481 1.00 18.25  ? 603 PRO A C   1 
ATOM   1194 O  O   . PRO A 1 153 ? 23.114 14.678 32.693 1.00 19.77  ? 603 PRO A O   1 
ATOM   1195 C  CB  . PRO A 1 153 ? 24.904 15.291 30.053 1.00 12.59  ? 603 PRO A CB  1 
ATOM   1196 C  CG  . PRO A 1 153 ? 25.785 15.646 31.170 1.00 11.43  ? 603 PRO A CG  1 
ATOM   1197 C  CD  . PRO A 1 153 ? 25.288 17.016 31.573 1.00 8.99   ? 603 PRO A CD  1 
ATOM   1198 N  N   . LYS A 1 154 ? 22.463 13.591 30.837 1.00 22.49  ? 604 LYS A N   1 
ATOM   1199 C  CA  . LYS A 1 154 ? 21.932 12.421 31.498 1.00 20.82  ? 604 LYS A CA  1 
ATOM   1200 C  C   . LYS A 1 154 ? 22.640 11.259 30.806 1.00 20.25  ? 604 LYS A C   1 
ATOM   1201 O  O   . LYS A 1 154 ? 23.181 11.430 29.722 1.00 25.44  ? 604 LYS A O   1 
ATOM   1202 C  CB  . LYS A 1 154 ? 20.423 12.339 31.276 1.00 23.73  ? 604 LYS A CB  1 
ATOM   1203 C  CG  . LYS A 1 154 ? 19.625 13.454 31.929 1.00 24.81  ? 604 LYS A CG  1 
ATOM   1204 C  CD  . LYS A 1 154 ? 18.137 13.185 31.796 1.00 27.96  ? 604 LYS A CD  1 
ATOM   1205 C  CE  . LYS A 1 154 ? 17.302 14.036 32.749 1.00 39.27  ? 604 LYS A CE  1 
ATOM   1206 N  NZ  . LYS A 1 154 ? 16.757 15.287 32.145 1.00 46.92  ? 604 LYS A NZ  1 
ATOM   1207 N  N   . LEU A 1 155 ? 22.664 10.088 31.428 1.00 18.82  ? 605 LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 155 ? 23.306 8.929  30.817 1.00 15.16  ? 605 LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 155 ? 22.323 8.229  29.890 1.00 13.50  ? 605 LEU A C   1 
ATOM   1210 O  O   . LEU A 1 155 ? 21.136 8.076  30.219 1.00 13.50  ? 605 LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 155 ? 23.803 7.954  31.887 1.00 17.33  ? 605 LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 155 ? 24.755 8.548  32.924 1.00 14.94  ? 605 LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 155 ? 25.020 7.546  34.006 1.00 12.69  ? 605 LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 155 ? 26.042 8.989  32.263 1.00 21.91  ? 605 LEU A CD2 1 
ATOM   1215 N  N   . ILE A 1 156 ? 22.834 7.780  28.747 1.00 12.59  ? 606 ILE A N   1 
ATOM   1216 C  CA  . ILE A 1 156 ? 22.040 7.097  27.726 1.00 9.71   ? 606 ILE A CA  1 
ATOM   1217 C  C   . ILE A 1 156 ? 21.325 5.885  28.319 1.00 13.24  ? 606 ILE A C   1 
ATOM   1218 O  O   . ILE A 1 156 ? 20.113 5.735  28.161 1.00 13.18  ? 606 ILE A O   1 
ATOM   1219 C  CB  . ILE A 1 156 ? 22.937 6.643  26.538 1.00 6.17   ? 606 ILE A CB  1 
ATOM   1220 C  CG1 . ILE A 1 156 ? 23.535 7.862  25.815 1.00 7.05   ? 606 ILE A CG1 1 
ATOM   1221 C  CG2 . ILE A 1 156 ? 22.142 5.801  25.579 1.00 5.49   ? 606 ILE A CG2 1 
ATOM   1222 C  CD1 . ILE A 1 156 ? 24.533 7.531  24.703 1.00 3.19   ? 606 ILE A CD1 1 
ATOM   1223 N  N   . ALA A 1 157 ? 22.098 5.059  29.032 1.00 17.57  ? 607 ALA A N   1 
ATOM   1224 C  CA  . ALA A 1 157 ? 21.637 3.840  29.697 1.00 14.52  ? 607 ALA A CA  1 
ATOM   1225 C  C   . ALA A 1 157 ? 20.509 4.088  30.694 1.00 20.13  ? 607 ALA A C   1 
ATOM   1226 O  O   . ALA A 1 157 ? 19.649 3.232  30.874 1.00 24.20  ? 607 ALA A O   1 
ATOM   1227 C  CB  . ALA A 1 157 ? 22.803 3.167  30.398 1.00 11.94  ? 607 ALA A CB  1 
ATOM   1228 N  N   . ASP A 1 158 ? 20.517 5.243  31.359 1.00 25.08  ? 608 ASP A N   1 
ATOM   1229 C  CA  . ASP A 1 158 ? 19.465 5.560  32.325 1.00 27.72  ? 608 ASP A CA  1 
ATOM   1230 C  C   . ASP A 1 158 ? 18.218 6.075  31.630 1.00 29.59  ? 608 ASP A C   1 
ATOM   1231 O  O   . ASP A 1 158 ? 17.124 5.562  31.835 1.00 38.66  ? 608 ASP A O   1 
ATOM   1232 C  CB  . ASP A 1 158 ? 19.910 6.623  33.346 1.00 30.37  ? 608 ASP A CB  1 
ATOM   1233 C  CG  . ASP A 1 158 ? 21.052 6.155  34.257 1.00 38.20  ? 608 ASP A CG  1 
ATOM   1234 O  OD1 . ASP A 1 158 ? 21.250 4.931  34.477 1.00 37.53  ? 608 ASP A OD1 1 
ATOM   1235 O  OD2 . ASP A 1 158 ? 21.761 7.047  34.770 1.00 35.97  ? 608 ASP A OD2 1 
ATOM   1236 N  N   . ALA A 1 159 ? 18.383 7.070  30.776 1.00 28.00  ? 609 ALA A N   1 
ATOM   1237 C  CA  . ALA A 1 159 ? 17.236 7.659  30.115 1.00 25.66  ? 609 ALA A CA  1 
ATOM   1238 C  C   . ALA A 1 159 ? 16.589 6.927  28.943 1.00 25.23  ? 609 ALA A C   1 
ATOM   1239 O  O   . ALA A 1 159 ? 15.379 6.997  28.799 1.00 28.33  ? 609 ALA A O   1 
ATOM   1240 C  CB  . ALA A 1 159 ? 17.553 9.091  29.733 1.00 25.96  ? 609 ALA A CB  1 
ATOM   1241 N  N   . TRP A 1 160 ? 17.366 6.237  28.107 1.00 26.76  ? 610 TRP A N   1 
ATOM   1242 C  CA  . TRP A 1 160 ? 16.797 5.561  26.935 1.00 26.62  ? 610 TRP A CA  1 
ATOM   1243 C  C   . TRP A 1 160 ? 16.512 4.081  27.128 1.00 32.84  ? 610 TRP A C   1 
ATOM   1244 O  O   . TRP A 1 160 ? 17.041 3.453  28.042 1.00 36.04  ? 610 TRP A O   1 
ATOM   1245 C  CB  . TRP A 1 160 ? 17.674 5.784  25.696 1.00 26.55  ? 610 TRP A CB  1 
ATOM   1246 C  CG  . TRP A 1 160 ? 17.747 7.221  25.260 1.00 18.03  ? 610 TRP A CG  1 
ATOM   1247 C  CD1 . TRP A 1 160 ? 18.577 8.175  25.753 1.00 11.96  ? 610 TRP A CD1 1 
ATOM   1248 C  CD2 . TRP A 1 160 ? 16.902 7.878  24.304 1.00 19.94  ? 610 TRP A CD2 1 
ATOM   1249 N  NE1 . TRP A 1 160 ? 18.299 9.385  25.185 1.00 12.80  ? 610 TRP A NE1 1 
ATOM   1250 C  CE2 . TRP A 1 160 ? 17.275 9.238  24.289 1.00 15.35  ? 610 TRP A CE2 1 
ATOM   1251 C  CE3 . TRP A 1 160 ? 15.859 7.448  23.461 1.00 22.34  ? 610 TRP A CE3 1 
ATOM   1252 C  CZ2 . TRP A 1 160 ? 16.641 10.191 23.461 1.00 18.79  ? 610 TRP A CZ2 1 
ATOM   1253 C  CZ3 . TRP A 1 160 ? 15.223 8.399  22.631 1.00 21.16  ? 610 TRP A CZ3 1 
ATOM   1254 C  CH2 . TRP A 1 160 ? 15.622 9.755  22.644 1.00 20.93  ? 610 TRP A CH2 1 
ATOM   1255 N  N   . ASN A 1 161 ? 15.694 3.523  26.238 1.00 38.11  ? 611 ASN A N   1 
ATOM   1256 C  CA  . ASN A 1 161 ? 15.287 2.117  26.311 1.00 41.37  ? 611 ASN A CA  1 
ATOM   1257 C  C   . ASN A 1 161 ? 16.080 1.194  25.409 1.00 36.56  ? 611 ASN A C   1 
ATOM   1258 O  O   . ASN A 1 161 ? 15.738 1.034  24.237 1.00 35.69  ? 611 ASN A O   1 
ATOM   1259 C  CB  . ASN A 1 161 ? 13.804 1.969  25.939 1.00 60.68  ? 611 ASN A CB  1 
ATOM   1260 C  CG  . ASN A 1 161 ? 12.889 2.884  26.756 1.00 77.15  ? 611 ASN A CG  1 
ATOM   1261 O  OD1 . ASN A 1 161 ? 13.168 4.086  26.944 1.00 82.59  ? 611 ASN A OD1 1 
ATOM   1262 N  ND2 . ASN A 1 161 ? 11.773 2.325  27.229 1.00 84.18  ? 611 ASN A ND2 1 
ATOM   1263 N  N   . ALA A 1 162 ? 17.117 0.573  25.963 1.00 29.29  ? 612 ALA A N   1 
ATOM   1264 C  CA  . ALA A 1 162 ? 17.957 -0.371 25.226 1.00 27.07  ? 612 ALA A CA  1 
ATOM   1265 C  C   . ALA A 1 162 ? 18.806 0.215  24.090 1.00 24.32  ? 612 ALA A C   1 
ATOM   1266 O  O   . ALA A 1 162 ? 19.154 -0.481 23.131 1.00 21.97  ? 612 ALA A O   1 
ATOM   1267 C  CB  . ALA A 1 162 ? 17.112 -1.528 24.713 1.00 32.59  ? 612 ALA A CB  1 
ATOM   1268 N  N   . ILE A 1 163 ? 19.174 1.479  24.237 1.00 20.29  ? 613 ILE A N   1 
ATOM   1269 C  CA  . ILE A 1 163 ? 19.993 2.184  23.270 1.00 16.32  ? 613 ILE A CA  1 
ATOM   1270 C  C   . ILE A 1 163 ? 21.427 2.048  23.785 1.00 19.66  ? 613 ILE A C   1 
ATOM   1271 O  O   . ILE A 1 163 ? 21.693 2.299  24.955 1.00 25.88  ? 613 ILE A O   1 
ATOM   1272 C  CB  . ILE A 1 163 ? 19.572 3.677  23.230 1.00 13.00  ? 613 ILE A CB  1 
ATOM   1273 C  CG1 . ILE A 1 163 ? 18.158 3.809  22.657 1.00 13.13  ? 613 ILE A CG1 1 
ATOM   1274 C  CG2 . ILE A 1 163 ? 20.571 4.507  22.479 1.00 13.38  ? 613 ILE A CG2 1 
ATOM   1275 C  CD1 . ILE A 1 163 ? 17.934 3.035  21.369 1.00 12.39  ? 613 ILE A CD1 1 
ATOM   1276 N  N   . PRO A 1 164 ? 22.367 1.623  22.930 1.00 20.56  ? 614 PRO A N   1 
ATOM   1277 C  CA  . PRO A 1 164 ? 23.756 1.473  23.377 1.00 19.75  ? 614 PRO A CA  1 
ATOM   1278 C  C   . PRO A 1 164 ? 24.521 2.788  23.484 1.00 16.68  ? 614 PRO A C   1 
ATOM   1279 O  O   . PRO A 1 164 ? 24.090 3.827  22.973 1.00 16.81  ? 614 PRO A O   1 
ATOM   1280 C  CB  . PRO A 1 164 ? 24.362 0.604  22.278 1.00 19.10  ? 614 PRO A CB  1 
ATOM   1281 C  CG  . PRO A 1 164 ? 23.675 1.139  21.066 1.00 19.91  ? 614 PRO A CG  1 
ATOM   1282 C  CD  . PRO A 1 164 ? 22.232 1.233  21.515 1.00 17.49  ? 614 PRO A CD  1 
ATOM   1283 N  N   . ASP A 1 165 ? 25.652 2.733  24.174 1.00 11.09  ? 615 ASP A N   1 
ATOM   1284 C  CA  . ASP A 1 165 ? 26.511 3.891  24.303 1.00 9.09   ? 615 ASP A CA  1 
ATOM   1285 C  C   . ASP A 1 165 ? 27.328 3.911  23.025 1.00 8.55   ? 615 ASP A C   1 
ATOM   1286 O  O   . ASP A 1 165 ? 27.294 2.964  22.245 1.00 8.24   ? 615 ASP A O   1 
ATOM   1287 C  CB  . ASP A 1 165 ? 27.469 3.749  25.491 1.00 12.15  ? 615 ASP A CB  1 
ATOM   1288 C  CG  . ASP A 1 165 ? 26.794 3.958  26.847 1.00 15.36  ? 615 ASP A CG  1 
ATOM   1289 O  OD1 . ASP A 1 165 ? 25.724 4.599  26.932 1.00 11.17  ? 615 ASP A OD1 1 
ATOM   1290 O  OD2 . ASP A 1 165 ? 27.377 3.497  27.852 1.00 17.80  ? 615 ASP A OD2 1 
ATOM   1291 N  N   . ASN A 1 166 ? 28.050 5.002  22.805 1.00 11.02  ? 616 ASN A N   1 
ATOM   1292 C  CA  . ASN A 1 166 ? 28.895 5.149  21.628 1.00 10.89  ? 616 ASN A CA  1 
ATOM   1293 C  C   . ASN A 1 166 ? 28.198 4.885  20.300 1.00 11.95  ? 616 ASN A C   1 
ATOM   1294 O  O   . ASN A 1 166 ? 28.659 4.090  19.479 1.00 15.87  ? 616 ASN A O   1 
ATOM   1295 C  CB  . ASN A 1 166 ? 30.123 4.263  21.769 1.00 13.45  ? 616 ASN A CB  1 
ATOM   1296 C  CG  . ASN A 1 166 ? 30.945 4.627  22.972 1.00 13.98  ? 616 ASN A CG  1 
ATOM   1297 O  OD1 . ASN A 1 166 ? 31.518 5.710  23.039 1.00 25.28  ? 616 ASN A OD1 1 
ATOM   1298 N  ND2 . ASN A 1 166 ? 30.993 3.736  23.943 1.00 20.36  ? 616 ASN A ND2 1 
ATOM   1299 N  N   . LEU A 1 167 ? 27.097 5.588  20.090 1.00 12.51  ? 617 LEU A N   1 
ATOM   1300 C  CA  . LEU A 1 167 ? 26.318 5.473  18.875 1.00 10.89  ? 617 LEU A CA  1 
ATOM   1301 C  C   . LEU A 1 167 ? 27.128 5.991  17.676 1.00 14.04  ? 617 LEU A C   1 
ATOM   1302 O  O   . LEU A 1 167 ? 28.084 6.771  17.854 1.00 11.31  ? 617 LEU A O   1 
ATOM   1303 C  CB  . LEU A 1 167 ? 25.063 6.323  19.027 1.00 10.05  ? 617 LEU A CB  1 
ATOM   1304 C  CG  . LEU A 1 167 ? 24.087 5.909  20.115 1.00 6.25   ? 617 LEU A CG  1 
ATOM   1305 C  CD1 . LEU A 1 167 ? 23.115 7.025  20.346 1.00 2.49   ? 617 LEU A CD1 1 
ATOM   1306 C  CD2 . LEU A 1 167 ? 23.370 4.655  19.683 1.00 4.36   ? 617 LEU A CD2 1 
ATOM   1307 N  N   . ASP A 1 168 ? 26.754 5.572  16.463 1.00 11.68  ? 618 ASP A N   1 
ATOM   1308 C  CA  . ASP A 1 168 ? 27.437 6.040  15.259 1.00 10.84  ? 618 ASP A CA  1 
ATOM   1309 C  C   . ASP A 1 168 ? 26.597 7.128  14.613 1.00 9.84   ? 618 ASP A C   1 
ATOM   1310 O  O   . ASP A 1 168 ? 27.149 8.081  14.026 1.00 14.03  ? 618 ASP A O   1 
ATOM   1311 C  CB  . ASP A 1 168 ? 27.681 4.905  14.262 1.00 17.20  ? 618 ASP A CB  1 
ATOM   1312 C  CG  . ASP A 1 168 ? 28.857 4.038  14.631 1.00 10.42  ? 618 ASP A CG  1 
ATOM   1313 O  OD1 . ASP A 1 168 ? 29.878 4.562  15.123 1.00 19.14  ? 618 ASP A OD1 1 
ATOM   1314 O  OD2 . ASP A 1 168 ? 28.772 2.822  14.402 1.00 14.79  ? 618 ASP A OD2 1 
ATOM   1315 N  N   . ALA A 1 169 ? 25.277 6.994  14.727 1.00 4.85   ? 619 ALA A N   1 
ATOM   1316 C  CA  . ALA A 1 169 ? 24.346 7.989  14.194 1.00 8.00   ? 619 ALA A CA  1 
ATOM   1317 C  C   . ALA A 1 169 ? 22.940 7.747  14.691 1.00 14.77  ? 619 ALA A C   1 
ATOM   1318 O  O   . ALA A 1 169 ? 22.641 6.700  15.294 1.00 19.71  ? 619 ALA A O   1 
ATOM   1319 C  CB  . ALA A 1 169 ? 24.344 7.981  12.690 1.00 7.21   ? 619 ALA A CB  1 
ATOM   1320 N  N   . VAL A 1 170 ? 22.083 8.732  14.451 1.00 15.86  ? 620 VAL A N   1 
ATOM   1321 C  CA  . VAL A 1 170 ? 20.670 8.656  14.821 1.00 15.08  ? 620 VAL A CA  1 
ATOM   1322 C  C   . VAL A 1 170 ? 19.845 9.566  13.894 1.00 16.15  ? 620 VAL A C   1 
ATOM   1323 O  O   . VAL A 1 170 ? 20.289 10.673 13.513 1.00 13.68  ? 620 VAL A O   1 
ATOM   1324 C  CB  . VAL A 1 170 ? 20.415 8.964  16.320 1.00 7.42   ? 620 VAL A CB  1 
ATOM   1325 C  CG1 . VAL A 1 170 ? 20.985 10.302 16.699 1.00 13.51  ? 620 VAL A CG1 1 
ATOM   1326 C  CG2 . VAL A 1 170 ? 18.930 8.923  16.606 1.00 6.31   ? 620 VAL A CG2 1 
ATOM   1327 N  N   . VAL A 1 171 ? 18.704 9.045  13.447 1.00 15.58  ? 621 VAL A N   1 
ATOM   1328 C  CA  . VAL A 1 171 ? 17.823 9.767  12.545 1.00 16.48  ? 621 VAL A CA  1 
ATOM   1329 C  C   . VAL A 1 171 ? 16.346 9.473  12.806 1.00 12.43  ? 621 VAL A C   1 
ATOM   1330 O  O   . VAL A 1 171 ? 15.985 8.392  13.240 1.00 13.40  ? 621 VAL A O   1 
ATOM   1331 C  CB  . VAL A 1 171 ? 18.174 9.446  11.043 1.00 17.33  ? 621 VAL A CB  1 
ATOM   1332 C  CG1 . VAL A 1 171 ? 17.892 8.001  10.709 1.00 25.21  ? 621 VAL A CG1 1 
ATOM   1333 C  CG2 . VAL A 1 171 ? 17.369 10.311 10.120 1.00 25.82  ? 621 VAL A CG2 1 
ATOM   1334 N  N   . ASP A 1 172 ? 15.513 10.479 12.586 1.00 14.38  ? 622 ASP A N   1 
ATOM   1335 C  CA  . ASP A 1 172 ? 14.059 10.371 12.732 1.00 17.84  ? 622 ASP A CA  1 
ATOM   1336 C  C   . ASP A 1 172 ? 13.577 10.777 11.345 1.00 22.48  ? 622 ASP A C   1 
ATOM   1337 O  O   . ASP A 1 172 ? 13.720 11.947 10.971 1.00 27.30  ? 622 ASP A O   1 
ATOM   1338 C  CB  . ASP A 1 172 ? 13.552 11.397 13.748 1.00 16.70  ? 622 ASP A CB  1 
ATOM   1339 C  CG  . ASP A 1 172 ? 12.054 11.301 14.004 1.00 16.13  ? 622 ASP A CG  1 
ATOM   1340 O  OD1 . ASP A 1 172 ? 11.330 10.544 13.333 1.00 16.11  ? 622 ASP A OD1 1 
ATOM   1341 O  OD2 . ASP A 1 172 ? 11.597 11.997 14.919 1.00 18.27  ? 622 ASP A OD2 1 
ATOM   1342 N  N   . LEU A 1 173 ? 13.081 9.823  10.558 1.00 18.12  ? 623 LEU A N   1 
ATOM   1343 C  CA  . LEU A 1 173 ? 12.620 10.134 9.203  1.00 14.60  ? 623 LEU A CA  1 
ATOM   1344 C  C   . LEU A 1 173 ? 11.310 10.911 9.215  1.00 12.51  ? 623 LEU A C   1 
ATOM   1345 O  O   . LEU A 1 173 ? 10.347 10.470 9.808  1.00 10.40  ? 623 LEU A O   1 
ATOM   1346 C  CB  . LEU A 1 173 ? 12.451 8.848  8.406  1.00 19.36  ? 623 LEU A CB  1 
ATOM   1347 C  CG  . LEU A 1 173 ? 13.551 8.326  7.479  1.00 14.81  ? 623 LEU A CG  1 
ATOM   1348 C  CD1 . LEU A 1 173 ? 14.926 8.888  7.796  1.00 12.99  ? 623 LEU A CD1 1 
ATOM   1349 C  CD2 . LEU A 1 173 ? 13.527 6.812  7.571  1.00 15.18  ? 623 LEU A CD2 1 
ATOM   1350 N  N   . GLN A 1 174 ? 11.285 12.059 8.547  1.00 11.91  ? 624 GLN A N   1 
ATOM   1351 C  CA  . GLN A 1 174 ? 10.095 12.901 8.493  1.00 18.61  ? 624 GLN A CA  1 
ATOM   1352 C  C   . GLN A 1 174 ? 8.832  12.126 8.167  1.00 23.34  ? 624 GLN A C   1 
ATOM   1353 O  O   . GLN A 1 174 ? 7.735  12.483 8.608  1.00 22.27  ? 624 GLN A O   1 
ATOM   1354 C  CB  . GLN A 1 174 ? 10.253 13.981 7.448  1.00 17.55  ? 624 GLN A CB  1 
ATOM   1355 C  CG  . GLN A 1 174 ? 11.187 15.079 7.819  1.00 25.12  ? 624 GLN A CG  1 
ATOM   1356 C  CD  . GLN A 1 174 ? 11.181 16.146 6.765  1.00 30.89  ? 624 GLN A CD  1 
ATOM   1357 O  OE1 . GLN A 1 174 ? 10.973 15.857 5.598  1.00 40.60  ? 624 GLN A OE1 1 
ATOM   1358 N  NE2 . GLN A 1 174 ? 11.378 17.388 7.166  1.00 35.72  ? 624 GLN A NE2 1 
ATOM   1359 N  N   . GLY A 1 175 ? 8.979  11.106 7.337  1.00 26.51  ? 625 GLY A N   1 
ATOM   1360 C  CA  . GLY A 1 175 ? 7.831  10.294 6.988  1.00 38.00  ? 625 GLY A CA  1 
ATOM   1361 C  C   . GLY A 1 175 ? 6.989  9.855  8.187  1.00 38.88  ? 625 GLY A C   1 
ATOM   1362 O  O   . GLY A 1 175 ? 6.106  10.595 8.640  1.00 34.82  ? 625 GLY A O   1 
ATOM   1363 N  N   . GLY A 1 176 ? 7.323  8.704  8.768  1.00 37.94  ? 626 GLY A N   1 
ATOM   1364 C  CA  . GLY A 1 176 ? 6.523  8.199  9.863  1.00 37.38  ? 626 GLY A CA  1 
ATOM   1365 C  C   . GLY A 1 176 ? 7.068  7.808  11.217 1.00 35.72  ? 626 GLY A C   1 
ATOM   1366 O  O   . GLY A 1 176 ? 7.432  6.644  11.456 1.00 38.31  ? 626 GLY A O   1 
ATOM   1367 N  N   . GLY A 1 177 ? 6.985  8.769  12.128 1.00 33.34  ? 627 GLY A N   1 
ATOM   1368 C  CA  . GLY A 1 177 ? 7.389  8.592  13.512 1.00 36.81  ? 627 GLY A CA  1 
ATOM   1369 C  C   . GLY A 1 177 ? 8.125  7.360  14.023 1.00 32.71  ? 627 GLY A C   1 
ATOM   1370 O  O   . GLY A 1 177 ? 7.609  6.606  14.856 1.00 26.09  ? 627 GLY A O   1 
ATOM   1371 N  N   . HIS A 1 178 ? 9.364  7.209  13.566 1.00 33.60  ? 628 HIS A N   1 
ATOM   1372 C  CA  . HIS A 1 178 ? 10.246 6.136  13.980 1.00 28.74  ? 628 HIS A CA  1 
ATOM   1373 C  C   . HIS A 1 178 ? 11.664 6.678  14.012 1.00 27.03  ? 628 HIS A C   1 
ATOM   1374 O  O   . HIS A 1 178 ? 12.094 7.377  13.093 1.00 30.23  ? 628 HIS A O   1 
ATOM   1375 C  CB  . HIS A 1 178 ? 10.126 4.933  13.058 1.00 31.54  ? 628 HIS A CB  1 
ATOM   1376 C  CG  . HIS A 1 178 ? 9.072  3.964  13.491 1.00 38.78  ? 628 HIS A CG  1 
ATOM   1377 N  ND1 . HIS A 1 178 ? 7.863  3.844  12.842 1.00 40.04  ? 628 HIS A ND1 1 
ATOM   1378 C  CD2 . HIS A 1 178 ? 9.025  3.107  14.535 1.00 38.85  ? 628 HIS A CD2 1 
ATOM   1379 C  CE1 . HIS A 1 178 ? 7.117  2.954  13.471 1.00 36.82  ? 628 HIS A CE1 1 
ATOM   1380 N  NE2 . HIS A 1 178 ? 7.797  2.493  14.504 1.00 36.62  ? 628 HIS A NE2 1 
ATOM   1381 N  N   . SER A 1 179 ? 12.350 6.433  15.120 1.00 22.87  ? 629 SER A N   1 
ATOM   1382 C  CA  . SER A 1 179 ? 13.717 6.897  15.298 1.00 23.66  ? 629 SER A CA  1 
ATOM   1383 C  C   . SER A 1 179 ? 14.663 5.733  15.084 1.00 23.38  ? 629 SER A C   1 
ATOM   1384 O  O   . SER A 1 179 ? 14.475 4.676  15.676 1.00 27.97  ? 629 SER A O   1 
ATOM   1385 C  CB  . SER A 1 179 ? 13.894 7.449  16.705 1.00 18.79  ? 629 SER A CB  1 
ATOM   1386 O  OG  . SER A 1 179 ? 13.001 8.520  16.924 1.00 26.71  ? 629 SER A OG  1 
ATOM   1387 N  N   . TYR A 1 180 ? 15.671 5.920  14.238 1.00 21.63  ? 630 TYR A N   1 
ATOM   1388 C  CA  . TYR A 1 180 ? 16.627 4.859  13.959 1.00 14.74  ? 630 TYR A CA  1 
ATOM   1389 C  C   . TYR A 1 180 ? 17.937 5.175  14.614 1.00 13.97  ? 630 TYR A C   1 
ATOM   1390 O  O   . TYR A 1 180 ? 18.460 6.270  14.419 1.00 12.95  ? 630 TYR A O   1 
ATOM   1391 C  CB  . TYR A 1 180 ? 16.839 4.716  12.459 1.00 19.70  ? 630 TYR A CB  1 
ATOM   1392 C  CG  . TYR A 1 180 ? 15.561 4.462  11.718 1.00 20.71  ? 630 TYR A CG  1 
ATOM   1393 C  CD1 . TYR A 1 180 ? 14.712 5.519  11.400 1.00 19.83  ? 630 TYR A CD1 1 
ATOM   1394 C  CD2 . TYR A 1 180 ? 15.158 3.160  11.398 1.00 19.25  ? 630 TYR A CD2 1 
ATOM   1395 C  CE1 . TYR A 1 180 ? 13.485 5.297  10.792 1.00 21.56  ? 630 TYR A CE1 1 
ATOM   1396 C  CE2 . TYR A 1 180 ? 13.925 2.926  10.786 1.00 21.32  ? 630 TYR A CE2 1 
ATOM   1397 C  CZ  . TYR A 1 180 ? 13.094 4.005  10.488 1.00 22.45  ? 630 TYR A CZ  1 
ATOM   1398 O  OH  . TYR A 1 180 ? 11.869 3.815  9.886  1.00 24.96  ? 630 TYR A OH  1 
ATOM   1399 N  N   . PHE A 1 181 ? 18.442 4.231  15.413 1.00 15.21  ? 631 PHE A N   1 
ATOM   1400 C  CA  . PHE A 1 181 ? 19.738 4.379  16.104 1.00 14.24  ? 631 PHE A CA  1 
ATOM   1401 C  C   . PHE A 1 181 ? 20.736 3.408  15.480 1.00 14.33  ? 631 PHE A C   1 
ATOM   1402 O  O   . PHE A 1 181 ? 20.535 2.195  15.499 1.00 15.25  ? 631 PHE A O   1 
ATOM   1403 C  CB  . PHE A 1 181 ? 19.602 4.104  17.594 1.00 9.36   ? 631 PHE A CB  1 
ATOM   1404 C  CG  . PHE A 1 181 ? 18.779 5.124  18.326 1.00 11.57  ? 631 PHE A CG  1 
ATOM   1405 C  CD1 . PHE A 1 181 ? 17.394 5.161  18.171 1.00 10.86  ? 631 PHE A CD1 1 
ATOM   1406 C  CD2 . PHE A 1 181 ? 19.385 6.025  19.206 1.00 10.66  ? 631 PHE A CD2 1 
ATOM   1407 C  CE1 . PHE A 1 181 ? 16.622 6.081  18.890 1.00 12.98  ? 631 PHE A CE1 1 
ATOM   1408 C  CE2 . PHE A 1 181 ? 18.622 6.945  19.923 1.00 14.01  ? 631 PHE A CE2 1 
ATOM   1409 C  CZ  . PHE A 1 181 ? 17.236 6.973  19.766 1.00 9.24   ? 631 PHE A CZ  1 
ATOM   1410 N  N   . PHE A 1 182 ? 21.809 3.959  14.923 1.00 18.23  ? 632 PHE A N   1 
ATOM   1411 C  CA  . PHE A 1 182 ? 22.820 3.175  14.222 1.00 14.99  ? 632 PHE A CA  1 
ATOM   1412 C  C   . PHE A 1 182 ? 24.046 2.917  15.066 1.00 12.89  ? 632 PHE A C   1 
ATOM   1413 O  O   . PHE A 1 182 ? 24.587 3.826  15.701 1.00 12.69  ? 632 PHE A O   1 
ATOM   1414 C  CB  . PHE A 1 182 ? 23.262 3.896  12.920 1.00 13.74  ? 632 PHE A CB  1 
ATOM   1415 C  CG  . PHE A 1 182 ? 22.139 4.129  11.915 1.00 9.44   ? 632 PHE A CG  1 
ATOM   1416 C  CD1 . PHE A 1 182 ? 21.298 5.241  12.026 1.00 10.55  ? 632 PHE A CD1 1 
ATOM   1417 C  CD2 . PHE A 1 182 ? 21.905 3.218  10.883 1.00 9.43   ? 632 PHE A CD2 1 
ATOM   1418 C  CE1 . PHE A 1 182 ? 20.222 5.442  11.122 1.00 9.81   ? 632 PHE A CE1 1 
ATOM   1419 C  CE2 . PHE A 1 182 ? 20.844 3.407  9.979  1.00 16.45  ? 632 PHE A CE2 1 
ATOM   1420 C  CZ  . PHE A 1 182 ? 20.000 4.524  10.105 1.00 15.39  ? 632 PHE A CZ  1 
ATOM   1421 N  N   . LYS A 1 183 ? 24.502 1.676  15.053 1.00 11.31  ? 633 LYS A N   1 
ATOM   1422 C  CA  . LYS A 1 183 ? 25.708 1.336  15.774 1.00 10.72  ? 633 LYS A CA  1 
ATOM   1423 C  C   . LYS A 1 183 ? 26.350 0.118  15.146 1.00 12.92  ? 633 LYS A C   1 
ATOM   1424 O  O   . LYS A 1 183 ? 25.759 -0.964 15.128 1.00 15.30  ? 633 LYS A O   1 
ATOM   1425 C  CB  . LYS A 1 183 ? 25.452 1.090  17.256 1.00 9.30   ? 633 LYS A CB  1 
ATOM   1426 C  CG  . LYS A 1 183 ? 26.754 1.064  18.050 1.00 5.00   ? 633 LYS A CG  1 
ATOM   1427 C  CD  . LYS A 1 183 ? 26.537 0.671  19.490 1.00 8.40   ? 633 LYS A CD  1 
ATOM   1428 C  CE  . LYS A 1 183 ? 27.840 0.177  20.119 1.00 12.09  ? 633 LYS A CE  1 
ATOM   1429 N  NZ  . LYS A 1 183 ? 28.889 1.216  20.234 1.00 18.31  ? 633 LYS A NZ  1 
ATOM   1430 N  N   . GLY A 1 184 ? 27.543 0.314  14.589 1.00 9.87   ? 634 GLY A N   1 
ATOM   1431 C  CA  . GLY A 1 184 ? 28.271 -0.767 13.973 1.00 4.63   ? 634 GLY A CA  1 
ATOM   1432 C  C   . GLY A 1 184 ? 27.596 -1.161 12.693 1.00 13.24  ? 634 GLY A C   1 
ATOM   1433 O  O   . GLY A 1 184 ? 27.337 -0.305 11.849 1.00 16.59  ? 634 GLY A O   1 
ATOM   1434 N  N   . ALA A 1 185 ? 27.291 -2.446 12.550 1.00 14.01  ? 635 ALA A N   1 
ATOM   1435 C  CA  . ALA A 1 185 ? 26.640 -2.923 11.344 1.00 16.84  ? 635 ALA A CA  1 
ATOM   1436 C  C   . ALA A 1 185 ? 25.116 -3.000 11.471 1.00 16.00  ? 635 ALA A C   1 
ATOM   1437 O  O   . ALA A 1 185 ? 24.432 -3.328 10.498 1.00 16.72  ? 635 ALA A O   1 
ATOM   1438 C  CB  . ALA A 1 185 ? 27.213 -4.280 10.949 1.00 15.27  ? 635 ALA A CB  1 
ATOM   1439 N  N   . TYR A 1 186 ? 24.594 -2.602 12.629 1.00 18.94  ? 636 TYR A N   1 
ATOM   1440 C  CA  . TYR A 1 186 ? 23.158 -2.670 12.923 1.00 20.76  ? 636 TYR A CA  1 
ATOM   1441 C  C   . TYR A 1 186 ? 22.499 -1.345 13.250 1.00 18.58  ? 636 TYR A C   1 
ATOM   1442 O  O   . TYR A 1 186 ? 23.170 -0.335 13.499 1.00 18.57  ? 636 TYR A O   1 
ATOM   1443 C  CB  . TYR A 1 186 ? 22.934 -3.605 14.116 1.00 23.66  ? 636 TYR A CB  1 
ATOM   1444 C  CG  . TYR A 1 186 ? 23.558 -4.955 13.901 1.00 34.24  ? 636 TYR A CG  1 
ATOM   1445 C  CD1 . TYR A 1 186 ? 24.891 -5.187 14.238 1.00 29.82  ? 636 TYR A CD1 1 
ATOM   1446 C  CD2 . TYR A 1 186 ? 22.842 -5.985 13.263 1.00 38.55  ? 636 TYR A CD2 1 
ATOM   1447 C  CE1 . TYR A 1 186 ? 25.506 -6.406 13.929 1.00 34.95  ? 636 TYR A CE1 1 
ATOM   1448 C  CE2 . TYR A 1 186 ? 23.444 -7.207 12.957 1.00 34.35  ? 636 TYR A CE2 1 
ATOM   1449 C  CZ  . TYR A 1 186 ? 24.774 -7.404 13.285 1.00 35.73  ? 636 TYR A CZ  1 
ATOM   1450 O  OH  . TYR A 1 186 ? 25.390 -8.575 12.931 1.00 37.45  ? 636 TYR A OH  1 
ATOM   1451 N  N   . TYR A 1 187 ? 21.174 -1.361 13.250 1.00 16.08  ? 637 TYR A N   1 
ATOM   1452 C  CA  . TYR A 1 187 ? 20.403 -0.183 13.613 1.00 23.20  ? 637 TYR A CA  1 
ATOM   1453 C  C   . TYR A 1 187 ? 19.227 -0.685 14.438 1.00 26.26  ? 637 TYR A C   1 
ATOM   1454 O  O   . TYR A 1 187 ? 18.807 -1.845 14.286 1.00 29.53  ? 637 TYR A O   1 
ATOM   1455 C  CB  . TYR A 1 187 ? 19.896 0.593  12.375 1.00 21.04  ? 637 TYR A CB  1 
ATOM   1456 C  CG  . TYR A 1 187 ? 18.746 -0.063 11.635 1.00 21.96  ? 637 TYR A CG  1 
ATOM   1457 C  CD1 . TYR A 1 187 ? 17.420 0.153  12.024 1.00 19.54  ? 637 TYR A CD1 1 
ATOM   1458 C  CD2 . TYR A 1 187 ? 18.984 -0.939 10.572 1.00 25.53  ? 637 TYR A CD2 1 
ATOM   1459 C  CE1 . TYR A 1 187 ? 16.372 -0.486 11.385 1.00 14.48  ? 637 TYR A CE1 1 
ATOM   1460 C  CE2 . TYR A 1 187 ? 17.937 -1.584 9.925  1.00 20.97  ? 637 TYR A CE2 1 
ATOM   1461 C  CZ  . TYR A 1 187 ? 16.634 -1.356 10.339 1.00 20.05  ? 637 TYR A CZ  1 
ATOM   1462 O  OH  . TYR A 1 187 ? 15.596 -2.023 9.717  1.00 22.89  ? 637 TYR A OH  1 
ATOM   1463 N  N   . LEU A 1 188 ? 18.754 0.155  15.353 1.00 24.52  ? 638 LEU A N   1 
ATOM   1464 C  CA  . LEU A 1 188 ? 17.593 -0.159 16.175 1.00 19.82  ? 638 LEU A CA  1 
ATOM   1465 C  C   . LEU A 1 188 ? 16.506 0.789  15.713 1.00 19.21  ? 638 LEU A C   1 
ATOM   1466 O  O   . LEU A 1 188 ? 16.788 1.923  15.317 1.00 19.37  ? 638 LEU A O   1 
ATOM   1467 C  CB  . LEU A 1 188 ? 17.879 0.088  17.644 1.00 25.26  ? 638 LEU A CB  1 
ATOM   1468 C  CG  . LEU A 1 188 ? 18.978 -0.812 18.191 1.00 37.34  ? 638 LEU A CG  1 
ATOM   1469 C  CD1 . LEU A 1 188 ? 19.680 -0.091 19.304 1.00 40.15  ? 638 LEU A CD1 1 
ATOM   1470 C  CD2 . LEU A 1 188 ? 18.406 -2.154 18.651 1.00 39.42  ? 638 LEU A CD2 1 
ATOM   1471 N  N   . LYS A 1 189 ? 15.275 0.307  15.726 1.00 18.20  ? 639 LYS A N   1 
ATOM   1472 C  CA  . LYS A 1 189 ? 14.138 1.094  15.316 1.00 17.83  ? 639 LYS A CA  1 
ATOM   1473 C  C   . LYS A 1 189 ? 13.217 1.280  16.520 1.00 19.98  ? 639 LYS A C   1 
ATOM   1474 O  O   . LYS A 1 189 ? 12.716 0.304  17.071 1.00 17.64  ? 639 LYS A O   1 
ATOM   1475 C  CB  . LYS A 1 189 ? 13.415 0.377  14.180 1.00 13.74  ? 639 LYS A CB  1 
ATOM   1476 C  CG  . LYS A 1 189 ? 12.228 1.111  13.653 1.00 12.06  ? 639 LYS A CG  1 
ATOM   1477 C  CD  . LYS A 1 189 ? 11.601 0.296  12.577 1.00 17.41  ? 639 LYS A CD  1 
ATOM   1478 C  CE  . LYS A 1 189 ? 10.221 0.799  12.249 1.00 21.62  ? 639 LYS A CE  1 
ATOM   1479 N  NZ  . LYS A 1 189 ? 9.581  -0.125 11.280 1.00 29.11  ? 639 LYS A NZ  1 
ATOM   1480 N  N   . LEU A 1 190 ? 13.066 2.533  16.950 1.00 25.28  ? 640 LEU A N   1 
ATOM   1481 C  CA  . LEU A 1 190 ? 12.212 2.921  18.083 1.00 30.42  ? 640 LEU A CA  1 
ATOM   1482 C  C   . LEU A 1 190 ? 10.932 3.628  17.624 1.00 32.84  ? 640 LEU A C   1 
ATOM   1483 O  O   . LEU A 1 190 ? 10.945 4.417  16.673 1.00 31.26  ? 640 LEU A O   1 
ATOM   1484 C  CB  . LEU A 1 190 ? 12.947 3.870  19.037 1.00 27.36  ? 640 LEU A CB  1 
ATOM   1485 C  CG  . LEU A 1 190 ? 13.471 3.337  20.369 1.00 31.50  ? 640 LEU A CG  1 
ATOM   1486 C  CD1 . LEU A 1 190 ? 14.615 2.343  20.184 1.00 27.58  ? 640 LEU A CD1 1 
ATOM   1487 C  CD2 . LEU A 1 190 ? 13.932 4.516  21.186 1.00 35.47  ? 640 LEU A CD2 1 
ATOM   1488 N  N   . GLU A 1 191 ? 9.833  3.357  18.318 1.00 35.78  ? 641 GLU A N   1 
ATOM   1489 C  CA  . GLU A 1 191 ? 8.567  3.981  17.994 1.00 35.69  ? 641 GLU A CA  1 
ATOM   1490 C  C   . GLU A 1 191 ? 8.493  5.238  18.838 1.00 30.48  ? 641 GLU A C   1 
ATOM   1491 O  O   . GLU A 1 191 ? 8.443  5.167  20.061 1.00 27.75  ? 641 GLU A O   1 
ATOM   1492 C  CB  . GLU A 1 191 ? 7.425  3.037  18.328 1.00 42.87  ? 641 GLU A CB  1 
ATOM   1493 C  CG  . GLU A 1 191 ? 6.103  3.445  17.720 1.00 52.22  ? 641 GLU A CG  1 
ATOM   1494 C  CD  . GLU A 1 191 ? 5.020  2.407  17.951 1.00 60.81  ? 641 GLU A CD  1 
ATOM   1495 O  OE1 . GLU A 1 191 ? 5.344  1.199  18.083 1.00 59.69  ? 641 GLU A OE1 1 
ATOM   1496 O  OE2 . GLU A 1 191 ? 3.835  2.804  17.995 1.00 66.95  ? 641 GLU A OE2 1 
ATOM   1497 N  N   . ASN A 1 192 ? 8.468  6.383  18.175 1.00 26.72  ? 642 ASN A N   1 
ATOM   1498 C  CA  . ASN A 1 192 ? 8.436  7.668  18.863 1.00 28.79  ? 642 ASN A CA  1 
ATOM   1499 C  C   . ASN A 1 192 ? 7.486  7.766  20.037 1.00 31.25  ? 642 ASN A C   1 
ATOM   1500 O  O   . ASN A 1 192 ? 7.824  8.323  21.058 1.00 33.65  ? 642 ASN A O   1 
ATOM   1501 C  CB  . ASN A 1 192 ? 8.110  8.798  17.887 1.00 30.04  ? 642 ASN A CB  1 
ATOM   1502 C  CG  . ASN A 1 192 ? 9.186  9.011  16.846 1.00 23.31  ? 642 ASN A CG  1 
ATOM   1503 O  OD1 . ASN A 1 192 ? 10.249 8.392  16.888 1.00 17.61  ? 642 ASN A OD1 1 
ATOM   1504 N  ND2 . ASN A 1 192 ? 8.922  9.912  15.912 1.00 30.06  ? 642 ASN A ND2 1 
ATOM   1505 N  N   . GLN A 1 193 ? 6.271  7.277  19.853 1.00 39.79  ? 643 GLN A N   1 
ATOM   1506 C  CA  . GLN A 1 193 ? 5.258  7.332  20.901 1.00 45.86  ? 643 GLN A CA  1 
ATOM   1507 C  C   . GLN A 1 193 ? 5.549  6.393  22.066 1.00 45.28  ? 643 GLN A C   1 
ATOM   1508 O  O   . GLN A 1 193 ? 5.770  6.844  23.179 1.00 47.52  ? 643 GLN A O   1 
ATOM   1509 C  CB  . GLN A 1 193 ? 3.858  7.061  20.317 1.00 50.11  ? 643 GLN A CB  1 
ATOM   1510 C  CG  . GLN A 1 193 ? 3.136  8.296  19.707 1.00 59.99  ? 643 GLN A CG  1 
ATOM   1511 C  CD  . GLN A 1 193 ? 3.900  8.988  18.559 1.00 64.20  ? 643 GLN A CD  1 
ATOM   1512 O  OE1 . GLN A 1 193 ? 4.254  8.361  17.558 1.00 67.55  ? 643 GLN A OE1 1 
ATOM   1513 N  NE2 . GLN A 1 193 ? 4.136  10.290 18.704 1.00 60.89  ? 643 GLN A NE2 1 
ATOM   1514 N  N   . SER A 1 194 ? 5.582  5.094  21.788 1.00 46.49  ? 644 SER A N   1 
ATOM   1515 C  CA  . SER A 1 194 ? 5.829  4.077  22.808 1.00 47.82  ? 644 SER A CA  1 
ATOM   1516 C  C   . SER A 1 194 ? 7.248  4.042  23.362 1.00 49.52  ? 644 SER A C   1 
ATOM   1517 O  O   . SER A 1 194 ? 7.444  3.732  24.530 1.00 49.17  ? 644 SER A O   1 
ATOM   1518 C  CB  . SER A 1 194 ? 5.502  2.688  22.249 1.00 50.92  ? 644 SER A CB  1 
ATOM   1519 O  OG  . SER A 1 194 ? 6.457  2.284  21.275 1.00 53.13  ? 644 SER A OG  1 
ATOM   1520 N  N   . LEU A 1 195 ? 8.226  4.333  22.507 1.00 52.76  ? 645 LEU A N   1 
ATOM   1521 C  CA  . LEU A 1 195 ? 9.639  4.288  22.866 1.00 53.34  ? 645 LEU A CA  1 
ATOM   1522 C  C   . LEU A 1 195 ? 10.102 2.849  22.995 1.00 56.11  ? 645 LEU A C   1 
ATOM   1523 O  O   . LEU A 1 195 ? 11.153 2.580  23.567 1.00 57.13  ? 645 LEU A O   1 
ATOM   1524 C  CB  . LEU A 1 195 ? 9.925  5.040  24.162 1.00 54.50  ? 645 LEU A CB  1 
ATOM   1525 C  CG  . LEU A 1 195 ? 10.022 6.554  24.044 1.00 55.19  ? 645 LEU A CG  1 
ATOM   1526 C  CD1 . LEU A 1 195 ? 10.380 7.127  25.400 1.00 57.96  ? 645 LEU A CD1 1 
ATOM   1527 C  CD2 . LEU A 1 195 ? 11.075 6.916  23.012 1.00 52.52  ? 645 LEU A CD2 1 
ATOM   1528 N  N   . LYS A 1 196 ? 9.310  1.920  22.471 1.00 60.65  ? 646 LYS A N   1 
ATOM   1529 C  CA  . LYS A 1 196 ? 9.671  0.514  22.525 1.00 64.49  ? 646 LYS A CA  1 
ATOM   1530 C  C   . LYS A 1 196 ? 10.341 0.070  21.231 1.00 63.79  ? 646 LYS A C   1 
ATOM   1531 O  O   . LYS A 1 196 ? 9.856  0.383  20.144 1.00 66.41  ? 646 LYS A O   1 
ATOM   1532 C  CB  . LYS A 1 196 ? 8.442  -0.349 22.813 1.00 70.50  ? 646 LYS A CB  1 
ATOM   1533 C  CG  . LYS A 1 196 ? 8.374  -0.833 24.261 1.00 81.24  ? 646 LYS A CG  1 
ATOM   1534 C  CD  . LYS A 1 196 ? 7.403  -0.021 25.114 1.00 86.76  ? 646 LYS A CD  1 
ATOM   1535 C  CE  . LYS A 1 196 ? 5.951  -0.398 24.812 1.00 91.30  ? 646 LYS A CE  1 
ATOM   1536 N  NZ  . LYS A 1 196 ? 4.965  0.261  25.723 1.00 92.79  ? 646 LYS A NZ  1 
ATOM   1537 N  N   . SER A 1 197 ? 11.481 -0.613 21.361 1.00 61.28  ? 647 SER A N   1 
ATOM   1538 C  CA  . SER A 1 197 ? 12.251 -1.131 20.223 1.00 56.13  ? 647 SER A CA  1 
ATOM   1539 C  C   . SER A 1 197 ? 11.411 -2.099 19.375 1.00 51.90  ? 647 SER A C   1 
ATOM   1540 O  O   . SER A 1 197 ? 11.240 -3.263 19.724 1.00 53.76  ? 647 SER A O   1 
ATOM   1541 C  CB  . SER A 1 197 ? 13.525 -1.818 20.733 1.00 55.22  ? 647 SER A CB  1 
ATOM   1542 O  OG  . SER A 1 197 ? 14.172 -2.569 19.718 1.00 62.64  ? 647 SER A OG  1 
ATOM   1543 N  N   . VAL A 1 198 ? 10.956 -1.624 18.223 1.00 46.58  ? 648 VAL A N   1 
ATOM   1544 C  CA  . VAL A 1 198 ? 10.114 -2.421 17.351 1.00 41.02  ? 648 VAL A CA  1 
ATOM   1545 C  C   . VAL A 1 198 ? 10.867 -3.454 16.526 1.00 38.67  ? 648 VAL A C   1 
ATOM   1546 O  O   . VAL A 1 198 ? 10.269 -4.391 16.008 1.00 41.88  ? 648 VAL A O   1 
ATOM   1547 C  CB  . VAL A 1 198 ? 9.284  -1.534 16.432 1.00 41.88  ? 648 VAL A CB  1 
ATOM   1548 C  CG1 . VAL A 1 198 ? 8.426  -0.600 17.261 1.00 44.58  ? 648 VAL A CG1 1 
ATOM   1549 C  CG2 . VAL A 1 198 ? 10.188 -0.743 15.524 1.00 46.06  ? 648 VAL A CG2 1 
ATOM   1550 N  N   . LYS A 1 199 ? 12.162 -3.247 16.344 1.00 33.48  ? 649 LYS A N   1 
ATOM   1551 C  CA  . LYS A 1 199 ? 12.986 -4.200 15.607 1.00 30.75  ? 649 LYS A CA  1 
ATOM   1552 C  C   . LYS A 1 199 ? 14.395 -3.664 15.435 1.00 28.79  ? 649 LYS A C   1 
ATOM   1553 O  O   . LYS A 1 199 ? 14.711 -2.573 15.908 1.00 34.32  ? 649 LYS A O   1 
ATOM   1554 C  CB  . LYS A 1 199 ? 12.389 -4.537 14.238 1.00 28.44  ? 649 LYS A CB  1 
ATOM   1555 C  CG  . LYS A 1 199 ? 12.678 -3.539 13.157 1.00 32.82  ? 649 LYS A CG  1 
ATOM   1556 C  CD  . LYS A 1 199 ? 12.184 -4.047 11.814 1.00 36.51  ? 649 LYS A CD  1 
ATOM   1557 C  CE  . LYS A 1 199 ? 12.596 -3.091 10.707 1.00 45.03  ? 649 LYS A CE  1 
ATOM   1558 N  NZ  . LYS A 1 199 ? 11.835 -3.281 9.440  1.00 53.87  ? 649 LYS A NZ  1 
ATOM   1559 N  N   . PHE A 1 200 ? 15.255 -4.488 14.850 1.00 22.25  ? 650 PHE A N   1 
ATOM   1560 C  CA  . PHE A 1 200 ? 16.626 -4.119 14.557 1.00 18.09  ? 650 PHE A CA  1 
ATOM   1561 C  C   . PHE A 1 200 ? 16.883 -4.777 13.231 1.00 19.43  ? 650 PHE A C   1 
ATOM   1562 O  O   . PHE A 1 200 ? 16.122 -5.634 12.816 1.00 25.86  ? 650 PHE A O   1 
ATOM   1563 C  CB  . PHE A 1 200 ? 17.609 -4.605 15.616 1.00 13.57  ? 650 PHE A CB  1 
ATOM   1564 C  CG  . PHE A 1 200 ? 17.552 -6.068 15.882 1.00 12.77  ? 650 PHE A CG  1 
ATOM   1565 C  CD1 . PHE A 1 200 ? 18.172 -6.973 15.028 1.00 21.38  ? 650 PHE A CD1 1 
ATOM   1566 C  CD2 . PHE A 1 200 ? 16.913 -6.549 17.017 1.00 17.77  ? 650 PHE A CD2 1 
ATOM   1567 C  CE1 . PHE A 1 200 ? 18.164 -8.348 15.292 1.00 17.12  ? 650 PHE A CE1 1 
ATOM   1568 C  CE2 . PHE A 1 200 ? 16.893 -7.909 17.295 1.00 23.37  ? 650 PHE A CE2 1 
ATOM   1569 C  CZ  . PHE A 1 200 ? 17.526 -8.813 16.423 1.00 23.55  ? 650 PHE A CZ  1 
ATOM   1570 N  N   . GLY A 1 201 ? 17.914 -4.334 12.536 1.00 22.52  ? 651 GLY A N   1 
ATOM   1571 C  CA  . GLY A 1 201 ? 18.209 -4.910 11.247 1.00 15.83  ? 651 GLY A CA  1 
ATOM   1572 C  C   . GLY A 1 201 ? 19.584 -4.511 10.792 1.00 19.78  ? 651 GLY A C   1 
ATOM   1573 O  O   . GLY A 1 201 ? 20.354 -3.911 11.540 1.00 23.50  ? 651 GLY A O   1 
ATOM   1574 N  N   . SER A 1 202 ? 19.875 -4.839 9.543  1.00 22.45  ? 652 SER A N   1 
ATOM   1575 C  CA  . SER A 1 202 ? 21.154 -4.554 8.932  1.00 20.13  ? 652 SER A CA  1 
ATOM   1576 C  C   . SER A 1 202 ? 21.154 -3.231 8.171  1.00 21.01  ? 652 SER A C   1 
ATOM   1577 O  O   . SER A 1 202 ? 20.175 -2.880 7.504  1.00 22.81  ? 652 SER A O   1 
ATOM   1578 C  CB  . SER A 1 202 ? 21.500 -5.689 7.980  1.00 20.56  ? 652 SER A CB  1 
ATOM   1579 O  OG  . SER A 1 202 ? 22.584 -5.344 7.138  1.00 34.38  ? 652 SER A OG  1 
ATOM   1580 N  N   . ILE A 1 203 ? 22.258 -2.502 8.265  1.00 17.92  ? 653 ILE A N   1 
ATOM   1581 C  CA  . ILE A 1 203 ? 22.378 -1.248 7.545  1.00 19.03  ? 653 ILE A CA  1 
ATOM   1582 C  C   . ILE A 1 203 ? 22.515 -1.583 6.069  1.00 19.08  ? 653 ILE A C   1 
ATOM   1583 O  O   . ILE A 1 203 ? 21.850 -0.995 5.243  1.00 20.63  ? 653 ILE A O   1 
ATOM   1584 C  CB  . ILE A 1 203 ? 23.593 -0.436 8.015  1.00 18.95  ? 653 ILE A CB  1 
ATOM   1585 C  CG1 . ILE A 1 203 ? 23.389 -0.020 9.475  1.00 20.85  ? 653 ILE A CG1 1 
ATOM   1586 C  CG2 . ILE A 1 203 ? 23.783 0.776  7.129  1.00 13.93  ? 653 ILE A CG2 1 
ATOM   1587 C  CD1 . ILE A 1 203 ? 24.607 0.554  10.141 1.00 19.88  ? 653 ILE A CD1 1 
ATOM   1588 N  N   . LYS A 1 204 ? 23.341 -2.573 5.749  1.00 20.86  ? 654 LYS A N   1 
ATOM   1589 C  CA  . LYS A 1 204 ? 23.527 -2.965 4.358  1.00 21.84  ? 654 LYS A CA  1 
ATOM   1590 C  C   . LYS A 1 204 ? 22.217 -3.380 3.710  1.00 23.06  ? 654 LYS A C   1 
ATOM   1591 O  O   . LYS A 1 204 ? 21.851 -2.882 2.648  1.00 25.45  ? 654 LYS A O   1 
ATOM   1592 C  CB  . LYS A 1 204 ? 24.504 -4.128 4.237  1.00 16.83  ? 654 LYS A CB  1 
ATOM   1593 C  CG  . LYS A 1 204 ? 25.967 -3.760 4.307  1.00 26.20  ? 654 LYS A CG  1 
ATOM   1594 C  CD  . LYS A 1 204 ? 26.815 -4.860 3.654  1.00 29.43  ? 654 LYS A CD  1 
ATOM   1595 C  CE  . LYS A 1 204 ? 28.304 -4.536 3.662  1.00 36.96  ? 654 LYS A CE  1 
ATOM   1596 N  NZ  . LYS A 1 204 ? 29.142 -5.637 3.061  1.00 44.02  ? 654 LYS A NZ  1 
ATOM   1597 N  N   . SER A 1 205 ? 21.506 -4.288 4.363  1.00 27.12  ? 655 SER A N   1 
ATOM   1598 C  CA  . SER A 1 205 ? 20.250 -4.802 3.824  1.00 30.67  ? 655 SER A CA  1 
ATOM   1599 C  C   . SER A 1 205 ? 19.162 -3.757 3.741  1.00 31.39  ? 655 SER A C   1 
ATOM   1600 O  O   . SER A 1 205 ? 18.739 -3.387 2.653  1.00 38.41  ? 655 SER A O   1 
ATOM   1601 C  CB  . SER A 1 205 ? 19.733 -5.987 4.658  1.00 35.16  ? 655 SER A CB  1 
ATOM   1602 O  OG  . SER A 1 205 ? 20.727 -6.990 4.862  1.00 46.10  ? 655 SER A OG  1 
ATOM   1603 N  N   . ASP A 1 206 ? 18.793 -3.221 4.899  1.00 29.88  ? 656 ASP A N   1 
ATOM   1604 C  CA  . ASP A 1 206 ? 17.715 -2.259 5.016  1.00 27.34  ? 656 ASP A CA  1 
ATOM   1605 C  C   . ASP A 1 206 ? 17.938 -0.805 4.641  1.00 23.91  ? 656 ASP A C   1 
ATOM   1606 O  O   . ASP A 1 206 ? 16.966 -0.062 4.508  1.00 22.80  ? 656 ASP A O   1 
ATOM   1607 C  CB  . ASP A 1 206 ? 17.119 -2.329 6.431  1.00 33.82  ? 656 ASP A CB  1 
ATOM   1608 C  CG  . ASP A 1 206 ? 16.518 -3.684 6.746  1.00 30.80  ? 656 ASP A CG  1 
ATOM   1609 O  OD1 . ASP A 1 206 ? 15.765 -4.210 5.904  1.00 41.51  ? 656 ASP A OD1 1 
ATOM   1610 O  OD2 . ASP A 1 206 ? 16.803 -4.233 7.826  1.00 36.68  ? 656 ASP A OD2 1 
ATOM   1611 N  N   . TRP A 1 207 ? 19.184 -0.365 4.525  1.00 23.54  ? 657 TRP A N   1 
ATOM   1612 C  CA  . TRP A 1 207 ? 19.431 1.044  4.187  1.00 21.23  ? 657 TRP A CA  1 
ATOM   1613 C  C   . TRP A 1 207 ? 20.130 1.319  2.853  1.00 19.52  ? 657 TRP A C   1 
ATOM   1614 O  O   . TRP A 1 207 ? 19.716 2.193  2.088  1.00 23.23  ? 657 TRP A O   1 
ATOM   1615 C  CB  . TRP A 1 207 ? 20.143 1.744  5.351  1.00 18.05  ? 657 TRP A CB  1 
ATOM   1616 C  CG  . TRP A 1 207 ? 19.220 1.930  6.531  1.00 19.99  ? 657 TRP A CG  1 
ATOM   1617 C  CD1 . TRP A 1 207 ? 18.809 0.966  7.419  1.00 18.40  ? 657 TRP A CD1 1 
ATOM   1618 C  CD2 . TRP A 1 207 ? 18.484 3.117  6.861  1.00 14.51  ? 657 TRP A CD2 1 
ATOM   1619 N  NE1 . TRP A 1 207 ? 17.849 1.476  8.256  1.00 12.67  ? 657 TRP A NE1 1 
ATOM   1620 C  CE2 . TRP A 1 207 ? 17.632 2.793  7.938  1.00 13.71  ? 657 TRP A CE2 1 
ATOM   1621 C  CE3 . TRP A 1 207 ? 18.457 4.422  6.344  1.00 12.17  ? 657 TRP A CE3 1 
ATOM   1622 C  CZ2 . TRP A 1 207 ? 16.764 3.724  8.503  1.00 13.22  ? 657 TRP A CZ2 1 
ATOM   1623 C  CZ3 . TRP A 1 207 ? 17.593 5.353  6.910  1.00 8.91   ? 657 TRP A CZ3 1 
ATOM   1624 C  CH2 . TRP A 1 207 ? 16.761 5.000  7.975  1.00 13.21  ? 657 TRP A CH2 1 
ATOM   1625 N  N   . LEU A 1 208 ? 21.178 0.561  2.571  1.00 19.59  ? 658 LEU A N   1 
ATOM   1626 C  CA  . LEU A 1 208 ? 21.926 0.714  1.333  1.00 20.69  ? 658 LEU A CA  1 
ATOM   1627 C  C   . LEU A 1 208 ? 21.307 -0.107 0.214  1.00 22.96  ? 658 LEU A C   1 
ATOM   1628 O  O   . LEU A 1 208 ? 21.719 0.007  -0.934 1.00 28.22  ? 658 LEU A O   1 
ATOM   1629 C  CB  . LEU A 1 208 ? 23.372 0.261  1.521  1.00 18.93  ? 658 LEU A CB  1 
ATOM   1630 C  CG  . LEU A 1 208 ? 24.146 0.877  2.671  1.00 12.34  ? 658 LEU A CG  1 
ATOM   1631 C  CD1 . LEU A 1 208 ? 25.575 0.362  2.609  1.00 22.11  ? 658 LEU A CD1 1 
ATOM   1632 C  CD2 . LEU A 1 208 ? 24.115 2.382  2.556  1.00 11.28  ? 658 LEU A CD2 1 
ATOM   1633 N  N   . GLY A 1 209 ? 20.357 -0.969 0.553  1.00 21.64  ? 659 GLY A N   1 
ATOM   1634 C  CA  . GLY A 1 209 ? 19.731 -1.787 -0.463 1.00 24.48  ? 659 GLY A CA  1 
ATOM   1635 C  C   . GLY A 1 209 ? 20.746 -2.672 -1.160 1.00 29.13  ? 659 GLY A C   1 
ATOM   1636 O  O   . GLY A 1 209 ? 20.712 -2.845 -2.383 1.00 32.14  ? 659 GLY A O   1 
ATOM   1637 N  N   . CYS A 1 210 ? 21.687 -3.201 -0.391 1.00 30.26  ? 660 CYS A N   1 
ATOM   1638 C  CA  . CYS A 1 210 ? 22.696 -4.078 -0.956 1.00 31.82  ? 660 CYS A CA  1 
ATOM   1639 C  C   . CYS A 1 210 ? 22.032 -5.347 -1.476 1.00 33.54  ? 660 CYS A C   1 
ATOM   1640 O  O   . CYS A 1 210 ? 21.509 -6.145 -0.698 1.00 38.34  ? 660 CYS A O   1 
ATOM   1641 C  CB  . CYS A 1 210 ? 23.747 -4.437 0.092  1.00 30.34  ? 660 CYS A CB  1 
ATOM   1642 S  SG  . CYS A 1 210 ? 24.770 -3.024 0.571  1.00 30.44  ? 660 CYS A SG  1 
HETATM 1643 CL CL  . CL  B 2 .   ? 24.515 11.407 13.211 1.00 30.56  ? 1   CL  A CL  1 
HETATM 1644 CA CA  . CA  C 3 .   ? 21.792 12.552 12.342 1.00 14.84  ? 2   CA  A CA  1 
HETATM 1645 CA CA  . CA  D 3 .   ? 28.883 9.688  14.120 1.00 19.98  ? 5   CA  A CA  1 
HETATM 1646 O  O   . HOH E 4 .   ? 9.032  11.629 12.479 1.00 13.70  ? 3   HOH A O   1 
HETATM 1647 O  O   . HOH E 4 .   ? 24.427 -2.893 17.077 1.00 34.17  ? 4   HOH A O   1 
HETATM 1648 O  O   . HOH E 4 .   ? 31.709 31.697 19.523 1.00 33.16  ? 6   HOH A O   1 
HETATM 1649 O  O   . HOH E 4 .   ? 35.634 26.002 8.008  1.00 25.26  ? 7   HOH A O   1 
HETATM 1650 O  O   . HOH E 4 .   ? 19.976 22.403 4.627  1.00 52.10  ? 8   HOH A O   1 
HETATM 1651 O  O   . HOH E 4 .   ? 34.570 1.958  8.434  1.00 19.55  ? 9   HOH A O   1 
HETATM 1652 O  O   . HOH E 4 .   ? 30.816 34.829 17.245 1.00 6.81   ? 11  HOH A O   1 
HETATM 1653 O  O   . HOH E 4 .   ? 46.429 12.080 0.399  1.00 11.19  ? 13  HOH A O   1 
HETATM 1654 O  O   . HOH E 4 .   ? 35.995 17.103 2.035  1.00 19.34  ? 15  HOH A O   1 
HETATM 1655 O  O   . HOH E 4 .   ? 10.371 11.298 5.073  1.00 18.52  ? 17  HOH A O   1 
HETATM 1656 O  O   . HOH E 4 .   ? 34.592 19.295 2.824  1.00 22.47  ? 18  HOH A O   1 
HETATM 1657 O  O   . HOH E 4 .   ? 35.359 23.173 23.156 1.00 56.49  ? 19  HOH A O   1 
HETATM 1658 O  O   . HOH E 4 .   ? 30.973 5.571  17.638 1.00 36.77  ? 20  HOH A O   1 
HETATM 1659 O  O   . HOH E 4 .   ? 23.369 21.868 30.657 1.00 55.50  ? 21  HOH A O   1 
HETATM 1660 O  O   . HOH E 4 .   ? 32.361 16.387 16.930 1.00 14.00  ? 23  HOH A O   1 
HETATM 1661 O  O   . HOH E 4 .   ? 12.194 16.362 12.321 1.00 43.98  ? 24  HOH A O   1 
HETATM 1662 O  O   . HOH E 4 .   ? 18.512 6.140  -4.557 1.00 38.54  ? 25  HOH A O   1 
HETATM 1663 O  O   . HOH E 4 .   ? 12.765 23.059 16.144 1.00 45.55  ? 26  HOH A O   1 
HETATM 1664 O  O   . HOH E 4 .   ? 26.770 2.253  12.509 1.00 15.96  ? 27  HOH A O   1 
HETATM 1665 O  O   . HOH E 4 .   ? 30.499 7.411  13.404 1.00 20.09  ? 28  HOH A O   1 
HETATM 1666 O  O   . HOH E 4 .   ? 38.768 11.774 3.041  1.00 44.09  ? 29  HOH A O   1 
HETATM 1667 O  O   . HOH E 4 .   ? 24.706 33.473 15.916 1.00 47.55  ? 30  HOH A O   1 
HETATM 1668 O  O   . HOH E 4 .   ? 23.070 11.425 -7.553 1.00 40.86  ? 31  HOH A O   1 
HETATM 1669 O  O   . HOH E 4 .   ? 19.687 13.431 11.612 1.00 24.87  ? 33  HOH A O   1 
HETATM 1670 O  O   . HOH E 4 .   ? 40.538 18.838 7.086  1.00 42.94  ? 34  HOH A O   1 
HETATM 1671 O  O   . HOH E 4 .   ? 32.898 12.401 6.964  1.00 20.61  ? 35  HOH A O   1 
HETATM 1672 O  O   . HOH E 4 .   ? 27.410 34.205 14.827 1.00 15.54  ? 36  HOH A O   1 
HETATM 1673 O  O   . HOH E 4 .   ? 24.912 5.374  -8.396 1.00 52.09  ? 37  HOH A O   1 
HETATM 1674 O  O   . HOH E 4 .   ? 30.635 3.373  -3.508 1.00 27.79  ? 38  HOH A O   1 
HETATM 1675 O  O   . HOH E 4 .   ? 27.246 3.396  9.989  1.00 16.37  ? 39  HOH A O   1 
HETATM 1676 O  O   . HOH E 4 .   ? 27.489 3.597  -4.959 1.00 46.34  ? 40  HOH A O   1 
HETATM 1677 O  O   . HOH E 4 .   ? 45.400 10.882 6.073  1.00 20.38  ? 42  HOH A O   1 
HETATM 1678 O  O   . HOH E 4 .   ? 32.648 10.865 16.477 1.00 26.81  ? 43  HOH A O   1 
HETATM 1679 O  O   . HOH E 4 .   ? 28.363 -1.248 4.719  1.00 36.80  ? 44  HOH A O   1 
HETATM 1680 O  O   . HOH E 4 .   ? 35.831 28.556 15.904 1.00 28.72  ? 45  HOH A O   1 
HETATM 1681 O  O   . HOH E 4 .   ? 38.780 19.757 16.297 1.00 32.32  ? 46  HOH A O   1 
HETATM 1682 O  O   . HOH E 4 .   ? 24.548 28.115 17.333 1.00 24.34  ? 47  HOH A O   1 
HETATM 1683 O  O   . HOH E 4 .   ? 13.539 22.868 19.988 1.00 38.04  ? 48  HOH A O   1 
HETATM 1684 O  O   . HOH E 4 .   ? 32.252 23.269 -4.146 1.00 46.40  ? 49  HOH A O   1 
HETATM 1685 O  O   . HOH E 4 .   ? 30.369 2.050  17.771 1.00 80.71  ? 50  HOH A O   1 
HETATM 1686 O  O   . HOH E 4 .   ? 27.253 9.083  -8.675 1.00 74.14  ? 51  HOH A O   1 
HETATM 1687 O  O   . HOH E 4 .   ? 25.778 -3.289 7.817  1.00 31.36  ? 52  HOH A O   1 
HETATM 1688 O  O   . HOH E 4 .   ? 29.036 -0.968 -3.598 1.00 73.69  ? 53  HOH A O   1 
HETATM 1689 O  O   . HOH E 4 .   ? 6.580  7.869  5.472  1.00 58.40  ? 55  HOH A O   1 
HETATM 1690 O  O   . HOH E 4 .   ? 16.311 14.081 12.497 1.00 31.09  ? 57  HOH A O   1 
HETATM 1691 O  O   . HOH E 4 .   ? 37.255 21.337 13.483 1.00 43.40  ? 60  HOH A O   1 
HETATM 1692 O  O   . HOH E 4 .   ? 30.060 31.372 2.626  1.00 62.64  ? 61  HOH A O   1 
HETATM 1693 O  O   . HOH E 4 .   ? 36.296 31.523 19.621 1.00 43.78  ? 63  HOH A O   1 
HETATM 1694 O  O   . HOH E 4 .   ? 39.873 23.198 15.972 1.00 69.61  ? 64  HOH A O   1 
HETATM 1695 O  O   . HOH E 4 .   ? 23.388 -7.388 2.560  1.00 57.36  ? 65  HOH A O   1 
HETATM 1696 O  O   . HOH E 4 .   ? 53.805 6.911  6.765  1.00 51.19  ? 66  HOH A O   1 
HETATM 1697 O  O   . HOH E 4 .   ? 20.678 2.297  34.709 1.00 70.12  ? 67  HOH A O   1 
HETATM 1698 O  O   . HOH E 4 .   ? 13.516 7.354  26.749 1.00 75.19  ? 68  HOH A O   1 
HETATM 1699 O  O   . HOH E 4 .   ? 16.973 23.917 3.356  1.00 30.48  ? 69  HOH A O   1 
HETATM 1700 O  O   . HOH E 4 .   ? 33.084 7.148  13.944 1.00 53.48  ? 70  HOH A O   1 
HETATM 1701 O  O   . HOH E 4 .   ? 28.083 -7.046 7.663  1.00 64.69  ? 71  HOH A O   1 
HETATM 1702 O  O   . HOH E 4 .   ? 23.178 27.871 -0.935 1.00 45.82  ? 73  HOH A O   1 
HETATM 1703 O  O   . HOH E 4 .   ? 5.289  0.058  14.643 1.00 50.88  ? 74  HOH A O   1 
HETATM 1704 O  O   . HOH E 4 .   ? 38.247 23.762 9.554  1.00 46.47  ? 76  HOH A O   1 
HETATM 1705 O  O   . HOH E 4 .   ? 11.728 20.944 8.641  1.00 43.87  ? 77  HOH A O   1 
HETATM 1706 O  O   . HOH E 4 .   ? 36.592 2.324  -5.421 1.00 57.94  ? 78  HOH A O   1 
HETATM 1707 O  O   . HOH E 4 .   ? 17.565 10.798 34.621 1.00 48.56  ? 79  HOH A O   1 
HETATM 1708 O  O   . HOH E 4 .   ? 16.957 2.088  30.922 1.00 37.02  ? 80  HOH A O   1 
HETATM 1709 O  O   . HOH E 4 .   ? 14.330 5.642  32.163 1.00 50.41  ? 81  HOH A O   1 
HETATM 1710 O  O   . HOH E 4 .   ? 23.006 26.565 25.574 1.00 66.69  ? 82  HOH A O   1 
HETATM 1711 O  O   . HOH E 4 .   ? 14.701 16.490 5.638  1.00 16.46  ? 83  HOH A O   1 
HETATM 1712 O  O   . HOH E 4 .   ? 32.649 10.242 13.688 1.00 55.80  ? 85  HOH A O   1 
HETATM 1713 O  O   . HOH E 4 .   ? 37.614 15.858 11.354 1.00 40.33  ? 86  HOH A O   1 
HETATM 1714 O  O   . HOH E 4 .   ? 34.437 15.950 4.424  1.00 42.37  ? 87  HOH A O   1 
HETATM 1715 O  O   . HOH E 4 .   ? 36.835 14.254 13.540 1.00 33.86  ? 88  HOH A O   1 
HETATM 1716 O  O   . HOH E 4 .   ? 34.785 16.533 -0.307 1.00 27.80  ? 89  HOH A O   1 
HETATM 1717 O  O   . HOH E 4 .   ? 38.194 16.185 -2.634 1.00 43.01  ? 90  HOH A O   1 
HETATM 1718 O  O   . HOH E 4 .   ? 40.304 10.827 0.665  1.00 44.84  ? 91  HOH A O   1 
HETATM 1719 O  O   . HOH E 4 .   ? 13.307 19.641 5.640  1.00 20.05  ? 92  HOH A O   1 
HETATM 1720 O  O   . HOH E 4 .   ? 27.141 7.875  22.311 1.00 32.94  ? 93  HOH A O   1 
HETATM 1721 O  O   . HOH E 4 .   ? 10.486 8.115  11.109 1.00 16.60  ? 94  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   451 ?   ?   ?   A . n 
A 1 2   ASP 2   452 ?   ?   ?   A . n 
A 1 3   LEU 3   453 ?   ?   ?   A . n 
A 1 4   GLY 4   454 ?   ?   ?   A . n 
A 1 5   THR 5   455 ?   ?   ?   A . n 
A 1 6   GLY 6   456 ?   ?   ?   A . n 
A 1 7   PRO 7   457 ?   ?   ?   A . n 
A 1 8   THR 8   458 458 THR THR A . n 
A 1 9   PRO 9   459 459 PRO PRO A . n 
A 1 10  THR 10  460 460 THR THR A . n 
A 1 11  LEU 11  461 461 LEU LEU A . n 
A 1 12  GLY 12  462 462 GLY GLY A . n 
A 1 13  PRO 13  463 463 PRO PRO A . n 
A 1 14  VAL 14  464 464 VAL VAL A . n 
A 1 15  THR 15  465 465 THR THR A . n 
A 1 16  PRO 16  466 466 PRO PRO A . n 
A 1 17  GLU 17  467 467 GLU GLU A . n 
A 1 18  ILE 18  468 468 ILE ILE A . n 
A 1 19  CYS 19  469 469 CYS CYS A . n 
A 1 20  LYS 20  470 470 LYS LYS A . n 
A 1 21  GLN 21  471 471 GLN GLN A . n 
A 1 22  ASP 22  472 472 ASP ASP A . n 
A 1 23  ILE 23  473 473 ILE ILE A . n 
A 1 24  VAL 24  474 474 VAL VAL A . n 
A 1 25  PHE 25  475 475 PHE PHE A . n 
A 1 26  ASP 26  476 476 ASP ASP A . n 
A 1 27  GLY 27  477 477 GLY GLY A . n 
A 1 28  ILE 28  478 478 ILE ILE A . n 
A 1 29  ALA 29  479 479 ALA ALA A . n 
A 1 30  GLN 30  480 480 GLN GLN A . n 
A 1 31  ILE 31  481 481 ILE ILE A . n 
A 1 32  ARG 32  482 482 ARG ARG A . n 
A 1 33  GLY 33  483 483 GLY GLY A . n 
A 1 34  GLU 34  484 484 GLU GLU A . n 
A 1 35  ILE 35  485 485 ILE ILE A . n 
A 1 36  PHE 36  486 486 PHE PHE A . n 
A 1 37  PHE 37  487 487 PHE PHE A . n 
A 1 38  PHE 38  488 488 PHE PHE A . n 
A 1 39  LYS 39  489 489 LYS LYS A . n 
A 1 40  ASP 40  490 490 ASP ASP A . n 
A 1 41  ARG 41  491 491 ARG ARG A . n 
A 1 42  PHE 42  492 492 PHE PHE A . n 
A 1 43  ILE 43  493 493 ILE ILE A . n 
A 1 44  TRP 44  494 494 TRP TRP A . n 
A 1 45  ARG 45  495 495 ARG ARG A . n 
A 1 46  THR 46  496 496 THR THR A . n 
A 1 47  VAL 47  497 497 VAL VAL A . n 
A 1 48  THR 48  498 498 THR THR A . n 
A 1 49  PRO 49  499 499 PRO PRO A . n 
A 1 50  ARG 50  500 500 ARG ARG A . n 
A 1 51  ASP 51  501 501 ASP ASP A . n 
A 1 52  LYS 52  502 502 LYS LYS A . n 
A 1 53  PRO 53  503 503 PRO PRO A . n 
A 1 54  MET 54  504 504 MET MET A . n 
A 1 55  GLY 55  505 505 GLY GLY A . n 
A 1 56  PRO 56  506 506 PRO PRO A . n 
A 1 57  LEU 57  507 507 LEU LEU A . n 
A 1 58  LEU 58  508 508 LEU LEU A . n 
A 1 59  VAL 59  509 509 VAL VAL A . n 
A 1 60  ALA 60  510 510 ALA ALA A . n 
A 1 61  THR 61  511 511 THR THR A . n 
A 1 62  PHE 62  512 512 PHE PHE A . n 
A 1 63  TRP 63  513 513 TRP TRP A . n 
A 1 64  PRO 64  514 514 PRO PRO A . n 
A 1 65  GLU 65  515 515 GLU GLU A . n 
A 1 66  LEU 66  516 516 LEU LEU A . n 
A 1 67  PRO 67  517 517 PRO PRO A . n 
A 1 68  GLU 68  518 518 GLU GLU A . n 
A 1 69  LYS 69  519 519 LYS LYS A . n 
A 1 70  ILE 70  520 520 ILE ILE A . n 
A 1 71  ASP 71  521 521 ASP ASP A . n 
A 1 72  ALA 72  522 522 ALA ALA A . n 
A 1 73  VAL 73  523 523 VAL VAL A . n 
A 1 74  TYR 74  524 524 TYR TYR A . n 
A 1 75  GLU 75  525 525 GLU GLU A . n 
A 1 76  ALA 76  526 526 ALA ALA A . n 
A 1 77  PRO 77  527 527 PRO PRO A . n 
A 1 78  GLN 78  528 528 GLN GLN A . n 
A 1 79  GLU 79  529 529 GLU GLU A . n 
A 1 80  GLU 80  530 530 GLU GLU A . n 
A 1 81  LYS 81  531 531 LYS LYS A . n 
A 1 82  ALA 82  532 532 ALA ALA A . n 
A 1 83  VAL 83  533 533 VAL VAL A . n 
A 1 84  PHE 84  534 534 PHE PHE A . n 
A 1 85  PHE 85  535 535 PHE PHE A . n 
A 1 86  ALA 86  536 536 ALA ALA A . n 
A 1 87  GLY 87  537 537 GLY GLY A . n 
A 1 88  ASN 88  538 538 ASN ASN A . n 
A 1 89  GLU 89  539 539 GLU GLU A . n 
A 1 90  TYR 90  540 540 TYR TYR A . n 
A 1 91  TRP 91  541 541 TRP TRP A . n 
A 1 92  ILE 92  542 542 ILE ILE A . n 
A 1 93  TYR 93  543 543 TYR TYR A . n 
A 1 94  SER 94  544 544 SER SER A . n 
A 1 95  ALA 95  545 545 ALA ALA A . n 
A 1 96  SER 96  546 546 SER SER A . n 
A 1 97  THR 97  547 547 THR THR A . n 
A 1 98  LEU 98  548 548 LEU LEU A . n 
A 1 99  GLU 99  549 549 GLU GLU A . n 
A 1 100 ARG 100 550 550 ARG ARG A . n 
A 1 101 GLY 101 551 551 GLY GLY A . n 
A 1 102 TYR 102 552 552 TYR TYR A . n 
A 1 103 PRO 103 553 553 PRO PRO A . n 
A 1 104 LYS 104 554 554 LYS LYS A . n 
A 1 105 PRO 105 555 555 PRO PRO A . n 
A 1 106 LEU 106 556 556 LEU LEU A . n 
A 1 107 THR 107 557 557 THR THR A . n 
A 1 108 SER 108 558 558 SER SER A . n 
A 1 109 LEU 109 559 559 LEU LEU A . n 
A 1 110 GLY 110 560 560 GLY GLY A . n 
A 1 111 LEU 111 561 561 LEU LEU A . n 
A 1 112 PRO 112 562 562 PRO PRO A . n 
A 1 113 PRO 113 563 563 PRO PRO A . n 
A 1 114 ASP 114 564 564 ASP ASP A . n 
A 1 115 VAL 115 565 565 VAL VAL A . n 
A 1 116 GLN 116 566 566 GLN GLN A . n 
A 1 117 ARG 117 567 567 ARG ARG A . n 
A 1 118 VAL 118 568 568 VAL VAL A . n 
A 1 119 ASP 119 569 569 ASP ASP A . n 
A 1 120 ALA 120 570 570 ALA ALA A . n 
A 1 121 ALA 121 571 571 ALA ALA A . n 
A 1 122 PHE 122 572 572 PHE PHE A . n 
A 1 123 ASN 123 573 573 ASN ASN A . n 
A 1 124 TRP 124 574 574 TRP TRP A . n 
A 1 125 SER 125 575 575 SER SER A . n 
A 1 126 LYS 126 576 576 LYS LYS A . n 
A 1 127 ASN 127 577 577 ASN ASN A . n 
A 1 128 LYS 128 578 578 LYS LYS A . n 
A 1 129 LYS 129 579 579 LYS LYS A . n 
A 1 130 THR 130 580 580 THR THR A . n 
A 1 131 TYR 131 581 581 TYR TYR A . n 
A 1 132 ILE 132 582 582 ILE ILE A . n 
A 1 133 PHE 133 583 583 PHE PHE A . n 
A 1 134 ALA 134 584 584 ALA ALA A . n 
A 1 135 GLY 135 585 585 GLY GLY A . n 
A 1 136 ASP 136 586 586 ASP ASP A . n 
A 1 137 LYS 137 587 587 LYS LYS A . n 
A 1 138 PHE 138 588 588 PHE PHE A . n 
A 1 139 TRP 139 589 589 TRP TRP A . n 
A 1 140 ARG 140 590 590 ARG ARG A . n 
A 1 141 TYR 141 591 591 TYR TYR A . n 
A 1 142 ASN 142 592 592 ASN ASN A . n 
A 1 143 GLU 143 593 593 GLU GLU A . n 
A 1 144 VAL 144 594 594 VAL VAL A . n 
A 1 145 LYS 145 595 595 LYS LYS A . n 
A 1 146 LYS 146 596 596 LYS LYS A . n 
A 1 147 LYS 147 597 597 LYS LYS A . n 
A 1 148 MET 148 598 598 MET MET A . n 
A 1 149 ASP 149 599 599 ASP ASP A . n 
A 1 150 PRO 150 600 600 PRO PRO A . n 
A 1 151 GLY 151 601 601 GLY GLY A . n 
A 1 152 PHE 152 602 602 PHE PHE A . n 
A 1 153 PRO 153 603 603 PRO PRO A . n 
A 1 154 LYS 154 604 604 LYS LYS A . n 
A 1 155 LEU 155 605 605 LEU LEU A . n 
A 1 156 ILE 156 606 606 ILE ILE A . n 
A 1 157 ALA 157 607 607 ALA ALA A . n 
A 1 158 ASP 158 608 608 ASP ASP A . n 
A 1 159 ALA 159 609 609 ALA ALA A . n 
A 1 160 TRP 160 610 610 TRP TRP A . n 
A 1 161 ASN 161 611 611 ASN ASN A . n 
A 1 162 ALA 162 612 612 ALA ALA A . n 
A 1 163 ILE 163 613 613 ILE ILE A . n 
A 1 164 PRO 164 614 614 PRO PRO A . n 
A 1 165 ASP 165 615 615 ASP ASP A . n 
A 1 166 ASN 166 616 616 ASN ASN A . n 
A 1 167 LEU 167 617 617 LEU LEU A . n 
A 1 168 ASP 168 618 618 ASP ASP A . n 
A 1 169 ALA 169 619 619 ALA ALA A . n 
A 1 170 VAL 170 620 620 VAL VAL A . n 
A 1 171 VAL 171 621 621 VAL VAL A . n 
A 1 172 ASP 172 622 622 ASP ASP A . n 
A 1 173 LEU 173 623 623 LEU LEU A . n 
A 1 174 GLN 174 624 624 GLN GLN A . n 
A 1 175 GLY 175 625 625 GLY GLY A . n 
A 1 176 GLY 176 626 626 GLY GLY A . n 
A 1 177 GLY 177 627 627 GLY GLY A . n 
A 1 178 HIS 178 628 628 HIS HIS A . n 
A 1 179 SER 179 629 629 SER SER A . n 
A 1 180 TYR 180 630 630 TYR TYR A . n 
A 1 181 PHE 181 631 631 PHE PHE A . n 
A 1 182 PHE 182 632 632 PHE PHE A . n 
A 1 183 LYS 183 633 633 LYS LYS A . n 
A 1 184 GLY 184 634 634 GLY GLY A . n 
A 1 185 ALA 185 635 635 ALA ALA A . n 
A 1 186 TYR 186 636 636 TYR TYR A . n 
A 1 187 TYR 187 637 637 TYR TYR A . n 
A 1 188 LEU 188 638 638 LEU LEU A . n 
A 1 189 LYS 189 639 639 LYS LYS A . n 
A 1 190 LEU 190 640 640 LEU LEU A . n 
A 1 191 GLU 191 641 641 GLU GLU A . n 
A 1 192 ASN 192 642 642 ASN ASN A . n 
A 1 193 GLN 193 643 643 GLN GLN A . n 
A 1 194 SER 194 644 644 SER SER A . n 
A 1 195 LEU 195 645 645 LEU LEU A . n 
A 1 196 LYS 196 646 646 LYS LYS A . n 
A 1 197 SER 197 647 647 SER SER A . n 
A 1 198 VAL 198 648 648 VAL VAL A . n 
A 1 199 LYS 199 649 649 LYS LYS A . n 
A 1 200 PHE 200 650 650 PHE PHE A . n 
A 1 201 GLY 201 651 651 GLY GLY A . n 
A 1 202 SER 202 652 652 SER SER A . n 
A 1 203 ILE 203 653 653 ILE ILE A . n 
A 1 204 LYS 204 654 654 LYS LYS A . n 
A 1 205 SER 205 655 655 SER SER A . n 
A 1 206 ASP 206 656 656 ASP ASP A . n 
A 1 207 TRP 207 657 657 TRP TRP A . n 
A 1 208 LEU 208 658 658 LEU LEU A . n 
A 1 209 GLY 209 659 659 GLY GLY A . n 
A 1 210 CYS 210 660 660 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1  1  1  CL  CL  A . 
C 3 CA  1  2  2  CA  CA  A . 
D 3 CA  1  5  5  CA  CA  A . 
E 4 HOH 1  3  3  HOH HOH A . 
E 4 HOH 2  4  4  HOH HOH A . 
E 4 HOH 3  6  6  HOH HOH A . 
E 4 HOH 4  7  7  HOH HOH A . 
E 4 HOH 5  8  8  HOH HOH A . 
E 4 HOH 6  9  9  HOH HOH A . 
E 4 HOH 7  11 11 HOH HOH A . 
E 4 HOH 8  13 13 HOH HOH A . 
E 4 HOH 9  15 15 HOH HOH A . 
E 4 HOH 10 17 17 HOH HOH A . 
E 4 HOH 11 18 18 HOH HOH A . 
E 4 HOH 12 19 19 HOH HOH A . 
E 4 HOH 13 20 20 HOH HOH A . 
E 4 HOH 14 21 21 HOH HOH A . 
E 4 HOH 15 23 23 HOH HOH A . 
E 4 HOH 16 24 24 HOH HOH A . 
E 4 HOH 17 25 25 HOH HOH A . 
E 4 HOH 18 26 26 HOH HOH A . 
E 4 HOH 19 27 27 HOH HOH A . 
E 4 HOH 20 28 28 HOH HOH A . 
E 4 HOH 21 29 29 HOH HOH A . 
E 4 HOH 22 30 30 HOH HOH A . 
E 4 HOH 23 31 31 HOH HOH A . 
E 4 HOH 24 33 33 HOH HOH A . 
E 4 HOH 25 34 34 HOH HOH A . 
E 4 HOH 26 35 35 HOH HOH A . 
E 4 HOH 27 36 36 HOH HOH A . 
E 4 HOH 28 37 37 HOH HOH A . 
E 4 HOH 29 38 38 HOH HOH A . 
E 4 HOH 30 39 39 HOH HOH A . 
E 4 HOH 31 40 40 HOH HOH A . 
E 4 HOH 32 42 42 HOH HOH A . 
E 4 HOH 33 43 43 HOH HOH A . 
E 4 HOH 34 44 44 HOH HOH A . 
E 4 HOH 35 45 45 HOH HOH A . 
E 4 HOH 36 46 46 HOH HOH A . 
E 4 HOH 37 47 47 HOH HOH A . 
E 4 HOH 38 48 48 HOH HOH A . 
E 4 HOH 39 49 49 HOH HOH A . 
E 4 HOH 40 50 50 HOH HOH A . 
E 4 HOH 41 51 51 HOH HOH A . 
E 4 HOH 42 52 52 HOH HOH A . 
E 4 HOH 43 53 53 HOH HOH A . 
E 4 HOH 44 55 55 HOH HOH A . 
E 4 HOH 45 57 57 HOH HOH A . 
E 4 HOH 46 60 60 HOH HOH A . 
E 4 HOH 47 61 61 HOH HOH A . 
E 4 HOH 48 63 63 HOH HOH A . 
E 4 HOH 49 64 64 HOH HOH A . 
E 4 HOH 50 65 65 HOH HOH A . 
E 4 HOH 51 66 66 HOH HOH A . 
E 4 HOH 52 67 67 HOH HOH A . 
E 4 HOH 53 68 68 HOH HOH A . 
E 4 HOH 54 69 69 HOH HOH A . 
E 4 HOH 55 70 70 HOH HOH A . 
E 4 HOH 56 71 71 HOH HOH A . 
E 4 HOH 57 73 73 HOH HOH A . 
E 4 HOH 58 74 74 HOH HOH A . 
E 4 HOH 59 76 76 HOH HOH A . 
E 4 HOH 60 77 77 HOH HOH A . 
E 4 HOH 61 78 78 HOH HOH A . 
E 4 HOH 62 79 79 HOH HOH A . 
E 4 HOH 63 80 80 HOH HOH A . 
E 4 HOH 64 81 81 HOH HOH A . 
E 4 HOH 65 82 82 HOH HOH A . 
E 4 HOH 66 83 83 HOH HOH A . 
E 4 HOH 67 85 85 HOH HOH A . 
E 4 HOH 68 86 86 HOH HOH A . 
E 4 HOH 69 87 87 HOH HOH A . 
E 4 HOH 70 88 88 HOH HOH A . 
E 4 HOH 71 89 89 HOH HOH A . 
E 4 HOH 72 90 90 HOH HOH A . 
E 4 HOH 73 91 91 HOH HOH A . 
E 4 HOH 74 92 92 HOH HOH A . 
E 4 HOH 75 93 93 HOH HOH A . 
E 4 HOH 76 94 94 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O  ? A ASP 168 ? A ASP 618 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 119 ? A ASP 569 ? 1_555 86.3  ? 
2  O  ? A ASP 168 ? A ASP 618 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? E HOH .   ? A HOH 28  ? 1_555 82.2  ? 
3  O  ? A ASP 119 ? A ASP 569 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? E HOH .   ? A HOH 28  ? 1_555 131.0 ? 
4  O  ? A ASP 168 ? A ASP 618 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 71  ? A ASP 521 ? 1_555 146.2 ? 
5  O  ? A ASP 119 ? A ASP 569 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 71  ? A ASP 521 ? 1_555 83.4  ? 
6  O  ? E HOH .   ? A HOH 28  ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 71  ? A ASP 521 ? 1_555 127.8 ? 
7  O  ? A ASP 168 ? A ASP 618 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 26  ? A ASP 476 ? 1_555 106.5 ? 
8  O  ? A ASP 119 ? A ASP 569 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 26  ? A ASP 476 ? 1_555 147.2 ? 
9  O  ? E HOH .   ? A HOH 28  ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 26  ? A ASP 476 ? 1_555 81.4  ? 
10 O  ? A ASP 71  ? A ASP 521 ? 1_555 CA ? D CA . ? A CA 5 ? 1_555 O  ? A ASP 26  ? A ASP 476 ? 1_555 69.0  ? 
11 O  ? A VAL 170 ? A VAL 620 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? E HOH .   ? A HOH 33  ? 1_555 84.1  ? 
12 O  ? A VAL 170 ? A VAL 620 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ILE 28  ? A ILE 478 ? 1_555 98.5  ? 
13 O  ? E HOH .   ? A HOH 33  ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ILE 28  ? A ILE 478 ? 1_555 99.9  ? 
14 O  ? A VAL 170 ? A VAL 620 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 CL ? B CL  .   ? A CL  1   ? 1_555 96.4  ? 
15 O  ? E HOH .   ? A HOH 33  ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 CL ? B CL  .   ? A CL  1   ? 1_555 178.6 ? 
16 O  ? A ILE 28  ? A ILE 478 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 CL ? B CL  .   ? A CL  1   ? 1_555 78.8  ? 
17 O  ? A VAL 170 ? A VAL 620 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A VAL 73  ? A VAL 523 ? 1_555 170.2 ? 
18 O  ? E HOH .   ? A HOH 33  ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A VAL 73  ? A VAL 523 ? 1_555 95.1  ? 
19 O  ? A ILE 28  ? A ILE 478 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A VAL 73  ? A VAL 523 ? 1_555 91.2  ? 
20 CL ? B CL  .   ? A CL  1   ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A VAL 73  ? A VAL 523 ? 1_555 84.6  ? 
21 O  ? A VAL 170 ? A VAL 620 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ALA 121 ? A ALA 571 ? 1_555 81.9  ? 
22 O  ? E HOH .   ? A HOH 33  ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ALA 121 ? A ALA 571 ? 1_555 94.1  ? 
23 O  ? A ILE 28  ? A ILE 478 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ALA 121 ? A ALA 571 ? 1_555 165.9 ? 
24 CL ? B CL  .   ? A CL  1   ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ALA 121 ? A ALA 571 ? 1_555 87.2  ? 
25 O  ? A VAL 73  ? A VAL 523 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 O  ? A ALA 121 ? A ALA 571 ? 1_555 88.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-06-10 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM/CCP4 'data collection' . ? 1 
X-PLOR      'model building'  . ? 2 
X-PLOR      refinement        . ? 3 
MOSFLM      'data reduction'  . ? 4 
CCP4        'data reduction'  . ? 5 
X-PLOR      phasing           . ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 490 ? ? 62.64   -129.99 
2 1 PRO A 499 ? ? -129.74 -140.41 
3 1 LYS A 502 ? ? -3.27   110.80  
4 1 LYS A 519 ? ? -170.51 132.11  
5 1 ALA A 545 ? ? -123.85 -81.21  
6 1 ASN A 577 ? ? -150.05 6.29    
7 1 SER A 647 ? ? -59.09  104.31  
8 1 LYS A 649 ? ? 174.78  175.94  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE 451 ? A ILE 1  
2  1 Y 1 A ASP 452 ? A ASP 2  
3  1 Y 1 A LEU 453 ? A LEU 3  
4  1 Y 1 A GLY 454 ? A GLY 4  
5  1 Y 1 A THR 455 ? A THR 5  
6  1 Y 1 A GLY 456 ? A GLY 6  
7  1 Y 1 A PRO 457 ? A PRO 7  
8  1 Y 0 A THR 498 ? A THR 48 
9  1 Y 0 A PRO 499 ? A PRO 49 
10 1 Y 0 A ARG 500 ? A ARG 50 
11 1 Y 0 A ASP 501 ? A ASP 51 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 'CALCIUM ION'  CA  
4 water          HOH 
#