data_1RTN
# 
_entry.id   1RTN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RTN         
WWPDB D_1000176222 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1RTO 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RTN 
_pdbx_database_status.recvd_initial_deposition_date   1995-02-21 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Skelton, N.J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            34 
_citation.page_first                5329 
_citation.page_last                 5342 
_citation.year                      1995 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7537088 
_citation.pdbx_database_id_DOI      10.1021/bi00016a004 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Skelton, N.J.' 1 
primary 'Aspiras, F.'   2 
primary 'Ogez, J.'      3 
primary 'Schall, T.J.'  4 
# 
_cell.entry_id           1RTN 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RTN 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           RANTES 
_entity.formula_weight             7862.011 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_seq_one_letter_code_can   SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  PRO n 
1 3  TYR n 
1 4  SER n 
1 5  SER n 
1 6  ASP n 
1 7  THR n 
1 8  THR n 
1 9  PRO n 
1 10 CYS n 
1 11 CYS n 
1 12 PHE n 
1 13 ALA n 
1 14 TYR n 
1 15 ILE n 
1 16 ALA n 
1 17 ARG n 
1 18 PRO n 
1 19 LEU n 
1 20 PRO n 
1 21 ARG n 
1 22 ALA n 
1 23 HIS n 
1 24 ILE n 
1 25 LYS n 
1 26 GLU n 
1 27 TYR n 
1 28 PHE n 
1 29 TYR n 
1 30 THR n 
1 31 SER n 
1 32 GLY n 
1 33 LYS n 
1 34 CYS n 
1 35 SER n 
1 36 ASN n 
1 37 PRO n 
1 38 ALA n 
1 39 VAL n 
1 40 VAL n 
1 41 PHE n 
1 42 VAL n 
1 43 THR n 
1 44 ARG n 
1 45 LYS n 
1 46 ASN n 
1 47 ARG n 
1 48 GLN n 
1 49 VAL n 
1 50 CYS n 
1 51 ALA n 
1 52 ASN n 
1 53 PRO n 
1 54 GLU n 
1 55 LYS n 
1 56 LYS n 
1 57 TRP n 
1 58 VAL n 
1 59 ARG n 
1 60 GLU n 
1 61 TYR n 
1 62 ILE n 
1 63 ASN n 
1 64 SER n 
1 65 LEU n 
1 66 GLU n 
1 67 MET n 
1 68 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL5_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13501 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKW
VREYINSLEMS
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RTN A 1 ? 68 ? P13501 24 ? 91 ? 1 68 
2 1 1RTN B 1 ? 68 ? P13501 24 ? 91 ? 1 68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1RTN 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement DGII   ?   HAVEL   1 
refinement X-PLOR 3.1 BRUNGER 2 
# 
_exptl.entry_id          1RTN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1RTN 
_struct.title                     'PROTON NMR ASSIGNMENTS AND SOLUTION CONFORMATION OF RANTES, A CHEMOKINE OF THE CC TYPE' 
_struct.pdbx_descriptor           
'RANTES (REGULATED UPON ACTIVATION, NORMAL T-CELL EXPRESSED AND PRESUMABLY SECRETED) (NMR, 20 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RTN 
_struct_keywords.pdbx_keywords   CHEMOKINE 
_struct_keywords.text            'CHEMOTACTIC CYTOKINE, CHEMOKINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AH1 TRP A 57 ? GLU A 66 ? TRP A 57 GLU A 66 1 ? 10 
HELX_P HELX_P2 BH1 TRP B 57 ? GLU B 66 ? TRP B 57 GLU B 66 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 10 A CYS 34 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf3 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 34 SG ? ? B CYS 10 B CYS 34 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf4 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 50 SG ? ? B CYS 11 B CYS 50 1_555 ? ? ? ? ? ? ? 2.020 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 24 ? THR A 30 ? ILE A 24 THR A 30 
A 2 ALA A 38 ? ARG A 44 ? ALA A 38 ARG A 44 
A 3 ARG A 47 ? ALA A 51 ? ARG A 47 ALA A 51 
B 1 ILE B 24 ? THR B 30 ? ILE B 24 THR B 30 
B 2 ALA B 38 ? ARG B 44 ? ALA B 38 ARG B 44 
B 3 ARG B 47 ? ALA B 51 ? ARG B 47 ALA B 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 26 ? O GLU A 26 N VAL A 42 ? N VAL A 42 
A 2 3 O PHE A 41 ? O PHE A 41 N VAL A 49 ? N VAL A 49 
B 1 2 O GLU B 26 ? O GLU B 26 N VAL B 42 ? N VAL B 42 
B 2 3 O PHE B 41 ? O PHE B 41 N VAL B 49 ? N VAL B 49 
# 
_database_PDB_matrix.entry_id          1RTN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RTN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1  ? -9.189  12.636  3.849   1.00 5.93 ? 1  SER A N    1  
ATOM 2     C CA   . SER A 1 1  ? -10.332 12.134  3.037   1.00 5.93 ? 1  SER A CA   1  
ATOM 3     C C    . SER A 1 1  ? -11.319 11.394  3.945   1.00 5.93 ? 1  SER A C    1  
ATOM 4     O O    . SER A 1 1  ? -10.938 10.865  4.970   1.00 5.93 ? 1  SER A O    1  
ATOM 5     C CB   . SER A 1 1  ? -9.813  11.178  1.962   1.00 5.93 ? 1  SER A CB   1  
ATOM 6     O OG   . SER A 1 1  ? -8.909  11.872  1.114   1.00 5.93 ? 1  SER A OG   1  
ATOM 7     H H1   . SER A 1 1  ? -8.825  11.867  4.448   1.00 5.93 ? 1  SER A H1   1  
ATOM 8     H H2   . SER A 1 1  ? -8.435  12.971  3.216   1.00 5.93 ? 1  SER A H2   1  
ATOM 9     H H3   . SER A 1 1  ? -9.510  13.420  4.452   1.00 5.93 ? 1  SER A H3   1  
ATOM 10    H HA   . SER A 1 1  ? -10.832 12.967  2.565   1.00 5.93 ? 1  SER A HA   1  
ATOM 11    H HB2  . SER A 1 1  ? -9.300  10.353  2.429   1.00 5.93 ? 1  SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1  ? -10.647 10.799  1.385   1.00 5.93 ? 1  SER A HB3  1  
ATOM 13    H HG   . SER A 1 1  ? -8.908  11.434  0.259   1.00 5.93 ? 1  SER A HG   1  
ATOM 14    N N    . PRO A 1 2  ? -12.563 11.381  3.537   1.00 3.89 ? 2  PRO A N    1  
ATOM 15    C CA   . PRO A 1 2  ? -13.639 10.714  4.291   1.00 3.89 ? 2  PRO A CA   1  
ATOM 16    C C    . PRO A 1 2  ? -13.589 9.201   4.067   1.00 3.89 ? 2  PRO A C    1  
ATOM 17    O O    . PRO A 1 2  ? -13.542 8.426   5.003   1.00 3.89 ? 2  PRO A O    1  
ATOM 18    C CB   . PRO A 1 2  ? -14.917 11.313  3.695   1.00 3.89 ? 2  PRO A CB   1  
ATOM 19    C CG   . PRO A 1 2  ? -14.539 11.838  2.289   1.00 3.89 ? 2  PRO A CG   1  
ATOM 20    C CD   . PRO A 1 2  ? -13.011 12.030  2.288   1.00 3.89 ? 2  PRO A CD   1  
ATOM 21    H HA   . PRO A 1 2  ? -13.574 10.951  5.340   1.00 3.89 ? 2  PRO A HA   1  
ATOM 22    H HB2  . PRO A 1 2  ? -15.681 10.551  3.618   1.00 3.89 ? 2  PRO A HB2  1  
ATOM 23    H HB3  . PRO A 1 2  ? -15.265 12.130  4.307   1.00 3.89 ? 2  PRO A HB3  1  
ATOM 24    H HG2  . PRO A 1 2  ? -14.826 11.116  1.536   1.00 3.89 ? 2  PRO A HG2  1  
ATOM 25    H HG3  . PRO A 1 2  ? -15.025 12.783  2.103   1.00 3.89 ? 2  PRO A HG3  1  
ATOM 26    H HD2  . PRO A 1 2  ? -12.571 11.544  1.427   1.00 3.89 ? 2  PRO A HD2  1  
ATOM 27    H HD3  . PRO A 1 2  ? -12.760 13.079  2.302   1.00 3.89 ? 2  PRO A HD3  1  
ATOM 28    N N    . TYR A 1 3  ? -13.597 8.772   2.835   1.00 2.56 ? 3  TYR A N    1  
ATOM 29    C CA   . TYR A 1 3  ? -13.550 7.310   2.553   1.00 2.56 ? 3  TYR A CA   1  
ATOM 30    C C    . TYR A 1 3  ? -13.057 7.081   1.124   1.00 2.56 ? 3  TYR A C    1  
ATOM 31    O O    . TYR A 1 3  ? -13.499 7.726   0.194   1.00 2.56 ? 3  TYR A O    1  
ATOM 32    C CB   . TYR A 1 3  ? -14.951 6.715   2.712   1.00 2.56 ? 3  TYR A CB   1  
ATOM 33    C CG   . TYR A 1 3  ? -15.975 7.691   2.186   1.00 2.56 ? 3  TYR A CG   1  
ATOM 34    C CD1  . TYR A 1 3  ? -16.196 7.800   0.808   1.00 2.56 ? 3  TYR A CD1  1  
ATOM 35    C CD2  . TYR A 1 3  ? -16.705 8.487   3.077   1.00 2.56 ? 3  TYR A CD2  1  
ATOM 36    C CE1  . TYR A 1 3  ? -17.146 8.705   0.320   1.00 2.56 ? 3  TYR A CE1  1  
ATOM 37    C CE2  . TYR A 1 3  ? -17.655 9.392   2.589   1.00 2.56 ? 3  TYR A CE2  1  
ATOM 38    C CZ   . TYR A 1 3  ? -17.875 9.502   1.211   1.00 2.56 ? 3  TYR A CZ   1  
ATOM 39    O OH   . TYR A 1 3  ? -18.812 10.393  0.729   1.00 2.56 ? 3  TYR A OH   1  
ATOM 40    H H    . TYR A 1 3  ? -13.635 9.412   2.094   1.00 2.56 ? 3  TYR A H    1  
ATOM 41    H HA   . TYR A 1 3  ? -12.876 6.831   3.248   1.00 2.56 ? 3  TYR A HA   1  
ATOM 42    H HB2  . TYR A 1 3  ? -15.014 5.790   2.156   1.00 2.56 ? 3  TYR A HB2  1  
ATOM 43    H HB3  . TYR A 1 3  ? -15.143 6.519   3.756   1.00 2.56 ? 3  TYR A HB3  1  
ATOM 44    H HD1  . TYR A 1 3  ? -15.632 7.186   0.121   1.00 2.56 ? 3  TYR A HD1  1  
ATOM 45    H HD2  . TYR A 1 3  ? -16.536 8.403   4.139   1.00 2.56 ? 3  TYR A HD2  1  
ATOM 46    H HE1  . TYR A 1 3  ? -17.315 8.789   -0.744  1.00 2.56 ? 3  TYR A HE1  1  
ATOM 47    H HE2  . TYR A 1 3  ? -18.218 10.007  3.275   1.00 2.56 ? 3  TYR A HE2  1  
ATOM 48    H HH   . TYR A 1 3  ? -18.415 11.268  0.727   1.00 2.56 ? 3  TYR A HH   1  
ATOM 49    N N    . SER A 1 4  ? -12.145 6.166   0.940   1.00 0.96 ? 4  SER A N    1  
ATOM 50    C CA   . SER A 1 4  ? -11.624 5.896   -0.430  1.00 0.96 ? 4  SER A CA   1  
ATOM 51    C C    . SER A 1 4  ? -11.404 4.393   -0.606  1.00 0.96 ? 4  SER A C    1  
ATOM 52    O O    . SER A 1 4  ? -10.678 3.771   0.144   1.00 0.96 ? 4  SER A O    1  
ATOM 53    C CB   . SER A 1 4  ? -10.298 6.632   -0.624  1.00 0.96 ? 4  SER A CB   1  
ATOM 54    O OG   . SER A 1 4  ? -10.401 7.497   -1.748  1.00 0.96 ? 4  SER A OG   1  
ATOM 55    H H    . SER A 1 4  ? -11.801 5.657   1.704   1.00 0.96 ? 4  SER A H    1  
ATOM 56    H HA   . SER A 1 4  ? -12.339 6.244   -1.161  1.00 0.96 ? 4  SER A HA   1  
ATOM 57    H HB2  . SER A 1 4  ? -10.075 7.215   0.252   1.00 0.96 ? 4  SER A HB2  1  
ATOM 58    H HB3  . SER A 1 4  ? -9.508  5.911   -0.784  1.00 0.96 ? 4  SER A HB3  1  
ATOM 59    H HG   . SER A 1 4  ? -9.553  7.502   -2.197  1.00 0.96 ? 4  SER A HG   1  
ATOM 60    N N    . SER A 1 5  ? -12.025 3.804   -1.591  1.00 0.48 ? 5  SER A N    1  
ATOM 61    C CA   . SER A 1 5  ? -11.850 2.341   -1.813  1.00 0.48 ? 5  SER A CA   1  
ATOM 62    C C    . SER A 1 5  ? -10.721 2.108   -2.819  1.00 0.48 ? 5  SER A C    1  
ATOM 63    O O    . SER A 1 5  ? -10.955 1.756   -3.958  1.00 0.48 ? 5  SER A O    1  
ATOM 64    C CB   . SER A 1 5  ? -13.150 1.750   -2.360  1.00 0.48 ? 5  SER A CB   1  
ATOM 65    O OG   . SER A 1 5  ? -13.884 2.767   -3.028  1.00 0.48 ? 5  SER A OG   1  
ATOM 66    H H    . SER A 1 5  ? -12.606 4.323   -2.185  1.00 0.48 ? 5  SER A H    1  
ATOM 67    H HA   . SER A 1 5  ? -11.603 1.862   -0.877  1.00 0.48 ? 5  SER A HA   1  
ATOM 68    H HB2  . SER A 1 5  ? -12.924 0.961   -3.058  1.00 0.48 ? 5  SER A HB2  1  
ATOM 69    H HB3  . SER A 1 5  ? -13.734 1.348   -1.542  1.00 0.48 ? 5  SER A HB3  1  
ATOM 70    H HG   . SER A 1 5  ? -14.775 2.774   -2.670  1.00 0.48 ? 5  SER A HG   1  
ATOM 71    N N    . ASP A 1 6  ? -9.498  2.302   -2.408  1.00 0.37 ? 6  ASP A N    1  
ATOM 72    C CA   . ASP A 1 6  ? -8.356  2.092   -3.341  1.00 0.37 ? 6  ASP A CA   1  
ATOM 73    C C    . ASP A 1 6  ? -7.125  1.648   -2.549  1.00 0.37 ? 6  ASP A C    1  
ATOM 74    O O    . ASP A 1 6  ? -6.914  2.063   -1.426  1.00 0.37 ? 6  ASP A O    1  
ATOM 75    C CB   . ASP A 1 6  ? -8.048  3.400   -4.073  1.00 0.37 ? 6  ASP A CB   1  
ATOM 76    C CG   . ASP A 1 6  ? -9.316  3.913   -4.757  1.00 0.37 ? 6  ASP A CG   1  
ATOM 77    O OD1  . ASP A 1 6  ? -9.558  3.518   -5.886  1.00 0.37 ? 6  ASP A OD1  1  
ATOM 78    O OD2  . ASP A 1 6  ? -10.024 4.692   -4.141  1.00 0.37 ? 6  ASP A OD2  1  
ATOM 79    H H    . ASP A 1 6  ? -9.331  2.587   -1.485  1.00 0.37 ? 6  ASP A H    1  
ATOM 80    H HA   . ASP A 1 6  ? -8.615  1.329   -4.060  1.00 0.37 ? 6  ASP A HA   1  
ATOM 81    H HB2  . ASP A 1 6  ? -7.698  4.135   -3.362  1.00 0.37 ? 6  ASP A HB2  1  
ATOM 82    H HB3  . ASP A 1 6  ? -7.285  3.226   -4.816  1.00 0.37 ? 6  ASP A HB3  1  
ATOM 83    N N    . THR A 1 7  ? -6.309  0.807   -3.123  1.00 0.35 ? 7  THR A N    1  
ATOM 84    C CA   . THR A 1 7  ? -5.093  0.338   -2.402  1.00 0.35 ? 7  THR A CA   1  
ATOM 85    C C    . THR A 1 7  ? -4.159  1.523   -2.151  1.00 0.35 ? 7  THR A C    1  
ATOM 86    O O    . THR A 1 7  ? -3.979  2.375   -2.999  1.00 0.35 ? 7  THR A O    1  
ATOM 87    C CB   . THR A 1 7  ? -4.369  -0.712  -3.250  1.00 0.35 ? 7  THR A CB   1  
ATOM 88    O OG1  . THR A 1 7  ? -4.442  -0.341  -4.620  1.00 0.35 ? 7  THR A OG1  1  
ATOM 89    C CG2  . THR A 1 7  ? -5.030  -2.076  -3.052  1.00 0.35 ? 7  THR A CG2  1  
ATOM 90    H H    . THR A 1 7  ? -6.496  0.484   -4.029  1.00 0.35 ? 7  THR A H    1  
ATOM 91    H HA   . THR A 1 7  ? -5.380  -0.100  -1.457  1.00 0.35 ? 7  THR A HA   1  
ATOM 92    H HB   . THR A 1 7  ? -3.334  -0.770  -2.947  1.00 0.35 ? 7  THR A HB   1  
ATOM 93    H HG1  . THR A 1 7  ? -3.552  -0.144  -4.922  1.00 0.35 ? 7  THR A HG1  1  
ATOM 94    H HG21 . THR A 1 7  ? -6.072  -2.015  -3.329  1.00 0.35 ? 7  THR A HG21 1  
ATOM 95    H HG22 . THR A 1 7  ? -4.535  -2.809  -3.672  1.00 0.35 ? 7  THR A HG22 1  
ATOM 96    H HG23 . THR A 1 7  ? -4.949  -2.368  -2.015  1.00 0.35 ? 7  THR A HG23 1  
ATOM 97    N N    . THR A 1 8  ? -3.561  1.586   -0.992  1.00 0.31 ? 8  THR A N    1  
ATOM 98    C CA   . THR A 1 8  ? -2.639  2.716   -0.690  1.00 0.31 ? 8  THR A CA   1  
ATOM 99    C C    . THR A 1 8  ? -1.189  2.259   -0.895  1.00 0.31 ? 8  THR A C    1  
ATOM 100   O O    . THR A 1 8  ? -0.832  1.161   -0.520  1.00 0.31 ? 8  THR A O    1  
ATOM 101   C CB   . THR A 1 8  ? -2.834  3.156   0.764   1.00 0.31 ? 8  THR A CB   1  
ATOM 102   O OG1  . THR A 1 8  ? -4.150  3.663   0.930   1.00 0.31 ? 8  THR A OG1  1  
ATOM 103   C CG2  . THR A 1 8  ? -1.817  4.244   1.113   1.00 0.31 ? 8  THR A CG2  1  
ATOM 104   H H    . THR A 1 8  ? -3.719  0.889   -0.322  1.00 0.31 ? 8  THR A H    1  
ATOM 105   H HA   . THR A 1 8  ? -2.860  3.542   -1.348  1.00 0.31 ? 8  THR A HA   1  
ATOM 106   H HB   . THR A 1 8  ? -2.688  2.310   1.418   1.00 0.31 ? 8  THR A HB   1  
ATOM 107   H HG1  . THR A 1 8  ? -4.766  2.936   0.808   1.00 0.31 ? 8  THR A HG1  1  
ATOM 108   H HG21 . THR A 1 8  ? -0.924  4.105   0.523   1.00 0.31 ? 8  THR A HG21 1  
ATOM 109   H HG22 . THR A 1 8  ? -2.241  5.214   0.899   1.00 0.31 ? 8  THR A HG22 1  
ATOM 110   H HG23 . THR A 1 8  ? -1.570  4.182   2.162   1.00 0.31 ? 8  THR A HG23 1  
ATOM 111   N N    . PRO A 1 9  ? -0.396  3.118   -1.487  1.00 0.34 ? 9  PRO A N    1  
ATOM 112   C CA   . PRO A 1 9  ? 1.024   2.828   -1.755  1.00 0.34 ? 9  PRO A CA   1  
ATOM 113   C C    . PRO A 1 9  ? 1.852   3.006   -0.478  1.00 0.34 ? 9  PRO A C    1  
ATOM 114   O O    . PRO A 1 9  ? 2.540   3.991   -0.307  1.00 0.34 ? 9  PRO A O    1  
ATOM 115   C CB   . PRO A 1 9  ? 1.412   3.871   -2.806  1.00 0.34 ? 9  PRO A CB   1  
ATOM 116   C CG   . PRO A 1 9  ? 0.396   5.031   -2.664  1.00 0.34 ? 9  PRO A CG   1  
ATOM 117   C CD   . PRO A 1 9  ? -0.836  4.453   -1.943  1.00 0.34 ? 9  PRO A CD   1  
ATOM 118   H HA   . PRO A 1 9  ? 1.145   1.835   -2.156  1.00 0.34 ? 9  PRO A HA   1  
ATOM 119   H HB2  . PRO A 1 9  ? 2.416   4.227   -2.621  1.00 0.34 ? 9  PRO A HB2  1  
ATOM 120   H HB3  . PRO A 1 9  ? 1.342   3.447   -3.795  1.00 0.34 ? 9  PRO A HB3  1  
ATOM 121   H HG2  . PRO A 1 9  ? 0.830   5.832   -2.080  1.00 0.34 ? 9  PRO A HG2  1  
ATOM 122   H HG3  . PRO A 1 9  ? 0.110   5.394   -3.639  1.00 0.34 ? 9  PRO A HG3  1  
ATOM 123   H HD2  . PRO A 1 9  ? -1.104  5.074   -1.099  1.00 0.34 ? 9  PRO A HD2  1  
ATOM 124   H HD3  . PRO A 1 9  ? -1.666  4.358   -2.625  1.00 0.34 ? 9  PRO A HD3  1  
ATOM 125   N N    . CYS A 1 10 ? 1.786   2.062   0.419   1.00 0.35 ? 10 CYS A N    1  
ATOM 126   C CA   . CYS A 1 10 ? 2.565   2.182   1.683   1.00 0.35 ? 10 CYS A CA   1  
ATOM 127   C C    . CYS A 1 10 ? 3.928   1.509   1.515   1.00 0.35 ? 10 CYS A C    1  
ATOM 128   O O    . CYS A 1 10 ? 4.019   0.330   1.235   1.00 0.35 ? 10 CYS A O    1  
ATOM 129   C CB   . CYS A 1 10 ? 1.797   1.502   2.819   1.00 0.35 ? 10 CYS A CB   1  
ATOM 130   S SG   . CYS A 1 10 ? 0.267   2.414   3.140   1.00 0.35 ? 10 CYS A SG   1  
ATOM 131   H H    . CYS A 1 10 ? 1.222   1.276   0.263   1.00 0.35 ? 10 CYS A H    1  
ATOM 132   H HA   . CYS A 1 10 ? 2.707   3.226   1.920   1.00 0.35 ? 10 CYS A HA   1  
ATOM 133   H HB2  . CYS A 1 10 ? 1.559   0.487   2.535   1.00 0.35 ? 10 CYS A HB2  1  
ATOM 134   H HB3  . CYS A 1 10 ? 2.405   1.494   3.710   1.00 0.35 ? 10 CYS A HB3  1  
ATOM 135   N N    . CYS A 1 11 ? 4.990   2.248   1.688   1.00 0.32 ? 11 CYS A N    1  
ATOM 136   C CA   . CYS A 1 11 ? 6.346   1.650   1.542   1.00 0.32 ? 11 CYS A CA   1  
ATOM 137   C C    . CYS A 1 11 ? 7.001   1.534   2.920   1.00 0.32 ? 11 CYS A C    1  
ATOM 138   O O    . CYS A 1 11 ? 6.907   2.427   3.739   1.00 0.32 ? 11 CYS A O    1  
ATOM 139   C CB   . CYS A 1 11 ? 7.203   2.543   0.643   1.00 0.32 ? 11 CYS A CB   1  
ATOM 140   S SG   . CYS A 1 11 ? 7.099   1.955   -1.066  1.00 0.32 ? 11 CYS A SG   1  
ATOM 141   H H    . CYS A 1 11 ? 4.894   3.196   1.917   1.00 0.32 ? 11 CYS A H    1  
ATOM 142   H HA   . CYS A 1 11 ? 6.262   0.669   1.099   1.00 0.32 ? 11 CYS A HA   1  
ATOM 143   H HB2  . CYS A 1 11 ? 6.844   3.560   0.696   1.00 0.32 ? 11 CYS A HB2  1  
ATOM 144   H HB3  . CYS A 1 11 ? 8.232   2.507   0.974   1.00 0.32 ? 11 CYS A HB3  1  
ATOM 145   N N    . PHE A 1 12 ? 7.662   0.441   3.183   1.00 0.28 ? 12 PHE A N    1  
ATOM 146   C CA   . PHE A 1 12 ? 8.320   0.270   4.508   1.00 0.28 ? 12 PHE A CA   1  
ATOM 147   C C    . PHE A 1 12 ? 9.811   -0.006  4.307   1.00 0.28 ? 12 PHE A C    1  
ATOM 148   O O    . PHE A 1 12 ? 10.634  0.339   5.133   1.00 0.28 ? 12 PHE A O    1  
ATOM 149   C CB   . PHE A 1 12 ? 7.678   -0.907  5.246   1.00 0.28 ? 12 PHE A CB   1  
ATOM 150   C CG   . PHE A 1 12 ? 6.202   -0.953  4.928   1.00 0.28 ? 12 PHE A CG   1  
ATOM 151   C CD1  . PHE A 1 12 ? 5.752   -1.630  3.788   1.00 0.28 ? 12 PHE A CD1  1  
ATOM 152   C CD2  . PHE A 1 12 ? 5.283   -0.319  5.773   1.00 0.28 ? 12 PHE A CD2  1  
ATOM 153   C CE1  . PHE A 1 12 ? 4.385   -1.672  3.492   1.00 0.28 ? 12 PHE A CE1  1  
ATOM 154   C CE2  . PHE A 1 12 ? 3.916   -0.362  5.478   1.00 0.28 ? 12 PHE A CE2  1  
ATOM 155   C CZ   . PHE A 1 12 ? 3.466   -1.038  4.337   1.00 0.28 ? 12 PHE A CZ   1  
ATOM 156   H H    . PHE A 1 12 ? 7.726   -0.267  2.508   1.00 0.28 ? 12 PHE A H    1  
ATOM 157   H HA   . PHE A 1 12 ? 8.196   1.171   5.091   1.00 0.28 ? 12 PHE A HA   1  
ATOM 158   H HB2  . PHE A 1 12 ? 8.144   -1.828  4.930   1.00 0.28 ? 12 PHE A HB2  1  
ATOM 159   H HB3  . PHE A 1 12 ? 7.812   -0.782  6.309   1.00 0.28 ? 12 PHE A HB3  1  
ATOM 160   H HD1  . PHE A 1 12 ? 6.462   -2.119  3.136   1.00 0.28 ? 12 PHE A HD1  1  
ATOM 161   H HD2  . PHE A 1 12 ? 5.630   0.203   6.653   1.00 0.28 ? 12 PHE A HD2  1  
ATOM 162   H HE1  . PHE A 1 12 ? 4.038   -2.194  2.612   1.00 0.28 ? 12 PHE A HE1  1  
ATOM 163   H HE2  . PHE A 1 12 ? 3.206   0.127   6.129   1.00 0.28 ? 12 PHE A HE2  1  
ATOM 164   H HZ   . PHE A 1 12 ? 2.411   -1.071  4.109   1.00 0.28 ? 12 PHE A HZ   1  
ATOM 165   N N    . ALA A 1 13 ? 10.168  -0.625  3.215   1.00 0.31 ? 13 ALA A N    1  
ATOM 166   C CA   . ALA A 1 13 ? 11.606  -0.921  2.961   1.00 0.31 ? 13 ALA A CA   1  
ATOM 167   C C    . ALA A 1 13 ? 12.241  0.244   2.200   1.00 0.31 ? 13 ALA A C    1  
ATOM 168   O O    . ALA A 1 13 ? 11.568  1.165   1.780   1.00 0.31 ? 13 ALA A O    1  
ATOM 169   C CB   . ALA A 1 13 ? 11.725  -2.199  2.129   1.00 0.31 ? 13 ALA A CB   1  
ATOM 170   H H    . ALA A 1 13 ? 9.489   -0.894  2.561   1.00 0.31 ? 13 ALA A H    1  
ATOM 171   H HA   . ALA A 1 13 ? 12.117  -1.056  3.903   1.00 0.31 ? 13 ALA A HA   1  
ATOM 172   H HB1  . ALA A 1 13 ? 10.994  -2.179  1.334   1.00 0.31 ? 13 ALA A HB1  1  
ATOM 173   H HB2  . ALA A 1 13 ? 12.716  -2.263  1.706   1.00 0.31 ? 13 ALA A HB2  1  
ATOM 174   H HB3  . ALA A 1 13 ? 11.546  -3.057  2.761   1.00 0.31 ? 13 ALA A HB3  1  
ATOM 175   N N    . TYR A 1 14 ? 13.533  0.212   2.018   1.00 0.29 ? 14 TYR A N    1  
ATOM 176   C CA   . TYR A 1 14 ? 14.210  1.319   1.282   1.00 0.29 ? 14 TYR A CA   1  
ATOM 177   C C    . TYR A 1 14 ? 15.287  0.735   0.365   1.00 0.29 ? 14 TYR A C    1  
ATOM 178   O O    . TYR A 1 14 ? 15.943  -0.231  0.698   1.00 0.29 ? 14 TYR A O    1  
ATOM 179   C CB   . TYR A 1 14 ? 14.859  2.277   2.284   1.00 0.29 ? 14 TYR A CB   1  
ATOM 180   C CG   . TYR A 1 14 ? 13.783  2.987   3.071   1.00 0.29 ? 14 TYR A CG   1  
ATOM 181   C CD1  . TYR A 1 14 ? 12.688  3.552   2.406   1.00 0.29 ? 14 TYR A CD1  1  
ATOM 182   C CD2  . TYR A 1 14 ? 13.881  3.079   4.464   1.00 0.29 ? 14 TYR A CD2  1  
ATOM 183   C CE1  . TYR A 1 14 ? 11.691  4.210   3.136   1.00 0.29 ? 14 TYR A CE1  1  
ATOM 184   C CE2  . TYR A 1 14 ? 12.883  3.737   5.193   1.00 0.29 ? 14 TYR A CE2  1  
ATOM 185   C CZ   . TYR A 1 14 ? 11.788  4.302   4.529   1.00 0.29 ? 14 TYR A CZ   1  
ATOM 186   O OH   . TYR A 1 14 ? 10.805  4.951   5.248   1.00 0.29 ? 14 TYR A OH   1  
ATOM 187   H H    . TYR A 1 14 ? 14.058  -0.538  2.363   1.00 0.29 ? 14 TYR A H    1  
ATOM 188   H HA   . TYR A 1 14 ? 13.484  1.854   0.690   1.00 0.29 ? 14 TYR A HA   1  
ATOM 189   H HB2  . TYR A 1 14 ? 15.490  1.718   2.960   1.00 0.29 ? 14 TYR A HB2  1  
ATOM 190   H HB3  . TYR A 1 14 ? 15.455  3.004   1.752   1.00 0.29 ? 14 TYR A HB3  1  
ATOM 191   H HD1  . TYR A 1 14 ? 12.613  3.481   1.332   1.00 0.29 ? 14 TYR A HD1  1  
ATOM 192   H HD2  . TYR A 1 14 ? 14.726  2.643   4.976   1.00 0.29 ? 14 TYR A HD2  1  
ATOM 193   H HE1  . TYR A 1 14 ? 10.846  4.645   2.623   1.00 0.29 ? 14 TYR A HE1  1  
ATOM 194   H HE2  . TYR A 1 14 ? 12.959  3.809   6.268   1.00 0.29 ? 14 TYR A HE2  1  
ATOM 195   H HH   . TYR A 1 14 ? 10.855  4.649   6.158   1.00 0.29 ? 14 TYR A HH   1  
ATOM 196   N N    . ILE A 1 15 ? 15.472  1.314   -0.791  1.00 0.32 ? 15 ILE A N    1  
ATOM 197   C CA   . ILE A 1 15 ? 16.507  0.792   -1.727  1.00 0.32 ? 15 ILE A CA   1  
ATOM 198   C C    . ILE A 1 15 ? 17.818  1.551   -1.514  1.00 0.32 ? 15 ILE A C    1  
ATOM 199   O O    . ILE A 1 15 ? 17.828  2.751   -1.326  1.00 0.32 ? 15 ILE A O    1  
ATOM 200   C CB   . ILE A 1 15 ? 16.033  0.984   -3.169  1.00 0.32 ? 15 ILE A CB   1  
ATOM 201   C CG1  . ILE A 1 15 ? 16.941  0.189   -4.112  1.00 0.32 ? 15 ILE A CG1  1  
ATOM 202   C CG2  . ILE A 1 15 ? 16.095  2.468   -3.535  1.00 0.32 ? 15 ILE A CG2  1  
ATOM 203   C CD1  . ILE A 1 15 ? 16.537  0.464   -5.561  1.00 0.32 ? 15 ILE A CD1  1  
ATOM 204   H H    . ILE A 1 15 ? 14.932  2.093   -1.042  1.00 0.32 ? 15 ILE A H    1  
ATOM 205   H HA   . ILE A 1 15 ? 16.665  -0.260  -1.537  1.00 0.32 ? 15 ILE A HA   1  
ATOM 206   H HB   . ILE A 1 15 ? 15.016  0.632   -3.263  1.00 0.32 ? 15 ILE A HB   1  
ATOM 207   H HG12 . ILE A 1 15 ? 17.967  0.487   -3.960  1.00 0.32 ? 15 ILE A HG12 1  
ATOM 208   H HG13 . ILE A 1 15 ? 16.838  -0.866  -3.906  1.00 0.32 ? 15 ILE A HG13 1  
ATOM 209   H HG21 . ILE A 1 15 ? 16.042  3.063   -2.636  1.00 0.32 ? 15 ILE A HG21 1  
ATOM 210   H HG22 . ILE A 1 15 ? 17.023  2.673   -4.050  1.00 0.32 ? 15 ILE A HG22 1  
ATOM 211   H HG23 . ILE A 1 15 ? 15.264  2.714   -4.180  1.00 0.32 ? 15 ILE A HG23 1  
ATOM 212   H HD11 . ILE A 1 15 ? 15.494  0.218   -5.698  1.00 0.32 ? 15 ILE A HD11 1  
ATOM 213   H HD12 . ILE A 1 15 ? 16.693  1.508   -5.787  1.00 0.32 ? 15 ILE A HD12 1  
ATOM 214   H HD13 . ILE A 1 15 ? 17.139  -0.141  -6.224  1.00 0.32 ? 15 ILE A HD13 1  
ATOM 215   N N    . ALA A 1 16 ? 18.926  0.862   -1.541  1.00 0.38 ? 16 ALA A N    1  
ATOM 216   C CA   . ALA A 1 16 ? 20.234  1.545   -1.339  1.00 0.38 ? 16 ALA A CA   1  
ATOM 217   C C    . ALA A 1 16 ? 20.737  2.088   -2.678  1.00 0.38 ? 16 ALA A C    1  
ATOM 218   O O    . ALA A 1 16 ? 21.254  3.185   -2.759  1.00 0.38 ? 16 ALA A O    1  
ATOM 219   C CB   . ALA A 1 16 ? 21.249  0.547   -0.780  1.00 0.38 ? 16 ALA A CB   1  
ATOM 220   H H    . ALA A 1 16 ? 18.897  -0.106  -1.694  1.00 0.38 ? 16 ALA A H    1  
ATOM 221   H HA   . ALA A 1 16 ? 20.110  2.360   -0.643  1.00 0.38 ? 16 ALA A HA   1  
ATOM 222   H HB1  . ALA A 1 16 ? 20.826  -0.446  -0.796  1.00 0.38 ? 16 ALA A HB1  1  
ATOM 223   H HB2  . ALA A 1 16 ? 22.144  0.566   -1.386  1.00 0.38 ? 16 ALA A HB2  1  
ATOM 224   H HB3  . ALA A 1 16 ? 21.497  0.816   0.236   1.00 0.38 ? 16 ALA A HB3  1  
ATOM 225   N N    . ARG A 1 17 ? 20.590  1.330   -3.730  1.00 0.42 ? 17 ARG A N    1  
ATOM 226   C CA   . ARG A 1 17 ? 21.060  1.806   -5.062  1.00 0.42 ? 17 ARG A CA   1  
ATOM 227   C C    . ARG A 1 17 ? 20.031  2.776   -5.649  1.00 0.42 ? 17 ARG A C    1  
ATOM 228   O O    . ARG A 1 17 ? 18.846  2.630   -5.423  1.00 0.42 ? 17 ARG A O    1  
ATOM 229   C CB   . ARG A 1 17 ? 21.226  0.608   -6.000  1.00 0.42 ? 17 ARG A CB   1  
ATOM 230   C CG   . ARG A 1 17 ? 20.029  -0.332  -5.849  1.00 0.42 ? 17 ARG A CG   1  
ATOM 231   C CD   . ARG A 1 17 ? 20.445  -1.561  -5.038  1.00 0.42 ? 17 ARG A CD   1  
ATOM 232   N NE   . ARG A 1 17 ? 21.417  -2.369  -5.826  1.00 0.42 ? 17 ARG A NE   1  
ATOM 233   C CZ   . ARG A 1 17 ? 22.638  -2.526  -5.391  1.00 0.42 ? 17 ARG A CZ   1  
ATOM 234   N NH1  . ARG A 1 17 ? 22.849  -3.015  -4.200  1.00 0.42 ? 17 ARG A NH1  1  
ATOM 235   N NH2  . ARG A 1 17 ? 23.648  -2.194  -6.147  1.00 0.42 ? 17 ARG A NH2  1  
ATOM 236   H H    . ARG A 1 17 ? 20.170  0.449   -3.643  1.00 0.42 ? 17 ARG A H    1  
ATOM 237   H HA   . ARG A 1 17 ? 22.008  2.309   -4.949  1.00 0.42 ? 17 ARG A HA   1  
ATOM 238   H HB2  . ARG A 1 17 ? 21.283  0.958   -7.022  1.00 0.42 ? 17 ARG A HB2  1  
ATOM 239   H HB3  . ARG A 1 17 ? 22.133  0.078   -5.750  1.00 0.42 ? 17 ARG A HB3  1  
ATOM 240   H HG2  . ARG A 1 17 ? 19.229  0.185   -5.337  1.00 0.42 ? 17 ARG A HG2  1  
ATOM 241   H HG3  . ARG A 1 17 ? 19.690  -0.644  -6.824  1.00 0.42 ? 17 ARG A HG3  1  
ATOM 242   H HD2  . ARG A 1 17 ? 20.904  -1.244  -4.114  1.00 0.42 ? 17 ARG A HD2  1  
ATOM 243   H HD3  . ARG A 1 17 ? 19.573  -2.160  -4.819  1.00 0.42 ? 17 ARG A HD3  1  
ATOM 244   H HE   . ARG A 1 17 ? 21.141  -2.783  -6.670  1.00 0.42 ? 17 ARG A HE   1  
ATOM 245   H HH11 . ARG A 1 17 ? 22.075  -3.270  -3.620  1.00 0.42 ? 17 ARG A HH11 1  
ATOM 246   H HH12 . ARG A 1 17 ? 23.784  -3.136  -3.867  1.00 0.42 ? 17 ARG A HH12 1  
ATOM 247   H HH21 . ARG A 1 17 ? 23.487  -1.818  -7.061  1.00 0.42 ? 17 ARG A HH21 1  
ATOM 248   H HH22 . ARG A 1 17 ? 24.584  -2.313  -5.814  1.00 0.42 ? 17 ARG A HH22 1  
ATOM 249   N N    . PRO A 1 18 ? 20.518  3.740   -6.388  1.00 0.41 ? 18 PRO A N    1  
ATOM 250   C CA   . PRO A 1 18 ? 19.667  4.758   -7.027  1.00 0.41 ? 18 PRO A CA   1  
ATOM 251   C C    . PRO A 1 18 ? 19.001  4.189   -8.282  1.00 0.41 ? 18 PRO A C    1  
ATOM 252   O O    . PRO A 1 18 ? 19.275  3.079   -8.694  1.00 0.41 ? 18 PRO A O    1  
ATOM 253   C CB   . PRO A 1 18 ? 20.651  5.874   -7.389  1.00 0.41 ? 18 PRO A CB   1  
ATOM 254   C CG   . PRO A 1 18 ? 22.049  5.214   -7.461  1.00 0.41 ? 18 PRO A CG   1  
ATOM 255   C CD   . PRO A 1 18 ? 21.962  3.905   -6.653  1.00 0.41 ? 18 PRO A CD   1  
ATOM 256   H HA   . PRO A 1 18 ? 18.928  5.128   -6.336  1.00 0.41 ? 18 PRO A HA   1  
ATOM 257   H HB2  . PRO A 1 18 ? 20.388  6.301   -8.348  1.00 0.41 ? 18 PRO A HB2  1  
ATOM 258   H HB3  . PRO A 1 18 ? 20.648  6.636   -6.626  1.00 0.41 ? 18 PRO A HB3  1  
ATOM 259   H HG2  . PRO A 1 18 ? 22.305  5.002   -8.490  1.00 0.41 ? 18 PRO A HG2  1  
ATOM 260   H HG3  . PRO A 1 18 ? 22.789  5.865   -7.020  1.00 0.41 ? 18 PRO A HG3  1  
ATOM 261   H HD2  . PRO A 1 18 ? 22.339  3.077   -7.237  1.00 0.41 ? 18 PRO A HD2  1  
ATOM 262   H HD3  . PRO A 1 18 ? 22.504  3.995   -5.725  1.00 0.41 ? 18 PRO A HD3  1  
ATOM 263   N N    . LEU A 1 19 ? 18.128  4.942   -8.894  1.00 0.45 ? 19 LEU A N    1  
ATOM 264   C CA   . LEU A 1 19 ? 17.443  4.447   -10.123 1.00 0.45 ? 19 LEU A CA   1  
ATOM 265   C C    . LEU A 1 19 ? 17.721  5.409   -11.281 1.00 0.45 ? 19 LEU A C    1  
ATOM 266   O O    . LEU A 1 19 ? 18.217  6.498   -11.072 1.00 0.45 ? 19 LEU A O    1  
ATOM 267   C CB   . LEU A 1 19 ? 15.931  4.362   -9.881  1.00 0.45 ? 19 LEU A CB   1  
ATOM 268   C CG   . LEU A 1 19 ? 15.526  5.295   -8.736  1.00 0.45 ? 19 LEU A CG   1  
ATOM 269   C CD1  . LEU A 1 19 ? 14.011  5.503   -8.757  1.00 0.45 ? 19 LEU A CD1  1  
ATOM 270   C CD2  . LEU A 1 19 ? 15.934  4.668   -7.400  1.00 0.45 ? 19 LEU A CD2  1  
ATOM 271   H H    . LEU A 1 19 ? 17.922  5.834   -8.544  1.00 0.45 ? 19 LEU A H    1  
ATOM 272   H HA   . LEU A 1 19 ? 17.823  3.466   -10.374 1.00 0.45 ? 19 LEU A HA   1  
ATOM 273   H HB2  . LEU A 1 19 ? 15.408  4.654   -10.780 1.00 0.45 ? 19 LEU A HB2  1  
ATOM 274   H HB3  . LEU A 1 19 ? 15.665  3.347   -9.625  1.00 0.45 ? 19 LEU A HB3  1  
ATOM 275   H HG   . LEU A 1 19 ? 16.022  6.247   -8.855  1.00 0.45 ? 19 LEU A HG   1  
ATOM 276   H HD11 . LEU A 1 19 ? 13.644  5.371   -9.764  1.00 0.45 ? 19 LEU A HD11 1  
ATOM 277   H HD12 . LEU A 1 19 ? 13.540  4.783   -8.105  1.00 0.45 ? 19 LEU A HD12 1  
ATOM 278   H HD13 . LEU A 1 19 ? 13.780  6.502   -8.419  1.00 0.45 ? 19 LEU A HD13 1  
ATOM 279   H HD21 . LEU A 1 19 ? 16.040  3.600   -7.522  1.00 0.45 ? 19 LEU A HD21 1  
ATOM 280   H HD22 . LEU A 1 19 ? 16.874  5.089   -7.077  1.00 0.45 ? 19 LEU A HD22 1  
ATOM 281   H HD23 . LEU A 1 19 ? 15.174  4.872   -6.661  1.00 0.45 ? 19 LEU A HD23 1  
ATOM 282   N N    . PRO A 1 20 ? 17.390  4.976   -12.470 1.00 0.58 ? 20 PRO A N    1  
ATOM 283   C CA   . PRO A 1 20 ? 17.589  5.778   -13.690 1.00 0.58 ? 20 PRO A CA   1  
ATOM 284   C C    . PRO A 1 20 ? 16.503  6.850   -13.807 1.00 0.58 ? 20 PRO A C    1  
ATOM 285   O O    . PRO A 1 20 ? 15.412  6.594   -14.274 1.00 0.58 ? 20 PRO A O    1  
ATOM 286   C CB   . PRO A 1 20 ? 17.470  4.749   -14.819 1.00 0.58 ? 20 PRO A CB   1  
ATOM 287   C CG   . PRO A 1 20 ? 16.665  3.560   -14.242 1.00 0.58 ? 20 PRO A CG   1  
ATOM 288   C CD   . PRO A 1 20 ? 16.787  3.648   -12.710 1.00 0.58 ? 20 PRO A CD   1  
ATOM 289   H HA   . PRO A 1 20 ? 18.570  6.224   -13.699 1.00 0.58 ? 20 PRO A HA   1  
ATOM 290   H HB2  . PRO A 1 20 ? 16.947  5.184   -15.660 1.00 0.58 ? 20 PRO A HB2  1  
ATOM 291   H HB3  . PRO A 1 20 ? 18.449  4.413   -15.121 1.00 0.58 ? 20 PRO A HB3  1  
ATOM 292   H HG2  . PRO A 1 20 ? 15.628  3.639   -14.540 1.00 0.58 ? 20 PRO A HG2  1  
ATOM 293   H HG3  . PRO A 1 20 ? 17.081  2.628   -14.588 1.00 0.58 ? 20 PRO A HG3  1  
ATOM 294   H HD2  . PRO A 1 20 ? 15.811  3.583   -12.250 1.00 0.58 ? 20 PRO A HD2  1  
ATOM 295   H HD3  . PRO A 1 20 ? 17.436  2.872   -12.336 1.00 0.58 ? 20 PRO A HD3  1  
ATOM 296   N N    . ARG A 1 21 ? 16.794  8.049   -13.383 1.00 0.75 ? 21 ARG A N    1  
ATOM 297   C CA   . ARG A 1 21 ? 15.779  9.137   -13.467 1.00 0.75 ? 21 ARG A CA   1  
ATOM 298   C C    . ARG A 1 21 ? 15.186  9.179   -14.877 1.00 0.75 ? 21 ARG A C    1  
ATOM 299   O O    . ARG A 1 21 ? 14.035  9.516   -15.065 1.00 0.75 ? 21 ARG A O    1  
ATOM 300   C CB   . ARG A 1 21 ? 16.445  10.479  -13.155 1.00 0.75 ? 21 ARG A CB   1  
ATOM 301   C CG   . ARG A 1 21 ? 15.373  11.514  -12.813 1.00 0.75 ? 21 ARG A CG   1  
ATOM 302   C CD   . ARG A 1 21 ? 15.754  12.865  -13.422 1.00 0.75 ? 21 ARG A CD   1  
ATOM 303   N NE   . ARG A 1 21 ? 14.589  13.791  -13.341 1.00 0.75 ? 21 ARG A NE   1  
ATOM 304   C CZ   . ARG A 1 21 ? 14.197  14.440  -14.403 1.00 0.75 ? 21 ARG A CZ   1  
ATOM 305   N NH1  . ARG A 1 21 ? 14.749  15.583  -14.710 1.00 0.75 ? 21 ARG A NH1  1  
ATOM 306   N NH2  . ARG A 1 21 ? 13.253  13.946  -15.157 1.00 0.75 ? 21 ARG A NH2  1  
ATOM 307   H H    . ARG A 1 21 ? 17.680  8.234   -13.007 1.00 0.75 ? 21 ARG A H    1  
ATOM 308   H HA   . ARG A 1 21 ? 14.992  8.952   -12.751 1.00 0.75 ? 21 ARG A HA   1  
ATOM 309   H HB2  . ARG A 1 21 ? 17.115  10.361  -12.315 1.00 0.75 ? 21 ARG A HB2  1  
ATOM 310   H HB3  . ARG A 1 21 ? 17.003  10.813  -14.017 1.00 0.75 ? 21 ARG A HB3  1  
ATOM 311   H HG2  . ARG A 1 21 ? 14.422  11.193  -13.212 1.00 0.75 ? 21 ARG A HG2  1  
ATOM 312   H HG3  . ARG A 1 21 ? 15.298  11.615  -11.740 1.00 0.75 ? 21 ARG A HG3  1  
ATOM 313   H HD2  . ARG A 1 21 ? 16.586  13.284  -12.877 1.00 0.75 ? 21 ARG A HD2  1  
ATOM 314   H HD3  . ARG A 1 21 ? 16.033  12.728  -14.456 1.00 0.75 ? 21 ARG A HD3  1  
ATOM 315   H HE   . ARG A 1 21 ? 14.118  13.914  -12.490 1.00 0.75 ? 21 ARG A HE   1  
ATOM 316   H HH11 . ARG A 1 21 ? 15.472  15.960  -14.132 1.00 0.75 ? 21 ARG A HH11 1  
ATOM 317   H HH12 . ARG A 1 21 ? 14.448  16.080  -15.524 1.00 0.75 ? 21 ARG A HH12 1  
ATOM 318   H HH21 . ARG A 1 21 ? 12.831  13.072  -14.922 1.00 0.75 ? 21 ARG A HH21 1  
ATOM 319   H HH22 . ARG A 1 21 ? 12.952  14.444  -15.971 1.00 0.75 ? 21 ARG A HH22 1  
ATOM 320   N N    . ALA A 1 22 ? 15.963  8.841   -15.868 1.00 0.89 ? 22 ALA A N    1  
ATOM 321   C CA   . ALA A 1 22 ? 15.442  8.863   -17.264 1.00 0.89 ? 22 ALA A CA   1  
ATOM 322   C C    . ALA A 1 22 ? 14.263  7.895   -17.384 1.00 0.89 ? 22 ALA A C    1  
ATOM 323   O O    . ALA A 1 22 ? 13.247  8.208   -17.973 1.00 0.89 ? 22 ALA A O    1  
ATOM 324   C CB   . ALA A 1 22 ? 16.549  8.440   -18.230 1.00 0.89 ? 22 ALA A CB   1  
ATOM 325   H H    . ALA A 1 22 ? 16.891  8.572   -15.696 1.00 0.89 ? 22 ALA A H    1  
ATOM 326   H HA   . ALA A 1 22 ? 15.112  9.862   -17.509 1.00 0.89 ? 22 ALA A HA   1  
ATOM 327   H HB1  . ALA A 1 22 ? 17.210  7.742   -17.736 1.00 0.89 ? 22 ALA A HB1  1  
ATOM 328   H HB2  . ALA A 1 22 ? 16.110  7.968   -19.097 1.00 0.89 ? 22 ALA A HB2  1  
ATOM 329   H HB3  . ALA A 1 22 ? 17.111  9.309   -18.539 1.00 0.89 ? 22 ALA A HB3  1  
ATOM 330   N N    . HIS A 1 23 ? 14.389  6.721   -16.830 1.00 0.71 ? 23 HIS A N    1  
ATOM 331   C CA   . HIS A 1 23 ? 13.276  5.733   -16.914 1.00 0.71 ? 23 HIS A CA   1  
ATOM 332   C C    . HIS A 1 23 ? 12.307  5.948   -15.748 1.00 0.71 ? 23 HIS A C    1  
ATOM 333   O O    . HIS A 1 23 ? 11.363  5.205   -15.571 1.00 0.71 ? 23 HIS A O    1  
ATOM 334   C CB   . HIS A 1 23 ? 13.846  4.315   -16.845 1.00 0.71 ? 23 HIS A CB   1  
ATOM 335   C CG   . HIS A 1 23 ? 14.861  4.129   -17.940 1.00 0.71 ? 23 HIS A CG   1  
ATOM 336   N ND1  . HIS A 1 23 ? 14.952  2.956   -18.672 1.00 0.71 ? 23 HIS A ND1  1  
ATOM 337   C CD2  . HIS A 1 23 ? 15.836  4.958   -18.437 1.00 0.71 ? 23 HIS A CD2  1  
ATOM 338   C CE1  . HIS A 1 23 ? 15.949  3.109   -19.563 1.00 0.71 ? 23 HIS A CE1  1  
ATOM 339   N NE2  . HIS A 1 23 ? 16.522  4.312   -19.462 1.00 0.71 ? 23 HIS A NE2  1  
ATOM 340   H H    . HIS A 1 23 ? 15.216  6.487   -16.361 1.00 0.71 ? 23 HIS A H    1  
ATOM 341   H HA   . HIS A 1 23 ? 12.749  5.863   -17.848 1.00 0.71 ? 23 HIS A HA   1  
ATOM 342   H HB2  . HIS A 1 23 ? 14.319  4.163   -15.886 1.00 0.71 ? 23 HIS A HB2  1  
ATOM 343   H HB3  . HIS A 1 23 ? 13.048  3.599   -16.971 1.00 0.71 ? 23 HIS A HB3  1  
ATOM 344   H HD1  . HIS A 1 23 ? 14.390  2.160   -18.562 1.00 0.71 ? 23 HIS A HD1  1  
ATOM 345   H HD2  . HIS A 1 23 ? 16.040  5.959   -18.087 1.00 0.71 ? 23 HIS A HD2  1  
ATOM 346   H HE1  . HIS A 1 23 ? 16.250  2.353   -20.272 1.00 0.71 ? 23 HIS A HE1  1  
ATOM 347   N N    . ILE A 1 24 ? 12.532  6.958   -14.951 1.00 0.56 ? 24 ILE A N    1  
ATOM 348   C CA   . ILE A 1 24 ? 11.621  7.214   -13.799 1.00 0.56 ? 24 ILE A CA   1  
ATOM 349   C C    . ILE A 1 24 ? 10.493  8.151   -14.239 1.00 0.56 ? 24 ILE A C    1  
ATOM 350   O O    . ILE A 1 24 ? 10.594  9.356   -14.121 1.00 0.56 ? 24 ILE A O    1  
ATOM 351   C CB   . ILE A 1 24 ? 12.409  7.859   -12.656 1.00 0.56 ? 24 ILE A CB   1  
ATOM 352   C CG1  . ILE A 1 24 ? 13.300  6.805   -11.994 1.00 0.56 ? 24 ILE A CG1  1  
ATOM 353   C CG2  . ILE A 1 24 ? 11.439  8.426   -11.618 1.00 0.56 ? 24 ILE A CG2  1  
ATOM 354   C CD1  . ILE A 1 24 ? 14.034  7.431   -10.807 1.00 0.56 ? 24 ILE A CD1  1  
ATOM 355   H H    . ILE A 1 24 ? 13.299  7.546   -15.109 1.00 0.56 ? 24 ILE A H    1  
ATOM 356   H HA   . ILE A 1 24 ? 11.198  6.278   -13.460 1.00 0.56 ? 24 ILE A HA   1  
ATOM 357   H HB   . ILE A 1 24 ? 13.022  8.658   -13.048 1.00 0.56 ? 24 ILE A HB   1  
ATOM 358   H HG12 . ILE A 1 24 ? 12.689  5.985   -11.648 1.00 0.56 ? 24 ILE A HG12 1  
ATOM 359   H HG13 . ILE A 1 24 ? 14.020  6.442   -12.709 1.00 0.56 ? 24 ILE A HG13 1  
ATOM 360   H HG21 . ILE A 1 24 ? 10.728  7.664   -11.334 1.00 0.56 ? 24 ILE A HG21 1  
ATOM 361   H HG22 . ILE A 1 24 ? 11.990  8.745   -10.745 1.00 0.56 ? 24 ILE A HG22 1  
ATOM 362   H HG23 . ILE A 1 24 ? 10.912  9.270   -12.039 1.00 0.56 ? 24 ILE A HG23 1  
ATOM 363   H HD11 . ILE A 1 24 ? 14.362  8.426   -11.069 1.00 0.56 ? 24 ILE A HD11 1  
ATOM 364   H HD12 . ILE A 1 24 ? 13.368  7.485   -9.958  1.00 0.56 ? 24 ILE A HD12 1  
ATOM 365   H HD13 . ILE A 1 24 ? 14.891  6.825   -10.554 1.00 0.56 ? 24 ILE A HD13 1  
ATOM 366   N N    . LYS A 1 25 ? 9.418   7.607   -14.741 1.00 0.59 ? 25 LYS A N    1  
ATOM 367   C CA   . LYS A 1 25 ? 8.285   8.466   -15.185 1.00 0.59 ? 25 LYS A CA   1  
ATOM 368   C C    . LYS A 1 25 ? 7.987   9.515   -14.111 1.00 0.59 ? 25 LYS A C    1  
ATOM 369   O O    . LYS A 1 25 ? 8.142   10.701  -14.327 1.00 0.59 ? 25 LYS A O    1  
ATOM 370   C CB   . LYS A 1 25 ? 7.046   7.597   -15.404 1.00 0.59 ? 25 LYS A CB   1  
ATOM 371   C CG   . LYS A 1 25 ? 6.185   8.209   -16.510 1.00 0.59 ? 25 LYS A CG   1  
ATOM 372   C CD   . LYS A 1 25 ? 4.854   7.459   -16.597 1.00 0.59 ? 25 LYS A CD   1  
ATOM 373   C CE   . LYS A 1 25 ? 3.699   8.461   -16.558 1.00 0.59 ? 25 LYS A CE   1  
ATOM 374   N NZ   . LYS A 1 25 ? 3.561   9.112   -17.890 1.00 0.59 ? 25 LYS A NZ   1  
ATOM 375   H H    . LYS A 1 25 ? 9.355   6.634   -14.825 1.00 0.59 ? 25 LYS A H    1  
ATOM 376   H HA   . LYS A 1 25 ? 8.547   8.961   -16.108 1.00 0.59 ? 25 LYS A HA   1  
ATOM 377   H HB2  . LYS A 1 25 ? 7.351   6.602   -15.694 1.00 0.59 ? 25 LYS A HB2  1  
ATOM 378   H HB3  . LYS A 1 25 ? 6.472   7.549   -14.491 1.00 0.59 ? 25 LYS A HB3  1  
ATOM 379   H HG2  . LYS A 1 25 ? 5.999   9.250   -16.286 1.00 0.59 ? 25 LYS A HG2  1  
ATOM 380   H HG3  . LYS A 1 25 ? 6.703   8.131   -17.454 1.00 0.59 ? 25 LYS A HG3  1  
ATOM 381   H HD2  . LYS A 1 25 ? 4.816   6.900   -17.521 1.00 0.59 ? 25 LYS A HD2  1  
ATOM 382   H HD3  . LYS A 1 25 ? 4.768   6.780   -15.762 1.00 0.59 ? 25 LYS A HD3  1  
ATOM 383   H HE2  . LYS A 1 25 ? 2.782   7.944   -16.313 1.00 0.59 ? 25 LYS A HE2  1  
ATOM 384   H HE3  . LYS A 1 25 ? 3.900   9.212   -15.808 1.00 0.59 ? 25 LYS A HE3  1  
ATOM 385   H HZ1  . LYS A 1 25 ? 4.293   8.745   -18.533 1.00 0.59 ? 25 LYS A HZ1  1  
ATOM 386   H HZ2  . LYS A 1 25 ? 2.621   8.907   -18.282 1.00 0.59 ? 25 LYS A HZ2  1  
ATOM 387   H HZ3  . LYS A 1 25 ? 3.673   10.140  -17.787 1.00 0.59 ? 25 LYS A HZ3  1  
ATOM 388   N N    . GLU A 1 26 ? 7.561   9.088   -12.953 1.00 0.53 ? 26 GLU A N    1  
ATOM 389   C CA   . GLU A 1 26 ? 7.253   10.061  -11.867 1.00 0.53 ? 26 GLU A CA   1  
ATOM 390   C C    . GLU A 1 26 ? 7.285   9.345   -10.515 1.00 0.53 ? 26 GLU A C    1  
ATOM 391   O O    . GLU A 1 26 ? 7.372   8.135   -10.445 1.00 0.53 ? 26 GLU A O    1  
ATOM 392   C CB   . GLU A 1 26 ? 5.862   10.657  -12.096 1.00 0.53 ? 26 GLU A CB   1  
ATOM 393   C CG   . GLU A 1 26 ? 4.832   9.529   -12.182 1.00 0.53 ? 26 GLU A CG   1  
ATOM 394   C CD   . GLU A 1 26 ? 3.656   9.976   -13.052 1.00 0.53 ? 26 GLU A CD   1  
ATOM 395   O OE1  . GLU A 1 26 ? 3.600   11.149  -13.381 1.00 0.53 ? 26 GLU A OE1  1  
ATOM 396   O OE2  . GLU A 1 26 ? 2.832   9.137   -13.377 1.00 0.53 ? 26 GLU A OE2  1  
ATOM 397   H H    . GLU A 1 26 ? 7.443   8.127   -12.799 1.00 0.53 ? 26 GLU A H    1  
ATOM 398   H HA   . GLU A 1 26 ? 7.989   10.852  -11.873 1.00 0.53 ? 26 GLU A HA   1  
ATOM 399   H HB2  . GLU A 1 26 ? 5.613   11.313  -11.275 1.00 0.53 ? 26 GLU A HB2  1  
ATOM 400   H HB3  . GLU A 1 26 ? 5.857   11.217  -13.018 1.00 0.53 ? 26 GLU A HB3  1  
ATOM 401   H HG2  . GLU A 1 26 ? 5.292   8.653   -12.617 1.00 0.53 ? 26 GLU A HG2  1  
ATOM 402   H HG3  . GLU A 1 26 ? 4.474   9.292   -11.191 1.00 0.53 ? 26 GLU A HG3  1  
ATOM 403   N N    . TYR A 1 27 ? 7.218   10.082  -9.440  1.00 0.39 ? 27 TYR A N    1  
ATOM 404   C CA   . TYR A 1 27 ? 7.245   9.442   -8.095  1.00 0.39 ? 27 TYR A CA   1  
ATOM 405   C C    . TYR A 1 27 ? 6.190   10.092  -7.196  1.00 0.39 ? 27 TYR A C    1  
ATOM 406   O O    . TYR A 1 27 ? 5.372   10.871  -7.644  1.00 0.39 ? 27 TYR A O    1  
ATOM 407   C CB   . TYR A 1 27 ? 8.635   9.620   -7.473  1.00 0.39 ? 27 TYR A CB   1  
ATOM 408   C CG   . TYR A 1 27 ? 8.800   11.042  -6.991  1.00 0.39 ? 27 TYR A CG   1  
ATOM 409   C CD1  . TYR A 1 27 ? 9.134   12.057  -7.896  1.00 0.39 ? 27 TYR A CD1  1  
ATOM 410   C CD2  . TYR A 1 27 ? 8.618   11.346  -5.635  1.00 0.39 ? 27 TYR A CD2  1  
ATOM 411   C CE1  . TYR A 1 27 ? 9.286   13.374  -7.447  1.00 0.39 ? 27 TYR A CE1  1  
ATOM 412   C CE2  . TYR A 1 27 ? 8.770   12.664  -5.187  1.00 0.39 ? 27 TYR A CE2  1  
ATOM 413   C CZ   . TYR A 1 27 ? 9.104   13.677  -6.092  1.00 0.39 ? 27 TYR A CZ   1  
ATOM 414   O OH   . TYR A 1 27 ? 9.253   14.976  -5.650  1.00 0.39 ? 27 TYR A OH   1  
ATOM 415   H H    . TYR A 1 27 ? 7.148   11.057  -9.518  1.00 0.39 ? 27 TYR A H    1  
ATOM 416   H HA   . TYR A 1 27 ? 7.029   8.388   -8.194  1.00 0.39 ? 27 TYR A HA   1  
ATOM 417   H HB2  . TYR A 1 27 ? 8.743   8.943   -6.639  1.00 0.39 ? 27 TYR A HB2  1  
ATOM 418   H HB3  . TYR A 1 27 ? 9.390   9.402   -8.213  1.00 0.39 ? 27 TYR A HB3  1  
ATOM 419   H HD1  . TYR A 1 27 ? 9.275   11.823  -8.941  1.00 0.39 ? 27 TYR A HD1  1  
ATOM 420   H HD2  . TYR A 1 27 ? 8.361   10.565  -4.937  1.00 0.39 ? 27 TYR A HD2  1  
ATOM 421   H HE1  . TYR A 1 27 ? 9.544   14.156  -8.144  1.00 0.39 ? 27 TYR A HE1  1  
ATOM 422   H HE2  . TYR A 1 27 ? 8.629   12.897  -4.142  1.00 0.39 ? 27 TYR A HE2  1  
ATOM 423   H HH   . TYR A 1 27 ? 8.395   15.289  -5.354  1.00 0.39 ? 27 TYR A HH   1  
ATOM 424   N N    . PHE A 1 28 ? 6.206   9.780   -5.930  1.00 0.35 ? 28 PHE A N    1  
ATOM 425   C CA   . PHE A 1 28 ? 5.208   10.380  -5.000  1.00 0.35 ? 28 PHE A CA   1  
ATOM 426   C C    . PHE A 1 28 ? 5.471   9.878   -3.579  1.00 0.35 ? 28 PHE A C    1  
ATOM 427   O O    . PHE A 1 28 ? 6.061   8.836   -3.378  1.00 0.35 ? 28 PHE A O    1  
ATOM 428   C CB   . PHE A 1 28 ? 3.795   9.979   -5.433  1.00 0.35 ? 28 PHE A CB   1  
ATOM 429   C CG   . PHE A 1 28 ? 3.771   8.511   -5.783  1.00 0.35 ? 28 PHE A CG   1  
ATOM 430   C CD1  . PHE A 1 28 ? 3.780   7.549   -4.767  1.00 0.35 ? 28 PHE A CD1  1  
ATOM 431   C CD2  . PHE A 1 28 ? 3.736   8.112   -7.124  1.00 0.35 ? 28 PHE A CD2  1  
ATOM 432   C CE1  . PHE A 1 28 ? 3.755   6.186   -5.092  1.00 0.35 ? 28 PHE A CE1  1  
ATOM 433   C CE2  . PHE A 1 28 ? 3.711   6.751   -7.450  1.00 0.35 ? 28 PHE A CE2  1  
ATOM 434   C CZ   . PHE A 1 28 ? 3.720   5.788   -6.433  1.00 0.35 ? 28 PHE A CZ   1  
ATOM 435   H H    . PHE A 1 28 ? 6.875   9.151   -5.590  1.00 0.35 ? 28 PHE A H    1  
ATOM 436   H HA   . PHE A 1 28 ? 5.299   11.456  -5.023  1.00 0.35 ? 28 PHE A HA   1  
ATOM 437   H HB2  . PHE A 1 28 ? 3.105   10.167  -4.623  1.00 0.35 ? 28 PHE A HB2  1  
ATOM 438   H HB3  . PHE A 1 28 ? 3.506   10.558  -6.296  1.00 0.35 ? 28 PHE A HB3  1  
ATOM 439   H HD1  . PHE A 1 28 ? 3.806   7.857   -3.732  1.00 0.35 ? 28 PHE A HD1  1  
ATOM 440   H HD2  . PHE A 1 28 ? 3.730   8.855   -7.909  1.00 0.35 ? 28 PHE A HD2  1  
ATOM 441   H HE1  . PHE A 1 28 ? 3.762   5.444   -4.308  1.00 0.35 ? 28 PHE A HE1  1  
ATOM 442   H HE2  . PHE A 1 28 ? 3.685   6.443   -8.485  1.00 0.35 ? 28 PHE A HE2  1  
ATOM 443   H HZ   . PHE A 1 28 ? 3.701   4.738   -6.684  1.00 0.35 ? 28 PHE A HZ   1  
ATOM 444   N N    . TYR A 1 29 ? 5.040   10.614  -2.591  1.00 0.32 ? 29 TYR A N    1  
ATOM 445   C CA   . TYR A 1 29 ? 5.269   10.179  -1.184  1.00 0.32 ? 29 TYR A CA   1  
ATOM 446   C C    . TYR A 1 29 ? 4.091   9.323   -0.716  1.00 0.32 ? 29 TYR A C    1  
ATOM 447   O O    . TYR A 1 29 ? 3.074   9.233   -1.375  1.00 0.32 ? 29 TYR A O    1  
ATOM 448   C CB   . TYR A 1 29 ? 5.393   11.411  -0.283  1.00 0.32 ? 29 TYR A CB   1  
ATOM 449   C CG   . TYR A 1 29 ? 6.669   12.149  -0.612  1.00 0.32 ? 29 TYR A CG   1  
ATOM 450   C CD1  . TYR A 1 29 ? 6.704   13.036  -1.695  1.00 0.32 ? 29 TYR A CD1  1  
ATOM 451   C CD2  . TYR A 1 29 ? 7.815   11.948  0.167   1.00 0.32 ? 29 TYR A CD2  1  
ATOM 452   C CE1  . TYR A 1 29 ? 7.887   13.722  -1.998  1.00 0.32 ? 29 TYR A CE1  1  
ATOM 453   C CE2  . TYR A 1 29 ? 8.996   12.634  -0.138  1.00 0.32 ? 29 TYR A CE2  1  
ATOM 454   C CZ   . TYR A 1 29 ? 9.033   13.521  -1.219  1.00 0.32 ? 29 TYR A CZ   1  
ATOM 455   O OH   . TYR A 1 29 ? 10.198  14.198  -1.519  1.00 0.32 ? 29 TYR A OH   1  
ATOM 456   H H    . TYR A 1 29 ? 4.568   11.452  -2.775  1.00 0.32 ? 29 TYR A H    1  
ATOM 457   H HA   . TYR A 1 29 ? 6.179   9.599   -1.129  1.00 0.32 ? 29 TYR A HA   1  
ATOM 458   H HB2  . TYR A 1 29 ? 4.547   12.062  -0.446  1.00 0.32 ? 29 TYR A HB2  1  
ATOM 459   H HB3  . TYR A 1 29 ? 5.414   11.099  0.750   1.00 0.32 ? 29 TYR A HB3  1  
ATOM 460   H HD1  . TYR A 1 29 ? 5.822   13.191  -2.296  1.00 0.32 ? 29 TYR A HD1  1  
ATOM 461   H HD2  . TYR A 1 29 ? 7.788   11.263  1.001   1.00 0.32 ? 29 TYR A HD2  1  
ATOM 462   H HE1  . TYR A 1 29 ? 7.915   14.407  -2.833  1.00 0.32 ? 29 TYR A HE1  1  
ATOM 463   H HE2  . TYR A 1 29 ? 9.881   12.479  0.464   1.00 0.32 ? 29 TYR A HE2  1  
ATOM 464   H HH   . TYR A 1 29 ? 10.935  13.674  -1.199  1.00 0.32 ? 29 TYR A HH   1  
ATOM 465   N N    . THR A 1 30 ? 4.218   8.693   0.420   1.00 0.37 ? 30 THR A N    1  
ATOM 466   C CA   . THR A 1 30 ? 3.106   7.842   0.930   1.00 0.37 ? 30 THR A CA   1  
ATOM 467   C C    . THR A 1 30 ? 3.130   7.835   2.460   1.00 0.37 ? 30 THR A C    1  
ATOM 468   O O    . THR A 1 30 ? 4.176   7.779   3.074   1.00 0.37 ? 30 THR A O    1  
ATOM 469   C CB   . THR A 1 30 ? 3.277   6.413   0.411   1.00 0.37 ? 30 THR A CB   1  
ATOM 470   O OG1  . THR A 1 30 ? 4.490   5.870   0.916   1.00 0.37 ? 30 THR A OG1  1  
ATOM 471   C CG2  . THR A 1 30 ? 3.318   6.423   -1.117  1.00 0.37 ? 30 THR A CG2  1  
ATOM 472   H H    . THR A 1 30 ? 5.046   8.778   0.937   1.00 0.37 ? 30 THR A H    1  
ATOM 473   H HA   . THR A 1 30 ? 2.162   8.239   0.586   1.00 0.37 ? 30 THR A HA   1  
ATOM 474   H HB   . THR A 1 30 ? 2.447   5.809   0.741   1.00 0.37 ? 30 THR A HB   1  
ATOM 475   H HG1  . THR A 1 30 ? 5.171   6.544   0.839   1.00 0.37 ? 30 THR A HG1  1  
ATOM 476   H HG21 . THR A 1 30 ? 4.087   7.101   -1.453  1.00 0.37 ? 30 THR A HG21 1  
ATOM 477   H HG22 . THR A 1 30 ? 3.532   5.427   -1.478  1.00 0.37 ? 30 THR A HG22 1  
ATOM 478   H HG23 . THR A 1 30 ? 2.361   6.745   -1.500  1.00 0.37 ? 30 THR A HG23 1  
ATOM 479   N N    . SER A 1 31 ? 1.982   7.888   3.081   1.00 0.47 ? 31 SER A N    1  
ATOM 480   C CA   . SER A 1 31 ? 1.941   7.882   4.569   1.00 0.47 ? 31 SER A CA   1  
ATOM 481   C C    . SER A 1 31 ? 0.485   7.925   5.041   1.00 0.47 ? 31 SER A C    1  
ATOM 482   O O    . SER A 1 31 ? -0.433  7.735   4.268   1.00 0.47 ? 31 SER A O    1  
ATOM 483   C CB   . SER A 1 31 ? 2.686   9.104   5.105   1.00 0.47 ? 31 SER A CB   1  
ATOM 484   O OG   . SER A 1 31 ? 3.132   8.839   6.430   1.00 0.47 ? 31 SER A OG   1  
ATOM 485   H H    . SER A 1 31 ? 1.149   7.931   2.567   1.00 0.47 ? 31 SER A H    1  
ATOM 486   H HA   . SER A 1 31 ? 2.411   6.983   4.939   1.00 0.47 ? 31 SER A HA   1  
ATOM 487   H HB2  . SER A 1 31 ? 3.538   9.312   4.480   1.00 0.47 ? 31 SER A HB2  1  
ATOM 488   H HB3  . SER A 1 31 ? 2.023   9.959   5.102   1.00 0.47 ? 31 SER A HB3  1  
ATOM 489   H HG   . SER A 1 31 ? 3.069   9.655   6.932   1.00 0.47 ? 31 SER A HG   1  
ATOM 490   N N    . GLY A 1 32 ? 0.269   8.173   6.304   1.00 0.60 ? 32 GLY A N    1  
ATOM 491   C CA   . GLY A 1 32 ? -1.127  8.228   6.823   1.00 0.60 ? 32 GLY A CA   1  
ATOM 492   C C    . GLY A 1 32 ? -1.650  6.805   7.028   1.00 0.60 ? 32 GLY A C    1  
ATOM 493   O O    . GLY A 1 32 ? -1.703  6.306   8.134   1.00 0.60 ? 32 GLY A O    1  
ATOM 494   H H    . GLY A 1 32 ? 1.023   8.323   6.910   1.00 0.60 ? 32 GLY A H    1  
ATOM 495   H HA2  . GLY A 1 32 ? -1.139  8.758   7.765   1.00 0.60 ? 32 GLY A HA2  1  
ATOM 496   H HA3  . GLY A 1 32 ? -1.757  8.741   6.113   1.00 0.60 ? 32 GLY A HA3  1  
ATOM 497   N N    . LYS A 1 33 ? -2.036  6.147   5.969   1.00 0.55 ? 33 LYS A N    1  
ATOM 498   C CA   . LYS A 1 33 ? -2.554  4.757   6.103   1.00 0.55 ? 33 LYS A CA   1  
ATOM 499   C C    . LYS A 1 33 ? -1.389  3.770   6.006   1.00 0.55 ? 33 LYS A C    1  
ATOM 500   O O    . LYS A 1 33 ? -1.512  2.704   5.435   1.00 0.55 ? 33 LYS A O    1  
ATOM 501   C CB   . LYS A 1 33 ? -3.556  4.475   4.982   1.00 0.55 ? 33 LYS A CB   1  
ATOM 502   C CG   . LYS A 1 33 ? -4.851  5.243   5.250   1.00 0.55 ? 33 LYS A CG   1  
ATOM 503   C CD   . LYS A 1 33 ? -6.021  4.518   4.582   1.00 0.55 ? 33 LYS A CD   1  
ATOM 504   C CE   . LYS A 1 33 ? -6.921  5.536   3.879   1.00 0.55 ? 33 LYS A CE   1  
ATOM 505   N NZ   . LYS A 1 33 ? -7.904  4.820   3.019   1.00 0.55 ? 33 LYS A NZ   1  
ATOM 506   H H    . LYS A 1 33 ? -1.985  6.568   5.085   1.00 0.55 ? 33 LYS A H    1  
ATOM 507   H HA   . LYS A 1 33 ? -3.043  4.645   7.060   1.00 0.55 ? 33 LYS A HA   1  
ATOM 508   H HB2  . LYS A 1 33 ? -3.137  4.791   4.038   1.00 0.55 ? 33 LYS A HB2  1  
ATOM 509   H HB3  . LYS A 1 33 ? -3.768  3.417   4.946   1.00 0.55 ? 33 LYS A HB3  1  
ATOM 510   H HG2  . LYS A 1 33 ? -5.022  5.301   6.315   1.00 0.55 ? 33 LYS A HG2  1  
ATOM 511   H HG3  . LYS A 1 33 ? -4.769  6.241   4.843   1.00 0.55 ? 33 LYS A HG3  1  
ATOM 512   H HD2  . LYS A 1 33 ? -5.640  3.813   3.857   1.00 0.55 ? 33 LYS A HD2  1  
ATOM 513   H HD3  . LYS A 1 33 ? -6.593  3.992   5.331   1.00 0.55 ? 33 LYS A HD3  1  
ATOM 514   H HE2  . LYS A 1 33 ? -7.447  6.122   4.618   1.00 0.55 ? 33 LYS A HE2  1  
ATOM 515   H HE3  . LYS A 1 33 ? -6.315  6.189   3.267   1.00 0.55 ? 33 LYS A HE3  1  
ATOM 516   H HZ1  . LYS A 1 33 ? -7.573  3.851   2.846   1.00 0.55 ? 33 LYS A HZ1  1  
ATOM 517   H HZ2  . LYS A 1 33 ? -8.827  4.792   3.500   1.00 0.55 ? 33 LYS A HZ2  1  
ATOM 518   H HZ3  . LYS A 1 33 ? -7.999  5.319   2.112   1.00 0.55 ? 33 LYS A HZ3  1  
ATOM 519   N N    . CYS A 1 34 ? -0.259  4.116   6.557   1.00 0.46 ? 34 CYS A N    1  
ATOM 520   C CA   . CYS A 1 34 ? 0.912   3.198   6.493   1.00 0.46 ? 34 CYS A CA   1  
ATOM 521   C C    . CYS A 1 34 ? 1.650   3.215   7.833   1.00 0.46 ? 34 CYS A C    1  
ATOM 522   O O    . CYS A 1 34 ? 1.229   3.854   8.777   1.00 0.46 ? 34 CYS A O    1  
ATOM 523   C CB   . CYS A 1 34 ? 1.860   3.661   5.385   1.00 0.46 ? 34 CYS A CB   1  
ATOM 524   S SG   . CYS A 1 34 ? 0.894   4.160   3.939   1.00 0.46 ? 34 CYS A SG   1  
ATOM 525   H H    . CYS A 1 34 ? -0.180  4.981   7.012   1.00 0.46 ? 34 CYS A H    1  
ATOM 526   H HA   . CYS A 1 34 ? 0.573   2.195   6.282   1.00 0.46 ? 34 CYS A HA   1  
ATOM 527   H HB2  . CYS A 1 34 ? 2.443   4.499   5.736   1.00 0.46 ? 34 CYS A HB2  1  
ATOM 528   H HB3  . CYS A 1 34 ? 2.521   2.850   5.115   1.00 0.46 ? 34 CYS A HB3  1  
ATOM 529   N N    . SER A 1 35 ? 2.749   2.517   7.925   1.00 0.42 ? 35 SER A N    1  
ATOM 530   C CA   . SER A 1 35 ? 3.513   2.494   9.204   1.00 0.42 ? 35 SER A CA   1  
ATOM 531   C C    . SER A 1 35 ? 4.487   3.673   9.236   1.00 0.42 ? 35 SER A C    1  
ATOM 532   O O    . SER A 1 35 ? 4.752   4.245   10.275  1.00 0.42 ? 35 SER A O    1  
ATOM 533   C CB   . SER A 1 35 ? 4.294   1.184   9.307   1.00 0.42 ? 35 SER A CB   1  
ATOM 534   O OG   . SER A 1 35 ? 3.442   0.168   9.817   1.00 0.42 ? 35 SER A OG   1  
ATOM 535   H H    . SER A 1 35 ? 3.072   2.009   7.153   1.00 0.42 ? 35 SER A H    1  
ATOM 536   H HA   . SER A 1 35 ? 2.827   2.570   10.034  1.00 0.42 ? 35 SER A HA   1  
ATOM 537   H HB2  . SER A 1 35 ? 4.647   0.894   8.331   1.00 0.42 ? 35 SER A HB2  1  
ATOM 538   H HB3  . SER A 1 35 ? 5.141   1.323   9.966   1.00 0.42 ? 35 SER A HB3  1  
ATOM 539   H HG   . SER A 1 35 ? 2.662   0.127   9.259   1.00 0.42 ? 35 SER A HG   1  
ATOM 540   N N    . ASN A 1 36 ? 5.023   4.042   8.105   1.00 0.38 ? 36 ASN A N    1  
ATOM 541   C CA   . ASN A 1 36 ? 5.980   5.184   8.071   1.00 0.38 ? 36 ASN A CA   1  
ATOM 542   C C    . ASN A 1 36 ? 5.889   5.885   6.712   1.00 0.38 ? 36 ASN A C    1  
ATOM 543   O O    . ASN A 1 36 ? 5.596   5.259   5.713   1.00 0.38 ? 36 ASN A O    1  
ATOM 544   C CB   . ASN A 1 36 ? 7.406   4.665   8.280   1.00 0.38 ? 36 ASN A CB   1  
ATOM 545   C CG   . ASN A 1 36 ? 7.378   3.432   9.185   1.00 0.38 ? 36 ASN A CG   1  
ATOM 546   O OD1  . ASN A 1 36 ? 7.177   3.543   10.378  1.00 0.38 ? 36 ASN A OD1  1  
ATOM 547   N ND2  . ASN A 1 36 ? 7.572   2.251   8.664   1.00 0.38 ? 36 ASN A ND2  1  
ATOM 548   H H    . ASN A 1 36 ? 4.797   3.568   7.278   1.00 0.38 ? 36 ASN A H    1  
ATOM 549   H HA   . ASN A 1 36 ? 5.733   5.884   8.855   1.00 0.38 ? 36 ASN A HA   1  
ATOM 550   H HB2  . ASN A 1 36 ? 7.837   4.401   7.325   1.00 0.38 ? 36 ASN A HB2  1  
ATOM 551   H HB3  . ASN A 1 36 ? 8.005   5.435   8.744   1.00 0.38 ? 36 ASN A HB3  1  
ATOM 552   H HD21 . ASN A 1 36 ? 7.734   2.161   7.701   1.00 0.38 ? 36 ASN A HD21 1  
ATOM 553   H HD22 . ASN A 1 36 ? 7.557   1.455   9.234   1.00 0.38 ? 36 ASN A HD22 1  
ATOM 554   N N    . PRO A 1 37 ? 6.144   7.168   6.719   1.00 0.37 ? 37 PRO A N    1  
ATOM 555   C CA   . PRO A 1 37 ? 6.102   7.993   5.499   1.00 0.37 ? 37 PRO A CA   1  
ATOM 556   C C    . PRO A 1 37 ? 7.371   7.781   4.669   1.00 0.37 ? 37 PRO A C    1  
ATOM 557   O O    . PRO A 1 37 ? 8.474   7.940   5.154   1.00 0.37 ? 37 PRO A O    1  
ATOM 558   C CB   . PRO A 1 37 ? 6.033   9.426   6.038   1.00 0.37 ? 37 PRO A CB   1  
ATOM 559   C CG   . PRO A 1 37 ? 6.604   9.379   7.475   1.00 0.37 ? 37 PRO A CG   1  
ATOM 560   C CD   . PRO A 1 37 ? 6.500   7.916   7.944   1.00 0.37 ? 37 PRO A CD   1  
ATOM 561   H HA   . PRO A 1 37 ? 5.221   7.773   4.919   1.00 0.37 ? 37 PRO A HA   1  
ATOM 562   H HB2  . PRO A 1 37 ? 6.629   10.082  5.418   1.00 0.37 ? 37 PRO A HB2  1  
ATOM 563   H HB3  . PRO A 1 37 ? 5.009   9.763   6.063   1.00 0.37 ? 37 PRO A HB3  1  
ATOM 564   H HG2  . PRO A 1 37 ? 7.636   9.698   7.472   1.00 0.37 ? 37 PRO A HG2  1  
ATOM 565   H HG3  . PRO A 1 37 ? 6.021   10.012  8.126   1.00 0.37 ? 37 PRO A HG3  1  
ATOM 566   H HD2  . PRO A 1 37 ? 7.450   7.577   8.335   1.00 0.37 ? 37 PRO A HD2  1  
ATOM 567   H HD3  . PRO A 1 37 ? 5.722   7.809   8.684   1.00 0.37 ? 37 PRO A HD3  1  
ATOM 568   N N    . ALA A 1 38 ? 7.224   7.420   3.424   1.00 0.33 ? 38 ALA A N    1  
ATOM 569   C CA   . ALA A 1 38 ? 8.423   7.195   2.568   1.00 0.33 ? 38 ALA A CA   1  
ATOM 570   C C    . ALA A 1 38 ? 8.132   7.668   1.143   1.00 0.33 ? 38 ALA A C    1  
ATOM 571   O O    . ALA A 1 38 ? 7.024   8.046   0.817   1.00 0.33 ? 38 ALA A O    1  
ATOM 572   C CB   . ALA A 1 38 ? 8.764   5.705   2.551   1.00 0.33 ? 38 ALA A CB   1  
ATOM 573   H H    . ALA A 1 38 ? 6.326   7.294   3.053   1.00 0.33 ? 38 ALA A H    1  
ATOM 574   H HA   . ALA A 1 38 ? 9.259   7.750   2.968   1.00 0.33 ? 38 ALA A HA   1  
ATOM 575   H HB1  . ALA A 1 38 ? 7.859   5.130   2.425   1.00 0.33 ? 38 ALA A HB1  1  
ATOM 576   H HB2  . ALA A 1 38 ? 9.438   5.498   1.732   1.00 0.33 ? 38 ALA A HB2  1  
ATOM 577   H HB3  . ALA A 1 38 ? 9.237   5.432   3.483   1.00 0.33 ? 38 ALA A HB3  1  
ATOM 578   N N    . VAL A 1 39 ? 9.120   7.646   0.289   1.00 0.30 ? 39 VAL A N    1  
ATOM 579   C CA   . VAL A 1 39 ? 8.901   8.092   -1.115  1.00 0.30 ? 39 VAL A CA   1  
ATOM 580   C C    . VAL A 1 39 ? 8.656   6.870   -2.004  1.00 0.30 ? 39 VAL A C    1  
ATOM 581   O O    . VAL A 1 39 ? 8.897   5.746   -1.611  1.00 0.30 ? 39 VAL A O    1  
ATOM 582   C CB   . VAL A 1 39 ? 10.138  8.846   -1.610  1.00 0.30 ? 39 VAL A CB   1  
ATOM 583   C CG1  . VAL A 1 39 ? 10.063  9.019   -3.128  1.00 0.30 ? 39 VAL A CG1  1  
ATOM 584   C CG2  . VAL A 1 39 ? 10.193  10.222  -0.945  1.00 0.30 ? 39 VAL A CG2  1  
ATOM 585   H H    . VAL A 1 39 ? 10.005  7.337   0.572   1.00 0.30 ? 39 VAL A H    1  
ATOM 586   H HA   . VAL A 1 39 ? 8.041   8.745   -1.156  1.00 0.30 ? 39 VAL A HA   1  
ATOM 587   H HB   . VAL A 1 39 ? 11.025  8.285   -1.355  1.00 0.30 ? 39 VAL A HB   1  
ATOM 588   H HG11 . VAL A 1 39 ? 9.126   9.487   -3.391  1.00 0.30 ? 39 VAL A HG11 1  
ATOM 589   H HG12 . VAL A 1 39 ? 10.881  9.641   -3.460  1.00 0.30 ? 39 VAL A HG12 1  
ATOM 590   H HG13 . VAL A 1 39 ? 10.129  8.052   -3.604  1.00 0.30 ? 39 VAL A HG13 1  
ATOM 591   H HG21 . VAL A 1 39 ? 9.642   10.195  -0.016  1.00 0.30 ? 39 VAL A HG21 1  
ATOM 592   H HG22 . VAL A 1 39 ? 11.222  10.485  -0.745  1.00 0.30 ? 39 VAL A HG22 1  
ATOM 593   H HG23 . VAL A 1 39 ? 9.754   10.957  -1.602  1.00 0.30 ? 39 VAL A HG23 1  
ATOM 594   N N    . VAL A 1 40 ? 8.176   7.082   -3.198  1.00 0.33 ? 40 VAL A N    1  
ATOM 595   C CA   . VAL A 1 40 ? 7.915   5.935   -4.112  1.00 0.33 ? 40 VAL A CA   1  
ATOM 596   C C    . VAL A 1 40 ? 8.199   6.360   -5.554  1.00 0.33 ? 40 VAL A C    1  
ATOM 597   O O    . VAL A 1 40 ? 7.538   7.221   -6.099  1.00 0.33 ? 40 VAL A O    1  
ATOM 598   C CB   . VAL A 1 40 ? 6.451   5.506   -3.980  1.00 0.33 ? 40 VAL A CB   1  
ATOM 599   C CG1  . VAL A 1 40 ? 6.083   4.570   -5.132  1.00 0.33 ? 40 VAL A CG1  1  
ATOM 600   C CG2  . VAL A 1 40 ? 6.253   4.777   -2.650  1.00 0.33 ? 40 VAL A CG2  1  
ATOM 601   H H    . VAL A 1 40 ? 7.988   7.997   -3.495  1.00 0.33 ? 40 VAL A H    1  
ATOM 602   H HA   . VAL A 1 40 ? 8.558   5.109   -3.846  1.00 0.33 ? 40 VAL A HA   1  
ATOM 603   H HB   . VAL A 1 40 ? 5.818   6.381   -4.012  1.00 0.33 ? 40 VAL A HB   1  
ATOM 604   H HG11 . VAL A 1 40 ? 6.879   3.856   -5.285  1.00 0.33 ? 40 VAL A HG11 1  
ATOM 605   H HG12 . VAL A 1 40 ? 5.170   4.045   -4.893  1.00 0.33 ? 40 VAL A HG12 1  
ATOM 606   H HG13 . VAL A 1 40 ? 5.940   5.146   -6.034  1.00 0.33 ? 40 VAL A HG13 1  
ATOM 607   H HG21 . VAL A 1 40 ? 6.950   3.955   -2.582  1.00 0.33 ? 40 VAL A HG21 1  
ATOM 608   H HG22 . VAL A 1 40 ? 6.426   5.463   -1.834  1.00 0.33 ? 40 VAL A HG22 1  
ATOM 609   H HG23 . VAL A 1 40 ? 5.244   4.398   -2.594  1.00 0.33 ? 40 VAL A HG23 1  
ATOM 610   N N    . PHE A 1 41 ? 9.178   5.763   -6.176  1.00 0.37 ? 41 PHE A N    1  
ATOM 611   C CA   . PHE A 1 41 ? 9.503   6.135   -7.582  1.00 0.37 ? 41 PHE A CA   1  
ATOM 612   C C    . PHE A 1 41 ? 8.696   5.259   -8.542  1.00 0.37 ? 41 PHE A C    1  
ATOM 613   O O    . PHE A 1 41 ? 8.307   4.155   -8.214  1.00 0.37 ? 41 PHE A O    1  
ATOM 614   C CB   . PHE A 1 41 ? 10.997  5.925   -7.832  1.00 0.37 ? 41 PHE A CB   1  
ATOM 615   C CG   . PHE A 1 41 ? 11.781  7.021   -7.151  1.00 0.37 ? 41 PHE A CG   1  
ATOM 616   C CD1  . PHE A 1 41 ? 11.959  8.255   -7.788  1.00 0.37 ? 41 PHE A CD1  1  
ATOM 617   C CD2  . PHE A 1 41 ? 12.329  6.803   -5.881  1.00 0.37 ? 41 PHE A CD2  1  
ATOM 618   C CE1  . PHE A 1 41 ? 12.686  9.271   -7.155  1.00 0.37 ? 41 PHE A CE1  1  
ATOM 619   C CE2  . PHE A 1 41 ? 13.055  7.820   -5.248  1.00 0.37 ? 41 PHE A CE2  1  
ATOM 620   C CZ   . PHE A 1 41 ? 13.233  9.053   -5.886  1.00 0.37 ? 41 PHE A CZ   1  
ATOM 621   H H    . PHE A 1 41 ? 9.700   5.071   -5.719  1.00 0.37 ? 41 PHE A H    1  
ATOM 622   H HA   . PHE A 1 41 ? 9.253   7.173   -7.746  1.00 0.37 ? 41 PHE A HA   1  
ATOM 623   H HB2  . PHE A 1 41 ? 11.298  4.966   -7.435  1.00 0.37 ? 41 PHE A HB2  1  
ATOM 624   H HB3  . PHE A 1 41 ? 11.192  5.952   -8.895  1.00 0.37 ? 41 PHE A HB3  1  
ATOM 625   H HD1  . PHE A 1 41 ? 11.536  8.422   -8.768  1.00 0.37 ? 41 PHE A HD1  1  
ATOM 626   H HD2  . PHE A 1 41 ? 12.192  5.852   -5.390  1.00 0.37 ? 41 PHE A HD2  1  
ATOM 627   H HE1  . PHE A 1 41 ? 12.823  10.223  -7.647  1.00 0.37 ? 41 PHE A HE1  1  
ATOM 628   H HE2  . PHE A 1 41 ? 13.478  7.651   -4.269  1.00 0.37 ? 41 PHE A HE2  1  
ATOM 629   H HZ   . PHE A 1 41 ? 13.793  9.837   -5.398  1.00 0.37 ? 41 PHE A HZ   1  
ATOM 630   N N    . VAL A 1 42 ? 8.441   5.742   -9.727  1.00 0.46 ? 42 VAL A N    1  
ATOM 631   C CA   . VAL A 1 42 ? 7.659   4.937   -10.708 1.00 0.46 ? 42 VAL A CA   1  
ATOM 632   C C    . VAL A 1 42 ? 8.296   5.063   -12.093 1.00 0.46 ? 42 VAL A C    1  
ATOM 633   O O    . VAL A 1 42 ? 8.414   6.143   -12.637 1.00 0.46 ? 42 VAL A O    1  
ATOM 634   C CB   . VAL A 1 42 ? 6.220   5.454   -10.761 1.00 0.46 ? 42 VAL A CB   1  
ATOM 635   C CG1  . VAL A 1 42 ? 5.376   4.531   -11.641 1.00 0.46 ? 42 VAL A CG1  1  
ATOM 636   C CG2  . VAL A 1 42 ? 5.638   5.480   -9.345  1.00 0.46 ? 42 VAL A CG2  1  
ATOM 637   H H    . VAL A 1 42 ? 8.764   6.633   -9.972  1.00 0.46 ? 42 VAL A H    1  
ATOM 638   H HA   . VAL A 1 42 ? 7.658   3.901   -10.404 1.00 0.46 ? 42 VAL A HA   1  
ATOM 639   H HB   . VAL A 1 42 ? 6.212   6.453   -11.174 1.00 0.46 ? 42 VAL A HB   1  
ATOM 640   H HG11 . VAL A 1 42 ? 5.939   4.260   -12.522 1.00 0.46 ? 42 VAL A HG11 1  
ATOM 641   H HG12 . VAL A 1 42 ? 5.121   3.639   -11.088 1.00 0.46 ? 42 VAL A HG12 1  
ATOM 642   H HG13 . VAL A 1 42 ? 4.472   5.042   -11.936 1.00 0.46 ? 42 VAL A HG13 1  
ATOM 643   H HG21 . VAL A 1 42 ? 6.323   4.995   -8.666  1.00 0.46 ? 42 VAL A HG21 1  
ATOM 644   H HG22 . VAL A 1 42 ? 5.488   6.504   -9.036  1.00 0.46 ? 42 VAL A HG22 1  
ATOM 645   H HG23 . VAL A 1 42 ? 4.693   4.959   -9.336  1.00 0.46 ? 42 VAL A HG23 1  
ATOM 646   N N    . THR A 1 43 ? 8.709   3.966   -12.667 1.00 0.54 ? 43 THR A N    1  
ATOM 647   C CA   . THR A 1 43 ? 9.340   4.022   -14.016 1.00 0.54 ? 43 THR A CA   1  
ATOM 648   C C    . THR A 1 43 ? 8.262   3.877   -15.092 1.00 0.54 ? 43 THR A C    1  
ATOM 649   O O    . THR A 1 43 ? 7.086   3.790   -14.800 1.00 0.54 ? 43 THR A O    1  
ATOM 650   C CB   . THR A 1 43 ? 10.353  2.883   -14.151 1.00 0.54 ? 43 THR A CB   1  
ATOM 651   O OG1  . THR A 1 43 ? 9.663   1.642   -14.215 1.00 0.54 ? 43 THR A OG1  1  
ATOM 652   C CG2  . THR A 1 43 ? 11.292  2.886   -12.944 1.00 0.54 ? 43 THR A CG2  1  
ATOM 653   H H    . THR A 1 43 ? 8.604   3.104   -12.210 1.00 0.54 ? 43 THR A H    1  
ATOM 654   H HA   . THR A 1 43 ? 9.845   4.968   -14.136 1.00 0.54 ? 43 THR A HA   1  
ATOM 655   H HB   . THR A 1 43 ? 10.931  3.020   -15.052 1.00 0.54 ? 43 THR A HB   1  
ATOM 656   H HG1  . THR A 1 43 ? 10.316  0.940   -14.240 1.00 0.54 ? 43 THR A HG1  1  
ATOM 657   H HG21 . THR A 1 43 ? 11.559  3.904   -12.698 1.00 0.54 ? 43 THR A HG21 1  
ATOM 658   H HG22 . THR A 1 43 ? 10.796  2.431   -12.101 1.00 0.54 ? 43 THR A HG22 1  
ATOM 659   H HG23 . THR A 1 43 ? 12.186  2.327   -13.182 1.00 0.54 ? 43 THR A HG23 1  
ATOM 660   N N    . ARG A 1 44 ? 8.654   3.851   -16.336 1.00 0.69 ? 44 ARG A N    1  
ATOM 661   C CA   . ARG A 1 44 ? 7.653   3.711   -17.431 1.00 0.69 ? 44 ARG A CA   1  
ATOM 662   C C    . ARG A 1 44 ? 7.049   2.307   -17.396 1.00 0.69 ? 44 ARG A C    1  
ATOM 663   O O    . ARG A 1 44 ? 5.995   2.060   -17.947 1.00 0.69 ? 44 ARG A O    1  
ATOM 664   C CB   . ARG A 1 44 ? 8.339   3.936   -18.781 1.00 0.69 ? 44 ARG A CB   1  
ATOM 665   C CG   . ARG A 1 44 ? 8.785   5.396   -18.890 1.00 0.69 ? 44 ARG A CG   1  
ATOM 666   C CD   . ARG A 1 44 ? 9.127   5.718   -20.346 1.00 0.69 ? 44 ARG A CD   1  
ATOM 667   N NE   . ARG A 1 44 ? 8.629   7.081   -20.683 1.00 0.69 ? 44 ARG A NE   1  
ATOM 668   C CZ   . ARG A 1 44 ? 9.450   8.096   -20.677 1.00 0.69 ? 44 ARG A CZ   1  
ATOM 669   N NH1  . ARG A 1 44 ? 10.215  8.309   -19.642 1.00 0.69 ? 44 ARG A NH1  1  
ATOM 670   N NH2  . ARG A 1 44 ? 9.505   8.898   -21.705 1.00 0.69 ? 44 ARG A NH2  1  
ATOM 671   H H    . ARG A 1 44 ? 9.608   3.922   -16.551 1.00 0.69 ? 44 ARG A H    1  
ATOM 672   H HA   . ARG A 1 44 ? 6.871   4.444   -17.299 1.00 0.69 ? 44 ARG A HA   1  
ATOM 673   H HB2  . ARG A 1 44 ? 9.200   3.288   -18.859 1.00 0.69 ? 44 ARG A HB2  1  
ATOM 674   H HB3  . ARG A 1 44 ? 7.646   3.714   -19.579 1.00 0.69 ? 44 ARG A HB3  1  
ATOM 675   H HG2  . ARG A 1 44 ? 7.988   6.042   -18.555 1.00 0.69 ? 44 ARG A HG2  1  
ATOM 676   H HG3  . ARG A 1 44 ? 9.659   5.552   -18.275 1.00 0.69 ? 44 ARG A HG3  1  
ATOM 677   H HD2  . ARG A 1 44 ? 10.197  5.681   -20.482 1.00 0.69 ? 44 ARG A HD2  1  
ATOM 678   H HD3  . ARG A 1 44 ? 8.657   4.992   -20.994 1.00 0.69 ? 44 ARG A HD3  1  
ATOM 679   H HE   . ARG A 1 44 ? 7.685   7.216   -20.910 1.00 0.69 ? 44 ARG A HE   1  
ATOM 680   H HH11 . ARG A 1 44 ? 10.173  7.695   -18.854 1.00 0.69 ? 44 ARG A HH11 1  
ATOM 681   H HH12 . ARG A 1 44 ? 10.845  9.086   -19.636 1.00 0.69 ? 44 ARG A HH12 1  
ATOM 682   H HH21 . ARG A 1 44 ? 8.919   8.734   -22.498 1.00 0.69 ? 44 ARG A HH21 1  
ATOM 683   H HH22 . ARG A 1 44 ? 10.134  9.674   -21.700 1.00 0.69 ? 44 ARG A HH22 1  
ATOM 684   N N    . LYS A 1 45 ? 7.708   1.383   -16.751 1.00 0.66 ? 45 LYS A N    1  
ATOM 685   C CA   . LYS A 1 45 ? 7.170   -0.004  -16.681 1.00 0.66 ? 45 LYS A CA   1  
ATOM 686   C C    . LYS A 1 45 ? 6.257   -0.138  -15.460 1.00 0.66 ? 45 LYS A C    1  
ATOM 687   O O    . LYS A 1 45 ? 6.206   -1.171  -14.822 1.00 0.66 ? 45 LYS A O    1  
ATOM 688   C CB   . LYS A 1 45 ? 8.329   -0.996  -16.562 1.00 0.66 ? 45 LYS A CB   1  
ATOM 689   C CG   . LYS A 1 45 ? 9.254   -0.848  -17.771 1.00 0.66 ? 45 LYS A CG   1  
ATOM 690   C CD   . LYS A 1 45 ? 8.443   -1.009  -19.058 1.00 0.66 ? 45 LYS A CD   1  
ATOM 691   C CE   . LYS A 1 45 ? 7.764   -2.379  -19.066 1.00 0.66 ? 45 LYS A CE   1  
ATOM 692   N NZ   . LYS A 1 45 ? 7.744   -2.916  -20.456 1.00 0.66 ? 45 LYS A NZ   1  
ATOM 693   H H    . LYS A 1 45 ? 8.556   1.603   -16.312 1.00 0.66 ? 45 LYS A H    1  
ATOM 694   H HA   . LYS A 1 45 ? 6.605   -0.218  -17.577 1.00 0.66 ? 45 LYS A HA   1  
ATOM 695   H HB2  . LYS A 1 45 ? 8.883   -0.794  -15.656 1.00 0.66 ? 45 LYS A HB2  1  
ATOM 696   H HB3  . LYS A 1 45 ? 7.941   -2.002  -16.529 1.00 0.66 ? 45 LYS A HB3  1  
ATOM 697   H HG2  . LYS A 1 45 ? 9.715   0.130   -17.754 1.00 0.66 ? 45 LYS A HG2  1  
ATOM 698   H HG3  . LYS A 1 45 ? 10.020  -1.608  -17.733 1.00 0.66 ? 45 LYS A HG3  1  
ATOM 699   H HD2  . LYS A 1 45 ? 7.692   -0.234  -19.109 1.00 0.66 ? 45 LYS A HD2  1  
ATOM 700   H HD3  . LYS A 1 45 ? 9.101   -0.930  -19.910 1.00 0.66 ? 45 LYS A HD3  1  
ATOM 701   H HE2  . LYS A 1 45 ? 8.311   -3.056  -18.427 1.00 0.66 ? 45 LYS A HE2  1  
ATOM 702   H HE3  . LYS A 1 45 ? 6.751   -2.282  -18.703 1.00 0.66 ? 45 LYS A HE3  1  
ATOM 703   H HZ1  . LYS A 1 45 ? 7.383   -2.186  -21.104 1.00 0.66 ? 45 LYS A HZ1  1  
ATOM 704   H HZ2  . LYS A 1 45 ? 8.707   -3.185  -20.738 1.00 0.66 ? 45 LYS A HZ2  1  
ATOM 705   H HZ3  . LYS A 1 45 ? 7.128   -3.752  -20.497 1.00 0.66 ? 45 LYS A HZ3  1  
ATOM 706   N N    . ASN A 1 46 ? 5.536   0.897   -15.129 1.00 0.61 ? 46 ASN A N    1  
ATOM 707   C CA   . ASN A 1 46 ? 4.629   0.828   -13.949 1.00 0.61 ? 46 ASN A CA   1  
ATOM 708   C C    . ASN A 1 46 ? 5.359   0.156   -12.785 1.00 0.61 ? 46 ASN A C    1  
ATOM 709   O O    . ASN A 1 46 ? 4.753   -0.470  -11.938 1.00 0.61 ? 46 ASN A O    1  
ATOM 710   C CB   . ASN A 1 46 ? 3.386   0.011   -14.310 1.00 0.61 ? 46 ASN A CB   1  
ATOM 711   C CG   . ASN A 1 46 ? 2.173   0.568   -13.563 1.00 0.61 ? 46 ASN A CG   1  
ATOM 712   O OD1  . ASN A 1 46 ? 1.537   1.496   -14.020 1.00 0.61 ? 46 ASN A OD1  1  
ATOM 713   N ND2  . ASN A 1 46 ? 1.824   0.037   -12.423 1.00 0.61 ? 46 ASN A ND2  1  
ATOM 714   H H    . ASN A 1 46 ? 5.591   1.722   -15.657 1.00 0.61 ? 46 ASN A H    1  
ATOM 715   H HA   . ASN A 1 46 ? 4.332   1.826   -13.662 1.00 0.61 ? 46 ASN A HA   1  
ATOM 716   H HB2  . ASN A 1 46 ? 3.212   0.071   -15.375 1.00 0.61 ? 46 ASN A HB2  1  
ATOM 717   H HB3  . ASN A 1 46 ? 3.538   -1.020  -14.027 1.00 0.61 ? 46 ASN A HB3  1  
ATOM 718   H HD21 . ASN A 1 46 ? 2.337   -0.712  -12.054 1.00 0.61 ? 46 ASN A HD21 1  
ATOM 719   H HD22 . ASN A 1 46 ? 1.049   0.387   -11.937 1.00 0.61 ? 46 ASN A HD22 1  
ATOM 720   N N    . ARG A 1 47 ? 6.657   0.282   -12.736 1.00 0.52 ? 47 ARG A N    1  
ATOM 721   C CA   . ARG A 1 47 ? 7.424   -0.350  -11.626 1.00 0.52 ? 47 ARG A CA   1  
ATOM 722   C C    . ARG A 1 47 ? 7.538   0.635   -10.461 1.00 0.52 ? 47 ARG A C    1  
ATOM 723   O O    . ARG A 1 47 ? 8.100   1.704   -10.592 1.00 0.52 ? 47 ARG A O    1  
ATOM 724   C CB   . ARG A 1 47 ? 8.825   -0.720  -12.118 1.00 0.52 ? 47 ARG A CB   1  
ATOM 725   C CG   . ARG A 1 47 ? 8.740   -1.951  -13.023 1.00 0.52 ? 47 ARG A CG   1  
ATOM 726   C CD   . ARG A 1 47 ? 8.526   -3.200  -12.168 1.00 0.52 ? 47 ARG A CD   1  
ATOM 727   N NE   . ARG A 1 47 ? 9.846   -3.733  -11.726 1.00 0.52 ? 47 ARG A NE   1  
ATOM 728   C CZ   . ARG A 1 47 ? 9.900   -4.699  -10.851 1.00 0.52 ? 47 ARG A CZ   1  
ATOM 729   N NH1  . ARG A 1 47 ? 9.426   -5.877  -11.150 1.00 0.52 ? 47 ARG A NH1  1  
ATOM 730   N NH2  . ARG A 1 47 ? 10.428  -4.487  -9.676  1.00 0.52 ? 47 ARG A NH2  1  
ATOM 731   H H    . ARG A 1 47 ? 7.127   0.790   -13.429 1.00 0.52 ? 47 ARG A H    1  
ATOM 732   H HA   . ARG A 1 47 ? 6.911   -1.241  -11.295 1.00 0.52 ? 47 ARG A HA   1  
ATOM 733   H HB2  . ARG A 1 47 ? 9.241   0.108   -12.673 1.00 0.52 ? 47 ARG A HB2  1  
ATOM 734   H HB3  . ARG A 1 47 ? 9.458   -0.941  -11.273 1.00 0.52 ? 47 ARG A HB3  1  
ATOM 735   H HG2  . ARG A 1 47 ? 7.912   -1.837  -13.709 1.00 0.52 ? 47 ARG A HG2  1  
ATOM 736   H HG3  . ARG A 1 47 ? 9.659   -2.052  -13.581 1.00 0.52 ? 47 ARG A HG3  1  
ATOM 737   H HD2  . ARG A 1 47 ? 7.932   -2.947  -11.302 1.00 0.52 ? 47 ARG A HD2  1  
ATOM 738   H HD3  . ARG A 1 47 ? 8.012   -3.952  -12.749 1.00 0.52 ? 47 ARG A HD3  1  
ATOM 739   H HE   . ARG A 1 47 ? 10.673  -3.356  -12.092 1.00 0.52 ? 47 ARG A HE   1  
ATOM 740   H HH11 . ARG A 1 47 ? 9.022   -6.040  -12.050 1.00 0.52 ? 47 ARG A HH11 1  
ATOM 741   H HH12 . ARG A 1 47 ? 9.467   -6.618  -10.480 1.00 0.52 ? 47 ARG A HH12 1  
ATOM 742   H HH21 . ARG A 1 47 ? 10.791  -3.584  -9.447  1.00 0.52 ? 47 ARG A HH21 1  
ATOM 743   H HH22 . ARG A 1 47 ? 10.470  -5.228  -9.006  1.00 0.52 ? 47 ARG A HH22 1  
ATOM 744   N N    . GLN A 1 48 ? 7.008   0.283   -9.321  1.00 0.45 ? 48 GLN A N    1  
ATOM 745   C CA   . GLN A 1 48 ? 7.085   1.201   -8.149  1.00 0.45 ? 48 GLN A CA   1  
ATOM 746   C C    . GLN A 1 48 ? 8.221   0.754   -7.227  1.00 0.45 ? 48 GLN A C    1  
ATOM 747   O O    . GLN A 1 48 ? 8.486   -0.422  -7.076  1.00 0.45 ? 48 GLN A O    1  
ATOM 748   C CB   . GLN A 1 48 ? 5.761   1.162   -7.383  1.00 0.45 ? 48 GLN A CB   1  
ATOM 749   C CG   . GLN A 1 48 ? 4.769   2.131   -8.028  1.00 0.45 ? 48 GLN A CG   1  
ATOM 750   C CD   . GLN A 1 48 ? 3.670   1.341   -8.740  1.00 0.45 ? 48 GLN A CD   1  
ATOM 751   O OE1  . GLN A 1 48 ? 3.950   0.522   -9.593  1.00 0.45 ? 48 GLN A OE1  1  
ATOM 752   N NE2  . GLN A 1 48 ? 2.422   1.553   -8.424  1.00 0.45 ? 48 GLN A NE2  1  
ATOM 753   H H    . GLN A 1 48 ? 6.558   -0.582  -9.236  1.00 0.45 ? 48 GLN A H    1  
ATOM 754   H HA   . GLN A 1 48 ? 7.274   2.208   -8.492  1.00 0.45 ? 48 GLN A HA   1  
ATOM 755   H HB2  . GLN A 1 48 ? 5.357   0.160   -7.414  1.00 0.45 ? 48 GLN A HB2  1  
ATOM 756   H HB3  . GLN A 1 48 ? 5.930   1.452   -6.358  1.00 0.45 ? 48 GLN A HB3  1  
ATOM 757   H HG2  . GLN A 1 48 ? 4.328   2.755   -7.264  1.00 0.45 ? 48 GLN A HG2  1  
ATOM 758   H HG3  . GLN A 1 48 ? 5.285   2.751   -8.745  1.00 0.45 ? 48 GLN A HG3  1  
ATOM 759   H HE21 . GLN A 1 48 ? 2.196   2.213   -7.736  1.00 0.45 ? 48 GLN A HE21 1  
ATOM 760   H HE22 . GLN A 1 48 ? 1.710   1.051   -8.874  1.00 0.45 ? 48 GLN A HE22 1  
ATOM 761   N N    . VAL A 1 49 ? 8.894   1.685   -6.606  1.00 0.37 ? 49 VAL A N    1  
ATOM 762   C CA   . VAL A 1 49 ? 10.012  1.312   -5.694  1.00 0.37 ? 49 VAL A CA   1  
ATOM 763   C C    . VAL A 1 49 ? 9.976   2.207   -4.453  1.00 0.37 ? 49 VAL A C    1  
ATOM 764   O O    . VAL A 1 49 ? 9.554   3.346   -4.509  1.00 0.37 ? 49 VAL A O    1  
ATOM 765   C CB   . VAL A 1 49 ? 11.346  1.499   -6.418  1.00 0.37 ? 49 VAL A CB   1  
ATOM 766   C CG1  . VAL A 1 49 ? 12.493  1.380   -5.414  1.00 0.37 ? 49 VAL A CG1  1  
ATOM 767   C CG2  . VAL A 1 49 ? 11.495  0.420   -7.494  1.00 0.37 ? 49 VAL A CG2  1  
ATOM 768   H H    . VAL A 1 49 ? 8.664   2.628   -6.740  1.00 0.37 ? 49 VAL A H    1  
ATOM 769   H HA   . VAL A 1 49 ? 9.905   0.280   -5.397  1.00 0.37 ? 49 VAL A HA   1  
ATOM 770   H HB   . VAL A 1 49 ? 11.371  2.475   -6.880  1.00 0.37 ? 49 VAL A HB   1  
ATOM 771   H HG11 . VAL A 1 49 ? 12.344  0.505   -4.800  1.00 0.37 ? 49 VAL A HG11 1  
ATOM 772   H HG12 . VAL A 1 49 ? 13.429  1.291   -5.947  1.00 0.37 ? 49 VAL A HG12 1  
ATOM 773   H HG13 . VAL A 1 49 ? 12.518  2.260   -4.789  1.00 0.37 ? 49 VAL A HG13 1  
ATOM 774   H HG21 . VAL A 1 49 ? 10.595  0.375   -8.086  1.00 0.37 ? 49 VAL A HG21 1  
ATOM 775   H HG22 . VAL A 1 49 ? 12.335  0.660   -8.130  1.00 0.37 ? 49 VAL A HG22 1  
ATOM 776   H HG23 . VAL A 1 49 ? 11.664  -0.537  -7.021  1.00 0.37 ? 49 VAL A HG23 1  
ATOM 777   N N    . CYS A 1 50 ? 10.412  1.701   -3.332  1.00 0.29 ? 50 CYS A N    1  
ATOM 778   C CA   . CYS A 1 50 ? 10.402  2.524   -2.090  1.00 0.29 ? 50 CYS A CA   1  
ATOM 779   C C    . CYS A 1 50 ? 11.769  3.185   -1.903  1.00 0.29 ? 50 CYS A C    1  
ATOM 780   O O    . CYS A 1 50 ? 12.798  2.552   -2.030  1.00 0.29 ? 50 CYS A O    1  
ATOM 781   C CB   . CYS A 1 50 ? 10.099  1.630   -0.887  1.00 0.29 ? 50 CYS A CB   1  
ATOM 782   S SG   . CYS A 1 50 ? 8.623   0.639   -1.229  1.00 0.29 ? 50 CYS A SG   1  
ATOM 783   H H    . CYS A 1 50 ? 10.748  0.781   -3.308  1.00 0.29 ? 50 CYS A H    1  
ATOM 784   H HA   . CYS A 1 50 ? 9.642   3.287   -2.171  1.00 0.29 ? 50 CYS A HA   1  
ATOM 785   H HB2  . CYS A 1 50 ? 10.939  0.974   -0.707  1.00 0.29 ? 50 CYS A HB2  1  
ATOM 786   H HB3  . CYS A 1 50 ? 9.927   2.243   -0.016  1.00 0.29 ? 50 CYS A HB3  1  
ATOM 787   N N    . ALA A 1 51 ? 11.787  4.454   -1.600  1.00 0.23 ? 51 ALA A N    1  
ATOM 788   C CA   . ALA A 1 51 ? 13.086  5.153   -1.401  1.00 0.23 ? 51 ALA A CA   1  
ATOM 789   C C    . ALA A 1 51 ? 12.971  6.111   -0.214  1.00 0.23 ? 51 ALA A C    1  
ATOM 790   O O    . ALA A 1 51 ? 11.976  6.787   -0.044  1.00 0.23 ? 51 ALA A O    1  
ATOM 791   C CB   . ALA A 1 51 ? 13.437  5.945   -2.663  1.00 0.23 ? 51 ALA A CB   1  
ATOM 792   H H    . ALA A 1 51 ? 10.945  4.945   -1.500  1.00 0.23 ? 51 ALA A H    1  
ATOM 793   H HA   . ALA A 1 51 ? 13.861  4.428   -1.204  1.00 0.23 ? 51 ALA A HA   1  
ATOM 794   H HB1  . ALA A 1 51 ? 13.408  5.288   -3.520  1.00 0.23 ? 51 ALA A HB1  1  
ATOM 795   H HB2  . ALA A 1 51 ? 12.722  6.743   -2.798  1.00 0.23 ? 51 ALA A HB2  1  
ATOM 796   H HB3  . ALA A 1 51 ? 14.429  6.362   -2.563  1.00 0.23 ? 51 ALA A HB3  1  
ATOM 797   N N    . ASN A 1 52 ? 13.982  6.176   0.609   1.00 0.26 ? 52 ASN A N    1  
ATOM 798   C CA   . ASN A 1 52 ? 13.926  7.089   1.783   1.00 0.26 ? 52 ASN A CA   1  
ATOM 799   C C    . ASN A 1 52 ? 14.486  8.460   1.388   1.00 0.26 ? 52 ASN A C    1  
ATOM 800   O O    . ASN A 1 52 ? 15.397  8.547   0.589   1.00 0.26 ? 52 ASN A O    1  
ATOM 801   C CB   . ASN A 1 52 ? 14.763  6.506   2.924   1.00 0.26 ? 52 ASN A CB   1  
ATOM 802   C CG   . ASN A 1 52 ? 14.059  6.762   4.257   1.00 0.26 ? 52 ASN A CG   1  
ATOM 803   O OD1  . ASN A 1 52 ? 12.851  6.668   4.348   1.00 0.26 ? 52 ASN A OD1  1  
ATOM 804   N ND2  . ASN A 1 52 ? 14.768  7.085   5.304   1.00 0.26 ? 52 ASN A ND2  1  
ATOM 805   H H    . ASN A 1 52 ? 14.776  5.623   0.454   1.00 0.26 ? 52 ASN A H    1  
ATOM 806   H HA   . ASN A 1 52 ? 12.901  7.196   2.107   1.00 0.26 ? 52 ASN A HA   1  
ATOM 807   H HB2  . ASN A 1 52 ? 14.879  5.442   2.776   1.00 0.26 ? 52 ASN A HB2  1  
ATOM 808   H HB3  . ASN A 1 52 ? 15.734  6.977   2.936   1.00 0.26 ? 52 ASN A HB3  1  
ATOM 809   H HD21 . ASN A 1 52 ? 15.743  7.162   5.231   1.00 0.26 ? 52 ASN A HD21 1  
ATOM 810   H HD22 . ASN A 1 52 ? 14.327  7.252   6.163   1.00 0.26 ? 52 ASN A HD22 1  
ATOM 811   N N    . PRO A 1 53 ? 13.920  9.492   1.961   1.00 0.30 ? 53 PRO A N    1  
ATOM 812   C CA   . PRO A 1 53 ? 14.338  10.879  1.691   1.00 0.30 ? 53 PRO A CA   1  
ATOM 813   C C    . PRO A 1 53 ? 15.623  11.209  2.456   1.00 0.30 ? 53 PRO A C    1  
ATOM 814   O O    . PRO A 1 53 ? 16.106  12.324  2.426   1.00 0.30 ? 53 PRO A O    1  
ATOM 815   C CB   . PRO A 1 53 ? 13.163  11.715  2.207   1.00 0.30 ? 53 PRO A CB   1  
ATOM 816   C CG   . PRO A 1 53 ? 12.418  10.831  3.235   1.00 0.30 ? 53 PRO A CG   1  
ATOM 817   C CD   . PRO A 1 53 ? 12.812  9.374   2.931   1.00 0.30 ? 53 PRO A CD   1  
ATOM 818   H HA   . PRO A 1 53 ? 14.469  11.039  0.633   1.00 0.30 ? 53 PRO A HA   1  
ATOM 819   H HB2  . PRO A 1 53 ? 13.532  12.615  2.682   1.00 0.30 ? 53 PRO A HB2  1  
ATOM 820   H HB3  . PRO A 1 53 ? 12.501  11.966  1.395   1.00 0.30 ? 53 PRO A HB3  1  
ATOM 821   H HG2  . PRO A 1 53 ? 12.720  11.099  4.239   1.00 0.30 ? 53 PRO A HG2  1  
ATOM 822   H HG3  . PRO A 1 53 ? 11.352  10.952  3.123   1.00 0.30 ? 53 PRO A HG3  1  
ATOM 823   H HD2  . PRO A 1 53 ? 13.145  8.878   3.832   1.00 0.30 ? 53 PRO A HD2  1  
ATOM 824   H HD3  . PRO A 1 53 ? 11.984  8.842   2.488   1.00 0.30 ? 53 PRO A HD3  1  
ATOM 825   N N    . GLU A 1 54 ? 16.180  10.248  3.140   1.00 0.43 ? 54 GLU A N    1  
ATOM 826   C CA   . GLU A 1 54 ? 17.431  10.507  3.906   1.00 0.43 ? 54 GLU A CA   1  
ATOM 827   C C    . GLU A 1 54 ? 18.633  10.020  3.096   1.00 0.43 ? 54 GLU A C    1  
ATOM 828   O O    . GLU A 1 54 ? 19.679  9.718   3.638   1.00 0.43 ? 54 GLU A O    1  
ATOM 829   C CB   . GLU A 1 54 ? 17.378  9.760   5.240   1.00 0.43 ? 54 GLU A CB   1  
ATOM 830   C CG   . GLU A 1 54 ? 16.122  10.175  6.009   1.00 0.43 ? 54 GLU A CG   1  
ATOM 831   C CD   . GLU A 1 54 ? 16.261  9.766   7.475   1.00 0.43 ? 54 GLU A CD   1  
ATOM 832   O OE1  . GLU A 1 54 ? 16.934  8.782   7.735   1.00 0.43 ? 54 GLU A OE1  1  
ATOM 833   O OE2  . GLU A 1 54 ? 15.693  10.444  8.316   1.00 0.43 ? 54 GLU A OE2  1  
ATOM 834   H H    . GLU A 1 54 ? 15.775  9.356   3.152   1.00 0.43 ? 54 GLU A H    1  
ATOM 835   H HA   . GLU A 1 54 ? 17.527  11.567  4.091   1.00 0.43 ? 54 GLU A HA   1  
ATOM 836   H HB2  . GLU A 1 54 ? 17.352  8.696   5.055   1.00 0.43 ? 54 GLU A HB2  1  
ATOM 837   H HB3  . GLU A 1 54 ? 18.252  10.003  5.825   1.00 0.43 ? 54 GLU A HB3  1  
ATOM 838   H HG2  . GLU A 1 54 ? 15.998  11.247  5.943   1.00 0.43 ? 54 GLU A HG2  1  
ATOM 839   H HG3  . GLU A 1 54 ? 15.259  9.687   5.581   1.00 0.43 ? 54 GLU A HG3  1  
ATOM 840   N N    . LYS A 1 55 ? 18.495  9.940   1.801   1.00 0.47 ? 55 LYS A N    1  
ATOM 841   C CA   . LYS A 1 55 ? 19.630  9.472   0.957   1.00 0.47 ? 55 LYS A CA   1  
ATOM 842   C C    . LYS A 1 55 ? 20.306  10.677  0.300   1.00 0.47 ? 55 LYS A C    1  
ATOM 843   O O    . LYS A 1 55 ? 19.986  11.813  0.585   1.00 0.47 ? 55 LYS A O    1  
ATOM 844   C CB   . LYS A 1 55 ? 19.105  8.528   -0.127  1.00 0.47 ? 55 LYS A CB   1  
ATOM 845   C CG   . LYS A 1 55 ? 19.353  7.079   0.293   1.00 0.47 ? 55 LYS A CG   1  
ATOM 846   C CD   . LYS A 1 55 ? 20.810  6.707   0.011   1.00 0.47 ? 55 LYS A CD   1  
ATOM 847   C CE   . LYS A 1 55 ? 20.942  5.185   -0.074  1.00 0.47 ? 55 LYS A CE   1  
ATOM 848   N NZ   . LYS A 1 55 ? 20.942  4.611   1.301   1.00 0.47 ? 55 LYS A NZ   1  
ATOM 849   H H    . LYS A 1 55 ? 17.644  10.188  1.383   1.00 0.47 ? 55 LYS A H    1  
ATOM 850   H HA   . LYS A 1 55 ? 20.346  8.949   1.574   1.00 0.47 ? 55 LYS A HA   1  
ATOM 851   H HB2  . LYS A 1 55 ? 18.045  8.689   -0.261  1.00 0.47 ? 55 LYS A HB2  1  
ATOM 852   H HB3  . LYS A 1 55 ? 19.619  8.726   -1.056  1.00 0.47 ? 55 LYS A HB3  1  
ATOM 853   H HG2  . LYS A 1 55 ? 19.151  6.971   1.349   1.00 0.47 ? 55 LYS A HG2  1  
ATOM 854   H HG3  . LYS A 1 55 ? 18.702  6.425   -0.267  1.00 0.47 ? 55 LYS A HG3  1  
ATOM 855   H HD2  . LYS A 1 55 ? 21.119  7.149   -0.926  1.00 0.47 ? 55 LYS A HD2  1  
ATOM 856   H HD3  . LYS A 1 55 ? 21.437  7.078   0.808   1.00 0.47 ? 55 LYS A HD3  1  
ATOM 857   H HE2  . LYS A 1 55 ? 20.111  4.782   -0.633  1.00 0.47 ? 55 LYS A HE2  1  
ATOM 858   H HE3  . LYS A 1 55 ? 21.867  4.931   -0.570  1.00 0.47 ? 55 LYS A HE3  1  
ATOM 859   H HZ1  . LYS A 1 55 ? 21.376  5.287   1.961   1.00 0.47 ? 55 LYS A HZ1  1  
ATOM 860   H HZ2  . LYS A 1 55 ? 19.963  4.420   1.597   1.00 0.47 ? 55 LYS A HZ2  1  
ATOM 861   H HZ3  . LYS A 1 55 ? 21.485  3.723   1.306   1.00 0.47 ? 55 LYS A HZ3  1  
ATOM 862   N N    . LYS A 1 56 ? 21.241  10.438  -0.579  1.00 0.58 ? 56 LYS A N    1  
ATOM 863   C CA   . LYS A 1 56 ? 21.936  11.569  -1.253  1.00 0.58 ? 56 LYS A CA   1  
ATOM 864   C C    . LYS A 1 56 ? 21.400  11.720  -2.678  1.00 0.58 ? 56 LYS A C    1  
ATOM 865   O O    . LYS A 1 56 ? 21.353  12.805  -3.223  1.00 0.58 ? 56 LYS A O    1  
ATOM 866   C CB   . LYS A 1 56 ? 23.440  11.288  -1.303  1.00 0.58 ? 56 LYS A CB   1  
ATOM 867   C CG   . LYS A 1 56 ? 23.703  10.077  -2.199  1.00 0.58 ? 56 LYS A CG   1  
ATOM 868   C CD   . LYS A 1 56 ? 25.197  9.992   -2.519  1.00 0.58 ? 56 LYS A CD   1  
ATOM 869   C CE   . LYS A 1 56 ? 25.598  8.526   -2.698  1.00 0.58 ? 56 LYS A CE   1  
ATOM 870   N NZ   . LYS A 1 56 ? 27.084  8.417   -2.730  1.00 0.58 ? 56 LYS A NZ   1  
ATOM 871   H H    . LYS A 1 56 ? 21.486  9.514   -0.796  1.00 0.58 ? 56 LYS A H    1  
ATOM 872   H HA   . LYS A 1 56 ? 21.758  12.481  -0.703  1.00 0.58 ? 56 LYS A HA   1  
ATOM 873   H HB2  . LYS A 1 56 ? 23.955  12.151  -1.700  1.00 0.58 ? 56 LYS A HB2  1  
ATOM 874   H HB3  . LYS A 1 56 ? 23.801  11.081  -0.306  1.00 0.58 ? 56 LYS A HB3  1  
ATOM 875   H HG2  . LYS A 1 56 ? 23.391  9.177   -1.689  1.00 0.58 ? 56 LYS A HG2  1  
ATOM 876   H HG3  . LYS A 1 56 ? 23.146  10.181  -3.118  1.00 0.58 ? 56 LYS A HG3  1  
ATOM 877   H HD2  . LYS A 1 56 ? 25.401  10.535  -3.431  1.00 0.58 ? 56 LYS A HD2  1  
ATOM 878   H HD3  . LYS A 1 56 ? 25.764  10.422  -1.708  1.00 0.58 ? 56 LYS A HD3  1  
ATOM 879   H HE2  . LYS A 1 56 ? 25.212  7.944   -1.873  1.00 0.58 ? 56 LYS A HE2  1  
ATOM 880   H HE3  . LYS A 1 56 ? 25.188  8.151   -3.624  1.00 0.58 ? 56 LYS A HE3  1  
ATOM 881   H HZ1  . LYS A 1 56 ? 27.497  9.138   -2.105  1.00 0.58 ? 56 LYS A HZ1  1  
ATOM 882   H HZ2  . LYS A 1 56 ? 27.369  7.472   -2.407  1.00 0.58 ? 56 LYS A HZ2  1  
ATOM 883   H HZ3  . LYS A 1 56 ? 27.421  8.565   -3.702  1.00 0.58 ? 56 LYS A HZ3  1  
ATOM 884   N N    . TRP A 1 57 ? 20.993  10.639  -3.285  1.00 0.41 ? 57 TRP A N    1  
ATOM 885   C CA   . TRP A 1 57 ? 20.460  10.719  -4.674  1.00 0.41 ? 57 TRP A CA   1  
ATOM 886   C C    . TRP A 1 57 ? 18.932  10.798  -4.629  1.00 0.41 ? 57 TRP A C    1  
ATOM 887   O O    . TRP A 1 57 ? 18.305  11.360  -5.505  1.00 0.41 ? 57 TRP A O    1  
ATOM 888   C CB   . TRP A 1 57 ? 20.883  9.474   -5.455  1.00 0.41 ? 57 TRP A CB   1  
ATOM 889   C CG   . TRP A 1 57 ? 20.289  8.259   -4.817  1.00 0.41 ? 57 TRP A CG   1  
ATOM 890   C CD1  . TRP A 1 57 ? 20.913  7.475   -3.908  1.00 0.41 ? 57 TRP A CD1  1  
ATOM 891   C CD2  . TRP A 1 57 ? 18.969  7.679   -5.022  1.00 0.41 ? 57 TRP A CD2  1  
ATOM 892   N NE1  . TRP A 1 57 ? 20.059  6.450   -3.542  1.00 0.41 ? 57 TRP A NE1  1  
ATOM 893   C CE2  . TRP A 1 57 ? 18.848  6.532   -4.201  1.00 0.41 ? 57 TRP A CE2  1  
ATOM 894   C CE3  . TRP A 1 57 ? 17.874  8.032   -5.831  1.00 0.41 ? 57 TRP A CE3  1  
ATOM 895   C CZ2  . TRP A 1 57 ? 17.684  5.764   -4.184  1.00 0.41 ? 57 TRP A CZ2  1  
ATOM 896   C CZ3  . TRP A 1 57 ? 16.701  7.261   -5.817  1.00 0.41 ? 57 TRP A CZ3  1  
ATOM 897   C CH2  . TRP A 1 57 ? 16.606  6.128   -4.996  1.00 0.41 ? 57 TRP A CH2  1  
ATOM 898   H H    . TRP A 1 57 ? 21.039  9.773   -2.828  1.00 0.41 ? 57 TRP A H    1  
ATOM 899   H HA   . TRP A 1 57 ? 20.852  11.601  -5.161  1.00 0.41 ? 57 TRP A HA   1  
ATOM 900   H HB2  . TRP A 1 57 ? 20.534  9.552   -6.475  1.00 0.41 ? 57 TRP A HB2  1  
ATOM 901   H HB3  . TRP A 1 57 ? 21.961  9.394   -5.449  1.00 0.41 ? 57 TRP A HB3  1  
ATOM 902   H HD1  . TRP A 1 57 ? 21.913  7.625   -3.530  1.00 0.41 ? 57 TRP A HD1  1  
ATOM 903   H HE1  . TRP A 1 57 ? 20.268  5.743   -2.895  1.00 0.41 ? 57 TRP A HE1  1  
ATOM 904   H HE3  . TRP A 1 57 ? 17.937  8.902   -6.468  1.00 0.41 ? 57 TRP A HE3  1  
ATOM 905   H HZ2  . TRP A 1 57 ? 17.617  4.892   -3.550  1.00 0.41 ? 57 TRP A HZ2  1  
ATOM 906   H HZ3  . TRP A 1 57 ? 15.867  7.541   -6.443  1.00 0.41 ? 57 TRP A HZ3  1  
ATOM 907   H HH2  . TRP A 1 57 ? 15.702  5.539   -4.989  1.00 0.41 ? 57 TRP A HH2  1  
ATOM 908   N N    . VAL A 1 58 ? 18.329  10.240  -3.615  1.00 0.32 ? 58 VAL A N    1  
ATOM 909   C CA   . VAL A 1 58 ? 16.843  10.285  -3.517  1.00 0.32 ? 58 VAL A CA   1  
ATOM 910   C C    . VAL A 1 58 ? 16.374  11.741  -3.574  1.00 0.32 ? 58 VAL A C    1  
ATOM 911   O O    . VAL A 1 58 ? 15.695  12.149  -4.495  1.00 0.32 ? 58 VAL A O    1  
ATOM 912   C CB   . VAL A 1 58 ? 16.400  9.657   -2.195  1.00 0.32 ? 58 VAL A CB   1  
ATOM 913   C CG1  . VAL A 1 58 ? 14.881  9.777   -2.055  1.00 0.32 ? 58 VAL A CG1  1  
ATOM 914   C CG2  . VAL A 1 58 ? 16.798  8.179   -2.177  1.00 0.32 ? 58 VAL A CG2  1  
ATOM 915   H H    . VAL A 1 58 ? 18.853  9.792   -2.919  1.00 0.32 ? 58 VAL A H    1  
ATOM 916   H HA   . VAL A 1 58 ? 16.411  9.736   -4.340  1.00 0.32 ? 58 VAL A HA   1  
ATOM 917   H HB   . VAL A 1 58 ? 16.878  10.170  -1.373  1.00 0.32 ? 58 VAL A HB   1  
ATOM 918   H HG11 . VAL A 1 58 ? 14.413  9.529   -2.996  1.00 0.32 ? 58 VAL A HG11 1  
ATOM 919   H HG12 . VAL A 1 58 ? 14.535  9.098   -1.290  1.00 0.32 ? 58 VAL A HG12 1  
ATOM 920   H HG13 . VAL A 1 58 ? 14.625  10.789  -1.781  1.00 0.32 ? 58 VAL A HG13 1  
ATOM 921   H HG21 . VAL A 1 58 ? 17.869  8.093   -2.276  1.00 0.32 ? 58 VAL A HG21 1  
ATOM 922   H HG22 . VAL A 1 58 ? 16.485  7.733   -1.243  1.00 0.32 ? 58 VAL A HG22 1  
ATOM 923   H HG23 . VAL A 1 58 ? 16.317  7.667   -2.998  1.00 0.32 ? 58 VAL A HG23 1  
ATOM 924   N N    . ARG A 1 59 ? 16.733  12.529  -2.597  1.00 0.34 ? 59 ARG A N    1  
ATOM 925   C CA   . ARG A 1 59 ? 16.310  13.957  -2.600  1.00 0.34 ? 59 ARG A CA   1  
ATOM 926   C C    . ARG A 1 59 ? 16.797  14.623  -3.887  1.00 0.34 ? 59 ARG A C    1  
ATOM 927   O O    . ARG A 1 59 ? 16.264  15.624  -4.321  1.00 0.34 ? 59 ARG A O    1  
ATOM 928   C CB   . ARG A 1 59 ? 16.916  14.673  -1.391  1.00 0.34 ? 59 ARG A CB   1  
ATOM 929   C CG   . ARG A 1 59 ? 16.364  16.097  -1.312  1.00 0.34 ? 59 ARG A CG   1  
ATOM 930   C CD   . ARG A 1 59 ? 17.500  17.070  -0.994  1.00 0.34 ? 59 ARG A CD   1  
ATOM 931   N NE   . ARG A 1 59 ? 18.018  17.659  -2.262  1.00 0.34 ? 59 ARG A NE   1  
ATOM 932   C CZ   . ARG A 1 59 ? 19.207  18.196  -2.294  1.00 0.34 ? 59 ARG A CZ   1  
ATOM 933   N NH1  . ARG A 1 59 ? 19.683  18.791  -1.235  1.00 0.34 ? 59 ARG A NH1  1  
ATOM 934   N NH2  . ARG A 1 59 ? 19.920  18.139  -3.386  1.00 0.34 ? 59 ARG A NH2  1  
ATOM 935   H H    . ARG A 1 59 ? 17.283  12.182  -1.863  1.00 0.34 ? 59 ARG A H    1  
ATOM 936   H HA   . ARG A 1 59 ? 15.232  14.013  -2.550  1.00 0.34 ? 59 ARG A HA   1  
ATOM 937   H HB2  . ARG A 1 59 ? 16.662  14.135  -0.490  1.00 0.34 ? 59 ARG A HB2  1  
ATOM 938   H HB3  . ARG A 1 59 ? 17.990  14.711  -1.497  1.00 0.34 ? 59 ARG A HB3  1  
ATOM 939   H HG2  . ARG A 1 59 ? 15.915  16.362  -2.258  1.00 0.34 ? 59 ARG A HG2  1  
ATOM 940   H HG3  . ARG A 1 59 ? 15.619  16.151  -0.531  1.00 0.34 ? 59 ARG A HG3  1  
ATOM 941   H HD2  . ARG A 1 59 ? 17.132  17.859  -0.356  1.00 0.34 ? 59 ARG A HD2  1  
ATOM 942   H HD3  . ARG A 1 59 ? 18.297  16.542  -0.492  1.00 0.34 ? 59 ARG A HD3  1  
ATOM 943   H HE   . ARG A 1 59 ? 17.466  17.642  -3.071  1.00 0.34 ? 59 ARG A HE   1  
ATOM 944   H HH11 . ARG A 1 59 ? 19.136  18.835  -0.398  1.00 0.34 ? 59 ARG A HH11 1  
ATOM 945   H HH12 . ARG A 1 59 ? 20.594  19.204  -1.260  1.00 0.34 ? 59 ARG A HH12 1  
ATOM 946   H HH21 . ARG A 1 59 ? 19.555  17.683  -4.198  1.00 0.34 ? 59 ARG A HH21 1  
ATOM 947   H HH22 . ARG A 1 59 ? 20.830  18.551  -3.411  1.00 0.34 ? 59 ARG A HH22 1  
ATOM 948   N N    . GLU A 1 60 ? 17.808  14.072  -4.502  1.00 0.37 ? 60 GLU A N    1  
ATOM 949   C CA   . GLU A 1 60 ? 18.332  14.669  -5.762  1.00 0.37 ? 60 GLU A CA   1  
ATOM 950   C C    . GLU A 1 60 ? 17.309  14.463  -6.882  1.00 0.37 ? 60 GLU A C    1  
ATOM 951   O O    . GLU A 1 60 ? 17.121  15.315  -7.728  1.00 0.37 ? 60 GLU A O    1  
ATOM 952   C CB   . GLU A 1 60 ? 19.649  13.987  -6.138  1.00 0.37 ? 60 GLU A CB   1  
ATOM 953   C CG   . GLU A 1 60 ? 20.820  14.787  -5.567  1.00 0.37 ? 60 GLU A CG   1  
ATOM 954   C CD   . GLU A 1 60 ? 22.090  13.936  -5.611  1.00 0.37 ? 60 GLU A CD   1  
ATOM 955   O OE1  . GLU A 1 60 ? 22.309  13.284  -6.619  1.00 0.37 ? 60 GLU A OE1  1  
ATOM 956   O OE2  . GLU A 1 60 ? 22.822  13.949  -4.635  1.00 0.37 ? 60 GLU A OE2  1  
ATOM 957   H H    . GLU A 1 60 ? 18.222  13.265  -4.135  1.00 0.37 ? 60 GLU A H    1  
ATOM 958   H HA   . GLU A 1 60 ? 18.501  15.726  -5.618  1.00 0.37 ? 60 GLU A HA   1  
ATOM 959   H HB2  . GLU A 1 60 ? 19.663  12.985  -5.733  1.00 0.37 ? 60 GLU A HB2  1  
ATOM 960   H HB3  . GLU A 1 60 ? 19.736  13.941  -7.213  1.00 0.37 ? 60 GLU A HB3  1  
ATOM 961   H HG2  . GLU A 1 60 ? 20.965  15.681  -6.156  1.00 0.37 ? 60 GLU A HG2  1  
ATOM 962   H HG3  . GLU A 1 60 ? 20.606  15.059  -4.545  1.00 0.37 ? 60 GLU A HG3  1  
ATOM 963   N N    . TYR A 1 61 ? 16.648  13.339  -6.892  1.00 0.36 ? 61 TYR A N    1  
ATOM 964   C CA   . TYR A 1 61 ? 15.637  13.078  -7.956  1.00 0.36 ? 61 TYR A CA   1  
ATOM 965   C C    . TYR A 1 61 ? 14.382  13.905  -7.674  1.00 0.36 ? 61 TYR A C    1  
ATOM 966   O O    . TYR A 1 61 ? 13.866  14.582  -8.541  1.00 0.36 ? 61 TYR A O    1  
ATOM 967   C CB   . TYR A 1 61 ? 15.278  11.588  -7.964  1.00 0.36 ? 61 TYR A CB   1  
ATOM 968   C CG   . TYR A 1 61 ? 16.309  10.809  -8.754  1.00 0.36 ? 61 TYR A CG   1  
ATOM 969   C CD1  . TYR A 1 61 ? 17.502  11.422  -9.165  1.00 0.36 ? 61 TYR A CD1  1  
ATOM 970   C CD2  . TYR A 1 61 ? 16.069  9.467   -9.075  1.00 0.36 ? 61 TYR A CD2  1  
ATOM 971   C CE1  . TYR A 1 61 ? 18.450  10.694  -9.893  1.00 0.36 ? 61 TYR A CE1  1  
ATOM 972   C CE2  . TYR A 1 61 ? 17.018  8.739   -9.804  1.00 0.36 ? 61 TYR A CE2  1  
ATOM 973   C CZ   . TYR A 1 61 ? 18.207  9.353   -10.213 1.00 0.36 ? 61 TYR A CZ   1  
ATOM 974   O OH   . TYR A 1 61 ? 19.143  8.636   -10.931 1.00 0.36 ? 61 TYR A OH   1  
ATOM 975   H H    . TYR A 1 61 ? 16.814  12.665  -6.201  1.00 0.36 ? 61 TYR A H    1  
ATOM 976   H HA   . TYR A 1 61 ? 16.044  13.356  -8.917  1.00 0.36 ? 61 TYR A HA   1  
ATOM 977   H HB2  . TYR A 1 61 ? 15.251  11.221  -6.949  1.00 0.36 ? 61 TYR A HB2  1  
ATOM 978   H HB3  . TYR A 1 61 ? 14.306  11.457  -8.418  1.00 0.36 ? 61 TYR A HB3  1  
ATOM 979   H HD1  . TYR A 1 61 ? 17.689  12.457  -8.919  1.00 0.36 ? 61 TYR A HD1  1  
ATOM 980   H HD2  . TYR A 1 61 ? 15.151  8.993   -8.759  1.00 0.36 ? 61 TYR A HD2  1  
ATOM 981   H HE1  . TYR A 1 61 ? 19.368  11.167  -10.209 1.00 0.36 ? 61 TYR A HE1  1  
ATOM 982   H HE2  . TYR A 1 61 ? 16.831  7.705   -10.050 1.00 0.36 ? 61 TYR A HE2  1  
ATOM 983   H HH   . TYR A 1 61 ? 20.015  8.940   -10.669 1.00 0.36 ? 61 TYR A HH   1  
ATOM 984   N N    . ILE A 1 62 ? 13.888  13.859  -6.467  1.00 0.38 ? 62 ILE A N    1  
ATOM 985   C CA   . ILE A 1 62 ? 12.669  14.646  -6.133  1.00 0.38 ? 62 ILE A CA   1  
ATOM 986   C C    . ILE A 1 62 ? 12.902  16.113  -6.499  1.00 0.38 ? 62 ILE A C    1  
ATOM 987   O O    . ILE A 1 62 ? 12.079  16.744  -7.134  1.00 0.38 ? 62 ILE A O    1  
ATOM 988   C CB   . ILE A 1 62 ? 12.382  14.533  -4.635  1.00 0.38 ? 62 ILE A CB   1  
ATOM 989   C CG1  . ILE A 1 62 ? 11.868  13.127  -4.320  1.00 0.38 ? 62 ILE A CG1  1  
ATOM 990   C CG2  . ILE A 1 62 ? 11.322  15.563  -4.238  1.00 0.38 ? 62 ILE A CG2  1  
ATOM 991   C CD1  . ILE A 1 62 ? 12.791  12.462  -3.296  1.00 0.38 ? 62 ILE A CD1  1  
ATOM 992   H H    . ILE A 1 62 ? 14.320  13.308  -5.780  1.00 0.38 ? 62 ILE A H    1  
ATOM 993   H HA   . ILE A 1 62 ? 11.827  14.264  -6.691  1.00 0.38 ? 62 ILE A HA   1  
ATOM 994   H HB   . ILE A 1 62 ? 13.291  14.719  -4.079  1.00 0.38 ? 62 ILE A HB   1  
ATOM 995   H HG12 . ILE A 1 62 ? 10.868  13.191  -3.917  1.00 0.38 ? 62 ILE A HG12 1  
ATOM 996   H HG13 . ILE A 1 62 ? 11.854  12.538  -5.224  1.00 0.38 ? 62 ILE A HG13 1  
ATOM 997   H HG21 . ILE A 1 62 ? 10.973  16.078  -5.119  1.00 0.38 ? 62 ILE A HG21 1  
ATOM 998   H HG22 . ILE A 1 62 ? 10.493  15.061  -3.761  1.00 0.38 ? 62 ILE A HG22 1  
ATOM 999   H HG23 . ILE A 1 62 ? 11.753  16.276  -3.550  1.00 0.38 ? 62 ILE A HG23 1  
ATOM 1000  H HD11 . ILE A 1 62 ? 13.472  13.198  -2.896  1.00 0.38 ? 62 ILE A HD11 1  
ATOM 1001  H HD12 . ILE A 1 62 ? 12.198  12.047  -2.494  1.00 0.38 ? 62 ILE A HD12 1  
ATOM 1002  H HD13 . ILE A 1 62 ? 13.352  11.674  -3.775  1.00 0.38 ? 62 ILE A HD13 1  
ATOM 1003  N N    . ASN A 1 63 ? 14.020  16.659  -6.107  1.00 0.49 ? 63 ASN A N    1  
ATOM 1004  C CA   . ASN A 1 63 ? 14.311  18.082  -6.435  1.00 0.49 ? 63 ASN A CA   1  
ATOM 1005  C C    . ASN A 1 63 ? 14.476  18.227  -7.949  1.00 0.49 ? 63 ASN A C    1  
ATOM 1006  O O    . ASN A 1 63 ? 14.143  19.243  -8.526  1.00 0.49 ? 63 ASN A O    1  
ATOM 1007  C CB   . ASN A 1 63 ? 15.603  18.513  -5.737  1.00 0.49 ? 63 ASN A CB   1  
ATOM 1008  C CG   . ASN A 1 63 ? 16.060  19.862  -6.294  1.00 0.49 ? 63 ASN A CG   1  
ATOM 1009  O OD1  . ASN A 1 63 ? 15.269  20.772  -6.439  1.00 0.49 ? 63 ASN A OD1  1  
ATOM 1010  N ND2  . ASN A 1 63 ? 17.314  20.031  -6.613  1.00 0.49 ? 63 ASN A ND2  1  
ATOM 1011  H H    . ASN A 1 63 ? 14.671  16.130  -5.599  1.00 0.49 ? 63 ASN A H    1  
ATOM 1012  H HA   . ASN A 1 63 ? 13.495  18.704  -6.101  1.00 0.49 ? 63 ASN A HA   1  
ATOM 1013  H HB2  . ASN A 1 63 ? 15.424  18.602  -4.675  1.00 0.49 ? 63 ASN A HB2  1  
ATOM 1014  H HB3  . ASN A 1 63 ? 16.370  17.774  -5.912  1.00 0.49 ? 63 ASN A HB3  1  
ATOM 1015  H HD21 . ASN A 1 63 ? 17.953  19.297  -6.495  1.00 0.49 ? 63 ASN A HD21 1  
ATOM 1016  H HD22 . ASN A 1 63 ? 17.617  20.891  -6.970  1.00 0.49 ? 63 ASN A HD22 1  
ATOM 1017  N N    . SER A 1 64 ? 14.986  17.216  -8.597  1.00 0.55 ? 64 SER A N    1  
ATOM 1018  C CA   . SER A 1 64 ? 15.171  17.291  -10.074 1.00 0.55 ? 64 SER A CA   1  
ATOM 1019  C C    . SER A 1 64 ? 13.846  16.969  -10.769 1.00 0.55 ? 64 SER A C    1  
ATOM 1020  O O    . SER A 1 64 ? 13.712  17.113  -11.968 1.00 0.55 ? 64 SER A O    1  
ATOM 1021  C CB   . SER A 1 64 ? 16.233  16.280  -10.506 1.00 0.55 ? 64 SER A CB   1  
ATOM 1022  O OG   . SER A 1 64 ? 15.595  15.078  -10.921 1.00 0.55 ? 64 SER A OG   1  
ATOM 1023  H H    . SER A 1 64 ? 15.247  16.404  -8.112  1.00 0.55 ? 64 SER A H    1  
ATOM 1024  H HA   . SER A 1 64 ? 15.488  18.287  -10.347 1.00 0.55 ? 64 SER A HA   1  
ATOM 1025  H HB2  . SER A 1 64 ? 16.802  16.680  -11.329 1.00 0.55 ? 64 SER A HB2  1  
ATOM 1026  H HB3  . SER A 1 64 ? 16.897  16.078  -9.676  1.00 0.55 ? 64 SER A HB3  1  
ATOM 1027  H HG   . SER A 1 64 ? 16.277  14.458  -11.191 1.00 0.55 ? 64 SER A HG   1  
ATOM 1028  N N    . LEU A 1 65 ? 12.865  16.533  -10.025 1.00 0.53 ? 65 LEU A N    1  
ATOM 1029  C CA   . LEU A 1 65 ? 11.550  16.203  -10.643 1.00 0.53 ? 65 LEU A CA   1  
ATOM 1030  C C    . LEU A 1 65 ? 10.666  17.451  -10.656 1.00 0.53 ? 65 LEU A C    1  
ATOM 1031  O O    . LEU A 1 65 ? 10.204  17.885  -11.693 1.00 0.53 ? 65 LEU A O    1  
ATOM 1032  C CB   . LEU A 1 65 ? 10.867  15.104  -9.826  1.00 0.53 ? 65 LEU A CB   1  
ATOM 1033  C CG   . LEU A 1 65 ? 10.505  13.934  -10.741 1.00 0.53 ? 65 LEU A CG   1  
ATOM 1034  C CD1  . LEU A 1 65 ? 9.711   14.451  -11.942 1.00 0.53 ? 65 LEU A CD1  1  
ATOM 1035  C CD2  . LEU A 1 65 ? 11.786  13.257  -11.233 1.00 0.53 ? 65 LEU A CD2  1  
ATOM 1036  H H    . LEU A 1 65 ? 12.993  16.424  -9.060  1.00 0.53 ? 65 LEU A H    1  
ATOM 1037  H HA   . LEU A 1 65 ? 11.704  15.858  -11.654 1.00 0.53 ? 65 LEU A HA   1  
ATOM 1038  H HB2  . LEU A 1 65 ? 11.538  14.761  -9.051  1.00 0.53 ? 65 LEU A HB2  1  
ATOM 1039  H HB3  . LEU A 1 65 ? 9.968   15.497  -9.375  1.00 0.53 ? 65 LEU A HB3  1  
ATOM 1040  H HG   . LEU A 1 65 ? 9.905   13.221  -10.195 1.00 0.53 ? 65 LEU A HG   1  
ATOM 1041  H HD11 . LEU A 1 65 ? 9.545   15.513  -11.834 1.00 0.53 ? 65 LEU A HD11 1  
ATOM 1042  H HD12 . LEU A 1 65 ? 10.267  14.264  -12.850 1.00 0.53 ? 65 LEU A HD12 1  
ATOM 1043  H HD13 . LEU A 1 65 ? 8.760   13.942  -11.990 1.00 0.53 ? 65 LEU A HD13 1  
ATOM 1044  H HD21 . LEU A 1 65 ? 12.456  14.002  -11.634 1.00 0.53 ? 65 LEU A HD21 1  
ATOM 1045  H HD22 . LEU A 1 65 ? 12.264  12.751  -10.407 1.00 0.53 ? 65 LEU A HD22 1  
ATOM 1046  H HD23 . LEU A 1 65 ? 11.542  12.540  -12.002 1.00 0.53 ? 65 LEU A HD23 1  
ATOM 1047  N N    . GLU A 1 66 ? 10.427  18.032  -9.512  1.00 0.61 ? 66 GLU A N    1  
ATOM 1048  C CA   . GLU A 1 66 ? 9.572   19.252  -9.460  1.00 0.61 ? 66 GLU A CA   1  
ATOM 1049  C C    . GLU A 1 66 ? 10.449  20.495  -9.619  1.00 0.61 ? 66 GLU A C    1  
ATOM 1050  O O    . GLU A 1 66 ? 10.703  21.212  -8.673  1.00 0.61 ? 66 GLU A O    1  
ATOM 1051  C CB   . GLU A 1 66 ? 8.845   19.308  -8.115  1.00 0.61 ? 66 GLU A CB   1  
ATOM 1052  C CG   . GLU A 1 66 ? 7.989   18.052  -7.944  1.00 0.61 ? 66 GLU A CG   1  
ATOM 1053  C CD   . GLU A 1 66 ? 7.362   18.048  -6.548  1.00 0.61 ? 66 GLU A CD   1  
ATOM 1054  O OE1  . GLU A 1 66 ? 8.040   18.445  -5.614  1.00 0.61 ? 66 GLU A OE1  1  
ATOM 1055  O OE2  . GLU A 1 66 ? 6.214   17.649  -6.437  1.00 0.61 ? 66 GLU A OE2  1  
ATOM 1056  H H    . GLU A 1 66 ? 10.809  17.666  -8.687  1.00 0.61 ? 66 GLU A H    1  
ATOM 1057  H HA   . GLU A 1 66 ? 8.847   19.218  -10.260 1.00 0.61 ? 66 GLU A HA   1  
ATOM 1058  H HB2  . GLU A 1 66 ? 9.570   19.364  -7.316  1.00 0.61 ? 66 GLU A HB2  1  
ATOM 1059  H HB3  . GLU A 1 66 ? 8.209   20.181  -8.087  1.00 0.61 ? 66 GLU A HB3  1  
ATOM 1060  H HG2  . GLU A 1 66 ? 7.208   18.043  -8.690  1.00 0.61 ? 66 GLU A HG2  1  
ATOM 1061  H HG3  . GLU A 1 66 ? 8.608   17.176  -8.059  1.00 0.61 ? 66 GLU A HG3  1  
ATOM 1062  N N    . MET A 1 67 ? 10.913  20.757  -10.810 1.00 1.45 ? 67 MET A N    1  
ATOM 1063  C CA   . MET A 1 67 ? 11.773  21.955  -11.029 1.00 1.45 ? 67 MET A CA   1  
ATOM 1064  C C    . MET A 1 67 ? 10.896  23.206  -11.099 1.00 1.45 ? 67 MET A C    1  
ATOM 1065  O O    . MET A 1 67 ? 9.742   23.189  -10.722 1.00 1.45 ? 67 MET A O    1  
ATOM 1066  C CB   . MET A 1 67 ? 12.543  21.797  -12.341 1.00 1.45 ? 67 MET A CB   1  
ATOM 1067  C CG   . MET A 1 67 ? 14.047  21.815  -12.058 1.00 1.45 ? 67 MET A CG   1  
ATOM 1068  S SD   . MET A 1 67 ? 14.870  20.573  -13.086 1.00 1.45 ? 67 MET A SD   1  
ATOM 1069  C CE   . MET A 1 67 ? 16.188  21.641  -13.717 1.00 1.45 ? 67 MET A CE   1  
ATOM 1070  H H    . MET A 1 67 ? 10.697  20.166  -11.562 1.00 1.45 ? 67 MET A H    1  
ATOM 1071  H HA   . MET A 1 67 ? 12.471  22.050  -10.211 1.00 1.45 ? 67 MET A HA   1  
ATOM 1072  H HB2  . MET A 1 67 ? 12.275  20.858  -12.805 1.00 1.45 ? 67 MET A HB2  1  
ATOM 1073  H HB3  . MET A 1 67 ? 12.294  22.611  -13.005 1.00 1.45 ? 67 MET A HB3  1  
ATOM 1074  H HG2  . MET A 1 67 ? 14.444  22.793  -12.286 1.00 1.45 ? 67 MET A HG2  1  
ATOM 1075  H HG3  . MET A 1 67 ? 14.218  21.591  -11.015 1.00 1.45 ? 67 MET A HG3  1  
ATOM 1076  H HE1  . MET A 1 67 ? 15.810  22.641  -13.850 1.00 1.45 ? 67 MET A HE1  1  
ATOM 1077  H HE2  . MET A 1 67 ? 17.006  21.658  -13.010 1.00 1.45 ? 67 MET A HE2  1  
ATOM 1078  H HE3  . MET A 1 67 ? 16.534  21.259  -14.667 1.00 1.45 ? 67 MET A HE3  1  
ATOM 1079  N N    . SER A 1 68 ? 11.435  24.293  -11.581 1.00 2.84 ? 68 SER A N    1  
ATOM 1080  C CA   . SER A 1 68 ? 10.632  25.544  -11.676 1.00 2.84 ? 68 SER A CA   1  
ATOM 1081  C C    . SER A 1 68 ? 9.245   25.219  -12.233 1.00 2.84 ? 68 SER A C    1  
ATOM 1082  O O    . SER A 1 68 ? 9.147   24.293  -13.022 1.00 2.84 ? 68 SER A O    1  
ATOM 1083  C CB   . SER A 1 68 ? 11.336  26.533  -12.606 1.00 2.84 ? 68 SER A CB   1  
ATOM 1084  O OG   . SER A 1 68 ? 12.158  25.816  -13.518 1.00 2.84 ? 68 SER A OG   1  
ATOM 1085  O OXT  . SER A 1 68 ? 8.304   25.902  -11.862 1.00 2.84 ? 68 SER A OXT  1  
ATOM 1086  H H    . SER A 1 68 ? 12.368  24.286  -11.881 1.00 2.84 ? 68 SER A H    1  
ATOM 1087  H HA   . SER A 1 68 ? 10.532  25.983  -10.694 1.00 2.84 ? 68 SER A HA   1  
ATOM 1088  H HB2  . SER A 1 68 ? 10.602  27.097  -13.157 1.00 2.84 ? 68 SER A HB2  1  
ATOM 1089  H HB3  . SER A 1 68 ? 11.941  27.211  -12.017 1.00 2.84 ? 68 SER A HB3  1  
ATOM 1090  H HG   . SER A 1 68 ? 12.997  26.277  -13.586 1.00 2.84 ? 68 SER A HG   1  
ATOM 1091  N N    . SER B 1 1  ? 8.943   -12.757 3.961   1.00 5.93 ? 1  SER B N    1  
ATOM 1092  C CA   . SER B 1 1  ? 10.094  -12.256 3.158   1.00 5.93 ? 1  SER B CA   1  
ATOM 1093  C C    . SER B 1 1  ? 11.071  -11.513 4.074   1.00 5.93 ? 1  SER B C    1  
ATOM 1094  O O    . SER B 1 1  ? 10.680  -10.982 5.094   1.00 5.93 ? 1  SER B O    1  
ATOM 1095  C CB   . SER B 1 1  ? 9.583   -11.302 2.077   1.00 5.93 ? 1  SER B CB   1  
ATOM 1096  O OG   . SER B 1 1  ? 8.687   -11.999 1.221   1.00 5.93 ? 1  SER B OG   1  
ATOM 1097  H H1   . SER B 1 1  ? 8.573   -11.989 4.555   1.00 5.93 ? 1  SER B H1   1  
ATOM 1098  H H2   . SER B 1 1  ? 8.194   -13.094 3.322   1.00 5.93 ? 1  SER B H2   1  
ATOM 1099  H H3   . SER B 1 1  ? 9.259   -13.539 4.570   1.00 5.93 ? 1  SER B H3   1  
ATOM 1100  H HA   . SER B 1 1  ? 10.598  -13.091 2.694   1.00 5.93 ? 1  SER B HA   1  
ATOM 1101  H HB2  . SER B 1 1  ? 9.065   -10.477 2.537   1.00 5.93 ? 1  SER B HB2  1  
ATOM 1102  H HB3  . SER B 1 1  ? 10.422  -10.925 1.507   1.00 5.93 ? 1  SER B HB3  1  
ATOM 1103  H HG   . SER B 1 1  ? 8.694   -11.563 0.366   1.00 5.93 ? 1  SER B HG   1  
ATOM 1104  N N    . PRO B 1 2  ? 12.318  -11.501 3.678   1.00 3.89 ? 2  PRO B N    1  
ATOM 1105  C CA   . PRO B 1 2  ? 13.387  -10.832 4.440   1.00 3.89 ? 2  PRO B CA   1  
ATOM 1106  C C    . PRO B 1 2  ? 13.337  -9.318  4.213   1.00 3.89 ? 2  PRO B C    1  
ATOM 1107  O O    . PRO B 1 2  ? 13.282  -8.542  5.147   1.00 3.89 ? 2  PRO B O    1  
ATOM 1108  C CB   . PRO B 1 2  ? 14.671  -11.430 3.858   1.00 3.89 ? 2  PRO B CB   1  
ATOM 1109  C CG   . PRO B 1 2  ? 14.307  -11.959 2.449   1.00 3.89 ? 2  PRO B CG   1  
ATOM 1110  C CD   . PRO B 1 2  ? 12.778  -12.152 2.434   1.00 3.89 ? 2  PRO B CD   1  
ATOM 1111  H HA   . PRO B 1 2  ? 13.313  -11.065 5.489   1.00 3.89 ? 2  PRO B HA   1  
ATOM 1112  H HB2  . PRO B 1 2  ? 15.435  -10.668 3.786   1.00 3.89 ? 2  PRO B HB2  1  
ATOM 1113  H HB3  . PRO B 1 2  ? 15.013  -12.246 4.475   1.00 3.89 ? 2  PRO B HB3  1  
ATOM 1114  H HG2  . PRO B 1 2  ? 14.600  -11.239 1.698   1.00 3.89 ? 2  PRO B HG2  1  
ATOM 1115  H HG3  . PRO B 1 2  ? 14.795  -12.904 2.270   1.00 3.89 ? 2  PRO B HG3  1  
ATOM 1116  H HD2  . PRO B 1 2  ? 12.346  -11.668 1.567   1.00 3.89 ? 2  PRO B HD2  1  
ATOM 1117  H HD3  . PRO B 1 2  ? 12.528  -13.201 2.448   1.00 3.89 ? 2  PRO B HD3  1  
ATOM 1118  N N    . TYR B 1 3  ? 13.357  -8.892  2.979   1.00 2.56 ? 3  TYR B N    1  
ATOM 1119  C CA   . TYR B 1 3  ? 13.312  -7.431  2.694   1.00 2.56 ? 3  TYR B CA   1  
ATOM 1120  C C    . TYR B 1 3  ? 12.832  -7.204  1.259   1.00 2.56 ? 3  TYR B C    1  
ATOM 1121  O O    . TYR B 1 3  ? 13.282  -7.852  0.335   1.00 2.56 ? 3  TYR B O    1  
ATOM 1122  C CB   . TYR B 1 3  ? 14.711  -6.834  2.865   1.00 2.56 ? 3  TYR B CB   1  
ATOM 1123  C CG   . TYR B 1 3  ? 15.741  -7.810  2.350   1.00 2.56 ? 3  TYR B CG   1  
ATOM 1124  C CD1  . TYR B 1 3  ? 15.974  -7.923  0.974   1.00 2.56 ? 3  TYR B CD1  1  
ATOM 1125  C CD2  . TYR B 1 3  ? 16.463  -8.605  3.249   1.00 2.56 ? 3  TYR B CD2  1  
ATOM 1126  C CE1  . TYR B 1 3  ? 16.929  -8.828  0.497   1.00 2.56 ? 3  TYR B CE1  1  
ATOM 1127  C CE2  . TYR B 1 3  ? 17.418  -9.510  2.772   1.00 2.56 ? 3  TYR B CE2  1  
ATOM 1128  C CZ   . TYR B 1 3  ? 17.651  -9.622  1.396   1.00 2.56 ? 3  TYR B CZ   1  
ATOM 1129  O OH   . TYR B 1 3  ? 18.592  -10.515 0.927   1.00 2.56 ? 3  TYR B OH   1  
ATOM 1130  H H    . TYR B 1 3  ? 13.403  -9.534  2.240   1.00 2.56 ? 3  TYR B H    1  
ATOM 1131  H HA   . TYR B 1 3  ? 12.630  -6.951  3.381   1.00 2.56 ? 3  TYR B HA   1  
ATOM 1132  H HB2  . TYR B 1 3  ? 14.779  -5.911  2.307   1.00 2.56 ? 3  TYR B HB2  1  
ATOM 1133  H HB3  . TYR B 1 3  ? 14.893  -6.636  3.911   1.00 2.56 ? 3  TYR B HB3  1  
ATOM 1134  H HD1  . TYR B 1 3  ? 15.417  -7.310  0.281   1.00 2.56 ? 3  TYR B HD1  1  
ATOM 1135  H HD2  . TYR B 1 3  ? 16.284  -8.518  4.310   1.00 2.56 ? 3  TYR B HD2  1  
ATOM 1136  H HE1  . TYR B 1 3  ? 17.109  -8.914  -0.564  1.00 2.56 ? 3  TYR B HE1  1  
ATOM 1137  H HE2  . TYR B 1 3  ? 17.976  -10.122 3.466   1.00 2.56 ? 3  TYR B HE2  1  
ATOM 1138  H HH   . TYR B 1 3  ? 18.197  -11.389 0.923   1.00 2.56 ? 3  TYR B HH   1  
ATOM 1139  N N    . SER B 1 4  ? 11.920  -6.292  1.065   1.00 0.96 ? 4  SER B N    1  
ATOM 1140  C CA   . SER B 1 4  ? 11.412  -6.026  -0.310  1.00 0.96 ? 4  SER B CA   1  
ATOM 1141  C C    . SER B 1 4  ? 11.193  -4.522  -0.491  1.00 0.96 ? 4  SER B C    1  
ATOM 1142  O O    . SER B 1 4  ? 10.460  -3.899  0.250   1.00 0.96 ? 4  SER B O    1  
ATOM 1143  C CB   . SER B 1 4  ? 10.089  -6.763  -0.515  1.00 0.96 ? 4  SER B CB   1  
ATOM 1144  O OG   . SER B 1 4  ? 10.204  -7.629  -1.636  1.00 0.96 ? 4  SER B OG   1  
ATOM 1145  H H    . SER B 1 4  ? 11.569  -5.780  1.825   1.00 0.96 ? 4  SER B H    1  
ATOM 1146  H HA   . SER B 1 4  ? 12.135  -6.374  -1.034  1.00 0.96 ? 4  SER B HA   1  
ATOM 1147  H HB2  . SER B 1 4  ? 9.859   -7.344  0.361   1.00 0.96 ? 4  SER B HB2  1  
ATOM 1148  H HB3  . SER B 1 4  ? 9.300   -6.041  -0.684  1.00 0.96 ? 4  SER B HB3  1  
ATOM 1149  H HG   . SER B 1 4  ? 9.359   -7.637  -2.094  1.00 0.96 ? 4  SER B HG   1  
ATOM 1150  N N    . SER B 1 5  ? 11.823  -3.935  -1.472  1.00 0.48 ? 5  SER B N    1  
ATOM 1151  C CA   . SER B 1 5  ? 11.650  -2.473  -1.699  1.00 0.48 ? 5  SER B CA   1  
ATOM 1152  C C    . SER B 1 5  ? 10.530  -2.243  -2.715  1.00 0.48 ? 5  SER B C    1  
ATOM 1153  O O    . SER B 1 5  ? 10.773  -1.893  -3.854  1.00 0.48 ? 5  SER B O    1  
ATOM 1154  C CB   . SER B 1 5  ? 12.954  -1.882  -2.235  1.00 0.48 ? 5  SER B CB   1  
ATOM 1155  O OG   . SER B 1 5  ? 13.695  -2.901  -2.893  1.00 0.48 ? 5  SER B OG   1  
ATOM 1156  H H    . SER B 1 5  ? 12.410  -4.456  -2.058  1.00 0.48 ? 5  SER B H    1  
ATOM 1157  H HA   . SER B 1 5  ? 11.393  -1.991  -0.767  1.00 0.48 ? 5  SER B HA   1  
ATOM 1158  H HB2  . SER B 1 5  ? 12.734  -1.094  -2.936  1.00 0.48 ? 5  SER B HB2  1  
ATOM 1159  H HB3  . SER B 1 5  ? 13.530  -1.477  -1.412  1.00 0.48 ? 5  SER B HB3  1  
ATOM 1160  H HG   . SER B 1 5  ? 14.582  -2.906  -2.527  1.00 0.48 ? 5  SER B HG   1  
ATOM 1161  N N    . ASP B 1 6  ? 9.303   -2.437  -2.316  1.00 0.37 ? 6  ASP B N    1  
ATOM 1162  C CA   . ASP B 1 6  ? 8.169   -2.230  -3.260  1.00 0.37 ? 6  ASP B CA   1  
ATOM 1163  C C    . ASP B 1 6  ? 6.931   -1.785  -2.479  1.00 0.37 ? 6  ASP B C    1  
ATOM 1164  O O    . ASP B 1 6  ? 6.710   -2.198  -1.359  1.00 0.37 ? 6  ASP B O    1  
ATOM 1165  C CB   . ASP B 1 6  ? 7.870   -3.539  -3.991  1.00 0.37 ? 6  ASP B CB   1  
ATOM 1166  C CG   . ASP B 1 6  ? 9.144   -4.053  -4.664  1.00 0.37 ? 6  ASP B CG   1  
ATOM 1167  O OD1  . ASP B 1 6  ? 9.396   -3.660  -5.790  1.00 0.37 ? 6  ASP B OD1  1  
ATOM 1168  O OD2  . ASP B 1 6  ? 9.847   -4.830  -4.039  1.00 0.37 ? 6  ASP B OD2  1  
ATOM 1169  H H    . ASP B 1 6  ? 9.128   -2.719  -1.393  1.00 0.37 ? 6  ASP B H    1  
ATOM 1170  H HA   . ASP B 1 6  ? 8.434   -1.469  -3.978  1.00 0.37 ? 6  ASP B HA   1  
ATOM 1171  H HB2  . ASP B 1 6  ? 7.513   -4.274  -3.283  1.00 0.37 ? 6  ASP B HB2  1  
ATOM 1172  H HB3  . ASP B 1 6  ? 7.113   -3.368  -4.743  1.00 0.37 ? 6  ASP B HB3  1  
ATOM 1173  N N    . THR B 1 7  ? 6.119   -0.946  -3.064  1.00 0.35 ? 7  THR B N    1  
ATOM 1174  C CA   . THR B 1 7  ? 4.895   -0.475  -2.355  1.00 0.35 ? 7  THR B CA   1  
ATOM 1175  C C    . THR B 1 7  ? 3.961   -1.662  -2.110  1.00 0.35 ? 7  THR B C    1  
ATOM 1176  O O    . THR B 1 7  ? 3.790   -2.515  -2.958  1.00 0.35 ? 7  THR B O    1  
ATOM 1177  C CB   . THR B 1 7  ? 4.180   0.571   -3.212  1.00 0.35 ? 7  THR B CB   1  
ATOM 1178  O OG1  . THR B 1 7  ? 4.266   0.198   -4.580  1.00 0.35 ? 7  THR B OG1  1  
ATOM 1179  C CG2  . THR B 1 7  ? 4.838   1.936   -3.011  1.00 0.35 ? 7  THR B CG2  1  
ATOM 1180  H H    . THR B 1 7  ? 6.315   -0.624  -3.968  1.00 0.35 ? 7  THR B H    1  
ATOM 1181  H HA   . THR B 1 7  ? 5.174   -0.036  -1.409  1.00 0.35 ? 7  THR B HA   1  
ATOM 1182  H HB   . THR B 1 7  ? 3.142   0.630   -2.919  1.00 0.35 ? 7  THR B HB   1  
ATOM 1183  H HG1  . THR B 1 7  ? 3.379   -0.001  -4.890  1.00 0.35 ? 7  THR B HG1  1  
ATOM 1184  H HG21 . THR B 1 7  ? 5.882   1.876   -3.277  1.00 0.35 ? 7  THR B HG21 1  
ATOM 1185  H HG22 . THR B 1 7  ? 4.348   2.668   -3.637  1.00 0.35 ? 7  THR B HG22 1  
ATOM 1186  H HG23 . THR B 1 7  ? 4.747   2.231   -1.975  1.00 0.35 ? 7  THR B HG23 1  
ATOM 1187  N N    . THR B 1 8  ? 3.352   -1.721  -0.957  1.00 0.31 ? 8  THR B N    1  
ATOM 1188  C CA   . THR B 1 8  ? 2.428   -2.852  -0.661  1.00 0.31 ? 8  THR B CA   1  
ATOM 1189  C C    . THR B 1 8  ? 0.981   -2.398  -0.881  1.00 0.31 ? 8  THR B C    1  
ATOM 1190  O O    . THR B 1 8  ? 0.619   -1.298  -0.511  1.00 0.31 ? 8  THR B O    1  
ATOM 1191  C CB   . THR B 1 8  ? 2.610   -3.288  0.795   1.00 0.31 ? 8  THR B CB   1  
ATOM 1192  O OG1  . THR B 1 8  ? 3.925   -3.794  0.976   1.00 0.31 ? 8  THR B OG1  1  
ATOM 1193  C CG2  . THR B 1 8  ? 1.590   -4.377  1.137   1.00 0.31 ? 8  THR B CG2  1  
ATOM 1194  H H    . THR B 1 8  ? 3.503   -1.024  -0.286  1.00 0.31 ? 8  THR B H    1  
ATOM 1195  H HA   . THR B 1 8  ? 2.656   -3.679  -1.315  1.00 0.31 ? 8  THR B HA   1  
ATOM 1196  H HB   . THR B 1 8  ? 2.457   -2.442  1.447   1.00 0.31 ? 8  THR B HB   1  
ATOM 1197  H HG1  . THR B 1 8  ? 4.541   -3.067  0.858   1.00 0.31 ? 8  THR B HG1  1  
ATOM 1198  H HG21 . THR B 1 8  ? 0.702   -4.240  0.539   1.00 0.31 ? 8  THR B HG21 1  
ATOM 1199  H HG22 . THR B 1 8  ? 2.017   -5.347  0.930   1.00 0.31 ? 8  THR B HG22 1  
ATOM 1200  H HG23 . THR B 1 8  ? 1.333   -4.313  2.184   1.00 0.31 ? 8  THR B HG23 1  
ATOM 1201  N N    . PRO B 1 9  ? 0.192   -3.257  -1.478  1.00 0.34 ? 9  PRO B N    1  
ATOM 1202  C CA   . PRO B 1 9  ? -1.225  -2.970  -1.759  1.00 0.34 ? 9  PRO B CA   1  
ATOM 1203  C C    . PRO B 1 9  ? -2.064  -3.146  -0.490  1.00 0.34 ? 9  PRO B C    1  
ATOM 1204  O O    . PRO B 1 9  ? -2.753  -4.131  -0.324  1.00 0.34 ? 9  PRO B O    1  
ATOM 1205  C CB   . PRO B 1 9  ? -1.602  -4.016  -2.812  1.00 0.34 ? 9  PRO B CB   1  
ATOM 1206  C CG   . PRO B 1 9  ? -0.587  -5.173  -2.658  1.00 0.34 ? 9  PRO B CG   1  
ATOM 1207  C CD   . PRO B 1 9  ? 0.637   -4.593  -1.927  1.00 0.34 ? 9  PRO B CD   1  
ATOM 1208  H HA   . PRO B 1 9  ? -1.342  -1.978  -2.164  1.00 0.34 ? 9  PRO B HA   1  
ATOM 1209  H HB2  . PRO B 1 9  ? -2.607  -4.372  -2.635  1.00 0.34 ? 9  PRO B HB2  1  
ATOM 1210  H HB3  . PRO B 1 9  ? -1.524  -3.593  -3.801  1.00 0.34 ? 9  PRO B HB3  1  
ATOM 1211  H HG2  . PRO B 1 9  ? -1.026  -5.973  -2.077  1.00 0.34 ? 9  PRO B HG2  1  
ATOM 1212  H HG3  . PRO B 1 9  ? -0.291  -5.539  -3.630  1.00 0.34 ? 9  PRO B HG3  1  
ATOM 1213  H HD2  . PRO B 1 9  ? 0.899   -5.212  -1.079  1.00 0.34 ? 9  PRO B HD2  1  
ATOM 1214  H HD3  . PRO B 1 9  ? 1.474   -4.499  -2.601  1.00 0.34 ? 9  PRO B HD3  1  
ATOM 1215  N N    . CYS B 1 10 ? -2.008  -2.199  0.406   1.00 0.35 ? 10 CYS B N    1  
ATOM 1216  C CA   . CYS B 1 10 ? -2.797  -2.317  1.662   1.00 0.35 ? 10 CYS B CA   1  
ATOM 1217  C C    . CYS B 1 10 ? -4.160  -1.645  1.481   1.00 0.35 ? 10 CYS B C    1  
ATOM 1218  O O    . CYS B 1 10 ? -4.250  -0.467  1.196   1.00 0.35 ? 10 CYS B O    1  
ATOM 1219  C CB   . CYS B 1 10 ? -2.041  -1.634  2.803   1.00 0.35 ? 10 CYS B CB   1  
ATOM 1220  S SG   . CYS B 1 10 ? -0.514  -2.543  3.141   1.00 0.35 ? 10 CYS B SG   1  
ATOM 1221  H H    . CYS B 1 10 ? -1.443  -1.413  0.253   1.00 0.35 ? 10 CYS B H    1  
ATOM 1222  H HA   . CYS B 1 10 ? -2.941  -3.360  1.901   1.00 0.35 ? 10 CYS B HA   1  
ATOM 1223  H HB2  . CYS B 1 10 ? -1.801  -0.620  2.520   1.00 0.35 ? 10 CYS B HB2  1  
ATOM 1224  H HB3  . CYS B 1 10 ? -2.658  -1.624  3.690   1.00 0.35 ? 10 CYS B HB3  1  
ATOM 1225  N N    . CYS B 1 11 ? -5.222  -2.385  1.645   1.00 0.32 ? 11 CYS B N    1  
ATOM 1226  C CA   . CYS B 1 11 ? -6.579  -1.788  1.485   1.00 0.32 ? 11 CYS B CA   1  
ATOM 1227  C C    . CYS B 1 11 ? -7.246  -1.670  2.856   1.00 0.32 ? 11 CYS B C    1  
ATOM 1228  O O    . CYS B 1 11 ? -7.159  -2.560  3.678   1.00 0.32 ? 11 CYS B O    1  
ATOM 1229  C CB   . CYS B 1 11 ? -7.427  -2.684  0.580   1.00 0.32 ? 11 CYS B CB   1  
ATOM 1230  S SG   . CYS B 1 11 ? -7.307  -2.099  -1.128  1.00 0.32 ? 11 CYS B SG   1  
ATOM 1231  H H    . CYS B 1 11 ? -5.129  -3.332  1.877   1.00 0.32 ? 11 CYS B H    1  
ATOM 1232  H HA   . CYS B 1 11 ? -6.491  -0.807  1.041   1.00 0.32 ? 11 CYS B HA   1  
ATOM 1233  H HB2  . CYS B 1 11 ? -7.067  -3.700  0.640   1.00 0.32 ? 11 CYS B HB2  1  
ATOM 1234  H HB3  . CYS B 1 11 ? -8.457  -2.648  0.901   1.00 0.32 ? 11 CYS B HB3  1  
ATOM 1235  N N    . PHE B 1 12 ? -7.911  -0.576  3.110   1.00 0.28 ? 12 PHE B N    1  
ATOM 1236  C CA   . PHE B 1 12 ? -8.581  -0.403  4.429   1.00 0.28 ? 12 PHE B CA   1  
ATOM 1237  C C    . PHE B 1 12 ? -10.070 -0.129  4.214   1.00 0.28 ? 12 PHE B C    1  
ATOM 1238  O O    . PHE B 1 12 ? -10.900 -0.473  5.033   1.00 0.28 ? 12 PHE B O    1  
ATOM 1239  C CB   . PHE B 1 12 ? -7.945  0.776   5.171   1.00 0.28 ? 12 PHE B CB   1  
ATOM 1240  C CG   . PHE B 1 12 ? -6.467  0.824   4.866   1.00 0.28 ? 12 PHE B CG   1  
ATOM 1241  C CD1  . PHE B 1 12 ? -6.008  1.498   3.729   1.00 0.28 ? 12 PHE B CD1  1  
ATOM 1242  C CD2  . PHE B 1 12 ? -5.557  0.191   5.721   1.00 0.28 ? 12 PHE B CD2  1  
ATOM 1243  C CE1  . PHE B 1 12 ? -4.638  1.541   3.446   1.00 0.28 ? 12 PHE B CE1  1  
ATOM 1244  C CE2  . PHE B 1 12 ? -4.185  0.235   5.438   1.00 0.28 ? 12 PHE B CE2  1  
ATOM 1245  C CZ   . PHE B 1 12 ? -3.726  0.908   4.301   1.00 0.28 ? 12 PHE B CZ   1  
ATOM 1246  H H    . PHE B 1 12 ? -7.968  0.131   2.435   1.00 0.28 ? 12 PHE B H    1  
ATOM 1247  H HA   . PHE B 1 12 ? -8.461  -1.302  5.016   1.00 0.28 ? 12 PHE B HA   1  
ATOM 1248  H HB2  . PHE B 1 12 ? -8.410  1.696   4.847   1.00 0.28 ? 12 PHE B HB2  1  
ATOM 1249  H HB3  . PHE B 1 12 ? -8.090  0.654   6.234   1.00 0.28 ? 12 PHE B HB3  1  
ATOM 1250  H HD1  . PHE B 1 12 ? -6.710  1.985   3.069   1.00 0.28 ? 12 PHE B HD1  1  
ATOM 1251  H HD2  . PHE B 1 12 ? -5.910  -0.328  6.599   1.00 0.28 ? 12 PHE B HD2  1  
ATOM 1252  H HE1  . PHE B 1 12 ? -4.283  2.061   2.567   1.00 0.28 ? 12 PHE B HE1  1  
ATOM 1253  H HE2  . PHE B 1 12 ? -3.483  -0.253  6.098   1.00 0.28 ? 12 PHE B HE2  1  
ATOM 1254  H HZ   . PHE B 1 12 ? -2.669  0.942   4.082   1.00 0.28 ? 12 PHE B HZ   1  
ATOM 1255  N N    . ALA B 1 13 ? -10.417 0.487   3.117   1.00 0.31 ? 13 ALA B N    1  
ATOM 1256  C CA   . ALA B 1 13 ? -11.853 0.782   2.849   1.00 0.31 ? 13 ALA B CA   1  
ATOM 1257  C C    . ALA B 1 13 ? -12.480 -0.385  2.084   1.00 0.31 ? 13 ALA B C    1  
ATOM 1258  O O    . ALA B 1 13 ? -11.802 -1.306  1.673   1.00 0.31 ? 13 ALA B O    1  
ATOM 1259  C CB   . ALA B 1 13 ? -11.964 2.059   2.013   1.00 0.31 ? 13 ALA B CB   1  
ATOM 1260  H H    . ALA B 1 13 ? -9.733  0.756   2.468   1.00 0.31 ? 13 ALA B H    1  
ATOM 1261  H HA   . ALA B 1 13 ? -12.372 0.919   3.786   1.00 0.31 ? 13 ALA B HA   1  
ATOM 1262  H HB1  . ALA B 1 13 ? -11.227 2.038   1.225   1.00 0.31 ? 13 ALA B HB1  1  
ATOM 1263  H HB2  . ALA B 1 13 ? -12.952 2.120   1.581   1.00 0.31 ? 13 ALA B HB2  1  
ATOM 1264  H HB3  . ALA B 1 13 ? -11.793 2.918   2.645   1.00 0.31 ? 13 ALA B HB3  1  
ATOM 1265  N N    . TYR B 1 14 ? -13.770 -0.355  1.890   1.00 0.29 ? 14 TYR B N    1  
ATOM 1266  C CA   . TYR B 1 14 ? -14.440 -1.462  1.151   1.00 0.29 ? 14 TYR B CA   1  
ATOM 1267  C C    . TYR B 1 14 ? -15.508 -0.882  0.222   1.00 0.29 ? 14 TYR B C    1  
ATOM 1268  O O    . TYR B 1 14 ? -16.168 0.084   0.548   1.00 0.29 ? 14 TYR B O    1  
ATOM 1269  C CB   . TYR B 1 14 ? -15.097 -2.419  2.148   1.00 0.29 ? 14 TYR B CB   1  
ATOM 1270  C CG   . TYR B 1 14 ? -14.029 -3.127  2.947   1.00 0.29 ? 14 TYR B CG   1  
ATOM 1271  C CD1  . TYR B 1 14 ? -12.927 -3.693  2.295   1.00 0.29 ? 14 TYR B CD1  1  
ATOM 1272  C CD2  . TYR B 1 14 ? -14.139 -3.216  4.340   1.00 0.29 ? 14 TYR B CD2  1  
ATOM 1273  C CE1  . TYR B 1 14 ? -11.936 -4.348  3.034   1.00 0.29 ? 14 TYR B CE1  1  
ATOM 1274  C CE2  . TYR B 1 14 ? -13.147 -3.872  5.079   1.00 0.29 ? 14 TYR B CE2  1  
ATOM 1275  C CZ   . TYR B 1 14 ? -12.046 -4.437  4.427   1.00 0.29 ? 14 TYR B CZ   1  
ATOM 1276  O OH   . TYR B 1 14 ? -11.069 -5.083  5.156   1.00 0.29 ? 14 TYR B OH   1  
ATOM 1277  H H    . TYR B 1 14 ? -14.299 0.397   2.230   1.00 0.29 ? 14 TYR B H    1  
ATOM 1278  H HA   . TYR B 1 14 ? -13.707 -2.000  0.567   1.00 0.29 ? 14 TYR B HA   1  
ATOM 1279  H HB2  . TYR B 1 14 ? -15.734 -1.859  2.817   1.00 0.29 ? 14 TYR B HB2  1  
ATOM 1280  H HB3  . TYR B 1 14 ? -15.687 -3.148  1.613   1.00 0.29 ? 14 TYR B HB3  1  
ATOM 1281  H HD1  . TYR B 1 14 ? -12.841 -3.625  1.220   1.00 0.29 ? 14 TYR B HD1  1  
ATOM 1282  H HD2  . TYR B 1 14 ? -14.989 -2.780  4.843   1.00 0.29 ? 14 TYR B HD2  1  
ATOM 1283  H HE1  . TYR B 1 14 ? -11.086 -4.783  2.530   1.00 0.29 ? 14 TYR B HE1  1  
ATOM 1284  H HE2  . TYR B 1 14 ? -13.233 -3.941  6.154   1.00 0.29 ? 14 TYR B HE2  1  
ATOM 1285  H HH   . TYR B 1 14 ? -11.127 -4.780  6.065   1.00 0.29 ? 14 TYR B HH   1  
ATOM 1286  N N    . ILE B 1 15 ? -15.683 -1.464  -0.933  1.00 0.32 ? 15 ILE B N    1  
ATOM 1287  C CA   . ILE B 1 15 ? -16.709 -0.944  -1.880  1.00 0.32 ? 15 ILE B CA   1  
ATOM 1288  C C    . ILE B 1 15 ? -18.021 -1.704  -1.678  1.00 0.32 ? 15 ILE B C    1  
ATOM 1289  O O    . ILE B 1 15 ? -18.031 -2.904  -1.487  1.00 0.32 ? 15 ILE B O    1  
ATOM 1290  C CB   . ILE B 1 15 ? -16.222 -1.139  -3.318  1.00 0.32 ? 15 ILE B CB   1  
ATOM 1291  C CG1  . ILE B 1 15 ? -17.120 -0.347  -4.271  1.00 0.32 ? 15 ILE B CG1  1  
ATOM 1292  C CG2  . ILE B 1 15 ? -16.278 -2.623  -3.681  1.00 0.32 ? 15 ILE B CG2  1  
ATOM 1293  C CD1  . ILE B 1 15 ? -16.702 -0.624  -5.716  1.00 0.32 ? 15 ILE B CD1  1  
ATOM 1294  H H    . ILE B 1 15 ? -15.139 -2.242  -1.178  1.00 0.32 ? 15 ILE B H    1  
ATOM 1295  H HA   . ILE B 1 15 ? -16.870 0.107   -1.694  1.00 0.32 ? 15 ILE B HA   1  
ATOM 1296  H HB   . ILE B 1 15 ? -15.204 -0.787  -3.404  1.00 0.32 ? 15 ILE B HB   1  
ATOM 1297  H HG12 . ILE B 1 15 ? -18.149 -0.647  -4.128  1.00 0.32 ? 15 ILE B HG12 1  
ATOM 1298  H HG13 . ILE B 1 15 ? -17.021 0.708   -4.066  1.00 0.32 ? 15 ILE B HG13 1  
ATOM 1299  H HG21 . ILE B 1 15 ? -16.233 -3.217  -2.780  1.00 0.32 ? 15 ILE B HG21 1  
ATOM 1300  H HG22 . ILE B 1 15 ? -17.201 -2.832  -4.204  1.00 0.32 ? 15 ILE B HG22 1  
ATOM 1301  H HG23 . ILE B 1 15 ? -15.441 -2.871  -4.318  1.00 0.32 ? 15 ILE B HG23 1  
ATOM 1302  H HD11 . ILE B 1 15 ? -15.658 -0.379  -5.843  1.00 0.32 ? 15 ILE B HD11 1  
ATOM 1303  H HD12 . ILE B 1 15 ? -16.856 -1.670  -5.941  1.00 0.32 ? 15 ILE B HD12 1  
ATOM 1304  H HD13 . ILE B 1 15 ? -17.298 -0.022  -6.385  1.00 0.32 ? 15 ILE B HD13 1  
ATOM 1305  N N    . ALA B 1 16 ? -19.128 -1.015  -1.717  1.00 0.38 ? 16 ALA B N    1  
ATOM 1306  C CA   . ALA B 1 16 ? -20.438 -1.699  -1.526  1.00 0.38 ? 16 ALA B CA   1  
ATOM 1307  C C    . ALA B 1 16 ? -20.929 -2.246  -2.869  1.00 0.38 ? 16 ALA B C    1  
ATOM 1308  O O    . ALA B 1 16 ? -21.443 -3.343  -2.951  1.00 0.38 ? 16 ALA B O    1  
ATOM 1309  C CB   . ALA B 1 16 ? -21.461 -0.701  -0.979  1.00 0.38 ? 16 ALA B CB   1  
ATOM 1310  H H    . ALA B 1 16 ? -19.098 -0.048  -1.871  1.00 0.38 ? 16 ALA B H    1  
ATOM 1311  H HA   . ALA B 1 16 ? -20.321 -2.513  -0.826  1.00 0.38 ? 16 ALA B HA   1  
ATOM 1312  H HB1  . ALA B 1 16 ? -21.037 0.292   -0.993  1.00 0.38 ? 16 ALA B HB1  1  
ATOM 1313  H HB2  . ALA B 1 16 ? -22.348 -0.722  -1.592  1.00 0.38 ? 16 ALA B HB2  1  
ATOM 1314  H HB3  . ALA B 1 16 ? -21.717 -0.968  0.036   1.00 0.38 ? 16 ALA B HB3  1  
ATOM 1315  N N    . ARG B 1 17 ? -20.772 -1.491  -3.920  1.00 0.42 ? 17 ARG B N    1  
ATOM 1316  C CA   . ARG B 1 17 ? -21.230 -1.968  -5.255  1.00 0.42 ? 17 ARG B CA   1  
ATOM 1317  C C    . ARG B 1 17 ? -20.194 -2.939  -5.831  1.00 0.42 ? 17 ARG B C    1  
ATOM 1318  O O    . ARG B 1 17 ? -19.011 -2.793  -5.594  1.00 0.42 ? 17 ARG B O    1  
ATOM 1319  C CB   . ARG B 1 17 ? -21.389 -0.774  -6.198  1.00 0.42 ? 17 ARG B CB   1  
ATOM 1320  C CG   . ARG B 1 17 ? -20.193 0.168   -6.037  1.00 0.42 ? 17 ARG B CG   1  
ATOM 1321  C CD   . ARG B 1 17 ? -20.617 1.398   -5.234  1.00 0.42 ? 17 ARG B CD   1  
ATOM 1322  N NE   . ARG B 1 17 ? -21.583 2.204   -6.032  1.00 0.42 ? 17 ARG B NE   1  
ATOM 1323  C CZ   . ARG B 1 17 ? -22.808 2.361   -5.609  1.00 0.42 ? 17 ARG B CZ   1  
ATOM 1324  N NH1  . ARG B 1 17 ? -23.030 2.853   -4.421  1.00 0.42 ? 17 ARG B NH1  1  
ATOM 1325  N NH2  . ARG B 1 17 ? -23.811 2.026   -6.374  1.00 0.42 ? 17 ARG B NH2  1  
ATOM 1326  H H    . ARG B 1 17 ? -20.354 -0.608  -3.832  1.00 0.42 ? 17 ARG B H    1  
ATOM 1327  H HA   . ARG B 1 17 ? -22.179 -2.473  -5.150  1.00 0.42 ? 17 ARG B HA   1  
ATOM 1328  H HB2  . ARG B 1 17 ? -21.436 -1.125  -7.219  1.00 0.42 ? 17 ARG B HB2  1  
ATOM 1329  H HB3  . ARG B 1 17 ? -22.297 -0.243  -5.957  1.00 0.42 ? 17 ARG B HB3  1  
ATOM 1330  H HG2  . ARG B 1 17 ? -19.397 -0.347  -5.518  1.00 0.42 ? 17 ARG B HG2  1  
ATOM 1331  H HG3  . ARG B 1 17 ? -19.845 0.478   -7.011  1.00 0.42 ? 17 ARG B HG3  1  
ATOM 1332  H HD2  . ARG B 1 17 ? -21.085 1.083   -4.313  1.00 0.42 ? 17 ARG B HD2  1  
ATOM 1333  H HD3  . ARG B 1 17 ? -19.747 1.998   -5.008  1.00 0.42 ? 17 ARG B HD3  1  
ATOM 1334  H HE   . ARG B 1 17 ? -21.299 2.616   -6.874  1.00 0.42 ? 17 ARG B HE   1  
ATOM 1335  H HH11 . ARG B 1 17 ? -22.261 3.110   -3.835  1.00 0.42 ? 17 ARG B HH11 1  
ATOM 1336  H HH12 . ARG B 1 17 ? -23.968 2.973   -4.096  1.00 0.42 ? 17 ARG B HH12 1  
ATOM 1337  H HH21 . ARG B 1 17 ? -23.640 1.649   -7.285  1.00 0.42 ? 17 ARG B HH21 1  
ATOM 1338  H HH22 . ARG B 1 17 ? -24.749 2.146   -6.050  1.00 0.42 ? 17 ARG B HH22 1  
ATOM 1339  N N    . PRO B 1 18 ? -20.674 -3.906  -6.571  1.00 0.41 ? 18 PRO B N    1  
ATOM 1340  C CA   . PRO B 1 18 ? -19.817 -4.924  -7.201  1.00 0.41 ? 18 PRO B CA   1  
ATOM 1341  C C    . PRO B 1 18 ? -19.140 -4.357  -8.452  1.00 0.41 ? 18 PRO B C    1  
ATOM 1342  O O    . PRO B 1 18 ? -19.410 -3.249  -8.868  1.00 0.41 ? 18 PRO B O    1  
ATOM 1343  C CB   . PRO B 1 18 ? -20.796 -6.042  -7.570  1.00 0.41 ? 18 PRO B CB   1  
ATOM 1344  C CG   . PRO B 1 18 ? -22.195 -5.383  -7.656  1.00 0.41 ? 18 PRO B CG   1  
ATOM 1345  C CD   . PRO B 1 18 ? -22.115 -4.072  -6.852  1.00 0.41 ? 18 PRO B CD   1  
ATOM 1346  H HA   . PRO B 1 18 ? -19.083 -5.292  -6.502  1.00 0.41 ? 18 PRO B HA   1  
ATOM 1347  H HB2  . PRO B 1 18 ? -20.525 -6.471  -8.525  1.00 0.41 ? 18 PRO B HB2  1  
ATOM 1348  H HB3  . PRO B 1 18 ? -20.798 -6.803  -6.806  1.00 0.41 ? 18 PRO B HB3  1  
ATOM 1349  H HG2  . PRO B 1 18 ? -22.440 -5.175  -8.688  1.00 0.41 ? 18 PRO B HG2  1  
ATOM 1350  H HG3  . PRO B 1 18 ? -22.938 -6.034  -7.221  1.00 0.41 ? 18 PRO B HG3  1  
ATOM 1351  H HD2  . PRO B 1 18 ? -22.488 -3.245  -7.441  1.00 0.41 ? 18 PRO B HD2  1  
ATOM 1352  H HD3  . PRO B 1 18 ? -22.665 -4.161  -5.927  1.00 0.41 ? 18 PRO B HD3  1  
ATOM 1353  N N    . LEU B 1 19 ? -18.261 -5.110  -9.053  1.00 0.45 ? 19 LEU B N    1  
ATOM 1354  C CA   . LEU B 1 19 ? -17.565 -4.618  -10.276 1.00 0.45 ? 19 LEU B CA   1  
ATOM 1355  C C    . LEU B 1 19 ? -17.830 -5.584  -11.435 1.00 0.45 ? 19 LEU B C    1  
ATOM 1356  O O    . LEU B 1 19 ? -18.328 -6.673  -11.229 1.00 0.45 ? 19 LEU B O    1  
ATOM 1357  C CB   . LEU B 1 19 ? -16.054 -4.532  -10.021 1.00 0.45 ? 19 LEU B CB   1  
ATOM 1358  C CG   . LEU B 1 19 ? -15.659 -5.462  -8.870  1.00 0.45 ? 19 LEU B CG   1  
ATOM 1359  C CD1  . LEU B 1 19 ? -14.144 -5.669  -8.877  1.00 0.45 ? 19 LEU B CD1  1  
ATOM 1360  C CD2  . LEU B 1 19 ? -16.080 -4.832  -7.540  1.00 0.45 ? 19 LEU B CD2  1  
ATOM 1361  H H    . LEU B 1 19 ? -18.057 -6.002  -8.700  1.00 0.45 ? 19 LEU B H    1  
ATOM 1362  H HA   . LEU B 1 19 ? -17.941 -3.639  -10.533 1.00 0.45 ? 19 LEU B HA   1  
ATOM 1363  H HB2  . LEU B 1 19 ? -15.522 -4.825  -10.914 1.00 0.45 ? 19 LEU B HB2  1  
ATOM 1364  H HB3  . LEU B 1 19 ? -15.791 -3.516  -9.765  1.00 0.45 ? 19 LEU B HB3  1  
ATOM 1365  H HG   . LEU B 1 19 ? -16.153 -6.415  -8.992  1.00 0.45 ? 19 LEU B HG   1  
ATOM 1366  H HD11 . LEU B 1 19 ? -13.767 -5.538  -9.881  1.00 0.45 ? 19 LEU B HD11 1  
ATOM 1367  H HD12 . LEU B 1 19 ? -13.679 -4.947  -8.222  1.00 0.45 ? 19 LEU B HD12 1  
ATOM 1368  H HD13 . LEU B 1 19 ? -13.915 -6.667  -8.534  1.00 0.45 ? 19 LEU B HD13 1  
ATOM 1369  H HD21 . LEU B 1 19 ? -16.186 -3.765  -7.665  1.00 0.45 ? 19 LEU B HD21 1  
ATOM 1370  H HD22 . LEU B 1 19 ? -17.023 -5.253  -7.225  1.00 0.45 ? 19 LEU B HD22 1  
ATOM 1371  H HD23 . LEU B 1 19 ? -15.327 -5.034  -6.792  1.00 0.45 ? 19 LEU B HD23 1  
ATOM 1372  N N    . PRO B 1 20 ? -17.488 -5.153  -12.622 1.00 0.58 ? 20 PRO B N    1  
ATOM 1373  C CA   . PRO B 1 20 ? -17.675 -5.957  -13.843 1.00 0.58 ? 20 PRO B CA   1  
ATOM 1374  C C    . PRO B 1 20 ? -16.587 -7.029  -13.946 1.00 0.58 ? 20 PRO B C    1  
ATOM 1375  O O    . PRO B 1 20 ? -15.492 -6.773  -14.404 1.00 0.58 ? 20 PRO B O    1  
ATOM 1376  C CB   . PRO B 1 20 ? -17.546 -4.931  -14.972 1.00 0.58 ? 20 PRO B CB   1  
ATOM 1377  C CG   . PRO B 1 20 ? -16.748 -3.741  -14.390 1.00 0.58 ? 20 PRO B CG   1  
ATOM 1378  C CD   . PRO B 1 20 ? -16.884 -3.825  -12.858 1.00 0.58 ? 20 PRO B CD   1  
ATOM 1379  H HA   . PRO B 1 20 ? -18.656 -6.404  -13.860 1.00 0.58 ? 20 PRO B HA   1  
ATOM 1380  H HB2  . PRO B 1 20 ? -17.015 -5.367  -15.808 1.00 0.58 ? 20 PRO B HB2  1  
ATOM 1381  H HB3  . PRO B 1 20 ? -18.522 -4.596  -15.284 1.00 0.58 ? 20 PRO B HB3  1  
ATOM 1382  H HG2  . PRO B 1 20 ? -15.708 -3.819  -14.678 1.00 0.58 ? 20 PRO B HG2  1  
ATOM 1383  H HG3  . PRO B 1 20 ? -17.162 -2.809  -14.742 1.00 0.58 ? 20 PRO B HG3  1  
ATOM 1384  H HD2  . PRO B 1 20 ? -15.912 -3.758  -12.391 1.00 0.58 ? 20 PRO B HD2  1  
ATOM 1385  H HD3  . PRO B 1 20 ? -17.538 -3.048  -12.493 1.00 0.58 ? 20 PRO B HD3  1  
ATOM 1386  N N    . ARG B 1 21 ? -16.882 -8.228  -13.523 1.00 0.75 ? 21 ARG B N    1  
ATOM 1387  C CA   . ARG B 1 21 ? -15.866 -9.315  -13.594 1.00 0.75 ? 21 ARG B CA   1  
ATOM 1388  C C    . ARG B 1 21 ? -15.260 -9.360  -14.999 1.00 0.75 ? 21 ARG B C    1  
ATOM 1389  O O    . ARG B 1 21 ? -14.106 -9.696  -15.177 1.00 0.75 ? 21 ARG B O    1  
ATOM 1390  C CB   . ARG B 1 21 ? -16.534 -10.656 -13.286 1.00 0.75 ? 21 ARG B CB   1  
ATOM 1391  C CG   . ARG B 1 21 ? -15.463 -11.691 -12.931 1.00 0.75 ? 21 ARG B CG   1  
ATOM 1392  C CD   . ARG B 1 21 ? -15.838 -13.042 -13.541 1.00 0.75 ? 21 ARG B CD   1  
ATOM 1393  N NE   . ARG B 1 21 ? -14.674 -13.967 -13.448 1.00 0.75 ? 21 ARG B NE   1  
ATOM 1394  C CZ   . ARG B 1 21 ? -14.270 -14.619 -14.504 1.00 0.75 ? 21 ARG B CZ   1  
ATOM 1395  N NH1  . ARG B 1 21 ? -14.818 -15.762 -14.815 1.00 0.75 ? 21 ARG B NH1  1  
ATOM 1396  N NH2  . ARG B 1 21 ? -13.321 -14.126 -15.251 1.00 0.75 ? 21 ARG B NH2  1  
ATOM 1397  H H    . ARG B 1 21 ? -17.771 -8.412  -13.155 1.00 0.75 ? 21 ARG B H    1  
ATOM 1398  H HA   . ARG B 1 21 ? -15.085 -9.127  -12.872 1.00 0.75 ? 21 ARG B HA   1  
ATOM 1399  H HB2  . ARG B 1 21 ? -17.211 -10.537 -12.453 1.00 0.75 ? 21 ARG B HB2  1  
ATOM 1400  H HB3  . ARG B 1 21 ? -17.083 -10.993 -14.153 1.00 0.75 ? 21 ARG B HB3  1  
ATOM 1401  H HG2  . ARG B 1 21 ? -14.509 -11.369 -13.322 1.00 0.75 ? 21 ARG B HG2  1  
ATOM 1402  H HG3  . ARG B 1 21 ? -15.399 -11.788 -11.858 1.00 0.75 ? 21 ARG B HG3  1  
ATOM 1403  H HD2  . ARG B 1 21 ? -16.675 -13.461 -13.003 1.00 0.75 ? 21 ARG B HD2  1  
ATOM 1404  H HD3  . ARG B 1 21 ? -16.108 -12.908 -14.578 1.00 0.75 ? 21 ARG B HD3  1  
ATOM 1405  H HE   . ARG B 1 21 ? -14.211 -14.087 -12.593 1.00 0.75 ? 21 ARG B HE   1  
ATOM 1406  H HH11 . ARG B 1 21 ? -15.546 -16.139 -14.243 1.00 0.75 ? 21 ARG B HH11 1  
ATOM 1407  H HH12 . ARG B 1 21 ? -14.510 -16.261 -15.625 1.00 0.75 ? 21 ARG B HH12 1  
ATOM 1408  H HH21 . ARG B 1 21 ? -12.901 -13.250 -15.014 1.00 0.75 ? 21 ARG B HH21 1  
ATOM 1409  H HH22 . ARG B 1 21 ? -13.012 -14.625 -16.060 1.00 0.75 ? 21 ARG B HH22 1  
ATOM 1410  N N    . ALA B 1 22 ? -16.027 -9.023  -15.999 1.00 0.89 ? 22 ALA B N    1  
ATOM 1411  C CA   . ALA B 1 22 ? -15.492 -9.048  -17.389 1.00 0.89 ? 22 ALA B CA   1  
ATOM 1412  C C    . ALA B 1 22 ? -14.313 -8.080  -17.500 1.00 0.89 ? 22 ALA B C    1  
ATOM 1413  O O    . ALA B 1 22 ? -13.292 -8.394  -18.079 1.00 0.89 ? 22 ALA B O    1  
ATOM 1414  C CB   . ALA B 1 22 ? -16.592 -8.628  -18.366 1.00 0.89 ? 22 ALA B CB   1  
ATOM 1415  H H    . ALA B 1 22 ? -16.956 -8.756  -15.836 1.00 0.89 ? 22 ALA B H    1  
ATOM 1416  H HA   . ALA B 1 22 ? -15.160 -10.048 -17.629 1.00 0.89 ? 22 ALA B HA   1  
ATOM 1417  H HB1  . ALA B 1 22 ? -17.258 -7.930  -17.880 1.00 0.89 ? 22 ALA B HB1  1  
ATOM 1418  H HB2  . ALA B 1 22 ? -16.146 -8.158  -19.231 1.00 0.89 ? 22 ALA B HB2  1  
ATOM 1419  H HB3  . ALA B 1 22 ? -17.149 -9.499  -18.678 1.00 0.89 ? 22 ALA B HB3  1  
ATOM 1420  N N    . HIS B 1 23 ? -14.446 -6.904  -16.950 1.00 0.71 ? 23 HIS B N    1  
ATOM 1421  C CA   . HIS B 1 23 ? -13.332 -5.916  -17.026 1.00 0.71 ? 23 HIS B CA   1  
ATOM 1422  C C    . HIS B 1 23 ? -12.375 -6.128  -15.850 1.00 0.71 ? 23 HIS B C    1  
ATOM 1423  O O    . HIS B 1 23 ? -11.432 -5.384  -15.666 1.00 0.71 ? 23 HIS B O    1  
ATOM 1424  C CB   . HIS B 1 23 ? -13.905 -4.499  -16.966 1.00 0.71 ? 23 HIS B CB   1  
ATOM 1425  C CG   . HIS B 1 23 ? -14.909 -4.316  -18.071 1.00 0.71 ? 23 HIS B CG   1  
ATOM 1426  N ND1  . HIS B 1 23 ? -14.994 -3.145  -18.806 1.00 0.71 ? 23 HIS B ND1  1  
ATOM 1427  C CD2  . HIS B 1 23 ? -15.880 -5.146  -18.575 1.00 0.71 ? 23 HIS B CD2  1  
ATOM 1428  C CE1  . HIS B 1 23 ? -15.983 -3.300  -19.705 1.00 0.71 ? 23 HIS B CE1  1  
ATOM 1429  N NE2  . HIS B 1 23 ? -16.556 -4.503  -19.607 1.00 0.71 ? 23 HIS B NE2  1  
ATOM 1430  H H    . HIS B 1 23 ? -15.277 -6.670  -16.488 1.00 0.71 ? 23 HIS B H    1  
ATOM 1431  H HA   . HIS B 1 23 ? -12.797 -6.049  -17.954 1.00 0.71 ? 23 HIS B HA   1  
ATOM 1432  H HB2  . HIS B 1 23 ? -14.387 -4.346  -16.011 1.00 0.71 ? 23 HIS B HB2  1  
ATOM 1433  H HB3  . HIS B 1 23 ? -13.106 -3.782  -17.085 1.00 0.71 ? 23 HIS B HB3  1  
ATOM 1434  H HD1  . HIS B 1 23 ? -14.435 -2.347  -18.693 1.00 0.71 ? 23 HIS B HD1  1  
ATOM 1435  H HD2  . HIS B 1 23 ? -16.086 -6.147  -18.225 1.00 0.71 ? 23 HIS B HD2  1  
ATOM 1436  H HE1  . HIS B 1 23 ? -16.277 -2.546  -20.419 1.00 0.71 ? 23 HIS B HE1  1  
ATOM 1437  N N    . ILE B 1 24 ? -12.606 -7.136  -15.053 1.00 0.56 ? 24 ILE B N    1  
ATOM 1438  C CA   . ILE B 1 24 ? -11.705 -7.389  -13.893 1.00 0.56 ? 24 ILE B CA   1  
ATOM 1439  C C    . ILE B 1 24 ? -10.572 -8.327  -14.319 1.00 0.56 ? 24 ILE B C    1  
ATOM 1440  O O    . ILE B 1 24 ? -10.675 -9.532  -14.201 1.00 0.56 ? 24 ILE B O    1  
ATOM 1441  C CB   . ILE B 1 24 ? -12.504 -8.033  -12.755 1.00 0.56 ? 24 ILE B CB   1  
ATOM 1442  C CG1  . ILE B 1 24 ? -13.401 -6.979  -12.104 1.00 0.56 ? 24 ILE B CG1  1  
ATOM 1443  C CG2  . ILE B 1 24 ? -11.543 -8.597  -11.706 1.00 0.56 ? 24 ILE B CG2  1  
ATOM 1444  C CD1  . ILE B 1 24 ? -14.146 -7.602  -10.922 1.00 0.56 ? 24 ILE B CD1  1  
ATOM 1445  H H    . ILE B 1 24 ? -13.370 -7.726  -15.217 1.00 0.56 ? 24 ILE B H    1  
ATOM 1446  H HA   . ILE B 1 24 ? -11.286 -6.453  -13.552 1.00 0.56 ? 24 ILE B HA   1  
ATOM 1447  H HB   . ILE B 1 24 ? -13.113 -8.832  -13.152 1.00 0.56 ? 24 ILE B HB   1  
ATOM 1448  H HG12 . ILE B 1 24 ? -12.794 -6.156  -11.754 1.00 0.56 ? 24 ILE B HG12 1  
ATOM 1449  H HG13 . ILE B 1 24 ? -14.116 -6.617  -12.827 1.00 0.56 ? 24 ILE B HG13 1  
ATOM 1450  H HG21 . ILE B 1 24 ? -10.835 -7.833  -11.418 1.00 0.56 ? 24 ILE B HG21 1  
ATOM 1451  H HG22 . ILE B 1 24 ? -12.103 -8.914  -10.839 1.00 0.56 ? 24 ILE B HG22 1  
ATOM 1452  H HG23 . ILE B 1 24 ? -11.012 -9.441  -12.122 1.00 0.56 ? 24 ILE B HG23 1  
ATOM 1453  H HD11 . ILE B 1 24 ? -14.470 -8.598  -11.186 1.00 0.56 ? 24 ILE B HD11 1  
ATOM 1454  H HD12 . ILE B 1 24 ? -13.488 -7.653  -10.068 1.00 0.56 ? 24 ILE B HD12 1  
ATOM 1455  H HD13 . ILE B 1 24 ? -15.007 -6.996  -10.679 1.00 0.56 ? 24 ILE B HD13 1  
ATOM 1456  N N    . LYS B 1 25 ? -9.494  -7.784  -14.813 1.00 0.59 ? 25 LYS B N    1  
ATOM 1457  C CA   . LYS B 1 25 ? -8.356  -8.643  -15.243 1.00 0.59 ? 25 LYS B CA   1  
ATOM 1458  C C    . LYS B 1 25 ? -8.068  -9.689  -14.164 1.00 0.59 ? 25 LYS B C    1  
ATOM 1459  O O    . LYS B 1 25 ? -8.219  -10.875 -14.380 1.00 0.59 ? 25 LYS B O    1  
ATOM 1460  C CB   . LYS B 1 25 ? -7.115  -7.773  -15.454 1.00 0.59 ? 25 LYS B CB   1  
ATOM 1461  C CG   . LYS B 1 25 ? -6.244  -8.386  -16.550 1.00 0.59 ? 25 LYS B CG   1  
ATOM 1462  C CD   . LYS B 1 25 ? -4.913  -7.635  -16.626 1.00 0.59 ? 25 LYS B CD   1  
ATOM 1463  C CE   . LYS B 1 25 ? -3.758  -8.636  -16.574 1.00 0.59 ? 25 LYS B CE   1  
ATOM 1464  N NZ   . LYS B 1 25 ? -3.606  -9.291  -17.905 1.00 0.59 ? 25 LYS B NZ   1  
ATOM 1465  H H    . LYS B 1 25 ? -9.431  -6.810  -14.899 1.00 0.59 ? 25 LYS B H    1  
ATOM 1466  H HA   . LYS B 1 25 ? -8.609  -9.138  -16.169 1.00 0.59 ? 25 LYS B HA   1  
ATOM 1467  H HB2  . LYS B 1 25 ? -7.419  -6.778  -15.748 1.00 0.59 ? 25 LYS B HB2  1  
ATOM 1468  H HB3  . LYS B 1 25 ? -6.551  -7.721  -14.535 1.00 0.59 ? 25 LYS B HB3  1  
ATOM 1469  H HG2  . LYS B 1 25 ? -6.059  -9.426  -16.322 1.00 0.59 ? 25 LYS B HG2  1  
ATOM 1470  H HG3  . LYS B 1 25 ? -6.753  -8.310  -17.499 1.00 0.59 ? 25 LYS B HG3  1  
ATOM 1471  H HD2  . LYS B 1 25 ? -4.867  -7.078  -17.552 1.00 0.59 ? 25 LYS B HD2  1  
ATOM 1472  H HD3  . LYS B 1 25 ? -4.835  -6.954  -15.792 1.00 0.59 ? 25 LYS B HD3  1  
ATOM 1473  H HE2  . LYS B 1 25 ? -2.844  -8.119  -16.322 1.00 0.59 ? 25 LYS B HE2  1  
ATOM 1474  H HE3  . LYS B 1 25 ? -3.965  -9.386  -15.825 1.00 0.59 ? 25 LYS B HE3  1  
ATOM 1475  H HZ1  . LYS B 1 25 ? -4.333  -8.925  -18.554 1.00 0.59 ? 25 LYS B HZ1  1  
ATOM 1476  H HZ2  . LYS B 1 25 ? -2.663  -9.086  -18.287 1.00 0.59 ? 25 LYS B HZ2  1  
ATOM 1477  H HZ3  . LYS B 1 25 ? -3.720  -10.319 -17.800 1.00 0.59 ? 25 LYS B HZ3  1  
ATOM 1478  N N    . GLU B 1 26 ? -7.653  -9.258  -13.004 1.00 0.53 ? 26 GLU B N    1  
ATOM 1479  C CA   . GLU B 1 26 ? -7.355  -10.229 -11.913 1.00 0.53 ? 26 GLU B CA   1  
ATOM 1480  C C    . GLU B 1 26 ? -7.400  -9.510  -10.563 1.00 0.53 ? 26 GLU B C    1  
ATOM 1481  O O    . GLU B 1 26 ? -7.487  -8.300  -10.497 1.00 0.53 ? 26 GLU B O    1  
ATOM 1482  C CB   . GLU B 1 26 ? -5.961  -10.824 -12.128 1.00 0.53 ? 26 GLU B CB   1  
ATOM 1483  C CG   . GLU B 1 26 ? -4.930  -9.696  -12.207 1.00 0.53 ? 26 GLU B CG   1  
ATOM 1484  C CD   . GLU B 1 26 ? -3.746  -10.144 -13.065 1.00 0.53 ? 26 GLU B CD   1  
ATOM 1485  O OE1  . GLU B 1 26 ? -3.686  -11.318 -13.390 1.00 0.53 ? 26 GLU B OE1  1  
ATOM 1486  O OE2  . GLU B 1 26 ? -2.920  -9.304  -13.384 1.00 0.53 ? 26 GLU B OE2  1  
ATOM 1487  H H    . GLU B 1 26 ? -7.537  -8.297  -12.852 1.00 0.53 ? 26 GLU B H    1  
ATOM 1488  H HA   . GLU B 1 26 ? -8.089  -11.021 -11.925 1.00 0.53 ? 26 GLU B HA   1  
ATOM 1489  H HB2  . GLU B 1 26 ? -5.718  -11.478 -11.303 1.00 0.53 ? 26 GLU B HB2  1  
ATOM 1490  H HB3  . GLU B 1 26 ? -5.947  -11.386 -13.050 1.00 0.53 ? 26 GLU B HB3  1  
ATOM 1491  H HG2  . GLU B 1 26 ? -5.387  -8.822  -12.648 1.00 0.53 ? 26 GLU B HG2  1  
ATOM 1492  H HG3  . GLU B 1 26 ? -4.582  -9.456  -11.213 1.00 0.53 ? 26 GLU B HG3  1  
ATOM 1493  N N    . TYR B 1 27 ? -7.341  -10.245 -9.487  1.00 0.39 ? 27 TYR B N    1  
ATOM 1494  C CA   . TYR B 1 27 ? -7.381  -9.602  -8.143  1.00 0.39 ? 27 TYR B CA   1  
ATOM 1495  C C    . TYR B 1 27 ? -6.334  -10.249 -7.233  1.00 0.39 ? 27 TYR B C    1  
ATOM 1496  O O    . TYR B 1 27 ? -5.511  -11.028 -7.672  1.00 0.39 ? 27 TYR B O    1  
ATOM 1497  C CB   . TYR B 1 27 ? -8.776  -9.780  -7.534  1.00 0.39 ? 27 TYR B CB   1  
ATOM 1498  C CG   . TYR B 1 27 ? -8.946  -11.201 -7.049  1.00 0.39 ? 27 TYR B CG   1  
ATOM 1499  C CD1  . TYR B 1 27 ? -9.271  -12.217 -7.955  1.00 0.39 ? 27 TYR B CD1  1  
ATOM 1500  C CD2  . TYR B 1 27 ? -8.776  -11.502 -5.692  1.00 0.39 ? 27 TYR B CD2  1  
ATOM 1501  C CE1  . TYR B 1 27 ? -9.426  -13.533 -7.505  1.00 0.39 ? 27 TYR B CE1  1  
ATOM 1502  C CE2  . TYR B 1 27 ? -8.931  -12.817 -5.242  1.00 0.39 ? 27 TYR B CE2  1  
ATOM 1503  C CZ   . TYR B 1 27 ? -9.255  -13.834 -6.148  1.00 0.39 ? 27 TYR B CZ   1  
ATOM 1504  O OH   . TYR B 1 27 ? -9.408  -15.131 -5.705  1.00 0.39 ? 27 TYR B OH   1  
ATOM 1505  H H    . TYR B 1 27 ? -7.271  -11.219 -9.561  1.00 0.39 ? 27 TYR B H    1  
ATOM 1506  H HA   . TYR B 1 27 ? -7.165  -8.548  -8.242  1.00 0.39 ? 27 TYR B HA   1  
ATOM 1507  H HB2  . TYR B 1 27 ? -8.894  -9.100  -6.701  1.00 0.39 ? 27 TYR B HB2  1  
ATOM 1508  H HB3  . TYR B 1 27 ? -9.525  -9.564  -8.282  1.00 0.39 ? 27 TYR B HB3  1  
ATOM 1509  H HD1  . TYR B 1 27 ? -9.402  -11.986 -9.003  1.00 0.39 ? 27 TYR B HD1  1  
ATOM 1510  H HD2  . TYR B 1 27 ? -8.526  -10.717 -4.993  1.00 0.39 ? 27 TYR B HD2  1  
ATOM 1511  H HE1  . TYR B 1 27 ? -9.677  -14.317 -8.204  1.00 0.39 ? 27 TYR B HE1  1  
ATOM 1512  H HE2  . TYR B 1 27 ? -8.799  -13.050 -4.195  1.00 0.39 ? 27 TYR B HE2  1  
ATOM 1513  H HH   . TYR B 1 27 ? -8.552  -15.444 -5.401  1.00 0.39 ? 27 TYR B HH   1  
ATOM 1514  N N    . PHE B 1 28 ? -6.361  -9.933  -5.967  1.00 0.35 ? 28 PHE B N    1  
ATOM 1515  C CA   . PHE B 1 28 ? -5.372  -10.532 -5.028  1.00 0.35 ? 28 PHE B CA   1  
ATOM 1516  C C    . PHE B 1 28 ? -5.649  -10.027 -3.610  1.00 0.35 ? 28 PHE B C    1  
ATOM 1517  O O    . PHE B 1 28 ? -6.242  -8.984  -3.416  1.00 0.35 ? 28 PHE B O    1  
ATOM 1518  C CB   . PHE B 1 28 ? -3.957  -10.130 -5.448  1.00 0.35 ? 28 PHE B CB   1  
ATOM 1519  C CG   . PHE B 1 28 ? -3.930  -8.663  -5.801  1.00 0.35 ? 28 PHE B CG   1  
ATOM 1520  C CD1  . PHE B 1 28 ? -3.949  -7.698  -4.786  1.00 0.35 ? 28 PHE B CD1  1  
ATOM 1521  C CD2  . PHE B 1 28 ? -3.883  -8.267  -7.143  1.00 0.35 ? 28 PHE B CD2  1  
ATOM 1522  C CE1  . PHE B 1 28 ? -3.922  -6.337  -5.115  1.00 0.35 ? 28 PHE B CE1  1  
ATOM 1523  C CE2  . PHE B 1 28 ? -3.856  -6.906  -7.471  1.00 0.35 ? 28 PHE B CE2  1  
ATOM 1524  C CZ   . PHE B 1 28 ? -3.875  -5.941  -6.457  1.00 0.35 ? 28 PHE B CZ   1  
ATOM 1525  H H    . PHE B 1 28 ? -7.035  -9.305  -5.635  1.00 0.35 ? 28 PHE B H    1  
ATOM 1526  H HA   . PHE B 1 28 ? -5.462  -11.608 -5.048  1.00 0.35 ? 28 PHE B HA   1  
ATOM 1527  H HB2  . PHE B 1 28 ? -3.273  -10.316 -4.632  1.00 0.35 ? 28 PHE B HB2  1  
ATOM 1528  H HB3  . PHE B 1 28 ? -3.658  -10.712 -6.307  1.00 0.35 ? 28 PHE B HB3  1  
ATOM 1529  H HD1  . PHE B 1 28 ? -3.985  -8.003  -3.751  1.00 0.35 ? 28 PHE B HD1  1  
ATOM 1530  H HD2  . PHE B 1 28 ? -3.868  -9.011  -7.925  1.00 0.35 ? 28 PHE B HD2  1  
ATOM 1531  H HE1  . PHE B 1 28 ? -3.937  -5.593  -4.332  1.00 0.35 ? 28 PHE B HE1  1  
ATOM 1532  H HE2  . PHE B 1 28 ? -3.820  -6.601  -8.505  1.00 0.35 ? 28 PHE B HE2  1  
ATOM 1533  H HZ   . PHE B 1 28 ? -3.854  -4.891  -6.709  1.00 0.35 ? 28 PHE B HZ   1  
ATOM 1534  N N    . TYR B 1 29 ? -5.228  -10.760 -2.616  1.00 0.32 ? 29 TYR B N    1  
ATOM 1535  C CA   . TYR B 1 29 ? -5.469  -10.322 -1.212  1.00 0.32 ? 29 TYR B CA   1  
ATOM 1536  C C    . TYR B 1 29 ? -4.296  -9.464  -0.734  1.00 0.32 ? 29 TYR B C    1  
ATOM 1537  O O    . TYR B 1 29 ? -3.273  -9.375  -1.385  1.00 0.32 ? 29 TYR B O    1  
ATOM 1538  C CB   . TYR B 1 29 ? -5.601  -11.551 -0.310  1.00 0.32 ? 29 TYR B CB   1  
ATOM 1539  C CG   . TYR B 1 29 ? -6.873  -12.292 -0.649  1.00 0.32 ? 29 TYR B CG   1  
ATOM 1540  C CD1  . TYR B 1 29 ? -6.899  -13.181 -1.730  1.00 0.32 ? 29 TYR B CD1  1  
ATOM 1541  C CD2  . TYR B 1 29 ? -8.026  -12.089 0.118   1.00 0.32 ? 29 TYR B CD2  1  
ATOM 1542  C CE1  . TYR B 1 29 ? -8.077  -13.869 -2.043  1.00 0.32 ? 29 TYR B CE1  1  
ATOM 1543  C CE2  . TYR B 1 29 ? -9.205  -12.777 -0.195  1.00 0.32 ? 29 TYR B CE2  1  
ATOM 1544  C CZ   . TYR B 1 29 ? -9.230  -13.667 -1.276  1.00 0.32 ? 29 TYR B CZ   1  
ATOM 1545  O OH   . TYR B 1 29 ? -10.392 -14.345 -1.584  1.00 0.32 ? 29 TYR B OH   1  
ATOM 1546  H H    . TYR B 1 29 ? -4.753  -11.598 -2.793  1.00 0.32 ? 29 TYR B H    1  
ATOM 1547  H HA   . TYR B 1 29 ? -6.380  -9.744  -1.167  1.00 0.32 ? 29 TYR B HA   1  
ATOM 1548  H HB2  . TYR B 1 29 ? -4.753  -12.203 -0.463  1.00 0.32 ? 29 TYR B HB2  1  
ATOM 1549  H HB3  . TYR B 1 29 ? -5.632  -11.238 0.722   1.00 0.32 ? 29 TYR B HB3  1  
ATOM 1550  H HD1  . TYR B 1 29 ? -6.009  -13.337 -2.322  1.00 0.32 ? 29 TYR B HD1  1  
ATOM 1551  H HD2  . TYR B 1 29 ? -8.007  -11.403 0.952   1.00 0.32 ? 29 TYR B HD2  1  
ATOM 1552  H HE1  . TYR B 1 29 ? -8.096  -14.555 -2.877  1.00 0.32 ? 29 TYR B HE1  1  
ATOM 1553  H HE2  . TYR B 1 29 ? -10.095 -12.621 0.397   1.00 0.32 ? 29 TYR B HE2  1  
ATOM 1554  H HH   . TYR B 1 29 ? -11.133 -13.821 -1.273  1.00 0.32 ? 29 TYR B HH   1  
ATOM 1555  N N    . THR B 1 30 ? -4.435  -8.831  0.398   1.00 0.37 ? 30 THR B N    1  
ATOM 1556  C CA   . THR B 1 30 ? -3.328  -7.979  0.917   1.00 0.37 ? 30 THR B CA   1  
ATOM 1557  C C    . THR B 1 30 ? -3.365  -7.968  2.446   1.00 0.37 ? 30 THR B C    1  
ATOM 1558  O O    . THR B 1 30 ? -4.418  -7.912  3.050   1.00 0.37 ? 30 THR B O    1  
ATOM 1559  C CB   . THR B 1 30 ? -3.496  -6.551  0.393   1.00 0.37 ? 30 THR B CB   1  
ATOM 1560  O OG1  . THR B 1 30 ? -4.713  -6.009  0.886   1.00 0.37 ? 30 THR B OG1  1  
ATOM 1561  C CG2  . THR B 1 30 ? -3.522  -6.564  -1.136  1.00 0.37 ? 30 THR B CG2  1  
ATOM 1562  H H    . THR B 1 30 ? -5.267  -8.916  0.908   1.00 0.37 ? 30 THR B H    1  
ATOM 1563  H HA   . THR B 1 30 ? -2.380  -8.376  0.583   1.00 0.37 ? 30 THR B HA   1  
ATOM 1564  H HB   . THR B 1 30 ? -2.669  -5.945  0.731   1.00 0.37 ? 30 THR B HB   1  
ATOM 1565  H HG1  . THR B 1 30 ? -5.392  -6.683  0.804   1.00 0.37 ? 30 THR B HG1  1  
ATOM 1566  H HG21 . THR B 1 30 ? -4.288  -7.244  -1.477  1.00 0.37 ? 30 THR B HG21 1  
ATOM 1567  H HG22 . THR B 1 30 ? -3.734  -5.570  -1.501  1.00 0.37 ? 30 THR B HG22 1  
ATOM 1568  H HG23 . THR B 1 30 ? -2.561  -6.887  -1.509  1.00 0.37 ? 30 THR B HG23 1  
ATOM 1569  N N    . SER B 1 31 ? -2.225  -8.019  3.078   1.00 0.47 ? 31 SER B N    1  
ATOM 1570  C CA   . SER B 1 31 ? -2.197  -8.010  4.567   1.00 0.47 ? 31 SER B CA   1  
ATOM 1571  C C    . SER B 1 31 ? -0.746  -8.051  5.051   1.00 0.47 ? 31 SER B C    1  
ATOM 1572  O O    . SER B 1 31 ? 0.179   -7.862  4.288   1.00 0.47 ? 31 SER B O    1  
ATOM 1573  C CB   . SER B 1 31 ? -2.946  -9.231  5.098   1.00 0.47 ? 31 SER B CB   1  
ATOM 1574  O OG   . SER B 1 31 ? -3.404  -8.964  6.418   1.00 0.47 ? 31 SER B OG   1  
ATOM 1575  H H    . SER B 1 31 ? -1.386  -8.062  2.572   1.00 0.47 ? 31 SER B H    1  
ATOM 1576  H HA   . SER B 1 31 ? -2.671  -7.111  4.929   1.00 0.47 ? 31 SER B HA   1  
ATOM 1577  H HB2  . SER B 1 31 ? -3.793  -9.441  4.465   1.00 0.47 ? 31 SER B HB2  1  
ATOM 1578  H HB3  . SER B 1 31 ? -2.283  -10.087 5.103   1.00 0.47 ? 31 SER B HB3  1  
ATOM 1579  H HG   . SER B 1 31 ? -3.346  -9.779  6.923   1.00 0.47 ? 31 SER B HG   1  
ATOM 1580  N N    . GLY B 1 32 ? -0.541  -8.296  6.317   1.00 0.60 ? 32 GLY B N    1  
ATOM 1581  C CA   . GLY B 1 32 ? 0.850   -8.349  6.850   1.00 0.60 ? 32 GLY B CA   1  
ATOM 1582  C C    . GLY B 1 32 ? 1.370   -6.925  7.056   1.00 0.60 ? 32 GLY B C    1  
ATOM 1583  O O    . GLY B 1 32 ? 1.412   -6.423  8.162   1.00 0.60 ? 32 GLY B O    1  
ATOM 1584  H H    . GLY B 1 32 ? -1.301  -8.445  6.917   1.00 0.60 ? 32 GLY B H    1  
ATOM 1585  H HA2  . GLY B 1 32 ? 0.854   -8.876  7.794   1.00 0.60 ? 32 GLY B HA2  1  
ATOM 1586  H HA3  . GLY B 1 32 ? 1.487   -8.862  6.147   1.00 0.60 ? 32 GLY B HA3  1  
ATOM 1587  N N    . LYS B 1 33 ? 1.766   -6.269  6.000   1.00 0.55 ? 33 LYS B N    1  
ATOM 1588  C CA   . LYS B 1 33 ? 2.281   -4.879  6.136   1.00 0.55 ? 33 LYS B CA   1  
ATOM 1589  C C    . LYS B 1 33 ? 1.117   -3.892  6.026   1.00 0.55 ? 33 LYS B C    1  
ATOM 1590  O O    . LYS B 1 33 ? 1.245   -2.827  5.454   1.00 0.55 ? 33 LYS B O    1  
ATOM 1591  C CB   . LYS B 1 33 ? 3.293   -4.598  5.023   1.00 0.55 ? 33 LYS B CB   1  
ATOM 1592  C CG   . LYS B 1 33 ? 4.587   -5.365  5.305   1.00 0.55 ? 33 LYS B CG   1  
ATOM 1593  C CD   . LYS B 1 33 ? 5.762   -4.640  4.646   1.00 0.55 ? 33 LYS B CD   1  
ATOM 1594  C CE   . LYS B 1 33 ? 6.668   -5.660  3.954   1.00 0.55 ? 33 LYS B CE   1  
ATOM 1595  N NZ   . LYS B 1 33 ? 7.660   -4.944  3.101   1.00 0.55 ? 33 LYS B NZ   1  
ATOM 1596  H H    . LYS B 1 33 ? 1.723   -6.692  5.117   1.00 0.55 ? 33 LYS B H    1  
ATOM 1597  H HA   . LYS B 1 33 ? 2.761   -4.764  7.096   1.00 0.55 ? 33 LYS B HA   1  
ATOM 1598  H HB2  . LYS B 1 33 ? 2.883   -4.917  4.075   1.00 0.55 ? 33 LYS B HB2  1  
ATOM 1599  H HB3  . LYS B 1 33 ? 3.505   -3.541  4.987   1.00 0.55 ? 33 LYS B HB3  1  
ATOM 1600  H HG2  . LYS B 1 33 ? 4.748   -5.419  6.371   1.00 0.55 ? 33 LYS B HG2  1  
ATOM 1601  H HG3  . LYS B 1 33 ? 4.509   -6.363  4.900   1.00 0.55 ? 33 LYS B HG3  1  
ATOM 1602  H HD2  . LYS B 1 33 ? 5.387   -3.937  3.917   1.00 0.55 ? 33 LYS B HD2  1  
ATOM 1603  H HD3  . LYS B 1 33 ? 6.327   -4.112  5.399   1.00 0.55 ? 33 LYS B HD3  1  
ATOM 1604  H HE2  . LYS B 1 33 ? 7.189   -6.243  4.699   1.00 0.55 ? 33 LYS B HE2  1  
ATOM 1605  H HE3  . LYS B 1 33 ? 6.070   -6.314  3.338   1.00 0.55 ? 33 LYS B HE3  1  
ATOM 1606  H HZ1  . LYS B 1 33 ? 7.330   -3.975  2.924   1.00 0.55 ? 33 LYS B HZ1  1  
ATOM 1607  H HZ2  . LYS B 1 33 ? 8.578   -4.914  3.591   1.00 0.55 ? 33 LYS B HZ2  1  
ATOM 1608  H HZ3  . LYS B 1 33 ? 7.765   -5.444  2.196   1.00 0.55 ? 33 LYS B HZ3  1  
ATOM 1609  N N    . CYS B 1 34 ? -0.018  -4.238  6.567   1.00 0.46 ? 34 CYS B N    1  
ATOM 1610  C CA   . CYS B 1 34 ? -1.190  -3.322  6.491   1.00 0.46 ? 34 CYS B CA   1  
ATOM 1611  C C    . CYS B 1 34 ? -1.940  -3.336  7.824   1.00 0.46 ? 34 CYS B C    1  
ATOM 1612  O O    . CYS B 1 34 ? -1.527  -3.972  8.773   1.00 0.46 ? 34 CYS B O    1  
ATOM 1613  C CB   . CYS B 1 34 ? -2.127  -3.786  5.374   1.00 0.46 ? 34 CYS B CB   1  
ATOM 1614  S SG   . CYS B 1 34 ? -1.146  -4.288  3.938   1.00 0.46 ? 34 CYS B SG   1  
ATOM 1615  H H    . CYS B 1 34 ? -0.102  -5.102  7.022   1.00 0.46 ? 34 CYS B H    1  
ATOM 1616  H HA   . CYS B 1 34 ? -0.849  -2.318  6.279   1.00 0.46 ? 34 CYS B HA   1  
ATOM 1617  H HB2  . CYS B 1 34 ? -2.712  -4.625  5.721   1.00 0.46 ? 34 CYS B HB2  1  
ATOM 1618  H HB3  . CYS B 1 34 ? -2.785  -2.977  5.096   1.00 0.46 ? 34 CYS B HB3  1  
ATOM 1619  N N    . SER B 1 35 ? -3.040  -2.638  7.903   1.00 0.42 ? 35 SER B N    1  
ATOM 1620  C CA   . SER B 1 35 ? -3.816  -2.613  9.175   1.00 0.42 ? 35 SER B CA   1  
ATOM 1621  C C    . SER B 1 35 ? -4.790  -3.792  9.200   1.00 0.42 ? 35 SER B C    1  
ATOM 1622  O O    . SER B 1 35 ? -5.064  -4.361  10.238  1.00 0.42 ? 35 SER B O    1  
ATOM 1623  C CB   . SER B 1 35 ? -4.599  -1.304  9.268   1.00 0.42 ? 35 SER B CB   1  
ATOM 1624  O OG   . SER B 1 35 ? -3.752  -0.285  9.784   1.00 0.42 ? 35 SER B OG   1  
ATOM 1625  H H    . SER B 1 35 ? -3.356  -2.132  7.126   1.00 0.42 ? 35 SER B H    1  
ATOM 1626  H HA   . SER B 1 35 ? -3.137  -2.687  10.012  1.00 0.42 ? 35 SER B HA   1  
ATOM 1627  H HB2  . SER B 1 35 ? -4.942  -1.016  8.288   1.00 0.42 ? 35 SER B HB2  1  
ATOM 1628  H HB3  . SER B 1 35 ? -5.453  -1.441  9.920   1.00 0.42 ? 35 SER B HB3  1  
ATOM 1629  H HG   . SER B 1 35 ? -2.967  -0.245  9.233   1.00 0.42 ? 35 SER B HG   1  
ATOM 1630  N N    . ASN B 1 36 ? -5.315  -4.165  8.065   1.00 0.38 ? 36 ASN B N    1  
ATOM 1631  C CA   . ASN B 1 36 ? -6.271  -5.307  8.025   1.00 0.38 ? 36 ASN B CA   1  
ATOM 1632  C C    . ASN B 1 36 ? -6.166  -6.011  6.668   1.00 0.38 ? 36 ASN B C    1  
ATOM 1633  O O    . ASN B 1 36 ? -5.864  -5.388  5.671   1.00 0.38 ? 36 ASN B O    1  
ATOM 1634  C CB   . ASN B 1 36 ? -7.700  -4.789  8.220   1.00 0.38 ? 36 ASN B CB   1  
ATOM 1635  C CG   . ASN B 1 36 ? -7.680  -3.554  9.121   1.00 0.38 ? 36 ASN B CG   1  
ATOM 1636  O OD1  . ASN B 1 36 ? -7.490  -3.662  10.317  1.00 0.38 ? 36 ASN B OD1  1  
ATOM 1637  N ND2  . ASN B 1 36 ? -7.870  -2.374  8.596   1.00 0.38 ? 36 ASN B ND2  1  
ATOM 1638  H H    . ASN B 1 36 ? -5.081  -3.693  7.239   1.00 0.38 ? 36 ASN B H    1  
ATOM 1639  H HA   . ASN B 1 36 ? -6.031  -6.006  8.812   1.00 0.38 ? 36 ASN B HA   1  
ATOM 1640  H HB2  . ASN B 1 36 ? -8.120  -4.528  7.259   1.00 0.38 ? 36 ASN B HB2  1  
ATOM 1641  H HB3  . ASN B 1 36 ? -8.301  -5.559  8.679   1.00 0.38 ? 36 ASN B HB3  1  
ATOM 1642  H HD21 . ASN B 1 36 ? -8.023  -2.287  7.632   1.00 0.38 ? 36 ASN B HD21 1  
ATOM 1643  H HD22 . ASN B 1 36 ? -7.860  -1.577  9.165   1.00 0.38 ? 36 ASN B HD22 1  
ATOM 1644  N N    . PRO B 1 37 ? -6.421  -7.294  6.676   1.00 0.37 ? 37 PRO B N    1  
ATOM 1645  C CA   . PRO B 1 37 ? -6.366  -8.122  5.459   1.00 0.37 ? 37 PRO B CA   1  
ATOM 1646  C C    . PRO B 1 37 ? -7.628  -7.912  4.616   1.00 0.37 ? 37 PRO B C    1  
ATOM 1647  O O    . PRO B 1 37 ? -8.735  -8.072  5.090   1.00 0.37 ? 37 PRO B O    1  
ATOM 1648  C CB   . PRO B 1 37 ? -6.301  -9.553  6.000   1.00 0.37 ? 37 PRO B CB   1  
ATOM 1649  C CG   . PRO B 1 37 ? -6.885  -9.505  7.432   1.00 0.37 ? 37 PRO B CG   1  
ATOM 1650  C CD   . PRO B 1 37 ? -6.787  -8.040  7.898   1.00 0.37 ? 37 PRO B CD   1  
ATOM 1651  H HA   . PRO B 1 37 ? -5.480  -7.902  4.886   1.00 0.37 ? 37 PRO B HA   1  
ATOM 1652  H HB2  . PRO B 1 37 ? -6.890  -10.212 5.376   1.00 0.37 ? 37 PRO B HB2  1  
ATOM 1653  H HB3  . PRO B 1 37 ? -5.278  -9.891  6.036   1.00 0.37 ? 37 PRO B HB3  1  
ATOM 1654  H HG2  . PRO B 1 37 ? -7.919  -9.824  7.420   1.00 0.37 ? 37 PRO B HG2  1  
ATOM 1655  H HG3  . PRO B 1 37 ? -6.308  -10.136 8.090   1.00 0.37 ? 37 PRO B HG3  1  
ATOM 1656  H HD2  . PRO B 1 37 ? -7.740  -7.700  8.280   1.00 0.37 ? 37 PRO B HD2  1  
ATOM 1657  H HD3  . PRO B 1 37 ? -6.017  -7.930  8.646   1.00 0.37 ? 37 PRO B HD3  1  
ATOM 1658  N N    . ALA B 1 38 ? -7.469  -7.554  3.371   1.00 0.33 ? 38 ALA B N    1  
ATOM 1659  C CA   . ALA B 1 38 ? -8.661  -7.332  2.504   1.00 0.33 ? 38 ALA B CA   1  
ATOM 1660  C C    . ALA B 1 38 ? -8.356  -7.807  1.082   1.00 0.33 ? 38 ALA B C    1  
ATOM 1661  O O    . ALA B 1 38 ? -7.245  -8.186  0.768   1.00 0.33 ? 38 ALA B O    1  
ATOM 1662  C CB   . ALA B 1 38 ? -9.003  -5.842  2.480   1.00 0.33 ? 38 ALA B CB   1  
ATOM 1663  H H    . ALA B 1 38 ? -6.568  -7.429  3.007   1.00 0.33 ? 38 ALA B H    1  
ATOM 1664  H HA   . ALA B 1 38 ? -9.500  -7.887  2.897   1.00 0.33 ? 38 ALA B HA   1  
ATOM 1665  H HB1  . ALA B 1 38 ? -8.096  -5.266  2.362   1.00 0.33 ? 38 ALA B HB1  1  
ATOM 1666  H HB2  . ALA B 1 38 ? -9.669  -5.638  1.654   1.00 0.33 ? 38 ALA B HB2  1  
ATOM 1667  H HB3  . ALA B 1 38 ? -9.485  -5.568  3.407   1.00 0.33 ? 38 ALA B HB3  1  
ATOM 1668  N N    . VAL B 1 39 ? -9.336  -7.789  0.220   1.00 0.30 ? 39 VAL B N    1  
ATOM 1669  C CA   . VAL B 1 39 ? -9.103  -8.238  -1.182  1.00 0.30 ? 39 VAL B CA   1  
ATOM 1670  C C    . VAL B 1 39 ? -8.851  -7.018  -2.071  1.00 0.30 ? 39 VAL B C    1  
ATOM 1671  O O    . VAL B 1 39 ? -9.097  -5.893  -1.683  1.00 0.30 ? 39 VAL B O    1  
ATOM 1672  C CB   . VAL B 1 39 ? -10.336 -8.993  -1.686  1.00 0.30 ? 39 VAL B CB   1  
ATOM 1673  C CG1  . VAL B 1 39 ? -10.246 -9.170  -3.203  1.00 0.30 ? 39 VAL B CG1  1  
ATOM 1674  C CG2  . VAL B 1 39 ? -10.396 -10.368 -1.018  1.00 0.30 ? 39 VAL B CG2  1  
ATOM 1675  H H    . VAL B 1 39 ? -10.224 -7.479  0.494   1.00 0.30 ? 39 VAL B H    1  
ATOM 1676  H HA   . VAL B 1 39 ? -8.243  -8.890  -1.213  1.00 0.30 ? 39 VAL B HA   1  
ATOM 1677  H HB   . VAL B 1 39 ? -11.225 -8.433  -1.441  1.00 0.30 ? 39 VAL B HB   1  
ATOM 1678  H HG11 . VAL B 1 39 ? -9.306  -9.637  -3.456  1.00 0.30 ? 39 VAL B HG11 1  
ATOM 1679  H HG12 . VAL B 1 39 ? -11.061 -9.793  -3.541  1.00 0.30 ? 39 VAL B HG12 1  
ATOM 1680  H HG13 . VAL B 1 39 ? -10.308 -8.204  -3.683  1.00 0.30 ? 39 VAL B HG13 1  
ATOM 1681  H HG21 . VAL B 1 39 ? -9.854  -10.339 -0.085  1.00 0.30 ? 39 VAL B HG21 1  
ATOM 1682  H HG22 . VAL B 1 39 ? -11.425 -10.631 -0.829  1.00 0.30 ? 39 VAL B HG22 1  
ATOM 1683  H HG23 . VAL B 1 39 ? -9.950  -11.104 -1.670  1.00 0.30 ? 39 VAL B HG23 1  
ATOM 1684  N N    . VAL B 1 40 ? -8.360  -7.232  -3.261  1.00 0.33 ? 40 VAL B N    1  
ATOM 1685  C CA   . VAL B 1 40 ? -8.090  -6.086  -4.174  1.00 0.33 ? 40 VAL B CA   1  
ATOM 1686  C C    . VAL B 1 40 ? -8.361  -6.515  -5.618  1.00 0.33 ? 40 VAL B C    1  
ATOM 1687  O O    . VAL B 1 40 ? -7.694  -7.376  -6.155  1.00 0.33 ? 40 VAL B O    1  
ATOM 1688  C CB   . VAL B 1 40 ? -6.629  -5.657  -4.030  1.00 0.33 ? 40 VAL B CB   1  
ATOM 1689  C CG1  . VAL B 1 40 ? -6.251  -4.722  -5.180  1.00 0.33 ? 40 VAL B CG1  1  
ATOM 1690  C CG2  . VAL B 1 40 ? -6.443  -4.925  -2.699  1.00 0.33 ? 40 VAL B CG2  1  
ATOM 1691  H H    . VAL B 1 40 ? -8.168  -8.147  -3.553  1.00 0.33 ? 40 VAL B H    1  
ATOM 1692  H HA   . VAL B 1 40 ? -8.737  -5.261  -3.916  1.00 0.33 ? 40 VAL B HA   1  
ATOM 1693  H HB   . VAL B 1 40 ? -5.994  -6.531  -4.053  1.00 0.33 ? 40 VAL B HB   1  
ATOM 1694  H HG11 . VAL B 1 40 ? -7.047  -4.008  -5.342  1.00 0.33 ? 40 VAL B HG11 1  
ATOM 1695  H HG12 . VAL B 1 40 ? -5.340  -4.196  -4.933  1.00 0.33 ? 40 VAL B HG12 1  
ATOM 1696  H HG13 . VAL B 1 40 ? -6.099  -5.301  -6.079  1.00 0.33 ? 40 VAL B HG13 1  
ATOM 1697  H HG21 . VAL B 1 40 ? -7.143  -4.103  -2.640  1.00 0.33 ? 40 VAL B HG21 1  
ATOM 1698  H HG22 . VAL B 1 40 ? -6.623  -5.609  -1.883  1.00 0.33 ? 40 VAL B HG22 1  
ATOM 1699  H HG23 . VAL B 1 40 ? -5.434  -4.544  -2.634  1.00 0.33 ? 40 VAL B HG23 1  
ATOM 1700  N N    . PHE B 1 41 ? -9.335  -5.921  -6.250  1.00 0.37 ? 41 PHE B N    1  
ATOM 1701  C CA   . PHE B 1 41 ? -9.646  -6.295  -7.659  1.00 0.37 ? 41 PHE B CA   1  
ATOM 1702  C C    . PHE B 1 41 ? -8.831  -5.420  -8.613  1.00 0.37 ? 41 PHE B C    1  
ATOM 1703  O O    . PHE B 1 41 ? -8.446  -4.316  -8.282  1.00 0.37 ? 41 PHE B O    1  
ATOM 1704  C CB   . PHE B 1 41 ? -11.139 -6.086  -7.923  1.00 0.37 ? 41 PHE B CB   1  
ATOM 1705  C CG   . PHE B 1 41 ? -11.928 -7.182  -7.246  1.00 0.37 ? 41 PHE B CG   1  
ATOM 1706  C CD1  . PHE B 1 41 ? -12.099 -8.417  -7.883  1.00 0.37 ? 41 PHE B CD1  1  
ATOM 1707  C CD2  . PHE B 1 41 ? -12.488 -6.961  -5.982  1.00 0.37 ? 41 PHE B CD2  1  
ATOM 1708  C CE1  . PHE B 1 41 ? -12.831 -9.432  -7.254  1.00 0.37 ? 41 PHE B CE1  1  
ATOM 1709  C CE2  . PHE B 1 41 ? -13.219 -7.977  -5.354  1.00 0.37 ? 41 PHE B CE2  1  
ATOM 1710  C CZ   . PHE B 1 41 ? -13.391 -9.212  -5.990  1.00 0.37 ? 41 PHE B CZ   1  
ATOM 1711  H H    . PHE B 1 41 ? -9.862  -5.228  -5.800  1.00 0.37 ? 41 PHE B H    1  
ATOM 1712  H HA   . PHE B 1 41 ? -9.394  -7.334  -7.818  1.00 0.37 ? 41 PHE B HA   1  
ATOM 1713  H HB2  . PHE B 1 41 ? -11.443 -5.128  -7.531  1.00 0.37 ? 41 PHE B HB2  1  
ATOM 1714  H HB3  . PHE B 1 41 ? -11.324 -6.116  -8.987  1.00 0.37 ? 41 PHE B HB3  1  
ATOM 1715  H HD1  . PHE B 1 41 ? -11.667 -8.586  -8.857  1.00 0.37 ? 41 PHE B HD1  1  
ATOM 1716  H HD2  . PHE B 1 41 ? -12.355 -6.009  -5.492  1.00 0.37 ? 41 PHE B HD2  1  
ATOM 1717  H HE1  . PHE B 1 41 ? -12.963 -10.385 -7.745  1.00 0.37 ? 41 PHE B HE1  1  
ATOM 1718  H HE2  . PHE B 1 41 ? -13.651 -7.807  -4.379  1.00 0.37 ? 41 PHE B HE2  1  
ATOM 1719  H HZ   . PHE B 1 41 ? -13.955 -9.996  -5.506  1.00 0.37 ? 41 PHE B HZ   1  
ATOM 1720  N N    . VAL B 1 42 ? -8.565  -5.905  -9.794  1.00 0.46 ? 42 VAL B N    1  
ATOM 1721  C CA   . VAL B 1 42 ? -7.773  -5.102  -10.769 1.00 0.46 ? 42 VAL B CA   1  
ATOM 1722  C C    . VAL B 1 42 ? -8.399  -5.232  -12.160 1.00 0.46 ? 42 VAL B C    1  
ATOM 1723  O O    . VAL B 1 42 ? -8.510  -6.314  -12.703 1.00 0.46 ? 42 VAL B O    1  
ATOM 1724  C CB   . VAL B 1 42 ? -6.335  -5.618  -10.807 1.00 0.46 ? 42 VAL B CB   1  
ATOM 1725  C CG1  . VAL B 1 42 ? -5.483  -4.697  -11.682 1.00 0.46 ? 42 VAL B CG1  1  
ATOM 1726  C CG2  . VAL B 1 42 ? -5.765  -5.641  -9.386  1.00 0.46 ? 42 VAL B CG2  1  
ATOM 1727  H H    . VAL B 1 42 ? -8.884  -6.798  -10.041 1.00 0.46 ? 42 VAL B H    1  
ATOM 1728  H HA   . VAL B 1 42 ? -7.777  -4.065  -10.468 1.00 0.46 ? 42 VAL B HA   1  
ATOM 1729  H HB   . VAL B 1 42 ? -6.321  -6.617  -11.218 1.00 0.46 ? 42 VAL B HB   1  
ATOM 1730  H HG11 . VAL B 1 42 ? -6.039  -4.428  -12.568 1.00 0.46 ? 42 VAL B HG11 1  
ATOM 1731  H HG12 . VAL B 1 42 ? -5.234  -3.804  -11.128 1.00 0.46 ? 42 VAL B HG12 1  
ATOM 1732  H HG13 . VAL B 1 42 ? -4.575  -5.209  -11.967 1.00 0.46 ? 42 VAL B HG13 1  
ATOM 1733  H HG21 . VAL B 1 42 ? -6.458  -5.155  -8.714  1.00 0.46 ? 42 VAL B HG21 1  
ATOM 1734  H HG22 . VAL B 1 42 ? -5.617  -6.664  -9.074  1.00 0.46 ? 42 VAL B HG22 1  
ATOM 1735  H HG23 . VAL B 1 42 ? -4.820  -5.119  -9.370  1.00 0.46 ? 42 VAL B HG23 1  
ATOM 1736  N N    . THR B 1 43 ? -8.806  -4.136  -12.740 1.00 0.54 ? 43 THR B N    1  
ATOM 1737  C CA   . THR B 1 43 ? -9.425  -4.196  -14.094 1.00 0.54 ? 43 THR B CA   1  
ATOM 1738  C C    . THR B 1 43 ? -8.338  -4.053  -15.161 1.00 0.54 ? 43 THR B C    1  
ATOM 1739  O O    . THR B 1 43 ? -7.164  -3.964  -14.858 1.00 0.54 ? 43 THR B O    1  
ATOM 1740  C CB   . THR B 1 43 ? -10.438 -3.059  -14.243 1.00 0.54 ? 43 THR B CB   1  
ATOM 1741  O OG1  . THR B 1 43 ? -9.748  -1.817  -14.302 1.00 0.54 ? 43 THR B OG1  1  
ATOM 1742  C CG2  . THR B 1 43 ? -11.388 -3.059  -13.045 1.00 0.54 ? 43 THR B CG2  1  
ATOM 1743  H H    . THR B 1 43 ? -8.707  -3.274  -12.285 1.00 0.54 ? 43 THR B H    1  
ATOM 1744  H HA   . THR B 1 43 ? -9.928  -5.143  -14.218 1.00 0.54 ? 43 THR B HA   1  
ATOM 1745  H HB   . THR B 1 43 ? -11.007 -3.198  -15.148 1.00 0.54 ? 43 THR B HB   1  
ATOM 1746  H HG1  . THR B 1 43 ? -10.401 -1.116  -14.335 1.00 0.54 ? 43 THR B HG1  1  
ATOM 1747  H HG21 . THR B 1 43 ? -11.657 -4.076  -12.798 1.00 0.54 ? 43 THR B HG21 1  
ATOM 1748  H HG22 . THR B 1 43 ? -10.900 -2.601  -12.197 1.00 0.54 ? 43 THR B HG22 1  
ATOM 1749  H HG23 . THR B 1 43 ? -12.279 -2.502  -13.291 1.00 0.54 ? 43 THR B HG23 1  
ATOM 1750  N N    . ARG B 1 44 ? -8.718  -4.029  -16.410 1.00 0.69 ? 44 ARG B N    1  
ATOM 1751  C CA   . ARG B 1 44 ? -7.707  -3.892  -17.495 1.00 0.69 ? 44 ARG B CA   1  
ATOM 1752  C C    . ARG B 1 44 ? -7.103  -2.486  -17.457 1.00 0.69 ? 44 ARG B C    1  
ATOM 1753  O O    . ARG B 1 44 ? -6.045  -2.240  -17.999 1.00 0.69 ? 44 ARG B O    1  
ATOM 1754  C CB   . ARG B 1 44 ? -8.379  -4.121  -18.851 1.00 0.69 ? 44 ARG B CB   1  
ATOM 1755  C CG   . ARG B 1 44 ? -8.825  -5.580  -18.961 1.00 0.69 ? 44 ARG B CG   1  
ATOM 1756  C CD   . ARG B 1 44 ? -9.152  -5.906  -20.419 1.00 0.69 ? 44 ARG B CD   1  
ATOM 1757  N NE   . ARG B 1 44 ? -8.650  -7.269  -20.749 1.00 0.69 ? 44 ARG B NE   1  
ATOM 1758  C CZ   . ARG B 1 44 ? -9.470  -8.285  -20.747 1.00 0.69 ? 44 ARG B CZ   1  
ATOM 1759  N NH1  . ARG B 1 44 ? -10.244 -8.496  -19.720 1.00 0.69 ? 44 ARG B NH1  1  
ATOM 1760  N NH2  . ARG B 1 44 ? -9.514  -9.088  -21.775 1.00 0.69 ? 44 ARG B NH2  1  
ATOM 1761  H H    . ARG B 1 44 ? -9.669  -4.103  -16.632 1.00 0.69 ? 44 ARG B H    1  
ATOM 1762  H HA   . ARG B 1 44 ? -6.925  -4.624  -17.353 1.00 0.69 ? 44 ARG B HA   1  
ATOM 1763  H HB2  . ARG B 1 44 ? -9.240  -3.473  -18.938 1.00 0.69 ? 44 ARG B HB2  1  
ATOM 1764  H HB3  . ARG B 1 44 ? -7.679  -3.899  -19.642 1.00 0.69 ? 44 ARG B HB3  1  
ATOM 1765  H HG2  . ARG B 1 44 ? -8.029  -6.225  -18.617 1.00 0.69 ? 44 ARG B HG2  1  
ATOM 1766  H HG3  . ARG B 1 44 ? -9.703  -5.735  -18.354 1.00 0.69 ? 44 ARG B HG3  1  
ATOM 1767  H HD2  . ARG B 1 44 ? -10.221 -5.871  -20.565 1.00 0.69 ? 44 ARG B HD2  1  
ATOM 1768  H HD3  . ARG B 1 44 ? -8.676  -5.181  -21.065 1.00 0.69 ? 44 ARG B HD3  1  
ATOM 1769  H HE   . ARG B 1 44 ? -7.703  -7.404  -20.967 1.00 0.69 ? 44 ARG B HE   1  
ATOM 1770  H HH11 . ARG B 1 44 ? -10.211 -7.880  -18.932 1.00 0.69 ? 44 ARG B HH11 1  
ATOM 1771  H HH12 . ARG B 1 44 ? -10.874 -9.273  -19.718 1.00 0.69 ? 44 ARG B HH12 1  
ATOM 1772  H HH21 . ARG B 1 44 ? -8.921  -8.926  -22.563 1.00 0.69 ? 44 ARG B HH21 1  
ATOM 1773  H HH22 . ARG B 1 44 ? -10.143 -9.866  -21.774 1.00 0.69 ? 44 ARG B HH22 1  
ATOM 1774  N N    . LYS B 1 45 ? -7.769  -1.562  -16.820 1.00 0.66 ? 45 LYS B N    1  
ATOM 1775  C CA   . LYS B 1 45 ? -7.233  -0.173  -16.748 1.00 0.66 ? 45 LYS B CA   1  
ATOM 1776  C C    . LYS B 1 45 ? -6.332  -0.037  -15.519 1.00 0.66 ? 45 LYS B C    1  
ATOM 1777  O O    . LYS B 1 45 ? -6.288  0.998   -14.883 1.00 0.66 ? 45 LYS B O    1  
ATOM 1778  C CB   . LYS B 1 45 ? -8.394  0.816   -16.642 1.00 0.66 ? 45 LYS B CB   1  
ATOM 1779  C CG   . LYS B 1 45 ? -9.307  0.666   -17.859 1.00 0.66 ? 45 LYS B CG   1  
ATOM 1780  C CD   . LYS B 1 45 ? -8.485  0.824   -19.139 1.00 0.66 ? 45 LYS B CD   1  
ATOM 1781  C CE   . LYS B 1 45 ? -7.806  2.196   -19.144 1.00 0.66 ? 45 LYS B CE   1  
ATOM 1782  N NZ   . LYS B 1 45 ? -7.774  2.729   -20.536 1.00 0.66 ? 45 LYS B NZ   1  
ATOM 1783  H H    . LYS B 1 45 ? -8.621  -1.781  -16.390 1.00 0.66 ? 45 LYS B H    1  
ATOM 1784  H HA   . LYS B 1 45 ? -6.660  0.038   -17.640 1.00 0.66 ? 45 LYS B HA   1  
ATOM 1785  H HB2  . LYS B 1 45 ? -8.956  0.617   -15.741 1.00 0.66 ? 45 LYS B HB2  1  
ATOM 1786  H HB3  . LYS B 1 45 ? -8.007  1.824   -16.609 1.00 0.66 ? 45 LYS B HB3  1  
ATOM 1787  H HG2  . LYS B 1 45 ? -9.768  -0.311  -17.845 1.00 0.66 ? 45 LYS B HG2  1  
ATOM 1788  H HG3  . LYS B 1 45 ? -10.074 1.426   -17.831 1.00 0.66 ? 45 LYS B HG3  1  
ATOM 1789  H HD2  . LYS B 1 45 ? -7.733  0.050   -19.182 1.00 0.66 ? 45 LYS B HD2  1  
ATOM 1790  H HD3  . LYS B 1 45 ? -9.134  0.744   -19.998 1.00 0.66 ? 45 LYS B HD3  1  
ATOM 1791  H HE2  . LYS B 1 45 ? -8.360  2.873   -18.511 1.00 0.66 ? 45 LYS B HE2  1  
ATOM 1792  H HE3  . LYS B 1 45 ? -6.797  2.099   -18.773 1.00 0.66 ? 45 LYS B HE3  1  
ATOM 1793  H HZ1  . LYS B 1 45 ? -7.407  1.998   -21.178 1.00 0.66 ? 45 LYS B HZ1  1  
ATOM 1794  H HZ2  . LYS B 1 45 ? -8.735  2.997   -20.827 1.00 0.66 ? 45 LYS B HZ2  1  
ATOM 1795  H HZ3  . LYS B 1 45 ? -7.158  3.566   -20.572 1.00 0.66 ? 45 LYS B HZ3  1  
ATOM 1796  N N    . ASN B 1 46 ? -5.613  -1.072  -15.180 1.00 0.61 ? 46 ASN B N    1  
ATOM 1797  C CA   . ASN B 1 46 ? -4.717  -0.998  -13.992 1.00 0.61 ? 46 ASN B CA   1  
ATOM 1798  C C    . ASN B 1 46 ? -5.459  -0.324  -12.836 1.00 0.61 ? 46 ASN B C    1  
ATOM 1799  O O    . ASN B 1 46 ? -4.861  0.304   -11.984 1.00 0.61 ? 46 ASN B O    1  
ATOM 1800  C CB   . ASN B 1 46 ? -3.471  -0.181  -14.343 1.00 0.61 ? 46 ASN B CB   1  
ATOM 1801  C CG   . ASN B 1 46 ? -2.266  -0.736  -13.583 1.00 0.61 ? 46 ASN B CG   1  
ATOM 1802  O OD1  . ASN B 1 46 ? -1.624  -1.665  -14.032 1.00 0.61 ? 46 ASN B OD1  1  
ATOM 1803  N ND2  . ASN B 1 46 ? -1.927  -0.202  -12.441 1.00 0.61 ? 46 ASN B ND2  1  
ATOM 1804  H H    . ASN B 1 46 ? -5.662  -1.897  -15.707 1.00 0.61 ? 46 ASN B H    1  
ATOM 1805  H HA   . ASN B 1 46 ? -4.423  -1.995  -13.700 1.00 0.61 ? 46 ASN B HA   1  
ATOM 1806  H HB2  . ASN B 1 46 ? -3.288  -0.244  -15.406 1.00 0.61 ? 46 ASN B HB2  1  
ATOM 1807  H HB3  . ASN B 1 46 ? -3.627  0.851   -14.064 1.00 0.61 ? 46 ASN B HB3  1  
ATOM 1808  H HD21 . ASN B 1 46 ? -2.444  0.548   -12.078 1.00 0.61 ? 46 ASN B HD21 1  
ATOM 1809  H HD22 . ASN B 1 46 ? -1.156  -0.550  -11.946 1.00 0.61 ? 46 ASN B HD22 1  
ATOM 1810  N N    . ARG B 1 47 ? -6.756  -0.451  -12.798 1.00 0.52 ? 47 ARG B N    1  
ATOM 1811  C CA   . ARG B 1 47 ? -7.534  0.183   -11.696 1.00 0.52 ? 47 ARG B CA   1  
ATOM 1812  C C    . ARG B 1 47 ? -7.658  -0.800  -10.530 1.00 0.52 ? 47 ARG B C    1  
ATOM 1813  O O    . ARG B 1 47 ? -8.219  -1.870  -10.664 1.00 0.52 ? 47 ARG B O    1  
ATOM 1814  C CB   . ARG B 1 47 ? -8.931  0.550   -12.204 1.00 0.52 ? 47 ARG B CB   1  
ATOM 1815  C CG   . ARG B 1 47 ? -8.839  1.780   -13.110 1.00 0.52 ? 47 ARG B CG   1  
ATOM 1816  C CD   . ARG B 1 47 ? -8.634  3.031   -12.255 1.00 0.52 ? 47 ARG B CD   1  
ATOM 1817  N NE   . ARG B 1 47 ? -9.957  3.563   -11.827 1.00 0.52 ? 47 ARG B NE   1  
ATOM 1818  C CZ   . ARG B 1 47 ? -10.021 4.531   -10.954 1.00 0.52 ? 47 ARG B CZ   1  
ATOM 1819  N NH1  . ARG B 1 47 ? -9.545  5.709   -11.252 1.00 0.52 ? 47 ARG B NH1  1  
ATOM 1820  N NH2  . ARG B 1 47 ? -10.559 4.322   -9.785  1.00 0.52 ? 47 ARG B NH2  1  
ATOM 1821  H H    . ARG B 1 47 ? -7.220  -0.962  -13.494 1.00 0.52 ? 47 ARG B H    1  
ATOM 1822  H HA   . ARG B 1 47 ? -7.025  1.075   -11.363 1.00 0.52 ? 47 ARG B HA   1  
ATOM 1823  H HB2  . ARG B 1 47 ? -9.341  -0.279  -12.760 1.00 0.52 ? 47 ARG B HB2  1  
ATOM 1824  H HB3  . ARG B 1 47 ? -9.572  0.773   -11.364 1.00 0.52 ? 47 ARG B HB3  1  
ATOM 1825  H HG2  . ARG B 1 47 ? -8.004  1.664   -13.788 1.00 0.52 ? 47 ARG B HG2  1  
ATOM 1826  H HG3  . ARG B 1 47 ? -9.752  1.879   -13.676 1.00 0.52 ? 47 ARG B HG3  1  
ATOM 1827  H HD2  . ARG B 1 47 ? -8.048  2.780   -11.383 1.00 0.52 ? 47 ARG B HD2  1  
ATOM 1828  H HD3  . ARG B 1 47 ? -8.114  3.781   -12.833 1.00 0.52 ? 47 ARG B HD3  1  
ATOM 1829  H HE   . ARG B 1 47 ? -10.781 3.185   -12.200 1.00 0.52 ? 47 ARG B HE   1  
ATOM 1830  H HH11 . ARG B 1 47 ? -9.133  5.870   -12.149 1.00 0.52 ? 47 ARG B HH11 1  
ATOM 1831  H HH12 . ARG B 1 47 ? -9.593  6.452   -10.584 1.00 0.52 ? 47 ARG B HH12 1  
ATOM 1832  H HH21 . ARG B 1 47 ? -10.924 3.420   -9.556  1.00 0.52 ? 47 ARG B HH21 1  
ATOM 1833  H HH22 . ARG B 1 47 ? -10.608 5.064   -9.117  1.00 0.52 ? 47 ARG B HH22 1  
ATOM 1834  N N    . GLN B 1 48 ? -7.139  -0.446  -9.386  1.00 0.45 ? 48 GLN B N    1  
ATOM 1835  C CA   . GLN B 1 48 ? -7.227  -1.360  -8.214  1.00 0.45 ? 48 GLN B CA   1  
ATOM 1836  C C    . GLN B 1 48 ? -8.372  -0.913  -7.303  1.00 0.45 ? 48 GLN B C    1  
ATOM 1837  O O    . GLN B 1 48 ? -8.639  0.263   -7.158  1.00 0.45 ? 48 GLN B O    1  
ATOM 1838  C CB   . GLN B 1 48 ? -5.910  -1.319  -7.436  1.00 0.45 ? 48 GLN B CB   1  
ATOM 1839  C CG   . GLN B 1 48 ? -4.911  -2.289  -8.069  1.00 0.45 ? 48 GLN B CG   1  
ATOM 1840  C CD   . GLN B 1 48 ? -3.806  -1.499  -8.773  1.00 0.45 ? 48 GLN B CD   1  
ATOM 1841  O OE1  . GLN B 1 48 ? -4.079  -0.682  -9.629  1.00 0.45 ? 48 GLN B OE1  1  
ATOM 1842  N NE2  . GLN B 1 48 ? -2.561  -1.709  -8.444  1.00 0.45 ? 48 GLN B NE2  1  
ATOM 1843  H H    . GLN B 1 48 ? -6.691  0.421   -9.299  1.00 0.45 ? 48 GLN B H    1  
ATOM 1844  H HA   . GLN B 1 48 ? -7.411  -2.368  -8.556  1.00 0.45 ? 48 GLN B HA   1  
ATOM 1845  H HB2  . GLN B 1 48 ? -5.508  -0.316  -7.464  1.00 0.45 ? 48 GLN B HB2  1  
ATOM 1846  H HB3  . GLN B 1 48 ? -6.089  -1.606  -6.411  1.00 0.45 ? 48 GLN B HB3  1  
ATOM 1847  H HG2  . GLN B 1 48 ? -4.477  -2.911  -7.299  1.00 0.45 ? 48 GLN B HG2  1  
ATOM 1848  H HG3  . GLN B 1 48 ? -5.421  -2.912  -8.790  1.00 0.45 ? 48 GLN B HG3  1  
ATOM 1849  H HE21 . GLN B 1 48 ? -2.340  -2.368  -7.753  1.00 0.45 ? 48 GLN B HE21 1  
ATOM 1850  H HE22 . GLN B 1 48 ? -1.846  -1.208  -8.889  1.00 0.45 ? 48 GLN B HE22 1  
ATOM 1851  N N    . VAL B 1 49 ? -9.050  -1.842  -6.687  1.00 0.37 ? 49 VAL B N    1  
ATOM 1852  C CA   . VAL B 1 49 ? -10.176 -1.469  -5.785  1.00 0.37 ? 49 VAL B CA   1  
ATOM 1853  C C    . VAL B 1 49 ? -10.151 -2.361  -4.543  1.00 0.37 ? 49 VAL B C    1  
ATOM 1854  O O    . VAL B 1 49 ? -9.729  -3.499  -4.593  1.00 0.37 ? 49 VAL B O    1  
ATOM 1855  C CB   . VAL B 1 49 ? -11.504 -1.658  -6.522  1.00 0.37 ? 49 VAL B CB   1  
ATOM 1856  C CG1  . VAL B 1 49 ? -12.661 -1.537  -5.529  1.00 0.37 ? 49 VAL B CG1  1  
ATOM 1857  C CG2  . VAL B 1 49 ? -11.644 -0.581  -7.600  1.00 0.37 ? 49 VAL B CG2  1  
ATOM 1858  H H    . VAL B 1 49 ? -8.818  -2.785  -6.817  1.00 0.37 ? 49 VAL B H    1  
ATOM 1859  H HA   . VAL B 1 49 ? -10.073 -0.436  -5.489  1.00 0.37 ? 49 VAL B HA   1  
ATOM 1860  H HB   . VAL B 1 49 ? -11.523 -2.635  -6.982  1.00 0.37 ? 49 VAL B HB   1  
ATOM 1861  H HG11 . VAL B 1 49 ? -12.518 -0.661  -4.915  1.00 0.37 ? 49 VAL B HG11 1  
ATOM 1862  H HG12 . VAL B 1 49 ? -13.592 -1.450  -6.070  1.00 0.37 ? 49 VAL B HG12 1  
ATOM 1863  H HG13 . VAL B 1 49 ? -12.690 -2.416  -4.901  1.00 0.37 ? 49 VAL B HG13 1  
ATOM 1864  H HG21 . VAL B 1 49 ? -10.737 -0.537  -8.186  1.00 0.37 ? 49 VAL B HG21 1  
ATOM 1865  H HG22 . VAL B 1 49 ? -12.477 -0.823  -8.245  1.00 0.37 ? 49 VAL B HG22 1  
ATOM 1866  H HG23 . VAL B 1 49 ? -11.818 0.377   -7.133  1.00 0.37 ? 49 VAL B HG23 1  
ATOM 1867  N N    . CYS B 1 50 ? -10.599 -1.853  -3.428  1.00 0.29 ? 50 CYS B N    1  
ATOM 1868  C CA   . CYS B 1 50 ? -10.599 -2.674  -2.184  1.00 0.29 ? 50 CYS B CA   1  
ATOM 1869  C C    . CYS B 1 50 ? -11.967 -3.334  -2.007  1.00 0.29 ? 50 CYS B C    1  
ATOM 1870  O O    . CYS B 1 50 ? -12.996 -2.702  -2.145  1.00 0.29 ? 50 CYS B O    1  
ATOM 1871  C CB   . CYS B 1 50 ? -10.309 -1.775  -0.979  1.00 0.29 ? 50 CYS B CB   1  
ATOM 1872  S SG   . CYS B 1 50 ? -8.830  -0.785  -1.309  1.00 0.29 ? 50 CYS B SG   1  
ATOM 1873  H H    . CYS B 1 50 ? -10.935 -0.933  -3.408  1.00 0.29 ? 50 CYS B H    1  
ATOM 1874  H HA   . CYS B 1 50 ? -9.838  -3.435  -2.255  1.00 0.29 ? 50 CYS B HA   1  
ATOM 1875  H HB2  . CYS B 1 50 ? -11.150 -1.120  -0.808  1.00 0.29 ? 50 CYS B HB2  1  
ATOM 1876  H HB3  . CYS B 1 50 ? -10.145 -2.387  -0.105  1.00 0.29 ? 50 CYS B HB3  1  
ATOM 1877  N N    . ALA B 1 51 ? -11.987 -4.602  -1.701  1.00 0.23 ? 51 ALA B N    1  
ATOM 1878  C CA   . ALA B 1 51 ? -13.288 -5.303  -1.514  1.00 0.23 ? 51 ALA B CA   1  
ATOM 1879  C C    . ALA B 1 51 ? -13.183 -6.258  -0.323  1.00 0.23 ? 51 ALA B C    1  
ATOM 1880  O O    . ALA B 1 51 ? -12.189 -6.933  -0.142  1.00 0.23 ? 51 ALA B O    1  
ATOM 1881  C CB   . ALA B 1 51 ? -13.626 -6.098  -2.776  1.00 0.23 ? 51 ALA B CB   1  
ATOM 1882  H H    . ALA B 1 51 ? -11.146 -5.093  -1.592  1.00 0.23 ? 51 ALA B H    1  
ATOM 1883  H HA   . ALA B 1 51 ? -14.065 -4.577  -1.325  1.00 0.23 ? 51 ALA B HA   1  
ATOM 1884  H HB1  . ALA B 1 51 ? -13.591 -5.442  -3.634  1.00 0.23 ? 51 ALA B HB1  1  
ATOM 1885  H HB2  . ALA B 1 51 ? -12.910 -6.896  -2.902  1.00 0.23 ? 51 ALA B HB2  1  
ATOM 1886  H HB3  . ALA B 1 51 ? -14.619 -6.514  -2.684  1.00 0.23 ? 51 ALA B HB3  1  
ATOM 1887  N N    . ASN B 1 52 ? -14.201 -6.321  0.490   1.00 0.26 ? 52 ASN B N    1  
ATOM 1888  C CA   . ASN B 1 52 ? -14.156 -7.233  1.668   1.00 0.26 ? 52 ASN B CA   1  
ATOM 1889  C C    . ASN B 1 52 ? -14.711 -8.605  1.270   1.00 0.26 ? 52 ASN B C    1  
ATOM 1890  O O    . ASN B 1 52 ? -15.614 -8.694  0.463   1.00 0.26 ? 52 ASN B O    1  
ATOM 1891  C CB   . ASN B 1 52 ? -15.004 -6.647  2.799   1.00 0.26 ? 52 ASN B CB   1  
ATOM 1892  C CG   . ASN B 1 52 ? -14.312 -6.900  4.139   1.00 0.26 ? 52 ASN B CG   1  
ATOM 1893  O OD1  . ASN B 1 52 ? -13.105 -6.805  4.242   1.00 0.26 ? 52 ASN B OD1  1  
ATOM 1894  N ND2  . ASN B 1 52 ? -15.031 -7.221  5.180   1.00 0.26 ? 52 ASN B ND2  1  
ATOM 1895  H H    . ASN B 1 52 ? -14.994 -5.769  0.328   1.00 0.26 ? 52 ASN B H    1  
ATOM 1896  H HA   . ASN B 1 52 ? -13.134 -7.337  2.000   1.00 0.26 ? 52 ASN B HA   1  
ATOM 1897  H HB2  . ASN B 1 52 ? -15.119 -5.583  2.647   1.00 0.26 ? 52 ASN B HB2  1  
ATOM 1898  H HB3  . ASN B 1 52 ? -15.975 -7.119  2.803   1.00 0.26 ? 52 ASN B HB3  1  
ATOM 1899  H HD21 . ASN B 1 52 ? -16.005 -7.298  5.099   1.00 0.26 ? 52 ASN B HD21 1  
ATOM 1900  H HD22 . ASN B 1 52 ? -14.597 -7.385  6.044   1.00 0.26 ? 52 ASN B HD22 1  
ATOM 1901  N N    . PRO B 1 53 ? -14.149 -9.635  1.851   1.00 0.30 ? 53 PRO B N    1  
ATOM 1902  C CA   . PRO B 1 53 ? -14.564 -11.023 1.579   1.00 0.30 ? 53 PRO B CA   1  
ATOM 1903  C C    . PRO B 1 53 ? -15.856 -11.351 2.333   1.00 0.30 ? 53 PRO B C    1  
ATOM 1904  O O    . PRO B 1 53 ? -16.337 -12.467 2.302   1.00 0.30 ? 53 PRO B O    1  
ATOM 1905  C CB   . PRO B 1 53 ? -13.394 -11.856 2.108   1.00 0.30 ? 53 PRO B CB   1  
ATOM 1906  C CG   . PRO B 1 53 ? -12.659 -10.971 3.142   1.00 0.30 ? 53 PRO B CG   1  
ATOM 1907  C CD   . PRO B 1 53 ? -13.051 -9.514  2.830   1.00 0.30 ? 53 PRO B CD   1  
ATOM 1908  H HA   . PRO B 1 53 ? -14.686 -11.185 0.521   1.00 0.30 ? 53 PRO B HA   1  
ATOM 1909  H HB2  . PRO B 1 53 ? -13.766 -12.755 2.582   1.00 0.30 ? 53 PRO B HB2  1  
ATOM 1910  H HB3  . PRO B 1 53 ? -12.724 -12.109 1.303   1.00 0.30 ? 53 PRO B HB3  1  
ATOM 1911  H HG2  . PRO B 1 53 ? -12.970 -11.235 4.143   1.00 0.30 ? 53 PRO B HG2  1  
ATOM 1912  H HG3  . PRO B 1 53 ? -11.591 -11.090 3.041   1.00 0.30 ? 53 PRO B HG3  1  
ATOM 1913  H HD2  . PRO B 1 53 ? -13.393 -9.015  3.728   1.00 0.30 ? 53 PRO B HD2  1  
ATOM 1914  H HD3  . PRO B 1 53 ? -12.219 -8.982  2.394   1.00 0.30 ? 53 PRO B HD3  1  
ATOM 1915  N N    . GLU B 1 54 ? -16.419 -10.390 3.011   1.00 0.43 ? 54 GLU B N    1  
ATOM 1916  C CA   . GLU B 1 54 ? -17.679 -10.648 3.766   1.00 0.43 ? 54 GLU B CA   1  
ATOM 1917  C C    . GLU B 1 54 ? -18.874 -10.163 2.943   1.00 0.43 ? 54 GLU B C    1  
ATOM 1918  O O    . GLU B 1 54 ? -19.924 -9.862  3.474   1.00 0.43 ? 54 GLU B O    1  
ATOM 1919  C CB   . GLU B 1 54 ? -17.638 -9.898  5.098   1.00 0.43 ? 54 GLU B CB   1  
ATOM 1920  C CG   . GLU B 1 54 ? -16.389 -10.311 5.879   1.00 0.43 ? 54 GLU B CG   1  
ATOM 1921  C CD   . GLU B 1 54 ? -16.542 -9.898  7.344   1.00 0.43 ? 54 GLU B CD   1  
ATOM 1922  O OE1  . GLU B 1 54 ? -17.218 -8.915  7.594   1.00 0.43 ? 54 GLU B OE1  1  
ATOM 1923  O OE2  . GLU B 1 54 ? -15.981 -10.574 8.190   1.00 0.43 ? 54 GLU B OE2  1  
ATOM 1924  H H    . GLU B 1 54 ? -16.016 -9.497  3.024   1.00 0.43 ? 54 GLU B H    1  
ATOM 1925  H HA   . GLU B 1 54 ? -17.775 -11.708 3.951   1.00 0.43 ? 54 GLU B HA   1  
ATOM 1926  H HB2  . GLU B 1 54 ? -17.611 -8.833  4.911   1.00 0.43 ? 54 GLU B HB2  1  
ATOM 1927  H HB3  . GLU B 1 54 ? -18.517 -10.140 5.675   1.00 0.43 ? 54 GLU B HB3  1  
ATOM 1928  H HG2  . GLU B 1 54 ? -16.264 -11.382 5.817   1.00 0.43 ? 54 GLU B HG2  1  
ATOM 1929  H HG3  . GLU B 1 54 ? -15.522 -9.823  5.459   1.00 0.43 ? 54 GLU B HG3  1  
ATOM 1930  N N    . LYS B 1 55 ? -18.723 -10.086 1.649   1.00 0.47 ? 55 LYS B N    1  
ATOM 1931  C CA   . LYS B 1 55 ? -19.851 -9.621  0.794   1.00 0.47 ? 55 LYS B CA   1  
ATOM 1932  C C    . LYS B 1 55 ? -20.520 -10.828 0.133   1.00 0.47 ? 55 LYS B C    1  
ATOM 1933  O O    . LYS B 1 55 ? -20.201 -11.964 0.423   1.00 0.47 ? 55 LYS B O    1  
ATOM 1934  C CB   . LYS B 1 55 ? -19.315 -8.680  -0.287  1.00 0.47 ? 55 LYS B CB   1  
ATOM 1935  C CG   . LYS B 1 55 ? -19.569 -7.229  0.126   1.00 0.47 ? 55 LYS B CG   1  
ATOM 1936  C CD   . LYS B 1 55 ? -21.024 -6.859  -0.170  1.00 0.47 ? 55 LYS B CD   1  
ATOM 1937  C CE   . LYS B 1 55 ? -21.156 -5.338  -0.259  1.00 0.47 ? 55 LYS B CE   1  
ATOM 1938  N NZ   . LYS B 1 55 ? -21.169 -4.760  1.114   1.00 0.47 ? 55 LYS B NZ   1  
ATOM 1939  H H    . LYS B 1 55 ? -17.867 -10.334 1.240   1.00 0.47 ? 55 LYS B H    1  
ATOM 1940  H HA   . LYS B 1 55 ? -20.572 -9.097  1.402   1.00 0.47 ? 55 LYS B HA   1  
ATOM 1941  H HB2  . LYS B 1 55 ? -18.254 -8.840  -0.411  1.00 0.47 ? 55 LYS B HB2  1  
ATOM 1942  H HB3  . LYS B 1 55 ? -19.821 -8.879  -1.221  1.00 0.47 ? 55 LYS B HB3  1  
ATOM 1943  H HG2  . LYS B 1 55 ? -19.377 -7.118  1.184   1.00 0.47 ? 55 LYS B HG2  1  
ATOM 1944  H HG3  . LYS B 1 55 ? -18.913 -6.576  -0.429  1.00 0.47 ? 55 LYS B HG3  1  
ATOM 1945  H HD2  . LYS B 1 55 ? -21.324 -7.303  -1.109  1.00 0.47 ? 55 LYS B HD2  1  
ATOM 1946  H HD3  . LYS B 1 55 ? -21.658 -7.228  0.622   1.00 0.47 ? 55 LYS B HD3  1  
ATOM 1947  H HE2  . LYS B 1 55 ? -20.320 -4.936  -0.812  1.00 0.47 ? 55 LYS B HE2  1  
ATOM 1948  H HE3  . LYS B 1 55 ? -22.077 -5.085  -0.764  1.00 0.47 ? 55 LYS B HE3  1  
ATOM 1949  H HZ1  . LYS B 1 55 ? -21.608 -5.434  1.771   1.00 0.47 ? 55 LYS B HZ1  1  
ATOM 1950  H HZ2  . LYS B 1 55 ? -20.193 -4.568  1.419   1.00 0.47 ? 55 LYS B HZ2  1  
ATOM 1951  H HZ3  . LYS B 1 55 ? -21.713 -3.872  1.112   1.00 0.47 ? 55 LYS B HZ3  1  
ATOM 1952  N N    . LYS B 1 56 ? -21.446 -10.591 -0.756  1.00 0.58 ? 56 LYS B N    1  
ATOM 1953  C CA   . LYS B 1 56 ? -22.135 -11.725 -1.434  1.00 0.58 ? 56 LYS B CA   1  
ATOM 1954  C C    . LYS B 1 56 ? -21.584 -11.878 -2.853  1.00 0.58 ? 56 LYS B C    1  
ATOM 1955  O O    . LYS B 1 56 ? -21.531 -12.964 -3.396  1.00 0.58 ? 56 LYS B O    1  
ATOM 1956  C CB   . LYS B 1 56 ? -23.638 -11.445 -1.497  1.00 0.58 ? 56 LYS B CB   1  
ATOM 1957  C CG   . LYS B 1 56 ? -23.893 -10.236 -2.400  1.00 0.58 ? 56 LYS B CG   1  
ATOM 1958  C CD   . LYS B 1 56 ? -25.384 -10.153 -2.734  1.00 0.58 ? 56 LYS B CD   1  
ATOM 1959  C CE   . LYS B 1 56 ? -25.784 -8.687  -2.919  1.00 0.58 ? 56 LYS B CE   1  
ATOM 1960  N NZ   . LYS B 1 56 ? -27.269 -8.579  -2.965  1.00 0.58 ? 56 LYS B NZ   1  
ATOM 1961  H H    . LYS B 1 56 ? -21.689 -9.668  -0.976  1.00 0.58 ? 56 LYS B H    1  
ATOM 1962  H HA   . LYS B 1 56 ? -21.961 -12.636 -0.880  1.00 0.58 ? 56 LYS B HA   1  
ATOM 1963  H HB2  . LYS B 1 56 ? -24.148 -12.309 -1.898  1.00 0.58 ? 56 LYS B HB2  1  
ATOM 1964  H HB3  . LYS B 1 56 ? -24.008 -11.235 -0.506  1.00 0.58 ? 56 LYS B HB3  1  
ATOM 1965  H HG2  . LYS B 1 56 ? -23.587 -9.334  -1.888  1.00 0.58 ? 56 LYS B HG2  1  
ATOM 1966  H HG3  . LYS B 1 56 ? -23.327 -10.342 -3.313  1.00 0.58 ? 56 LYS B HG3  1  
ATOM 1967  H HD2  . LYS B 1 56 ? -25.579 -10.698 -3.646  1.00 0.58 ? 56 LYS B HD2  1  
ATOM 1968  H HD3  . LYS B 1 56 ? -25.958 -10.581 -1.926  1.00 0.58 ? 56 LYS B HD3  1  
ATOM 1969  H HE2  . LYS B 1 56 ? -25.406 -8.104  -2.092  1.00 0.58 ? 56 LYS B HE2  1  
ATOM 1970  H HE3  . LYS B 1 56 ? -25.366 -8.314  -3.843  1.00 0.58 ? 56 LYS B HE3  1  
ATOM 1971  H HZ1  . LYS B 1 56 ? -27.689 -9.299  -2.343  1.00 0.58 ? 56 LYS B HZ1  1  
ATOM 1972  H HZ2  . LYS B 1 56 ? -27.559 -7.634  -2.647  1.00 0.58 ? 56 LYS B HZ2  1  
ATOM 1973  H HZ3  . LYS B 1 56 ? -27.598 -8.730  -3.940  1.00 0.58 ? 56 LYS B HZ3  1  
ATOM 1974  N N    . TRP B 1 57 ? -21.173 -10.798 -3.459  1.00 0.41 ? 57 TRP B N    1  
ATOM 1975  C CA   . TRP B 1 57 ? -20.626 -10.882 -4.843  1.00 0.41 ? 57 TRP B CA   1  
ATOM 1976  C C    . TRP B 1 57 ? -19.100 -10.959 -4.783  1.00 0.41 ? 57 TRP B C    1  
ATOM 1977  O O    . TRP B 1 57 ? -18.464 -11.522 -5.652  1.00 0.41 ? 57 TRP B O    1  
ATOM 1978  C CB   . TRP B 1 57 ? -21.044 -9.637  -5.631  1.00 0.41 ? 57 TRP B CB   1  
ATOM 1979  C CG   . TRP B 1 57 ? -20.456 -8.421  -4.989  1.00 0.41 ? 57 TRP B CG   1  
ATOM 1980  C CD1  . TRP B 1 57 ? -21.088 -7.636  -4.087  1.00 0.41 ? 57 TRP B CD1  1  
ATOM 1981  C CD2  . TRP B 1 57 ? -19.134 -7.840  -5.182  1.00 0.41 ? 57 TRP B CD2  1  
ATOM 1982  N NE1  . TRP B 1 57 ? -20.239 -6.609  -3.716  1.00 0.41 ? 57 TRP B NE1  1  
ATOM 1983  C CE2  . TRP B 1 57 ? -19.023 -6.692  -4.364  1.00 0.41 ? 57 TRP B CE2  1  
ATOM 1984  C CE3  . TRP B 1 57 ? -18.032 -8.195  -5.982  1.00 0.41 ? 57 TRP B CE3  1  
ATOM 1985  C CZ2  . TRP B 1 57 ? -17.859 -5.922  -4.338  1.00 0.41 ? 57 TRP B CZ2  1  
ATOM 1986  C CZ3  . TRP B 1 57 ? -16.859 -7.422  -5.958  1.00 0.41 ? 57 TRP B CZ3  1  
ATOM 1987  C CH2  . TRP B 1 57 ? -16.774 -6.288  -5.138  1.00 0.41 ? 57 TRP B CH2  1  
ATOM 1988  H H    . TRP B 1 57 ? -21.225 -9.932  -3.004  1.00 0.41 ? 57 TRP B H    1  
ATOM 1989  H HA   . TRP B 1 57 ? -21.013 -11.763 -5.331  1.00 0.41 ? 57 TRP B HA   1  
ATOM 1990  H HB2  . TRP B 1 57 ? -20.685 -9.718  -6.646  1.00 0.41 ? 57 TRP B HB2  1  
ATOM 1991  H HB3  . TRP B 1 57 ? -22.120 -9.558  -5.634  1.00 0.41 ? 57 TRP B HB3  1  
ATOM 1992  H HD1  . TRP B 1 57 ? -22.092 -7.785  -3.719  1.00 0.41 ? 57 TRP B HD1  1  
ATOM 1993  H HE1  . TRP B 1 57 ? -20.455 -5.901  -3.073  1.00 0.41 ? 57 TRP B HE1  1  
ATOM 1994  H HE3  . TRP B 1 57 ? -18.088 -9.066  -6.617  1.00 0.41 ? 57 TRP B HE3  1  
ATOM 1995  H HZ2  . TRP B 1 57 ? -17.798 -5.051  -3.705  1.00 0.41 ? 57 TRP B HZ2  1  
ATOM 1996  H HZ3  . TRP B 1 57 ? -16.019 -7.703  -6.576  1.00 0.41 ? 57 TRP B HZ3  1  
ATOM 1997  H HH2  . TRP B 1 57 ? -15.870 -5.698  -5.124  1.00 0.41 ? 57 TRP B HH2  1  
ATOM 1998  N N    . VAL B 1 58 ? -18.507 -10.398 -3.766  1.00 0.32 ? 58 VAL B N    1  
ATOM 1999  C CA   . VAL B 1 58 ? -17.021 -10.442 -3.653  1.00 0.32 ? 58 VAL B CA   1  
ATOM 2000  C C    . VAL B 1 58 ? -16.551 -11.897 -3.702  1.00 0.32 ? 58 VAL B C    1  
ATOM 2001  O O    . VAL B 1 58 ? -15.862 -12.306 -4.616  1.00 0.32 ? 58 VAL B O    1  
ATOM 2002  C CB   . VAL B 1 58 ? -16.591 -9.810  -2.328  1.00 0.32 ? 58 VAL B CB   1  
ATOM 2003  C CG1  . VAL B 1 58 ? -15.074 -9.929  -2.174  1.00 0.32 ? 58 VAL B CG1  1  
ATOM 2004  C CG2  . VAL B 1 58 ? -16.990 -8.332  -2.317  1.00 0.32 ? 58 VAL B CG2  1  
ATOM 2005  H H    . VAL B 1 58 ? -19.037 -9.948  -3.075  1.00 0.32 ? 58 VAL B H    1  
ATOM 2006  H HA   . VAL B 1 58 ? -16.582 -9.894  -4.473  1.00 0.32 ? 58 VAL B HA   1  
ATOM 2007  H HB   . VAL B 1 58 ? -17.077 -10.323 -1.510  1.00 0.32 ? 58 VAL B HB   1  
ATOM 2008  H HG11 . VAL B 1 58 ? -14.596 -9.682  -3.110  1.00 0.32 ? 58 VAL B HG11 1  
ATOM 2009  H HG12 . VAL B 1 58 ? -14.736 -9.247  -1.407  1.00 0.32 ? 58 VAL B HG12 1  
ATOM 2010  H HG13 . VAL B 1 58 ? -14.818 -10.941 -1.895  1.00 0.32 ? 58 VAL B HG13 1  
ATOM 2011  H HG21 . VAL B 1 58 ? -18.060 -8.248  -2.426  1.00 0.32 ? 58 VAL B HG21 1  
ATOM 2012  H HG22 . VAL B 1 58 ? -16.686 -7.886  -1.382  1.00 0.32 ? 58 VAL B HG22 1  
ATOM 2013  H HG23 . VAL B 1 58 ? -16.502 -7.822  -3.134  1.00 0.32 ? 58 VAL B HG23 1  
ATOM 2014  N N    . ARG B 1 59 ? -16.919 -12.683 -2.727  1.00 0.34 ? 59 ARG B N    1  
ATOM 2015  C CA   . ARG B 1 59 ? -16.493 -14.111 -2.722  1.00 0.34 ? 59 ARG B CA   1  
ATOM 2016  C C    . ARG B 1 59 ? -16.968 -14.781 -4.013  1.00 0.34 ? 59 ARG B C    1  
ATOM 2017  O O    . ARG B 1 59 ? -16.430 -15.783 -4.440  1.00 0.34 ? 59 ARG B O    1  
ATOM 2018  C CB   . ARG B 1 59 ? -17.111 -14.825 -1.519  1.00 0.34 ? 59 ARG B CB   1  
ATOM 2019  C CG   . ARG B 1 59 ? -16.558 -16.248 -1.430  1.00 0.34 ? 59 ARG B CG   1  
ATOM 2020  C CD   . ARG B 1 59 ? -17.698 -17.221 -1.122  1.00 0.34 ? 59 ARG B CD   1  
ATOM 2021  N NE   . ARG B 1 59 ? -18.203 -17.814 -2.393  1.00 0.34 ? 59 ARG B NE   1  
ATOM 2022  C CZ   . ARG B 1 59 ? -19.391 -18.352 -2.435  1.00 0.34 ? 59 ARG B CZ   1  
ATOM 2023  N NH1  . ARG B 1 59 ? -19.876 -18.945 -1.379  1.00 0.34 ? 59 ARG B NH1  1  
ATOM 2024  N NH2  . ARG B 1 59 ? -20.093 -18.298 -3.533  1.00 0.34 ? 59 ARG B NH2  1  
ATOM 2025  H H    . ARG B 1 59 ? -17.475 -12.334 -2.000  1.00 0.34 ? 59 ARG B H    1  
ATOM 2026  H HA   . ARG B 1 59 ? -15.417 -14.167 -2.663  1.00 0.34 ? 59 ARG B HA   1  
ATOM 2027  H HB2  . ARG B 1 59 ? -16.865 -14.285 -0.615  1.00 0.34 ? 59 ARG B HB2  1  
ATOM 2028  H HB3  . ARG B 1 59 ? -18.184 -14.864 -1.634  1.00 0.34 ? 59 ARG B HB3  1  
ATOM 2029  H HG2  . ARG B 1 59 ? -16.100 -16.515 -2.372  1.00 0.34 ? 59 ARG B HG2  1  
ATOM 2030  H HG3  . ARG B 1 59 ? -15.820 -16.300 -0.643  1.00 0.34 ? 59 ARG B HG3  1  
ATOM 2031  H HD2  . ARG B 1 59 ? -17.334 -18.009 -0.478  1.00 0.34 ? 59 ARG B HD2  1  
ATOM 2032  H HD3  . ARG B 1 59 ? -18.499 -16.693 -0.628  1.00 0.34 ? 59 ARG B HD3  1  
ATOM 2033  H HE   . ARG B 1 59 ? -17.642 -17.798 -3.197  1.00 0.34 ? 59 ARG B HE   1  
ATOM 2034  H HH11 . ARG B 1 59 ? -19.337 -18.987 -0.537  1.00 0.34 ? 59 ARG B HH11 1  
ATOM 2035  H HH12 . ARG B 1 59 ? -20.786 -19.358 -1.411  1.00 0.34 ? 59 ARG B HH12 1  
ATOM 2036  H HH21 . ARG B 1 59 ? -19.721 -17.843 -4.343  1.00 0.34 ? 59 ARG B HH21 1  
ATOM 2037  H HH22 . ARG B 1 59 ? -21.004 -18.710 -3.566  1.00 0.34 ? 59 ARG B HH22 1  
ATOM 2038  N N    . GLU B 1 60 ? -17.975 -14.232 -4.638  1.00 0.37 ? 60 GLU B N    1  
ATOM 2039  C CA   . GLU B 1 60 ? -18.485 -14.832 -5.902  1.00 0.37 ? 60 GLU B CA   1  
ATOM 2040  C C    . GLU B 1 60 ? -17.453 -14.628 -7.013  1.00 0.37 ? 60 GLU B C    1  
ATOM 2041  O O    . GLU B 1 60 ? -17.256 -15.481 -7.855  1.00 0.37 ? 60 GLU B O    1  
ATOM 2042  C CB   . GLU B 1 60 ? -19.799 -14.152 -6.293  1.00 0.37 ? 60 GLU B CB   1  
ATOM 2043  C CG   . GLU B 1 60 ? -20.976 -14.951 -5.731  1.00 0.37 ? 60 GLU B CG   1  
ATOM 2044  C CD   . GLU B 1 60 ? -22.246 -14.100 -5.788  1.00 0.37 ? 60 GLU B CD   1  
ATOM 2045  O OE1  . GLU B 1 60 ? -22.456 -13.451 -6.799  1.00 0.37 ? 60 GLU B OE1  1  
ATOM 2046  O OE2  . GLU B 1 60 ? -22.987 -14.113 -4.819  1.00 0.37 ? 60 GLU B OE2  1  
ATOM 2047  H H    . GLU B 1 60 ? -18.393 -13.423 -4.277  1.00 0.37 ? 60 GLU B H    1  
ATOM 2048  H HA   . GLU B 1 60 ? -18.656 -15.889 -5.757  1.00 0.37 ? 60 GLU B HA   1  
ATOM 2049  H HB2  . GLU B 1 60 ? -19.818 -13.149 -5.889  1.00 0.37 ? 60 GLU B HB2  1  
ATOM 2050  H HB3  . GLU B 1 60 ? -19.878 -14.108 -7.368  1.00 0.37 ? 60 GLU B HB3  1  
ATOM 2051  H HG2  . GLU B 1 60 ? -21.115 -15.847 -6.318  1.00 0.37 ? 60 GLU B HG2  1  
ATOM 2052  H HG3  . GLU B 1 60 ? -20.771 -15.221 -4.705  1.00 0.37 ? 60 GLU B HG3  1  
ATOM 2053  N N    . TYR B 1 61 ? -16.792 -13.502 -7.020  1.00 0.36 ? 61 TYR B N    1  
ATOM 2054  C CA   . TYR B 1 61 ? -15.772 -13.243 -8.074  1.00 0.36 ? 61 TYR B CA   1  
ATOM 2055  C C    . TYR B 1 61 ? -14.519 -14.069 -7.779  1.00 0.36 ? 61 TYR B C    1  
ATOM 2056  O O    . TYR B 1 61 ? -13.994 -14.748 -8.639  1.00 0.36 ? 61 TYR B O    1  
ATOM 2057  C CB   . TYR B 1 61 ? -15.414 -11.754 -8.083  1.00 0.36 ? 61 TYR B CB   1  
ATOM 2058  C CG   . TYR B 1 61 ? -16.438 -10.977 -8.883  1.00 0.36 ? 61 TYR B CG   1  
ATOM 2059  C CD1  . TYR B 1 61 ? -17.626 -11.591 -9.304  1.00 0.36 ? 61 TYR B CD1  1  
ATOM 2060  C CD2  . TYR B 1 61 ? -16.196 -9.635  -9.205  1.00 0.36 ? 61 TYR B CD2  1  
ATOM 2061  C CE1  . TYR B 1 61 ? -18.567 -10.866 -10.043 1.00 0.36 ? 61 TYR B CE1  1  
ATOM 2062  C CE2  . TYR B 1 61 ? -17.138 -8.910  -9.944  1.00 0.36 ? 61 TYR B CE2  1  
ATOM 2063  C CZ   . TYR B 1 61 ? -18.324 -9.525  -10.363 1.00 0.36 ? 61 TYR B CZ   1  
ATOM 2064  O OH   . TYR B 1 61 ? -19.253 -8.810  -11.091 1.00 0.36 ? 61 TYR B OH   1  
ATOM 2065  H H    . TYR B 1 61 ? -16.966 -12.828 -6.330  1.00 0.36 ? 61 TYR B H    1  
ATOM 2066  H HA   . TYR B 1 61 ? -16.169 -13.524 -9.038  1.00 0.36 ? 61 TYR B HA   1  
ATOM 2067  H HB2  . TYR B 1 61 ? -15.397 -11.383 -7.068  1.00 0.36 ? 61 TYR B HB2  1  
ATOM 2068  H HB3  . TYR B 1 61 ? -14.438 -11.624 -8.527  1.00 0.36 ? 61 TYR B HB3  1  
ATOM 2069  H HD1  . TYR B 1 61 ? -17.815 -12.626 -9.058  1.00 0.36 ? 61 TYR B HD1  1  
ATOM 2070  H HD2  . TYR B 1 61 ? -15.282 -9.159  -8.882  1.00 0.36 ? 61 TYR B HD2  1  
ATOM 2071  H HE1  . TYR B 1 61 ? -19.483 -11.340 -10.366 1.00 0.36 ? 61 TYR B HE1  1  
ATOM 2072  H HE2  . TYR B 1 61 ? -16.950 -7.875  -10.190 1.00 0.36 ? 61 TYR B HE2  1  
ATOM 2073  H HH   . TYR B 1 61 ? -20.127 -9.114  -10.837 1.00 0.36 ? 61 TYR B HH   1  
ATOM 2074  N N    . ILE B 1 62 ? -14.036 -14.020 -6.568  1.00 0.38 ? 62 ILE B N    1  
ATOM 2075  C CA   . ILE B 1 62 ? -12.820 -14.806 -6.220  1.00 0.38 ? 62 ILE B CA   1  
ATOM 2076  C C    . ILE B 1 62 ? -13.048 -16.273 -6.585  1.00 0.38 ? 62 ILE B C    1  
ATOM 2077  O O    . ILE B 1 62 ? -12.219 -16.905 -7.211  1.00 0.38 ? 62 ILE B O    1  
ATOM 2078  C CB   . ILE B 1 62 ? -12.547 -14.689 -4.719  1.00 0.38 ? 62 ILE B CB   1  
ATOM 2079  C CG1  . ILE B 1 62 ? -12.037 -13.281 -4.403  1.00 0.38 ? 62 ILE B CG1  1  
ATOM 2080  C CG2  . ILE B 1 62 ? -11.490 -15.717 -4.310  1.00 0.38 ? 62 ILE B CG2  1  
ATOM 2081  C CD1  . ILE B 1 62 ? -12.969 -12.616 -3.389  1.00 0.38 ? 62 ILE B CD1  1  
ATOM 2082  H H    . ILE B 1 62 ? -14.475 -13.468 -5.886  1.00 0.38 ? 62 ILE B H    1  
ATOM 2083  H HA   . ILE B 1 62 ? -11.973 -14.424 -6.771  1.00 0.38 ? 62 ILE B HA   1  
ATOM 2084  H HB   . ILE B 1 62 ? -13.460 -14.874 -4.173  1.00 0.38 ? 62 ILE B HB   1  
ATOM 2085  H HG12 . ILE B 1 62 ? -11.040 -13.344 -3.990  1.00 0.38 ? 62 ILE B HG12 1  
ATOM 2086  H HG13 . ILE B 1 62 ? -12.015 -12.695 -5.309  1.00 0.38 ? 62 ILE B HG13 1  
ATOM 2087  H HG21 . ILE B 1 62 ? -11.132 -16.234 -5.188  1.00 0.38 ? 62 ILE B HG21 1  
ATOM 2088  H HG22 . ILE B 1 62 ? -10.667 -15.213 -3.827  1.00 0.38 ? 62 ILE B HG22 1  
ATOM 2089  H HG23 . ILE B 1 62 ? -11.928 -16.429 -3.626  1.00 0.38 ? 62 ILE B HG23 1  
ATOM 2090  H HD11 . ILE B 1 62 ? -13.655 -13.351 -2.994  1.00 0.38 ? 62 ILE B HD11 1  
ATOM 2091  H HD12 . ILE B 1 62 ? -12.385 -12.198 -2.583  1.00 0.38 ? 62 ILE B HD12 1  
ATOM 2092  H HD13 . ILE B 1 62 ? -13.527 -11.828 -3.876  1.00 0.38 ? 62 ILE B HD13 1  
ATOM 2093  N N    . ASN B 1 63 ? -14.170 -16.819 -6.203  1.00 0.49 ? 63 ASN B N    1  
ATOM 2094  C CA   . ASN B 1 63 ? -14.457 -18.243 -6.530  1.00 0.49 ? 63 ASN B CA   1  
ATOM 2095  C C    . ASN B 1 63 ? -14.607 -18.391 -8.045  1.00 0.49 ? 63 ASN B C    1  
ATOM 2096  O O    . ASN B 1 63 ? -14.267 -19.409 -8.616  1.00 0.49 ? 63 ASN B O    1  
ATOM 2097  C CB   . ASN B 1 63 ? -15.755 -18.673 -5.842  1.00 0.49 ? 63 ASN B CB   1  
ATOM 2098  C CG   . ASN B 1 63 ? -16.205 -20.024 -6.401  1.00 0.49 ? 63 ASN B CG   1  
ATOM 2099  O OD1  . ASN B 1 63 ? -15.412 -20.934 -6.537  1.00 0.49 ? 63 ASN B OD1  1  
ATOM 2100  N ND2  . ASN B 1 63 ? -17.456 -20.194 -6.731  1.00 0.49 ? 63 ASN B ND2  1  
ATOM 2101  H H    . ASN B 1 63 ? -14.826 -16.290 -5.702  1.00 0.49 ? 63 ASN B H    1  
ATOM 2102  H HA   . ASN B 1 63 ? -13.642 -18.864 -6.186  1.00 0.49 ? 63 ASN B HA   1  
ATOM 2103  H HB2  . ASN B 1 63 ? -15.586 -18.760 -4.779  1.00 0.49 ? 63 ASN B HB2  1  
ATOM 2104  H HB3  . ASN B 1 63 ? -16.520 -17.935 -6.027  1.00 0.49 ? 63 ASN B HB3  1  
ATOM 2105  H HD21 . ASN B 1 63 ? -18.097 -19.461 -6.621  1.00 0.49 ? 63 ASN B HD21 1  
ATOM 2106  H HD22 . ASN B 1 63 ? -17.755 -21.056 -7.090  1.00 0.49 ? 63 ASN B HD22 1  
ATOM 2107  N N    . SER B 1 64 ? -15.113 -17.382 -8.700  1.00 0.55 ? 64 SER B N    1  
ATOM 2108  C CA   . SER B 1 64 ? -15.283 -17.461 -10.178 1.00 0.55 ? 64 SER B CA   1  
ATOM 2109  C C    . SER B 1 64 ? -13.952 -17.139 -10.861 1.00 0.55 ? 64 SER B C    1  
ATOM 2110  O O    . SER B 1 64 ? -13.806 -17.286 -12.059 1.00 0.55 ? 64 SER B O    1  
ATOM 2111  C CB   . SER B 1 64 ? -16.341 -16.451 -10.623 1.00 0.55 ? 64 SER B CB   1  
ATOM 2112  O OG   . SER B 1 64 ? -15.701 -15.250 -11.035 1.00 0.55 ? 64 SER B OG   1  
ATOM 2113  H H    . SER B 1 64 ? -15.378 -16.570 -8.220  1.00 0.55 ? 64 SER B H    1  
ATOM 2114  H HA   . SER B 1 64 ? -15.597 -18.457 -10.452 1.00 0.55 ? 64 SER B HA   1  
ATOM 2115  H HB2  . SER B 1 64 ? -16.902 -16.854 -11.449 1.00 0.55 ? 64 SER B HB2  1  
ATOM 2116  H HB3  . SER B 1 64 ? -17.013 -16.249 -9.799  1.00 0.55 ? 64 SER B HB3  1  
ATOM 2117  H HG   . SER B 1 64 ? -16.381 -14.631 -11.312 1.00 0.55 ? 64 SER B HG   1  
ATOM 2118  N N    . LEU B 1 65 ? -12.978 -16.701 -10.110 1.00 0.53 ? 65 LEU B N    1  
ATOM 2119  C CA   . LEU B 1 65 ? -11.658 -16.371 -10.716 1.00 0.53 ? 65 LEU B CA   1  
ATOM 2120  C C    . LEU B 1 65 ? -10.773 -17.619 -10.718 1.00 0.53 ? 65 LEU B C    1  
ATOM 2121  O O    . LEU B 1 65 ? -10.301 -18.055 -11.749 1.00 0.53 ? 65 LEU B O    1  
ATOM 2122  C CB   . LEU B 1 65 ? -10.983 -15.270 -9.895  1.00 0.53 ? 65 LEU B CB   1  
ATOM 2123  C CG   . LEU B 1 65 ? -10.613 -14.102 -10.810 1.00 0.53 ? 65 LEU B CG   1  
ATOM 2124  C CD1  . LEU B 1 65 ? -9.808  -14.622 -12.002 1.00 0.53 ? 65 LEU B CD1  1  
ATOM 2125  C CD2  . LEU B 1 65 ? -11.890 -13.427 -11.314 1.00 0.53 ? 65 LEU B CD2  1  
ATOM 2126  H H    . LEU B 1 65 ? -13.116 -16.590 -9.145  1.00 0.53 ? 65 LEU B H    1  
ATOM 2127  H HA   . LEU B 1 65 ? -11.802 -16.028 -11.730 1.00 0.53 ? 65 LEU B HA   1  
ATOM 2128  H HB2  . LEU B 1 65 ? -11.662 -14.926 -9.127  1.00 0.53 ? 65 LEU B HB2  1  
ATOM 2129  H HB3  . LEU B 1 65 ? -10.089 -15.662 -9.435  1.00 0.53 ? 65 LEU B HB3  1  
ATOM 2130  H HG   . LEU B 1 65 ? -10.019 -13.387 -10.259 1.00 0.53 ? 65 LEU B HG   1  
ATOM 2131  H HD11 . LEU B 1 65 ? -9.642  -15.683 -11.890 1.00 0.53 ? 65 LEU B HD11 1  
ATOM 2132  H HD12 . LEU B 1 65 ? -10.355 -14.437 -12.914 1.00 0.53 ? 65 LEU B HD12 1  
ATOM 2133  H HD13 . LEU B 1 65 ? -8.857  -14.111 -12.043 1.00 0.53 ? 65 LEU B HD13 1  
ATOM 2134  H HD21 . LEU B 1 65 ? -12.556 -14.173 -11.720 1.00 0.53 ? 65 LEU B HD21 1  
ATOM 2135  H HD22 . LEU B 1 65 ? -12.376 -12.919 -10.495 1.00 0.53 ? 65 LEU B HD22 1  
ATOM 2136  H HD23 . LEU B 1 65 ? -11.640 -12.711 -12.084 1.00 0.53 ? 65 LEU B HD23 1  
ATOM 2137  N N    . GLU B 1 66 ? -10.544 -18.197 -9.571  1.00 0.61 ? 66 GLU B N    1  
ATOM 2138  C CA   . GLU B 1 66 ? -9.688  -19.416 -9.509  1.00 0.61 ? 66 GLU B CA   1  
ATOM 2139  C C    . GLU B 1 66 ? -10.563 -20.661 -9.673  1.00 0.61 ? 66 GLU B C    1  
ATOM 2140  O O    . GLU B 1 66 ? -10.826 -21.376 -8.726  1.00 0.61 ? 66 GLU B O    1  
ATOM 2141  C CB   . GLU B 1 66 ? -8.974  -19.469 -8.157  1.00 0.61 ? 66 GLU B CB   1  
ATOM 2142  C CG   . GLU B 1 66 ? -8.120  -18.212 -7.979  1.00 0.61 ? 66 GLU B CG   1  
ATOM 2143  C CD   . GLU B 1 66 ? -7.507  -18.204 -6.578  1.00 0.61 ? 66 GLU B CD   1  
ATOM 2144  O OE1  . GLU B 1 66 ? -8.192  -18.600 -5.650  1.00 0.61 ? 66 GLU B OE1  1  
ATOM 2145  O OE2  . GLU B 1 66 ? -6.361  -17.804 -6.457  1.00 0.61 ? 66 GLU B OE2  1  
ATOM 2146  H H    . GLU B 1 66 ? -10.934 -17.829 -8.750  1.00 0.61 ? 66 GLU B H    1  
ATOM 2147  H HA   . GLU B 1 66 ? -8.957  -19.383 -10.302 1.00 0.61 ? 66 GLU B HA   1  
ATOM 2148  H HB2  . GLU B 1 66 ? -9.707  -19.523 -7.365  1.00 0.61 ? 66 GLU B HB2  1  
ATOM 2149  H HB3  . GLU B 1 66 ? -8.338  -20.341 -8.119  1.00 0.61 ? 66 GLU B HB3  1  
ATOM 2150  H HG2  . GLU B 1 66 ? -7.333  -18.204 -8.719  1.00 0.61 ? 66 GLU B HG2  1  
ATOM 2151  H HG3  . GLU B 1 66 ? -8.740  -17.336 -8.103  1.00 0.61 ? 66 GLU B HG3  1  
ATOM 2152  N N    . MET B 1 67 ? -11.016 -20.925 -10.868 1.00 1.45 ? 67 MET B N    1  
ATOM 2153  C CA   . MET B 1 67 ? -11.873 -22.124 -11.092 1.00 1.45 ? 67 MET B CA   1  
ATOM 2154  C C    . MET B 1 67 ? -10.994 -23.375 -11.152 1.00 1.45 ? 67 MET B C    1  
ATOM 2155  O O    . MET B 1 67 ? -9.843  -23.357 -10.762 1.00 1.45 ? 67 MET B O    1  
ATOM 2156  C CB   . MET B 1 67 ? -12.631 -21.970 -12.412 1.00 1.45 ? 67 MET B CB   1  
ATOM 2157  C CG   . MET B 1 67 ? -14.136 -21.989 -12.141 1.00 1.45 ? 67 MET B CG   1  
ATOM 2158  S SD   . MET B 1 67 ? -14.951 -20.749 -13.180 1.00 1.45 ? 67 MET B SD   1  
ATOM 2159  C CE   . MET B 1 67 ? -16.262 -21.819 -13.821 1.00 1.45 ? 67 MET B CE   1  
ATOM 2160  H H    . MET B 1 67 ? -10.793 -20.336 -11.618 1.00 1.45 ? 67 MET B H    1  
ATOM 2161  H HA   . MET B 1 67 ? -12.579 -22.218 -10.280 1.00 1.45 ? 67 MET B HA   1  
ATOM 2162  H HB2  . MET B 1 67 ? -12.359 -21.032 -12.875 1.00 1.45 ? 67 MET B HB2  1  
ATOM 2163  H HB3  . MET B 1 67 ? -12.376 -22.785 -13.071 1.00 1.45 ? 67 MET B HB3  1  
ATOM 2164  H HG2  . MET B 1 67 ? -14.532 -22.966 -12.371 1.00 1.45 ? 67 MET B HG2  1  
ATOM 2165  H HG3  . MET B 1 67 ? -14.319 -21.762 -11.101 1.00 1.45 ? 67 MET B HG3  1  
ATOM 2166  H HE1  . MET B 1 67 ? -15.883 -22.820 -13.948 1.00 1.45 ? 67 MET B HE1  1  
ATOM 2167  H HE2  . MET B 1 67 ? -17.087 -21.835 -13.122 1.00 1.45 ? 67 MET B HE2  1  
ATOM 2168  H HE3  . MET B 1 67 ? -16.601 -21.440 -14.776 1.00 1.45 ? 67 MET B HE3  1  
ATOM 2169  N N    . SER B 1 68 ? -11.528 -24.463 -11.635 1.00 2.84 ? 68 SER B N    1  
ATOM 2170  C CA   . SER B 1 68 ? -10.724 -25.714 -11.720 1.00 2.84 ? 68 SER B CA   1  
ATOM 2171  C C    . SER B 1 68 ? -9.331  -25.390 -12.265 1.00 2.84 ? 68 SER B C    1  
ATOM 2172  O O    . SER B 1 68 ? -9.227  -24.465 -13.054 1.00 2.84 ? 68 SER B O    1  
ATOM 2173  C CB   . SER B 1 68 ? -11.418 -26.706 -12.654 1.00 2.84 ? 68 SER B CB   1  
ATOM 2174  O OG   . SER B 1 68 ? -12.231 -25.991 -13.576 1.00 2.84 ? 68 SER B OG   1  
ATOM 2175  O OXT  . SER B 1 68 ? -8.393  -26.070 -11.884 1.00 2.84 ? 68 SER B OXT  1  
ATOM 2176  H H    . SER B 1 68 ? -12.459 -24.458 -11.944 1.00 2.84 ? 68 SER B H    1  
ATOM 2177  H HA   . SER B 1 68 ? -10.632 -26.150 -10.736 1.00 2.84 ? 68 SER B HA   1  
ATOM 2178  H HB2  . SER B 1 68 ? -10.679 -27.270 -13.198 1.00 2.84 ? 68 SER B HB2  1  
ATOM 2179  H HB3  . SER B 1 68 ? -12.027 -27.382 -12.070 1.00 2.84 ? 68 SER B HB3  1  
ATOM 2180  H HG   . SER B 1 68 ? -13.070 -26.452 -13.650 1.00 2.84 ? 68 SER B HG   1  
ATOM 2181  N N    . SER A 1 1  ? -17.615 5.701   -2.811  1.00 5.93 ? 1  SER A N    2  
ATOM 2182  C CA   . SER A 1 1  ? -16.955 5.482   -1.494  1.00 5.93 ? 1  SER A CA   2  
ATOM 2183  C C    . SER A 1 1  ? -16.748 6.830   -0.796  1.00 5.93 ? 1  SER A C    2  
ATOM 2184  O O    . SER A 1 1  ? -16.713 7.860   -1.440  1.00 5.93 ? 1  SER A O    2  
ATOM 2185  C CB   . SER A 1 1  ? -15.600 4.807   -1.709  1.00 5.93 ? 1  SER A CB   2  
ATOM 2186  O OG   . SER A 1 1  ? -15.805 3.445   -2.063  1.00 5.93 ? 1  SER A OG   2  
ATOM 2187  H H1   . SER A 1 1  ? -17.884 6.701   -2.903  1.00 5.93 ? 1  SER A H1   2  
ATOM 2188  H H2   . SER A 1 1  ? -16.957 5.449   -3.576  1.00 5.93 ? 1  SER A H2   2  
ATOM 2189  H H3   . SER A 1 1  ? -18.466 5.105   -2.875  1.00 5.93 ? 1  SER A H3   2  
ATOM 2190  H HA   . SER A 1 1  ? -17.579 4.850   -0.879  1.00 5.93 ? 1  SER A HA   2  
ATOM 2191  H HB2  . SER A 1 1  ? -15.069 5.303   -2.504  1.00 5.93 ? 1  SER A HB2  2  
ATOM 2192  H HB3  . SER A 1 1  ? -15.020 4.868   -0.798  1.00 5.93 ? 1  SER A HB3  2  
ATOM 2193  H HG   . SER A 1 1  ? -14.945 3.033   -2.169  1.00 5.93 ? 1  SER A HG   2  
ATOM 2194  N N    . PRO A 1 2  ? -16.616 6.779   0.505   1.00 3.89 ? 2  PRO A N    2  
ATOM 2195  C CA   . PRO A 1 2  ? -16.411 7.982   1.330   1.00 3.89 ? 2  PRO A CA   2  
ATOM 2196  C C    . PRO A 1 2  ? -14.955 8.449   1.239   1.00 3.89 ? 2  PRO A C    2  
ATOM 2197  O O    . PRO A 1 2  ? -14.679 9.601   0.967   1.00 3.89 ? 2  PRO A O    2  
ATOM 2198  C CB   . PRO A 1 2  ? -16.745 7.505   2.746   1.00 3.89 ? 2  PRO A CB   2  
ATOM 2199  C CG   . PRO A 1 2  ? -16.569 5.968   2.743   1.00 3.89 ? 2  PRO A CG   2  
ATOM 2200  C CD   . PRO A 1 2  ? -16.661 5.518   1.273   1.00 3.89 ? 2  PRO A CD   2  
ATOM 2201  H HA   . PRO A 1 2  ? -17.086 8.768   1.035   1.00 3.89 ? 2  PRO A HA   2  
ATOM 2202  H HB2  . PRO A 1 2  ? -16.067 7.960   3.458   1.00 3.89 ? 2  PRO A HB2  2  
ATOM 2203  H HB3  . PRO A 1 2  ? -17.765 7.754   2.992   1.00 3.89 ? 2  PRO A HB3  2  
ATOM 2204  H HG2  . PRO A 1 2  ? -15.602 5.706   3.154   1.00 3.89 ? 2  PRO A HG2  2  
ATOM 2205  H HG3  . PRO A 1 2  ? -17.354 5.504   3.317   1.00 3.89 ? 2  PRO A HG3  2  
ATOM 2206  H HD2  . PRO A 1 2  ? -15.821 4.886   1.018   1.00 3.89 ? 2  PRO A HD2  2  
ATOM 2207  H HD3  . PRO A 1 2  ? -17.593 5.004   1.092   1.00 3.89 ? 2  PRO A HD3  2  
ATOM 2208  N N    . TYR A 1 3  ? -14.023 7.565   1.465   1.00 2.56 ? 3  TYR A N    2  
ATOM 2209  C CA   . TYR A 1 3  ? -12.587 7.959   1.391   1.00 2.56 ? 3  TYR A CA   2  
ATOM 2210  C C    . TYR A 1 3  ? -11.999 7.495   0.058   1.00 2.56 ? 3  TYR A C    2  
ATOM 2211  O O    . TYR A 1 3  ? -11.793 8.279   -0.848  1.00 2.56 ? 3  TYR A O    2  
ATOM 2212  C CB   . TYR A 1 3  ? -11.819 7.308   2.543   1.00 2.56 ? 3  TYR A CB   2  
ATOM 2213  C CG   . TYR A 1 3  ? -11.858 8.213   3.750   1.00 2.56 ? 3  TYR A CG   2  
ATOM 2214  C CD1  . TYR A 1 3  ? -13.086 8.653   4.256   1.00 2.56 ? 3  TYR A CD1  2  
ATOM 2215  C CD2  . TYR A 1 3  ? -10.665 8.610   4.365   1.00 2.56 ? 3  TYR A CD2  2  
ATOM 2216  C CE1  . TYR A 1 3  ? -13.122 9.493   5.375   1.00 2.56 ? 3  TYR A CE1  2  
ATOM 2217  C CE2  . TYR A 1 3  ? -10.701 9.448   5.486   1.00 2.56 ? 3  TYR A CE2  2  
ATOM 2218  C CZ   . TYR A 1 3  ? -11.929 9.890   5.991   1.00 2.56 ? 3  TYR A CZ   2  
ATOM 2219  O OH   . TYR A 1 3  ? -11.964 10.717  7.095   1.00 2.56 ? 3  TYR A OH   2  
ATOM 2220  H H    . TYR A 1 3  ? -14.265 6.641   1.683   1.00 2.56 ? 3  TYR A H    2  
ATOM 2221  H HA   . TYR A 1 3  ? -12.505 9.034   1.467   1.00 2.56 ? 3  TYR A HA   2  
ATOM 2222  H HB2  . TYR A 1 3  ? -12.276 6.359   2.788   1.00 2.56 ? 3  TYR A HB2  2  
ATOM 2223  H HB3  . TYR A 1 3  ? -10.793 7.148   2.246   1.00 2.56 ? 3  TYR A HB3  2  
ATOM 2224  H HD1  . TYR A 1 3  ? -14.007 8.347   3.781   1.00 2.56 ? 3  TYR A HD1  2  
ATOM 2225  H HD2  . TYR A 1 3  ? -9.717  8.269   3.976   1.00 2.56 ? 3  TYR A HD2  2  
ATOM 2226  H HE1  . TYR A 1 3  ? -14.070 9.833   5.765   1.00 2.56 ? 3  TYR A HE1  2  
ATOM 2227  H HE2  . TYR A 1 3  ? -9.780  9.756   5.960   1.00 2.56 ? 3  TYR A HE2  2  
ATOM 2228  H HH   . TYR A 1 3  ? -12.524 11.468  6.885   1.00 2.56 ? 3  TYR A HH   2  
ATOM 2229  N N    . SER A 1 4  ? -11.726 6.225   -0.070  1.00 0.96 ? 4  SER A N    2  
ATOM 2230  C CA   . SER A 1 4  ? -11.151 5.712   -1.346  1.00 0.96 ? 4  SER A CA   2  
ATOM 2231  C C    . SER A 1 4  ? -11.196 4.183   -1.347  1.00 0.96 ? 4  SER A C    2  
ATOM 2232  O O    . SER A 1 4  ? -10.912 3.543   -0.354  1.00 0.96 ? 4  SER A O    2  
ATOM 2233  C CB   . SER A 1 4  ? -9.700  6.179   -1.475  1.00 0.96 ? 4  SER A CB   2  
ATOM 2234  O OG   . SER A 1 4  ? -9.581  7.034   -2.604  1.00 0.96 ? 4  SER A OG   2  
ATOM 2235  H H    . SER A 1 4  ? -11.899 5.609   0.671   1.00 0.96 ? 4  SER A H    2  
ATOM 2236  H HA   . SER A 1 4  ? -11.726 6.090   -2.179  1.00 0.96 ? 4  SER A HA   2  
ATOM 2237  H HB2  . SER A 1 4  ? -9.413  6.720   -0.589  1.00 0.96 ? 4  SER A HB2  2  
ATOM 2238  H HB3  . SER A 1 4  ? -9.055  5.318   -1.593  1.00 0.96 ? 4  SER A HB3  2  
ATOM 2239  H HG   . SER A 1 4  ? -8.908  6.670   -3.183  1.00 0.96 ? 4  SER A HG   2  
ATOM 2240  N N    . SER A 1 5  ? -11.553 3.592   -2.454  1.00 0.48 ? 5  SER A N    2  
ATOM 2241  C CA   . SER A 1 5  ? -11.617 2.104   -2.516  1.00 0.48 ? 5  SER A CA   2  
ATOM 2242  C C    . SER A 1 5  ? -10.465 1.580   -3.376  1.00 0.48 ? 5  SER A C    2  
ATOM 2243  O O    . SER A 1 5  ? -10.575 0.558   -4.023  1.00 0.48 ? 5  SER A O    2  
ATOM 2244  C CB   . SER A 1 5  ? -12.948 1.677   -3.134  1.00 0.48 ? 5  SER A CB   2  
ATOM 2245  O OG   . SER A 1 5  ? -13.349 2.642   -4.098  1.00 0.48 ? 5  SER A OG   2  
ATOM 2246  H H    . SER A 1 5  ? -11.779 4.126   -3.244  1.00 0.48 ? 5  SER A H    2  
ATOM 2247  H HA   . SER A 1 5  ? -11.536 1.698   -1.520  1.00 0.48 ? 5  SER A HA   2  
ATOM 2248  H HB2  . SER A 1 5  ? -12.834 0.720   -3.617  1.00 0.48 ? 5  SER A HB2  2  
ATOM 2249  H HB3  . SER A 1 5  ? -13.696 1.598   -2.355  1.00 0.48 ? 5  SER A HB3  2  
ATOM 2250  H HG   . SER A 1 5  ? -12.561 2.962   -4.543  1.00 0.48 ? 5  SER A HG   2  
ATOM 2251  N N    . ASP A 1 6  ? -9.358  2.272   -3.387  1.00 0.37 ? 6  ASP A N    2  
ATOM 2252  C CA   . ASP A 1 6  ? -8.200  1.811   -4.205  1.00 0.37 ? 6  ASP A CA   2  
ATOM 2253  C C    . ASP A 1 6  ? -7.011  1.521   -3.287  1.00 0.37 ? 6  ASP A C    2  
ATOM 2254  O O    . ASP A 1 6  ? -6.736  2.256   -2.359  1.00 0.37 ? 6  ASP A O    2  
ATOM 2255  C CB   . ASP A 1 6  ? -7.818  2.903   -5.207  1.00 0.37 ? 6  ASP A CB   2  
ATOM 2256  C CG   . ASP A 1 6  ? -9.080  3.445   -5.878  1.00 0.37 ? 6  ASP A CG   2  
ATOM 2257  O OD1  . ASP A 1 6  ? -9.730  4.287   -5.280  1.00 0.37 ? 6  ASP A OD1  2  
ATOM 2258  O OD2  . ASP A 1 6  ? -9.375  3.011   -6.979  1.00 0.37 ? 6  ASP A OD2  2  
ATOM 2259  H H    . ASP A 1 6  ? -9.288  3.093   -2.857  1.00 0.37 ? 6  ASP A H    2  
ATOM 2260  H HA   . ASP A 1 6  ? -8.471  0.912   -4.738  1.00 0.37 ? 6  ASP A HA   2  
ATOM 2261  H HB2  . ASP A 1 6  ? -7.311  3.705   -4.688  1.00 0.37 ? 6  ASP A HB2  2  
ATOM 2262  H HB3  . ASP A 1 6  ? -7.162  2.488   -5.958  1.00 0.37 ? 6  ASP A HB3  2  
ATOM 2263  N N    . THR A 1 7  ? -6.302  0.455   -3.538  1.00 0.35 ? 7  THR A N    2  
ATOM 2264  C CA   . THR A 1 7  ? -5.132  0.118   -2.680  1.00 0.35 ? 7  THR A CA   2  
ATOM 2265  C C    . THR A 1 7  ? -4.311  1.382   -2.418  1.00 0.35 ? 7  THR A C    2  
ATOM 2266  O O    . THR A 1 7  ? -4.457  2.381   -3.095  1.00 0.35 ? 7  THR A O    2  
ATOM 2267  C CB   . THR A 1 7  ? -4.258  -0.918  -3.393  1.00 0.35 ? 7  THR A CB   2  
ATOM 2268  O OG1  . THR A 1 7  ? -4.193  -0.608  -4.777  1.00 0.35 ? 7  THR A OG1  2  
ATOM 2269  C CG2  . THR A 1 7  ? -4.862  -2.311  -3.208  1.00 0.35 ? 7  THR A CG2  2  
ATOM 2270  H H    . THR A 1 7  ? -6.540  -0.125  -4.292  1.00 0.35 ? 7  THR A H    2  
ATOM 2271  H HA   . THR A 1 7  ? -5.478  -0.288  -1.742  1.00 0.35 ? 7  THR A HA   2  
ATOM 2272  H HB   . THR A 1 7  ? -3.264  -0.903  -2.972  1.00 0.35 ? 7  THR A HB   2  
ATOM 2273  H HG1  . THR A 1 7  ? -3.381  -0.120  -4.935  1.00 0.35 ? 7  THR A HG1  2  
ATOM 2274  H HG21 . THR A 1 7  ? -5.859  -2.329  -3.623  1.00 0.35 ? 7  THR A HG21 2  
ATOM 2275  H HG22 . THR A 1 7  ? -4.246  -3.040  -3.714  1.00 0.35 ? 7  THR A HG22 2  
ATOM 2276  H HG23 . THR A 1 7  ? -4.907  -2.546  -2.155  1.00 0.35 ? 7  THR A HG23 2  
ATOM 2277  N N    . THR A 1 8  ? -3.447  1.348   -1.440  1.00 0.31 ? 8  THR A N    2  
ATOM 2278  C CA   . THR A 1 8  ? -2.617  2.548   -1.136  1.00 0.31 ? 8  THR A CA   2  
ATOM 2279  C C    . THR A 1 8  ? -1.139  2.215   -1.365  1.00 0.31 ? 8  THR A C    2  
ATOM 2280  O O    . THR A 1 8  ? -0.701  1.120   -1.069  1.00 0.31 ? 8  THR A O    2  
ATOM 2281  C CB   . THR A 1 8  ? -2.830  2.955   0.325   1.00 0.31 ? 8  THR A CB   2  
ATOM 2282  O OG1  . THR A 1 8  ? -4.165  3.409   0.499   1.00 0.31 ? 8  THR A OG1  2  
ATOM 2283  C CG2  . THR A 1 8  ? -1.855  4.075   0.696   1.00 0.31 ? 8  THR A CG2  2  
ATOM 2284  H H    . THR A 1 8  ? -3.344  0.533   -0.906  1.00 0.31 ? 8  THR A H    2  
ATOM 2285  H HA   . THR A 1 8  ? -2.912  3.361   -1.782  1.00 0.31 ? 8  THR A HA   2  
ATOM 2286  H HB   . THR A 1 8  ? -2.653  2.104   0.965   1.00 0.31 ? 8  THR A HB   2  
ATOM 2287  H HG1  . THR A 1 8  ? -4.751  2.657   0.385   1.00 0.31 ? 8  THR A HG1  2  
ATOM 2288  H HG21 . THR A 1 8  ? -0.884  3.863   0.274   1.00 0.31 ? 8  THR A HG21 2  
ATOM 2289  H HG22 . THR A 1 8  ? -2.222  5.014   0.306   1.00 0.31 ? 8  THR A HG22 2  
ATOM 2290  H HG23 . THR A 1 8  ? -1.775  4.140   1.771   1.00 0.31 ? 8  THR A HG23 2  
ATOM 2291  N N    . PRO A 1 9  ? -0.411  3.172   -1.885  1.00 0.34 ? 9  PRO A N    2  
ATOM 2292  C CA   . PRO A 1 9  ? 1.027   3.011   -2.164  1.00 0.34 ? 9  PRO A CA   2  
ATOM 2293  C C    . PRO A 1 9  ? 1.836   3.149   -0.871  1.00 0.34 ? 9  PRO A C    2  
ATOM 2294  O O    . PRO A 1 9  ? 2.494   4.145   -0.642  1.00 0.34 ? 9  PRO A O    2  
ATOM 2295  C CB   . PRO A 1 9  ? 1.336   4.160   -3.128  1.00 0.34 ? 9  PRO A CB   2  
ATOM 2296  C CG   . PRO A 1 9  ? 0.237   5.225   -2.903  1.00 0.34 ? 9  PRO A CG   2  
ATOM 2297  C CD   . PRO A 1 9  ? -0.950  4.501   -2.241  1.00 0.34 ? 9  PRO A CD   2  
ATOM 2298  H HA   . PRO A 1 9  ? 1.221   2.064   -2.640  1.00 0.34 ? 9  PRO A HA   2  
ATOM 2299  H HB2  . PRO A 1 9  ? 2.310   4.575   -2.908  1.00 0.34 ? 9  PRO A HB2  2  
ATOM 2300  H HB3  . PRO A 1 9  ? 1.301   3.810   -4.147  1.00 0.34 ? 9  PRO A HB3  2  
ATOM 2301  H HG2  . PRO A 1 9  ? 0.606   6.007   -2.255  1.00 0.34 ? 9  PRO A HG2  2  
ATOM 2302  H HG3  . PRO A 1 9  ? -0.074  5.642   -3.849  1.00 0.34 ? 9  PRO A HG3  2  
ATOM 2303  H HD2  . PRO A 1 9  ? -1.270  5.034   -1.356  1.00 0.34 ? 9  PRO A HD2  2  
ATOM 2304  H HD3  . PRO A 1 9  ? -1.768  4.396   -2.937  1.00 0.34 ? 9  PRO A HD3  2  
ATOM 2305  N N    . CYS A 1 10 ? 1.791   2.157   -0.024  1.00 0.35 ? 10 CYS A N    2  
ATOM 2306  C CA   . CYS A 1 10 ? 2.554   2.234   1.253   1.00 0.35 ? 10 CYS A CA   2  
ATOM 2307  C C    . CYS A 1 10 ? 3.929   1.590   1.067   1.00 0.35 ? 10 CYS A C    2  
ATOM 2308  O O    . CYS A 1 10 ? 4.043   0.450   0.664   1.00 0.35 ? 10 CYS A O    2  
ATOM 2309  C CB   . CYS A 1 10 ? 1.787   1.491   2.348   1.00 0.35 ? 10 CYS A CB   2  
ATOM 2310  S SG   . CYS A 1 10 ? 0.233   2.356   2.685   1.00 0.35 ? 10 CYS A SG   2  
ATOM 2311  H H    . CYS A 1 10 ? 1.252   1.364   -0.226  1.00 0.35 ? 10 CYS A H    2  
ATOM 2312  H HA   . CYS A 1 10 ? 2.676   3.268   1.538   1.00 0.35 ? 10 CYS A HA   2  
ATOM 2313  H HB2  . CYS A 1 10 ? 1.575   0.485   2.020   1.00 0.35 ? 10 CYS A HB2  2  
ATOM 2314  H HB3  . CYS A 1 10 ? 2.383   1.459   3.248   1.00 0.35 ? 10 CYS A HB3  2  
ATOM 2315  N N    . CYS A 1 11 ? 4.975   2.313   1.360   1.00 0.32 ? 11 CYS A N    2  
ATOM 2316  C CA   . CYS A 1 11 ? 6.342   1.743   1.203   1.00 0.32 ? 11 CYS A CA   2  
ATOM 2317  C C    . CYS A 1 11 ? 7.001   1.619   2.578   1.00 0.32 ? 11 CYS A C    2  
ATOM 2318  O O    . CYS A 1 11 ? 6.968   2.531   3.378   1.00 0.32 ? 11 CYS A O    2  
ATOM 2319  C CB   . CYS A 1 11 ? 7.180   2.666   0.315   1.00 0.32 ? 11 CYS A CB   2  
ATOM 2320  S SG   . CYS A 1 11 ? 7.124   2.070   -1.393  1.00 0.32 ? 11 CYS A SG   2  
ATOM 2321  H H    . CYS A 1 11 ? 4.861   3.231   1.685   1.00 0.32 ? 11 CYS A H    2  
ATOM 2322  H HA   . CYS A 1 11 ? 6.275   0.768   0.746   1.00 0.32 ? 11 CYS A HA   2  
ATOM 2323  H HB2  . CYS A 1 11 ? 6.782   3.668   0.361   1.00 0.32 ? 11 CYS A HB2  2  
ATOM 2324  H HB3  . CYS A 1 11 ? 8.203   2.668   0.663   1.00 0.32 ? 11 CYS A HB3  2  
ATOM 2325  N N    . PHE A 1 12 ? 7.596   0.492   2.858   1.00 0.28 ? 12 PHE A N    2  
ATOM 2326  C CA   . PHE A 1 12 ? 8.252   0.307   4.183   1.00 0.28 ? 12 PHE A CA   2  
ATOM 2327  C C    . PHE A 1 12 ? 9.740   0.009   3.980   1.00 0.28 ? 12 PHE A C    2  
ATOM 2328  O O    . PHE A 1 12 ? 10.546  0.189   4.871   1.00 0.28 ? 12 PHE A O    2  
ATOM 2329  C CB   . PHE A 1 12 ? 7.591   -0.861  4.920   1.00 0.28 ? 12 PHE A CB   2  
ATOM 2330  C CG   . PHE A 1 12 ? 6.118   -0.892  4.589   1.00 0.28 ? 12 PHE A CG   2  
ATOM 2331  C CD1  . PHE A 1 12 ? 5.672   -1.560  3.442   1.00 0.28 ? 12 PHE A CD1  2  
ATOM 2332  C CD2  . PHE A 1 12 ? 5.198   -0.250  5.426   1.00 0.28 ? 12 PHE A CD2  2  
ATOM 2333  C CE1  . PHE A 1 12 ? 4.306   -1.587  3.133   1.00 0.28 ? 12 PHE A CE1  2  
ATOM 2334  C CE2  . PHE A 1 12 ? 3.833   -0.276  5.119   1.00 0.28 ? 12 PHE A CE2  2  
ATOM 2335  C CZ   . PHE A 1 12 ? 3.387   -0.945  3.972   1.00 0.28 ? 12 PHE A CZ   2  
ATOM 2336  H H    . PHE A 1 12 ? 7.609   -0.233  2.200   1.00 0.28 ? 12 PHE A H    2  
ATOM 2337  H HA   . PHE A 1 12 ? 8.143   1.208   4.769   1.00 0.28 ? 12 PHE A HA   2  
ATOM 2338  H HB2  . PHE A 1 12 ? 8.051   -1.788  4.609   1.00 0.28 ? 12 PHE A HB2  2  
ATOM 2339  H HB3  . PHE A 1 12 ? 7.718   -0.734  5.984   1.00 0.28 ? 12 PHE A HB3  2  
ATOM 2340  H HD1  . PHE A 1 12 ? 6.381   -2.056  2.796   1.00 0.28 ? 12 PHE A HD1  2  
ATOM 2341  H HD2  . PHE A 1 12 ? 5.542   0.266   6.312   1.00 0.28 ? 12 PHE A HD2  2  
ATOM 2342  H HE1  . PHE A 1 12 ? 3.962   -2.101  2.248   1.00 0.28 ? 12 PHE A HE1  2  
ATOM 2343  H HE2  . PHE A 1 12 ? 3.124   0.219   5.765   1.00 0.28 ? 12 PHE A HE2  2  
ATOM 2344  H HZ   . PHE A 1 12 ? 2.333   -0.964  3.734   1.00 0.28 ? 12 PHE A HZ   2  
ATOM 2345  N N    . ALA A 1 13 ? 10.110  -0.444  2.812   1.00 0.31 ? 13 ALA A N    2  
ATOM 2346  C CA   . ALA A 1 13 ? 11.545  -0.751  2.553   1.00 0.31 ? 13 ALA A CA   2  
ATOM 2347  C C    . ALA A 1 13 ? 12.240  0.496   2.005   1.00 0.31 ? 13 ALA A C    2  
ATOM 2348  O O    . ALA A 1 13 ? 11.601  1.443   1.591   1.00 0.31 ? 13 ALA A O    2  
ATOM 2349  C CB   . ALA A 1 13 ? 11.648  -1.884  1.530   1.00 0.31 ? 13 ALA A CB   2  
ATOM 2350  H H    . ALA A 1 13 ? 9.445   -0.581  2.107   1.00 0.31 ? 13 ALA A H    2  
ATOM 2351  H HA   . ALA A 1 13 ? 12.021  -1.053  3.475   1.00 0.31 ? 13 ALA A HA   2  
ATOM 2352  H HB1  . ALA A 1 13 ? 10.704  -2.405  1.476   1.00 0.31 ? 13 ALA A HB1  2  
ATOM 2353  H HB2  . ALA A 1 13 ? 11.889  -1.473  0.561   1.00 0.31 ? 13 ALA A HB2  2  
ATOM 2354  H HB3  . ALA A 1 13 ? 12.423  -2.572  1.832   1.00 0.31 ? 13 ALA A HB3  2  
ATOM 2355  N N    . TYR A 1 14 ? 13.546  0.507   1.998   1.00 0.29 ? 14 TYR A N    2  
ATOM 2356  C CA   . TYR A 1 14 ? 14.277  1.695   1.476   1.00 0.29 ? 14 TYR A CA   2  
ATOM 2357  C C    . TYR A 1 14 ? 15.513  1.234   0.700   1.00 0.29 ? 14 TYR A C    2  
ATOM 2358  O O    . TYR A 1 14 ? 16.553  0.968   1.269   1.00 0.29 ? 14 TYR A O    2  
ATOM 2359  C CB   . TYR A 1 14 ? 14.712  2.580   2.645   1.00 0.29 ? 14 TYR A CB   2  
ATOM 2360  C CG   . TYR A 1 14 ? 13.490  3.140   3.332   1.00 0.29 ? 14 TYR A CG   2  
ATOM 2361  C CD1  . TYR A 1 14 ? 12.441  3.670   2.572   1.00 0.29 ? 14 TYR A CD1  2  
ATOM 2362  C CD2  . TYR A 1 14 ? 13.406  3.129   4.730   1.00 0.29 ? 14 TYR A CD2  2  
ATOM 2363  C CE1  . TYR A 1 14 ? 11.307  4.187   3.209   1.00 0.29 ? 14 TYR A CE1  2  
ATOM 2364  C CE2  . TYR A 1 14 ? 12.271  3.646   5.367   1.00 0.29 ? 14 TYR A CE2  2  
ATOM 2365  C CZ   . TYR A 1 14 ? 11.223  4.176   4.607   1.00 0.29 ? 14 TYR A CZ   2  
ATOM 2366  O OH   . TYR A 1 14 ? 10.105  4.686   5.233   1.00 0.29 ? 14 TYR A OH   2  
ATOM 2367  H H    . TYR A 1 14 ? 14.043  -0.266  2.336   1.00 0.29 ? 14 TYR A H    2  
ATOM 2368  H HA   . TYR A 1 14 ? 13.629  2.257   0.820   1.00 0.29 ? 14 TYR A HA   2  
ATOM 2369  H HB2  . TYR A 1 14 ? 15.285  1.994   3.348   1.00 0.29 ? 14 TYR A HB2  2  
ATOM 2370  H HB3  . TYR A 1 14 ? 15.319  3.393   2.275   1.00 0.29 ? 14 TYR A HB3  2  
ATOM 2371  H HD1  . TYR A 1 14 ? 12.505  3.679   1.495   1.00 0.29 ? 14 TYR A HD1  2  
ATOM 2372  H HD2  . TYR A 1 14 ? 14.216  2.721   5.316   1.00 0.29 ? 14 TYR A HD2  2  
ATOM 2373  H HE1  . TYR A 1 14 ? 10.499  4.594   2.622   1.00 0.29 ? 14 TYR A HE1  2  
ATOM 2374  H HE2  . TYR A 1 14 ? 12.206  3.637   6.445   1.00 0.29 ? 14 TYR A HE2  2  
ATOM 2375  H HH   . TYR A 1 14 ? 10.336  5.542   5.602   1.00 0.29 ? 14 TYR A HH   2  
ATOM 2376  N N    . ILE A 1 15 ? 15.408  1.139   -0.598  1.00 0.32 ? 15 ILE A N    2  
ATOM 2377  C CA   . ILE A 1 15 ? 16.578  0.697   -1.409  1.00 0.32 ? 15 ILE A CA   2  
ATOM 2378  C C    . ILE A 1 15 ? 17.803  1.531   -1.029  1.00 0.32 ? 15 ILE A C    2  
ATOM 2379  O O    . ILE A 1 15 ? 17.687  2.656   -0.584  1.00 0.32 ? 15 ILE A O    2  
ATOM 2380  C CB   . ILE A 1 15 ? 16.270  0.889   -2.895  1.00 0.32 ? 15 ILE A CB   2  
ATOM 2381  C CG1  . ILE A 1 15 ? 17.461  0.409   -3.727  1.00 0.32 ? 15 ILE A CG1  2  
ATOM 2382  C CG2  . ILE A 1 15 ? 16.017  2.371   -3.176  1.00 0.32 ? 15 ILE A CG2  2  
ATOM 2383  C CD1  . ILE A 1 15 ? 16.962  -0.125  -5.071  1.00 0.32 ? 15 ILE A CD1  2  
ATOM 2384  H H    . ILE A 1 15 ? 14.561  1.359   -1.039  1.00 0.32 ? 15 ILE A H    2  
ATOM 2385  H HA   . ILE A 1 15 ? 16.778  -0.346  -1.214  1.00 0.32 ? 15 ILE A HA   2  
ATOM 2386  H HB   . ILE A 1 15 ? 15.391  0.318   -3.157  1.00 0.32 ? 15 ILE A HB   2  
ATOM 2387  H HG12 . ILE A 1 15 ? 18.138  1.234   -3.896  1.00 0.32 ? 15 ILE A HG12 2  
ATOM 2388  H HG13 . ILE A 1 15 ? 17.976  -0.378  -3.198  1.00 0.32 ? 15 ILE A HG13 2  
ATOM 2389  H HG21 . ILE A 1 15 ? 16.502  2.969   -2.420  1.00 0.32 ? 15 ILE A HG21 2  
ATOM 2390  H HG22 . ILE A 1 15 ? 16.414  2.625   -4.148  1.00 0.32 ? 15 ILE A HG22 2  
ATOM 2391  H HG23 . ILE A 1 15 ? 14.953  2.564   -3.161  1.00 0.32 ? 15 ILE A HG23 2  
ATOM 2392  H HD11 . ILE A 1 15 ? 16.037  0.365   -5.333  1.00 0.32 ? 15 ILE A HD11 2  
ATOM 2393  H HD12 . ILE A 1 15 ? 17.702  0.070   -5.834  1.00 0.32 ? 15 ILE A HD12 2  
ATOM 2394  H HD13 . ILE A 1 15 ? 16.797  -1.190  -4.996  1.00 0.32 ? 15 ILE A HD13 2  
ATOM 2395  N N    . ALA A 1 16 ? 18.978  0.989   -1.201  1.00 0.38 ? 16 ALA A N    2  
ATOM 2396  C CA   . ALA A 1 16 ? 20.208  1.753   -0.848  1.00 0.38 ? 16 ALA A CA   2  
ATOM 2397  C C    . ALA A 1 16 ? 20.879  2.257   -2.126  1.00 0.38 ? 16 ALA A C    2  
ATOM 2398  O O    . ALA A 1 16 ? 21.695  3.158   -2.097  1.00 0.38 ? 16 ALA A O    2  
ATOM 2399  C CB   . ALA A 1 16 ? 21.174  0.841   -0.091  1.00 0.38 ? 16 ALA A CB   2  
ATOM 2400  H H    . ALA A 1 16 ? 19.051  0.081   -1.560  1.00 0.38 ? 16 ALA A H    2  
ATOM 2401  H HA   . ALA A 1 16 ? 19.943  2.594   -0.225  1.00 0.38 ? 16 ALA A HA   2  
ATOM 2402  H HB1  . ALA A 1 16 ? 21.215  -0.123  -0.576  1.00 0.38 ? 16 ALA A HB1  2  
ATOM 2403  H HB2  . ALA A 1 16 ? 22.159  1.285   -0.087  1.00 0.38 ? 16 ALA A HB2  2  
ATOM 2404  H HB3  . ALA A 1 16 ? 20.832  0.718   0.927   1.00 0.38 ? 16 ALA A HB3  2  
ATOM 2405  N N    . ARG A 1 17 ? 20.544  1.685   -3.250  1.00 0.42 ? 17 ARG A N    2  
ATOM 2406  C CA   . ARG A 1 17 ? 21.165  2.133   -4.528  1.00 0.42 ? 17 ARG A CA   2  
ATOM 2407  C C    . ARG A 1 17 ? 20.198  3.062   -5.269  1.00 0.42 ? 17 ARG A C    2  
ATOM 2408  O O    . ARG A 1 17 ? 18.997  2.912   -5.165  1.00 0.42 ? 17 ARG A O    2  
ATOM 2409  C CB   . ARG A 1 17 ? 21.471  0.914   -5.402  1.00 0.42 ? 17 ARG A CB   2  
ATOM 2410  C CG   . ARG A 1 17 ? 22.961  0.577   -5.305  1.00 0.42 ? 17 ARG A CG   2  
ATOM 2411  C CD   . ARG A 1 17 ? 23.541  0.423   -6.712  1.00 0.42 ? 17 ARG A CD   2  
ATOM 2412  N NE   . ARG A 1 17 ? 23.563  -1.020  -7.085  1.00 0.42 ? 17 ARG A NE   2  
ATOM 2413  C CZ   . ARG A 1 17 ? 24.637  -1.731  -6.881  1.00 0.42 ? 17 ARG A CZ   2  
ATOM 2414  N NH1  . ARG A 1 17 ? 25.738  -1.449  -7.523  1.00 0.42 ? 17 ARG A NH1  2  
ATOM 2415  N NH2  . ARG A 1 17 ? 24.611  -2.725  -6.035  1.00 0.42 ? 17 ARG A NH2  2  
ATOM 2416  H H    . ARG A 1 17 ? 19.885  0.960   -3.253  1.00 0.42 ? 17 ARG A H    2  
ATOM 2417  H HA   . ARG A 1 17 ? 22.082  2.664   -4.316  1.00 0.42 ? 17 ARG A HA   2  
ATOM 2418  H HB2  . ARG A 1 17 ? 20.887  0.072   -5.061  1.00 0.42 ? 17 ARG A HB2  2  
ATOM 2419  H HB3  . ARG A 1 17 ? 21.220  1.135   -6.429  1.00 0.42 ? 17 ARG A HB3  2  
ATOM 2420  H HG2  . ARG A 1 17 ? 23.476  1.373   -4.787  1.00 0.42 ? 17 ARG A HG2  2  
ATOM 2421  H HG3  . ARG A 1 17 ? 23.086  -0.347  -4.763  1.00 0.42 ? 17 ARG A HG3  2  
ATOM 2422  H HD2  . ARG A 1 17 ? 22.930  0.967   -7.416  1.00 0.42 ? 17 ARG A HD2  2  
ATOM 2423  H HD3  . ARG A 1 17 ? 24.548  0.814   -6.731  1.00 0.42 ? 17 ARG A HD3  2  
ATOM 2424  H HE   . ARG A 1 17 ? 22.768  -1.434  -7.483  1.00 0.42 ? 17 ARG A HE   2  
ATOM 2425  H HH11 . ARG A 1 17 ? 25.757  -0.688  -8.172  1.00 0.42 ? 17 ARG A HH11 2  
ATOM 2426  H HH12 . ARG A 1 17 ? 26.561  -1.994  -7.367  1.00 0.42 ? 17 ARG A HH12 2  
ATOM 2427  H HH21 . ARG A 1 17 ? 23.768  -2.940  -5.544  1.00 0.42 ? 17 ARG A HH21 2  
ATOM 2428  H HH22 . ARG A 1 17 ? 25.436  -3.269  -5.879  1.00 0.42 ? 17 ARG A HH22 2  
ATOM 2429  N N    . PRO A 1 18 ? 20.756  3.996   -5.996  1.00 0.41 ? 18 PRO A N    2  
ATOM 2430  C CA   . PRO A 1 18 ? 19.973  4.973   -6.772  1.00 0.41 ? 18 PRO A CA   2  
ATOM 2431  C C    . PRO A 1 18 ? 19.448  4.333   -8.061  1.00 0.41 ? 18 PRO A C    2  
ATOM 2432  O O    . PRO A 1 18 ? 19.834  3.240   -8.426  1.00 0.41 ? 18 PRO A O    2  
ATOM 2433  C CB   . PRO A 1 18 ? 20.986  6.078   -7.083  1.00 0.41 ? 18 PRO A CB   2  
ATOM 2434  C CG   . PRO A 1 18 ? 22.387  5.431   -6.971  1.00 0.41 ? 18 PRO A CG   2  
ATOM 2435  C CD   . PRO A 1 18 ? 22.219  4.164   -6.111  1.00 0.41 ? 18 PRO A CD   2  
ATOM 2436  H HA   . PRO A 1 18 ? 19.162  5.369   -6.184  1.00 0.41 ? 18 PRO A HA   2  
ATOM 2437  H HB2  . PRO A 1 18 ? 20.826  6.456   -8.084  1.00 0.41 ? 18 PRO A HB2  2  
ATOM 2438  H HB3  . PRO A 1 18 ? 20.897  6.878   -6.364  1.00 0.41 ? 18 PRO A HB3  2  
ATOM 2439  H HG2  . PRO A 1 18 ? 22.752  5.168   -7.955  1.00 0.41 ? 18 PRO A HG2  2  
ATOM 2440  H HG3  . PRO A 1 18 ? 23.072  6.111   -6.489  1.00 0.41 ? 18 PRO A HG3  2  
ATOM 2441  H HD2  . PRO A 1 18 ? 22.664  3.311   -6.604  1.00 0.41 ? 18 PRO A HD2  2  
ATOM 2442  H HD3  . PRO A 1 18 ? 22.655  4.309   -5.135  1.00 0.41 ? 18 PRO A HD3  2  
ATOM 2443  N N    . LEU A 1 19 ? 18.572  5.008   -8.752  1.00 0.45 ? 19 LEU A N    2  
ATOM 2444  C CA   . LEU A 1 19 ? 18.021  4.442   -10.016 1.00 0.45 ? 19 LEU A CA   2  
ATOM 2445  C C    . LEU A 1 19 ? 18.445  5.329   -11.190 1.00 0.45 ? 19 LEU A C    2  
ATOM 2446  O O    . LEU A 1 19 ? 18.905  6.436   -10.992 1.00 0.45 ? 19 LEU A O    2  
ATOM 2447  C CB   . LEU A 1 19 ? 16.491  4.397   -9.935  1.00 0.45 ? 19 LEU A CB   2  
ATOM 2448  C CG   . LEU A 1 19 ? 16.056  4.201   -8.481  1.00 0.45 ? 19 LEU A CG   2  
ATOM 2449  C CD1  . LEU A 1 19 ? 16.059  5.550   -7.761  1.00 0.45 ? 19 LEU A CD1  2  
ATOM 2450  C CD2  . LEU A 1 19 ? 14.645  3.610   -8.448  1.00 0.45 ? 19 LEU A CD2  2  
ATOM 2451  H H    . LEU A 1 19 ? 18.274  5.887   -8.439  1.00 0.45 ? 19 LEU A H    2  
ATOM 2452  H HA   . LEU A 1 19 ? 18.405  3.443   -10.162 1.00 0.45 ? 19 LEU A HA   2  
ATOM 2453  H HB2  . LEU A 1 19 ? 16.084  5.324   -10.311 1.00 0.45 ? 19 LEU A HB2  2  
ATOM 2454  H HB3  . LEU A 1 19 ? 16.124  3.575   -10.530 1.00 0.45 ? 19 LEU A HB3  2  
ATOM 2455  H HG   . LEU A 1 19 ? 16.743  3.528   -7.987  1.00 0.45 ? 19 LEU A HG   2  
ATOM 2456  H HD11 . LEU A 1 19 ? 16.053  6.348   -8.488  1.00 0.45 ? 19 LEU A HD11 2  
ATOM 2457  H HD12 . LEU A 1 19 ? 15.181  5.627   -7.136  1.00 0.45 ? 19 LEU A HD12 2  
ATOM 2458  H HD13 . LEU A 1 19 ? 16.944  5.628   -7.147  1.00 0.45 ? 19 LEU A HD13 2  
ATOM 2459  H HD21 . LEU A 1 19 ? 14.026  4.114   -9.175  1.00 0.45 ? 19 LEU A HD21 2  
ATOM 2460  H HD22 . LEU A 1 19 ? 14.690  2.556   -8.682  1.00 0.45 ? 19 LEU A HD22 2  
ATOM 2461  H HD23 . LEU A 1 19 ? 14.222  3.742   -7.463  1.00 0.45 ? 19 LEU A HD23 2  
ATOM 2462  N N    . PRO A 1 20 ? 18.276  4.815   -12.382 1.00 0.58 ? 20 PRO A N    2  
ATOM 2463  C CA   . PRO A 1 20 ? 18.632  5.540   -13.613 1.00 0.58 ? 20 PRO A CA   2  
ATOM 2464  C C    . PRO A 1 20 ? 17.568  6.594   -13.936 1.00 0.58 ? 20 PRO A C    2  
ATOM 2465  O O    . PRO A 1 20 ? 16.397  6.292   -14.053 1.00 0.58 ? 20 PRO A O    2  
ATOM 2466  C CB   . PRO A 1 20 ? 18.667  4.443   -14.680 1.00 0.58 ? 20 PRO A CB   2  
ATOM 2467  C CG   . PRO A 1 20 ? 17.799  3.281   -14.140 1.00 0.58 ? 20 PRO A CG   2  
ATOM 2468  C CD   . PRO A 1 20 ? 17.713  3.469   -12.613 1.00 0.58 ? 20 PRO A CD   2  
ATOM 2469  H HA   . PRO A 1 20 ? 19.604  5.996   -13.520 1.00 0.58 ? 20 PRO A HA   2  
ATOM 2470  H HB2  . PRO A 1 20 ? 18.258  4.817   -15.609 1.00 0.58 ? 20 PRO A HB2  2  
ATOM 2471  H HB3  . PRO A 1 20 ? 19.680  4.101   -14.829 1.00 0.58 ? 20 PRO A HB3  2  
ATOM 2472  H HG2  . PRO A 1 20 ? 16.811  3.324   -14.578 1.00 0.58 ? 20 PRO A HG2  2  
ATOM 2473  H HG3  . PRO A 1 20 ? 18.265  2.334   -14.365 1.00 0.58 ? 20 PRO A HG3  2  
ATOM 2474  H HD2  . PRO A 1 20 ? 16.684  3.424   -12.287 1.00 0.58 ? 20 PRO A HD2  2  
ATOM 2475  H HD3  . PRO A 1 20 ? 18.306  2.725   -12.106 1.00 0.58 ? 20 PRO A HD3  2  
ATOM 2476  N N    . ARG A 1 21 ? 17.967  7.827   -14.074 1.00 0.75 ? 21 ARG A N    2  
ATOM 2477  C CA   . ARG A 1 21 ? 16.981  8.902   -14.383 1.00 0.75 ? 21 ARG A CA   2  
ATOM 2478  C C    . ARG A 1 21 ? 16.279  8.594   -15.707 1.00 0.75 ? 21 ARG A C    2  
ATOM 2479  O O    . ARG A 1 21 ? 15.270  9.186   -16.036 1.00 0.75 ? 21 ARG A O    2  
ATOM 2480  C CB   . ARG A 1 21 ? 17.709  10.244  -14.493 1.00 0.75 ? 21 ARG A CB   2  
ATOM 2481  C CG   . ARG A 1 21 ? 17.199  11.194  -13.408 1.00 0.75 ? 21 ARG A CG   2  
ATOM 2482  C CD   . ARG A 1 21 ? 15.669  11.215  -13.425 1.00 0.75 ? 21 ARG A CD   2  
ATOM 2483  N NE   . ARG A 1 21 ? 15.189  12.624  -13.345 1.00 0.75 ? 21 ARG A NE   2  
ATOM 2484  C CZ   . ARG A 1 21 ? 15.809  13.484  -12.585 1.00 0.75 ? 21 ARG A CZ   2  
ATOM 2485  N NH1  . ARG A 1 21 ? 16.298  13.106  -11.436 1.00 0.75 ? 21 ARG A NH1  2  
ATOM 2486  N NH2  . ARG A 1 21 ? 15.942  14.723  -12.974 1.00 0.75 ? 21 ARG A NH2  2  
ATOM 2487  H H    . ARG A 1 21 ? 18.916  8.050   -13.972 1.00 0.75 ? 21 ARG A H    2  
ATOM 2488  H HA   . ARG A 1 21 ? 16.249  8.955   -13.590 1.00 0.75 ? 21 ARG A HA   2  
ATOM 2489  H HB2  . ARG A 1 21 ? 18.771  10.087  -14.366 1.00 0.75 ? 21 ARG A HB2  2  
ATOM 2490  H HB3  . ARG A 1 21 ? 17.522  10.676  -15.464 1.00 0.75 ? 21 ARG A HB3  2  
ATOM 2491  H HG2  . ARG A 1 21 ? 17.543  10.854  -12.442 1.00 0.75 ? 21 ARG A HG2  2  
ATOM 2492  H HG3  . ARG A 1 21 ? 17.574  12.188  -13.595 1.00 0.75 ? 21 ARG A HG3  2  
ATOM 2493  H HD2  . ARG A 1 21 ? 15.314  10.766  -14.342 1.00 0.75 ? 21 ARG A HD2  2  
ATOM 2494  H HD3  . ARG A 1 21 ? 15.291  10.656  -12.582 1.00 0.75 ? 21 ARG A HD3  2  
ATOM 2495  H HE   . ARG A 1 21 ? 14.405  12.904  -13.863 1.00 0.75 ? 21 ARG A HE   2  
ATOM 2496  H HH11 . ARG A 1 21 ? 16.198  12.157  -11.137 1.00 0.75 ? 21 ARG A HH11 2  
ATOM 2497  H HH12 . ARG A 1 21 ? 16.774  13.765  -10.853 1.00 0.75 ? 21 ARG A HH12 2  
ATOM 2498  H HH21 . ARG A 1 21 ? 15.567  15.012  -13.855 1.00 0.75 ? 21 ARG A HH21 2  
ATOM 2499  H HH22 . ARG A 1 21 ? 16.418  15.382  -12.392 1.00 0.75 ? 21 ARG A HH22 2  
ATOM 2500  N N    . ALA A 1 22 ? 16.804  7.676   -16.471 1.00 0.89 ? 22 ALA A N    2  
ATOM 2501  C CA   . ALA A 1 22 ? 16.164  7.336   -17.773 1.00 0.89 ? 22 ALA A CA   2  
ATOM 2502  C C    . ALA A 1 22 ? 15.073  6.284   -17.554 1.00 0.89 ? 22 ALA A C    2  
ATOM 2503  O O    . ALA A 1 22 ? 14.626  5.638   -18.481 1.00 0.89 ? 22 ALA A O    2  
ATOM 2504  C CB   . ALA A 1 22 ? 17.221  6.781   -18.731 1.00 0.89 ? 22 ALA A CB   2  
ATOM 2505  H H    . ALA A 1 22 ? 17.619  7.211   -16.189 1.00 0.89 ? 22 ALA A H    2  
ATOM 2506  H HA   . ALA A 1 22 ? 15.724  8.225   -18.201 1.00 0.89 ? 22 ALA A HA   2  
ATOM 2507  H HB1  . ALA A 1 22 ? 18.110  7.392   -18.679 1.00 0.89 ? 22 ALA A HB1  2  
ATOM 2508  H HB2  . ALA A 1 22 ? 17.464  5.767   -18.449 1.00 0.89 ? 22 ALA A HB2  2  
ATOM 2509  H HB3  . ALA A 1 22 ? 16.835  6.792   -19.739 1.00 0.89 ? 22 ALA A HB3  2  
ATOM 2510  N N    . HIS A 1 23 ? 14.640  6.106   -16.335 1.00 0.71 ? 23 HIS A N    2  
ATOM 2511  C CA   . HIS A 1 23 ? 13.580  5.095   -16.062 1.00 0.71 ? 23 HIS A CA   2  
ATOM 2512  C C    . HIS A 1 23 ? 12.739  5.548   -14.866 1.00 0.71 ? 23 HIS A C    2  
ATOM 2513  O O    . HIS A 1 23 ? 12.186  4.741   -14.145 1.00 0.71 ? 23 HIS A O    2  
ATOM 2514  C CB   . HIS A 1 23 ? 14.230  3.748   -15.747 1.00 0.71 ? 23 HIS A CB   2  
ATOM 2515  C CG   . HIS A 1 23 ? 14.261  2.901   -16.989 1.00 0.71 ? 23 HIS A CG   2  
ATOM 2516  N ND1  . HIS A 1 23 ? 13.492  1.756   -17.122 1.00 0.71 ? 23 HIS A ND1  2  
ATOM 2517  C CD2  . HIS A 1 23 ? 14.964  3.020   -18.161 1.00 0.71 ? 23 HIS A CD2  2  
ATOM 2518  C CE1  . HIS A 1 23 ? 13.748  1.235   -18.335 1.00 0.71 ? 23 HIS A CE1  2  
ATOM 2519  N NE2  . HIS A 1 23 ? 14.638  1.966   -19.011 1.00 0.71 ? 23 HIS A NE2  2  
ATOM 2520  H H    . HIS A 1 23 ? 15.012  6.637   -15.600 1.00 0.71 ? 23 HIS A H    2  
ATOM 2521  H HA   . HIS A 1 23 ? 12.946  4.995   -16.931 1.00 0.71 ? 23 HIS A HA   2  
ATOM 2522  H HB2  . HIS A 1 23 ? 15.239  3.909   -15.395 1.00 0.71 ? 23 HIS A HB2  2  
ATOM 2523  H HB3  . HIS A 1 23 ? 13.659  3.242   -14.981 1.00 0.71 ? 23 HIS A HB3  2  
ATOM 2524  H HD1  . HIS A 1 23 ? 12.874  1.391   -16.454 1.00 0.71 ? 23 HIS A HD1  2  
ATOM 2525  H HD2  . HIS A 1 23 ? 15.664  3.810   -18.391 1.00 0.71 ? 23 HIS A HD2  2  
ATOM 2526  H HE1  . HIS A 1 23 ? 13.290  0.335   -18.717 1.00 0.71 ? 23 HIS A HE1  2  
ATOM 2527  N N    . ILE A 1 24 ? 12.638  6.830   -14.650 1.00 0.56 ? 24 ILE A N    2  
ATOM 2528  C CA   . ILE A 1 24 ? 11.834  7.330   -13.498 1.00 0.56 ? 24 ILE A CA   2  
ATOM 2529  C C    . ILE A 1 24 ? 10.677  8.186   -14.015 1.00 0.56 ? 24 ILE A C    2  
ATOM 2530  O O    . ILE A 1 24 ? 10.692  9.396   -13.911 1.00 0.56 ? 24 ILE A O    2  
ATOM 2531  C CB   . ILE A 1 24 ? 12.722  8.172   -12.582 1.00 0.56 ? 24 ILE A CB   2  
ATOM 2532  C CG1  . ILE A 1 24 ? 13.737  7.263   -11.884 1.00 0.56 ? 24 ILE A CG1  2  
ATOM 2533  C CG2  . ILE A 1 24 ? 11.856  8.871   -11.532 1.00 0.56 ? 24 ILE A CG2  2  
ATOM 2534  C CD1  . ILE A 1 24 ? 14.427  8.038   -10.759 1.00 0.56 ? 24 ILE A CD1  2  
ATOM 2535  H H    . ILE A 1 24 ? 13.092  7.466   -15.242 1.00 0.56 ? 24 ILE A H    2  
ATOM 2536  H HA   . ILE A 1 24 ? 11.440  6.489   -12.945 1.00 0.56 ? 24 ILE A HA   2  
ATOM 2537  H HB   . ILE A 1 24 ? 13.244  8.913   -13.169 1.00 0.56 ? 24 ILE A HB   2  
ATOM 2538  H HG12 . ILE A 1 24 ? 13.227  6.405   -11.470 1.00 0.56 ? 24 ILE A HG12 2  
ATOM 2539  H HG13 . ILE A 1 24 ? 14.476  6.934   -12.597 1.00 0.56 ? 24 ILE A HG13 2  
ATOM 2540  H HG21 . ILE A 1 24 ? 10.817  8.646   -11.716 1.00 0.56 ? 24 ILE A HG21 2  
ATOM 2541  H HG22 . ILE A 1 24 ? 12.131  8.520   -10.548 1.00 0.56 ? 24 ILE A HG22 2  
ATOM 2542  H HG23 . ILE A 1 24 ? 12.011  9.938   -11.591 1.00 0.56 ? 24 ILE A HG23 2  
ATOM 2543  H HD11 . ILE A 1 24 ? 13.682  8.464   -10.106 1.00 0.56 ? 24 ILE A HD11 2  
ATOM 2544  H HD12 . ILE A 1 24 ? 15.058  7.366   -10.195 1.00 0.56 ? 24 ILE A HD12 2  
ATOM 2545  H HD13 . ILE A 1 24 ? 15.030  8.827   -11.183 1.00 0.56 ? 24 ILE A HD13 2  
ATOM 2546  N N    . LYS A 1 25 ? 9.671   7.567   -14.573 1.00 0.59 ? 25 LYS A N    2  
ATOM 2547  C CA   . LYS A 1 25 ? 8.514   8.345   -15.095 1.00 0.59 ? 25 LYS A CA   2  
ATOM 2548  C C    . LYS A 1 25 ? 8.113   9.412   -14.076 1.00 0.59 ? 25 LYS A C    2  
ATOM 2549  O O    . LYS A 1 25 ? 8.203   10.596  -14.335 1.00 0.59 ? 25 LYS A O    2  
ATOM 2550  C CB   . LYS A 1 25 ? 7.334   7.400   -15.334 1.00 0.59 ? 25 LYS A CB   2  
ATOM 2551  C CG   . LYS A 1 25 ? 6.495   7.919   -16.502 1.00 0.59 ? 25 LYS A CG   2  
ATOM 2552  C CD   . LYS A 1 25 ? 5.299   6.992   -16.724 1.00 0.59 ? 25 LYS A CD   2  
ATOM 2553  C CE   . LYS A 1 25 ? 4.498   6.871   -15.426 1.00 0.59 ? 25 LYS A CE   2  
ATOM 2554  N NZ   . LYS A 1 25 ? 3.060   6.655   -15.747 1.00 0.59 ? 25 LYS A NZ   2  
ATOM 2555  H H    . LYS A 1 25 ? 9.679   6.590   -14.647 1.00 0.59 ? 25 LYS A H    2  
ATOM 2556  H HA   . LYS A 1 25 ? 8.790   8.819   -16.025 1.00 0.59 ? 25 LYS A HA   2  
ATOM 2557  H HB2  . LYS A 1 25 ? 7.706   6.412   -15.567 1.00 0.59 ? 25 LYS A HB2  2  
ATOM 2558  H HB3  . LYS A 1 25 ? 6.723   7.356   -14.446 1.00 0.59 ? 25 LYS A HB3  2  
ATOM 2559  H HG2  . LYS A 1 25 ? 6.144   8.915   -16.276 1.00 0.59 ? 25 LYS A HG2  2  
ATOM 2560  H HG3  . LYS A 1 25 ? 7.100   7.944   -17.396 1.00 0.59 ? 25 LYS A HG3  2  
ATOM 2561  H HD2  . LYS A 1 25 ? 4.667   7.400   -17.500 1.00 0.59 ? 25 LYS A HD2  2  
ATOM 2562  H HD3  . LYS A 1 25 ? 5.650   6.015   -17.020 1.00 0.59 ? 25 LYS A HD3  2  
ATOM 2563  H HE2  . LYS A 1 25 ? 4.868   6.035   -14.851 1.00 0.59 ? 25 LYS A HE2  2  
ATOM 2564  H HE3  . LYS A 1 25 ? 4.607   7.779   -14.850 1.00 0.59 ? 25 LYS A HE3  2  
ATOM 2565  H HZ1  . LYS A 1 25 ? 2.977   5.982   -16.534 1.00 0.59 ? 25 LYS A HZ1  2  
ATOM 2566  H HZ2  . LYS A 1 25 ? 2.572   6.271   -14.913 1.00 0.59 ? 25 LYS A HZ2  2  
ATOM 2567  H HZ3  . LYS A 1 25 ? 2.626   7.562   -16.018 1.00 0.59 ? 25 LYS A HZ3  2  
ATOM 2568  N N    . GLU A 1 26 ? 7.670   9.005   -12.919 1.00 0.53 ? 26 GLU A N    2  
ATOM 2569  C CA   . GLU A 1 26 ? 7.262   9.998   -11.885 1.00 0.53 ? 26 GLU A CA   2  
ATOM 2570  C C    . GLU A 1 26 ? 7.260   9.331   -10.508 1.00 0.53 ? 26 GLU A C    2  
ATOM 2571  O O    . GLU A 1 26 ? 7.138   8.129   -10.391 1.00 0.53 ? 26 GLU A O    2  
ATOM 2572  C CB   . GLU A 1 26 ? 5.858   10.518  -12.203 1.00 0.53 ? 26 GLU A CB   2  
ATOM 2573  C CG   . GLU A 1 26 ? 4.891   9.337   -12.313 1.00 0.53 ? 26 GLU A CG   2  
ATOM 2574  C CD   . GLU A 1 26 ? 3.572   9.813   -12.927 1.00 0.53 ? 26 GLU A CD   2  
ATOM 2575  O OE1  . GLU A 1 26 ? 3.582   10.178  -14.091 1.00 0.53 ? 26 GLU A OE1  2  
ATOM 2576  O OE2  . GLU A 1 26 ? 2.576   9.804   -12.222 1.00 0.53 ? 26 GLU A OE2  2  
ATOM 2577  H H    . GLU A 1 26 ? 7.604   8.045   -12.728 1.00 0.53 ? 26 GLU A H    2  
ATOM 2578  H HA   . GLU A 1 26 ? 7.960   10.823  -11.885 1.00 0.53 ? 26 GLU A HA   2  
ATOM 2579  H HB2  . GLU A 1 26 ? 5.532   11.179  -11.414 1.00 0.53 ? 26 GLU A HB2  2  
ATOM 2580  H HB3  . GLU A 1 26 ? 5.876   11.054  -13.140 1.00 0.53 ? 26 GLU A HB3  2  
ATOM 2581  H HG2  . GLU A 1 26 ? 5.325   8.572   -12.940 1.00 0.53 ? 26 GLU A HG2  2  
ATOM 2582  H HG3  . GLU A 1 26 ? 4.702   8.933   -11.329 1.00 0.53 ? 26 GLU A HG3  2  
ATOM 2583  N N    . TYR A 1 27 ? 7.393   10.102  -9.464  1.00 0.39 ? 27 TYR A N    2  
ATOM 2584  C CA   . TYR A 1 27 ? 7.398   9.509   -8.096  1.00 0.39 ? 27 TYR A CA   2  
ATOM 2585  C C    . TYR A 1 27 ? 6.306   10.169  -7.249  1.00 0.39 ? 27 TYR A C    2  
ATOM 2586  O O    . TYR A 1 27 ? 5.514   10.949  -7.737  1.00 0.39 ? 27 TYR A O    2  
ATOM 2587  C CB   . TYR A 1 27 ? 8.764   9.742   -7.444  1.00 0.39 ? 27 TYR A CB   2  
ATOM 2588  C CG   . TYR A 1 27 ? 8.901   11.194  -7.051  1.00 0.39 ? 27 TYR A CG   2  
ATOM 2589  C CD1  . TYR A 1 27 ? 9.335   12.137  -7.989  1.00 0.39 ? 27 TYR A CD1  2  
ATOM 2590  C CD2  . TYR A 1 27 ? 8.590   11.597  -5.746  1.00 0.39 ? 27 TYR A CD2  2  
ATOM 2591  C CE1  . TYR A 1 27 ? 9.460   13.483  -7.623  1.00 0.39 ? 27 TYR A CE1  2  
ATOM 2592  C CE2  . TYR A 1 27 ? 8.714   12.943  -5.379  1.00 0.39 ? 27 TYR A CE2  2  
ATOM 2593  C CZ   . TYR A 1 27 ? 9.149   13.886  -6.319  1.00 0.39 ? 27 TYR A CZ   2  
ATOM 2594  O OH   . TYR A 1 27 ? 9.272   15.212  -5.959  1.00 0.39 ? 27 TYR A OH   2  
ATOM 2595  H H    . TYR A 1 27 ? 7.490   11.071  -9.578  1.00 0.39 ? 27 TYR A H    2  
ATOM 2596  H HA   . TYR A 1 27 ? 7.209   8.448   -8.165  1.00 0.39 ? 27 TYR A HA   2  
ATOM 2597  H HB2  . TYR A 1 27 ? 8.853   9.121   -6.565  1.00 0.39 ? 27 TYR A HB2  2  
ATOM 2598  H HB3  . TYR A 1 27 ? 9.546   9.486   -8.144  1.00 0.39 ? 27 TYR A HB3  2  
ATOM 2599  H HD1  . TYR A 1 27 ? 9.575   11.827  -8.996  1.00 0.39 ? 27 TYR A HD1  2  
ATOM 2600  H HD2  . TYR A 1 27 ? 8.254   10.870  -5.021  1.00 0.39 ? 27 TYR A HD2  2  
ATOM 2601  H HE1  . TYR A 1 27 ? 9.795   14.210  -8.348  1.00 0.39 ? 27 TYR A HE1  2  
ATOM 2602  H HE2  . TYR A 1 27 ? 8.474   13.254  -4.373  1.00 0.39 ? 27 TYR A HE2  2  
ATOM 2603  H HH   . TYR A 1 27 ? 8.508   15.447  -5.425  1.00 0.39 ? 27 TYR A HH   2  
ATOM 2604  N N    . PHE A 1 28 ? 6.262   9.860   -5.982  1.00 0.35 ? 28 PHE A N    2  
ATOM 2605  C CA   . PHE A 1 28 ? 5.225   10.469  -5.101  1.00 0.35 ? 28 PHE A CA   2  
ATOM 2606  C C    . PHE A 1 28 ? 5.414   9.964   -3.671  1.00 0.35 ? 28 PHE A C    2  
ATOM 2607  O O    . PHE A 1 28 ? 5.945   8.895   -3.444  1.00 0.35 ? 28 PHE A O    2  
ATOM 2608  C CB   . PHE A 1 28 ? 3.832   10.080  -5.602  1.00 0.35 ? 28 PHE A CB   2  
ATOM 2609  C CG   . PHE A 1 28 ? 3.793   8.599   -5.892  1.00 0.35 ? 28 PHE A CG   2  
ATOM 2610  C CD1  . PHE A 1 28 ? 3.665   7.683   -4.842  1.00 0.35 ? 28 PHE A CD1  2  
ATOM 2611  C CD2  . PHE A 1 28 ? 3.883   8.142   -7.212  1.00 0.35 ? 28 PHE A CD2  2  
ATOM 2612  C CE1  . PHE A 1 28 ? 3.626   6.310   -5.111  1.00 0.35 ? 28 PHE A CE1  2  
ATOM 2613  C CE2  . PHE A 1 28 ? 3.845   6.769   -7.482  1.00 0.35 ? 28 PHE A CE2  2  
ATOM 2614  C CZ   . PHE A 1 28 ? 3.716   5.852   -6.431  1.00 0.35 ? 28 PHE A CZ   2  
ATOM 2615  H H    . PHE A 1 28 ? 6.911   9.230   -5.608  1.00 0.35 ? 28 PHE A H    2  
ATOM 2616  H HA   . PHE A 1 28 ? 5.325   11.544  -5.120  1.00 0.35 ? 28 PHE A HA   2  
ATOM 2617  H HB2  . PHE A 1 28 ? 3.099   10.318  -4.846  1.00 0.35 ? 28 PHE A HB2  2  
ATOM 2618  H HB3  . PHE A 1 28 ? 3.608   10.628  -6.506  1.00 0.35 ? 28 PHE A HB3  2  
ATOM 2619  H HD1  . PHE A 1 28 ? 3.595   8.036   -3.823  1.00 0.35 ? 28 PHE A HD1  2  
ATOM 2620  H HD2  . PHE A 1 28 ? 3.982   8.848   -8.023  1.00 0.35 ? 28 PHE A HD2  2  
ATOM 2621  H HE1  . PHE A 1 28 ? 3.527   5.602   -4.300  1.00 0.35 ? 28 PHE A HE1  2  
ATOM 2622  H HE2  . PHE A 1 28 ? 3.915   6.416   -8.500  1.00 0.35 ? 28 PHE A HE2  2  
ATOM 2623  H HZ   . PHE A 1 28 ? 3.686   4.793   -6.639  1.00 0.35 ? 28 PHE A HZ   2  
ATOM 2624  N N    . TYR A 1 29 ? 4.986   10.724  -2.700  1.00 0.32 ? 29 TYR A N    2  
ATOM 2625  C CA   . TYR A 1 29 ? 5.145   10.285  -1.285  1.00 0.32 ? 29 TYR A CA   2  
ATOM 2626  C C    . TYR A 1 29 ? 3.916   9.479   -0.859  1.00 0.32 ? 29 TYR A C    2  
ATOM 2627  O O    . TYR A 1 29 ? 2.895   9.490   -1.518  1.00 0.32 ? 29 TYR A O    2  
ATOM 2628  C CB   . TYR A 1 29 ? 5.285   11.513  -0.383  1.00 0.32 ? 29 TYR A CB   2  
ATOM 2629  C CG   . TYR A 1 29 ? 6.547   12.263  -0.740  1.00 0.32 ? 29 TYR A CG   2  
ATOM 2630  C CD1  . TYR A 1 29 ? 6.572   13.097  -1.865  1.00 0.32 ? 29 TYR A CD1  2  
ATOM 2631  C CD2  . TYR A 1 29 ? 7.692   12.127  0.055   1.00 0.32 ? 29 TYR A CD2  2  
ATOM 2632  C CE1  . TYR A 1 29 ? 7.740   13.794  -2.194  1.00 0.32 ? 29 TYR A CE1  2  
ATOM 2633  C CE2  . TYR A 1 29 ? 8.859   12.825  -0.274  1.00 0.32 ? 29 TYR A CE2  2  
ATOM 2634  C CZ   . TYR A 1 29 ? 8.884   13.658  -1.399  1.00 0.32 ? 29 TYR A CZ   2  
ATOM 2635  O OH   . TYR A 1 29 ? 10.036  14.345  -1.723  1.00 0.32 ? 29 TYR A OH   2  
ATOM 2636  H H    . TYR A 1 29 ? 4.561   11.584  -2.903  1.00 0.32 ? 29 TYR A H    2  
ATOM 2637  H HA   . TYR A 1 29 ? 6.027   9.669   -1.197  1.00 0.32 ? 29 TYR A HA   2  
ATOM 2638  H HB2  . TYR A 1 29 ? 4.431   12.159  -0.520  1.00 0.32 ? 29 TYR A HB2  2  
ATOM 2639  H HB3  . TYR A 1 29 ? 5.336   11.198  0.648   1.00 0.32 ? 29 TYR A HB3  2  
ATOM 2640  H HD1  . TYR A 1 29 ? 5.689   13.202  -2.479  1.00 0.32 ? 29 TYR A HD1  2  
ATOM 2641  H HD2  . TYR A 1 29 ? 7.673   11.483  0.922   1.00 0.32 ? 29 TYR A HD2  2  
ATOM 2642  H HE1  . TYR A 1 29 ? 7.760   14.438  -3.062  1.00 0.32 ? 29 TYR A HE1  2  
ATOM 2643  H HE2  . TYR A 1 29 ? 9.742   12.719  0.339   1.00 0.32 ? 29 TYR A HE2  2  
ATOM 2644  H HH   . TYR A 1 29 ? 10.761  13.716  -1.746  1.00 0.32 ? 29 TYR A HH   2  
ATOM 2645  N N    . THR A 1 30 ? 4.006   8.780   0.239   1.00 0.37 ? 30 THR A N    2  
ATOM 2646  C CA   . THR A 1 30 ? 2.845   7.975   0.709   1.00 0.37 ? 30 THR A CA   2  
ATOM 2647  C C    . THR A 1 30 ? 2.859   7.904   2.236   1.00 0.37 ? 30 THR A C    2  
ATOM 2648  O O    . THR A 1 30 ? 3.903   7.819   2.854   1.00 0.37 ? 30 THR A O    2  
ATOM 2649  C CB   . THR A 1 30 ? 2.938   6.559   0.131   1.00 0.37 ? 30 THR A CB   2  
ATOM 2650  O OG1  . THR A 1 30 ? 3.739   5.754   0.985   1.00 0.37 ? 30 THR A OG1  2  
ATOM 2651  C CG2  . THR A 1 30 ? 3.568   6.614   -1.261  1.00 0.37 ? 30 THR A CG2  2  
ATOM 2652  H H    . THR A 1 30 ? 4.839   8.786   0.756   1.00 0.37 ? 30 THR A H    2  
ATOM 2653  H HA   . THR A 1 30 ? 1.927   8.438   0.378   1.00 0.37 ? 30 THR A HA   2  
ATOM 2654  H HB   . THR A 1 30 ? 1.949   6.134   0.059   1.00 0.37 ? 30 THR A HB   2  
ATOM 2655  H HG1  . THR A 1 30 ? 4.610   6.155   1.041   1.00 0.37 ? 30 THR A HG1  2  
ATOM 2656  H HG21 . THR A 1 30 ? 4.493   7.169   -1.216  1.00 0.37 ? 30 THR A HG21 2  
ATOM 2657  H HG22 . THR A 1 30 ? 3.768   5.609   -1.604  1.00 0.37 ? 30 THR A HG22 2  
ATOM 2658  H HG23 . THR A 1 30 ? 2.889   7.101   -1.945  1.00 0.37 ? 30 THR A HG23 2  
ATOM 2659  N N    . SER A 1 31 ? 1.708   7.937   2.852   1.00 0.47 ? 31 SER A N    2  
ATOM 2660  C CA   . SER A 1 31 ? 1.657   7.872   4.339   1.00 0.47 ? 31 SER A CA   2  
ATOM 2661  C C    . SER A 1 31 ? 0.199   7.903   4.801   1.00 0.47 ? 31 SER A C    2  
ATOM 2662  O O    . SER A 1 31 ? -0.715  7.758   4.014   1.00 0.47 ? 31 SER A O    2  
ATOM 2663  C CB   . SER A 1 31 ? 2.405   9.069   4.927   1.00 0.47 ? 31 SER A CB   2  
ATOM 2664  O OG   . SER A 1 31 ? 2.755   8.787   6.277   1.00 0.47 ? 31 SER A OG   2  
ATOM 2665  H H    . SER A 1 31 ? 0.878   8.004   2.335   1.00 0.47 ? 31 SER A H    2  
ATOM 2666  H HA   . SER A 1 31 ? 2.121   6.956   4.675   1.00 0.47 ? 31 SER A HA   2  
ATOM 2667  H HB2  . SER A 1 31 ? 3.302   9.251   4.359   1.00 0.47 ? 31 SER A HB2  2  
ATOM 2668  H HB3  . SER A 1 31 ? 1.770   9.944   4.885   1.00 0.47 ? 31 SER A HB3  2  
ATOM 2669  H HG   . SER A 1 31 ? 2.827   7.834   6.371   1.00 0.47 ? 31 SER A HG   2  
ATOM 2670  N N    . GLY A 1 32 ? -0.027  8.092   6.072   1.00 0.60 ? 32 GLY A N    2  
ATOM 2671  C CA   . GLY A 1 32 ? -1.426  8.132   6.584   1.00 0.60 ? 32 GLY A CA   2  
ATOM 2672  C C    . GLY A 1 32 ? -1.948  6.705   6.754   1.00 0.60 ? 32 GLY A C    2  
ATOM 2673  O O    . GLY A 1 32 ? -2.049  6.197   7.853   1.00 0.60 ? 32 GLY A O    2  
ATOM 2674  H H    . GLY A 1 32 ? 0.725   8.207   6.692   1.00 0.60 ? 32 GLY A H    2  
ATOM 2675  H HA2  . GLY A 1 32 ? -1.446  8.641   7.537   1.00 0.60 ? 32 GLY A HA2  2  
ATOM 2676  H HA3  . GLY A 1 32 ? -2.051  8.659   5.880   1.00 0.60 ? 32 GLY A HA3  2  
ATOM 2677  N N    . LYS A 1 33 ? -2.280  6.053   5.674   1.00 0.55 ? 33 LYS A N    2  
ATOM 2678  C CA   . LYS A 1 33 ? -2.795  4.657   5.774   1.00 0.55 ? 33 LYS A CA   2  
ATOM 2679  C C    . LYS A 1 33 ? -1.620  3.679   5.738   1.00 0.55 ? 33 LYS A C    2  
ATOM 2680  O O    . LYS A 1 33 ? -1.782  2.509   5.448   1.00 0.55 ? 33 LYS A O    2  
ATOM 2681  C CB   . LYS A 1 33 ? -3.731  4.375   4.597   1.00 0.55 ? 33 LYS A CB   2  
ATOM 2682  C CG   . LYS A 1 33 ? -4.998  5.220   4.736   1.00 0.55 ? 33 LYS A CG   2  
ATOM 2683  C CD   . LYS A 1 33 ? -6.147  4.546   3.983   1.00 0.55 ? 33 LYS A CD   2  
ATOM 2684  C CE   . LYS A 1 33 ? -6.870  5.582   3.121   1.00 0.55 ? 33 LYS A CE   2  
ATOM 2685  N NZ   . LYS A 1 33 ? -7.619  4.889   2.034   1.00 0.55 ? 33 LYS A NZ   2  
ATOM 2686  H H    . LYS A 1 33 ? -2.191  6.480   4.796   1.00 0.55 ? 33 LYS A H    2  
ATOM 2687  H HA   . LYS A 1 33 ? -3.336  4.538   6.701   1.00 0.55 ? 33 LYS A HA   2  
ATOM 2688  H HB2  . LYS A 1 33 ? -3.231  4.622   3.672   1.00 0.55 ? 33 LYS A HB2  2  
ATOM 2689  H HB3  . LYS A 1 33 ? -3.998  3.328   4.593   1.00 0.55 ? 33 LYS A HB3  2  
ATOM 2690  H HG2  . LYS A 1 33 ? -5.256  5.312   5.782   1.00 0.55 ? 33 LYS A HG2  2  
ATOM 2691  H HG3  . LYS A 1 33 ? -4.824  6.201   4.320   1.00 0.55 ? 33 LYS A HG3  2  
ATOM 2692  H HD2  . LYS A 1 33 ? -5.752  3.763   3.353   1.00 0.55 ? 33 LYS A HD2  2  
ATOM 2693  H HD3  . LYS A 1 33 ? -6.842  4.122   4.692   1.00 0.55 ? 33 LYS A HD3  2  
ATOM 2694  H HE2  . LYS A 1 33 ? -7.561  6.142   3.735   1.00 0.55 ? 33 LYS A HE2  2  
ATOM 2695  H HE3  . LYS A 1 33 ? -6.147  6.257   2.687   1.00 0.55 ? 33 LYS A HE3  2  
ATOM 2696  H HZ1  . LYS A 1 33 ? -7.606  3.864   2.204   1.00 0.55 ? 33 LYS A HZ1  2  
ATOM 2697  H HZ2  . LYS A 1 33 ? -8.603  5.224   2.023   1.00 0.55 ? 33 LYS A HZ2  2  
ATOM 2698  H HZ3  . LYS A 1 33 ? -7.170  5.096   1.119   1.00 0.55 ? 33 LYS A HZ3  2  
ATOM 2699  N N    . CYS A 1 34 ? -0.437  4.147   6.027   1.00 0.46 ? 34 CYS A N    2  
ATOM 2700  C CA   . CYS A 1 34 ? 0.747   3.242   6.008   1.00 0.46 ? 34 CYS A CA   2  
ATOM 2701  C C    . CYS A 1 34 ? 1.435   3.272   7.374   1.00 0.46 ? 34 CYS A C    2  
ATOM 2702  O O    . CYS A 1 34 ? 1.043   4.005   8.261   1.00 0.46 ? 34 CYS A O    2  
ATOM 2703  C CB   . CYS A 1 34 ? 1.728   3.714   4.933   1.00 0.46 ? 34 CYS A CB   2  
ATOM 2704  S SG   . CYS A 1 34 ? 0.815   4.140   3.431   1.00 0.46 ? 34 CYS A SG   2  
ATOM 2705  H H    . CYS A 1 34 ? -0.327  5.093   6.257   1.00 0.46 ? 34 CYS A H    2  
ATOM 2706  H HA   . CYS A 1 34 ? 0.428   2.235   5.788   1.00 0.46 ? 34 CYS A HA   2  
ATOM 2707  H HB2  . CYS A 1 34 ? 2.262   4.582   5.289   1.00 0.46 ? 34 CYS A HB2  2  
ATOM 2708  H HB3  . CYS A 1 34 ? 2.431   2.923   4.715   1.00 0.46 ? 34 CYS A HB3  2  
ATOM 2709  N N    . SER A 1 35 ? 2.458   2.483   7.551   1.00 0.42 ? 35 SER A N    2  
ATOM 2710  C CA   . SER A 1 35 ? 3.169   2.467   8.860   1.00 0.42 ? 35 SER A CA   2  
ATOM 2711  C C    . SER A 1 35 ? 4.112   3.669   8.942   1.00 0.42 ? 35 SER A C    2  
ATOM 2712  O O    . SER A 1 35 ? 4.325   4.233   9.996   1.00 0.42 ? 35 SER A O    2  
ATOM 2713  C CB   . SER A 1 35 ? 3.979   1.176   8.984   1.00 0.42 ? 35 SER A CB   2  
ATOM 2714  O OG   . SER A 1 35 ? 3.301   0.280   9.857   1.00 0.42 ? 35 SER A OG   2  
ATOM 2715  H H    . SER A 1 35 ? 2.759   1.900   6.823   1.00 0.42 ? 35 SER A H    2  
ATOM 2716  H HA   . SER A 1 35 ? 2.449   2.519   9.662   1.00 0.42 ? 35 SER A HA   2  
ATOM 2717  H HB2  . SER A 1 35 ? 4.080   0.716   8.015   1.00 0.42 ? 35 SER A HB2  2  
ATOM 2718  H HB3  . SER A 1 35 ? 4.961   1.404   9.376   1.00 0.42 ? 35 SER A HB3  2  
ATOM 2719  H HG   . SER A 1 35 ? 3.595   -0.611  9.654   1.00 0.42 ? 35 SER A HG   2  
ATOM 2720  N N    . ASN A 1 36 ? 4.680   4.066   7.835   1.00 0.38 ? 36 ASN A N    2  
ATOM 2721  C CA   . ASN A 1 36 ? 5.608   5.233   7.852   1.00 0.38 ? 36 ASN A CA   2  
ATOM 2722  C C    . ASN A 1 36 ? 5.549   5.950   6.499   1.00 0.38 ? 36 ASN A C    2  
ATOM 2723  O O    . ASN A 1 36 ? 5.308   5.331   5.481   1.00 0.38 ? 36 ASN A O    2  
ATOM 2724  C CB   . ASN A 1 36 ? 7.040   4.751   8.107   1.00 0.38 ? 36 ASN A CB   2  
ATOM 2725  C CG   . ASN A 1 36 ? 7.014   3.463   8.934   1.00 0.38 ? 36 ASN A CG   2  
ATOM 2726  O OD1  . ASN A 1 36 ? 6.729   3.489   10.114  1.00 0.38 ? 36 ASN A OD1  2  
ATOM 2727  N ND2  . ASN A 1 36 ? 7.303   2.328   8.357   1.00 0.38 ? 36 ASN A ND2  2  
ATOM 2728  H H    . ASN A 1 36 ? 4.495   3.598   6.994   1.00 0.38 ? 36 ASN A H    2  
ATOM 2729  H HA   . ASN A 1 36 ? 5.312   5.917   8.635   1.00 0.38 ? 36 ASN A HA   2  
ATOM 2730  H HB2  . ASN A 1 36 ? 7.528   4.563   7.162   1.00 0.38 ? 36 ASN A HB2  2  
ATOM 2731  H HB3  . ASN A 1 36 ? 7.583   5.511   8.648   1.00 0.38 ? 36 ASN A HB3  2  
ATOM 2732  H HD21 . ASN A 1 36 ? 7.534   2.307   7.404   1.00 0.38 ? 36 ASN A HD21 2  
ATOM 2733  H HD22 . ASN A 1 36 ? 7.290   1.497   8.877   1.00 0.38 ? 36 ASN A HD22 2  
ATOM 2734  N N    . PRO A 1 37 ? 5.774   7.239   6.532   1.00 0.37 ? 37 PRO A N    2  
ATOM 2735  C CA   . PRO A 1 37 ? 5.760   8.079   5.322   1.00 0.37 ? 37 PRO A CA   2  
ATOM 2736  C C    . PRO A 1 37 ? 7.066   7.905   4.542   1.00 0.37 ? 37 PRO A C    2  
ATOM 2737  O O    . PRO A 1 37 ? 8.145   8.013   5.089   1.00 0.37 ? 37 PRO A O    2  
ATOM 2738  C CB   . PRO A 1 37 ? 5.637   9.502   5.875   1.00 0.37 ? 37 PRO A CB   2  
ATOM 2739  C CG   . PRO A 1 37 ? 6.154   9.449   7.332   1.00 0.37 ? 37 PRO A CG   2  
ATOM 2740  C CD   . PRO A 1 37 ? 6.066   7.978   7.779   1.00 0.37 ? 37 PRO A CD   2  
ATOM 2741  H HA   . PRO A 1 37 ? 4.908   7.845   4.703   1.00 0.37 ? 37 PRO A HA   2  
ATOM 2742  H HB2  . PRO A 1 37 ? 6.241   10.179  5.286   1.00 0.37 ? 37 PRO A HB2  2  
ATOM 2743  H HB3  . PRO A 1 37 ? 4.605   9.817   5.864   1.00 0.37 ? 37 PRO A HB3  2  
ATOM 2744  H HG2  . PRO A 1 37 ? 7.179   9.791   7.373   1.00 0.37 ? 37 PRO A HG2  2  
ATOM 2745  H HG3  . PRO A 1 37 ? 5.532   10.061  7.967   1.00 0.37 ? 37 PRO A HG3  2  
ATOM 2746  H HD2  . PRO A 1 37 ? 7.008   7.655   8.202   1.00 0.37 ? 37 PRO A HD2  2  
ATOM 2747  H HD3  . PRO A 1 37 ? 5.264   7.843   8.487   1.00 0.37 ? 37 PRO A HD3  2  
ATOM 2748  N N    . ALA A 1 38 ? 6.979   7.633   3.268   1.00 0.33 ? 38 ALA A N    2  
ATOM 2749  C CA   . ALA A 1 38 ? 8.219   7.450   2.463   1.00 0.33 ? 38 ALA A CA   2  
ATOM 2750  C C    . ALA A 1 38 ? 7.966   7.891   1.020   1.00 0.33 ? 38 ALA A C    2  
ATOM 2751  O O    . ALA A 1 38 ? 6.856   8.202   0.639   1.00 0.33 ? 38 ALA A O    2  
ATOM 2752  C CB   . ALA A 1 38 ? 8.623   5.976   2.479   1.00 0.33 ? 38 ALA A CB   2  
ATOM 2753  H H    . ALA A 1 38 ? 6.099   7.547   2.843   1.00 0.33 ? 38 ALA A H    2  
ATOM 2754  H HA   . ALA A 1 38 ? 9.015   8.045   2.887   1.00 0.33 ? 38 ALA A HA   2  
ATOM 2755  H HB1  . ALA A 1 38 ? 7.759   5.363   2.269   1.00 0.33 ? 38 ALA A HB1  2  
ATOM 2756  H HB2  . ALA A 1 38 ? 9.379   5.801   1.728   1.00 0.33 ? 38 ALA A HB2  2  
ATOM 2757  H HB3  . ALA A 1 38 ? 9.016   5.721   3.453   1.00 0.33 ? 38 ALA A HB3  2  
ATOM 2758  N N    . VAL A 1 39 ? 8.993   7.920   0.214   1.00 0.30 ? 39 VAL A N    2  
ATOM 2759  C CA   . VAL A 1 39 ? 8.814   8.338   -1.205  1.00 0.30 ? 39 VAL A CA   2  
ATOM 2760  C C    . VAL A 1 39 ? 8.577   7.101   -2.073  1.00 0.30 ? 39 VAL A C    2  
ATOM 2761  O O    . VAL A 1 39 ? 8.816   5.984   -1.659  1.00 0.30 ? 39 VAL A O    2  
ATOM 2762  C CB   . VAL A 1 39 ? 10.074  9.064   -1.684  1.00 0.30 ? 39 VAL A CB   2  
ATOM 2763  C CG1  . VAL A 1 39 ? 10.031  9.218   -3.206  1.00 0.30 ? 39 VAL A CG1  2  
ATOM 2764  C CG2  . VAL A 1 39 ? 10.142  10.448  -1.035  1.00 0.30 ? 39 VAL A CG2  2  
ATOM 2765  H H    . VAL A 1 39 ? 9.880   7.665   0.541   1.00 0.30 ? 39 VAL A H    2  
ATOM 2766  H HA   . VAL A 1 39 ? 7.966   9.001   -1.282  1.00 0.30 ? 39 VAL A HA   2  
ATOM 2767  H HB   . VAL A 1 39 ? 10.946  8.492   -1.404  1.00 0.30 ? 39 VAL A HB   2  
ATOM 2768  H HG11 . VAL A 1 39 ? 9.107   9.696   -3.493  1.00 0.30 ? 39 VAL A HG11 2  
ATOM 2769  H HG12 . VAL A 1 39 ? 10.865  9.822   -3.530  1.00 0.30 ? 39 VAL A HG12 2  
ATOM 2770  H HG13 . VAL A 1 39 ? 10.091  8.244   -3.667  1.00 0.30 ? 39 VAL A HG13 2  
ATOM 2771  H HG21 . VAL A 1 39 ? 9.526   10.460  -0.148  1.00 0.30 ? 39 VAL A HG21 2  
ATOM 2772  H HG22 . VAL A 1 39 ? 11.164  10.670  -0.768  1.00 0.30 ? 39 VAL A HG22 2  
ATOM 2773  H HG23 . VAL A 1 39 ? 9.782   11.190  -1.732  1.00 0.30 ? 39 VAL A HG23 2  
ATOM 2774  N N    . VAL A 1 40 ? 8.109   7.291   -3.276  1.00 0.33 ? 40 VAL A N    2  
ATOM 2775  C CA   . VAL A 1 40 ? 7.856   6.126   -4.170  1.00 0.33 ? 40 VAL A CA   2  
ATOM 2776  C C    . VAL A 1 40 ? 8.295   6.472   -5.594  1.00 0.33 ? 40 VAL A C    2  
ATOM 2777  O O    . VAL A 1 40 ? 7.753   7.361   -6.221  1.00 0.33 ? 40 VAL A O    2  
ATOM 2778  C CB   . VAL A 1 40 ? 6.364   5.793   -4.162  1.00 0.33 ? 40 VAL A CB   2  
ATOM 2779  C CG1  . VAL A 1 40 ? 6.056   4.800   -5.284  1.00 0.33 ? 40 VAL A CG1  2  
ATOM 2780  C CG2  . VAL A 1 40 ? 5.989   5.170   -2.815  1.00 0.33 ? 40 VAL A CG2  2  
ATOM 2781  H H    . VAL A 1 40 ? 7.923   8.199   -3.592  1.00 0.33 ? 40 VAL A H    2  
ATOM 2782  H HA   . VAL A 1 40 ? 8.418   5.274   -3.817  1.00 0.33 ? 40 VAL A HA   2  
ATOM 2783  H HB   . VAL A 1 40 ? 5.793   6.697   -4.314  1.00 0.33 ? 40 VAL A HB   2  
ATOM 2784  H HG11 . VAL A 1 40 ? 6.833   4.051   -5.325  1.00 0.33 ? 40 VAL A HG11 2  
ATOM 2785  H HG12 . VAL A 1 40 ? 5.106   4.323   -5.092  1.00 0.33 ? 40 VAL A HG12 2  
ATOM 2786  H HG13 . VAL A 1 40 ? 6.011   5.325   -6.226  1.00 0.33 ? 40 VAL A HG13 2  
ATOM 2787  H HG21 . VAL A 1 40 ? 6.786   4.523   -2.483  1.00 0.33 ? 40 VAL A HG21 2  
ATOM 2788  H HG22 . VAL A 1 40 ? 5.833   5.953   -2.087  1.00 0.33 ? 40 VAL A HG22 2  
ATOM 2789  H HG23 . VAL A 1 40 ? 5.081   4.596   -2.924  1.00 0.33 ? 40 VAL A HG23 2  
ATOM 2790  N N    . PHE A 1 41 ? 9.274   5.779   -6.109  1.00 0.37 ? 41 PHE A N    2  
ATOM 2791  C CA   . PHE A 1 41 ? 9.746   6.072   -7.491  1.00 0.37 ? 41 PHE A CA   2  
ATOM 2792  C C    . PHE A 1 41 ? 9.053   5.131   -8.478  1.00 0.37 ? 41 PHE A C    2  
ATOM 2793  O O    . PHE A 1 41 ? 9.102   3.924   -8.340  1.00 0.37 ? 41 PHE A O    2  
ATOM 2794  C CB   . PHE A 1 41 ? 11.260  5.863   -7.566  1.00 0.37 ? 41 PHE A CB   2  
ATOM 2795  C CG   . PHE A 1 41 ? 11.965  7.082   -7.019  1.00 0.37 ? 41 PHE A CG   2  
ATOM 2796  C CD1  . PHE A 1 41 ? 12.003  8.264   -7.769  1.00 0.37 ? 41 PHE A CD1  2  
ATOM 2797  C CD2  . PHE A 1 41 ? 12.581  7.030   -5.763  1.00 0.37 ? 41 PHE A CD2  2  
ATOM 2798  C CE1  . PHE A 1 41 ? 12.657  9.393   -7.263  1.00 0.37 ? 41 PHE A CE1  2  
ATOM 2799  C CE2  . PHE A 1 41 ? 13.235  8.159   -5.257  1.00 0.37 ? 41 PHE A CE2  2  
ATOM 2800  C CZ   . PHE A 1 41 ? 13.273  9.341   -6.006  1.00 0.37 ? 41 PHE A CZ   2  
ATOM 2801  H H    . PHE A 1 41 ? 9.698   5.068   -5.585  1.00 0.37 ? 41 PHE A H    2  
ATOM 2802  H HA   . PHE A 1 41 ? 9.510   7.095   -7.743  1.00 0.37 ? 41 PHE A HA   2  
ATOM 2803  H HB2  . PHE A 1 41 ? 11.533  4.996   -6.982  1.00 0.37 ? 41 PHE A HB2  2  
ATOM 2804  H HB3  . PHE A 1 41 ? 11.552  5.711   -8.595  1.00 0.37 ? 41 PHE A HB3  2  
ATOM 2805  H HD1  . PHE A 1 41 ? 11.527  8.304   -8.738  1.00 0.37 ? 41 PHE A HD1  2  
ATOM 2806  H HD2  . PHE A 1 41 ? 12.552  6.118   -5.186  1.00 0.37 ? 41 PHE A HD2  2  
ATOM 2807  H HE1  . PHE A 1 41 ? 12.686  10.304  -7.841  1.00 0.37 ? 41 PHE A HE1  2  
ATOM 2808  H HE2  . PHE A 1 41 ? 13.711  8.119   -4.288  1.00 0.37 ? 41 PHE A HE2  2  
ATOM 2809  H HZ   . PHE A 1 41 ? 13.778  10.211  -5.615  1.00 0.37 ? 41 PHE A HZ   2  
ATOM 2810  N N    . VAL A 1 42 ? 8.407   5.673   -9.474  1.00 0.46 ? 42 VAL A N    2  
ATOM 2811  C CA   . VAL A 1 42 ? 7.713   4.809   -10.471 1.00 0.46 ? 42 VAL A CA   2  
ATOM 2812  C C    . VAL A 1 42 ? 8.382   4.972   -11.837 1.00 0.46 ? 42 VAL A C    2  
ATOM 2813  O O    . VAL A 1 42 ? 8.521   6.067   -12.345 1.00 0.46 ? 42 VAL A O    2  
ATOM 2814  C CB   . VAL A 1 42 ? 6.244   5.224   -10.569 1.00 0.46 ? 42 VAL A CB   2  
ATOM 2815  C CG1  . VAL A 1 42 ? 5.579   4.477   -11.726 1.00 0.46 ? 42 VAL A CG1  2  
ATOM 2816  C CG2  . VAL A 1 42 ? 5.529   4.875   -9.261  1.00 0.46 ? 42 VAL A CG2  2  
ATOM 2817  H H    . VAL A 1 42 ? 8.381   6.648   -9.568  1.00 0.46 ? 42 VAL A H    2  
ATOM 2818  H HA   . VAL A 1 42 ? 7.777   3.778   -10.159 1.00 0.46 ? 42 VAL A HA   2  
ATOM 2819  H HB   . VAL A 1 42 ? 6.181   6.288   -10.743 1.00 0.46 ? 42 VAL A HB   2  
ATOM 2820  H HG11 . VAL A 1 42 ? 6.035   3.504   -11.837 1.00 0.46 ? 42 VAL A HG11 2  
ATOM 2821  H HG12 . VAL A 1 42 ? 4.525   4.359   -11.521 1.00 0.46 ? 42 VAL A HG12 2  
ATOM 2822  H HG13 . VAL A 1 42 ? 5.706   5.040   -12.639 1.00 0.46 ? 42 VAL A HG13 2  
ATOM 2823  H HG21 . VAL A 1 42 ? 5.842   3.896   -8.929  1.00 0.46 ? 42 VAL A HG21 2  
ATOM 2824  H HG22 . VAL A 1 42 ? 5.780   5.608   -8.508  1.00 0.46 ? 42 VAL A HG22 2  
ATOM 2825  H HG23 . VAL A 1 42 ? 4.461   4.877   -9.423  1.00 0.46 ? 42 VAL A HG23 2  
ATOM 2826  N N    . THR A 1 43 ? 8.798   3.889   -12.435 1.00 0.54 ? 43 THR A N    2  
ATOM 2827  C CA   . THR A 1 43 ? 9.460   3.981   -13.768 1.00 0.54 ? 43 THR A CA   2  
ATOM 2828  C C    . THR A 1 43 ? 8.405   3.880   -14.872 1.00 0.54 ? 43 THR A C    2  
ATOM 2829  O O    . THR A 1 43 ? 7.220   3.836   -14.609 1.00 0.54 ? 43 THR A O    2  
ATOM 2830  C CB   . THR A 1 43 ? 10.466  2.836   -13.916 1.00 0.54 ? 43 THR A CB   2  
ATOM 2831  O OG1  . THR A 1 43 ? 9.765   1.607   -14.042 1.00 0.54 ? 43 THR A OG1  2  
ATOM 2832  C CG2  . THR A 1 43 ? 11.371  2.786   -12.684 1.00 0.54 ? 43 THR A CG2  2  
ATOM 2833  H H    . THR A 1 43 ? 8.677   3.016   -12.008 1.00 0.54 ? 43 THR A H    2  
ATOM 2834  H HA   . THR A 1 43 ? 9.976   4.926   -13.848 1.00 0.54 ? 43 THR A HA   2  
ATOM 2835  H HB   . THR A 1 43 ? 11.070  3.000   -14.795 1.00 0.54 ? 43 THR A HB   2  
ATOM 2836  H HG1  . THR A 1 43 ? 10.376  0.895   -13.839 1.00 0.54 ? 43 THR A HG1  2  
ATOM 2837  H HG21 . THR A 1 43 ? 11.426  3.769   -12.239 1.00 0.54 ? 43 THR A HG21 2  
ATOM 2838  H HG22 . THR A 1 43 ? 10.964  2.089   -11.967 1.00 0.54 ? 43 THR A HG22 2  
ATOM 2839  H HG23 . THR A 1 43 ? 12.359  2.467   -12.977 1.00 0.54 ? 43 THR A HG23 2  
ATOM 2840  N N    . ARG A 1 44 ? 8.828   3.843   -16.106 1.00 0.69 ? 44 ARG A N    2  
ATOM 2841  C CA   . ARG A 1 44 ? 7.850   3.746   -17.227 1.00 0.69 ? 44 ARG A CA   2  
ATOM 2842  C C    . ARG A 1 44 ? 7.241   2.343   -17.253 1.00 0.69 ? 44 ARG A C    2  
ATOM 2843  O O    . ARG A 1 44 ? 6.232   2.105   -17.888 1.00 0.69 ? 44 ARG A O    2  
ATOM 2844  C CB   . ARG A 1 44 ? 8.563   4.018   -18.552 1.00 0.69 ? 44 ARG A CB   2  
ATOM 2845  C CG   . ARG A 1 44 ? 9.058   5.466   -18.580 1.00 0.69 ? 44 ARG A CG   2  
ATOM 2846  C CD   . ARG A 1 44 ? 10.328  5.556   -19.427 1.00 0.69 ? 44 ARG A CD   2  
ATOM 2847  N NE   . ARG A 1 44 ? 9.961   5.816   -20.847 1.00 0.69 ? 44 ARG A NE   2  
ATOM 2848  C CZ   . ARG A 1 44 ? 10.895  6.027   -21.735 1.00 0.69 ? 44 ARG A CZ   2  
ATOM 2849  N NH1  . ARG A 1 44 ? 12.021  6.580   -21.378 1.00 0.69 ? 44 ARG A NH1  2  
ATOM 2850  N NH2  . ARG A 1 44 ? 10.702  5.682   -22.979 1.00 0.69 ? 44 ARG A NH2  2  
ATOM 2851  H H    . ARG A 1 44 ? 9.788   3.881   -16.296 1.00 0.69 ? 44 ARG A H    2  
ATOM 2852  H HA   . ARG A 1 44 ? 7.066   4.475   -17.084 1.00 0.69 ? 44 ARG A HA   2  
ATOM 2853  H HB2  . ARG A 1 44 ? 9.405   3.348   -18.651 1.00 0.69 ? 44 ARG A HB2  2  
ATOM 2854  H HB3  . ARG A 1 44 ? 7.878   3.858   -19.370 1.00 0.69 ? 44 ARG A HB3  2  
ATOM 2855  H HG2  . ARG A 1 44 ? 8.293   6.099   -19.007 1.00 0.69 ? 44 ARG A HG2  2  
ATOM 2856  H HG3  . ARG A 1 44 ? 9.275   5.792   -17.574 1.00 0.69 ? 44 ARG A HG3  2  
ATOM 2857  H HD2  . ARG A 1 44 ? 10.948  6.362   -19.062 1.00 0.69 ? 44 ARG A HD2  2  
ATOM 2858  H HD3  . ARG A 1 44 ? 10.872  4.625   -19.361 1.00 0.69 ? 44 ARG A HD3  2  
ATOM 2859  H HE   . ARG A 1 44 ? 9.019   5.830   -21.115 1.00 0.69 ? 44 ARG A HE   2  
ATOM 2860  H HH11 . ARG A 1 44 ? 12.170  6.844   -20.425 1.00 0.69 ? 44 ARG A HH11 2  
ATOM 2861  H HH12 . ARG A 1 44 ? 12.736  6.742   -22.059 1.00 0.69 ? 44 ARG A HH12 2  
ATOM 2862  H HH21 . ARG A 1 44 ? 9.838   5.258   -23.252 1.00 0.69 ? 44 ARG A HH21 2  
ATOM 2863  H HH22 . ARG A 1 44 ? 11.417  5.844   -23.659 1.00 0.69 ? 44 ARG A HH22 2  
ATOM 2864  N N    . LYS A 1 45 ? 7.846   1.410   -16.569 1.00 0.66 ? 45 LYS A N    2  
ATOM 2865  C CA   . LYS A 1 45 ? 7.300   0.023   -16.557 1.00 0.66 ? 45 LYS A CA   2  
ATOM 2866  C C    . LYS A 1 45 ? 6.300   -0.122  -15.409 1.00 0.66 ? 45 LYS A C    2  
ATOM 2867  O O    . LYS A 1 45 ? 6.193   -1.164  -14.794 1.00 0.66 ? 45 LYS A O    2  
ATOM 2868  C CB   . LYS A 1 45 ? 8.445   -0.973  -16.366 1.00 0.66 ? 45 LYS A CB   2  
ATOM 2869  C CG   . LYS A 1 45 ? 9.067   -1.304  -17.724 1.00 0.66 ? 45 LYS A CG   2  
ATOM 2870  C CD   . LYS A 1 45 ? 9.808   -0.076  -18.259 1.00 0.66 ? 45 LYS A CD   2  
ATOM 2871  C CE   . LYS A 1 45 ? 10.649  -0.476  -19.473 1.00 0.66 ? 45 LYS A CE   2  
ATOM 2872  N NZ   . LYS A 1 45 ? 11.456  -1.684  -19.142 1.00 0.66 ? 45 LYS A NZ   2  
ATOM 2873  H H    . LYS A 1 45 ? 8.658   1.622   -16.064 1.00 0.66 ? 45 LYS A H    2  
ATOM 2874  H HA   . LYS A 1 45 ? 6.803   -0.176  -17.495 1.00 0.66 ? 45 LYS A HA   2  
ATOM 2875  H HB2  . LYS A 1 45 ? 9.196   -0.539  -15.721 1.00 0.66 ? 45 LYS A HB2  2  
ATOM 2876  H HB3  . LYS A 1 45 ? 8.064   -1.878  -15.918 1.00 0.66 ? 45 LYS A HB3  2  
ATOM 2877  H HG2  . LYS A 1 45 ? 9.761   -2.124  -17.612 1.00 0.66 ? 45 LYS A HG2  2  
ATOM 2878  H HG3  . LYS A 1 45 ? 8.289   -1.582  -18.419 1.00 0.66 ? 45 LYS A HG3  2  
ATOM 2879  H HD2  . LYS A 1 45 ? 9.092   0.678   -18.549 1.00 0.66 ? 45 LYS A HD2  2  
ATOM 2880  H HD3  . LYS A 1 45 ? 10.455  0.316   -17.489 1.00 0.66 ? 45 LYS A HD3  2  
ATOM 2881  H HE2  . LYS A 1 45 ? 9.998   -0.696  -20.305 1.00 0.66 ? 45 LYS A HE2  2  
ATOM 2882  H HE3  . LYS A 1 45 ? 11.309  0.337   -19.736 1.00 0.66 ? 45 LYS A HE3  2  
ATOM 2883  H HZ1  . LYS A 1 45 ? 11.904  -1.559  -18.212 1.00 0.66 ? 45 LYS A HZ1  2  
ATOM 2884  H HZ2  . LYS A 1 45 ? 10.837  -2.519  -19.116 1.00 0.66 ? 45 LYS A HZ2  2  
ATOM 2885  H HZ3  . LYS A 1 45 ? 12.191  -1.819  -19.866 1.00 0.66 ? 45 LYS A HZ3  2  
ATOM 2886  N N    . ASN A 1 46 ? 5.564   0.916   -15.115 1.00 0.61 ? 46 ASN A N    2  
ATOM 2887  C CA   . ASN A 1 46 ? 4.572   0.836   -14.007 1.00 0.61 ? 46 ASN A CA   2  
ATOM 2888  C C    . ASN A 1 46 ? 5.212   0.151   -12.796 1.00 0.61 ? 46 ASN A C    2  
ATOM 2889  O O    . ASN A 1 46 ? 4.537   -0.441  -11.979 1.00 0.61 ? 46 ASN A O    2  
ATOM 2890  C CB   . ASN A 1 46 ? 3.357   0.026   -14.467 1.00 0.61 ? 46 ASN A CB   2  
ATOM 2891  C CG   . ASN A 1 46 ? 2.075   0.766   -14.081 1.00 0.61 ? 46 ASN A CG   2  
ATOM 2892  O OD1  . ASN A 1 46 ? 1.400   0.387   -13.146 1.00 0.61 ? 46 ASN A OD1  2  
ATOM 2893  N ND2  . ASN A 1 46 ? 1.709   1.813   -14.769 1.00 0.61 ? 46 ASN A ND2  2  
ATOM 2894  H H    . ASN A 1 46 ? 5.666   1.748   -15.623 1.00 0.61 ? 46 ASN A H    2  
ATOM 2895  H HA   . ASN A 1 46 ? 4.258   1.832   -13.733 1.00 0.61 ? 46 ASN A HA   2  
ATOM 2896  H HB2  . ASN A 1 46 ? 3.394   -0.098  -15.539 1.00 0.61 ? 46 ASN A HB2  2  
ATOM 2897  H HB3  . ASN A 1 46 ? 3.369   -0.942  -13.991 1.00 0.61 ? 46 ASN A HB3  2  
ATOM 2898  H HD21 . ASN A 1 46 ? 2.253   2.119   -15.524 1.00 0.61 ? 46 ASN A HD21 2  
ATOM 2899  H HD22 . ASN A 1 46 ? 0.889   2.294   -14.530 1.00 0.61 ? 46 ASN A HD22 2  
ATOM 2900  N N    . ARG A 1 47 ? 6.509   0.228   -12.676 1.00 0.52 ? 47 ARG A N    2  
ATOM 2901  C CA   . ARG A 1 47 ? 7.189   -0.417  -11.519 1.00 0.52 ? 47 ARG A CA   2  
ATOM 2902  C C    . ARG A 1 47 ? 7.283   0.580   -10.362 1.00 0.52 ? 47 ARG A C    2  
ATOM 2903  O O    . ARG A 1 47 ? 7.830   1.655   -10.499 1.00 0.52 ? 47 ARG A O    2  
ATOM 2904  C CB   . ARG A 1 47 ? 8.595   -0.854  -11.931 1.00 0.52 ? 47 ARG A CB   2  
ATOM 2905  C CG   . ARG A 1 47 ? 8.686   -2.381  -11.900 1.00 0.52 ? 47 ARG A CG   2  
ATOM 2906  C CD   . ARG A 1 47 ? 9.446   -2.874  -13.133 1.00 0.52 ? 47 ARG A CD   2  
ATOM 2907  N NE   . ARG A 1 47 ? 10.824  -3.281  -12.737 1.00 0.52 ? 47 ARG A NE   2  
ATOM 2908  C CZ   . ARG A 1 47 ? 11.146  -4.545  -12.699 1.00 0.52 ? 47 ARG A CZ   2  
ATOM 2909  N NH1  . ARG A 1 47 ? 10.255  -5.435  -12.360 1.00 0.52 ? 47 ARG A NH1  2  
ATOM 2910  N NH2  . ARG A 1 47 ? 12.359  -4.919  -13.002 1.00 0.52 ? 47 ARG A NH2  2  
ATOM 2911  H H    . ARG A 1 47 ? 7.036   0.712   -13.347 1.00 0.52 ? 47 ARG A H    2  
ATOM 2912  H HA   . ARG A 1 47 ? 6.621   -1.281  -11.204 1.00 0.52 ? 47 ARG A HA   2  
ATOM 2913  H HB2  . ARG A 1 47 ? 8.803   -0.501  -12.932 1.00 0.52 ? 47 ARG A HB2  2  
ATOM 2914  H HB3  . ARG A 1 47 ? 9.318   -0.439  -11.246 1.00 0.52 ? 47 ARG A HB3  2  
ATOM 2915  H HG2  . ARG A 1 47 ? 9.208   -2.692  -11.006 1.00 0.52 ? 47 ARG A HG2  2  
ATOM 2916  H HG3  . ARG A 1 47 ? 7.691   -2.801  -11.901 1.00 0.52 ? 47 ARG A HG3  2  
ATOM 2917  H HD2  . ARG A 1 47 ? 8.929   -3.721  -13.559 1.00 0.52 ? 47 ARG A HD2  2  
ATOM 2918  H HD3  . ARG A 1 47 ? 9.501   -2.080  -13.863 1.00 0.52 ? 47 ARG A HD3  2  
ATOM 2919  H HE   . ARG A 1 47 ? 11.488  -2.599  -12.505 1.00 0.52 ? 47 ARG A HE   2  
ATOM 2920  H HH11 . ARG A 1 47 ? 9.325   -5.150  -12.129 1.00 0.52 ? 47 ARG A HH11 2  
ATOM 2921  H HH12 . ARG A 1 47 ? 10.501  -6.404  -12.331 1.00 0.52 ? 47 ARG A HH12 2  
ATOM 2922  H HH21 . ARG A 1 47 ? 13.042  -4.235  -13.261 1.00 0.52 ? 47 ARG A HH21 2  
ATOM 2923  H HH22 . ARG A 1 47 ? 12.605  -5.887  -12.973 1.00 0.52 ? 47 ARG A HH22 2  
ATOM 2924  N N    . GLN A 1 48 ? 6.751   0.231   -9.222  1.00 0.45 ? 48 GLN A N    2  
ATOM 2925  C CA   . GLN A 1 48 ? 6.810   1.160   -8.058  1.00 0.45 ? 48 GLN A CA   2  
ATOM 2926  C C    . GLN A 1 48 ? 8.043   0.840   -7.211  1.00 0.45 ? 48 GLN A C    2  
ATOM 2927  O O    . GLN A 1 48 ? 8.433   -0.302  -7.069  1.00 0.45 ? 48 GLN A O    2  
ATOM 2928  C CB   . GLN A 1 48 ? 5.550   0.991   -7.208  1.00 0.45 ? 48 GLN A CB   2  
ATOM 2929  C CG   . GLN A 1 48 ? 4.348   0.741   -8.121  1.00 0.45 ? 48 GLN A CG   2  
ATOM 2930  C CD   . GLN A 1 48 ? 4.080   1.988   -8.966  1.00 0.45 ? 48 GLN A CD   2  
ATOM 2931  O OE1  . GLN A 1 48 ? 4.648   2.148   -10.028 1.00 0.45 ? 48 GLN A OE1  2  
ATOM 2932  N NE2  . GLN A 1 48 ? 3.233   2.884   -8.537  1.00 0.45 ? 48 GLN A NE2  2  
ATOM 2933  H H    . GLN A 1 48 ? 6.314   -0.641  -9.131  1.00 0.45 ? 48 GLN A H    2  
ATOM 2934  H HA   . GLN A 1 48 ? 6.871   2.178   -8.413  1.00 0.45 ? 48 GLN A HA   2  
ATOM 2935  H HB2  . GLN A 1 48 ? 5.676   0.152   -6.540  1.00 0.45 ? 48 GLN A HB2  2  
ATOM 2936  H HB3  . GLN A 1 48 ? 5.381   1.888   -6.631  1.00 0.45 ? 48 GLN A HB3  2  
ATOM 2937  H HG2  . GLN A 1 48 ? 4.556   -0.097  -8.769  1.00 0.45 ? 48 GLN A HG2  2  
ATOM 2938  H HG3  . GLN A 1 48 ? 3.477   0.524   -7.519  1.00 0.45 ? 48 GLN A HG3  2  
ATOM 2939  H HE21 . GLN A 1 48 ? 2.775   2.754   -7.679  1.00 0.45 ? 48 GLN A HE21 2  
ATOM 2940  H HE22 . GLN A 1 48 ? 3.055   3.685   -9.071  1.00 0.45 ? 48 GLN A HE22 2  
ATOM 2941  N N    . VAL A 1 49 ? 8.659   1.841   -6.644  1.00 0.37 ? 49 VAL A N    2  
ATOM 2942  C CA   . VAL A 1 49 ? 9.866   1.596   -5.805  1.00 0.37 ? 49 VAL A CA   2  
ATOM 2943  C C    . VAL A 1 49 ? 9.750   2.396   -4.506  1.00 0.37 ? 49 VAL A C    2  
ATOM 2944  O O    . VAL A 1 49 ? 8.994   3.341   -4.414  1.00 0.37 ? 49 VAL A O    2  
ATOM 2945  C CB   . VAL A 1 49 ? 11.117  2.036   -6.567  1.00 0.37 ? 49 VAL A CB   2  
ATOM 2946  C CG1  . VAL A 1 49 ? 12.345  1.871   -5.671  1.00 0.37 ? 49 VAL A CG1  2  
ATOM 2947  C CG2  . VAL A 1 49 ? 11.280  1.171   -7.818  1.00 0.37 ? 49 VAL A CG2  2  
ATOM 2948  H H    . VAL A 1 49 ? 8.329   2.755   -6.770  1.00 0.37 ? 49 VAL A H    2  
ATOM 2949  H HA   . VAL A 1 49 ? 9.935   0.543   -5.574  1.00 0.37 ? 49 VAL A HA   2  
ATOM 2950  H HB   . VAL A 1 49 ? 11.016  3.073   -6.853  1.00 0.37 ? 49 VAL A HB   2  
ATOM 2951  H HG11 . VAL A 1 49 ? 12.381  0.862   -5.290  1.00 0.37 ? 49 VAL A HG11 2  
ATOM 2952  H HG12 . VAL A 1 49 ? 13.238  2.073   -6.244  1.00 0.37 ? 49 VAL A HG12 2  
ATOM 2953  H HG13 . VAL A 1 49 ? 12.284  2.566   -4.845  1.00 0.37 ? 49 VAL A HG13 2  
ATOM 2954  H HG21 . VAL A 1 49 ? 10.309  0.959   -8.239  1.00 0.37 ? 49 VAL A HG21 2  
ATOM 2955  H HG22 . VAL A 1 49 ? 11.881  1.699   -8.544  1.00 0.37 ? 49 VAL A HG22 2  
ATOM 2956  H HG23 . VAL A 1 49 ? 11.767  0.244   -7.554  1.00 0.37 ? 49 VAL A HG23 2  
ATOM 2957  N N    . CYS A 1 50 ? 10.495  2.025   -3.499  1.00 0.29 ? 50 CYS A N    2  
ATOM 2958  C CA   . CYS A 1 50 ? 10.424  2.768   -2.210  1.00 0.29 ? 50 CYS A CA   2  
ATOM 2959  C C    . CYS A 1 50 ? 11.762  3.457   -1.941  1.00 0.29 ? 50 CYS A C    2  
ATOM 2960  O O    . CYS A 1 50 ? 12.809  2.841   -1.986  1.00 0.29 ? 50 CYS A O    2  
ATOM 2961  C CB   . CYS A 1 50 ? 10.117  1.791   -1.074  1.00 0.29 ? 50 CYS A CB   2  
ATOM 2962  S SG   . CYS A 1 50 ? 8.678   0.786   -1.517  1.00 0.29 ? 50 CYS A SG   2  
ATOM 2963  H H    . CYS A 1 50 ? 11.099  1.260   -3.593  1.00 0.29 ? 50 CYS A H    2  
ATOM 2964  H HA   . CYS A 1 50 ? 9.642   3.511   -2.265  1.00 0.29 ? 50 CYS A HA   2  
ATOM 2965  H HB2  . CYS A 1 50 ? 10.969  1.148   -0.910  1.00 0.29 ? 50 CYS A HB2  2  
ATOM 2966  H HB3  . CYS A 1 50 ? 9.905   2.344   -0.170  1.00 0.29 ? 50 CYS A HB3  2  
ATOM 2967  N N    . ALA A 1 51 ? 11.738  4.731   -1.663  1.00 0.23 ? 51 ALA A N    2  
ATOM 2968  C CA   . ALA A 1 51 ? 13.009  5.458   -1.390  1.00 0.23 ? 51 ALA A CA   2  
ATOM 2969  C C    . ALA A 1 51 ? 12.814  6.388   -0.192  1.00 0.23 ? 51 ALA A C    2  
ATOM 2970  O O    . ALA A 1 51 ? 11.837  7.104   -0.101  1.00 0.23 ? 51 ALA A O    2  
ATOM 2971  C CB   . ALA A 1 51 ? 13.398  6.285   -2.618  1.00 0.23 ? 51 ALA A CB   2  
ATOM 2972  H H    . ALA A 1 51 ? 10.883  5.210   -1.631  1.00 0.23 ? 51 ALA A H    2  
ATOM 2973  H HA   . ALA A 1 51 ? 13.791  4.748   -1.172  1.00 0.23 ? 51 ALA A HA   2  
ATOM 2974  H HB1  . ALA A 1 51 ? 12.519  6.771   -3.018  1.00 0.23 ? 51 ALA A HB1  2  
ATOM 2975  H HB2  . ALA A 1 51 ? 14.125  7.032   -2.334  1.00 0.23 ? 51 ALA A HB2  2  
ATOM 2976  H HB3  . ALA A 1 51 ? 13.823  5.635   -3.369  1.00 0.23 ? 51 ALA A HB3  2  
ATOM 2977  N N    . ASN A 1 52 ? 13.736  6.384   0.731   1.00 0.26 ? 52 ASN A N    2  
ATOM 2978  C CA   . ASN A 1 52 ? 13.600  7.268   1.922   1.00 0.26 ? 52 ASN A CA   2  
ATOM 2979  C C    . ASN A 1 52 ? 14.257  8.621   1.628   1.00 0.26 ? 52 ASN A C    2  
ATOM 2980  O O    . ASN A 1 52 ? 15.245  8.685   0.922   1.00 0.26 ? 52 ASN A O    2  
ATOM 2981  C CB   . ASN A 1 52 ? 14.288  6.617   3.123   1.00 0.26 ? 52 ASN A CB   2  
ATOM 2982  C CG   . ASN A 1 52 ? 13.474  6.891   4.388   1.00 0.26 ? 52 ASN A CG   2  
ATOM 2983  O OD1  . ASN A 1 52 ? 12.260  6.827   4.371   1.00 0.26 ? 52 ASN A OD1  2  
ATOM 2984  N ND2  . ASN A 1 52 ? 14.095  7.198   5.496   1.00 0.26 ? 52 ASN A ND2  2  
ATOM 2985  H H    . ASN A 1 52 ? 14.518  5.799   0.641   1.00 0.26 ? 52 ASN A H    2  
ATOM 2986  H HA   . ASN A 1 52 ? 12.553  7.413   2.141   1.00 0.26 ? 52 ASN A HA   2  
ATOM 2987  H HB2  . ASN A 1 52 ? 14.358  5.550   2.963   1.00 0.26 ? 52 ASN A HB2  2  
ATOM 2988  H HB3  . ASN A 1 52 ? 15.279  7.029   3.238   1.00 0.26 ? 52 ASN A HB3  2  
ATOM 2989  H HD21 . ASN A 1 52 ? 15.073  7.250   5.510   1.00 0.26 ? 52 ASN A HD21 2  
ATOM 2990  H HD22 . ASN A 1 52 ? 13.582  7.376   6.311   1.00 0.26 ? 52 ASN A HD22 2  
ATOM 2991  N N    . PRO A 1 53 ? 13.684  9.662   2.176   1.00 0.30 ? 53 PRO A N    2  
ATOM 2992  C CA   . PRO A 1 53 ? 14.185  11.037  1.995   1.00 0.30 ? 53 PRO A CA   2  
ATOM 2993  C C    . PRO A 1 53 ? 15.368  11.312  2.934   1.00 0.30 ? 53 PRO A C    2  
ATOM 2994  O O    . PRO A 1 53 ? 15.464  12.366  3.530   1.00 0.30 ? 53 PRO A O    2  
ATOM 2995  C CB   . PRO A 1 53 ? 12.985  11.907  2.376   1.00 0.30 ? 53 PRO A CB   2  
ATOM 2996  C CG   . PRO A 1 53 ? 12.083  11.035  3.284   1.00 0.30 ? 53 PRO A CG   2  
ATOM 2997  C CD   . PRO A 1 53 ? 12.476  9.569   3.023   1.00 0.30 ? 53 PRO A CD   2  
ATOM 2998  H HA   . PRO A 1 53 ? 14.459  11.214  0.969   1.00 0.30 ? 53 PRO A HA   2  
ATOM 2999  H HB2  . PRO A 1 53 ? 13.320  12.785  2.911   1.00 0.30 ? 53 PRO A HB2  2  
ATOM 3000  H HB3  . PRO A 1 53 ? 12.440  12.195  1.491   1.00 0.30 ? 53 PRO A HB3  2  
ATOM 3001  H HG2  . PRO A 1 53 ? 12.251  11.287  4.322   1.00 0.30 ? 53 PRO A HG2  2  
ATOM 3002  H HG3  . PRO A 1 53 ? 11.046  11.185  3.029   1.00 0.30 ? 53 PRO A HG3  2  
ATOM 3003  H HD2  . PRO A 1 53 ? 12.701  9.066   3.954   1.00 0.30 ? 53 PRO A HD2  2  
ATOM 3004  H HD3  . PRO A 1 53 ? 11.690  9.053   2.493   1.00 0.30 ? 53 PRO A HD3  2  
ATOM 3005  N N    . GLU A 1 54 ? 16.268  10.376  3.071   1.00 0.43 ? 54 GLU A N    2  
ATOM 3006  C CA   . GLU A 1 54 ? 17.435  10.593  3.971   1.00 0.43 ? 54 GLU A CA   2  
ATOM 3007  C C    . GLU A 1 54 ? 18.721  10.184  3.249   1.00 0.43 ? 54 GLU A C    2  
ATOM 3008  O O    . GLU A 1 54 ? 19.764  10.035  3.854   1.00 0.43 ? 54 GLU A O    2  
ATOM 3009  C CB   . GLU A 1 54 ? 17.270  9.747   5.235   1.00 0.43 ? 54 GLU A CB   2  
ATOM 3010  C CG   . GLU A 1 54 ? 16.167  10.346  6.111   1.00 0.43 ? 54 GLU A CG   2  
ATOM 3011  C CD   . GLU A 1 54 ? 16.653  10.428  7.559   1.00 0.43 ? 54 GLU A CD   2  
ATOM 3012  O OE1  . GLU A 1 54 ? 16.617  9.412   8.234   1.00 0.43 ? 54 GLU A OE1  2  
ATOM 3013  O OE2  . GLU A 1 54 ? 17.053  11.505  7.969   1.00 0.43 ? 54 GLU A OE2  2  
ATOM 3014  H H    . GLU A 1 54 ? 16.178  9.532   2.585   1.00 0.43 ? 54 GLU A H    2  
ATOM 3015  H HA   . GLU A 1 54 ? 17.492  11.637  4.242   1.00 0.43 ? 54 GLU A HA   2  
ATOM 3016  H HB2  . GLU A 1 54 ? 17.003  8.737   4.959   1.00 0.43 ? 54 GLU A HB2  2  
ATOM 3017  H HB3  . GLU A 1 54 ? 18.198  9.737   5.786   1.00 0.43 ? 54 GLU A HB3  2  
ATOM 3018  H HG2  . GLU A 1 54 ? 15.924  11.337  5.754   1.00 0.43 ? 54 GLU A HG2  2  
ATOM 3019  H HG3  . GLU A 1 54 ? 15.290  9.720   6.062   1.00 0.43 ? 54 GLU A HG3  2  
ATOM 3020  N N    . LYS A 1 55 ? 18.656  10.002  1.958   1.00 0.47 ? 55 LYS A N    2  
ATOM 3021  C CA   . LYS A 1 55 ? 19.875  9.603   1.200   1.00 0.47 ? 55 LYS A CA   2  
ATOM 3022  C C    . LYS A 1 55 ? 20.487  10.836  0.533   1.00 0.47 ? 55 LYS A C    2  
ATOM 3023  O O    . LYS A 1 55 ? 19.989  11.936  0.665   1.00 0.47 ? 55 LYS A O    2  
ATOM 3024  C CB   . LYS A 1 55 ? 19.498  8.578   0.128   1.00 0.47 ? 55 LYS A CB   2  
ATOM 3025  C CG   . LYS A 1 55 ? 18.969  7.308   0.797   1.00 0.47 ? 55 LYS A CG   2  
ATOM 3026  C CD   . LYS A 1 55 ? 19.991  6.181   0.633   1.00 0.47 ? 55 LYS A CD   2  
ATOM 3027  C CE   . LYS A 1 55 ? 19.773  5.132   1.725   1.00 0.47 ? 55 LYS A CE   2  
ATOM 3028  N NZ   . LYS A 1 55 ? 20.827  5.273   2.768   1.00 0.47 ? 55 LYS A NZ   2  
ATOM 3029  H H    . LYS A 1 55 ? 17.805  10.127  1.488   1.00 0.47 ? 55 LYS A H    2  
ATOM 3030  H HA   . LYS A 1 55 ? 20.593  9.167   1.877   1.00 0.47 ? 55 LYS A HA   2  
ATOM 3031  H HB2  . LYS A 1 55 ? 18.733  8.993   -0.513  1.00 0.47 ? 55 LYS A HB2  2  
ATOM 3032  H HB3  . LYS A 1 55 ? 20.370  8.336   -0.461  1.00 0.47 ? 55 LYS A HB3  2  
ATOM 3033  H HG2  . LYS A 1 55 ? 18.805  7.497   1.848   1.00 0.47 ? 55 LYS A HG2  2  
ATOM 3034  H HG3  . LYS A 1 55 ? 18.039  7.018   0.333   1.00 0.47 ? 55 LYS A HG3  2  
ATOM 3035  H HD2  . LYS A 1 55 ? 19.869  5.724   -0.338  1.00 0.47 ? 55 LYS A HD2  2  
ATOM 3036  H HD3  . LYS A 1 55 ? 20.989  6.585   0.719   1.00 0.47 ? 55 LYS A HD3  2  
ATOM 3037  H HE2  . LYS A 1 55 ? 18.801  5.274   2.173   1.00 0.47 ? 55 LYS A HE2  2  
ATOM 3038  H HE3  . LYS A 1 55 ? 19.828  4.144   1.290   1.00 0.47 ? 55 LYS A HE3  2  
ATOM 3039  H HZ1  . LYS A 1 55 ? 21.731  5.524   2.317   1.00 0.47 ? 55 LYS A HZ1  2  
ATOM 3040  H HZ2  . LYS A 1 55 ? 20.557  6.023   3.435   1.00 0.47 ? 55 LYS A HZ2  2  
ATOM 3041  H HZ3  . LYS A 1 55 ? 20.931  4.374   3.280   1.00 0.47 ? 55 LYS A HZ3  2  
ATOM 3042  N N    . LYS A 1 56 ? 21.563  10.661  -0.185  1.00 0.58 ? 56 LYS A N    2  
ATOM 3043  C CA   . LYS A 1 56 ? 22.205  11.824  -0.860  1.00 0.58 ? 56 LYS A CA   2  
ATOM 3044  C C    . LYS A 1 56 ? 21.702  11.916  -2.303  1.00 0.58 ? 56 LYS A C    2  
ATOM 3045  O O    . LYS A 1 56 ? 21.914  12.900  -2.983  1.00 0.58 ? 56 LYS A O    2  
ATOM 3046  C CB   . LYS A 1 56 ? 23.723  11.639  -0.859  1.00 0.58 ? 56 LYS A CB   2  
ATOM 3047  C CG   . LYS A 1 56 ? 24.062  10.197  -1.240  1.00 0.58 ? 56 LYS A CG   2  
ATOM 3048  C CD   . LYS A 1 56 ? 25.364  10.174  -2.044  1.00 0.58 ? 56 LYS A CD   2  
ATOM 3049  C CE   . LYS A 1 56 ? 25.359  8.973   -2.992  1.00 0.58 ? 56 LYS A CE   2  
ATOM 3050  N NZ   . LYS A 1 56 ? 25.311  9.454   -4.402  1.00 0.58 ? 56 LYS A NZ   2  
ATOM 3051  H H    . LYS A 1 56 ? 21.948  9.765   -0.280  1.00 0.58 ? 56 LYS A H    2  
ATOM 3052  H HA   . LYS A 1 56 ? 21.952  12.731  -0.333  1.00 0.58 ? 56 LYS A HA   2  
ATOM 3053  H HB2  . LYS A 1 56 ? 24.169  12.316  -1.575  1.00 0.58 ? 56 LYS A HB2  2  
ATOM 3054  H HB3  . LYS A 1 56 ? 24.111  11.849  0.126   1.00 0.58 ? 56 LYS A HB3  2  
ATOM 3055  H HG2  . LYS A 1 56 ? 24.182  9.606   -0.344  1.00 0.58 ? 56 LYS A HG2  2  
ATOM 3056  H HG3  . LYS A 1 56 ? 23.265  9.785   -1.840  1.00 0.58 ? 56 LYS A HG3  2  
ATOM 3057  H HD2  . LYS A 1 56 ? 25.451  11.086  -2.617  1.00 0.58 ? 56 LYS A HD2  2  
ATOM 3058  H HD3  . LYS A 1 56 ? 26.203  10.092  -1.369  1.00 0.58 ? 56 LYS A HD3  2  
ATOM 3059  H HE2  . LYS A 1 56 ? 26.255  8.389   -2.841  1.00 0.58 ? 56 LYS A HE2  2  
ATOM 3060  H HE3  . LYS A 1 56 ? 24.492  8.360   -2.792  1.00 0.58 ? 56 LYS A HE3  2  
ATOM 3061  H HZ1  . LYS A 1 56 ? 25.536  10.469  -4.429  1.00 0.58 ? 56 LYS A HZ1  2  
ATOM 3062  H HZ2  . LYS A 1 56 ? 26.006  8.929   -4.971  1.00 0.58 ? 56 LYS A HZ2  2  
ATOM 3063  H HZ3  . LYS A 1 56 ? 24.361  9.298   -4.790  1.00 0.58 ? 56 LYS A HZ3  2  
ATOM 3064  N N    . TRP A 1 57 ? 21.040  10.896  -2.777  1.00 0.41 ? 57 TRP A N    2  
ATOM 3065  C CA   . TRP A 1 57 ? 20.526  10.925  -4.174  1.00 0.41 ? 57 TRP A CA   2  
ATOM 3066  C C    . TRP A 1 57 ? 18.995  10.906  -4.156  1.00 0.41 ? 57 TRP A C    2  
ATOM 3067  O O    . TRP A 1 57 ? 18.349  11.361  -5.077  1.00 0.41 ? 57 TRP A O    2  
ATOM 3068  C CB   . TRP A 1 57 ? 21.042  9.701   -4.933  1.00 0.41 ? 57 TRP A CB   2  
ATOM 3069  C CG   . TRP A 1 57 ? 20.406  8.468   -4.379  1.00 0.41 ? 57 TRP A CG   2  
ATOM 3070  C CD1  . TRP A 1 57 ? 20.958  7.663   -3.441  1.00 0.41 ? 57 TRP A CD1  2  
ATOM 3071  C CD2  . TRP A 1 57 ? 19.111  7.885   -4.708  1.00 0.41 ? 57 TRP A CD2  2  
ATOM 3072  N NE1  . TRP A 1 57 ? 20.085  6.623   -3.175  1.00 0.41 ? 57 TRP A NE1  2  
ATOM 3073  C CE2  . TRP A 1 57 ? 18.932  6.716   -3.930  1.00 0.41 ? 57 TRP A CE2  2  
ATOM 3074  C CE3  . TRP A 1 57 ? 18.086  8.254   -5.596  1.00 0.41 ? 57 TRP A CE3  2  
ATOM 3075  C CZ2  . TRP A 1 57 ? 17.777  5.942   -4.031  1.00 0.41 ? 57 TRP A CZ2  2  
ATOM 3076  C CZ3  . TRP A 1 57 ? 16.921  7.475   -5.700  1.00 0.41 ? 57 TRP A CZ3  2  
ATOM 3077  C CH2  . TRP A 1 57 ? 16.767  6.322   -4.918  1.00 0.41 ? 57 TRP A CH2  2  
ATOM 3078  H H    . TRP A 1 57 ? 20.881  10.110  -2.212  1.00 0.41 ? 57 TRP A H    2  
ATOM 3079  H HA   . TRP A 1 57 ? 20.868  11.824  -4.665  1.00 0.41 ? 57 TRP A HA   2  
ATOM 3080  H HB2  . TRP A 1 57 ? 20.793  9.795   -5.980  1.00 0.41 ? 57 TRP A HB2  2  
ATOM 3081  H HB3  . TRP A 1 57 ? 22.114  9.634   -4.822  1.00 0.41 ? 57 TRP A HB3  2  
ATOM 3082  H HD1  . TRP A 1 57 ? 21.922  7.808   -2.978  1.00 0.41 ? 57 TRP A HD1  2  
ATOM 3083  H HE1  . TRP A 1 57 ? 20.245  5.901   -2.533  1.00 0.41 ? 57 TRP A HE1  2  
ATOM 3084  H HE3  . TRP A 1 57 ? 18.195  9.141   -6.202  1.00 0.41 ? 57 TRP A HE3  2  
ATOM 3085  H HZ2  . TRP A 1 57 ? 17.663  5.053   -3.426  1.00 0.41 ? 57 TRP A HZ2  2  
ATOM 3086  H HZ3  . TRP A 1 57 ? 16.140  7.768   -6.386  1.00 0.41 ? 57 TRP A HZ3  2  
ATOM 3087  H HH2  . TRP A 1 57 ? 15.869  5.728   -5.002  1.00 0.41 ? 57 TRP A HH2  2  
ATOM 3088  N N    . VAL A 1 58 ? 18.411  10.384  -3.113  1.00 0.32 ? 58 VAL A N    2  
ATOM 3089  C CA   . VAL A 1 58 ? 16.923  10.340  -3.039  1.00 0.32 ? 58 VAL A CA   2  
ATOM 3090  C C    . VAL A 1 58 ? 16.372  11.764  -3.123  1.00 0.32 ? 58 VAL A C    2  
ATOM 3091  O O    . VAL A 1 58 ? 15.681  12.120  -4.057  1.00 0.32 ? 58 VAL A O    2  
ATOM 3092  C CB   . VAL A 1 58 ? 16.494  9.703   -1.717  1.00 0.32 ? 58 VAL A CB   2  
ATOM 3093  C CG1  . VAL A 1 58 ? 14.979  9.833   -1.554  1.00 0.32 ? 58 VAL A CG1  2  
ATOM 3094  C CG2  . VAL A 1 58 ? 16.880  8.222   -1.718  1.00 0.32 ? 58 VAL A CG2  2  
ATOM 3095  H H    . VAL A 1 58 ? 18.949  10.022  -2.378  1.00 0.32 ? 58 VAL A H    2  
ATOM 3096  H HA   . VAL A 1 58 ? 16.538  9.756   -3.862  1.00 0.32 ? 58 VAL A HA   2  
ATOM 3097  H HB   . VAL A 1 58 ? 16.989  10.205  -0.898  1.00 0.32 ? 58 VAL A HB   2  
ATOM 3098  H HG11 . VAL A 1 58 ? 14.533  10.069  -2.508  1.00 0.32 ? 58 VAL A HG11 2  
ATOM 3099  H HG12 . VAL A 1 58 ? 14.574  8.901   -1.189  1.00 0.32 ? 58 VAL A HG12 2  
ATOM 3100  H HG13 . VAL A 1 58 ? 14.760  10.621  -0.848  1.00 0.32 ? 58 VAL A HG13 2  
ATOM 3101  H HG21 . VAL A 1 58 ? 17.924  8.121   -1.975  1.00 0.32 ? 58 VAL A HG21 2  
ATOM 3102  H HG22 . VAL A 1 58 ? 16.709  7.805   -0.736  1.00 0.32 ? 58 VAL A HG22 2  
ATOM 3103  H HG23 . VAL A 1 58 ? 16.279  7.694   -2.443  1.00 0.32 ? 58 VAL A HG23 2  
ATOM 3104  N N    . ARG A 1 59 ? 16.677  12.586  -2.155  1.00 0.34 ? 59 ARG A N    2  
ATOM 3105  C CA   . ARG A 1 59 ? 16.175  13.987  -2.185  1.00 0.34 ? 59 ARG A CA   2  
ATOM 3106  C C    . ARG A 1 59 ? 16.659  14.667  -3.466  1.00 0.34 ? 59 ARG A C    2  
ATOM 3107  O O    . ARG A 1 59 ? 16.141  15.688  -3.874  1.00 0.34 ? 59 ARG A O    2  
ATOM 3108  C CB   . ARG A 1 59 ? 16.708  14.748  -0.969  1.00 0.34 ? 59 ARG A CB   2  
ATOM 3109  C CG   . ARG A 1 59 ? 16.183  16.184  -0.992  1.00 0.34 ? 59 ARG A CG   2  
ATOM 3110  C CD   . ARG A 1 59 ? 17.354  17.158  -0.862  1.00 0.34 ? 59 ARG A CD   2  
ATOM 3111  N NE   . ARG A 1 59 ? 17.264  18.191  -1.933  1.00 0.34 ? 59 ARG A NE   2  
ATOM 3112  C CZ   . ARG A 1 59 ? 18.150  19.147  -1.993  1.00 0.34 ? 59 ARG A CZ   2  
ATOM 3113  N NH1  . ARG A 1 59 ? 18.227  20.028  -1.034  1.00 0.34 ? 59 ARG A NH1  2  
ATOM 3114  N NH2  . ARG A 1 59 ? 18.960  19.223  -3.014  1.00 0.34 ? 59 ARG A NH2  2  
ATOM 3115  H H    . ARG A 1 59 ? 17.239  12.281  -1.412  1.00 0.34 ? 59 ARG A H    2  
ATOM 3116  H HA   . ARG A 1 59 ? 15.095  13.984  -2.163  1.00 0.34 ? 59 ARG A HA   2  
ATOM 3117  H HB2  . ARG A 1 59 ? 16.377  14.257  -0.064  1.00 0.34 ? 59 ARG A HB2  2  
ATOM 3118  H HB3  . ARG A 1 59 ? 17.787  14.760  -0.997  1.00 0.34 ? 59 ARG A HB3  2  
ATOM 3119  H HG2  . ARG A 1 59 ? 15.667  16.363  -1.925  1.00 0.34 ? 59 ARG A HG2  2  
ATOM 3120  H HG3  . ARG A 1 59 ? 15.500  16.332  -0.169  1.00 0.34 ? 59 ARG A HG3  2  
ATOM 3121  H HD2  . ARG A 1 59 ? 17.317  17.639  0.105   1.00 0.34 ? 59 ARG A HD2  2  
ATOM 3122  H HD3  . ARG A 1 59 ? 18.285  16.619  -0.960  1.00 0.34 ? 59 ARG A HD3  2  
ATOM 3123  H HE   . ARG A 1 59 ? 16.540  18.152  -2.591  1.00 0.34 ? 59 ARG A HE   2  
ATOM 3124  H HH11 . ARG A 1 59 ? 17.606  19.970  -0.251  1.00 0.34 ? 59 ARG A HH11 2  
ATOM 3125  H HH12 . ARG A 1 59 ? 18.905  20.761  -1.080  1.00 0.34 ? 59 ARG A HH12 2  
ATOM 3126  H HH21 . ARG A 1 59 ? 18.902  18.548  -3.749  1.00 0.34 ? 59 ARG A HH21 2  
ATOM 3127  H HH22 . ARG A 1 59 ? 19.638  19.955  -3.061  1.00 0.34 ? 59 ARG A HH22 2  
ATOM 3128  N N    . GLU A 1 60 ? 17.648  14.106  -4.106  1.00 0.37 ? 60 GLU A N    2  
ATOM 3129  C CA   . GLU A 1 60 ? 18.166  14.715  -5.362  1.00 0.37 ? 60 GLU A CA   2  
ATOM 3130  C C    . GLU A 1 60 ? 17.153  14.490  -6.487  1.00 0.37 ? 60 GLU A C    2  
ATOM 3131  O O    . GLU A 1 60 ? 16.844  15.386  -7.246  1.00 0.37 ? 60 GLU A O    2  
ATOM 3132  C CB   . GLU A 1 60 ? 19.499  14.060  -5.734  1.00 0.37 ? 60 GLU A CB   2  
ATOM 3133  C CG   . GLU A 1 60 ? 20.652  14.912  -5.202  1.00 0.37 ? 60 GLU A CG   2  
ATOM 3134  C CD   . GLU A 1 60 ? 21.982  14.327  -5.681  1.00 0.37 ? 60 GLU A CD   2  
ATOM 3135  O OE1  . GLU A 1 60 ? 22.058  13.117  -5.825  1.00 0.37 ? 60 GLU A OE1  2  
ATOM 3136  O OE2  . GLU A 1 60 ? 22.902  15.098  -5.897  1.00 0.37 ? 60 GLU A OE2  2  
ATOM 3137  H H    . GLU A 1 60 ? 18.050  13.281  -3.759  1.00 0.37 ? 60 GLU A H    2  
ATOM 3138  H HA   . GLU A 1 60 ? 18.313  15.774  -5.215  1.00 0.37 ? 60 GLU A HA   2  
ATOM 3139  H HB2  . GLU A 1 60 ? 19.548  13.073  -5.299  1.00 0.37 ? 60 GLU A HB2  2  
ATOM 3140  H HB3  . GLU A 1 60 ? 19.576  13.984  -6.808  1.00 0.37 ? 60 GLU A HB3  2  
ATOM 3141  H HG2  . GLU A 1 60 ? 20.551  15.923  -5.568  1.00 0.37 ? 60 GLU A HG2  2  
ATOM 3142  H HG3  . GLU A 1 60 ? 20.630  14.914  -4.123  1.00 0.37 ? 60 GLU A HG3  2  
ATOM 3143  N N    . TYR A 1 61 ? 16.634  13.297  -6.598  1.00 0.36 ? 61 TYR A N    2  
ATOM 3144  C CA   . TYR A 1 61 ? 15.639  13.013  -7.670  1.00 0.36 ? 61 TYR A CA   2  
ATOM 3145  C C    . TYR A 1 61 ? 14.343  13.768  -7.373  1.00 0.36 ? 61 TYR A C    2  
ATOM 3146  O O    . TYR A 1 61 ? 13.734  14.347  -8.251  1.00 0.36 ? 61 TYR A O    2  
ATOM 3147  C CB   . TYR A 1 61 ? 15.355  11.509  -7.717  1.00 0.36 ? 61 TYR A CB   2  
ATOM 3148  C CG   . TYR A 1 61 ? 16.459  10.797  -8.472  1.00 0.36 ? 61 TYR A CG   2  
ATOM 3149  C CD1  . TYR A 1 61 ? 17.697  11.423  -8.671  1.00 0.36 ? 61 TYR A CD1  2  
ATOM 3150  C CD2  . TYR A 1 61 ? 16.240  9.508   -8.970  1.00 0.36 ? 61 TYR A CD2  2  
ATOM 3151  C CE1  . TYR A 1 61 ? 18.713  10.759  -9.367  1.00 0.36 ? 61 TYR A CE1  2  
ATOM 3152  C CE2  . TYR A 1 61 ? 17.258  8.844   -9.667  1.00 0.36 ? 61 TYR A CE2  2  
ATOM 3153  C CZ   . TYR A 1 61 ? 18.494  9.471   -9.866  1.00 0.36 ? 61 TYR A CZ   2  
ATOM 3154  O OH   . TYR A 1 61 ? 19.495  8.816   -10.553 1.00 0.36 ? 61 TYR A OH   2  
ATOM 3155  H H    . TYR A 1 61 ? 16.896  12.588  -5.974  1.00 0.36 ? 61 TYR A H    2  
ATOM 3156  H HA   . TYR A 1 61 ? 16.034  13.336  -8.623  1.00 0.36 ? 61 TYR A HA   2  
ATOM 3157  H HB2  . TYR A 1 61 ? 15.303  11.123  -6.710  1.00 0.36 ? 61 TYR A HB2  2  
ATOM 3158  H HB3  . TYR A 1 61 ? 14.412  11.338  -8.217  1.00 0.36 ? 61 TYR A HB3  2  
ATOM 3159  H HD1  . TYR A 1 61 ? 17.866  12.419  -8.286  1.00 0.36 ? 61 TYR A HD1  2  
ATOM 3160  H HD2  . TYR A 1 61 ? 15.287  9.023   -8.817  1.00 0.36 ? 61 TYR A HD2  2  
ATOM 3161  H HE1  . TYR A 1 61 ? 19.666  11.243  -9.521  1.00 0.36 ? 61 TYR A HE1  2  
ATOM 3162  H HE2  . TYR A 1 61 ? 17.089  7.849   -10.052 1.00 0.36 ? 61 TYR A HE2  2  
ATOM 3163  H HH   . TYR A 1 61 ? 19.135  8.521   -11.392 1.00 0.36 ? 61 TYR A HH   2  
ATOM 3164  N N    . ILE A 1 62 ? 13.914  13.764  -6.140  1.00 0.38 ? 62 ILE A N    2  
ATOM 3165  C CA   . ILE A 1 62 ? 12.657  14.482  -5.787  1.00 0.38 ? 62 ILE A CA   2  
ATOM 3166  C C    . ILE A 1 62 ? 12.820  15.973  -6.091  1.00 0.38 ? 62 ILE A C    2  
ATOM 3167  O O    . ILE A 1 62 ? 11.933  16.609  -6.623  1.00 0.38 ? 62 ILE A O    2  
ATOM 3168  C CB   . ILE A 1 62 ? 12.363  14.294  -4.298  1.00 0.38 ? 62 ILE A CB   2  
ATOM 3169  C CG1  . ILE A 1 62 ? 12.071  12.817  -4.021  1.00 0.38 ? 62 ILE A CG1  2  
ATOM 3170  C CG2  . ILE A 1 62 ? 11.146  15.134  -3.906  1.00 0.38 ? 62 ILE A CG2  2  
ATOM 3171  C CD1  . ILE A 1 62 ? 12.872  12.358  -2.801  1.00 0.38 ? 62 ILE A CD1  2  
ATOM 3172  H H    . ILE A 1 62 ? 14.420  13.291  -5.446  1.00 0.38 ? 62 ILE A H    2  
ATOM 3173  H HA   . ILE A 1 62 ? 11.839  14.083  -6.370  1.00 0.38 ? 62 ILE A HA   2  
ATOM 3174  H HB   . ILE A 1 62 ? 13.218  14.609  -3.719  1.00 0.38 ? 62 ILE A HB   2  
ATOM 3175  H HG12 . ILE A 1 62 ? 11.016  12.688  -3.829  1.00 0.38 ? 62 ILE A HG12 2  
ATOM 3176  H HG13 . ILE A 1 62 ? 12.356  12.226  -4.878  1.00 0.38 ? 62 ILE A HG13 2  
ATOM 3177  H HG21 . ILE A 1 62 ? 10.964  15.879  -4.667  1.00 0.38 ? 62 ILE A HG21 2  
ATOM 3178  H HG22 . ILE A 1 62 ? 10.281  14.494  -3.815  1.00 0.38 ? 62 ILE A HG22 2  
ATOM 3179  H HG23 . ILE A 1 62 ? 11.334  15.621  -2.961  1.00 0.38 ? 62 ILE A HG23 2  
ATOM 3180  H HD11 . ILE A 1 62 ? 13.408  13.198  -2.386  1.00 0.38 ? 62 ILE A HD11 2  
ATOM 3181  H HD12 . ILE A 1 62 ? 12.198  11.959  -2.057  1.00 0.38 ? 62 ILE A HD12 2  
ATOM 3182  H HD13 . ILE A 1 62 ? 13.574  11.594  -3.097  1.00 0.38 ? 62 ILE A HD13 2  
ATOM 3183  N N    . ASN A 1 63 ? 13.950  16.536  -5.757  1.00 0.49 ? 63 ASN A N    2  
ATOM 3184  C CA   . ASN A 1 63 ? 14.169  17.985  -6.028  1.00 0.49 ? 63 ASN A CA   2  
ATOM 3185  C C    . ASN A 1 63 ? 14.435  18.189  -7.521  1.00 0.49 ? 63 ASN A C    2  
ATOM 3186  O O    . ASN A 1 63 ? 14.306  19.279  -8.041  1.00 0.49 ? 63 ASN A O    2  
ATOM 3187  C CB   . ASN A 1 63 ? 15.373  18.478  -5.224  1.00 0.49 ? 63 ASN A CB   2  
ATOM 3188  C CG   . ASN A 1 63 ? 15.772  19.874  -5.706  1.00 0.49 ? 63 ASN A CG   2  
ATOM 3189  O OD1  . ASN A 1 63 ? 15.079  20.838  -5.450  1.00 0.49 ? 63 ASN A OD1  2  
ATOM 3190  N ND2  . ASN A 1 63 ? 16.869  20.023  -6.398  1.00 0.49 ? 63 ASN A ND2  2  
ATOM 3191  H H    . ASN A 1 63 ? 14.655  16.006  -5.329  1.00 0.49 ? 63 ASN A H    2  
ATOM 3192  H HA   . ASN A 1 63 ? 13.289  18.542  -5.739  1.00 0.49 ? 63 ASN A HA   2  
ATOM 3193  H HB2  . ASN A 1 63 ? 15.113  18.518  -4.176  1.00 0.49 ? 63 ASN A HB2  2  
ATOM 3194  H HB3  . ASN A 1 63 ? 16.202  17.800  -5.364  1.00 0.49 ? 63 ASN A HB3  2  
ATOM 3195  H HD21 . ASN A 1 63 ? 17.429  19.246  -6.603  1.00 0.49 ? 63 ASN A HD21 2  
ATOM 3196  H HD22 . ASN A 1 63 ? 17.132  20.914  -6.711  1.00 0.49 ? 63 ASN A HD22 2  
ATOM 3197  N N    . SER A 1 64 ? 14.805  17.147  -8.215  1.00 0.55 ? 64 SER A N    2  
ATOM 3198  C CA   . SER A 1 64 ? 15.078  17.282  -9.673  1.00 0.55 ? 64 SER A CA   2  
ATOM 3199  C C    . SER A 1 64 ? 13.755  17.269  -10.443 1.00 0.55 ? 64 SER A C    2  
ATOM 3200  O O    . SER A 1 64 ? 13.624  17.886  -11.481 1.00 0.55 ? 64 SER A O    2  
ATOM 3201  C CB   . SER A 1 64 ? 15.950  16.116  -10.139 1.00 0.55 ? 64 SER A CB   2  
ATOM 3202  O OG   . SER A 1 64 ? 15.124  15.109  -10.711 1.00 0.55 ? 64 SER A OG   2  
ATOM 3203  H H    . SER A 1 64 ? 14.902  16.275  -7.777  1.00 0.55 ? 64 SER A H    2  
ATOM 3204  H HA   . SER A 1 64 ? 15.593  18.213  -9.858  1.00 0.55 ? 64 SER A HA   2  
ATOM 3205  H HB2  . SER A 1 64 ? 16.653  16.460  -10.878 1.00 0.55 ? 64 SER A HB2  2  
ATOM 3206  H HB3  . SER A 1 64 ? 16.492  15.713  -9.293  1.00 0.55 ? 64 SER A HB3  2  
ATOM 3207  H HG   . SER A 1 64 ? 14.350  15.009  -10.152 1.00 0.55 ? 64 SER A HG   2  
ATOM 3208  N N    . LEU A 1 65 ? 12.774  16.572  -9.941  1.00 0.53 ? 65 LEU A N    2  
ATOM 3209  C CA   . LEU A 1 65 ? 11.461  16.519  -10.644 1.00 0.53 ? 65 LEU A CA   2  
ATOM 3210  C C    . LEU A 1 65 ? 10.627  17.743  -10.257 1.00 0.53 ? 65 LEU A C    2  
ATOM 3211  O O    . LEU A 1 65 ? 9.900   18.290  -11.062 1.00 0.53 ? 65 LEU A O    2  
ATOM 3212  C CB   . LEU A 1 65 ? 10.716  15.245  -10.239 1.00 0.53 ? 65 LEU A CB   2  
ATOM 3213  C CG   . LEU A 1 65 ? 10.363  14.441  -11.491 1.00 0.53 ? 65 LEU A CG   2  
ATOM 3214  C CD1  . LEU A 1 65 ? 11.471  13.427  -11.776 1.00 0.53 ? 65 LEU A CD1  2  
ATOM 3215  C CD2  . LEU A 1 65 ? 9.042   13.702  -11.264 1.00 0.53 ? 65 LEU A CD2  2  
ATOM 3216  H H    . LEU A 1 65 ? 12.900  16.081  -9.102  1.00 0.53 ? 65 LEU A H    2  
ATOM 3217  H HA   . LEU A 1 65 ? 11.624  16.517  -11.712 1.00 0.53 ? 65 LEU A HA   2  
ATOM 3218  H HB2  . LEU A 1 65 ? 11.346  14.651  -9.594  1.00 0.53 ? 65 LEU A HB2  2  
ATOM 3219  H HB3  . LEU A 1 65 ? 9.809   15.509  -9.715  1.00 0.53 ? 65 LEU A HB3  2  
ATOM 3220  H HG   . LEU A 1 65 ? 10.263  15.111  -12.332 1.00 0.53 ? 65 LEU A HG   2  
ATOM 3221  H HD11 . LEU A 1 65 ? 12.415  13.942  -11.868 1.00 0.53 ? 65 LEU A HD11 2  
ATOM 3222  H HD12 . LEU A 1 65 ? 11.526  12.715  -10.965 1.00 0.53 ? 65 LEU A HD12 2  
ATOM 3223  H HD13 . LEU A 1 65 ? 11.255  12.906  -12.698 1.00 0.53 ? 65 LEU A HD13 2  
ATOM 3224  H HD21 . LEU A 1 65 ? 8.679   13.910  -10.269 1.00 0.53 ? 65 LEU A HD21 2  
ATOM 3225  H HD22 . LEU A 1 65 ? 8.314   14.034  -11.990 1.00 0.53 ? 65 LEU A HD22 2  
ATOM 3226  H HD23 . LEU A 1 65 ? 9.201   12.639  -11.375 1.00 0.53 ? 65 LEU A HD23 2  
ATOM 3227  N N    . GLU A 1 66 ? 10.727  18.176  -9.030  1.00 0.61 ? 66 GLU A N    2  
ATOM 3228  C CA   . GLU A 1 66 ? 9.941   19.363  -8.592  1.00 0.61 ? 66 GLU A CA   2  
ATOM 3229  C C    . GLU A 1 66 ? 10.759  20.633  -8.836  1.00 0.61 ? 66 GLU A C    2  
ATOM 3230  O O    . GLU A 1 66 ? 11.533  20.714  -9.769  1.00 0.61 ? 66 GLU A O    2  
ATOM 3231  C CB   . GLU A 1 66 ? 9.619   19.239  -7.102  1.00 0.61 ? 66 GLU A CB   2  
ATOM 3232  C CG   . GLU A 1 66 ? 8.948   17.890  -6.834  1.00 0.61 ? 66 GLU A CG   2  
ATOM 3233  C CD   . GLU A 1 66 ? 7.506   17.928  -7.343  1.00 0.61 ? 66 GLU A CD   2  
ATOM 3234  O OE1  . GLU A 1 66 ? 6.655   18.416  -6.618  1.00 0.61 ? 66 GLU A OE1  2  
ATOM 3235  O OE2  . GLU A 1 66 ? 7.277   17.467  -8.450  1.00 0.61 ? 66 GLU A OE2  2  
ATOM 3236  H H    . GLU A 1 66 ? 11.319  17.721  -8.396  1.00 0.61 ? 66 GLU A H    2  
ATOM 3237  H HA   . GLU A 1 66 ? 9.021   19.413  -9.156  1.00 0.61 ? 66 GLU A HA   2  
ATOM 3238  H HB2  . GLU A 1 66 ? 10.533  19.306  -6.529  1.00 0.61 ? 66 GLU A HB2  2  
ATOM 3239  H HB3  . GLU A 1 66 ? 8.952   20.035  -6.809  1.00 0.61 ? 66 GLU A HB3  2  
ATOM 3240  H HG2  . GLU A 1 66 ? 9.492   17.110  -7.346  1.00 0.61 ? 66 GLU A HG2  2  
ATOM 3241  H HG3  . GLU A 1 66 ? 8.947   17.692  -5.772  1.00 0.61 ? 66 GLU A HG3  2  
ATOM 3242  N N    . MET A 1 67 ? 10.596  21.627  -8.005  1.00 1.45 ? 67 MET A N    2  
ATOM 3243  C CA   . MET A 1 67 ? 11.365  22.889  -8.193  1.00 1.45 ? 67 MET A CA   2  
ATOM 3244  C C    . MET A 1 67 ? 12.859  22.568  -8.282  1.00 1.45 ? 67 MET A C    2  
ATOM 3245  O O    . MET A 1 67 ? 13.282  21.460  -8.019  1.00 1.45 ? 67 MET A O    2  
ATOM 3246  C CB   . MET A 1 67 ? 11.114  23.821  -7.007  1.00 1.45 ? 67 MET A CB   2  
ATOM 3247  C CG   . MET A 1 67 ? 10.762  25.218  -7.519  1.00 1.45 ? 67 MET A CG   2  
ATOM 3248  S SD   . MET A 1 67 ? 11.513  26.464  -6.442  1.00 1.45 ? 67 MET A SD   2  
ATOM 3249  C CE   . MET A 1 67 ? 12.953  26.821  -7.480  1.00 1.45 ? 67 MET A CE   2  
ATOM 3250  H H    . MET A 1 67 ? 9.967   21.543  -7.259  1.00 1.45 ? 67 MET A H    2  
ATOM 3251  H HA   . MET A 1 67 ? 11.047  23.373  -9.105  1.00 1.45 ? 67 MET A HA   2  
ATOM 3252  H HB2  . MET A 1 67 ? 10.296  23.436  -6.414  1.00 1.45 ? 67 MET A HB2  2  
ATOM 3253  H HB3  . MET A 1 67 ? 12.004  23.877  -6.398  1.00 1.45 ? 67 MET A HB3  2  
ATOM 3254  H HG2  . MET A 1 67 ? 11.137  25.338  -8.524  1.00 1.45 ? 67 MET A HG2  2  
ATOM 3255  H HG3  . MET A 1 67 ? 9.689   25.342  -7.518  1.00 1.45 ? 67 MET A HG3  2  
ATOM 3256  H HE1  . MET A 1 67 ? 12.632  26.959  -8.503  1.00 1.45 ? 67 MET A HE1  2  
ATOM 3257  H HE2  . MET A 1 67 ? 13.434  27.722  -7.132  1.00 1.45 ? 67 MET A HE2  2  
ATOM 3258  H HE3  . MET A 1 67 ? 13.650  25.997  -7.423  1.00 1.45 ? 67 MET A HE3  2  
ATOM 3259  N N    . SER A 1 68 ? 13.661  23.528  -8.651  1.00 2.84 ? 68 SER A N    2  
ATOM 3260  C CA   . SER A 1 68 ? 15.126  23.277  -8.756  1.00 2.84 ? 68 SER A CA   2  
ATOM 3261  C C    . SER A 1 68 ? 15.877  24.248  -7.842  1.00 2.84 ? 68 SER A C    2  
ATOM 3262  O O    . SER A 1 68 ? 17.020  24.549  -8.142  1.00 2.84 ? 68 SER A O    2  
ATOM 3263  C CB   . SER A 1 68 ? 15.577  23.488  -10.202 1.00 2.84 ? 68 SER A CB   2  
ATOM 3264  O OG   . SER A 1 68 ? 14.821  24.544  -10.780 1.00 2.84 ? 68 SER A OG   2  
ATOM 3265  O OXT  . SER A 1 68 ? 15.295  24.673  -6.858  1.00 2.84 ? 68 SER A OXT  2  
ATOM 3266  H H    . SER A 1 68 ? 13.299  24.416  -8.860  1.00 2.84 ? 68 SER A H    2  
ATOM 3267  H HA   . SER A 1 68 ? 15.339  22.262  -8.457  1.00 2.84 ? 68 SER A HA   2  
ATOM 3268  H HB2  . SER A 1 68 ? 16.622  23.748  -10.221 1.00 2.84 ? 68 SER A HB2  2  
ATOM 3269  H HB3  . SER A 1 68 ? 15.426  22.574  -10.762 1.00 2.84 ? 68 SER A HB3  2  
ATOM 3270  H HG   . SER A 1 68 ? 15.360  25.337  -10.768 1.00 2.84 ? 68 SER A HG   2  
ATOM 3271  N N    . SER B 1 1  ? 17.427  -5.873  -2.630  1.00 5.93 ? 1  SER B N    2  
ATOM 3272  C CA   . SER B 1 1  ? 16.754  -5.651  -1.319  1.00 5.93 ? 1  SER B CA   2  
ATOM 3273  C C    . SER B 1 1  ? 16.539  -6.997  -0.620  1.00 5.93 ? 1  SER B C    2  
ATOM 3274  O O    . SER B 1 1  ? 16.509  -8.029  -1.261  1.00 5.93 ? 1  SER B O    2  
ATOM 3275  C CB   . SER B 1 1  ? 15.402  -4.974  -1.549  1.00 5.93 ? 1  SER B CB   2  
ATOM 3276  O OG   . SER B 1 1  ? 15.613  -3.615  -1.906  1.00 5.93 ? 1  SER B OG   2  
ATOM 3277  H H1   . SER B 1 1  ? 17.697  -6.874  -2.716  1.00 5.93 ? 1  SER B H1   2  
ATOM 3278  H H2   . SER B 1 1  ? 16.777  -5.624  -3.402  1.00 5.93 ? 1  SER B H2   2  
ATOM 3279  H H3   . SER B 1 1  ? 18.279  -5.278  -2.687  1.00 5.93 ? 1  SER B H3   2  
ATOM 3280  H HA   . SER B 1 1  ? 17.372  -5.018  -0.700  1.00 5.93 ? 1  SER B HA   2  
ATOM 3281  H HB2  . SER B 1 1  ? 14.879  -5.473  -2.349  1.00 5.93 ? 1  SER B HB2  2  
ATOM 3282  H HB3  . SER B 1 1  ? 14.813  -5.034  -0.644  1.00 5.93 ? 1  SER B HB3  2  
ATOM 3283  H HG   . SER B 1 1  ? 14.753  -3.202  -2.020  1.00 5.93 ? 1  SER B HG   2  
ATOM 3284  N N    . PRO B 1 2  ? 16.396  -6.942  0.680   1.00 3.89 ? 2  PRO B N    2  
ATOM 3285  C CA   . PRO B 1 2  ? 16.180  -8.143  1.506   1.00 3.89 ? 2  PRO B CA   2  
ATOM 3286  C C    . PRO B 1 2  ? 14.726  -8.609  1.402   1.00 3.89 ? 2  PRO B C    2  
ATOM 3287  O O    . PRO B 1 2  ? 14.451  -9.761  1.130   1.00 3.89 ? 2  PRO B O    2  
ATOM 3288  C CB   . PRO B 1 2  ? 16.501  -7.663  2.924   1.00 3.89 ? 2  PRO B CB   2  
ATOM 3289  C CG   . PRO B 1 2  ? 16.327  -6.126  2.915   1.00 3.89 ? 2  PRO B CG   2  
ATOM 3290  C CD   . PRO B 1 2  ? 16.434  -5.679  1.444   1.00 3.89 ? 2  PRO B CD   2  
ATOM 3291  H HA   . PRO B 1 2  ? 16.857  -8.931  1.220   1.00 3.89 ? 2  PRO B HA   2  
ATOM 3292  H HB2  . PRO B 1 2  ? 15.817  -8.114  3.630   1.00 3.89 ? 2  PRO B HB2  2  
ATOM 3293  H HB3  . PRO B 1 2  ? 17.519  -7.912  3.180   1.00 3.89 ? 2  PRO B HB3  2  
ATOM 3294  H HG2  . PRO B 1 2  ? 15.357  -5.862  3.316   1.00 3.89 ? 2  PRO B HG2  2  
ATOM 3295  H HG3  . PRO B 1 2  ? 17.108  -5.660  3.495   1.00 3.89 ? 2  PRO B HG3  2  
ATOM 3296  H HD2  . PRO B 1 2  ? 15.597  -5.047  1.181   1.00 3.89 ? 2  PRO B HD2  2  
ATOM 3297  H HD3  . PRO B 1 2  ? 17.367  -5.167  1.271   1.00 3.89 ? 2  PRO B HD3  2  
ATOM 3298  N N    . TYR B 1 3  ? 13.792  -7.723  1.617   1.00 2.56 ? 3  TYR B N    2  
ATOM 3299  C CA   . TYR B 1 3  ? 12.357  -8.117  1.530   1.00 2.56 ? 3  TYR B CA   2  
ATOM 3300  C C    . TYR B 1 3  ? 11.782  -7.655  0.190   1.00 2.56 ? 3  TYR B C    2  
ATOM 3301  O O    . TYR B 1 3  ? 11.584  -8.442  -0.716  1.00 2.56 ? 3  TYR B O    2  
ATOM 3302  C CB   . TYR B 1 3  ? 11.579  -7.461  2.673   1.00 2.56 ? 3  TYR B CB   2  
ATOM 3303  C CG   . TYR B 1 3  ? 11.605  -8.362  3.884   1.00 2.56 ? 3  TYR B CG   2  
ATOM 3304  C CD1  . TYR B 1 3  ? 12.828  -8.804  4.401   1.00 2.56 ? 3  TYR B CD1  2  
ATOM 3305  C CD2  . TYR B 1 3  ? 10.406  -8.758  4.488   1.00 2.56 ? 3  TYR B CD2  2  
ATOM 3306  C CE1  . TYR B 1 3  ? 12.853  -9.640  5.523   1.00 2.56 ? 3  TYR B CE1  2  
ATOM 3307  C CE2  . TYR B 1 3  ? 10.429  -9.593  5.611   1.00 2.56 ? 3  TYR B CE2  2  
ATOM 3308  C CZ   . TYR B 1 3  ? 11.653  -10.035 6.128   1.00 2.56 ? 3  TYR B CZ   2  
ATOM 3309  O OH   . TYR B 1 3  ? 11.677  -10.859 7.235   1.00 2.56 ? 3  TYR B OH   2  
ATOM 3310  H H    . TYR B 1 3  ? 14.034  -6.799  1.834   1.00 2.56 ? 3  TYR B H    2  
ATOM 3311  H HA   . TYR B 1 3  ? 12.273  -9.191  1.607   1.00 2.56 ? 3  TYR B HA   2  
ATOM 3312  H HB2  . TYR B 1 3  ? 12.033  -6.513  2.919   1.00 2.56 ? 3  TYR B HB2  2  
ATOM 3313  H HB3  . TYR B 1 3  ? 10.555  -7.301  2.366   1.00 2.56 ? 3  TYR B HB3  2  
ATOM 3314  H HD1  . TYR B 1 3  ? 13.753  -8.500  3.934   1.00 2.56 ? 3  TYR B HD1  2  
ATOM 3315  H HD2  . TYR B 1 3  ? 9.462   -8.417  4.089   1.00 2.56 ? 3  TYR B HD2  2  
ATOM 3316  H HE1  . TYR B 1 3  ? 13.797  -9.980  5.923   1.00 2.56 ? 3  TYR B HE1  2  
ATOM 3317  H HE2  . TYR B 1 3  ? 9.505   -9.898  6.078   1.00 2.56 ? 3  TYR B HE2  2  
ATOM 3318  H HH   . TYR B 1 3  ? 12.239  -11.611 7.033   1.00 2.56 ? 3  TYR B HH   2  
ATOM 3319  N N    . SER B 1 4  ? 11.511  -6.386  0.056   1.00 0.96 ? 4  SER B N    2  
ATOM 3320  C CA   . SER B 1 4  ? 10.948  -5.876  -1.226  1.00 0.96 ? 4  SER B CA   2  
ATOM 3321  C C    . SER B 1 4  ? 10.996  -4.346  -1.230  1.00 0.96 ? 4  SER B C    2  
ATOM 3322  O O    . SER B 1 4  ? 10.702  -3.703  -0.242  1.00 0.96 ? 4  SER B O    2  
ATOM 3323  C CB   . SER B 1 4  ? 9.499   -6.341  -1.368  1.00 0.96 ? 4  SER B CB   2  
ATOM 3324  O OG   . SER B 1 4  ? 9.390   -7.200  -2.496  1.00 0.96 ? 4  SER B OG   2  
ATOM 3325  H H    . SER B 1 4  ? 11.678  -5.768  0.798   1.00 0.96 ? 4  SER B H    2  
ATOM 3326  H HA   . SER B 1 4  ? 11.531  -6.256  -2.052  1.00 0.96 ? 4  SER B HA   2  
ATOM 3327  H HB2  . SER B 1 4  ? 9.203   -6.879  -0.483  1.00 0.96 ? 4  SER B HB2  2  
ATOM 3328  H HB3  . SER B 1 4  ? 8.856   -5.480  -1.494  1.00 0.96 ? 4  SER B HB3  2  
ATOM 3329  H HG   . SER B 1 4  ? 8.723   -6.836  -3.082  1.00 0.96 ? 4  SER B HG   2  
ATOM 3330  N N    . SER B 1 5  ? 11.363  -3.757  -2.336  1.00 0.48 ? 5  SER B N    2  
ATOM 3331  C CA   . SER B 1 5  ? 11.429  -2.271  -2.402  1.00 0.48 ? 5  SER B CA   2  
ATOM 3332  C C    . SER B 1 5  ? 10.285  -1.747  -3.273  1.00 0.48 ? 5  SER B C    2  
ATOM 3333  O O    . SER B 1 5  ? 10.403  -0.728  -3.923  1.00 0.48 ? 5  SER B O    2  
ATOM 3334  C CB   . SER B 1 5  ? 12.766  -1.847  -3.008  1.00 0.48 ? 5  SER B CB   2  
ATOM 3335  O OG   . SER B 1 5  ? 13.177  -2.814  -3.966  1.00 0.48 ? 5  SER B OG   2  
ATOM 3336  H H    . SER B 1 5  ? 11.596  -4.294  -3.122  1.00 0.48 ? 5  SER B H    2  
ATOM 3337  H HA   . SER B 1 5  ? 11.339  -1.861  -1.407  1.00 0.48 ? 5  SER B HA   2  
ATOM 3338  H HB2  . SER B 1 5  ? 12.658  -0.891  -3.494  1.00 0.48 ? 5  SER B HB2  2  
ATOM 3339  H HB3  . SER B 1 5  ? 13.507  -1.766  -2.222  1.00 0.48 ? 5  SER B HB3  2  
ATOM 3340  H HG   . SER B 1 5  ? 12.393  -3.135  -4.417  1.00 0.48 ? 5  SER B HG   2  
ATOM 3341  N N    . ASP B 1 6  ? 9.178   -2.438  -3.294  1.00 0.37 ? 6  ASP B N    2  
ATOM 3342  C CA   . ASP B 1 6  ? 8.029   -1.979  -4.123  1.00 0.37 ? 6  ASP B CA   2  
ATOM 3343  C C    . ASP B 1 6  ? 6.831   -1.686  -3.218  1.00 0.37 ? 6  ASP B C    2  
ATOM 3344  O O    . ASP B 1 6  ? 6.547   -2.418  -2.291  1.00 0.37 ? 6  ASP B O    2  
ATOM 3345  C CB   . ASP B 1 6  ? 7.654   -3.073  -5.126  1.00 0.37 ? 6  ASP B CB   2  
ATOM 3346  C CG   . ASP B 1 6  ? 8.923   -3.619  -5.784  1.00 0.37 ? 6  ASP B CG   2  
ATOM 3347  O OD1  . ASP B 1 6  ? 9.567   -4.459  -5.178  1.00 0.37 ? 6  ASP B OD1  2  
ATOM 3348  O OD2  . ASP B 1 6  ? 9.229   -3.187  -6.883  1.00 0.37 ? 6  ASP B OD2  2  
ATOM 3349  H H    . ASP B 1 6  ? 9.103   -3.258  -2.763  1.00 0.37 ? 6  ASP B H    2  
ATOM 3350  H HA   . ASP B 1 6  ? 8.306   -1.082  -4.656  1.00 0.37 ? 6  ASP B HA   2  
ATOM 3351  H HB2  . ASP B 1 6  ? 7.142   -3.873  -4.610  1.00 0.37 ? 6  ASP B HB2  2  
ATOM 3352  H HB3  . ASP B 1 6  ? 7.007   -2.660  -5.884  1.00 0.37 ? 6  ASP B HB3  2  
ATOM 3353  N N    . THR B 1 7  ? 6.126   -0.620  -3.478  1.00 0.35 ? 7  THR B N    2  
ATOM 3354  C CA   . THR B 1 7  ? 4.947   -0.280  -2.634  1.00 0.35 ? 7  THR B CA   2  
ATOM 3355  C C    . THR B 1 7  ? 4.123   -1.542  -2.375  1.00 0.35 ? 7  THR B C    2  
ATOM 3356  O O    . THR B 1 7  ? 4.275   -2.543  -3.048  1.00 0.35 ? 7  THR B O    2  
ATOM 3357  C CB   . THR B 1 7  ? 4.082   0.756   -3.356  1.00 0.35 ? 7  THR B CB   2  
ATOM 3358  O OG1  . THR B 1 7  ? 4.030   0.442   -4.740  1.00 0.35 ? 7  THR B OG1  2  
ATOM 3359  C CG2  . THR B 1 7  ? 4.685   2.148   -3.169  1.00 0.35 ? 7  THR B CG2  2  
ATOM 3360  H H    . THR B 1 7  ? 6.372   -0.041  -4.232  1.00 0.35 ? 7  THR B H    2  
ATOM 3361  H HA   . THR B 1 7  ? 5.285   0.128   -1.692  1.00 0.35 ? 7  THR B HA   2  
ATOM 3362  H HB   . THR B 1 7  ? 3.085   0.742   -2.945  1.00 0.35 ? 7  THR B HB   2  
ATOM 3363  H HG1  . THR B 1 7  ? 3.219   -0.046  -4.904  1.00 0.35 ? 7  THR B HG1  2  
ATOM 3364  H HG21 . THR B 1 7  ? 5.686   2.165   -3.575  1.00 0.35 ? 7  THR B HG21 2  
ATOM 3365  H HG22 . THR B 1 7  ? 4.076   2.876   -3.683  1.00 0.35 ? 7  THR B HG22 2  
ATOM 3366  H HG23 . THR B 1 7  ? 4.721   2.387   -2.116  1.00 0.35 ? 7  THR B HG23 2  
ATOM 3367  N N    . THR B 1 8  ? 3.250   -1.505  -1.406  1.00 0.31 ? 8  THR B N    2  
ATOM 3368  C CA   . THR B 1 8  ? 2.417   -2.703  -1.106  1.00 0.31 ? 8  THR B CA   2  
ATOM 3369  C C    . THR B 1 8  ? 0.940   -2.369  -1.349  1.00 0.31 ? 8  THR B C    2  
ATOM 3370  O O    . THR B 1 8  ? 0.501   -1.274  -1.062  1.00 0.31 ? 8  THR B O    2  
ATOM 3371  C CB   . THR B 1 8  ? 2.614   -3.106  0.358   1.00 0.31 ? 8  THR B CB   2  
ATOM 3372  O OG1  . THR B 1 8  ? 3.947   -3.561  0.546   1.00 0.31 ? 8  THR B OG1  2  
ATOM 3373  C CG2  . THR B 1 8  ? 1.636   -4.225  0.723   1.00 0.31 ? 8  THR B CG2  2  
ATOM 3374  H H    . THR B 1 8  ? 3.143   -0.688  -0.875  1.00 0.31 ? 8  THR B H    2  
ATOM 3375  H HA   . THR B 1 8  ? 2.716   -3.518  -1.748  1.00 0.31 ? 8  THR B HA   2  
ATOM 3376  H HB   . THR B 1 8  ? 2.432   -2.253  0.994   1.00 0.31 ? 8  THR B HB   2  
ATOM 3377  H HG1  . THR B 1 8  ? 4.535   -2.810  0.435   1.00 0.31 ? 8  THR B HG1  2  
ATOM 3378  H HG21 . THR B 1 8  ? 0.669   -4.013  0.290   1.00 0.31 ? 8  THR B HG21 2  
ATOM 3379  H HG22 . THR B 1 8  ? 2.004   -5.164  0.339   1.00 0.31 ? 8  THR B HG22 2  
ATOM 3380  H HG23 . THR B 1 8  ? 1.545   -4.287  1.798   1.00 0.31 ? 8  THR B HG23 2  
ATOM 3381  N N    . PRO B 1 9  ? 0.217   -3.327  -1.874  1.00 0.34 ? 9  PRO B N    2  
ATOM 3382  C CA   . PRO B 1 9  ? -1.218  -3.165  -2.167  1.00 0.34 ? 9  PRO B CA   2  
ATOM 3383  C C    . PRO B 1 9  ? -2.040  -3.299  -0.883  1.00 0.34 ? 9  PRO B C    2  
ATOM 3384  O O    . PRO B 1 9  ? -2.700  -4.294  -0.658  1.00 0.34 ? 9  PRO B O    2  
ATOM 3385  C CB   . PRO B 1 9  ? -1.519  -4.316  -3.131  1.00 0.34 ? 9  PRO B CB   2  
ATOM 3386  C CG   . PRO B 1 9  ? -0.422  -5.382  -2.894  1.00 0.34 ? 9  PRO B CG   2  
ATOM 3387  C CD   . PRO B 1 9  ? 0.759   -4.658  -2.221  1.00 0.34 ? 9  PRO B CD   2  
ATOM 3388  H HA   . PRO B 1 9  ? -1.407  -2.221  -2.648  1.00 0.34 ? 9  PRO B HA   2  
ATOM 3389  H HB2  . PRO B 1 9  ? -2.496  -4.730  -2.920  1.00 0.34 ? 9  PRO B HB2  2  
ATOM 3390  H HB3  . PRO B 1 9  ? -1.473  -3.969  -4.152  1.00 0.34 ? 9  PRO B HB3  2  
ATOM 3391  H HG2  . PRO B 1 9  ? -0.800  -6.162  -2.246  1.00 0.34 ? 9  PRO B HG2  2  
ATOM 3392  H HG3  . PRO B 1 9  ? -0.104  -5.803  -3.835  1.00 0.34 ? 9  PRO B HG3  2  
ATOM 3393  H HD2  . PRO B 1 9  ? 1.070   -5.188  -1.333  1.00 0.34 ? 9  PRO B HD2  2  
ATOM 3394  H HD3  . PRO B 1 9  ? 1.583   -4.555  -2.911  1.00 0.34 ? 9  PRO B HD3  2  
ATOM 3395  N N    . CYS B 1 10 ? -2.002  -2.306  -0.038  1.00 0.35 ? 10 CYS B N    2  
ATOM 3396  C CA   . CYS B 1 10 ? -2.777  -2.378  1.232   1.00 0.35 ? 10 CYS B CA   2  
ATOM 3397  C C    . CYS B 1 10 ? -4.150  -1.734  1.031   1.00 0.35 ? 10 CYS B C    2  
ATOM 3398  O O    . CYS B 1 10 ? -4.259  -0.595  0.625   1.00 0.35 ? 10 CYS B O    2  
ATOM 3399  C CB   . CYS B 1 10 ? -2.020  -1.634  2.332   1.00 0.35 ? 10 CYS B CB   2  
ATOM 3400  S SG   . CYS B 1 10 ? -0.470  -2.498  2.687   1.00 0.35 ? 10 CYS B SG   2  
ATOM 3401  H H    . CYS B 1 10 ? -1.460  -1.513  -0.237  1.00 0.35 ? 10 CYS B H    2  
ATOM 3402  H HA   . CYS B 1 10 ? -2.903  -3.412  1.518   1.00 0.35 ? 10 CYS B HA   2  
ATOM 3403  H HB2  . CYS B 1 10 ? -1.804  -0.628  2.005   1.00 0.35 ? 10 CYS B HB2  2  
ATOM 3404  H HB3  . CYS B 1 10 ? -2.625  -1.599  3.227   1.00 0.35 ? 10 CYS B HB3  2  
ATOM 3405  N N    . CYS B 1 11 ? -5.200  -2.455  1.317   1.00 0.32 ? 11 CYS B N    2  
ATOM 3406  C CA   . CYS B 1 11 ? -6.564  -1.885  1.145   1.00 0.32 ? 11 CYS B CA   2  
ATOM 3407  C C    . CYS B 1 11 ? -7.236  -1.755  2.512   1.00 0.32 ? 11 CYS B C    2  
ATOM 3408  O O    . CYS B 1 11 ? -7.211  -2.667  3.316   1.00 0.32 ? 11 CYS B O    2  
ATOM 3409  C CB   . CYS B 1 11 ? -7.394  -2.808  0.252   1.00 0.32 ? 11 CYS B CB   2  
ATOM 3410  S SG   . CYS B 1 11 ? -7.322  -2.216  -1.457  1.00 0.32 ? 11 CYS B SG   2  
ATOM 3411  H H    . CYS B 1 11 ? -5.088  -3.371  1.644   1.00 0.32 ? 11 CYS B H    2  
ATOM 3412  H HA   . CYS B 1 11 ? -6.492  -0.909  0.686   1.00 0.32 ? 11 CYS B HA   2  
ATOM 3413  H HB2  . CYS B 1 11 ? -6.998  -3.811  0.304   1.00 0.32 ? 11 CYS B HB2  2  
ATOM 3414  H HB3  . CYS B 1 11 ? -8.420  -2.808  0.590   1.00 0.32 ? 11 CYS B HB3  2  
ATOM 3415  N N    . PHE B 1 12 ? -7.833  -0.628  2.785   1.00 0.28 ? 12 PHE B N    2  
ATOM 3416  C CA   . PHE B 1 12 ? -8.501  -0.438  4.103   1.00 0.28 ? 12 PHE B CA   2  
ATOM 3417  C C    . PHE B 1 12 ? -9.987  -0.139  3.885   1.00 0.28 ? 12 PHE B C    2  
ATOM 3418  O O    . PHE B 1 12 ? -10.802 -0.317  4.768   1.00 0.28 ? 12 PHE B O    2  
ATOM 3419  C CB   . PHE B 1 12 ? -7.847  0.731   4.842   1.00 0.28 ? 12 PHE B CB   2  
ATOM 3420  C CG   . PHE B 1 12 ? -6.370  0.760   4.526   1.00 0.28 ? 12 PHE B CG   2  
ATOM 3421  C CD1  . PHE B 1 12 ? -5.911  1.424   3.382   1.00 0.28 ? 12 PHE B CD1  2  
ATOM 3422  C CD2  . PHE B 1 12 ? -5.459  0.119   5.375   1.00 0.28 ? 12 PHE B CD2  2  
ATOM 3423  C CE1  . PHE B 1 12 ? -4.544  1.449   3.086   1.00 0.28 ? 12 PHE B CE1  2  
ATOM 3424  C CE2  . PHE B 1 12 ? -4.091  0.143   5.079   1.00 0.28 ? 12 PHE B CE2  2  
ATOM 3425  C CZ   . PHE B 1 12 ? -3.633  0.808   3.935   1.00 0.28 ? 12 PHE B CZ   2  
ATOM 3426  H H    . PHE B 1 12 ? -7.839  0.096   2.125   1.00 0.28 ? 12 PHE B H    2  
ATOM 3427  H HA   . PHE B 1 12 ? -8.399  -1.339  4.692   1.00 0.28 ? 12 PHE B HA   2  
ATOM 3428  H HB2  . PHE B 1 12 ? -8.302  1.658   4.525   1.00 0.28 ? 12 PHE B HB2  2  
ATOM 3429  H HB3  . PHE B 1 12 ? -7.983  0.607   5.906   1.00 0.28 ? 12 PHE B HB3  2  
ATOM 3430  H HD1  . PHE B 1 12 ? -6.615  1.919   2.727   1.00 0.28 ? 12 PHE B HD1  2  
ATOM 3431  H HD2  . PHE B 1 12 ? -5.811  -0.394  6.257   1.00 0.28 ? 12 PHE B HD2  2  
ATOM 3432  H HE1  . PHE B 1 12 ? -4.190  1.961   2.203   1.00 0.28 ? 12 PHE B HE1  2  
ATOM 3433  H HE2  . PHE B 1 12 ? -3.387  -0.351  5.734   1.00 0.28 ? 12 PHE B HE2  2  
ATOM 3434  H HZ   . PHE B 1 12 ? -2.577  0.827   3.706   1.00 0.28 ? 12 PHE B HZ   2  
ATOM 3435  N N    . ALA B 1 13 ? -10.345 0.311   2.713   1.00 0.31 ? 13 ALA B N    2  
ATOM 3436  C CA   . ALA B 1 13 ? -11.777 0.618   2.439   1.00 0.31 ? 13 ALA B CA   2  
ATOM 3437  C C    . ALA B 1 13 ? -12.469 -0.631  1.887   1.00 0.31 ? 13 ALA B C    2  
ATOM 3438  O O    . ALA B 1 13 ? -11.826 -1.579  1.481   1.00 0.31 ? 13 ALA B O    2  
ATOM 3439  C CB   . ALA B 1 13 ? -11.869 1.749   1.412   1.00 0.31 ? 13 ALA B CB   2  
ATOM 3440  H H    . ALA B 1 13 ? -9.673  0.445   2.013   1.00 0.31 ? 13 ALA B H    2  
ATOM 3441  H HA   . ALA B 1 13 ? -12.262 0.923   3.355   1.00 0.31 ? 13 ALA B HA   2  
ATOM 3442  H HB1  . ALA B 1 13 ? -10.925 2.269   1.365   1.00 0.31 ? 13 ALA B HB1  2  
ATOM 3443  H HB2  . ALA B 1 13 ? -12.102 1.336   0.442   1.00 0.31 ? 13 ALA B HB2  2  
ATOM 3444  H HB3  . ALA B 1 13 ? -12.646 2.438   1.705   1.00 0.31 ? 13 ALA B HB3  2  
ATOM 3445  N N    . TYR B 1 14 ? -13.773 -0.639  1.867   1.00 0.29 ? 14 TYR B N    2  
ATOM 3446  C CA   . TYR B 1 14 ? -14.502 -1.828  1.342   1.00 0.29 ? 14 TYR B CA   2  
ATOM 3447  C C    . TYR B 1 14 ? -15.730 -1.368  0.552   1.00 0.29 ? 14 TYR B C    2  
ATOM 3448  O O    . TYR B 1 14 ? -16.774 -1.100  1.111   1.00 0.29 ? 14 TYR B O    2  
ATOM 3449  C CB   . TYR B 1 14 ? -14.948 -2.711  2.509   1.00 0.29 ? 14 TYR B CB   2  
ATOM 3450  C CG   . TYR B 1 14 ? -13.734 -3.269  3.210   1.00 0.29 ? 14 TYR B CG   2  
ATOM 3451  C CD1  . TYR B 1 14 ? -12.677 -3.801  2.461   1.00 0.29 ? 14 TYR B CD1  2  
ATOM 3452  C CD2  . TYR B 1 14 ? -13.662 -3.254  4.608   1.00 0.29 ? 14 TYR B CD2  2  
ATOM 3453  C CE1  . TYR B 1 14 ? -11.550 -4.318  3.110   1.00 0.29 ? 14 TYR B CE1  2  
ATOM 3454  C CE2  . TYR B 1 14 ? -12.535 -3.771  5.257   1.00 0.29 ? 14 TYR B CE2  2  
ATOM 3455  C CZ   . TYR B 1 14 ? -11.479 -4.303  4.507   1.00 0.29 ? 14 TYR B CZ   2  
ATOM 3456  O OH   . TYR B 1 14 ? -10.367 -4.812  5.148   1.00 0.29 ? 14 TYR B OH   2  
ATOM 3457  H H    . TYR B 1 14 ? -14.275 0.135   2.200   1.00 0.29 ? 14 TYR B H    2  
ATOM 3458  H HA   . TYR B 1 14 ? -13.848 -2.392  0.693   1.00 0.29 ? 14 TYR B HA   2  
ATOM 3459  H HB2  . TYR B 1 14 ? -15.527 -2.121  3.206   1.00 0.29 ? 14 TYR B HB2  2  
ATOM 3460  H HB3  . TYR B 1 14 ? -15.553 -3.524  2.136   1.00 0.29 ? 14 TYR B HB3  2  
ATOM 3461  H HD1  . TYR B 1 14 ? -12.731 -3.814  1.383   1.00 0.29 ? 14 TYR B HD1  2  
ATOM 3462  H HD2  . TYR B 1 14 ? -14.478 -2.843  5.186   1.00 0.29 ? 14 TYR B HD2  2  
ATOM 3463  H HE1  . TYR B 1 14 ? -10.736 -4.728  2.532   1.00 0.29 ? 14 TYR B HE1  2  
ATOM 3464  H HE2  . TYR B 1 14 ? -12.480 -3.760  6.335   1.00 0.29 ? 14 TYR B HE2  2  
ATOM 3465  H HH   . TYR B 1 14 ? -10.603 -5.667  5.516   1.00 0.29 ? 14 TYR B HH   2  
ATOM 3466  N N    . ILE B 1 15 ? -15.612 -1.277  -0.744  1.00 0.32 ? 15 ILE B N    2  
ATOM 3467  C CA   . ILE B 1 15 ? -16.773 -0.836  -1.567  1.00 0.32 ? 15 ILE B CA   2  
ATOM 3468  C C    . ILE B 1 15 ? -18.003 -1.668  -1.197  1.00 0.32 ? 15 ILE B C    2  
ATOM 3469  O O    . ILE B 1 15 ? -17.892 -2.792  -0.749  1.00 0.32 ? 15 ILE B O    2  
ATOM 3470  C CB   . ILE B 1 15 ? -16.452 -1.032  -3.050  1.00 0.32 ? 15 ILE B CB   2  
ATOM 3471  C CG1  . ILE B 1 15 ? -17.635 -0.554  -3.895  1.00 0.32 ? 15 ILE B CG1  2  
ATOM 3472  C CG2  . ILE B 1 15 ? -16.197 -2.515  -3.326  1.00 0.32 ? 15 ILE B CG2  2  
ATOM 3473  C CD1  . ILE B 1 15 ? -17.123 -0.022  -5.235  1.00 0.32 ? 15 ILE B CD1  2  
ATOM 3474  H H    . ILE B 1 15 ? -14.761 -1.499  -1.176  1.00 0.32 ? 15 ILE B H    2  
ATOM 3475  H HA   . ILE B 1 15 ? -16.974 0.208   -1.377  1.00 0.32 ? 15 ILE B HA   2  
ATOM 3476  H HB   . ILE B 1 15 ? -15.570 -0.462  -3.305  1.00 0.32 ? 15 ILE B HB   2  
ATOM 3477  H HG12 . ILE B 1 15 ? -18.310 -1.378  -4.067  1.00 0.32 ? 15 ILE B HG12 2  
ATOM 3478  H HG13 . ILE B 1 15 ? -18.154 0.236   -3.373  1.00 0.32 ? 15 ILE B HG13 2  
ATOM 3479  H HG21 . ILE B 1 15 ? -16.690 -3.112  -2.573  1.00 0.32 ? 15 ILE B HG21 2  
ATOM 3480  H HG22 . ILE B 1 15 ? -16.585 -2.772  -4.300  1.00 0.32 ? 15 ILE B HG22 2  
ATOM 3481  H HG23 . ILE B 1 15 ? -15.135 -2.708  -3.299  1.00 0.32 ? 15 ILE B HG23 2  
ATOM 3482  H HD11 . ILE B 1 15 ? -16.195 -0.515  -5.487  1.00 0.32 ? 15 ILE B HD11 2  
ATOM 3483  H HD12 . ILE B 1 15 ? -17.855 -0.220  -6.004  1.00 0.32 ? 15 ILE B HD12 2  
ATOM 3484  H HD13 . ILE B 1 15 ? -16.956 1.042   -5.161  1.00 0.32 ? 15 ILE B HD13 2  
ATOM 3485  N N    . ALA B 1 16 ? -19.176 -1.126  -1.381  1.00 0.38 ? 16 ALA B N    2  
ATOM 3486  C CA   . ALA B 1 16 ? -20.410 -1.887  -1.038  1.00 0.38 ? 16 ALA B CA   2  
ATOM 3487  C C    . ALA B 1 16 ? -21.070 -2.395  -2.322  1.00 0.38 ? 16 ALA B C    2  
ATOM 3488  O O    . ALA B 1 16 ? -21.886 -3.294  -2.298  1.00 0.38 ? 16 ALA B O    2  
ATOM 3489  C CB   . ALA B 1 16 ? -21.382 -0.973  -0.292  1.00 0.38 ? 16 ALA B CB   2  
ATOM 3490  H H    . ALA B 1 16 ? -19.245 -0.218  -1.744  1.00 0.38 ? 16 ALA B H    2  
ATOM 3491  H HA   . ALA B 1 16 ? -20.152 -2.727  -0.410  1.00 0.38 ? 16 ALA B HA   2  
ATOM 3492  H HB1  . ALA B 1 16 ? -21.418 -0.010  -0.780  1.00 0.38 ? 16 ALA B HB1  2  
ATOM 3493  H HB2  . ALA B 1 16 ? -22.368 -1.414  -0.297  1.00 0.38 ? 16 ALA B HB2  2  
ATOM 3494  H HB3  . ALA B 1 16 ? -21.049 -0.847  0.727   1.00 0.38 ? 16 ALA B HB3  2  
ATOM 3495  N N    . ARG B 1 17 ? -20.723 -1.824  -3.444  1.00 0.42 ? 17 ARG B N    2  
ATOM 3496  C CA   . ARG B 1 17 ? -21.332 -2.276  -4.727  1.00 0.42 ? 17 ARG B CA   2  
ATOM 3497  C C    . ARG B 1 17 ? -20.358 -3.208  -5.455  1.00 0.42 ? 17 ARG B C    2  
ATOM 3498  O O    . ARG B 1 17 ? -19.158 -3.059  -5.341  1.00 0.42 ? 17 ARG B O    2  
ATOM 3499  C CB   . ARG B 1 17 ? -21.629 -1.059  -5.606  1.00 0.42 ? 17 ARG B CB   2  
ATOM 3500  C CG   . ARG B 1 17 ? -23.118 -0.720  -5.525  1.00 0.42 ? 17 ARG B CG   2  
ATOM 3501  C CD   . ARG B 1 17 ? -23.685 -0.569  -6.938  1.00 0.42 ? 17 ARG B CD   2  
ATOM 3502  N NE   . ARG B 1 17 ? -23.701 0.872   -7.314  1.00 0.42 ? 17 ARG B NE   2  
ATOM 3503  C CZ   . ARG B 1 17 ? -24.778 1.584   -7.122  1.00 0.42 ? 17 ARG B CZ   2  
ATOM 3504  N NH1  . ARG B 1 17 ? -25.872 1.302   -7.774  1.00 0.42 ? 17 ARG B NH1  2  
ATOM 3505  N NH2  . ARG B 1 17 ? -24.759 2.580   -6.279  1.00 0.42 ? 17 ARG B NH2  2  
ATOM 3506  H H    . ARG B 1 17 ? -20.063 -1.100  -3.443  1.00 0.42 ? 17 ARG B H    2  
ATOM 3507  H HA   . ARG B 1 17 ? -22.251 -2.805  -4.523  1.00 0.42 ? 17 ARG B HA   2  
ATOM 3508  H HB2  . ARG B 1 17 ? -21.047 -0.216  -5.262  1.00 0.42 ? 17 ARG B HB2  2  
ATOM 3509  H HB3  . ARG B 1 17 ? -21.367 -1.282  -6.630  1.00 0.42 ? 17 ARG B HB3  2  
ATOM 3510  H HG2  . ARG B 1 17 ? -23.640 -1.514  -5.009  1.00 0.42 ? 17 ARG B HG2  2  
ATOM 3511  H HG3  . ARG B 1 17 ? -23.248 0.205   -4.986  1.00 0.42 ? 17 ARG B HG3  2  
ATOM 3512  H HD2  . ARG B 1 17 ? -23.068 -1.117  -7.634  1.00 0.42 ? 17 ARG B HD2  2  
ATOM 3513  H HD3  . ARG B 1 17 ? -24.692 -0.960  -6.966  1.00 0.42 ? 17 ARG B HD3  2  
ATOM 3514  H HE   . ARG B 1 17 ? -22.904 1.285   -7.706  1.00 0.42 ? 17 ARG B HE   2  
ATOM 3515  H HH11 . ARG B 1 17 ? -25.886 0.540   -8.421  1.00 0.42 ? 17 ARG B HH11 2  
ATOM 3516  H HH12 . ARG B 1 17 ? -26.697 1.848   -7.627  1.00 0.42 ? 17 ARG B HH12 2  
ATOM 3517  H HH21 . ARG B 1 17 ? -23.920 2.797   -5.779  1.00 0.42 ? 17 ARG B HH21 2  
ATOM 3518  H HH22 . ARG B 1 17 ? -25.584 3.127   -6.132  1.00 0.42 ? 17 ARG B HH22 2  
ATOM 3519  N N    . PRO B 1 18 ? -20.911 -4.143  -6.185  1.00 0.41 ? 18 PRO B N    2  
ATOM 3520  C CA   . PRO B 1 18 ? -20.121 -5.122  -6.951  1.00 0.41 ? 18 PRO B CA   2  
ATOM 3521  C C    . PRO B 1 18 ? -19.584 -4.487  -8.237  1.00 0.41 ? 18 PRO B C    2  
ATOM 3522  O O    . PRO B 1 18 ? -19.965 -3.395  -8.608  1.00 0.41 ? 18 PRO B O    2  
ATOM 3523  C CB   . PRO B 1 18 ? -21.132 -6.228  -7.269  1.00 0.41 ? 18 PRO B CB   2  
ATOM 3524  C CG   . PRO B 1 18 ? -22.533 -5.579  -7.172  1.00 0.41 ? 18 PRO B CG   2  
ATOM 3525  C CD   . PRO B 1 18 ? -22.373 -4.311  -6.314  1.00 0.41 ? 18 PRO B CD   2  
ATOM 3526  H HA   . PRO B 1 18 ? -19.317 -5.518  -6.354  1.00 0.41 ? 18 PRO B HA   2  
ATOM 3527  H HB2  . PRO B 1 18 ? -20.963 -6.609  -8.267  1.00 0.41 ? 18 PRO B HB2  2  
ATOM 3528  H HB3  . PRO B 1 18 ? -21.050 -7.025  -6.547  1.00 0.41 ? 18 PRO B HB3  2  
ATOM 3529  H HG2  . PRO B 1 18 ? -22.889 -5.319  -8.160  1.00 0.41 ? 18 PRO B HG2  2  
ATOM 3530  H HG3  . PRO B 1 18 ? -23.224 -6.257  -6.695  1.00 0.41 ? 18 PRO B HG3  2  
ATOM 3531  H HD2  . PRO B 1 18 ? -22.812 -3.458  -6.815  1.00 0.41 ? 18 PRO B HD2  2  
ATOM 3532  H HD3  . PRO B 1 18 ? -22.819 -4.452  -5.342  1.00 0.41 ? 18 PRO B HD3  2  
ATOM 3533  N N    . LEU B 1 19 ? -18.701 -5.164  -8.918  1.00 0.45 ? 19 LEU B N    2  
ATOM 3534  C CA   . LEU B 1 19 ? -18.138 -4.602  -10.178 1.00 0.45 ? 19 LEU B CA   2  
ATOM 3535  C C    . LEU B 1 19 ? -18.551 -5.492  -11.355 1.00 0.45 ? 19 LEU B C    2  
ATOM 3536  O O    . LEU B 1 19 ? -19.014 -6.597  -11.157 1.00 0.45 ? 19 LEU B O    2  
ATOM 3537  C CB   . LEU B 1 19 ? -16.609 -4.558  -10.083 1.00 0.45 ? 19 LEU B CB   2  
ATOM 3538  C CG   . LEU B 1 19 ? -16.188 -4.359  -8.625  1.00 0.45 ? 19 LEU B CG   2  
ATOM 3539  C CD1  . LEU B 1 19 ? -16.198 -5.706  -7.900  1.00 0.45 ? 19 LEU B CD1  2  
ATOM 3540  C CD2  . LEU B 1 19 ? -14.777 -3.768  -8.580  1.00 0.45 ? 19 LEU B CD2  2  
ATOM 3541  H H    . LEU B 1 19 ? -18.407 -6.043  -8.600  1.00 0.45 ? 19 LEU B H    2  
ATOM 3542  H HA   . LEU B 1 19 ? -18.519 -3.603  -10.330 1.00 0.45 ? 19 LEU B HA   2  
ATOM 3543  H HB2  . LEU B 1 19 ? -16.199 -5.487  -10.452 1.00 0.45 ? 19 LEU B HB2  2  
ATOM 3544  H HB3  . LEU B 1 19 ? -16.235 -3.738  -10.676 1.00 0.45 ? 19 LEU B HB3  2  
ATOM 3545  H HG   . LEU B 1 19 ? -16.878 -3.684  -8.139  1.00 0.45 ? 19 LEU B HG   2  
ATOM 3546  H HD11 . LEU B 1 19 ? -16.186 -6.505  -8.627  1.00 0.45 ? 19 LEU B HD11 2  
ATOM 3547  H HD12 . LEU B 1 19 ? -15.326 -5.782  -7.268  1.00 0.45 ? 19 LEU B HD12 2  
ATOM 3548  H HD13 . LEU B 1 19 ? -17.090 -5.782  -7.296  1.00 0.45 ? 19 LEU B HD13 2  
ATOM 3549  H HD21 . LEU B 1 19 ? -14.151 -4.275  -9.300  1.00 0.45 ? 19 LEU B HD21 2  
ATOM 3550  H HD22 . LEU B 1 19 ? -14.818 -2.716  -8.817  1.00 0.45 ? 19 LEU B HD22 2  
ATOM 3551  H HD23 . LEU B 1 19 ? -14.364 -3.899  -7.591  1.00 0.45 ? 19 LEU B HD23 2  
ATOM 3552  N N    . PRO B 1 20 ? -18.371 -4.982  -12.545 1.00 0.58 ? 20 PRO B N    2  
ATOM 3553  C CA   . PRO B 1 20 ? -18.715 -5.710  -13.778 1.00 0.58 ? 20 PRO B CA   2  
ATOM 3554  C C    . PRO B 1 20 ? -17.649 -6.764  -14.088 1.00 0.58 ? 20 PRO B C    2  
ATOM 3555  O O    . PRO B 1 20 ? -16.477 -6.463  -14.194 1.00 0.58 ? 20 PRO B O    2  
ATOM 3556  C CB   . PRO B 1 20 ? -18.740 -4.614  -14.848 1.00 0.58 ? 20 PRO B CB   2  
ATOM 3557  C CG   . PRO B 1 20 ? -17.876 -3.453  -14.303 1.00 0.58 ? 20 PRO B CG   2  
ATOM 3558  C CD   . PRO B 1 20 ? -17.804 -3.636  -12.774 1.00 0.58 ? 20 PRO B CD   2  
ATOM 3559  H HA   . PRO B 1 20 ? -19.689 -6.164  -13.693 1.00 0.58 ? 20 PRO B HA   2  
ATOM 3560  H HB2  . PRO B 1 20 ? -18.321 -4.991  -15.772 1.00 0.58 ? 20 PRO B HB2  2  
ATOM 3561  H HB3  . PRO B 1 20 ? -19.750 -4.272  -15.008 1.00 0.58 ? 20 PRO B HB3  2  
ATOM 3562  H HG2  . PRO B 1 20 ? -16.883 -3.498  -14.731 1.00 0.58 ? 20 PRO B HG2  2  
ATOM 3563  H HG3  . PRO B 1 20 ? -18.338 -2.506  -14.535 1.00 0.58 ? 20 PRO B HG3  2  
ATOM 3564  H HD2  . PRO B 1 20 ? -16.778 -3.592  -12.440 1.00 0.58 ? 20 PRO B HD2  2  
ATOM 3565  H HD3  . PRO B 1 20 ? -18.402 -2.891  -12.275 1.00 0.58 ? 20 PRO B HD3  2  
ATOM 3566  N N    . ARG B 1 21 ? -18.048 -7.999  -14.227 1.00 0.75 ? 21 ARG B N    2  
ATOM 3567  C CA   . ARG B 1 21 ? -17.060 -9.074  -14.523 1.00 0.75 ? 21 ARG B CA   2  
ATOM 3568  C C    . ARG B 1 21 ? -16.345 -8.771  -15.841 1.00 0.75 ? 21 ARG B C    2  
ATOM 3569  O O    . ARG B 1 21 ? -15.334 -9.365  -16.160 1.00 0.75 ? 21 ARG B O    2  
ATOM 3570  C CB   . ARG B 1 21 ? -17.789 -10.416 -14.637 1.00 0.75 ? 21 ARG B CB   2  
ATOM 3571  C CG   . ARG B 1 21 ? -17.289 -11.362 -13.544 1.00 0.75 ? 21 ARG B CG   2  
ATOM 3572  C CD   . ARG B 1 21 ? -15.760 -11.386 -13.547 1.00 0.75 ? 21 ARG B CD   2  
ATOM 3573  N NE   . ARG B 1 21 ? -15.281 -12.796 -13.458 1.00 0.75 ? 21 ARG B NE   2  
ATOM 3574  C CZ   . ARG B 1 21 ? -15.910 -13.653 -12.702 1.00 0.75 ? 21 ARG B CZ   2  
ATOM 3575  N NH1  . ARG B 1 21 ? -16.410 -13.271 -11.558 1.00 0.75 ? 21 ARG B NH1  2  
ATOM 3576  N NH2  . ARG B 1 21 ? -16.040 -14.892 -13.089 1.00 0.75 ? 21 ARG B NH2  2  
ATOM 3577  H H    . ARG B 1 21 ? -18.998 -8.219  -14.132 1.00 0.75 ? 21 ARG B H    2  
ATOM 3578  H HA   . ARG B 1 21 ? -16.336 -9.126  -13.723 1.00 0.75 ? 21 ARG B HA   2  
ATOM 3579  H HB2  . ARG B 1 21 ? -18.851 -10.258 -14.520 1.00 0.75 ? 21 ARG B HB2  2  
ATOM 3580  H HB3  . ARG B 1 21 ? -17.593 -10.851 -15.605 1.00 0.75 ? 21 ARG B HB3  2  
ATOM 3581  H HG2  . ARG B 1 21 ? -17.644 -11.021 -12.583 1.00 0.75 ? 21 ARG B HG2  2  
ATOM 3582  H HG3  . ARG B 1 21 ? -17.663 -12.358 -13.733 1.00 0.75 ? 21 ARG B HG3  2  
ATOM 3583  H HD2  . ARG B 1 21 ? -15.396 -10.940 -14.461 1.00 0.75 ? 21 ARG B HD2  2  
ATOM 3584  H HD3  . ARG B 1 21 ? -15.389 -10.826 -12.701 1.00 0.75 ? 21 ARG B HD3  2  
ATOM 3585  H HE   . ARG B 1 21 ? -14.493 -13.078 -13.967 1.00 0.75 ? 21 ARG B HE   2  
ATOM 3586  H HH11 . ARG B 1 21 ? -16.311 -12.322 -11.262 1.00 0.75 ? 21 ARG B HH11 2  
ATOM 3587  H HH12 . ARG B 1 21 ? -16.892 -13.928 -10.978 1.00 0.75 ? 21 ARG B HH12 2  
ATOM 3588  H HH21 . ARG B 1 21 ? -15.657 -15.185 -13.966 1.00 0.75 ? 21 ARG B HH21 2  
ATOM 3589  H HH22 . ARG B 1 21 ? -16.522 -15.550 -12.510 1.00 0.75 ? 21 ARG B HH22 2  
ATOM 3590  N N    . ALA B 1 22 ? -16.862 -7.854  -16.612 1.00 0.89 ? 22 ALA B N    2  
ATOM 3591  C CA   . ALA B 1 22 ? -16.209 -7.518  -17.910 1.00 0.89 ? 22 ALA B CA   2  
ATOM 3592  C C    . ALA B 1 22 ? -15.120 -6.466  -17.682 1.00 0.89 ? 22 ALA B C    2  
ATOM 3593  O O    . ALA B 1 22 ? -14.664 -5.823  -18.607 1.00 0.89 ? 22 ALA B O    2  
ATOM 3594  C CB   . ALA B 1 22 ? -17.256 -6.964  -18.878 1.00 0.89 ? 22 ALA B CB   2  
ATOM 3595  H H    . ALA B 1 22 ? -17.679 -7.387  -16.340 1.00 0.89 ? 22 ALA B H    2  
ATOM 3596  H HA   . ALA B 1 22 ? -15.767 -8.408  -18.330 1.00 0.89 ? 22 ALA B HA   2  
ATOM 3597  H HB1  . ALA B 1 22 ? -18.146 -7.575  -18.833 1.00 0.89 ? 22 ALA B HB1  2  
ATOM 3598  H HB2  . ALA B 1 22 ? -17.502 -5.950  -18.602 1.00 0.89 ? 22 ALA B HB2  2  
ATOM 3599  H HB3  . ALA B 1 22 ? -16.861 -6.979  -19.883 1.00 0.89 ? 22 ALA B HB3  2  
ATOM 3600  N N    . HIS B 1 23 ? -14.698 -6.286  -16.460 1.00 0.71 ? 23 HIS B N    2  
ATOM 3601  C CA   . HIS B 1 23 ? -13.640 -5.276  -16.180 1.00 0.71 ? 23 HIS B CA   2  
ATOM 3602  C C    . HIS B 1 23 ? -12.811 -5.725  -14.974 1.00 0.71 ? 23 HIS B C    2  
ATOM 3603  O O    . HIS B 1 23 ? -12.265 -4.918  -14.250 1.00 0.71 ? 23 HIS B O    2  
ATOM 3604  C CB   . HIS B 1 23 ? -14.292 -3.927  -15.873 1.00 0.71 ? 23 HIS B CB   2  
ATOM 3605  C CG   . HIS B 1 23 ? -14.310 -3.083  -17.118 1.00 0.71 ? 23 HIS B CG   2  
ATOM 3606  N ND1  . HIS B 1 23 ? -13.539 -1.939  -17.247 1.00 0.71 ? 23 HIS B ND1  2  
ATOM 3607  C CD2  . HIS B 1 23 ? -15.002 -3.204  -18.297 1.00 0.71 ? 23 HIS B CD2  2  
ATOM 3608  C CE1  . HIS B 1 23 ? -13.783 -1.420  -18.465 1.00 0.71 ? 23 HIS B CE1  2  
ATOM 3609  N NE2  . HIS B 1 23 ? -14.668 -2.153  -19.147 1.00 0.71 ? 23 HIS B NE2  2  
ATOM 3610  H H    . HIS B 1 23 ? -15.078 -6.814  -15.727 1.00 0.71 ? 23 HIS B H    2  
ATOM 3611  H HA   . HIS B 1 23 ? -12.998 -5.178  -17.043 1.00 0.71 ? 23 HIS B HA   2  
ATOM 3612  H HB2  . HIS B 1 23 ? -15.303 -4.086  -15.531 1.00 0.71 ? 23 HIS B HB2  2  
ATOM 3613  H HB3  . HIS B 1 23 ? -13.728 -3.420  -15.105 1.00 0.71 ? 23 HIS B HB3  2  
ATOM 3614  H HD1  . HIS B 1 23 ? -12.927 -1.573  -16.575 1.00 0.71 ? 23 HIS B HD1  2  
ATOM 3615  H HD2  . HIS B 1 23 ? -15.699 -3.994  -18.531 1.00 0.71 ? 23 HIS B HD2  2  
ATOM 3616  H HE1  . HIS B 1 23 ? -13.320 -0.522  -18.844 1.00 0.71 ? 23 HIS B HE1  2  
ATOM 3617  N N    . ILE B 1 24 ? -12.713 -7.007  -14.753 1.00 0.56 ? 24 ILE B N    2  
ATOM 3618  C CA   . ILE B 1 24 ? -11.921 -7.503  -13.594 1.00 0.56 ? 24 ILE B CA   2  
ATOM 3619  C C    . ILE B 1 24 ? -10.759 -8.363  -14.097 1.00 0.56 ? 24 ILE B C    2  
ATOM 3620  O O    . ILE B 1 24 ? -10.776 -9.573  -13.990 1.00 0.56 ? 24 ILE B O    2  
ATOM 3621  C CB   . ILE B 1 24 ? -12.818 -8.344  -12.684 1.00 0.56 ? 24 ILE B CB   2  
ATOM 3622  C CG1  . ILE B 1 24 ? -13.839 -7.432  -11.997 1.00 0.56 ? 24 ILE B CG1  2  
ATOM 3623  C CG2  . ILE B 1 24 ? -11.964 -9.040  -11.623 1.00 0.56 ? 24 ILE B CG2  2  
ATOM 3624  C CD1  . ILE B 1 24 ? -14.541 -8.202  -10.877 1.00 0.56 ? 24 ILE B CD1  2  
ATOM 3625  H H    . ILE B 1 24 ? -13.162 -7.644  -15.349 1.00 0.56 ? 24 ILE B H    2  
ATOM 3626  H HA   . ILE B 1 24 ? -11.531 -6.663  -13.039 1.00 0.56 ? 24 ILE B HA   2  
ATOM 3627  H HB   . ILE B 1 24 ? -13.336 -9.086  -13.274 1.00 0.56 ? 24 ILE B HB   2  
ATOM 3628  H HG12 . ILE B 1 24 ? -13.331 -6.574  -11.581 1.00 0.56 ? 24 ILE B HG12 2  
ATOM 3629  H HG13 . ILE B 1 24 ? -14.571 -7.103  -12.719 1.00 0.56 ? 24 ILE B HG13 2  
ATOM 3630  H HG21 . ILE B 1 24 ? -10.921 -8.817  -11.799 1.00 0.56 ? 24 ILE B HG21 2  
ATOM 3631  H HG22 . ILE B 1 24 ? -12.247 -8.688  -10.644 1.00 0.56 ? 24 ILE B HG22 2  
ATOM 3632  H HG23 . ILE B 1 24 ? -12.118 -10.108 -11.681 1.00 0.56 ? 24 ILE B HG23 2  
ATOM 3633  H HD11 . ILE B 1 24 ? -13.801 -8.629  -10.216 1.00 0.56 ? 24 ILE B HD11 2  
ATOM 3634  H HD12 . ILE B 1 24 ? -15.176 -7.529  -10.321 1.00 0.56 ? 24 ILE B HD12 2  
ATOM 3635  H HD13 . ILE B 1 24 ? -15.140 -8.993  -11.305 1.00 0.56 ? 24 ILE B HD13 2  
ATOM 3636  N N    . LYS B 1 25 ? -9.748  -7.746  -14.646 1.00 0.59 ? 25 LYS B N    2  
ATOM 3637  C CA   . LYS B 1 25 ? -8.586  -8.527  -15.156 1.00 0.59 ? 25 LYS B CA   2  
ATOM 3638  C C    . LYS B 1 25 ? -8.196  -9.592  -14.130 1.00 0.59 ? 25 LYS B C    2  
ATOM 3639  O O    . LYS B 1 25 ? -8.285  -10.776 -14.387 1.00 0.59 ? 25 LYS B O    2  
ATOM 3640  C CB   . LYS B 1 25 ? -7.404  -7.584  -15.386 1.00 0.59 ? 25 LYS B CB   2  
ATOM 3641  C CG   . LYS B 1 25 ? -6.554  -8.106  -16.545 1.00 0.59 ? 25 LYS B CG   2  
ATOM 3642  C CD   . LYS B 1 25 ? -5.354  -7.181  -16.757 1.00 0.59 ? 25 LYS B CD   2  
ATOM 3643  C CE   . LYS B 1 25 ? -4.567  -7.057  -15.451 1.00 0.59 ? 25 LYS B CE   2  
ATOM 3644  N NZ   . LYS B 1 25 ? -3.125  -6.844  -15.760 1.00 0.59 ? 25 LYS B NZ   2  
ATOM 3645  H H    . LYS B 1 25 ? -9.753  -6.770  -14.723 1.00 0.59 ? 25 LYS B H    2  
ATOM 3646  H HA   . LYS B 1 25 ? -8.853  -9.003  -16.087 1.00 0.59 ? 25 LYS B HA   2  
ATOM 3647  H HB2  . LYS B 1 25 ? -7.772  -6.596  -15.624 1.00 0.59 ? 25 LYS B HB2  2  
ATOM 3648  H HB3  . LYS B 1 25 ? -6.801  -7.537  -14.492 1.00 0.59 ? 25 LYS B HB3  2  
ATOM 3649  H HG2  . LYS B 1 25 ? -6.206  -9.103  -16.313 1.00 0.59 ? 25 LYS B HG2  2  
ATOM 3650  H HG3  . LYS B 1 25 ? -7.150  -8.133  -17.444 1.00 0.59 ? 25 LYS B HG3  2  
ATOM 3651  H HD2  . LYS B 1 25 ? -4.716  -7.591  -17.526 1.00 0.59 ? 25 LYS B HD2  2  
ATOM 3652  H HD3  . LYS B 1 25 ? -5.702  -6.205  -17.059 1.00 0.59 ? 25 LYS B HD3  2  
ATOM 3653  H HE2  . LYS B 1 25 ? -4.941  -6.219  -14.882 1.00 0.59 ? 25 LYS B HE2  2  
ATOM 3654  H HE3  . LYS B 1 25 ? -4.681  -7.964  -14.875 1.00 0.59 ? 25 LYS B HE3  2  
ATOM 3655  H HZ1  . LYS B 1 25 ? -3.034  -6.173  -16.549 1.00 0.59 ? 25 LYS B HZ1  2  
ATOM 3656  H HZ2  . LYS B 1 25 ? -2.644  -6.457  -14.923 1.00 0.59 ? 25 LYS B HZ2  2  
ATOM 3657  H HZ3  . LYS B 1 25 ? -2.688  -7.751  -16.024 1.00 0.59 ? 25 LYS B HZ3  2  
ATOM 3658  N N    . GLU B 1 26 ? -7.764  -9.181  -12.970 1.00 0.53 ? 26 GLU B N    2  
ATOM 3659  C CA   . GLU B 1 26 ? -7.367  -10.173 -11.930 1.00 0.53 ? 26 GLU B CA   2  
ATOM 3660  C C    . GLU B 1 26 ? -7.376  -9.503  -10.555 1.00 0.53 ? 26 GLU B C    2  
ATOM 3661  O O    . GLU B 1 26 ? -7.255  -8.299  -10.440 1.00 0.53 ? 26 GLU B O    2  
ATOM 3662  C CB   . GLU B 1 26 ? -5.960  -10.694 -12.233 1.00 0.53 ? 26 GLU B CB   2  
ATOM 3663  C CG   . GLU B 1 26 ? -4.990  -9.516  -12.337 1.00 0.53 ? 26 GLU B CG   2  
ATOM 3664  C CD   . GLU B 1 26 ? -3.668  -9.993  -12.936 1.00 0.53 ? 26 GLU B CD   2  
ATOM 3665  O OE1  . GLU B 1 26 ? -3.665  -10.362 -14.099 1.00 0.53 ? 26 GLU B OE1  2  
ATOM 3666  O OE2  . GLU B 1 26 ? -2.677  -9.984  -12.223 1.00 0.53 ? 26 GLU B OE2  2  
ATOM 3667  H H    . GLU B 1 26 ? -7.699  -8.222  -12.781 1.00 0.53 ? 26 GLU B H    2  
ATOM 3668  H HA   . GLU B 1 26 ? -8.064  -10.997 -11.933 1.00 0.53 ? 26 GLU B HA   2  
ATOM 3669  H HB2  . GLU B 1 26 ? -5.643  -11.355 -11.439 1.00 0.53 ? 26 GLU B HB2  2  
ATOM 3670  H HB3  . GLU B 1 26 ? -5.970  -11.233 -13.168 1.00 0.53 ? 26 GLU B HB3  2  
ATOM 3671  H HG2  . GLU B 1 26 ? -5.419  -8.752  -12.969 1.00 0.53 ? 26 GLU B HG2  2  
ATOM 3672  H HG3  . GLU B 1 26 ? -4.812  -9.109  -11.353 1.00 0.53 ? 26 GLU B HG3  2  
ATOM 3673  N N    . TYR B 1 27 ? -7.520  -10.271 -9.510  1.00 0.39 ? 27 TYR B N    2  
ATOM 3674  C CA   . TYR B 1 27 ? -7.539  -9.674  -8.143  1.00 0.39 ? 27 TYR B CA   2  
ATOM 3675  C C    . TYR B 1 27 ? -6.455  -10.332 -7.284  1.00 0.39 ? 27 TYR B C    2  
ATOM 3676  O O    . TYR B 1 27 ? -5.660  -11.115 -7.763  1.00 0.39 ? 27 TYR B O    2  
ATOM 3677  C CB   . TYR B 1 27 ? -8.911  -9.904  -7.504  1.00 0.39 ? 27 TYR B CB   2  
ATOM 3678  C CG   . TYR B 1 27 ? -9.052  -11.355 -7.108  1.00 0.39 ? 27 TYR B CG   2  
ATOM 3679  C CD1  . TYR B 1 27 ? -9.479  -12.300 -8.047  1.00 0.39 ? 27 TYR B CD1  2  
ATOM 3680  C CD2  . TYR B 1 27 ? -8.754  -11.754 -5.799  1.00 0.39 ? 27 TYR B CD2  2  
ATOM 3681  C CE1  . TYR B 1 27 ? -9.608  -13.644 -7.680  1.00 0.39 ? 27 TYR B CE1  2  
ATOM 3682  C CE2  . TYR B 1 27 ? -8.884  -13.099 -5.431  1.00 0.39 ? 27 TYR B CE2  2  
ATOM 3683  C CZ   . TYR B 1 27 ? -9.311  -14.044 -6.372  1.00 0.39 ? 27 TYR B CZ   2  
ATOM 3684  O OH   . TYR B 1 27 ? -9.438  -15.369 -6.008  1.00 0.39 ? 27 TYR B OH   2  
ATOM 3685  H H    . TYR B 1 27 ? -7.618  -11.240 -9.622  1.00 0.39 ? 27 TYR B H    2  
ATOM 3686  H HA   . TYR B 1 27 ? -7.347  -8.613  -8.213  1.00 0.39 ? 27 TYR B HA   2  
ATOM 3687  H HB2  . TYR B 1 27 ? -9.008  -9.280  -6.627  1.00 0.39 ? 27 TYR B HB2  2  
ATOM 3688  H HB3  . TYR B 1 27 ? -9.685  -9.649  -8.213  1.00 0.39 ? 27 TYR B HB3  2  
ATOM 3689  H HD1  . TYR B 1 27 ? -9.708  -11.992 -9.057  1.00 0.39 ? 27 TYR B HD1  2  
ATOM 3690  H HD2  . TYR B 1 27 ? -8.425  -11.025 -5.073  1.00 0.39 ? 27 TYR B HD2  2  
ATOM 3691  H HE1  . TYR B 1 27 ? -9.937  -14.373 -8.406  1.00 0.39 ? 27 TYR B HE1  2  
ATOM 3692  H HE2  . TYR B 1 27 ? -8.654  -13.407 -4.421  1.00 0.39 ? 27 TYR B HE2  2  
ATOM 3693  H HH   . TYR B 1 27 ? -8.680  -15.603 -5.468  1.00 0.39 ? 27 TYR B HH   2  
ATOM 3694  N N    . PHE B 1 28 ? -6.422  -10.020 -6.017  1.00 0.35 ? 28 PHE B N    2  
ATOM 3695  C CA   . PHE B 1 28 ? -5.394  -10.628 -5.125  1.00 0.35 ? 28 PHE B CA   2  
ATOM 3696  C C    . PHE B 1 28 ? -5.597  -10.118 -3.698  1.00 0.35 ? 28 PHE B C    2  
ATOM 3697  O O    . PHE B 1 28 ? -6.130  -9.048  -3.480  1.00 0.35 ? 28 PHE B O    2  
ATOM 3698  C CB   . PHE B 1 28 ? -3.997  -10.241 -5.614  1.00 0.35 ? 28 PHE B CB   2  
ATOM 3699  C CG   . PHE B 1 28 ? -3.954  -8.761  -5.908  1.00 0.35 ? 28 PHE B CG   2  
ATOM 3700  C CD1  . PHE B 1 28 ? -3.834  -7.842  -4.858  1.00 0.35 ? 28 PHE B CD1  2  
ATOM 3701  C CD2  . PHE B 1 28 ? -4.031  -8.307  -7.230  1.00 0.35 ? 28 PHE B CD2  2  
ATOM 3702  C CE1  . PHE B 1 28 ? -3.792  -6.469  -5.131  1.00 0.35 ? 28 PHE B CE1  2  
ATOM 3703  C CE2  . PHE B 1 28 ? -3.989  -6.935  -7.503  1.00 0.35 ? 28 PHE B CE2  2  
ATOM 3704  C CZ   . PHE B 1 28 ? -3.870  -6.015  -6.453  1.00 0.35 ? 28 PHE B CZ   2  
ATOM 3705  H H    . PHE B 1 28 ? -7.075  -9.387  -5.652  1.00 0.35 ? 28 PHE B H    2  
ATOM 3706  H HA   . PHE B 1 28 ? -5.496  -11.703 -5.141  1.00 0.35 ? 28 PHE B HA   2  
ATOM 3707  H HB2  . PHE B 1 28 ? -3.271  -10.478 -4.850  1.00 0.35 ? 28 PHE B HB2  2  
ATOM 3708  H HB3  . PHE B 1 28 ? -3.765  -10.792 -6.514  1.00 0.35 ? 28 PHE B HB3  2  
ATOM 3709  H HD1  . PHE B 1 28 ? -3.776  -8.192  -3.838  1.00 0.35 ? 28 PHE B HD1  2  
ATOM 3710  H HD2  . PHE B 1 28 ? -4.123  -9.015  -8.040  1.00 0.35 ? 28 PHE B HD2  2  
ATOM 3711  H HE1  . PHE B 1 28 ? -3.700  -5.761  -4.321  1.00 0.35 ? 28 PHE B HE1  2  
ATOM 3712  H HE2  . PHE B 1 28 ? -4.049  -6.585  -8.522  1.00 0.35 ? 28 PHE B HE2  2  
ATOM 3713  H HZ   . PHE B 1 28 ? -3.837  -4.957  -6.664  1.00 0.35 ? 28 PHE B HZ   2  
ATOM 3714  N N    . TYR B 1 29 ? -5.178  -10.876 -2.722  1.00 0.32 ? 29 TYR B N    2  
ATOM 3715  C CA   . TYR B 1 29 ? -5.351  -10.434 -1.309  1.00 0.32 ? 29 TYR B CA   2  
ATOM 3716  C C    . TYR B 1 29 ? -4.126  -9.627  -0.874  1.00 0.32 ? 29 TYR B C    2  
ATOM 3717  O O    . TYR B 1 29 ? -3.098  -9.641  -1.522  1.00 0.32 ? 29 TYR B O    2  
ATOM 3718  C CB   . TYR B 1 29 ? -5.501  -11.659 -0.405  1.00 0.32 ? 29 TYR B CB   2  
ATOM 3719  C CG   . TYR B 1 29 ? -6.760  -12.409 -0.772  1.00 0.32 ? 29 TYR B CG   2  
ATOM 3720  C CD1  . TYR B 1 29 ? -6.774  -13.246 -1.895  1.00 0.32 ? 29 TYR B CD1  2  
ATOM 3721  C CD2  . TYR B 1 29 ? -7.912  -12.270 0.012   1.00 0.32 ? 29 TYR B CD2  2  
ATOM 3722  C CE1  . TYR B 1 29 ? -7.940  -13.943 -2.234  1.00 0.32 ? 29 TYR B CE1  2  
ATOM 3723  C CE2  . TYR B 1 29 ? -9.077  -12.967 -0.327  1.00 0.32 ? 29 TYR B CE2  2  
ATOM 3724  C CZ   . TYR B 1 29 ? -9.092  -13.803 -1.449  1.00 0.32 ? 29 TYR B CZ   2  
ATOM 3725  O OH   . TYR B 1 29 ? -10.241 -14.490 -1.782  1.00 0.32 ? 29 TYR B OH   2  
ATOM 3726  H H    . TYR B 1 29 ? -4.753  -11.737 -2.917  1.00 0.32 ? 29 TYR B H    2  
ATOM 3727  H HA   . TYR B 1 29 ? -6.234  -9.818  -1.230  1.00 0.32 ? 29 TYR B HA   2  
ATOM 3728  H HB2  . TYR B 1 29 ? -4.646  -12.307 -0.532  1.00 0.32 ? 29 TYR B HB2  2  
ATOM 3729  H HB3  . TYR B 1 29 ? -5.561  -11.341 0.625   1.00 0.32 ? 29 TYR B HB3  2  
ATOM 3730  H HD1  . TYR B 1 29 ? -5.887  -13.353 -2.501  1.00 0.32 ? 29 TYR B HD1  2  
ATOM 3731  H HD2  . TYR B 1 29 ? -7.901  -11.623 0.877   1.00 0.32 ? 29 TYR B HD2  2  
ATOM 3732  H HE1  . TYR B 1 29 ? -7.952  -14.589 -3.100  1.00 0.32 ? 29 TYR B HE1  2  
ATOM 3733  H HE2  . TYR B 1 29 ? -9.966  -12.859 0.278   1.00 0.32 ? 29 TYR B HE2  2  
ATOM 3734  H HH   . TYR B 1 29 ? -10.965 -13.861 -1.814  1.00 0.32 ? 29 TYR B HH   2  
ATOM 3735  N N    . THR B 1 30 ? -4.226  -8.926  0.222   1.00 0.37 ? 30 THR B N    2  
ATOM 3736  C CA   . THR B 1 30 ? -3.068  -8.120  0.700   1.00 0.37 ? 30 THR B CA   2  
ATOM 3737  C C    . THR B 1 30 ? -3.097  -8.045  2.228   1.00 0.37 ? 30 THR B C    2  
ATOM 3738  O O    . THR B 1 30 ? -4.147  -7.959  2.835   1.00 0.37 ? 30 THR B O    2  
ATOM 3739  C CB   . THR B 1 30 ? -3.155  -6.706  0.120   1.00 0.37 ? 30 THR B CB   2  
ATOM 3740  O OG1  . THR B 1 30 ? -3.962  -5.898  0.963   1.00 0.37 ? 30 THR B OG1  2  
ATOM 3741  C CG2  . THR B 1 30 ? -3.771  -6.763  -1.279  1.00 0.37 ? 30 THR B CG2  2  
ATOM 3742  H H    . THR B 1 30 ? -5.064  -8.929  0.730   1.00 0.37 ? 30 THR B H    2  
ATOM 3743  H HA   . THR B 1 30 ? -2.148  -8.585  0.380   1.00 0.37 ? 30 THR B HA   2  
ATOM 3744  H HB   . THR B 1 30 ? -2.165  -6.282  0.054   1.00 0.37 ? 30 THR B HB   2  
ATOM 3745  H HG1  . THR B 1 30 ? -4.835  -6.298  1.011   1.00 0.37 ? 30 THR B HG1  2  
ATOM 3746  H HG21 . THR B 1 30 ? -4.697  -7.318  -1.241  1.00 0.37 ? 30 THR B HG21 2  
ATOM 3747  H HG22 . THR B 1 30 ? -3.966  -5.760  -1.627  1.00 0.37 ? 30 THR B HG22 2  
ATOM 3748  H HG23 . THR B 1 30 ? -3.086  -7.253  -1.955  1.00 0.37 ? 30 THR B HG23 2  
ATOM 3749  N N    . SER B 1 31 ? -1.953  -8.077  2.854   1.00 0.47 ? 31 SER B N    2  
ATOM 3750  C CA   . SER B 1 31 ? -1.915  -8.009  4.342   1.00 0.47 ? 31 SER B CA   2  
ATOM 3751  C C    . SER B 1 31 ? -0.461  -8.040  4.818   1.00 0.47 ? 31 SER B C    2  
ATOM 3752  O O    . SER B 1 31 ? 0.460   -7.898  4.039   1.00 0.47 ? 31 SER B O    2  
ATOM 3753  C CB   . SER B 1 31 ? -2.670  -9.204  4.926   1.00 0.47 ? 31 SER B CB   2  
ATOM 3754  O OG   . SER B 1 31 ? -3.032  -8.917  6.271   1.00 0.47 ? 31 SER B OG   2  
ATOM 3755  H H    . SER B 1 31 ? -1.118  -8.147  2.346   1.00 0.47 ? 31 SER B H    2  
ATOM 3756  H HA   . SER B 1 31 ? -2.382  -7.092  4.671   1.00 0.47 ? 31 SER B HA   2  
ATOM 3757  H HB2  . SER B 1 31 ? -3.561  -9.386  4.350   1.00 0.47 ? 31 SER B HB2  2  
ATOM 3758  H HB3  . SER B 1 31 ? -2.035  -10.080 4.892   1.00 0.47 ? 31 SER B HB3  2  
ATOM 3759  H HG   . SER B 1 31 ? -3.105  -7.965  6.362   1.00 0.47 ? 31 SER B HG   2  
ATOM 3760  N N    . GLY B 1 32 ? -0.248  -8.226  6.092   1.00 0.60 ? 32 GLY B N    2  
ATOM 3761  C CA   . GLY B 1 32 ? 1.147   -8.266  6.617   1.00 0.60 ? 32 GLY B CA   2  
ATOM 3762  C C    . GLY B 1 32 ? 1.669   -6.839  6.788   1.00 0.60 ? 32 GLY B C    2  
ATOM 3763  O O    . GLY B 1 32 ? 1.759   -6.328  7.887   1.00 0.60 ? 32 GLY B O    2  
ATOM 3764  H H    . GLY B 1 32 ? -1.005  -8.338  6.704   1.00 0.60 ? 32 GLY B H    2  
ATOM 3765  H HA2  . GLY B 1 32 ? 1.157   -8.773  7.571   1.00 0.60 ? 32 GLY B HA2  2  
ATOM 3766  H HA3  . GLY B 1 32 ? 1.779   -8.796  5.920   1.00 0.60 ? 32 GLY B HA3  2  
ATOM 3767  N N    . LYS B 1 33 ? 2.011   -6.189  5.709   1.00 0.55 ? 33 LYS B N    2  
ATOM 3768  C CA   . LYS B 1 33 ? 2.527   -4.795  5.811   1.00 0.55 ? 33 LYS B CA   2  
ATOM 3769  C C    . LYS B 1 33 ? 1.353   -3.814  5.761   1.00 0.55 ? 33 LYS B C    2  
ATOM 3770  O O    . LYS B 1 33 ? 1.519   -2.646  5.470   1.00 0.55 ? 33 LYS B O    2  
ATOM 3771  C CB   . LYS B 1 33 ? 3.473   -4.516  4.643   1.00 0.55 ? 33 LYS B CB   2  
ATOM 3772  C CG   . LYS B 1 33 ? 4.738   -5.362  4.795   1.00 0.55 ? 33 LYS B CG   2  
ATOM 3773  C CD   . LYS B 1 33 ? 5.895   -4.690  4.052   1.00 0.55 ? 33 LYS B CD   2  
ATOM 3774  C CE   . LYS B 1 33 ? 6.625   -5.730  3.199   1.00 0.55 ? 33 LYS B CE   2  
ATOM 3775  N NZ   . LYS B 1 33 ? 7.385   -5.040  2.119   1.00 0.55 ? 33 LYS B NZ   2  
ATOM 3776  H H    . LYS B 1 33 ? 1.930   -6.618  4.833   1.00 0.55 ? 33 LYS B H    2  
ATOM 3777  H HA   . LYS B 1 33 ? 3.058   -4.674  6.743   1.00 0.55 ? 33 LYS B HA   2  
ATOM 3778  H HB2  . LYS B 1 33 ? 2.982   -4.766  3.713   1.00 0.55 ? 33 LYS B HB2  2  
ATOM 3779  H HB3  . LYS B 1 33 ? 3.742   -3.470  4.638   1.00 0.55 ? 33 LYS B HB3  2  
ATOM 3780  H HG2  . LYS B 1 33 ? 4.986   -5.451  5.844   1.00 0.55 ? 33 LYS B HG2  2  
ATOM 3781  H HG3  . LYS B 1 33 ? 4.568   -6.343  4.381   1.00 0.55 ? 33 LYS B HG3  2  
ATOM 3782  H HD2  . LYS B 1 33 ? 5.508   -3.909  3.415   1.00 0.55 ? 33 LYS B HD2  2  
ATOM 3783  H HD3  . LYS B 1 33 ? 6.584   -4.266  4.766   1.00 0.55 ? 33 LYS B HD3  2  
ATOM 3784  H HE2  . LYS B 1 33 ? 7.311   -6.287  3.820   1.00 0.55 ? 33 LYS B HE2  2  
ATOM 3785  H HE3  . LYS B 1 33 ? 5.907   -6.405  2.760   1.00 0.55 ? 33 LYS B HE3  2  
ATOM 3786  H HZ1  . LYS B 1 33 ? 7.372   -4.014  2.285   1.00 0.55 ? 33 LYS B HZ1  2  
ATOM 3787  H HZ2  . LYS B 1 33 ? 8.369   -5.376  2.117   1.00 0.55 ? 33 LYS B HZ2  2  
ATOM 3788  H HZ3  . LYS B 1 33 ? 6.945   -5.249  1.198   1.00 0.55 ? 33 LYS B HZ3  2  
ATOM 3789  N N    . CYS B 1 34 ? 0.166   -4.280  6.040   1.00 0.46 ? 34 CYS B N    2  
ATOM 3790  C CA   . CYS B 1 34 ? -1.017  -3.376  6.007   1.00 0.46 ? 34 CYS B CA   2  
ATOM 3791  C C    . CYS B 1 34 ? -1.718  -3.401  7.367   1.00 0.46 ? 34 CYS B C    2  
ATOM 3792  O O    . CYS B 1 34 ? -1.335  -4.132  8.259   1.00 0.46 ? 34 CYS B O    2  
ATOM 3793  C CB   . CYS B 1 34 ? -1.988  -3.848  4.924   1.00 0.46 ? 34 CYS B CB   2  
ATOM 3794  S SG   . CYS B 1 34 ? -1.061  -4.281  3.431   1.00 0.46 ? 34 CYS B SG   2  
ATOM 3795  H H    . CYS B 1 34 ? 0.053   -5.226  6.271   1.00 0.46 ? 34 CYS B H    2  
ATOM 3796  H HA   . CYS B 1 34 ? -0.695  -2.369  5.787   1.00 0.46 ? 34 CYS B HA   2  
ATOM 3797  H HB2  . CYS B 1 34 ? -2.526  -4.717  5.277   1.00 0.46 ? 34 CYS B HB2  2  
ATOM 3798  H HB3  . CYS B 1 34 ? -2.688  -3.058  4.697   1.00 0.46 ? 34 CYS B HB3  2  
ATOM 3799  N N    . SER B 1 35 ? -2.741  -2.610  7.531   1.00 0.42 ? 35 SER B N    2  
ATOM 3800  C CA   . SER B 1 35 ? -3.465  -2.591  8.833   1.00 0.42 ? 35 SER B CA   2  
ATOM 3801  C C    . SER B 1 35 ? -4.409  -3.791  8.909   1.00 0.42 ? 35 SER B C    2  
ATOM 3802  O O    . SER B 1 35 ? -4.633  -4.353  9.964   1.00 0.42 ? 35 SER B O    2  
ATOM 3803  C CB   . SER B 1 35 ? -4.274  -1.298  8.947   1.00 0.42 ? 35 SER B CB   2  
ATOM 3804  O OG   . SER B 1 35 ? -3.605  -0.401  9.824   1.00 0.42 ? 35 SER B OG   2  
ATOM 3805  H H    . SER B 1 35 ? -3.034  -2.028  6.798   1.00 0.42 ? 35 SER B H    2  
ATOM 3806  H HA   . SER B 1 35 ? -2.752  -2.641  9.642   1.00 0.42 ? 35 SER B HA   2  
ATOM 3807  H HB2  . SER B 1 35 ? -4.366  -0.841  7.975   1.00 0.42 ? 35 SER B HB2  2  
ATOM 3808  H HB3  . SER B 1 35 ? -5.260  -1.525  9.331   1.00 0.42 ? 35 SER B HB3  2  
ATOM 3809  H HG   . SER B 1 35 ? -3.896  0.490   9.615   1.00 0.42 ? 35 SER B HG   2  
ATOM 3810  N N    . ASN B 1 36 ? -4.967  -4.192  7.799   1.00 0.38 ? 36 ASN B N    2  
ATOM 3811  C CA   . ASN B 1 36 ? -5.896  -5.357  7.810   1.00 0.38 ? 36 ASN B CA   2  
ATOM 3812  C C    . ASN B 1 36 ? -5.825  -6.078  6.460   1.00 0.38 ? 36 ASN B C    2  
ATOM 3813  O O    . ASN B 1 36 ? -5.574  -5.462  5.443   1.00 0.38 ? 36 ASN B O    2  
ATOM 3814  C CB   . ASN B 1 36 ? -7.330  -4.873  8.050   1.00 0.38 ? 36 ASN B CB   2  
ATOM 3815  C CG   . ASN B 1 36 ? -7.312  -3.583  8.874   1.00 0.38 ? 36 ASN B CG   2  
ATOM 3816  O OD1  . ASN B 1 36 ? -7.038  -3.607  10.057  1.00 0.38 ? 36 ASN B OD1  2  
ATOM 3817  N ND2  . ASN B 1 36 ? -7.594  -2.450  8.291   1.00 0.38 ? 36 ASN B ND2  2  
ATOM 3818  H H    . ASN B 1 36 ? -4.775  -3.726  6.958   1.00 0.38 ? 36 ASN B H    2  
ATOM 3819  H HA   . ASN B 1 36 ? -5.609  -6.038  8.597   1.00 0.38 ? 36 ASN B HA   2  
ATOM 3820  H HB2  . ASN B 1 36 ? -7.810  -4.687  7.100   1.00 0.38 ? 36 ASN B HB2  2  
ATOM 3821  H HB3  . ASN B 1 36 ? -7.879  -5.632  8.588   1.00 0.38 ? 36 ASN B HB3  2  
ATOM 3822  H HD21 . ASN B 1 36 ? -7.815  -2.430  7.336   1.00 0.38 ? 36 ASN B HD21 2  
ATOM 3823  H HD22 . ASN B 1 36 ? -7.585  -1.617  8.809   1.00 0.38 ? 36 ASN B HD22 2  
ATOM 3824  N N    . PRO B 1 37 ? -6.053  -7.366  6.494   1.00 0.37 ? 37 PRO B N    2  
ATOM 3825  C CA   . PRO B 1 37 ? -6.027  -8.209  5.286   1.00 0.37 ? 37 PRO B CA   2  
ATOM 3826  C C    . PRO B 1 37 ? -7.325  -8.036  4.493   1.00 0.37 ? 37 PRO B C    2  
ATOM 3827  O O    . PRO B 1 37 ? -8.409  -8.141  5.030   1.00 0.37 ? 37 PRO B O    2  
ATOM 3828  C CB   . PRO B 1 37 ? -5.911  -9.631  5.843   1.00 0.37 ? 37 PRO B CB   2  
ATOM 3829  C CG   . PRO B 1 37 ? -6.441  -9.574  7.295   1.00 0.37 ? 37 PRO B CG   2  
ATOM 3830  C CD   . PRO B 1 37 ? -6.356  -8.101  7.739   1.00 0.37 ? 37 PRO B CD   2  
ATOM 3831  H HA   . PRO B 1 37 ? -5.169  -7.978  4.676   1.00 0.37 ? 37 PRO B HA   2  
ATOM 3832  H HB2  . PRO B 1 37 ? -6.509  -10.309 5.251   1.00 0.37 ? 37 PRO B HB2  2  
ATOM 3833  H HB3  . PRO B 1 37 ? -4.880  -9.946  5.844   1.00 0.37 ? 37 PRO B HB3  2  
ATOM 3834  H HG2  . PRO B 1 37 ? -7.467  -9.915  7.327   1.00 0.37 ? 37 PRO B HG2  2  
ATOM 3835  H HG3  . PRO B 1 37 ? -5.827  -10.184 7.939   1.00 0.37 ? 37 PRO B HG3  2  
ATOM 3836  H HD2  . PRO B 1 37 ? -7.301  -7.777  8.153   1.00 0.37 ? 37 PRO B HD2  2  
ATOM 3837  H HD3  . PRO B 1 37 ? -5.561  -7.966  8.454   1.00 0.37 ? 37 PRO B HD3  2  
ATOM 3838  N N    . ALA B 1 38 ? -7.226  -7.768  3.219   1.00 0.33 ? 38 ALA B N    2  
ATOM 3839  C CA   . ALA B 1 38 ? -8.458  -7.586  2.402   1.00 0.33 ? 38 ALA B CA   2  
ATOM 3840  C C    . ALA B 1 38 ? -8.193  -8.032  0.962   1.00 0.33 ? 38 ALA B C    2  
ATOM 3841  O O    . ALA B 1 38 ? -7.078  -8.344  0.594   1.00 0.33 ? 38 ALA B O    2  
ATOM 3842  C CB   . ALA B 1 38 ? -8.861  -6.111  2.411   1.00 0.33 ? 38 ALA B CB   2  
ATOM 3843  H H    . ALA B 1 38 ? -6.342  -7.684  2.803   1.00 0.33 ? 38 ALA B H    2  
ATOM 3844  H HA   . ALA B 1 38 ? -9.258  -8.179  2.820   1.00 0.33 ? 38 ALA B HA   2  
ATOM 3845  H HB1  . ALA B 1 38 ? -7.994  -5.500  2.207   1.00 0.33 ? 38 ALA B HB1  2  
ATOM 3846  H HB2  . ALA B 1 38 ? -9.610  -5.937  1.652   1.00 0.33 ? 38 ALA B HB2  2  
ATOM 3847  H HB3  . ALA B 1 38 ? -9.263  -5.854  3.379   1.00 0.33 ? 38 ALA B HB3  2  
ATOM 3848  N N    . VAL B 1 39 ? -9.211  -8.061  0.147   1.00 0.30 ? 39 VAL B N    2  
ATOM 3849  C CA   . VAL B 1 39 ? -9.020  -8.484  -1.270  1.00 0.30 ? 39 VAL B CA   2  
ATOM 3850  C C    . VAL B 1 39 ? -8.773  -7.249  -2.138  1.00 0.30 ? 39 VAL B C    2  
ATOM 3851  O O    . VAL B 1 39 ? -9.015  -6.131  -1.729  1.00 0.30 ? 39 VAL B O    2  
ATOM 3852  C CB   . VAL B 1 39 ? -10.275 -9.209  -1.758  1.00 0.30 ? 39 VAL B CB   2  
ATOM 3853  C CG1  . VAL B 1 39 ? -10.218 -9.367  -3.279  1.00 0.30 ? 39 VAL B CG1  2  
ATOM 3854  C CG2  . VAL B 1 39 ? -10.350 -10.591 -1.107  1.00 0.30 ? 39 VAL B CG2  2  
ATOM 3855  H H    . VAL B 1 39 ? -10.101 -7.803  0.464   1.00 0.30 ? 39 VAL B H    2  
ATOM 3856  H HA   . VAL B 1 39 ? -8.171  -9.148  -1.337  1.00 0.30 ? 39 VAL B HA   2  
ATOM 3857  H HB   . VAL B 1 39 ? -11.149 -8.635  -1.489  1.00 0.30 ? 39 VAL B HB   2  
ATOM 3858  H HG11 . VAL B 1 39 ? -9.291  -9.847  -3.556  1.00 0.30 ? 39 VAL B HG11 2  
ATOM 3859  H HG12 . VAL B 1 39 ? -11.049 -9.972  -3.609  1.00 0.30 ? 39 VAL B HG12 2  
ATOM 3860  H HG13 . VAL B 1 39 ? -10.272 -8.394  -3.744  1.00 0.30 ? 39 VAL B HG13 2  
ATOM 3861  H HG21 . VAL B 1 39 ? -9.744  -10.601 -0.213  1.00 0.30 ? 39 VAL B HG21 2  
ATOM 3862  H HG22 . VAL B 1 39 ? -11.376 -10.812 -0.848  1.00 0.30 ? 39 VAL B HG22 2  
ATOM 3863  H HG23 . VAL B 1 39 ? -9.985  -11.336 -1.799  1.00 0.30 ? 39 VAL B HG23 2  
ATOM 3864  N N    . VAL B 1 40 ? -8.293  -7.442  -3.336  1.00 0.33 ? 40 VAL B N    2  
ATOM 3865  C CA   . VAL B 1 40 ? -8.031  -6.279  -4.230  1.00 0.33 ? 40 VAL B CA   2  
ATOM 3866  C C    . VAL B 1 40 ? -8.457  -6.630  -5.658  1.00 0.33 ? 40 VAL B C    2  
ATOM 3867  O O    . VAL B 1 40 ? -7.910  -7.520  -6.278  1.00 0.33 ? 40 VAL B O    2  
ATOM 3868  C CB   . VAL B 1 40 ? -6.539  -5.948  -4.209  1.00 0.33 ? 40 VAL B CB   2  
ATOM 3869  C CG1  . VAL B 1 40 ? -6.219  -4.958  -5.331  1.00 0.33 ? 40 VAL B CG1  2  
ATOM 3870  C CG2  . VAL B 1 40 ? -6.176  -5.322  -2.860  1.00 0.33 ? 40 VAL B CG2  2  
ATOM 3871  H H    . VAL B 1 40 ? -8.105  -8.352  -3.648  1.00 0.33 ? 40 VAL B H    2  
ATOM 3872  H HA   . VAL B 1 40 ? -8.595  -5.426  -3.885  1.00 0.33 ? 40 VAL B HA   2  
ATOM 3873  H HB   . VAL B 1 40 ? -5.967  -6.852  -4.354  1.00 0.33 ? 40 VAL B HB   2  
ATOM 3874  H HG11 . VAL B 1 40 ? -6.994  -4.208  -5.381  1.00 0.33 ? 40 VAL B HG11 2  
ATOM 3875  H HG12 . VAL B 1 40 ? -5.270  -4.482  -5.131  1.00 0.33 ? 40 VAL B HG12 2  
ATOM 3876  H HG13 . VAL B 1 40 ? -6.166  -5.485  -6.271  1.00 0.33 ? 40 VAL B HG13 2  
ATOM 3877  H HG21 . VAL B 1 40 ? -6.976  -4.673  -2.537  1.00 0.33 ? 40 VAL B HG21 2  
ATOM 3878  H HG22 . VAL B 1 40 ? -6.028  -6.104  -2.129  1.00 0.33 ? 40 VAL B HG22 2  
ATOM 3879  H HG23 . VAL B 1 40 ? -5.266  -4.748  -2.963  1.00 0.33 ? 40 VAL B HG23 2  
ATOM 3880  N N    . PHE B 1 41 ? -9.430  -5.937  -6.183  1.00 0.37 ? 41 PHE B N    2  
ATOM 3881  C CA   . PHE B 1 41 ? -9.889  -6.232  -7.569  1.00 0.37 ? 41 PHE B CA   2  
ATOM 3882  C C    . PHE B 1 41 ? -9.185  -5.294  -8.553  1.00 0.37 ? 41 PHE B C    2  
ATOM 3883  O O    . PHE B 1 41 ? -9.236  -4.088  -8.418  1.00 0.37 ? 41 PHE B O    2  
ATOM 3884  C CB   . PHE B 1 41 ? -11.402 -6.023  -7.660  1.00 0.37 ? 41 PHE B CB   2  
ATOM 3885  C CG   . PHE B 1 41 ? -12.113 -7.239  -7.117  1.00 0.37 ? 41 PHE B CG   2  
ATOM 3886  C CD1  . PHE B 1 41 ? -12.145 -8.423  -7.864  1.00 0.37 ? 41 PHE B CD1  2  
ATOM 3887  C CD2  . PHE B 1 41 ? -12.741 -7.183  -5.867  1.00 0.37 ? 41 PHE B CD2  2  
ATOM 3888  C CE1  . PHE B 1 41 ? -12.805 -9.551  -7.360  1.00 0.37 ? 41 PHE B CE1  2  
ATOM 3889  C CE2  . PHE B 1 41 ? -13.401 -8.311  -5.363  1.00 0.37 ? 41 PHE B CE2  2  
ATOM 3890  C CZ   . PHE B 1 41 ? -13.433 -9.494  -6.111  1.00 0.37 ? 41 PHE B CZ   2  
ATOM 3891  H H    . PHE B 1 41 ? -9.858  -5.224  -5.667  1.00 0.37 ? 41 PHE B H    2  
ATOM 3892  H HA   . PHE B 1 41 ? -9.652  -7.256  -7.816  1.00 0.37 ? 41 PHE B HA   2  
ATOM 3893  H HB2  . PHE B 1 41 ? -11.681 -5.154  -7.080  1.00 0.37 ? 41 PHE B HB2  2  
ATOM 3894  H HB3  . PHE B 1 41 ? -11.684 -5.873  -8.692  1.00 0.37 ? 41 PHE B HB3  2  
ATOM 3895  H HD1  . PHE B 1 41 ? -11.661 -8.467  -8.828  1.00 0.37 ? 41 PHE B HD1  2  
ATOM 3896  H HD2  . PHE B 1 41 ? -12.717 -6.270  -5.291  1.00 0.37 ? 41 PHE B HD2  2  
ATOM 3897  H HE1  . PHE B 1 41 ? -12.829 -10.464 -7.937  1.00 0.37 ? 41 PHE B HE1  2  
ATOM 3898  H HE2  . PHE B 1 41 ? -13.885 -8.267  -4.399  1.00 0.37 ? 41 PHE B HE2  2  
ATOM 3899  H HZ   . PHE B 1 41 ? -13.943 -10.364 -5.722  1.00 0.37 ? 41 PHE B HZ   2  
ATOM 3900  N N    . VAL B 1 42 ? -8.531  -5.839  -9.541  1.00 0.46 ? 42 VAL B N    2  
ATOM 3901  C CA   . VAL B 1 42 ? -7.827  -4.980  -10.533 1.00 0.46 ? 42 VAL B CA   2  
ATOM 3902  C C    . VAL B 1 42 ? -8.482  -5.146  -11.905 1.00 0.46 ? 42 VAL B C    2  
ATOM 3903  O O    . VAL B 1 42 ? -8.618  -6.242  -12.411 1.00 0.46 ? 42 VAL B O    2  
ATOM 3904  C CB   . VAL B 1 42 ? -6.357  -5.396  -10.616 1.00 0.46 ? 42 VAL B CB   2  
ATOM 3905  C CG1  . VAL B 1 42 ? -5.680  -4.653  -11.769 1.00 0.46 ? 42 VAL B CG1  2  
ATOM 3906  C CG2  . VAL B 1 42 ? -5.654  -5.045  -9.303  1.00 0.46 ? 42 VAL B CG2  2  
ATOM 3907  H H    . VAL B 1 42 ? -8.505  -6.815  -9.632  1.00 0.46 ? 42 VAL B H    2  
ATOM 3908  H HA   . VAL B 1 42 ? -7.892  -3.947  -10.225 1.00 0.46 ? 42 VAL B HA   2  
ATOM 3909  H HB   . VAL B 1 42 ? -6.293  -6.461  -10.788 1.00 0.46 ? 42 VAL B HB   2  
ATOM 3910  H HG11 . VAL B 1 42 ? -6.134  -3.680  -11.887 1.00 0.46 ? 42 VAL B HG11 2  
ATOM 3911  H HG12 . VAL B 1 42 ? -4.628  -4.536  -11.553 1.00 0.46 ? 42 VAL B HG12 2  
ATOM 3912  H HG13 . VAL B 1 42 ? -5.800  -5.218  -12.681 1.00 0.46 ? 42 VAL B HG13 2  
ATOM 3913  H HG21 . VAL B 1 42 ? -5.969  -4.064  -8.976  1.00 0.46 ? 42 VAL B HG21 2  
ATOM 3914  H HG22 . VAL B 1 42 ? -5.913  -5.775  -8.550  1.00 0.46 ? 42 VAL B HG22 2  
ATOM 3915  H HG23 . VAL B 1 42 ? -4.585  -5.047  -9.454  1.00 0.46 ? 42 VAL B HG23 2  
ATOM 3916  N N    . THR B 1 43 ? -8.892  -4.064  -12.511 1.00 0.54 ? 43 THR B N    2  
ATOM 3917  C CA   . THR B 1 43 ? -9.541  -4.159  -13.849 1.00 0.54 ? 43 THR B CA   2  
ATOM 3918  C C    . THR B 1 43 ? -8.475  -4.061  -14.943 1.00 0.54 ? 43 THR B C    2  
ATOM 3919  O O    . THR B 1 43 ? -7.293  -4.017  -14.669 1.00 0.54 ? 43 THR B O    2  
ATOM 3920  C CB   . THR B 1 43 ? -10.544 -3.013  -14.009 1.00 0.54 ? 43 THR B CB   2  
ATOM 3921  O OG1  . THR B 1 43 ? -9.841  -1.785  -14.133 1.00 0.54 ? 43 THR B OG1  2  
ATOM 3922  C CG2  . THR B 1 43 ? -11.461 -2.960  -12.787 1.00 0.54 ? 43 THR B CG2  2  
ATOM 3923  H H    . THR B 1 43 ? -8.774  -3.189  -12.085 1.00 0.54 ? 43 THR B H    2  
ATOM 3924  H HA   . THR B 1 43 ? -10.058 -5.103  -13.932 1.00 0.54 ? 43 THR B HA   2  
ATOM 3925  H HB   . THR B 1 43 ? -11.141 -3.178  -14.894 1.00 0.54 ? 43 THR B HB   2  
ATOM 3926  H HG1  . THR B 1 43 ? -10.454 -1.072  -13.938 1.00 0.54 ? 43 THR B HG1  2  
ATOM 3927  H HG21 . THR B 1 43 ? -11.522 -3.941  -12.339 1.00 0.54 ? 43 THR B HG21 2  
ATOM 3928  H HG22 . THR B 1 43 ? -11.060 -2.261  -12.068 1.00 0.54 ? 43 THR B HG22 2  
ATOM 3929  H HG23 . THR B 1 43 ? -12.446 -2.640  -13.089 1.00 0.54 ? 43 THR B HG23 2  
ATOM 3930  N N    . ARG B 1 44 ? -8.886  -4.028  -16.181 1.00 0.69 ? 44 ARG B N    2  
ATOM 3931  C CA   . ARG B 1 44 ? -7.897  -3.934  -17.292 1.00 0.69 ? 44 ARG B CA   2  
ATOM 3932  C C    . ARG B 1 44 ? -7.288  -2.531  -17.318 1.00 0.69 ? 44 ARG B C    2  
ATOM 3933  O O    . ARG B 1 44 ? -6.272  -2.296  -17.944 1.00 0.69 ? 44 ARG B O    2  
ATOM 3934  C CB   . ARG B 1 44 ? -8.599  -4.209  -18.624 1.00 0.69 ? 44 ARG B CB   2  
ATOM 3935  C CG   . ARG B 1 44 ? -9.095  -5.656  -18.653 1.00 0.69 ? 44 ARG B CG   2  
ATOM 3936  C CD   . ARG B 1 44 ? -10.357 -5.747  -19.511 1.00 0.69 ? 44 ARG B CD   2  
ATOM 3937  N NE   . ARG B 1 44 ? -9.976  -6.013  -20.928 1.00 0.69 ? 44 ARG B NE   2  
ATOM 3938  C CZ   . ARG B 1 44 ? -10.901 -6.224  -21.824 1.00 0.69 ? 44 ARG B CZ   2  
ATOM 3939  N NH1  . ARG B 1 44 ? -12.032 -6.776  -21.476 1.00 0.69 ? 44 ARG B NH1  2  
ATOM 3940  N NH2  . ARG B 1 44 ? -10.696 -5.884  -23.066 1.00 0.69 ? 44 ARG B NH2  2  
ATOM 3941  H H    . ARG B 1 44 ? -9.845  -4.065  -16.382 1.00 0.69 ? 44 ARG B H    2  
ATOM 3942  H HA   . ARG B 1 44 ? -7.115  -4.664  -17.141 1.00 0.69 ? 44 ARG B HA   2  
ATOM 3943  H HB2  . ARG B 1 44 ? -9.439  -3.538  -18.733 1.00 0.69 ? 44 ARG B HB2  2  
ATOM 3944  H HB3  . ARG B 1 44 ? -7.905  -4.052  -19.437 1.00 0.69 ? 44 ARG B HB3  2  
ATOM 3945  H HG2  . ARG B 1 44 ? -8.326  -6.291  -19.071 1.00 0.69 ? 44 ARG B HG2  2  
ATOM 3946  H HG3  . ARG B 1 44 ? -9.321  -5.980  -17.647 1.00 0.69 ? 44 ARG B HG3  2  
ATOM 3947  H HD2  . ARG B 1 44 ? -10.981 -6.552  -19.151 1.00 0.69 ? 44 ARG B HD2  2  
ATOM 3948  H HD3  . ARG B 1 44 ? -10.900 -4.816  -19.453 1.00 0.69 ? 44 ARG B HD3  2  
ATOM 3949  H HE   . ARG B 1 44 ? -9.031  -6.027  -21.187 1.00 0.69 ? 44 ARG B HE   2  
ATOM 3950  H HH11 . ARG B 1 44 ? -12.189 -7.036  -20.525 1.00 0.69 ? 44 ARG B HH11 2  
ATOM 3951  H HH12 . ARG B 1 44 ? -12.741 -6.938  -22.164 1.00 0.69 ? 44 ARG B HH12 2  
ATOM 3952  H HH21 . ARG B 1 44 ? -9.830  -5.460  -23.333 1.00 0.69 ? 44 ARG B HH21 2  
ATOM 3953  H HH22 . ARG B 1 44 ? -11.404 -6.045  -23.753 1.00 0.69 ? 44 ARG B HH22 2  
ATOM 3954  N N    . LYS B 1 45 ? -7.898  -1.596  -16.641 1.00 0.66 ? 45 LYS B N    2  
ATOM 3955  C CA   . LYS B 1 45 ? -7.351  -0.210  -16.629 1.00 0.66 ? 45 LYS B CA   2  
ATOM 3956  C C    . LYS B 1 45 ? -6.361  -0.063  -15.471 1.00 0.66 ? 45 LYS B C    2  
ATOM 3957  O O    . LYS B 1 45 ? -6.259  0.981   -14.858 1.00 0.66 ? 45 LYS B O    2  
ATOM 3958  C CB   . LYS B 1 45 ? -8.497  0.788   -16.450 1.00 0.66 ? 45 LYS B CB   2  
ATOM 3959  C CG   . LYS B 1 45 ? -9.105  1.116   -17.815 1.00 0.66 ? 45 LYS B CG   2  
ATOM 3960  C CD   . LYS B 1 45 ? -9.842  -0.112  -18.354 1.00 0.66 ? 45 LYS B CD   2  
ATOM 3961  C CE   . LYS B 1 45 ? -10.671 0.285   -19.576 1.00 0.66 ? 45 LYS B CE   2  
ATOM 3962  N NZ   . LYS B 1 45 ? -11.481 1.495   -19.256 1.00 0.66 ? 45 LYS B NZ   2  
ATOM 3963  H H    . LYS B 1 45 ? -8.714  -1.806  -16.143 1.00 0.66 ? 45 LYS B H    2  
ATOM 3964  H HA   . LYS B 1 45 ? -6.844  -0.014  -17.562 1.00 0.66 ? 45 LYS B HA   2  
ATOM 3965  H HB2  . LYS B 1 45 ? -9.254  0.356   -15.811 1.00 0.66 ? 45 LYS B HB2  2  
ATOM 3966  H HB3  . LYS B 1 45 ? -8.119  1.693   -16.000 1.00 0.66 ? 45 LYS B HB3  2  
ATOM 3967  H HG2  . LYS B 1 45 ? -9.800  1.937   -17.711 1.00 0.66 ? 45 LYS B HG2  2  
ATOM 3968  H HG3  . LYS B 1 45 ? -8.320  1.392   -18.503 1.00 0.66 ? 45 LYS B HG3  2  
ATOM 3969  H HD2  . LYS B 1 45 ? -9.124  -0.868  -18.635 1.00 0.66 ? 45 LYS B HD2  2  
ATOM 3970  H HD3  . LYS B 1 45 ? -10.497 -0.504  -17.590 1.00 0.66 ? 45 LYS B HD3  2  
ATOM 3971  H HE2  . LYS B 1 45 ? -10.011 0.501   -20.403 1.00 0.66 ? 45 LYS B HE2  2  
ATOM 3972  H HE3  . LYS B 1 45 ? -11.330 -0.528  -19.845 1.00 0.66 ? 45 LYS B HE3  2  
ATOM 3973  H HZ1  . LYS B 1 45 ? -11.937 1.372   -18.330 1.00 0.66 ? 45 LYS B HZ1  2  
ATOM 3974  H HZ2  . LYS B 1 45 ? -10.861 2.329   -19.228 1.00 0.66 ? 45 LYS B HZ2  2  
ATOM 3975  H HZ3  . LYS B 1 45 ? -12.208 1.628   -19.988 1.00 0.66 ? 45 LYS B HZ3  2  
ATOM 3976  N N    . ASN B 1 46 ? -5.631  -1.101  -15.166 1.00 0.61 ? 46 ASN B N    2  
ATOM 3977  C CA   . ASN B 1 46 ? -4.648  -1.019  -14.049 1.00 0.61 ? 46 ASN B CA   2  
ATOM 3978  C C    . ASN B 1 46 ? -5.299  -0.331  -12.848 1.00 0.61 ? 46 ASN B C    2  
ATOM 3979  O O    . ASN B 1 46 ? -4.631  0.264   -12.024 1.00 0.61 ? 46 ASN B O    2  
ATOM 3980  C CB   . ASN B 1 46 ? -3.428  -0.211  -14.501 1.00 0.61 ? 46 ASN B CB   2  
ATOM 3981  C CG   . ASN B 1 46 ? -2.151  -0.951  -14.100 1.00 0.61 ? 46 ASN B CG   2  
ATOM 3982  O OD1  . ASN B 1 46 ? -1.484  -0.570  -13.159 1.00 0.61 ? 46 ASN B OD1  2  
ATOM 3983  N ND2  . ASN B 1 46 ? -1.779  -2.001  -14.781 1.00 0.61 ? 46 ASN B ND2  2  
ATOM 3984  H H    . ASN B 1 46 ? -5.727  -1.933  -15.674 1.00 0.61 ? 46 ASN B H    2  
ATOM 3985  H HA   . ASN B 1 46 ? -4.337  -2.015  -13.769 1.00 0.61 ? 46 ASN B HA   2  
ATOM 3986  H HB2  . ASN B 1 46 ? -3.455  -0.089  -15.574 1.00 0.61 ? 46 ASN B HB2  2  
ATOM 3987  H HB3  . ASN B 1 46 ? -3.443  0.758   -14.027 1.00 0.61 ? 46 ASN B HB3  2  
ATOM 3988  H HD21 . ASN B 1 46 ? -2.316  -2.308  -15.541 1.00 0.61 ? 46 ASN B HD21 2  
ATOM 3989  H HD22 . ASN B 1 46 ? -0.961  -2.481  -14.534 1.00 0.61 ? 46 ASN B HD22 2  
ATOM 3990  N N    . ARG B 1 47 ? -6.597  -0.406  -12.739 1.00 0.52 ? 47 ARG B N    2  
ATOM 3991  C CA   . ARG B 1 47 ? -7.287  0.244   -11.590 1.00 0.52 ? 47 ARG B CA   2  
ATOM 3992  C C    . ARG B 1 47 ? -7.393  -0.750  -10.431 1.00 0.52 ? 47 ARG B C    2  
ATOM 3993  O O    . ARG B 1 47 ? -7.940  -1.826  -10.572 1.00 0.52 ? 47 ARG B O    2  
ATOM 3994  C CB   . ARG B 1 47 ? -8.690  0.681   -12.018 1.00 0.52 ? 47 ARG B CB   2  
ATOM 3995  C CG   . ARG B 1 47 ? -8.779  2.207   -11.991 1.00 0.52 ? 47 ARG B CG   2  
ATOM 3996  C CD   . ARG B 1 47 ? -9.527  2.699   -13.231 1.00 0.52 ? 47 ARG B CD   2  
ATOM 3997  N NE   . ARG B 1 47 ? -10.908 3.106   -12.850 1.00 0.52 ? 47 ARG B NE   2  
ATOM 3998  C CZ   . ARG B 1 47 ? -11.229 4.372   -12.820 1.00 0.52 ? 47 ARG B CZ   2  
ATOM 3999  N NH1  . ARG B 1 47 ? -10.340 5.262   -12.473 1.00 0.52 ? 47 ARG B NH1  2  
ATOM 4000  N NH2  . ARG B 1 47 ? -12.439 4.745   -13.133 1.00 0.52 ? 47 ARG B NH2  2  
ATOM 4001  H H    . ARG B 1 47 ? -7.118  -0.891  -13.413 1.00 0.52 ? 47 ARG B H    2  
ATOM 4002  H HA   . ARG B 1 47 ? -6.722  1.108   -11.272 1.00 0.52 ? 47 ARG B HA   2  
ATOM 4003  H HB2  . ARG B 1 47 ? -8.888  0.325   -13.018 1.00 0.52 ? 47 ARG B HB2  2  
ATOM 4004  H HB3  . ARG B 1 47 ? -9.419  0.267   -11.338 1.00 0.52 ? 47 ARG B HB3  2  
ATOM 4005  H HG2  . ARG B 1 47 ? -9.309  2.521   -11.103 1.00 0.52 ? 47 ARG B HG2  2  
ATOM 4006  H HG3  . ARG B 1 47 ? -7.784  2.627   -11.983 1.00 0.52 ? 47 ARG B HG3  2  
ATOM 4007  H HD2  . ARG B 1 47 ? -9.006  3.544   -13.655 1.00 0.52 ? 47 ARG B HD2  2  
ATOM 4008  H HD3  . ARG B 1 47 ? -9.575  1.903   -13.960 1.00 0.52 ? 47 ARG B HD3  2  
ATOM 4009  H HE   . ARG B 1 47 ? -11.575 2.426   -12.623 1.00 0.52 ? 47 ARG B HE   2  
ATOM 4010  H HH11 . ARG B 1 47 ? -9.413  4.976   -12.232 1.00 0.52 ? 47 ARG B HH11 2  
ATOM 4011  H HH12 . ARG B 1 47 ? -10.586 6.231   -12.449 1.00 0.52 ? 47 ARG B HH12 2  
ATOM 4012  H HH21 . ARG B 1 47 ? -13.120 4.063   -13.398 1.00 0.52 ? 47 ARG B HH21 2  
ATOM 4013  H HH22 . ARG B 1 47 ? -12.685 5.714   -13.110 1.00 0.52 ? 47 ARG B HH22 2  
ATOM 4014  N N    . GLN B 1 48 ? -6.872  -0.399  -9.288  1.00 0.45 ? 48 GLN B N    2  
ATOM 4015  C CA   . GLN B 1 48 ? -6.943  -1.325  -8.122  1.00 0.45 ? 48 GLN B CA   2  
ATOM 4016  C C    . GLN B 1 48 ? -8.184  -1.002  -7.287  1.00 0.45 ? 48 GLN B C    2  
ATOM 4017  O O    . GLN B 1 48 ? -8.574  0.141   -7.152  1.00 0.45 ? 48 GLN B O    2  
ATOM 4018  C CB   . GLN B 1 48 ? -5.690  -1.155  -7.260  1.00 0.45 ? 48 GLN B CB   2  
ATOM 4019  C CG   . GLN B 1 48 ? -4.479  -0.908  -8.161  1.00 0.45 ? 48 GLN B CG   2  
ATOM 4020  C CD   . GLN B 1 48 ? -4.205  -2.157  -9.001  1.00 0.45 ? 48 GLN B CD   2  
ATOM 4021  O OE1  . GLN B 1 48 ? -4.762  -2.320  -10.068 1.00 0.45 ? 48 GLN B OE1  2  
ATOM 4022  N NE2  . GLN B 1 48 ? -3.364  -3.052  -8.561  1.00 0.45 ? 48 GLN B NE2  2  
ATOM 4023  H H    . GLN B 1 48 ? -6.435  0.472   -9.196  1.00 0.45 ? 48 GLN B H    2  
ATOM 4024  H HA   . GLN B 1 48 ? -7.002  -2.344  -8.474  1.00 0.45 ? 48 GLN B HA   2  
ATOM 4025  H HB2  . GLN B 1 48 ? -5.823  -0.313  -6.595  1.00 0.45 ? 48 GLN B HB2  2  
ATOM 4026  H HB3  . GLN B 1 48 ? -5.528  -2.051  -6.680  1.00 0.45 ? 48 GLN B HB3  2  
ATOM 4027  H HG2  . GLN B 1 48 ? -4.682  -0.071  -8.814  1.00 0.45 ? 48 GLN B HG2  2  
ATOM 4028  H HG3  . GLN B 1 48 ? -3.615  -0.690  -7.552  1.00 0.45 ? 48 GLN B HG3  2  
ATOM 4029  H HE21 . GLN B 1 48 ? -2.914  -2.922  -7.701  1.00 0.45 ? 48 GLN B HE21 2  
ATOM 4030  H HE22 . GLN B 1 48 ? -3.182  -3.856  -9.092  1.00 0.45 ? 48 GLN B HE22 2  
ATOM 4031  N N    . VAL B 1 49 ? -8.806  -2.001  -6.723  1.00 0.37 ? 49 VAL B N    2  
ATOM 4032  C CA   . VAL B 1 49 ? -10.021 -1.751  -5.896  1.00 0.37 ? 49 VAL B CA   2  
ATOM 4033  C C    . VAL B 1 49 ? -9.918  -2.549  -4.594  1.00 0.37 ? 49 VAL B C    2  
ATOM 4034  O O    . VAL B 1 49 ? -9.163  -3.495  -4.493  1.00 0.37 ? 49 VAL B O    2  
ATOM 4035  C CB   . VAL B 1 49 ? -11.264 -2.193  -6.669  1.00 0.37 ? 49 VAL B CB   2  
ATOM 4036  C CG1  . VAL B 1 49 ? -12.501 -2.026  -5.785  1.00 0.37 ? 49 VAL B CG1  2  
ATOM 4037  C CG2  . VAL B 1 49 ? -11.416 -1.331  -7.925  1.00 0.37 ? 49 VAL B CG2  2  
ATOM 4038  H H    . VAL B 1 49 ? -8.475  -2.915  -6.844  1.00 0.37 ? 49 VAL B H    2  
ATOM 4039  H HA   . VAL B 1 49 ? -10.091 -0.699  -5.669  1.00 0.37 ? 49 VAL B HA   2  
ATOM 4040  H HB   . VAL B 1 49 ? -11.162 -3.231  -6.952  1.00 0.37 ? 49 VAL B HB   2  
ATOM 4041  H HG11 . VAL B 1 49 ? -12.540 -1.015  -5.408  1.00 0.37 ? 49 VAL B HG11 2  
ATOM 4042  H HG12 . VAL B 1 49 ? -13.389 -2.227  -6.367  1.00 0.37 ? 49 VAL B HG12 2  
ATOM 4043  H HG13 . VAL B 1 49 ? -12.449 -2.717  -4.957  1.00 0.37 ? 49 VAL B HG13 2  
ATOM 4044  H HG21 . VAL B 1 49 ? -10.439 -1.122  -8.337  1.00 0.37 ? 49 VAL B HG21 2  
ATOM 4045  H HG22 . VAL B 1 49 ? -12.009 -1.860  -8.655  1.00 0.37 ? 49 VAL B HG22 2  
ATOM 4046  H HG23 . VAL B 1 49 ? -11.904 -0.403  -7.667  1.00 0.37 ? 49 VAL B HG23 2  
ATOM 4047  N N    . CYS B 1 50 ? -10.672 -2.175  -3.597  1.00 0.29 ? 50 CYS B N    2  
ATOM 4048  C CA   . CYS B 1 50 ? -10.613 -2.915  -2.304  1.00 0.29 ? 50 CYS B CA   2  
ATOM 4049  C C    . CYS B 1 50 ? -11.956 -3.601  -2.047  1.00 0.29 ? 50 CYS B C    2  
ATOM 4050  O O    . CYS B 1 50 ? -13.001 -2.984  -2.103  1.00 0.29 ? 50 CYS B O    2  
ATOM 4051  C CB   . CYS B 1 50 ? -10.318 -1.934  -1.167  1.00 0.29 ? 50 CYS B CB   2  
ATOM 4052  S SG   . CYS B 1 50 ? -8.874  -0.932  -1.599  1.00 0.29 ? 50 CYS B SG   2  
ATOM 4053  H H    . CYS B 1 50 ? -11.274 -1.409  -3.697  1.00 0.29 ? 50 CYS B H    2  
ATOM 4054  H HA   . CYS B 1 50 ? -9.832  -3.658  -2.351  1.00 0.29 ? 50 CYS B HA   2  
ATOM 4055  H HB2  . CYS B 1 50 ? -11.170 -1.291  -1.014  1.00 0.29 ? 50 CYS B HB2  2  
ATOM 4056  H HB3  . CYS B 1 50 ? -10.114 -2.485  -0.261  1.00 0.29 ? 50 CYS B HB3  2  
ATOM 4057  N N    . ALA B 1 51 ? -11.935 -4.874  -1.764  1.00 0.23 ? 51 ALA B N    2  
ATOM 4058  C CA   . ALA B 1 51 ? -13.209 -5.600  -1.502  1.00 0.23 ? 51 ALA B CA   2  
ATOM 4059  C C    . ALA B 1 51 ? -13.027 -6.526  -0.298  1.00 0.23 ? 51 ALA B C    2  
ATOM 4060  O O    . ALA B 1 51 ? -12.051 -7.243  -0.197  1.00 0.23 ? 51 ALA B O    2  
ATOM 4061  C CB   . ALA B 1 51 ? -13.587 -6.429  -2.731  1.00 0.23 ? 51 ALA B CB   2  
ATOM 4062  H H    . ALA B 1 51 ? -11.081 -5.353  -1.723  1.00 0.23 ? 51 ALA B H    2  
ATOM 4063  H HA   . ALA B 1 51 ? -13.993 -4.888  -1.293  1.00 0.23 ? 51 ALA B HA   2  
ATOM 4064  H HB1  . ALA B 1 51 ? -12.706 -6.917  -3.121  1.00 0.23 ? 51 ALA B HB1  2  
ATOM 4065  H HB2  . ALA B 1 51 ? -14.317 -7.175  -2.452  1.00 0.23 ? 51 ALA B HB2  2  
ATOM 4066  H HB3  . ALA B 1 51 ? -14.004 -5.782  -3.489  1.00 0.23 ? 51 ALA B HB3  2  
ATOM 4067  N N    . ASN B 1 52 ? -13.958 -6.520  0.615   1.00 0.26 ? 52 ASN B N    2  
ATOM 4068  C CA   . ASN B 1 52 ? -13.834 -7.400  1.809   1.00 0.26 ? 52 ASN B CA   2  
ATOM 4069  C C    . ASN B 1 52 ? -14.489 -8.753  1.512   1.00 0.26 ? 52 ASN B C    2  
ATOM 4070  O O    . ASN B 1 52 ? -15.470 -8.819  0.797   1.00 0.26 ? 52 ASN B O    2  
ATOM 4071  C CB   . ASN B 1 52 ? -14.533 -6.746  3.002   1.00 0.26 ? 52 ASN B CB   2  
ATOM 4072  C CG   . ASN B 1 52 ? -13.731 -7.017  4.276   1.00 0.26 ? 52 ASN B CG   2  
ATOM 4073  O OD1  . ASN B 1 52 ? -12.518 -6.954  4.269   1.00 0.26 ? 52 ASN B OD1  2  
ATOM 4074  N ND2  . ASN B 1 52 ? -14.362 -7.321  5.378   1.00 0.26 ? 52 ASN B ND2  2  
ATOM 4075  H H    . ASN B 1 52 ? -14.738 -5.934  0.515   1.00 0.26 ? 52 ASN B H    2  
ATOM 4076  H HA   . ASN B 1 52 ? -12.789 -7.547  2.039   1.00 0.26 ? 52 ASN B HA   2  
ATOM 4077  H HB2  . ASN B 1 52 ? -14.600 -5.679  2.839   1.00 0.26 ? 52 ASN B HB2  2  
ATOM 4078  H HB3  . ASN B 1 52 ? -15.525 -7.157  3.109   1.00 0.26 ? 52 ASN B HB3  2  
ATOM 4079  H HD21 . ASN B 1 52 ? -15.340 -7.372  5.383   1.00 0.26 ? 52 ASN B HD21 2  
ATOM 4080  H HD22 . ASN B 1 52 ? -13.857 -7.496  6.199   1.00 0.26 ? 52 ASN B HD22 2  
ATOM 4081  N N    . PRO B 1 53 ? -13.921 -9.795  2.069   1.00 0.30 ? 53 PRO B N    2  
ATOM 4082  C CA   . PRO B 1 53 ? -14.423 -11.169 1.886   1.00 0.30 ? 53 PRO B CA   2  
ATOM 4083  C C    . PRO B 1 53 ? -15.615 -11.440 2.815   1.00 0.30 ? 53 PRO B C    2  
ATOM 4084  O O    . PRO B 1 53 ? -15.717 -12.493 3.412   1.00 0.30 ? 53 PRO B O    2  
ATOM 4085  C CB   . PRO B 1 53 ? -13.227 -12.038 2.281   1.00 0.30 ? 53 PRO B CB   2  
ATOM 4086  C CG   . PRO B 1 53 ? -12.333 -11.166 3.195   1.00 0.30 ? 53 PRO B CG   2  
ATOM 4087  C CD   . PRO B 1 53 ? -12.722 -9.700  2.926   1.00 0.30 ? 53 PRO B CD   2  
ATOM 4088  H HA   . PRO B 1 53 ? -14.688 -11.348 0.858   1.00 0.30 ? 53 PRO B HA   2  
ATOM 4089  H HB2  . PRO B 1 53 ? -13.568 -12.915 2.816   1.00 0.30 ? 53 PRO B HB2  2  
ATOM 4090  H HB3  . PRO B 1 53 ? -12.673 -12.330 1.402   1.00 0.30 ? 53 PRO B HB3  2  
ATOM 4091  H HG2  . PRO B 1 53 ? -12.512 -11.415 4.232   1.00 0.30 ? 53 PRO B HG2  2  
ATOM 4092  H HG3  . PRO B 1 53 ? -11.293 -11.316 2.951   1.00 0.30 ? 53 PRO B HG3  2  
ATOM 4093  H HD2  . PRO B 1 53 ? -12.955 -9.195  3.855   1.00 0.30 ? 53 PRO B HD2  2  
ATOM 4094  H HD3  . PRO B 1 53 ? -11.930 -9.187  2.403   1.00 0.30 ? 53 PRO B HD3  2  
ATOM 4095  N N    . GLU B 1 54 ? -16.515 -10.503 2.941   1.00 0.43 ? 54 GLU B N    2  
ATOM 4096  C CA   . GLU B 1 54 ? -17.692 -10.718 3.830   1.00 0.43 ? 54 GLU B CA   2  
ATOM 4097  C C    . GLU B 1 54 ? -18.970 -10.309 3.095   1.00 0.43 ? 54 GLU B C    2  
ATOM 4098  O O    . GLU B 1 54 ? -20.018 -10.157 3.690   1.00 0.43 ? 54 GLU B O    2  
ATOM 4099  C CB   . GLU B 1 54 ? -17.537 -9.868  5.094   1.00 0.43 ? 54 GLU B CB   2  
ATOM 4100  C CG   . GLU B 1 54 ? -16.444 -10.465 5.981   1.00 0.43 ? 54 GLU B CG   2  
ATOM 4101  C CD   . GLU B 1 54 ? -16.943 -10.543 7.426   1.00 0.43 ? 54 GLU B CD   2  
ATOM 4102  O OE1  . GLU B 1 54 ? -16.913 -9.525  8.097   1.00 0.43 ? 54 GLU B OE1  2  
ATOM 4103  O OE2  . GLU B 1 54 ? -17.349 -11.619 7.835   1.00 0.43 ? 54 GLU B OE2  2  
ATOM 4104  H H    . GLU B 1 54 ? -16.419 -9.661  2.453   1.00 0.43 ? 54 GLU B H    2  
ATOM 4105  H HA   . GLU B 1 54 ? -17.751 -11.761 4.103   1.00 0.43 ? 54 GLU B HA   2  
ATOM 4106  H HB2  . GLU B 1 54 ? -17.267 -8.858  4.818   1.00 0.43 ? 54 GLU B HB2  2  
ATOM 4107  H HB3  . GLU B 1 54 ? -18.471 -9.856  5.636   1.00 0.43 ? 54 GLU B HB3  2  
ATOM 4108  H HG2  . GLU B 1 54 ? -16.198 -11.457 5.631   1.00 0.43 ? 54 GLU B HG2  2  
ATOM 4109  H HG3  . GLU B 1 54 ? -15.565 -9.840  5.940   1.00 0.43 ? 54 GLU B HG3  2  
ATOM 4110  N N    . LYS B 1 55 ? -18.892 -10.129 1.805   1.00 0.47 ? 55 LYS B N    2  
ATOM 4111  C CA   . LYS B 1 55 ? -20.104 -9.731  1.033   1.00 0.47 ? 55 LYS B CA   2  
ATOM 4112  C C    . LYS B 1 55 ? -20.710 -10.966 0.364   1.00 0.47 ? 55 LYS B C    2  
ATOM 4113  O O    . LYS B 1 55 ? -20.215 -12.067 0.504   1.00 0.47 ? 55 LYS B O    2  
ATOM 4114  C CB   . LYS B 1 55 ? -19.715 -8.710  -0.038  1.00 0.47 ? 55 LYS B CB   2  
ATOM 4115  C CG   . LYS B 1 55 ? -19.191 -7.439  0.633   1.00 0.47 ? 55 LYS B CG   2  
ATOM 4116  C CD   . LYS B 1 55 ? -20.211 -6.312  0.456   1.00 0.47 ? 55 LYS B CD   2  
ATOM 4117  C CE   . LYS B 1 55 ? -20.003 -5.259  1.547   1.00 0.47 ? 55 LYS B CE   2  
ATOM 4118  N NZ   . LYS B 1 55 ? -21.067 -5.398  2.581   1.00 0.47 ? 55 LYS B NZ   2  
ATOM 4119  H H    . LYS B 1 55 ? -18.037 -10.256 1.342   1.00 0.47 ? 55 LYS B H    2  
ATOM 4120  H HA   . LYS B 1 55 ? -20.828 -9.292  1.703   1.00 0.47 ? 55 LYS B HA   2  
ATOM 4121  H HB2  . LYS B 1 55 ? -18.945 -9.128  -0.670  1.00 0.47 ? 55 LYS B HB2  2  
ATOM 4122  H HB3  . LYS B 1 55 ? -20.581 -8.469  -0.636  1.00 0.47 ? 55 LYS B HB3  2  
ATOM 4123  H HG2  . LYS B 1 55 ? -19.038 -7.625  1.686   1.00 0.47 ? 55 LYS B HG2  2  
ATOM 4124  H HG3  . LYS B 1 55 ? -18.257 -7.151  0.177   1.00 0.47 ? 55 LYS B HG3  2  
ATOM 4125  H HD2  . LYS B 1 55 ? -20.079 -5.857  -0.514  1.00 0.47 ? 55 LYS B HD2  2  
ATOM 4126  H HD3  . LYS B 1 55 ? -21.210 -6.714  0.534   1.00 0.47 ? 55 LYS B HD3  2  
ATOM 4127  H HE2  . LYS B 1 55 ? -19.036 -5.401  2.005   1.00 0.47 ? 55 LYS B HE2  2  
ATOM 4128  H HE3  . LYS B 1 55 ? -20.053 -4.273  1.109   1.00 0.47 ? 55 LYS B HE3  2  
ATOM 4129  H HZ1  . LYS B 1 55 ? -21.967 -5.648  2.122   1.00 0.47 ? 55 LYS B HZ1  2  
ATOM 4130  H HZ2  . LYS B 1 55 ? -20.804 -6.146  3.253   1.00 0.47 ? 55 LYS B HZ2  2  
ATOM 4131  H HZ3  . LYS B 1 55 ? -21.176 -4.496  3.089   1.00 0.47 ? 55 LYS B HZ3  2  
ATOM 4132  N N    . LYS B 1 56 ? -21.779 -10.793 -0.365  1.00 0.58 ? 56 LYS B N    2  
ATOM 4133  C CA   . LYS B 1 56 ? -22.416 -11.956 -1.043  1.00 0.58 ? 56 LYS B CA   2  
ATOM 4134  C C    . LYS B 1 56 ? -21.900 -12.052 -2.481  1.00 0.58 ? 56 LYS B C    2  
ATOM 4135  O O    . LYS B 1 56 ? -22.105 -13.038 -3.160  1.00 0.58 ? 56 LYS B O    2  
ATOM 4136  C CB   . LYS B 1 56 ? -23.934 -11.769 -1.058  1.00 0.58 ? 56 LYS B CB   2  
ATOM 4137  C CG   . LYS B 1 56 ? -24.268 -10.328 -1.445  1.00 0.58 ? 56 LYS B CG   2  
ATOM 4138  C CD   . LYS B 1 56 ? -25.563 -10.306 -2.261  1.00 0.58 ? 56 LYS B CD   2  
ATOM 4139  C CE   . LYS B 1 56 ? -25.546 -9.108  -3.212  1.00 0.58 ? 56 LYS B CE   2  
ATOM 4140  N NZ   . LYS B 1 56 ? -25.486 -9.592  -4.621  1.00 0.58 ? 56 LYS B NZ   2  
ATOM 4141  H H    . LYS B 1 56 ? -22.162 -9.896  -0.466  1.00 0.58 ? 56 LYS B H    2  
ATOM 4142  H HA   . LYS B 1 56 ? -22.169 -12.862 -0.511  1.00 0.58 ? 56 LYS B HA   2  
ATOM 4143  H HB2  . LYS B 1 56 ? -24.373 -12.448 -1.775  1.00 0.58 ? 56 LYS B HB2  2  
ATOM 4144  H HB3  . LYS B 1 56 ? -24.331 -11.977 -0.075  1.00 0.58 ? 56 LYS B HB3  2  
ATOM 4145  H HG2  . LYS B 1 56 ? -24.396 -9.735  -0.551  1.00 0.58 ? 56 LYS B HG2  2  
ATOM 4146  H HG3  . LYS B 1 56 ? -23.464 -9.919  -2.038  1.00 0.58 ? 56 LYS B HG3  2  
ATOM 4147  H HD2  . LYS B 1 56 ? -25.643 -11.219 -2.833  1.00 0.58 ? 56 LYS B HD2  2  
ATOM 4148  H HD3  . LYS B 1 56 ? -26.408 -10.222 -1.595  1.00 0.58 ? 56 LYS B HD3  2  
ATOM 4149  H HE2  . LYS B 1 56 ? -26.444 -8.523  -3.071  1.00 0.58 ? 56 LYS B HE2  2  
ATOM 4150  H HE3  . LYS B 1 56 ? -24.682 -8.496  -3.006  1.00 0.58 ? 56 LYS B HE3  2  
ATOM 4151  H HZ1  . LYS B 1 56 ? -25.712 -10.608 -4.647  1.00 0.58 ? 56 LYS B HZ1  2  
ATOM 4152  H HZ2  . LYS B 1 56 ? -26.175 -9.068  -5.197  1.00 0.58 ? 56 LYS B HZ2  2  
ATOM 4153  H HZ3  . LYS B 1 56 ? -24.531 -9.439  -5.001  1.00 0.58 ? 56 LYS B HZ3  2  
ATOM 4154  N N    . TRP B 1 57 ? -21.231 -11.034 -2.950  1.00 0.41 ? 57 TRP B N    2  
ATOM 4155  C CA   . TRP B 1 57 ? -20.704 -11.067 -4.344  1.00 0.41 ? 57 TRP B CA   2  
ATOM 4156  C C    . TRP B 1 57 ? -19.174 -11.049 -4.310  1.00 0.41 ? 57 TRP B C    2  
ATOM 4157  O O    . TRP B 1 57 ? -18.520 -11.508 -5.225  1.00 0.41 ? 57 TRP B O    2  
ATOM 4158  C CB   . TRP B 1 57 ? -21.212 -9.845  -5.111  1.00 0.41 ? 57 TRP B CB   2  
ATOM 4159  C CG   . TRP B 1 57 ? -20.580 -8.610  -4.553  1.00 0.41 ? 57 TRP B CG   2  
ATOM 4160  C CD1  . TRP B 1 57 ? -21.140 -7.803  -3.624  1.00 0.41 ? 57 TRP B CD1  2  
ATOM 4161  C CD2  . TRP B 1 57 ? -19.282 -8.030  -4.871  1.00 0.41 ? 57 TRP B CD2  2  
ATOM 4162  N NE1  . TRP B 1 57 ? -20.269 -6.763  -3.350  1.00 0.41 ? 57 TRP B NE1  2  
ATOM 4163  C CE2  . TRP B 1 57 ? -19.110 -6.860  -4.094  1.00 0.41 ? 57 TRP B CE2  2  
ATOM 4164  C CE3  . TRP B 1 57 ? -18.248 -8.402  -5.749  1.00 0.41 ? 57 TRP B CE3  2  
ATOM 4165  C CZ2  . TRP B 1 57 ? -17.952 -6.086  -4.186  1.00 0.41 ? 57 TRP B CZ2  2  
ATOM 4166  C CZ3  . TRP B 1 57 ? -17.082 -7.626  -5.843  1.00 0.41 ? 57 TRP B CZ3  2  
ATOM 4167  C CH2  . TRP B 1 57 ? -16.935 -6.470  -5.063  1.00 0.41 ? 57 TRP B CH2  2  
ATOM 4168  H H    . TRP B 1 57 ? -21.077 -10.247 -2.387  1.00 0.41 ? 57 TRP B H    2  
ATOM 4169  H HA   . TRP B 1 57 ? -21.042 -11.968 -4.835  1.00 0.41 ? 57 TRP B HA   2  
ATOM 4170  H HB2  . TRP B 1 57 ? -20.954 -9.942  -6.154  1.00 0.41 ? 57 TRP B HB2  2  
ATOM 4171  H HB3  . TRP B 1 57 ? -22.285 -9.777  -5.010  1.00 0.41 ? 57 TRP B HB3  2  
ATOM 4172  H HD1  . TRP B 1 57 ? -22.109 -7.945  -3.168  1.00 0.41 ? 57 TRP B HD1  2  
ATOM 4173  H HE1  . TRP B 1 57 ? -20.435 -6.039  -2.712  1.00 0.41 ? 57 TRP B HE1  2  
ATOM 4174  H HE3  . TRP B 1 57 ? -18.352 -9.290  -6.354  1.00 0.41 ? 57 TRP B HE3  2  
ATOM 4175  H HZ2  . TRP B 1 57 ? -17.843 -5.197  -3.583  1.00 0.41 ? 57 TRP B HZ2  2  
ATOM 4176  H HZ3  . TRP B 1 57 ? -16.294 -7.920  -6.521  1.00 0.41 ? 57 TRP B HZ3  2  
ATOM 4177  H HH2  . TRP B 1 57 ? -16.035 -5.876  -5.141  1.00 0.41 ? 57 TRP B HH2  2  
ATOM 4178  N N    . VAL B 1 58 ? -18.598 -10.525 -3.263  1.00 0.32 ? 58 VAL B N    2  
ATOM 4179  C CA   . VAL B 1 58 ? -17.112 -10.483 -3.176  1.00 0.32 ? 58 VAL B CA   2  
ATOM 4180  C C    . VAL B 1 58 ? -16.562 -11.908 -3.250  1.00 0.32 ? 58 VAL B C    2  
ATOM 4181  O O    . VAL B 1 58 ? -15.861 -12.267 -4.177  1.00 0.32 ? 58 VAL B O    2  
ATOM 4182  C CB   . VAL B 1 58 ? -16.695 -9.842  -1.851  1.00 0.32 ? 58 VAL B CB   2  
ATOM 4183  C CG1  . VAL B 1 58 ? -15.182 -9.974  -1.673  1.00 0.32 ? 58 VAL B CG1  2  
ATOM 4184  C CG2  . VAL B 1 58 ? -17.080 -8.361  -1.860  1.00 0.32 ? 58 VAL B CG2  2  
ATOM 4185  H H    . VAL B 1 58 ? -19.144 -10.161 -2.535  1.00 0.32 ? 58 VAL B H    2  
ATOM 4186  H HA   . VAL B 1 58 ? -16.719 -9.902  -3.997  1.00 0.32 ? 58 VAL B HA   2  
ATOM 4187  H HB   . VAL B 1 58 ? -17.198 -10.342 -1.036  1.00 0.32 ? 58 VAL B HB   2  
ATOM 4188  H HG11 . VAL B 1 58 ? -14.727 -10.213 -2.623  1.00 0.32 ? 58 VAL B HG11 2  
ATOM 4189  H HG12 . VAL B 1 58 ? -14.780 -9.040  -1.306  1.00 0.32 ? 58 VAL B HG12 2  
ATOM 4190  H HG13 . VAL B 1 58 ? -14.970 -10.760 -0.964  1.00 0.32 ? 58 VAL B HG13 2  
ATOM 4191  H HG21 . VAL B 1 58 ? -18.121 -8.261  -2.127  1.00 0.32 ? 58 VAL B HG21 2  
ATOM 4192  H HG22 . VAL B 1 58 ? -16.918 -7.941  -0.877  1.00 0.32 ? 58 VAL B HG22 2  
ATOM 4193  H HG23 . VAL B 1 58 ? -16.470 -7.835  -2.580  1.00 0.32 ? 58 VAL B HG23 2  
ATOM 4194  N N    . ARG B 1 59 ? -16.876 -12.726 -2.283  1.00 0.34 ? 59 ARG B N    2  
ATOM 4195  C CA   . ARG B 1 59 ? -16.375 -14.129 -2.304  1.00 0.34 ? 59 ARG B CA   2  
ATOM 4196  C C    . ARG B 1 59 ? -16.847 -14.812 -3.588  1.00 0.34 ? 59 ARG B C    2  
ATOM 4197  O O    . ARG B 1 59 ? -16.326 -15.833 -3.989  1.00 0.34 ? 59 ARG B O    2  
ATOM 4198  C CB   . ARG B 1 59 ? -16.921 -14.885 -1.091  1.00 0.34 ? 59 ARG B CB   2  
ATOM 4199  C CG   . ARG B 1 59 ? -16.397 -16.322 -1.106  1.00 0.34 ? 59 ARG B CG   2  
ATOM 4200  C CD   . ARG B 1 59 ? -17.570 -17.295 -0.984  1.00 0.34 ? 59 ARG B CD   2  
ATOM 4201  N NE   . ARG B 1 59 ? -17.471 -18.330 -2.051  1.00 0.34 ? 59 ARG B NE   2  
ATOM 4202  C CZ   . ARG B 1 59 ? -18.357 -19.286 -2.118  1.00 0.34 ? 59 ARG B CZ   2  
ATOM 4203  N NH1  . ARG B 1 59 ? -18.443 -20.164 -1.157  1.00 0.34 ? 59 ARG B NH1  2  
ATOM 4204  N NH2  . ARG B 1 59 ? -19.156 -19.363 -3.147  1.00 0.34 ? 59 ARG B NH2  2  
ATOM 4205  H H    . ARG B 1 59 ? -17.445 -12.420 -1.547  1.00 0.34 ? 59 ARG B H    2  
ATOM 4206  H HA   . ARG B 1 59 ? -15.295 -14.126 -2.272  1.00 0.34 ? 59 ARG B HA   2  
ATOM 4207  H HB2  . ARG B 1 59 ? -16.598 -14.393 -0.185  1.00 0.34 ? 59 ARG B HB2  2  
ATOM 4208  H HB3  . ARG B 1 59 ? -18.000 -14.897 -1.129  1.00 0.34 ? 59 ARG B HB3  2  
ATOM 4209  H HG2  . ARG B 1 59 ? -15.872 -16.504 -2.034  1.00 0.34 ? 59 ARG B HG2  2  
ATOM 4210  H HG3  . ARG B 1 59 ? -15.722 -16.468 -0.276  1.00 0.34 ? 59 ARG B HG3  2  
ATOM 4211  H HD2  . ARG B 1 59 ? -17.543 -17.773 -0.016  1.00 0.34 ? 59 ARG B HD2  2  
ATOM 4212  H HD3  . ARG B 1 59 ? -18.499 -16.754 -1.093  1.00 0.34 ? 59 ARG B HD3  2  
ATOM 4213  H HE   . ARG B 1 59 ? -16.740 -18.293 -2.704  1.00 0.34 ? 59 ARG B HE   2  
ATOM 4214  H HH11 . ARG B 1 59 ? -17.830 -20.104 -0.369  1.00 0.34 ? 59 ARG B HH11 2  
ATOM 4215  H HH12 . ARG B 1 59 ? -19.122 -20.897 -1.208  1.00 0.34 ? 59 ARG B HH12 2  
ATOM 4216  H HH21 . ARG B 1 59 ? -19.091 -18.690 -3.883  1.00 0.34 ? 59 ARG B HH21 2  
ATOM 4217  H HH22 . ARG B 1 59 ? -19.836 -20.095 -3.197  1.00 0.34 ? 59 ARG B HH22 2  
ATOM 4218  N N    . GLU B 1 60 ? -17.831 -14.251 -4.239  1.00 0.37 ? 60 GLU B N    2  
ATOM 4219  C CA   . GLU B 1 60 ? -18.336 -14.862 -5.499  1.00 0.37 ? 60 GLU B CA   2  
ATOM 4220  C C    . GLU B 1 60 ? -17.313 -14.641 -6.614  1.00 0.37 ? 60 GLU B C    2  
ATOM 4221  O O    . GLU B 1 60 ? -16.997 -15.540 -7.368  1.00 0.37 ? 60 GLU B O    2  
ATOM 4222  C CB   . GLU B 1 60 ? -19.665 -14.207 -5.885  1.00 0.37 ? 60 GLU B CB   2  
ATOM 4223  C CG   . GLU B 1 60 ? -20.825 -15.056 -5.362  1.00 0.37 ? 60 GLU B CG   2  
ATOM 4224  C CD   . GLU B 1 60 ? -22.150 -14.472 -5.855  1.00 0.37 ? 60 GLU B CD   2  
ATOM 4225  O OE1  . GLU B 1 60 ? -22.222 -13.262 -6.002  1.00 0.37 ? 60 GLU B OE1  2  
ATOM 4226  O OE2  . GLU B 1 60 ? -23.068 -15.242 -6.077  1.00 0.37 ? 60 GLU B OE2  2  
ATOM 4227  H H    . GLU B 1 60 ? -18.234 -13.425 -3.899  1.00 0.37 ? 60 GLU B H    2  
ATOM 4228  H HA   . GLU B 1 60 ? -18.486 -15.922 -5.351  1.00 0.37 ? 60 GLU B HA   2  
ATOM 4229  H HB2  . GLU B 1 60 ? -19.718 -13.219 -5.453  1.00 0.37 ? 60 GLU B HB2  2  
ATOM 4230  H HB3  . GLU B 1 60 ? -19.731 -14.134 -6.960  1.00 0.37 ? 60 GLU B HB3  2  
ATOM 4231  H HG2  . GLU B 1 60 ? -20.721 -16.069 -5.724  1.00 0.37 ? 60 GLU B HG2  2  
ATOM 4232  H HG3  . GLU B 1 60 ? -20.813 -15.056 -4.283  1.00 0.37 ? 60 GLU B HG3  2  
ATOM 4233  N N    . TYR B 1 61 ? -16.791 -13.449 -6.724  1.00 0.36 ? 61 TYR B N    2  
ATOM 4234  C CA   . TYR B 1 61 ? -15.786 -13.169 -7.788  1.00 0.36 ? 61 TYR B CA   2  
ATOM 4235  C C    . TYR B 1 61 ? -14.493 -13.923 -7.475  1.00 0.36 ? 61 TYR B C    2  
ATOM 4236  O O    . TYR B 1 61 ? -13.878 -14.506 -8.345  1.00 0.36 ? 61 TYR B O    2  
ATOM 4237  C CB   . TYR B 1 61 ? -15.500 -11.665 -7.836  1.00 0.36 ? 61 TYR B CB   2  
ATOM 4238  C CG   . TYR B 1 61 ? -16.595 -10.954 -8.602  1.00 0.36 ? 61 TYR B CG   2  
ATOM 4239  C CD1  . TYR B 1 61 ? -17.832 -11.580 -8.811  1.00 0.36 ? 61 TYR B CD1  2  
ATOM 4240  C CD2  . TYR B 1 61 ? -16.372 -9.667  -9.101  1.00 0.36 ? 61 TYR B CD2  2  
ATOM 4241  C CE1  . TYR B 1 61 ? -18.842 -10.918 -9.519  1.00 0.36 ? 61 TYR B CE1  2  
ATOM 4242  C CE2  . TYR B 1 61 ? -17.381 -9.004  -9.810  1.00 0.36 ? 61 TYR B CE2  2  
ATOM 4243  C CZ   . TYR B 1 61 ? -18.616 -9.630  -10.019 1.00 0.36 ? 61 TYR B CZ   2  
ATOM 4244  O OH   . TYR B 1 61 ? -19.611 -8.976  -10.718 1.00 0.36 ? 61 TYR B OH   2  
ATOM 4245  H H    . TYR B 1 61 ? -17.059 -12.740 -6.104  1.00 0.36 ? 61 TYR B H    2  
ATOM 4246  H HA   . TYR B 1 61 ? -16.172 -13.493 -8.742  1.00 0.36 ? 61 TYR B HA   2  
ATOM 4247  H HB2  . TYR B 1 61 ? -15.457 -11.276 -6.829  1.00 0.36 ? 61 TYR B HB2  2  
ATOM 4248  H HB3  . TYR B 1 61 ? -14.553 -11.496 -8.326  1.00 0.36 ? 61 TYR B HB3  2  
ATOM 4249  H HD1  . TYR B 1 61 ? -18.007 -12.575 -8.427  1.00 0.36 ? 61 TYR B HD1  2  
ATOM 4250  H HD2  . TYR B 1 61 ? -15.420 -9.183  -8.940  1.00 0.36 ? 61 TYR B HD2  2  
ATOM 4251  H HE1  . TYR B 1 61 ? -19.795 -11.400 -9.681  1.00 0.36 ? 61 TYR B HE1  2  
ATOM 4252  H HE2  . TYR B 1 61 ? -17.208 -8.010  -10.196 1.00 0.36 ? 61 TYR B HE2  2  
ATOM 4253  H HH   . TYR B 1 61 ? -19.243 -8.684  -11.555 1.00 0.36 ? 61 TYR B HH   2  
ATOM 4254  N N    . ILE B 1 62 ? -14.077 -13.919 -6.239  1.00 0.38 ? 62 ILE B N    2  
ATOM 4255  C CA   . ILE B 1 62 ? -12.824 -14.636 -5.872  1.00 0.38 ? 62 ILE B CA   2  
ATOM 4256  C C    . ILE B 1 62 ? -12.986 -16.128 -6.173  1.00 0.38 ? 62 ILE B C    2  
ATOM 4257  O O    . ILE B 1 62 ? -12.093 -16.765 -6.695  1.00 0.38 ? 62 ILE B O    2  
ATOM 4258  C CB   . ILE B 1 62 ? -12.543 -14.444 -4.380  1.00 0.38 ? 62 ILE B CB   2  
ATOM 4259  C CG1  . ILE B 1 62 ? -12.254 -12.967 -4.104  1.00 0.38 ? 62 ILE B CG1  2  
ATOM 4260  C CG2  . ILE B 1 62 ? -11.331 -15.284 -3.975  1.00 0.38 ? 62 ILE B CG2  2  
ATOM 4261  C CD1  . ILE B 1 62 ? -13.065 -12.504 -2.893  1.00 0.38 ? 62 ILE B CD1  2  
ATOM 4262  H H    . ILE B 1 62 ? -14.589 -13.442 -5.550  1.00 0.38 ? 62 ILE B H    2  
ATOM 4263  H HA   . ILE B 1 62 ? -12.000 -14.240 -6.447  1.00 0.38 ? 62 ILE B HA   2  
ATOM 4264  H HB   . ILE B 1 62 ? -13.406 -14.757 -3.808  1.00 0.38 ? 62 ILE B HB   2  
ATOM 4265  H HG12 . ILE B 1 62 ? -11.199 -12.838 -3.903  1.00 0.38 ? 62 ILE B HG12 2  
ATOM 4266  H HG13 . ILE B 1 62 ? -12.529 -12.377 -4.966  1.00 0.38 ? 62 ILE B HG13 2  
ATOM 4267  H HG21 . ILE B 1 62 ? -11.142 -16.032 -4.731  1.00 0.38 ? 62 ILE B HG21 2  
ATOM 4268  H HG22 . ILE B 1 62 ? -10.466 -14.645 -3.877  1.00 0.38 ? 62 ILE B HG22 2  
ATOM 4269  H HG23 . ILE B 1 62 ? -11.529 -15.769 -3.031  1.00 0.38 ? 62 ILE B HG23 2  
ATOM 4270  H HD11 . ILE B 1 62 ? -13.606 -13.343 -2.480  1.00 0.38 ? 62 ILE B HD11 2  
ATOM 4271  H HD12 . ILE B 1 62 ? -12.398 -12.103 -2.144  1.00 0.38 ? 62 ILE B HD12 2  
ATOM 4272  H HD13 . ILE B 1 62 ? -13.764 -11.739 -3.199  1.00 0.38 ? 62 ILE B HD13 2  
ATOM 4273  N N    . ASN B 1 63 ? -14.119 -16.688 -5.848  1.00 0.49 ? 63 ASN B N    2  
ATOM 4274  C CA   . ASN B 1 63 ? -14.337 -18.138 -6.118  1.00 0.49 ? 63 ASN B CA   2  
ATOM 4275  C C    . ASN B 1 63 ? -14.588 -18.345 -7.613  1.00 0.49 ? 63 ASN B C    2  
ATOM 4276  O O    . ASN B 1 63 ? -14.456 -19.437 -8.128  1.00 0.49 ? 63 ASN B O    2  
ATOM 4277  C CB   . ASN B 1 63 ? -15.548 -18.627 -5.324  1.00 0.49 ? 63 ASN B CB   2  
ATOM 4278  C CG   . ASN B 1 63 ? -15.944 -20.025 -5.806  1.00 0.49 ? 63 ASN B CG   2  
ATOM 4279  O OD1  . ASN B 1 63 ? -15.254 -20.990 -5.541  1.00 0.49 ? 63 ASN B OD1  2  
ATOM 4280  N ND2  . ASN B 1 63 ? -17.034 -20.176 -6.507  1.00 0.49 ? 63 ASN B ND2  2  
ATOM 4281  H H    . ASN B 1 63 ? -14.827 -16.156 -5.429  1.00 0.49 ? 63 ASN B H    2  
ATOM 4282  H HA   . ASN B 1 63 ? -13.461 -18.694 -5.819  1.00 0.49 ? 63 ASN B HA   2  
ATOM 4283  H HB2  . ASN B 1 63 ? -15.299 -18.666 -4.272  1.00 0.49 ? 63 ASN B HB2  2  
ATOM 4284  H HB3  . ASN B 1 63 ? -16.376 -17.950 -5.473  1.00 0.49 ? 63 ASN B HB3  2  
ATOM 4285  H HD21 . ASN B 1 63 ? -17.591 -19.397 -6.721  1.00 0.49 ? 63 ASN B HD21 2  
ATOM 4286  H HD22 . ASN B 1 63 ? -17.296 -21.066 -6.821  1.00 0.49 ? 63 ASN B HD22 2  
ATOM 4287  N N    . SER B 1 64 ? -14.950 -17.305 -8.312  1.00 0.55 ? 64 SER B N    2  
ATOM 4288  C CA   . SER B 1 64 ? -15.210 -17.443 -9.773  1.00 0.55 ? 64 SER B CA   2  
ATOM 4289  C C    . SER B 1 64 ? -13.880 -17.434 -10.530 1.00 0.55 ? 64 SER B C    2  
ATOM 4290  O O    . SER B 1 64 ? -13.740 -18.053 -11.565 1.00 0.55 ? 64 SER B O    2  
ATOM 4291  C CB   . SER B 1 64 ? -16.076 -16.278 -10.250 1.00 0.55 ? 64 SER B CB   2  
ATOM 4292  O OG   . SER B 1 64 ? -15.245 -15.274 -10.817 1.00 0.55 ? 64 SER B OG   2  
ATOM 4293  H H    . SER B 1 64 ? -15.051 -16.433 -7.878  1.00 0.55 ? 64 SER B H    2  
ATOM 4294  H HA   . SER B 1 64 ? -15.723 -18.375 -9.960  1.00 0.55 ? 64 SER B HA   2  
ATOM 4295  H HB2  . SER B 1 64 ? -16.772 -16.624 -10.995 1.00 0.55 ? 64 SER B HB2  2  
ATOM 4296  H HB3  . SER B 1 64 ? -16.627 -15.872 -9.410  1.00 0.55 ? 64 SER B HB3  2  
ATOM 4297  H HG   . SER B 1 64 ? -14.475 -15.172 -10.250 1.00 0.55 ? 64 SER B HG   2  
ATOM 4298  N N    . LEU B 1 65 ? -12.902 -16.736 -10.021 1.00 0.53 ? 65 LEU B N    2  
ATOM 4299  C CA   . LEU B 1 65 ? -11.583 -16.687 -10.712 1.00 0.53 ? 65 LEU B CA   2  
ATOM 4300  C C    . LEU B 1 65 ? -10.754 -17.910 -10.313 1.00 0.53 ? 65 LEU B C    2  
ATOM 4301  O O    . LEU B 1 65 ? -10.020 -18.460 -11.109 1.00 0.53 ? 65 LEU B O    2  
ATOM 4302  C CB   . LEU B 1 65 ? -10.841 -15.413 -10.303 1.00 0.53 ? 65 LEU B CB   2  
ATOM 4303  C CG   . LEU B 1 65 ? -10.474 -14.612 -11.553 1.00 0.53 ? 65 LEU B CG   2  
ATOM 4304  C CD1  . LEU B 1 65 ? -11.579 -13.597 -11.853 1.00 0.53 ? 65 LEU B CD1  2  
ATOM 4305  C CD2  . LEU B 1 65 ? -9.156  -13.872 -11.316 1.00 0.53 ? 65 LEU B CD2  2  
ATOM 4306  H H    . LEU B 1 65 ? -13.036 -16.243 -9.184  1.00 0.53 ? 65 LEU B H    2  
ATOM 4307  H HA   . LEU B 1 65 ? -11.735 -16.688 -11.780 1.00 0.53 ? 65 LEU B HA   2  
ATOM 4308  H HB2  . LEU B 1 65 ? -11.477 -14.815 -9.665  1.00 0.53 ? 65 LEU B HB2  2  
ATOM 4309  H HB3  . LEU B 1 65 ? -9.939  -15.675 -9.770  1.00 0.53 ? 65 LEU B HB3  2  
ATOM 4310  H HG   . LEU B 1 65 ? -10.367 -15.284 -12.393 1.00 0.53 ? 65 LEU B HG   2  
ATOM 4311  H HD11 . LEU B 1 65 ? -12.523 -14.112 -11.952 1.00 0.53 ? 65 LEU B HD11 2  
ATOM 4312  H HD12 . LEU B 1 65 ? -11.641 -12.884 -11.044 1.00 0.53 ? 65 LEU B HD12 2  
ATOM 4313  H HD13 . LEU B 1 65 ? -11.354 -13.079 -12.773 1.00 0.53 ? 65 LEU B HD13 2  
ATOM 4314  H HD21 . LEU B 1 65 ? -8.803  -14.078 -10.316 1.00 0.53 ? 65 LEU B HD21 2  
ATOM 4315  H HD22 . LEU B 1 65 ? -8.421  -14.208 -12.034 1.00 0.53 ? 65 LEU B HD22 2  
ATOM 4316  H HD23 . LEU B 1 65 ? -9.312  -12.811 -11.431 1.00 0.53 ? 65 LEU B HD23 2  
ATOM 4317  N N    . GLU B 1 66 ? -10.866 -18.340 -9.086  1.00 0.61 ? 66 GLU B N    2  
ATOM 4318  C CA   . GLU B 1 66 ? -10.085 -19.527 -8.637  1.00 0.61 ? 66 GLU B CA   2  
ATOM 4319  C C    . GLU B 1 66 ? -10.902 -20.796 -8.887  1.00 0.61 ? 66 GLU B C    2  
ATOM 4320  O O    . GLU B 1 66 ? -11.667 -20.879 -9.826  1.00 0.61 ? 66 GLU B O    2  
ATOM 4321  C CB   . GLU B 1 66 ? -9.778  -19.398 -7.145  1.00 0.61 ? 66 GLU B CB   2  
ATOM 4322  C CG   . GLU B 1 66 ? -9.107  -18.050 -6.874  1.00 0.61 ? 66 GLU B CG   2  
ATOM 4323  C CD   . GLU B 1 66 ? -7.661  -18.090 -7.369  1.00 0.61 ? 66 GLU B CD   2  
ATOM 4324  O OE1  . GLU B 1 66 ? -6.817  -18.577 -6.635  1.00 0.61 ? 66 GLU B OE1  2  
ATOM 4325  O OE2  . GLU B 1 66 ? -7.421  -17.633 -8.474  1.00 0.61 ? 66 GLU B OE2  2  
ATOM 4326  H H    . GLU B 1 66 ? -11.465 -17.883 -8.459  1.00 0.61 ? 66 GLU B H    2  
ATOM 4327  H HA   . GLU B 1 66 ? -9.160  -19.579 -9.193  1.00 0.61 ? 66 GLU B HA   2  
ATOM 4328  H HB2  . GLU B 1 66 ? -10.698 -19.464 -6.581  1.00 0.61 ? 66 GLU B HB2  2  
ATOM 4329  H HB3  . GLU B 1 66 ? -9.113  -20.195 -6.843  1.00 0.61 ? 66 GLU B HB3  2  
ATOM 4330  H HG2  . GLU B 1 66 ? -9.646  -17.270 -7.393  1.00 0.61 ? 66 GLU B HG2  2  
ATOM 4331  H HG3  . GLU B 1 66 ? -9.117  -17.849 -5.813  1.00 0.61 ? 66 GLU B HG3  2  
ATOM 4332  N N    . MET B 1 67 ? -10.748 -21.788 -8.051  1.00 1.45 ? 67 MET B N    2  
ATOM 4333  C CA   . MET B 1 67 ? -11.517 -23.050 -8.243  1.00 1.45 ? 67 MET B CA   2  
ATOM 4334  C C    . MET B 1 67 ? -13.009 -22.728 -8.347  1.00 1.45 ? 67 MET B C    2  
ATOM 4335  O O    . MET B 1 67 ? -13.434 -21.618 -8.090  1.00 1.45 ? 67 MET B O    2  
ATOM 4336  C CB   . MET B 1 67 ? -11.278 -23.979 -7.051  1.00 1.45 ? 67 MET B CB   2  
ATOM 4337  C CG   . MET B 1 67 ? -10.922 -25.378 -7.557  1.00 1.45 ? 67 MET B CG   2  
ATOM 4338  S SD   . MET B 1 67 ? -11.686 -26.620 -6.485  1.00 1.45 ? 67 MET B SD   2  
ATOM 4339  C CE   . MET B 1 67 ? -13.115 -26.980 -7.535  1.00 1.45 ? 67 MET B CE   2  
ATOM 4340  H H    . MET B 1 67 ? -10.126 -21.703 -7.299  1.00 1.45 ? 67 MET B H    2  
ATOM 4341  H HA   . MET B 1 67 ? -11.190 -23.537 -9.150  1.00 1.45 ? 67 MET B HA   2  
ATOM 4342  H HB2  . MET B 1 67 ? -10.464 -23.594 -6.453  1.00 1.45 ? 67 MET B HB2  2  
ATOM 4343  H HB3  . MET B 1 67 ? -12.173 -24.033 -6.451  1.00 1.45 ? 67 MET B HB3  2  
ATOM 4344  H HG2  . MET B 1 67 ? -11.287 -25.500 -8.566  1.00 1.45 ? 67 MET B HG2  2  
ATOM 4345  H HG3  . MET B 1 67 ? -9.849  -25.503 -7.546  1.00 1.45 ? 67 MET B HG3  2  
ATOM 4346  H HE1  . MET B 1 67 ? -12.785 -27.120 -8.555  1.00 1.45 ? 67 MET B HE1  2  
ATOM 4347  H HE2  . MET B 1 67 ? -13.600 -27.878 -7.189  1.00 1.45 ? 67 MET B HE2  2  
ATOM 4348  H HE3  . MET B 1 67 ? -13.812 -26.155 -7.486  1.00 1.45 ? 67 MET B HE3  2  
ATOM 4349  N N    . SER B 1 68 ? -13.809 -23.688 -8.721  1.00 2.84 ? 68 SER B N    2  
ATOM 4350  C CA   . SER B 1 68 ? -15.272 -23.437 -8.841  1.00 2.84 ? 68 SER B CA   2  
ATOM 4351  C C    . SER B 1 68 ? -16.033 -24.403 -7.931  1.00 2.84 ? 68 SER B C    2  
ATOM 4352  O O    . SER B 1 68 ? -17.173 -24.705 -8.241  1.00 2.84 ? 68 SER B O    2  
ATOM 4353  C CB   . SER B 1 68 ? -15.709 -23.651 -10.291 1.00 2.84 ? 68 SER B CB   2  
ATOM 4354  O OG   . SER B 1 68 ? -14.948 -24.709 -10.859 1.00 2.84 ? 68 SER B OG   2  
ATOM 4355  O OXT  . SER B 1 68 ? -15.461 -24.827 -6.940  1.00 2.84 ? 68 SER B OXT  2  
ATOM 4356  H H    . SER B 1 68 ? -13.446 -24.576 -8.924  1.00 2.84 ? 68 SER B H    2  
ATOM 4357  H HA   . SER B 1 68 ? -15.487 -22.420 -8.546  1.00 2.84 ? 68 SER B HA   2  
ATOM 4358  H HB2  . SER B 1 68 ? -16.754 -23.910 -10.319 1.00 2.84 ? 68 SER B HB2  2  
ATOM 4359  H HB3  . SER B 1 68 ? -15.551 -22.738 -10.851 1.00 2.84 ? 68 SER B HB3  2  
ATOM 4360  H HG   . SER B 1 68 ? -15.490 -25.501 -10.850 1.00 2.84 ? 68 SER B HG   2  
ATOM 4361  N N    . SER A 1 1  ? -19.842 4.221   -6.772  1.00 5.93 ? 1  SER A N    3  
ATOM 4362  C CA   . SER A 1 1  ? -18.369 4.049   -6.928  1.00 5.93 ? 1  SER A CA   3  
ATOM 4363  C C    . SER A 1 1  ? -17.657 5.339   -6.511  1.00 5.93 ? 1  SER A C    3  
ATOM 4364  O O    . SER A 1 1  ? -17.313 6.152   -7.344  1.00 5.93 ? 1  SER A O    3  
ATOM 4365  C CB   . SER A 1 1  ? -18.045 3.737   -8.388  1.00 5.93 ? 1  SER A CB   3  
ATOM 4366  O OG   . SER A 1 1  ? -16.724 3.218   -8.475  1.00 5.93 ? 1  SER A OG   3  
ATOM 4367  H H1   . SER A 1 1  ? -20.032 4.913   -6.018  1.00 5.93 ? 1  SER A H1   3  
ATOM 4368  H H2   . SER A 1 1  ? -20.248 4.563   -7.667  1.00 5.93 ? 1  SER A H2   3  
ATOM 4369  H H3   . SER A 1 1  ? -20.274 3.310   -6.524  1.00 5.93 ? 1  SER A H3   3  
ATOM 4370  H HA   . SER A 1 1  ? -18.035 3.234   -6.302  1.00 5.93 ? 1  SER A HA   3  
ATOM 4371  H HB2  . SER A 1 1  ? -18.739 3.005   -8.766  1.00 5.93 ? 1  SER A HB2  3  
ATOM 4372  H HB3  . SER A 1 1  ? -18.126 4.643   -8.975  1.00 5.93 ? 1  SER A HB3  3  
ATOM 4373  H HG   . SER A 1 1  ? -16.766 2.377   -8.936  1.00 5.93 ? 1  SER A HG   3  
ATOM 4374  N N    . PRO A 1 2  ? -17.459 5.484   -5.225  1.00 3.89 ? 2  PRO A N    3  
ATOM 4375  C CA   . PRO A 1 2  ? -16.789 6.665   -4.653  1.00 3.89 ? 2  PRO A CA   3  
ATOM 4376  C C    . PRO A 1 2  ? -15.272 6.560   -4.837  1.00 3.89 ? 2  PRO A C    3  
ATOM 4377  O O    . PRO A 1 2  ? -14.787 5.798   -5.649  1.00 3.89 ? 2  PRO A O    3  
ATOM 4378  C CB   . PRO A 1 2  ? -17.165 6.608   -3.171  1.00 3.89 ? 2  PRO A CB   3  
ATOM 4379  C CG   . PRO A 1 2  ? -17.535 5.136   -2.871  1.00 3.89 ? 2  PRO A CG   3  
ATOM 4380  C CD   . PRO A 1 2  ? -17.885 4.486   -4.222  1.00 3.89 ? 2  PRO A CD   3  
ATOM 4381  H HA   . PRO A 1 2  ? -17.167 7.573   -5.096  1.00 3.89 ? 2  PRO A HA   3  
ATOM 4382  H HB2  . PRO A 1 2  ? -16.323 6.914   -2.563  1.00 3.89 ? 2  PRO A HB2  3  
ATOM 4383  H HB3  . PRO A 1 2  ? -18.015 7.244   -2.977  1.00 3.89 ? 2  PRO A HB3  3  
ATOM 4384  H HG2  . PRO A 1 2  ? -16.695 4.628   -2.417  1.00 3.89 ? 2  PRO A HG2  3  
ATOM 4385  H HG3  . PRO A 1 2  ? -18.392 5.095   -2.215  1.00 3.89 ? 2  PRO A HG3  3  
ATOM 4386  H HD2  . PRO A 1 2  ? -17.337 3.562   -4.349  1.00 3.89 ? 2  PRO A HD2  3  
ATOM 4387  H HD3  . PRO A 1 2  ? -18.947 4.313   -4.297  1.00 3.89 ? 2  PRO A HD3  3  
ATOM 4388  N N    . TYR A 1 3  ? -14.520 7.319   -4.088  1.00 2.56 ? 3  TYR A N    3  
ATOM 4389  C CA   . TYR A 1 3  ? -13.037 7.262   -4.221  1.00 2.56 ? 3  TYR A CA   3  
ATOM 4390  C C    . TYR A 1 3  ? -12.419 6.870   -2.877  1.00 2.56 ? 3  TYR A C    3  
ATOM 4391  O O    . TYR A 1 3  ? -11.405 7.399   -2.471  1.00 2.56 ? 3  TYR A O    3  
ATOM 4392  C CB   . TYR A 1 3  ? -12.509 8.635   -4.643  1.00 2.56 ? 3  TYR A CB   3  
ATOM 4393  C CG   . TYR A 1 3  ? -13.107 9.015   -5.977  1.00 2.56 ? 3  TYR A CG   3  
ATOM 4394  C CD1  . TYR A 1 3  ? -12.573 8.487   -7.159  1.00 2.56 ? 3  TYR A CD1  3  
ATOM 4395  C CD2  . TYR A 1 3  ? -14.193 9.896   -6.031  1.00 2.56 ? 3  TYR A CD2  3  
ATOM 4396  C CE1  . TYR A 1 3  ? -13.127 8.840   -8.396  1.00 2.56 ? 3  TYR A CE1  3  
ATOM 4397  C CE2  . TYR A 1 3  ? -14.746 10.249  -7.268  1.00 2.56 ? 3  TYR A CE2  3  
ATOM 4398  C CZ   . TYR A 1 3  ? -14.214 9.722   -8.450  1.00 2.56 ? 3  TYR A CZ   3  
ATOM 4399  O OH   . TYR A 1 3  ? -14.759 10.070  -9.669  1.00 2.56 ? 3  TYR A OH   3  
ATOM 4400  H H    . TYR A 1 3  ? -14.930 7.928   -3.439  1.00 2.56 ? 3  TYR A H    3  
ATOM 4401  H HA   . TYR A 1 3  ? -12.770 6.529   -4.968  1.00 2.56 ? 3  TYR A HA   3  
ATOM 4402  H HB2  . TYR A 1 3  ? -12.785 9.370   -3.901  1.00 2.56 ? 3  TYR A HB2  3  
ATOM 4403  H HB3  . TYR A 1 3  ? -11.434 8.596   -4.730  1.00 2.56 ? 3  TYR A HB3  3  
ATOM 4404  H HD1  . TYR A 1 3  ? -11.736 7.808   -7.117  1.00 2.56 ? 3  TYR A HD1  3  
ATOM 4405  H HD2  . TYR A 1 3  ? -14.603 10.305  -5.119  1.00 2.56 ? 3  TYR A HD2  3  
ATOM 4406  H HE1  . TYR A 1 3  ? -12.716 8.433   -9.308  1.00 2.56 ? 3  TYR A HE1  3  
ATOM 4407  H HE2  . TYR A 1 3  ? -15.585 10.929  -7.310  1.00 2.56 ? 3  TYR A HE2  3  
ATOM 4408  H HH   . TYR A 1 3  ? -15.153 9.282   -10.053 1.00 2.56 ? 3  TYR A HH   3  
ATOM 4409  N N    . SER A 1 4  ? -13.024 5.942   -2.184  1.00 0.96 ? 4  SER A N    3  
ATOM 4410  C CA   . SER A 1 4  ? -12.471 5.518   -0.868  1.00 0.96 ? 4  SER A CA   3  
ATOM 4411  C C    . SER A 1 4  ? -12.090 4.037   -0.929  1.00 0.96 ? 4  SER A C    3  
ATOM 4412  O O    . SER A 1 4  ? -11.783 3.423   0.074   1.00 0.96 ? 4  SER A O    3  
ATOM 4413  C CB   . SER A 1 4  ? -13.525 5.728   0.219   1.00 0.96 ? 4  SER A CB   3  
ATOM 4414  O OG   . SER A 1 4  ? -12.916 5.585   1.496   1.00 0.96 ? 4  SER A OG   3  
ATOM 4415  H H    . SER A 1 4  ? -13.841 5.527   -2.530  1.00 0.96 ? 4  SER A H    3  
ATOM 4416  H HA   . SER A 1 4  ? -11.594 6.105   -0.639  1.00 0.96 ? 4  SER A HA   3  
ATOM 4417  H HB2  . SER A 1 4  ? -13.940 6.719   0.134   1.00 0.96 ? 4  SER A HB2  3  
ATOM 4418  H HB3  . SER A 1 4  ? -14.314 4.998   0.100   1.00 0.96 ? 4  SER A HB3  3  
ATOM 4419  H HG   . SER A 1 4  ? -13.468 5.001   2.023   1.00 0.96 ? 4  SER A HG   3  
ATOM 4420  N N    . SER A 1 5  ? -12.107 3.457   -2.098  1.00 0.48 ? 5  SER A N    3  
ATOM 4421  C CA   . SER A 1 5  ? -11.745 2.017   -2.220  1.00 0.48 ? 5  SER A CA   3  
ATOM 4422  C C    . SER A 1 5  ? -10.552 1.869   -3.166  1.00 0.48 ? 5  SER A C    3  
ATOM 4423  O O    . SER A 1 5  ? -10.699 1.496   -4.314  1.00 0.48 ? 5  SER A O    3  
ATOM 4424  C CB   . SER A 1 5  ? -12.937 1.239   -2.778  1.00 0.48 ? 5  SER A CB   3  
ATOM 4425  O OG   . SER A 1 5  ? -13.279 1.756   -4.058  1.00 0.48 ? 5  SER A OG   3  
ATOM 4426  H H    . SER A 1 5  ? -12.356 3.970   -2.895  1.00 0.48 ? 5  SER A H    3  
ATOM 4427  H HA   . SER A 1 5  ? -11.485 1.627   -1.248  1.00 0.48 ? 5  SER A HA   3  
ATOM 4428  H HB2  . SER A 1 5  ? -12.677 0.198   -2.876  1.00 0.48 ? 5  SER A HB2  3  
ATOM 4429  H HB3  . SER A 1 5  ? -13.778 1.336   -2.103  1.00 0.48 ? 5  SER A HB3  3  
ATOM 4430  H HG   . SER A 1 5  ? -14.182 1.497   -4.251  1.00 0.48 ? 5  SER A HG   3  
ATOM 4431  N N    . ASP A 1 6  ? -9.370  2.159   -2.695  1.00 0.37 ? 6  ASP A N    3  
ATOM 4432  C CA   . ASP A 1 6  ? -8.169  2.035   -3.569  1.00 0.37 ? 6  ASP A CA   3  
ATOM 4433  C C    . ASP A 1 6  ? -6.955  1.658   -2.717  1.00 0.37 ? 6  ASP A C    3  
ATOM 4434  O O    . ASP A 1 6  ? -6.626  2.326   -1.758  1.00 0.37 ? 6  ASP A O    3  
ATOM 4435  C CB   . ASP A 1 6  ? -7.906  3.372   -4.267  1.00 0.37 ? 6  ASP A CB   3  
ATOM 4436  C CG   . ASP A 1 6  ? -9.184  3.845   -4.962  1.00 0.37 ? 6  ASP A CG   3  
ATOM 4437  O OD1  . ASP A 1 6  ? -9.732  3.079   -5.737  1.00 0.37 ? 6  ASP A OD1  3  
ATOM 4438  O OD2  . ASP A 1 6  ? -9.592  4.966   -4.707  1.00 0.37 ? 6  ASP A OD2  3  
ATOM 4439  H H    . ASP A 1 6  ? -9.272  2.458   -1.768  1.00 0.37 ? 6  ASP A H    3  
ATOM 4440  H HA   . ASP A 1 6  ? -8.341  1.270   -4.311  1.00 0.37 ? 6  ASP A HA   3  
ATOM 4441  H HB2  . ASP A 1 6  ? -7.600  4.105   -3.535  1.00 0.37 ? 6  ASP A HB2  3  
ATOM 4442  H HB3  . ASP A 1 6  ? -7.125  3.247   -5.002  1.00 0.37 ? 6  ASP A HB3  3  
ATOM 4443  N N    . THR A 1 7  ? -6.286  0.590   -3.061  1.00 0.35 ? 7  THR A N    3  
ATOM 4444  C CA   . THR A 1 7  ? -5.095  0.172   -2.271  1.00 0.35 ? 7  THR A CA   3  
ATOM 4445  C C    . THR A 1 7  ? -4.216  1.392   -1.988  1.00 0.35 ? 7  THR A C    3  
ATOM 4446  O O    . THR A 1 7  ? -4.174  2.330   -2.760  1.00 0.35 ? 7  THR A O    3  
ATOM 4447  C CB   . THR A 1 7  ? -4.293  -0.861  -3.067  1.00 0.35 ? 7  THR A CB   3  
ATOM 4448  O OG1  . THR A 1 7  ? -3.650  -0.219  -4.159  1.00 0.35 ? 7  THR A OG1  3  
ATOM 4449  C CG2  . THR A 1 7  ? -5.232  -1.946  -3.591  1.00 0.35 ? 7  THR A CG2  3  
ATOM 4450  H H    . THR A 1 7  ? -6.568  0.065   -3.839  1.00 0.35 ? 7  THR A H    3  
ATOM 4451  H HA   . THR A 1 7  ? -5.418  -0.264  -1.337  1.00 0.35 ? 7  THR A HA   3  
ATOM 4452  H HB   . THR A 1 7  ? -3.550  -1.312  -2.426  1.00 0.35 ? 7  THR A HB   3  
ATOM 4453  H HG1  . THR A 1 7  ? -4.327  0.195   -4.700  1.00 0.35 ? 7  THR A HG1  3  
ATOM 4454  H HG21 . THR A 1 7  ? -6.247  -1.716  -3.302  1.00 0.35 ? 7  THR A HG21 3  
ATOM 4455  H HG22 . THR A 1 7  ? -5.167  -1.991  -4.669  1.00 0.35 ? 7  THR A HG22 3  
ATOM 4456  H HG23 . THR A 1 7  ? -4.947  -2.902  -3.174  1.00 0.35 ? 7  THR A HG23 3  
ATOM 4457  N N    . THR A 1 8  ? -3.514  1.387   -0.889  1.00 0.31 ? 8  THR A N    3  
ATOM 4458  C CA   . THR A 1 8  ? -2.638  2.547   -0.560  1.00 0.31 ? 8  THR A CA   3  
ATOM 4459  C C    . THR A 1 8  ? -1.172  2.157   -0.784  1.00 0.31 ? 8  THR A C    3  
ATOM 4460  O O    . THR A 1 8  ? -0.775  1.054   -0.464  1.00 0.31 ? 8  THR A O    3  
ATOM 4461  C CB   . THR A 1 8  ? -2.844  2.939   0.906   1.00 0.31 ? 8  THR A CB   3  
ATOM 4462  O OG1  . THR A 1 8  ? -4.145  3.488   1.068   1.00 0.31 ? 8  THR A OG1  3  
ATOM 4463  C CG2  . THR A 1 8  ? -1.797  3.977   1.313   1.00 0.31 ? 8  THR A CG2  3  
ATOM 4464  H H    . THR A 1 8  ? -3.561  0.621   -0.280  1.00 0.31 ? 8  THR A H    3  
ATOM 4465  H HA   . THR A 1 8  ? -2.896  3.380   -1.196  1.00 0.31 ? 8  THR A HA   3  
ATOM 4466  H HB   . THR A 1 8  ? -2.741  2.066   1.530   1.00 0.31 ? 8  THR A HB   3  
ATOM 4467  H HG1  . THR A 1 8  ? -4.283  4.135   0.373   1.00 0.31 ? 8  THR A HG1  3  
ATOM 4468  H HG21 . THR A 1 8  ? -0.820  3.651   0.986   1.00 0.31 ? 8  THR A HG21 3  
ATOM 4469  H HG22 . THR A 1 8  ? -2.031  4.926   0.855   1.00 0.31 ? 8  THR A HG22 3  
ATOM 4470  H HG23 . THR A 1 8  ? -1.797  4.087   2.388   1.00 0.31 ? 8  THR A HG23 3  
ATOM 4471  N N    . PRO A 1 9  ? -0.411  3.074   -1.327  1.00 0.34 ? 9  PRO A N    3  
ATOM 4472  C CA   . PRO A 1 9  ? 1.019   2.855   -1.605  1.00 0.34 ? 9  PRO A CA   3  
ATOM 4473  C C    . PRO A 1 9  ? 1.838   3.002   -0.320  1.00 0.34 ? 9  PRO A C    3  
ATOM 4474  O O    . PRO A 1 9  ? 2.572   3.954   -0.146  1.00 0.34 ? 9  PRO A O    3  
ATOM 4475  C CB   . PRO A 1 9  ? 1.365   3.965   -2.601  1.00 0.34 ? 9  PRO A CB   3  
ATOM 4476  C CG   . PRO A 1 9  ? 0.305   5.075   -2.403  1.00 0.34 ? 9  PRO A CG   3  
ATOM 4477  C CD   . PRO A 1 9  ? -0.903  4.413   -1.713  1.00 0.34 ? 9  PRO A CD   3  
ATOM 4478  H HA   . PRO A 1 9  ? 1.179   1.889   -2.055  1.00 0.34 ? 9  PRO A HA   3  
ATOM 4479  H HB2  . PRO A 1 9  ? 2.355   4.350   -2.396  1.00 0.34 ? 9  PRO A HB2  3  
ATOM 4480  H HB3  . PRO A 1 9  ? 1.313   3.588   -3.610  1.00 0.34 ? 9  PRO A HB3  3  
ATOM 4481  H HG2  . PRO A 1 9  ? 0.707   5.861   -1.780  1.00 0.34 ? 9  PRO A HG2  3  
ATOM 4482  H HG3  . PRO A 1 9  ? 0.004   5.476   -3.358  1.00 0.34 ? 9  PRO A HG3  3  
ATOM 4483  H HD2  . PRO A 1 9  ? -1.194  4.980   -0.839  1.00 0.34 ? 9  PRO A HD2  3  
ATOM 4484  H HD3  . PRO A 1 9  ? -1.729  4.322   -2.401  1.00 0.34 ? 9  PRO A HD3  3  
ATOM 4485  N N    . CYS A 1 10 ? 1.713   2.069   0.584   1.00 0.35 ? 10 CYS A N    3  
ATOM 4486  C CA   . CYS A 1 10 ? 2.481   2.160   1.858   1.00 0.35 ? 10 CYS A CA   3  
ATOM 4487  C C    . CYS A 1 10 ? 3.815   1.427   1.710   1.00 0.35 ? 10 CYS A C    3  
ATOM 4488  O O    . CYS A 1 10 ? 3.858   0.225   1.537   1.00 0.35 ? 10 CYS A O    3  
ATOM 4489  C CB   . CYS A 1 10 ? 1.669   1.520   2.985   1.00 0.35 ? 10 CYS A CB   3  
ATOM 4490  S SG   . CYS A 1 10 ? 0.181   2.503   3.289   1.00 0.35 ? 10 CYS A SG   3  
ATOM 4491  H H    . CYS A 1 10 ? 1.113   1.311   0.427   1.00 0.35 ? 10 CYS A H    3  
ATOM 4492  H HA   . CYS A 1 10 ? 2.665   3.199   2.093   1.00 0.35 ? 10 CYS A HA   3  
ATOM 4493  H HB2  . CYS A 1 10 ? 1.387   0.517   2.702   1.00 0.35 ? 10 CYS A HB2  3  
ATOM 4494  H HB3  . CYS A 1 10 ? 2.267   1.485   3.884   1.00 0.35 ? 10 CYS A HB3  3  
ATOM 4495  N N    . CYS A 1 11 ? 4.905   2.140   1.782   1.00 0.32 ? 11 CYS A N    3  
ATOM 4496  C CA   . CYS A 1 11 ? 6.235   1.483   1.651   1.00 0.32 ? 11 CYS A CA   3  
ATOM 4497  C C    . CYS A 1 11 ? 6.855   1.314   3.039   1.00 0.32 ? 11 CYS A C    3  
ATOM 4498  O O    . CYS A 1 11 ? 6.374   1.856   4.014   1.00 0.32 ? 11 CYS A O    3  
ATOM 4499  C CB   . CYS A 1 11 ? 7.154   2.350   0.788   1.00 0.32 ? 11 CYS A CB   3  
ATOM 4500  S SG   . CYS A 1 11 ? 7.048   1.811   -0.936  1.00 0.32 ? 11 CYS A SG   3  
ATOM 4501  H H    . CYS A 1 11 ? 4.849   3.108   1.926   1.00 0.32 ? 11 CYS A H    3  
ATOM 4502  H HA   . CYS A 1 11 ? 6.115   0.515   1.189   1.00 0.32 ? 11 CYS A HA   3  
ATOM 4503  H HB2  . CYS A 1 11 ? 6.847   3.383   0.862   1.00 0.32 ? 11 CYS A HB2  3  
ATOM 4504  H HB3  . CYS A 1 11 ? 8.172   2.252   1.134   1.00 0.32 ? 11 CYS A HB3  3  
ATOM 4505  N N    . PHE A 1 12 ? 7.917   0.563   3.137   1.00 0.28 ? 12 PHE A N    3  
ATOM 4506  C CA   . PHE A 1 12 ? 8.564   0.360   4.464   1.00 0.28 ? 12 PHE A CA   3  
ATOM 4507  C C    . PHE A 1 12 ? 10.065  0.133   4.273   1.00 0.28 ? 12 PHE A C    3  
ATOM 4508  O O    . PHE A 1 12 ? 10.876  0.595   5.051   1.00 0.28 ? 12 PHE A O    3  
ATOM 4509  C CB   . PHE A 1 12 ? 7.944   -0.859  5.149   1.00 0.28 ? 12 PHE A CB   3  
ATOM 4510  C CG   . PHE A 1 12 ? 6.451   -0.857  4.922   1.00 0.28 ? 12 PHE A CG   3  
ATOM 4511  C CD1  . PHE A 1 12 ? 5.912   -1.500  3.801   1.00 0.28 ? 12 PHE A CD1  3  
ATOM 4512  C CD2  . PHE A 1 12 ? 5.605   -0.211  5.832   1.00 0.28 ? 12 PHE A CD2  3  
ATOM 4513  C CE1  . PHE A 1 12 ? 4.528   -1.497  3.589   1.00 0.28 ? 12 PHE A CE1  3  
ATOM 4514  C CE2  . PHE A 1 12 ? 4.221   -0.207  5.620   1.00 0.28 ? 12 PHE A CE2  3  
ATOM 4515  C CZ   . PHE A 1 12 ? 3.683   -0.851  4.499   1.00 0.28 ? 12 PHE A CZ   3  
ATOM 4516  H H    . PHE A 1 12 ? 8.288   0.135   2.339   1.00 0.28 ? 12 PHE A H    3  
ATOM 4517  H HA   . PHE A 1 12 ? 8.408   1.234   5.078   1.00 0.28 ? 12 PHE A HA   3  
ATOM 4518  H HB2  . PHE A 1 12 ? 8.371   -1.761  4.735   1.00 0.28 ? 12 PHE A HB2  3  
ATOM 4519  H HB3  . PHE A 1 12 ? 8.146   -0.819  6.209   1.00 0.28 ? 12 PHE A HB3  3  
ATOM 4520  H HD1  . PHE A 1 12 ? 6.564   -1.998  3.099   1.00 0.28 ? 12 PHE A HD1  3  
ATOM 4521  H HD2  . PHE A 1 12 ? 6.021   0.285   6.696   1.00 0.28 ? 12 PHE A HD2  3  
ATOM 4522  H HE1  . PHE A 1 12 ? 4.113   -1.994  2.725   1.00 0.28 ? 12 PHE A HE1  3  
ATOM 4523  H HE2  . PHE A 1 12 ? 3.568   0.292   6.322   1.00 0.28 ? 12 PHE A HE2  3  
ATOM 4524  H HZ   . PHE A 1 12 ? 2.615   -0.849  4.336   1.00 0.28 ? 12 PHE A HZ   3  
ATOM 4525  N N    . ALA A 1 13 ? 10.443  -0.577  3.244   1.00 0.31 ? 13 ALA A N    3  
ATOM 4526  C CA   . ALA A 1 13 ? 11.892  -0.831  3.008   1.00 0.31 ? 13 ALA A CA   3  
ATOM 4527  C C    . ALA A 1 13 ? 12.469  0.282   2.130   1.00 0.31 ? 13 ALA A C    3  
ATOM 4528  O O    . ALA A 1 13 ? 11.747  1.012   1.482   1.00 0.31 ? 13 ALA A O    3  
ATOM 4529  C CB   . ALA A 1 13 ? 12.064  -2.177  2.302   1.00 0.31 ? 13 ALA A CB   3  
ATOM 4530  H H    . ALA A 1 13 ? 9.774   -0.941  2.629   1.00 0.31 ? 13 ALA A H    3  
ATOM 4531  H HA   . ALA A 1 13 ? 12.414  -0.851  3.953   1.00 0.31 ? 13 ALA A HA   3  
ATOM 4532  H HB1  . ALA A 1 13 ? 11.101  -2.535  1.967   1.00 0.31 ? 13 ALA A HB1  3  
ATOM 4533  H HB2  . ALA A 1 13 ? 12.718  -2.057  1.451   1.00 0.31 ? 13 ALA A HB2  3  
ATOM 4534  H HB3  . ALA A 1 13 ? 12.495  -2.891  2.988   1.00 0.31 ? 13 ALA A HB3  3  
ATOM 4535  N N    . TYR A 1 14 ? 13.766  0.418   2.106   1.00 0.29 ? 14 TYR A N    3  
ATOM 4536  C CA   . TYR A 1 14 ? 14.389  1.484   1.271   1.00 0.29 ? 14 TYR A CA   3  
ATOM 4537  C C    . TYR A 1 14 ? 15.596  0.910   0.528   1.00 0.29 ? 14 TYR A C    3  
ATOM 4538  O O    . TYR A 1 14 ? 16.540  0.436   1.129   1.00 0.29 ? 14 TYR A O    3  
ATOM 4539  C CB   . TYR A 1 14 ? 14.844  2.636   2.169   1.00 0.29 ? 14 TYR A CB   3  
ATOM 4540  C CG   . TYR A 1 14 ? 13.689  3.091   3.029   1.00 0.29 ? 14 TYR A CG   3  
ATOM 4541  C CD1  . TYR A 1 14 ? 12.486  3.486   2.433   1.00 0.29 ? 14 TYR A CD1  3  
ATOM 4542  C CD2  . TYR A 1 14 ? 13.823  3.119   4.422   1.00 0.29 ? 14 TYR A CD2  3  
ATOM 4543  C CE1  . TYR A 1 14 ? 11.415  3.908   3.231   1.00 0.29 ? 14 TYR A CE1  3  
ATOM 4544  C CE2  . TYR A 1 14 ? 12.753  3.541   5.220   1.00 0.29 ? 14 TYR A CE2  3  
ATOM 4545  C CZ   . TYR A 1 14 ? 11.549  3.935   4.624   1.00 0.29 ? 14 TYR A CZ   3  
ATOM 4546  O OH   . TYR A 1 14 ? 10.494  4.352   5.410   1.00 0.29 ? 14 TYR A OH   3  
ATOM 4547  H H    . TYR A 1 14 ? 14.333  -0.181  2.637   1.00 0.29 ? 14 TYR A H    3  
ATOM 4548  H HA   . TYR A 1 14 ? 13.666  1.849   0.555   1.00 0.29 ? 14 TYR A HA   3  
ATOM 4549  H HB2  . TYR A 1 14 ? 15.654  2.302   2.801   1.00 0.29 ? 14 TYR A HB2  3  
ATOM 4550  H HB3  . TYR A 1 14 ? 15.181  3.459   1.556   1.00 0.29 ? 14 TYR A HB3  3  
ATOM 4551  H HD1  . TYR A 1 14 ? 12.383  3.464   1.358   1.00 0.29 ? 14 TYR A HD1  3  
ATOM 4552  H HD2  . TYR A 1 14 ? 14.752  2.814   4.882   1.00 0.29 ? 14 TYR A HD2  3  
ATOM 4553  H HE1  . TYR A 1 14 ? 10.486  4.212   2.772   1.00 0.29 ? 14 TYR A HE1  3  
ATOM 4554  H HE2  . TYR A 1 14 ? 12.856  3.562   6.294   1.00 0.29 ? 14 TYR A HE2  3  
ATOM 4555  H HH   . TYR A 1 14 ? 10.712  5.217   5.765   1.00 0.29 ? 14 TYR A HH   3  
ATOM 4556  N N    . ILE A 1 15 ? 15.575  0.949   -0.777  1.00 0.32 ? 15 ILE A N    3  
ATOM 4557  C CA   . ILE A 1 15 ? 16.723  0.405   -1.557  1.00 0.32 ? 15 ILE A CA   3  
ATOM 4558  C C    . ILE A 1 15 ? 17.953  1.287   -1.334  1.00 0.32 ? 15 ILE A C    3  
ATOM 4559  O O    . ILE A 1 15 ? 17.843  2.460   -1.035  1.00 0.32 ? 15 ILE A O    3  
ATOM 4560  C CB   . ILE A 1 15 ? 16.368  0.390   -3.044  1.00 0.32 ? 15 ILE A CB   3  
ATOM 4561  C CG1  . ILE A 1 15 ? 17.500  -0.275  -3.830  1.00 0.32 ? 15 ILE A CG1  3  
ATOM 4562  C CG2  . ILE A 1 15 ? 16.181  1.826   -3.539  1.00 0.32 ? 15 ILE A CG2  3  
ATOM 4563  C CD1  . ILE A 1 15 ? 17.121  -0.347  -5.310  1.00 0.32 ? 15 ILE A CD1  3  
ATOM 4564  H H    . ILE A 1 15 ? 14.806  1.336   -1.243  1.00 0.32 ? 15 ILE A H    3  
ATOM 4565  H HA   . ILE A 1 15 ? 16.938  -0.601  -1.227  1.00 0.32 ? 15 ILE A HA   3  
ATOM 4566  H HB   . ILE A 1 15 ? 15.452  -0.164  -3.190  1.00 0.32 ? 15 ILE A HB   3  
ATOM 4567  H HG12 . ILE A 1 15 ? 18.406  0.303   -3.717  1.00 0.32 ? 15 ILE A HG12 3  
ATOM 4568  H HG13 . ILE A 1 15 ? 17.662  -1.275  -3.453  1.00 0.32 ? 15 ILE A HG13 3  
ATOM 4569  H HG21 . ILE A 1 15 ? 16.491  2.516   -2.769  1.00 0.32 ? 15 ILE A HG21 3  
ATOM 4570  H HG22 . ILE A 1 15 ? 16.779  1.982   -4.425  1.00 0.32 ? 15 ILE A HG22 3  
ATOM 4571  H HG23 . ILE A 1 15 ? 15.140  1.992   -3.774  1.00 0.32 ? 15 ILE A HG23 3  
ATOM 4572  H HD11 . ILE A 1 15 ? 16.045  -0.331  -5.407  1.00 0.32 ? 15 ILE A HD11 3  
ATOM 4573  H HD12 . ILE A 1 15 ? 17.542  0.500   -5.832  1.00 0.32 ? 15 ILE A HD12 3  
ATOM 4574  H HD13 . ILE A 1 15 ? 17.507  -1.261  -5.737  1.00 0.32 ? 15 ILE A HD13 3  
ATOM 4575  N N    . ALA A 1 16 ? 19.127  0.734   -1.480  1.00 0.38 ? 16 ALA A N    3  
ATOM 4576  C CA   . ALA A 1 16 ? 20.362  1.542   -1.277  1.00 0.38 ? 16 ALA A CA   3  
ATOM 4577  C C    . ALA A 1 16 ? 20.832  2.098   -2.623  1.00 0.38 ? 16 ALA A C    3  
ATOM 4578  O O    . ALA A 1 16 ? 21.241  3.238   -2.725  1.00 0.38 ? 16 ALA A O    3  
ATOM 4579  C CB   . ALA A 1 16 ? 21.458  0.657   -0.679  1.00 0.38 ? 16 ALA A CB   3  
ATOM 4580  H H    . ALA A 1 16 ? 19.195  -0.213  -1.722  1.00 0.38 ? 16 ALA A H    3  
ATOM 4581  H HA   . ALA A 1 16 ? 20.152  2.358   -0.604  1.00 0.38 ? 16 ALA A HA   3  
ATOM 4582  H HB1  . ALA A 1 16 ? 21.010  -0.217  -0.230  1.00 0.38 ? 16 ALA A HB1  3  
ATOM 4583  H HB2  . ALA A 1 16 ? 22.139  0.352   -1.459  1.00 0.38 ? 16 ALA A HB2  3  
ATOM 4584  H HB3  . ALA A 1 16 ? 21.997  1.212   0.074   1.00 0.38 ? 16 ALA A HB3  3  
ATOM 4585  N N    . ARG A 1 17 ? 20.780  1.303   -3.656  1.00 0.42 ? 17 ARG A N    3  
ATOM 4586  C CA   . ARG A 1 17 ? 21.223  1.787   -4.992  1.00 0.42 ? 17 ARG A CA   3  
ATOM 4587  C C    . ARG A 1 17 ? 20.162  2.728   -5.572  1.00 0.42 ? 17 ARG A C    3  
ATOM 4588  O O    . ARG A 1 17 ? 18.984  2.554   -5.331  1.00 0.42 ? 17 ARG A O    3  
ATOM 4589  C CB   . ARG A 1 17 ? 21.416  0.594   -5.931  1.00 0.42 ? 17 ARG A CB   3  
ATOM 4590  C CG   . ARG A 1 17 ? 22.795  -0.024  -5.696  1.00 0.42 ? 17 ARG A CG   3  
ATOM 4591  C CD   . ARG A 1 17 ? 22.633  -1.460  -5.196  1.00 0.42 ? 17 ARG A CD   3  
ATOM 4592  N NE   . ARG A 1 17 ? 23.060  -2.408  -6.263  1.00 0.42 ? 17 ARG A NE   3  
ATOM 4593  C CZ   . ARG A 1 17 ? 24.284  -2.859  -6.283  1.00 0.42 ? 17 ARG A CZ   3  
ATOM 4594  N NH1  . ARG A 1 17 ? 25.287  -2.028  -6.198  1.00 0.42 ? 17 ARG A NH1  3  
ATOM 4595  N NH2  . ARG A 1 17 ? 24.506  -4.140  -6.390  1.00 0.42 ? 17 ARG A NH2  3  
ATOM 4596  H H    . ARG A 1 17 ? 20.447  0.386   -3.553  1.00 0.42 ? 17 ARG A H    3  
ATOM 4597  H HA   . ARG A 1 17 ? 22.158  2.319   -4.889  1.00 0.42 ? 17 ARG A HA   3  
ATOM 4598  H HB2  . ARG A 1 17 ? 20.651  -0.144  -5.734  1.00 0.42 ? 17 ARG A HB2  3  
ATOM 4599  H HB3  . ARG A 1 17 ? 21.341  0.926   -6.956  1.00 0.42 ? 17 ARG A HB3  3  
ATOM 4600  H HG2  . ARG A 1 17 ? 23.351  -0.024  -6.622  1.00 0.42 ? 17 ARG A HG2  3  
ATOM 4601  H HG3  . ARG A 1 17 ? 23.328  0.555   -4.957  1.00 0.42 ? 17 ARG A HG3  3  
ATOM 4602  H HD2  . ARG A 1 17 ? 23.245  -1.607  -4.318  1.00 0.42 ? 17 ARG A HD2  3  
ATOM 4603  H HD3  . ARG A 1 17 ? 21.597  -1.640  -4.948  1.00 0.42 ? 17 ARG A HD3  3  
ATOM 4604  H HE   . ARG A 1 17 ? 22.422  -2.694  -6.950  1.00 0.42 ? 17 ARG A HE   3  
ATOM 4605  H HH11 . ARG A 1 17 ? 25.118  -1.046  -6.117  1.00 0.42 ? 17 ARG A HH11 3  
ATOM 4606  H HH12 . ARG A 1 17 ? 26.226  -2.374  -6.214  1.00 0.42 ? 17 ARG A HH12 3  
ATOM 4607  H HH21 . ARG A 1 17 ? 23.738  -4.777  -6.455  1.00 0.42 ? 17 ARG A HH21 3  
ATOM 4608  H HH22 . ARG A 1 17 ? 25.445  -4.486  -6.406  1.00 0.42 ? 17 ARG A HH22 3  
ATOM 4609  N N    . PRO A 1 18 ? 20.615  3.700   -6.322  1.00 0.41 ? 18 PRO A N    3  
ATOM 4610  C CA   . PRO A 1 18 ? 19.730  4.693   -6.956  1.00 0.41 ? 18 PRO A CA   3  
ATOM 4611  C C    . PRO A 1 18 ? 19.061  4.098   -8.199  1.00 0.41 ? 18 PRO A C    3  
ATOM 4612  O O    . PRO A 1 18 ? 19.394  3.015   -8.637  1.00 0.41 ? 18 PRO A O    3  
ATOM 4613  C CB   . PRO A 1 18 ? 20.681  5.829   -7.337  1.00 0.41 ? 18 PRO A CB   3  
ATOM 4614  C CG   . PRO A 1 18 ? 22.094  5.206   -7.424  1.00 0.41 ? 18 PRO A CG   3  
ATOM 4615  C CD   . PRO A 1 18 ? 22.051  3.901   -6.607  1.00 0.41 ? 18 PRO A CD   3  
ATOM 4616  H HA   . PRO A 1 18 ? 18.991  5.048   -6.256  1.00 0.41 ? 18 PRO A HA   3  
ATOM 4617  H HB2  . PRO A 1 18 ? 20.395  6.245   -8.294  1.00 0.41 ? 18 PRO A HB2  3  
ATOM 4618  H HB3  . PRO A 1 18 ? 20.668  6.596   -6.578  1.00 0.41 ? 18 PRO A HB3  3  
ATOM 4619  H HG2  . PRO A 1 18 ? 22.342  4.993   -8.455  1.00 0.41 ? 18 PRO A HG2  3  
ATOM 4620  H HG3  . PRO A 1 18 ? 22.823  5.877   -6.998  1.00 0.41 ? 18 PRO A HG3  3  
ATOM 4621  H HD2  . PRO A 1 18 ? 22.442  3.078   -7.189  1.00 0.41 ? 18 PRO A HD2  3  
ATOM 4622  H HD3  . PRO A 1 18 ? 22.602  4.010   -5.686  1.00 0.41 ? 18 PRO A HD3  3  
ATOM 4623  N N    . LEU A 1 19 ? 18.121  4.801   -8.769  1.00 0.45 ? 19 LEU A N    3  
ATOM 4624  C CA   . LEU A 1 19 ? 17.430  4.279   -9.983  1.00 0.45 ? 19 LEU A CA   3  
ATOM 4625  C C    . LEU A 1 19 ? 17.679  5.229   -11.159 1.00 0.45 ? 19 LEU A C    3  
ATOM 4626  O O    . LEU A 1 19 ? 18.148  6.334   -10.971 1.00 0.45 ? 19 LEU A O    3  
ATOM 4627  C CB   . LEU A 1 19 ? 15.921  4.177   -9.723  1.00 0.45 ? 19 LEU A CB   3  
ATOM 4628  C CG   . LEU A 1 19 ? 15.513  5.151   -8.614  1.00 0.45 ? 19 LEU A CG   3  
ATOM 4629  C CD1  . LEU A 1 19 ? 13.997  5.352   -8.643  1.00 0.45 ? 19 LEU A CD1  3  
ATOM 4630  C CD2  . LEU A 1 19 ? 15.924  4.575   -7.257  1.00 0.45 ? 19 LEU A CD2  3  
ATOM 4631  H H    . LEU A 1 19 ? 17.868  5.673   -8.399  1.00 0.45 ? 19 LEU A H    3  
ATOM 4632  H HA   . LEU A 1 19 ? 17.820  3.301   -10.224 1.00 0.45 ? 19 LEU A HA   3  
ATOM 4633  H HB2  . LEU A 1 19 ? 15.385  4.422   -10.628 1.00 0.45 ? 19 LEU A HB2  3  
ATOM 4634  H HB3  . LEU A 1 19 ? 15.677  3.169   -9.422  1.00 0.45 ? 19 LEU A HB3  3  
ATOM 4635  H HG   . LEU A 1 19 ? 16.005  6.099   -8.769  1.00 0.45 ? 19 LEU A HG   3  
ATOM 4636  H HD11 . LEU A 1 19 ? 13.631  5.184   -9.645  1.00 0.45 ? 19 LEU A HD11 3  
ATOM 4637  H HD12 . LEU A 1 19 ? 13.528  4.652   -7.966  1.00 0.45 ? 19 LEU A HD12 3  
ATOM 4638  H HD13 . LEU A 1 19 ? 13.762  6.361   -8.337  1.00 0.45 ? 19 LEU A HD13 3  
ATOM 4639  H HD21 . LEU A 1 19 ? 16.002  3.500   -7.331  1.00 0.45 ? 19 LEU A HD21 3  
ATOM 4640  H HD22 . LEU A 1 19 ? 16.878  4.987   -6.964  1.00 0.45 ? 19 LEU A HD22 3  
ATOM 4641  H HD23 . LEU A 1 19 ? 15.178  4.830   -6.517  1.00 0.45 ? 19 LEU A HD23 3  
ATOM 4642  N N    . PRO A 1 20 ? 17.356  4.767   -12.339 1.00 0.58 ? 20 PRO A N    3  
ATOM 4643  C CA   . PRO A 1 20 ? 17.531  5.552   -13.574 1.00 0.58 ? 20 PRO A CA   3  
ATOM 4644  C C    . PRO A 1 20 ? 16.411  6.588   -13.710 1.00 0.58 ? 20 PRO A C    3  
ATOM 4645  O O    . PRO A 1 20 ? 15.316  6.281   -14.138 1.00 0.58 ? 20 PRO A O    3  
ATOM 4646  C CB   . PRO A 1 20 ? 17.441  4.500   -14.682 1.00 0.58 ? 20 PRO A CB   3  
ATOM 4647  C CG   . PRO A 1 20 ? 16.671  3.299   -14.084 1.00 0.58 ? 20 PRO A CG   3  
ATOM 4648  C CD   . PRO A 1 20 ? 16.787  3.420   -12.553 1.00 0.58 ? 20 PRO A CD   3  
ATOM 4649  H HA   . PRO A 1 20 ? 18.498  6.027   -13.592 1.00 0.58 ? 20 PRO A HA   3  
ATOM 4650  H HB2  . PRO A 1 20 ? 16.907  4.904   -15.532 1.00 0.58 ? 20 PRO A HB2  3  
ATOM 4651  H HB3  . PRO A 1 20 ? 18.430  4.186   -14.979 1.00 0.58 ? 20 PRO A HB3  3  
ATOM 4652  H HG2  . PRO A 1 20 ? 15.632  3.340   -14.385 1.00 0.58 ? 20 PRO A HG2  3  
ATOM 4653  H HG3  . PRO A 1 20 ? 17.116  2.372   -14.411 1.00 0.58 ? 20 PRO A HG3  3  
ATOM 4654  H HD2  . PRO A 1 20 ? 15.811  3.340   -12.093 1.00 0.58 ? 20 PRO A HD2  3  
ATOM 4655  H HD3  . PRO A 1 20 ? 17.455  2.668   -12.163 1.00 0.58 ? 20 PRO A HD3  3  
ATOM 4656  N N    . ARG A 1 21 ? 16.677  7.813   -13.347 1.00 0.75 ? 21 ARG A N    3  
ATOM 4657  C CA   . ARG A 1 21 ? 15.629  8.867   -13.454 1.00 0.75 ? 21 ARG A CA   3  
ATOM 4658  C C    . ARG A 1 21 ? 15.049  8.872   -14.869 1.00 0.75 ? 21 ARG A C    3  
ATOM 4659  O O    . ARG A 1 21 ? 13.904  9.219   -15.080 1.00 0.75 ? 21 ARG A O    3  
ATOM 4660  C CB   . ARG A 1 21 ? 16.248  10.233  -13.152 1.00 0.75 ? 21 ARG A CB   3  
ATOM 4661  C CG   . ARG A 1 21 ? 15.142  11.232  -12.808 1.00 0.75 ? 21 ARG A CG   3  
ATOM 4662  C CD   . ARG A 1 21 ? 15.413  12.559  -13.519 1.00 0.75 ? 21 ARG A CD   3  
ATOM 4663  N NE   . ARG A 1 21 ? 14.218  13.441  -13.398 1.00 0.75 ? 21 ARG A NE   3  
ATOM 4664  C CZ   . ARG A 1 21 ? 13.485  13.696  -14.447 1.00 0.75 ? 21 ARG A CZ   3  
ATOM 4665  N NH1  . ARG A 1 21 ? 12.864  12.725  -15.060 1.00 0.75 ? 21 ARG A NH1  3  
ATOM 4666  N NH2  . ARG A 1 21 ? 13.376  14.921  -14.884 1.00 0.75 ? 21 ARG A NH2  3  
ATOM 4667  H H    . ARG A 1 21 ? 17.566  8.040   -13.003 1.00 0.75 ? 21 ARG A H    3  
ATOM 4668  H HA   . ARG A 1 21 ? 14.841  8.665   -12.743 1.00 0.75 ? 21 ARG A HA   3  
ATOM 4669  H HB2  . ARG A 1 21 ? 16.927  10.143  -12.317 1.00 0.75 ? 21 ARG A HB2  3  
ATOM 4670  H HB3  . ARG A 1 21 ? 16.789  10.582  -14.019 1.00 0.75 ? 21 ARG A HB3  3  
ATOM 4671  H HG2  . ARG A 1 21 ? 14.189  10.837  -13.129 1.00 0.75 ? 21 ARG A HG2  3  
ATOM 4672  H HG3  . ARG A 1 21 ? 15.124  11.395  -11.741 1.00 0.75 ? 21 ARG A HG3  3  
ATOM 4673  H HD2  . ARG A 1 21 ? 16.266  13.043  -13.067 1.00 0.75 ? 21 ARG A HD2  3  
ATOM 4674  H HD3  . ARG A 1 21 ? 15.617  12.371  -14.564 1.00 0.75 ? 21 ARG A HD3  3  
ATOM 4675  H HE   . ARG A 1 21 ? 13.982  13.829  -12.530 1.00 0.75 ? 21 ARG A HE   3  
ATOM 4676  H HH11 . ARG A 1 21 ? 12.948  11.787  -14.726 1.00 0.75 ? 21 ARG A HH11 3  
ATOM 4677  H HH12 . ARG A 1 21 ? 12.303  12.921  -15.865 1.00 0.75 ? 21 ARG A HH12 3  
ATOM 4678  H HH21 . ARG A 1 21 ? 13.853  15.663  -14.415 1.00 0.75 ? 21 ARG A HH21 3  
ATOM 4679  H HH22 . ARG A 1 21 ? 12.815  15.116  -15.688 1.00 0.75 ? 21 ARG A HH22 3  
ATOM 4680  N N    . ALA A 1 22 ? 15.829  8.490   -15.843 1.00 0.89 ? 22 ALA A N    3  
ATOM 4681  C CA   . ALA A 1 22 ? 15.321  8.474   -17.243 1.00 0.89 ? 22 ALA A CA   3  
ATOM 4682  C C    . ALA A 1 22 ? 14.134  7.514   -17.346 1.00 0.89 ? 22 ALA A C    3  
ATOM 4683  O O    . ALA A 1 22 ? 13.142  7.804   -17.983 1.00 0.89 ? 22 ALA A O    3  
ATOM 4684  C CB   . ALA A 1 22 ? 16.436  8.010   -18.184 1.00 0.89 ? 22 ALA A CB   3  
ATOM 4685  H H    . ALA A 1 22 ? 16.751  8.214   -15.653 1.00 0.89 ? 22 ALA A H    3  
ATOM 4686  H HA   . ALA A 1 22 ? 15.006  9.468   -17.523 1.00 0.89 ? 22 ALA A HA   3  
ATOM 4687  H HB1  . ALA A 1 22 ? 16.964  7.183   -17.734 1.00 0.89 ? 22 ALA A HB1  3  
ATOM 4688  H HB2  . ALA A 1 22 ? 16.006  7.695   -19.123 1.00 0.89 ? 22 ALA A HB2  3  
ATOM 4689  H HB3  . ALA A 1 22 ? 17.122  8.825   -18.358 1.00 0.89 ? 22 ALA A HB3  3  
ATOM 4690  N N    . HIS A 1 23 ? 14.229  6.371   -16.723 1.00 0.71 ? 23 HIS A N    3  
ATOM 4691  C CA   . HIS A 1 23 ? 13.106  5.393   -16.787 1.00 0.71 ? 23 HIS A CA   3  
ATOM 4692  C C    . HIS A 1 23 ? 12.146  5.636   -15.620 1.00 0.71 ? 23 HIS A C    3  
ATOM 4693  O O    . HIS A 1 23 ? 11.209  4.890   -15.411 1.00 0.71 ? 23 HIS A O    3  
ATOM 4694  C CB   . HIS A 1 23 ? 13.664  3.971   -16.701 1.00 0.71 ? 23 HIS A CB   3  
ATOM 4695  C CG   . HIS A 1 23 ? 14.678  3.761   -17.793 1.00 0.71 ? 23 HIS A CG   3  
ATOM 4696  N ND1  . HIS A 1 23 ? 14.766  2.572   -18.499 1.00 0.71 ? 23 HIS A ND1  3  
ATOM 4697  C CD2  . HIS A 1 23 ? 15.652  4.579   -18.309 1.00 0.71 ? 23 HIS A CD2  3  
ATOM 4698  C CE1  . HIS A 1 23 ? 15.762  2.707   -19.394 1.00 0.71 ? 23 HIS A CE1  3  
ATOM 4699  N NE2  . HIS A 1 23 ? 16.336  3.911   -19.321 1.00 0.71 ? 23 HIS A NE2  3  
ATOM 4700  H H    . HIS A 1 23 ? 15.039  6.155   -16.216 1.00 0.71 ? 23 HIS A H    3  
ATOM 4701  H HA   . HIS A 1 23 ? 12.576  5.515   -17.720 1.00 0.71 ? 23 HIS A HA   3  
ATOM 4702  H HB2  . HIS A 1 23 ? 14.136  3.827   -15.739 1.00 0.71 ? 23 HIS A HB2  3  
ATOM 4703  H HB3  . HIS A 1 23 ? 12.859  3.261   -16.816 1.00 0.71 ? 23 HIS A HB3  3  
ATOM 4704  H HD1  . HIS A 1 23 ? 14.206  1.779   -18.371 1.00 0.71 ? 23 HIS A HD1  3  
ATOM 4705  H HD2  . HIS A 1 23 ? 15.857  5.587   -17.980 1.00 0.71 ? 23 HIS A HD2  3  
ATOM 4706  H HE1  . HIS A 1 23 ? 16.062  1.935   -20.088 1.00 0.71 ? 23 HIS A HE1  3  
ATOM 4707  N N    . ILE A 1 24 ? 12.369  6.671   -14.857 1.00 0.56 ? 24 ILE A N    3  
ATOM 4708  C CA   . ILE A 1 24 ? 11.465  6.957   -13.707 1.00 0.56 ? 24 ILE A CA   3  
ATOM 4709  C C    . ILE A 1 24 ? 10.340  7.889   -14.161 1.00 0.56 ? 24 ILE A C    3  
ATOM 4710  O O    . ILE A 1 24 ? 10.461  9.097   -14.104 1.00 0.56 ? 24 ILE A O    3  
ATOM 4711  C CB   . ILE A 1 24 ? 12.263  7.624   -12.583 1.00 0.56 ? 24 ILE A CB   3  
ATOM 4712  C CG1  . ILE A 1 24 ? 13.157  6.582   -11.906 1.00 0.56 ? 24 ILE A CG1  3  
ATOM 4713  C CG2  . ILE A 1 24 ? 11.301  8.214   -11.549 1.00 0.56 ? 24 ILE A CG2  3  
ATOM 4714  C CD1  . ILE A 1 24 ? 13.910  7.234   -10.745 1.00 0.56 ? 24 ILE A CD1  3  
ATOM 4715  H H    . ILE A 1 24 ? 13.129  7.261   -15.041 1.00 0.56 ? 24 ILE A H    3  
ATOM 4716  H HA   . ILE A 1 24 ? 11.040  6.031   -13.346 1.00 0.56 ? 24 ILE A HA   3  
ATOM 4717  H HB   . ILE A 1 24 ? 12.875  8.413   -12.996 1.00 0.56 ? 24 ILE A HB   3  
ATOM 4718  H HG12 . ILE A 1 24 ? 12.545  5.774   -11.532 1.00 0.56 ? 24 ILE A HG12 3  
ATOM 4719  H HG13 . ILE A 1 24 ? 13.865  6.196   -12.622 1.00 0.56 ? 24 ILE A HG13 3  
ATOM 4720  H HG21 . ILE A 1 24 ? 10.485  7.526   -11.382 1.00 0.56 ? 24 ILE A HG21 3  
ATOM 4721  H HG22 . ILE A 1 24 ? 11.828  8.381   -10.622 1.00 0.56 ? 24 ILE A HG22 3  
ATOM 4722  H HG23 . ILE A 1 24 ? 10.911  9.153   -11.916 1.00 0.56 ? 24 ILE A HG23 3  
ATOM 4723  H HD11 . ILE A 1 24 ? 14.222  8.227   -11.031 1.00 0.56 ? 24 ILE A HD11 3  
ATOM 4724  H HD12 . ILE A 1 24 ? 13.262  7.293   -9.883  1.00 0.56 ? 24 ILE A HD12 3  
ATOM 4725  H HD13 . ILE A 1 24 ? 14.780  6.639   -10.502 1.00 0.56 ? 24 ILE A HD13 3  
ATOM 4726  N N    . LYS A 1 25 ? 9.246   7.339   -14.612 1.00 0.59 ? 25 LYS A N    3  
ATOM 4727  C CA   . LYS A 1 25 ? 8.115   8.192   -15.068 1.00 0.59 ? 25 LYS A CA   3  
ATOM 4728  C C    . LYS A 1 25 ? 7.809   9.249   -14.005 1.00 0.59 ? 25 LYS A C    3  
ATOM 4729  O O    . LYS A 1 25 ? 7.961   10.433  -14.230 1.00 0.59 ? 25 LYS A O    3  
ATOM 4730  C CB   . LYS A 1 25 ? 6.878   7.321   -15.288 1.00 0.59 ? 25 LYS A CB   3  
ATOM 4731  C CG   . LYS A 1 25 ? 6.025   7.922   -16.404 1.00 0.59 ? 25 LYS A CG   3  
ATOM 4732  C CD   . LYS A 1 25 ? 4.702   7.161   -16.504 1.00 0.59 ? 25 LYS A CD   3  
ATOM 4733  C CE   . LYS A 1 25 ? 4.338   6.959   -17.976 1.00 0.59 ? 25 LYS A CE   3  
ATOM 4734  N NZ   . LYS A 1 25 ? 2.858   6.845   -18.111 1.00 0.59 ? 25 LYS A NZ   3  
ATOM 4735  H H    . LYS A 1 25 ? 9.168   6.364   -14.649 1.00 0.59 ? 25 LYS A H    3  
ATOM 4736  H HA   . LYS A 1 25 ? 8.381   8.679   -15.994 1.00 0.59 ? 25 LYS A HA   3  
ATOM 4737  H HB2  . LYS A 1 25 ? 7.186   6.322   -15.566 1.00 0.59 ? 25 LYS A HB2  3  
ATOM 4738  H HB3  . LYS A 1 25 ? 6.299   7.279   -14.378 1.00 0.59 ? 25 LYS A HB3  3  
ATOM 4739  H HG2  . LYS A 1 25 ? 5.829   8.962   -16.185 1.00 0.59 ? 25 LYS A HG2  3  
ATOM 4740  H HG3  . LYS A 1 25 ? 6.554   7.845   -17.342 1.00 0.59 ? 25 LYS A HG3  3  
ATOM 4741  H HD2  . LYS A 1 25 ? 4.802   6.200   -16.021 1.00 0.59 ? 25 LYS A HD2  3  
ATOM 4742  H HD3  . LYS A 1 25 ? 3.922   7.729   -16.018 1.00 0.59 ? 25 LYS A HD3  3  
ATOM 4743  H HE2  . LYS A 1 25 ? 4.689   7.801   -18.553 1.00 0.59 ? 25 LYS A HE2  3  
ATOM 4744  H HE3  . LYS A 1 25 ? 4.803   6.054   -18.341 1.00 0.59 ? 25 LYS A HE3  3  
ATOM 4745  H HZ1  . LYS A 1 25 ? 2.399   7.529   -17.478 1.00 0.59 ? 25 LYS A HZ1  3  
ATOM 4746  H HZ2  . LYS A 1 25 ? 2.584   7.046   -19.093 1.00 0.59 ? 25 LYS A HZ2  3  
ATOM 4747  H HZ3  . LYS A 1 25 ? 2.561   5.881   -17.858 1.00 0.59 ? 25 LYS A HZ3  3  
ATOM 4748  N N    . GLU A 1 26 ? 7.377   8.831   -12.847 1.00 0.53 ? 26 GLU A N    3  
ATOM 4749  C CA   . GLU A 1 26 ? 7.059   9.813   -11.772 1.00 0.53 ? 26 GLU A CA   3  
ATOM 4750  C C    . GLU A 1 26 ? 7.051   9.103   -10.417 1.00 0.53 ? 26 GLU A C    3  
ATOM 4751  O O    . GLU A 1 26 ? 7.069   7.891   -10.340 1.00 0.53 ? 26 GLU A O    3  
ATOM 4752  C CB   . GLU A 1 26 ? 5.683   10.427  -12.034 1.00 0.53 ? 26 GLU A CB   3  
ATOM 4753  C CG   . GLU A 1 26 ? 4.632   9.317   -12.091 1.00 0.53 ? 26 GLU A CG   3  
ATOM 4754  C CD   . GLU A 1 26 ? 3.430   9.792   -12.910 1.00 0.53 ? 26 GLU A CD   3  
ATOM 4755  O OE1  . GLU A 1 26 ? 3.245   10.994  -13.009 1.00 0.53 ? 26 GLU A OE1  3  
ATOM 4756  O OE2  . GLU A 1 26 ? 2.715   8.947   -13.423 1.00 0.53 ? 26 GLU A OE2  3  
ATOM 4757  H H    . GLU A 1 26 ? 7.259   7.870   -12.685 1.00 0.53 ? 26 GLU A H    3  
ATOM 4758  H HA   . GLU A 1 26 ? 7.806   10.592  -11.766 1.00 0.53 ? 26 GLU A HA   3  
ATOM 4759  H HB2  . GLU A 1 26 ? 5.439   11.115  -11.237 1.00 0.53 ? 26 GLU A HB2  3  
ATOM 4760  H HB3  . GLU A 1 26 ? 5.697   10.955  -12.975 1.00 0.53 ? 26 GLU A HB3  3  
ATOM 4761  H HG2  . GLU A 1 26 ? 5.060   8.440   -12.555 1.00 0.53 ? 26 GLU A HG2  3  
ATOM 4762  H HG3  . GLU A 1 26 ? 4.309   9.073   -11.090 1.00 0.53 ? 26 GLU A HG3  3  
ATOM 4763  N N    . TYR A 1 27 ? 7.022   9.849   -9.346  1.00 0.39 ? 27 TYR A N    3  
ATOM 4764  C CA   . TYR A 1 27 ? 7.011   9.216   -7.997  1.00 0.39 ? 27 TYR A CA   3  
ATOM 4765  C C    . TYR A 1 27 ? 5.964   9.904   -7.119  1.00 0.39 ? 27 TYR A C    3  
ATOM 4766  O O    . TYR A 1 27 ? 5.176   10.703  -7.585  1.00 0.39 ? 27 TYR A O    3  
ATOM 4767  C CB   . TYR A 1 27 ? 8.396   9.358   -7.356  1.00 0.39 ? 27 TYR A CB   3  
ATOM 4768  C CG   . TYR A 1 27 ? 8.605   10.785  -6.904  1.00 0.39 ? 27 TYR A CG   3  
ATOM 4769  C CD1  . TYR A 1 27 ? 9.038   11.753  -7.819  1.00 0.39 ? 27 TYR A CD1  3  
ATOM 4770  C CD2  . TYR A 1 27 ? 8.367   11.139  -5.571  1.00 0.39 ? 27 TYR A CD2  3  
ATOM 4771  C CE1  . TYR A 1 27 ? 9.231   13.074  -7.400  1.00 0.39 ? 27 TYR A CE1  3  
ATOM 4772  C CE2  . TYR A 1 27 ? 8.560   12.461  -5.153  1.00 0.39 ? 27 TYR A CE2  3  
ATOM 4773  C CZ   . TYR A 1 27 ? 8.993   13.429  -6.067  1.00 0.39 ? 27 TYR A CZ   3  
ATOM 4774  O OH   . TYR A 1 27 ? 9.183   14.731  -5.654  1.00 0.39 ? 27 TYR A OH   3  
ATOM 4775  H H    . TYR A 1 27 ? 7.007   10.825  -9.429  1.00 0.39 ? 27 TYR A H    3  
ATOM 4776  H HA   . TYR A 1 27 ? 6.767   8.169   -8.093  1.00 0.39 ? 27 TYR A HA   3  
ATOM 4777  H HB2  . TYR A 1 27 ? 8.466   8.698   -6.504  1.00 0.39 ? 27 TYR A HB2  3  
ATOM 4778  H HB3  . TYR A 1 27 ? 9.155   9.096   -8.077  1.00 0.39 ? 27 TYR A HB3  3  
ATOM 4779  H HD1  . TYR A 1 27 ? 9.222   11.480  -8.848  1.00 0.39 ? 27 TYR A HD1  3  
ATOM 4780  H HD2  . TYR A 1 27 ? 8.033   10.393  -4.866  1.00 0.39 ? 27 TYR A HD2  3  
ATOM 4781  H HE1  . TYR A 1 27 ? 9.564   13.821  -8.105  1.00 0.39 ? 27 TYR A HE1  3  
ATOM 4782  H HE2  . TYR A 1 27 ? 8.375   12.734  -4.124  1.00 0.39 ? 27 TYR A HE2  3  
ATOM 4783  H HH   . TYR A 1 27 ? 8.474   15.265  -6.019  1.00 0.39 ? 27 TYR A HH   3  
ATOM 4784  N N    . PHE A 1 28 ? 5.950   9.599   -5.852  1.00 0.35 ? 28 PHE A N    3  
ATOM 4785  C CA   . PHE A 1 28 ? 4.956   10.234  -4.942  1.00 0.35 ? 28 PHE A CA   3  
ATOM 4786  C C    . PHE A 1 28 ? 5.222   9.779   -3.505  1.00 0.35 ? 28 PHE A C    3  
ATOM 4787  O O    . PHE A 1 28 ? 5.840   8.760   -3.271  1.00 0.35 ? 28 PHE A O    3  
ATOM 4788  C CB   . PHE A 1 28 ? 3.543   9.820   -5.357  1.00 0.35 ? 28 PHE A CB   3  
ATOM 4789  C CG   . PHE A 1 28 ? 3.525   8.348   -5.691  1.00 0.35 ? 28 PHE A CG   3  
ATOM 4790  C CD1  . PHE A 1 28 ? 3.536   7.398   -4.664  1.00 0.35 ? 28 PHE A CD1  3  
ATOM 4791  C CD2  . PHE A 1 28 ? 3.495   7.933   -7.028  1.00 0.35 ? 28 PHE A CD2  3  
ATOM 4792  C CE1  . PHE A 1 28 ? 3.516   6.033   -4.972  1.00 0.35 ? 28 PHE A CE1  3  
ATOM 4793  C CE2  . PHE A 1 28 ? 3.477   6.568   -7.337  1.00 0.35 ? 28 PHE A CE2  3  
ATOM 4794  C CZ   . PHE A 1 28 ? 3.487   5.618   -6.309  1.00 0.35 ? 28 PHE A CZ   3  
ATOM 4795  H H    . PHE A 1 28 ? 6.596   8.953   -5.498  1.00 0.35 ? 28 PHE A H    3  
ATOM 4796  H HA   . PHE A 1 28 ? 5.049   11.309  -5.002  1.00 0.35 ? 28 PHE A HA   3  
ATOM 4797  H HB2  . PHE A 1 28 ? 2.858   10.014  -4.545  1.00 0.35 ? 28 PHE A HB2  3  
ATOM 4798  H HB3  . PHE A 1 28 ? 3.243   10.389  -6.225  1.00 0.35 ? 28 PHE A HB3  3  
ATOM 4799  H HD1  . PHE A 1 28 ? 3.559   7.718   -3.633  1.00 0.35 ? 28 PHE A HD1  3  
ATOM 4800  H HD2  . PHE A 1 28 ? 3.488   8.667   -7.821  1.00 0.35 ? 28 PHE A HD2  3  
ATOM 4801  H HE1  . PHE A 1 28 ? 3.524   5.299   -4.179  1.00 0.35 ? 28 PHE A HE1  3  
ATOM 4802  H HE2  . PHE A 1 28 ? 3.454   6.248   -8.368  1.00 0.35 ? 28 PHE A HE2  3  
ATOM 4803  H HZ   . PHE A 1 28 ? 3.472   4.564   -6.547  1.00 0.35 ? 28 PHE A HZ   3  
ATOM 4804  N N    . TYR A 1 29 ? 4.762   10.528  -2.541  1.00 0.32 ? 29 TYR A N    3  
ATOM 4805  C CA   . TYR A 1 29 ? 4.991   10.138  -1.121  1.00 0.32 ? 29 TYR A CA   3  
ATOM 4806  C C    . TYR A 1 29 ? 3.806   9.313   -0.618  1.00 0.32 ? 29 TYR A C    3  
ATOM 4807  O O    . TYR A 1 29 ? 2.761   9.267   -1.237  1.00 0.32 ? 29 TYR A O    3  
ATOM 4808  C CB   . TYR A 1 29 ? 5.136   11.397  -0.264  1.00 0.32 ? 29 TYR A CB   3  
ATOM 4809  C CG   . TYR A 1 29 ? 6.407   12.120  -0.642  1.00 0.32 ? 29 TYR A CG   3  
ATOM 4810  C CD1  . TYR A 1 29 ? 6.425   12.970  -1.755  1.00 0.32 ? 29 TYR A CD1  3  
ATOM 4811  C CD2  . TYR A 1 29 ? 7.567   11.942  0.121   1.00 0.32 ? 29 TYR A CD2  3  
ATOM 4812  C CE1  . TYR A 1 29 ? 7.603   13.639  -2.104  1.00 0.32 ? 29 TYR A CE1  3  
ATOM 4813  C CE2  . TYR A 1 29 ? 8.745   12.612  -0.229  1.00 0.32 ? 29 TYR A CE2  3  
ATOM 4814  C CZ   . TYR A 1 29 ? 8.764   13.461  -1.341  1.00 0.32 ? 29 TYR A CZ   3  
ATOM 4815  O OH   . TYR A 1 29 ? 9.925   14.122  -1.686  1.00 0.32 ? 29 TYR A OH   3  
ATOM 4816  H H    . TYR A 1 29 ? 4.266   11.347  -2.751  1.00 0.32 ? 29 TYR A H    3  
ATOM 4817  H HA   . TYR A 1 29 ? 5.894   9.550   -1.052  1.00 0.32 ? 29 TYR A HA   3  
ATOM 4818  H HB2  . TYR A 1 29 ? 4.289   12.047  -0.432  1.00 0.32 ? 29 TYR A HB2  3  
ATOM 4819  H HB3  . TYR A 1 29 ? 5.177   11.121  0.779   1.00 0.32 ? 29 TYR A HB3  3  
ATOM 4820  H HD1  . TYR A 1 29 ? 5.531   13.107  -2.345  1.00 0.32 ? 29 TYR A HD1  3  
ATOM 4821  H HD2  . TYR A 1 29 ? 7.553   11.286  0.979   1.00 0.32 ? 29 TYR A HD2  3  
ATOM 4822  H HE1  . TYR A 1 29 ? 7.618   14.294  -2.963  1.00 0.32 ? 29 TYR A HE1  3  
ATOM 4823  H HE2  . TYR A 1 29 ? 9.640   12.475  0.360   1.00 0.32 ? 29 TYR A HE2  3  
ATOM 4824  H HH   . TYR A 1 29 ? 10.228  14.609  -0.917  1.00 0.32 ? 29 TYR A HH   3  
ATOM 4825  N N    . THR A 1 30 ? 3.959   8.660   0.501   1.00 0.37 ? 30 THR A N    3  
ATOM 4826  C CA   . THR A 1 30 ? 2.841   7.837   1.044   1.00 0.37 ? 30 THR A CA   3  
ATOM 4827  C C    . THR A 1 30 ? 2.893   7.850   2.572   1.00 0.37 ? 30 THR A C    3  
ATOM 4828  O O    . THR A 1 30 ? 3.952   7.802   3.167   1.00 0.37 ? 30 THR A O    3  
ATOM 4829  C CB   . THR A 1 30 ? 2.975   6.397   0.543   1.00 0.37 ? 30 THR A CB   3  
ATOM 4830  O OG1  . THR A 1 30 ? 3.822   5.670   1.422   1.00 0.37 ? 30 THR A OG1  3  
ATOM 4831  C CG2  . THR A 1 30 ? 3.576   6.396   -0.863  1.00 0.37 ? 30 THR A CG2  3  
ATOM 4832  H H    . THR A 1 30 ? 4.809   8.709   0.985   1.00 0.37 ? 30 THR A H    3  
ATOM 4833  H HA   . THR A 1 30 ? 1.898   8.248   0.712   1.00 0.37 ? 30 THR A HA   3  
ATOM 4834  H HB   . THR A 1 30 ? 2.002   5.934   0.514   1.00 0.37 ? 30 THR A HB   3  
ATOM 4835  H HG1  . THR A 1 30 ? 3.268   5.110   1.971   1.00 0.37 ? 30 THR A HG1  3  
ATOM 4836  H HG21 . THR A 1 30 ? 4.529   6.905   -0.848  1.00 0.37 ? 30 THR A HG21 3  
ATOM 4837  H HG22 . THR A 1 30 ? 3.716   5.378   -1.194  1.00 0.37 ? 30 THR A HG22 3  
ATOM 4838  H HG23 . THR A 1 30 ? 2.907   6.906   -1.541  1.00 0.37 ? 30 THR A HG23 3  
ATOM 4839  N N    . SER A 1 31 ? 1.758   7.915   3.213   1.00 0.47 ? 31 SER A N    3  
ATOM 4840  C CA   . SER A 1 31 ? 1.743   7.930   4.702   1.00 0.47 ? 31 SER A CA   3  
ATOM 4841  C C    . SER A 1 31 ? 0.295   7.890   5.197   1.00 0.47 ? 31 SER A C    3  
ATOM 4842  O O    . SER A 1 31 ? -0.625  7.661   4.437   1.00 0.47 ? 31 SER A O    3  
ATOM 4843  C CB   . SER A 1 31 ? 2.419   9.204   5.207   1.00 0.47 ? 31 SER A CB   3  
ATOM 4844  O OG   . SER A 1 31 ? 2.873   8.999   6.539   1.00 0.47 ? 31 SER A OG   3  
ATOM 4845  H H    . SER A 1 31 ? 0.916   7.952   2.713   1.00 0.47 ? 31 SER A H    3  
ATOM 4846  H HA   . SER A 1 31 ? 2.273   7.067   5.076   1.00 0.47 ? 31 SER A HA   3  
ATOM 4847  H HB2  . SER A 1 31 ? 3.261   9.440   4.578   1.00 0.47 ? 31 SER A HB2  3  
ATOM 4848  H HB3  . SER A 1 31 ? 1.711   10.022  5.179   1.00 0.47 ? 31 SER A HB3  3  
ATOM 4849  H HG   . SER A 1 31 ? 3.120   9.852   6.903   1.00 0.47 ? 31 SER A HG   3  
ATOM 4850  N N    . GLY A 1 32 ? 0.086   8.109   6.467   1.00 0.60 ? 32 GLY A N    3  
ATOM 4851  C CA   . GLY A 1 32 ? -1.302  8.081   7.009   1.00 0.60 ? 32 GLY A CA   3  
ATOM 4852  C C    . GLY A 1 32 ? -1.743  6.629   7.201   1.00 0.60 ? 32 GLY A C    3  
ATOM 4853  O O    . GLY A 1 32 ? -1.752  6.113   8.302   1.00 0.60 ? 32 GLY A O    3  
ATOM 4854  H H    . GLY A 1 32 ? 0.841   8.290   7.064   1.00 0.60 ? 32 GLY A H    3  
ATOM 4855  H HA2  . GLY A 1 32 ? -1.328  8.597   7.959   1.00 0.60 ? 32 GLY A HA2  3  
ATOM 4856  H HA3  . GLY A 1 32 ? -1.971  8.568   6.315   1.00 0.60 ? 32 GLY A HA3  3  
ATOM 4857  N N    . LYS A 1 33 ? -2.108  5.965   6.139   1.00 0.55 ? 33 LYS A N    3  
ATOM 4858  C CA   . LYS A 1 33 ? -2.545  4.546   6.260   1.00 0.55 ? 33 LYS A CA   3  
ATOM 4859  C C    . LYS A 1 33 ? -1.328  3.627   6.135   1.00 0.55 ? 33 LYS A C    3  
ATOM 4860  O O    . LYS A 1 33 ? -1.396  2.566   5.548   1.00 0.55 ? 33 LYS A O    3  
ATOM 4861  C CB   . LYS A 1 33 ? -3.543  4.225   5.146   1.00 0.55 ? 33 LYS A CB   3  
ATOM 4862  C CG   . LYS A 1 33 ? -4.772  5.124   5.287   1.00 0.55 ? 33 LYS A CG   3  
ATOM 4863  C CD   . LYS A 1 33 ? -5.997  4.404   4.720   1.00 0.55 ? 33 LYS A CD   3  
ATOM 4864  C CE   . LYS A 1 33 ? -6.866  5.402   3.952   1.00 0.55 ? 33 LYS A CE   3  
ATOM 4865  N NZ   . LYS A 1 33 ? -7.700  4.671   2.956   1.00 0.55 ? 33 LYS A NZ   3  
ATOM 4866  H H    . LYS A 1 33 ? -2.091  6.399   5.260   1.00 0.55 ? 33 LYS A H    3  
ATOM 4867  H HA   . LYS A 1 33 ? -3.015  4.394   7.220   1.00 0.55 ? 33 LYS A HA   3  
ATOM 4868  H HB2  . LYS A 1 33 ? -3.078  4.396   4.186   1.00 0.55 ? 33 LYS A HB2  3  
ATOM 4869  H HB3  . LYS A 1 33 ? -3.846  3.191   5.221   1.00 0.55 ? 33 LYS A HB3  3  
ATOM 4870  H HG2  . LYS A 1 33 ? -4.936  5.348   6.331   1.00 0.55 ? 33 LYS A HG2  3  
ATOM 4871  H HG3  . LYS A 1 33 ? -4.612  6.041   4.742   1.00 0.55 ? 33 LYS A HG3  3  
ATOM 4872  H HD2  . LYS A 1 33 ? -5.675  3.619   4.054   1.00 0.55 ? 33 LYS A HD2  3  
ATOM 4873  H HD3  . LYS A 1 33 ? -6.572  3.979   5.529   1.00 0.55 ? 33 LYS A HD3  3  
ATOM 4874  H HE2  . LYS A 1 33 ? -7.509  5.927   4.643   1.00 0.55 ? 33 LYS A HE2  3  
ATOM 4875  H HE3  . LYS A 1 33 ? -6.233  6.111   3.440   1.00 0.55 ? 33 LYS A HE3  3  
ATOM 4876  H HZ1  . LYS A 1 33 ? -8.065  3.797   3.385   1.00 0.55 ? 33 LYS A HZ1  3  
ATOM 4877  H HZ2  . LYS A 1 33 ? -8.496  5.273   2.663   1.00 0.55 ? 33 LYS A HZ2  3  
ATOM 4878  H HZ3  . LYS A 1 33 ? -7.121  4.432   2.127   1.00 0.55 ? 33 LYS A HZ3  3  
ATOM 4879  N N    . CYS A 1 34 ? -0.212  4.028   6.681   1.00 0.46 ? 34 CYS A N    3  
ATOM 4880  C CA   . CYS A 1 34 ? 1.009   3.180   6.591   1.00 0.46 ? 34 CYS A CA   3  
ATOM 4881  C C    . CYS A 1 34 ? 1.771   3.239   7.917   1.00 0.46 ? 34 CYS A C    3  
ATOM 4882  O O    . CYS A 1 34 ? 1.558   4.119   8.727   1.00 0.46 ? 34 CYS A O    3  
ATOM 4883  C CB   . CYS A 1 34 ? 1.907   3.697   5.465   1.00 0.46 ? 34 CYS A CB   3  
ATOM 4884  S SG   . CYS A 1 34 ? 0.882   4.228   4.071   1.00 0.46 ? 34 CYS A SG   3  
ATOM 4885  H H    . CYS A 1 34 ? -0.178  4.888   7.149   1.00 0.46 ? 34 CYS A H    3  
ATOM 4886  H HA   . CYS A 1 34 ? 0.725   2.159   6.384   1.00 0.46 ? 34 CYS A HA   3  
ATOM 4887  H HB2  . CYS A 1 34 ? 2.488   4.534   5.823   1.00 0.46 ? 34 CYS A HB2  3  
ATOM 4888  H HB3  . CYS A 1 34 ? 2.572   2.909   5.144   1.00 0.46 ? 34 CYS A HB3  3  
ATOM 4889  N N    . SER A 1 35 ? 2.660   2.311   8.143   1.00 0.42 ? 35 SER A N    3  
ATOM 4890  C CA   . SER A 1 35 ? 3.434   2.316   9.415   1.00 0.42 ? 35 SER A CA   3  
ATOM 4891  C C    . SER A 1 35 ? 4.348   3.543   9.449   1.00 0.42 ? 35 SER A C    3  
ATOM 4892  O O    . SER A 1 35 ? 4.561   4.142   10.484  1.00 0.42 ? 35 SER A O    3  
ATOM 4893  C CB   . SER A 1 35 ? 4.281   1.047   9.502   1.00 0.42 ? 35 SER A CB   3  
ATOM 4894  O OG   . SER A 1 35 ? 3.515   -0.061  9.047   1.00 0.42 ? 35 SER A OG   3  
ATOM 4895  H H    . SER A 1 35 ? 2.817   1.611   7.476   1.00 0.42 ? 35 SER A H    3  
ATOM 4896  H HA   . SER A 1 35 ? 2.752   2.352   10.252  1.00 0.42 ? 35 SER A HA   3  
ATOM 4897  H HB2  . SER A 1 35 ? 5.155   1.152   8.881   1.00 0.42 ? 35 SER A HB2  3  
ATOM 4898  H HB3  . SER A 1 35 ? 4.589   0.890   10.527  1.00 0.42 ? 35 SER A HB3  3  
ATOM 4899  H HG   . SER A 1 35 ? 3.022   -0.408  9.795   1.00 0.42 ? 35 SER A HG   3  
ATOM 4900  N N    . ASN A 1 36 ? 4.889   3.921   8.323   1.00 0.38 ? 36 ASN A N    3  
ATOM 4901  C CA   . ASN A 1 36 ? 5.788   5.108   8.288   1.00 0.38 ? 36 ASN A CA   3  
ATOM 4902  C C    . ASN A 1 36 ? 5.691   5.783   6.917   1.00 0.38 ? 36 ASN A C    3  
ATOM 4903  O O    . ASN A 1 36 ? 5.382   5.140   5.933   1.00 0.38 ? 36 ASN A O    3  
ATOM 4904  C CB   . ASN A 1 36 ? 7.231   4.662   8.537   1.00 0.38 ? 36 ASN A CB   3  
ATOM 4905  C CG   . ASN A 1 36 ? 7.692   3.763   7.389   1.00 0.38 ? 36 ASN A CG   3  
ATOM 4906  O OD1  . ASN A 1 36 ? 8.380   4.208   6.492   1.00 0.38 ? 36 ASN A OD1  3  
ATOM 4907  N ND2  . ASN A 1 36 ? 7.341   2.506   7.378   1.00 0.38 ? 36 ASN A ND2  3  
ATOM 4908  H H    . ASN A 1 36 ? 4.703   3.424   7.499   1.00 0.38 ? 36 ASN A H    3  
ATOM 4909  H HA   . ASN A 1 36 ? 5.490   5.808   9.056   1.00 0.38 ? 36 ASN A HA   3  
ATOM 4910  H HB2  . ASN A 1 36 ? 7.871   5.531   8.595   1.00 0.38 ? 36 ASN A HB2  3  
ATOM 4911  H HB3  . ASN A 1 36 ? 7.284   4.114   9.465   1.00 0.38 ? 36 ASN A HB3  3  
ATOM 4912  H HD21 . ASN A 1 36 ? 6.786   2.147   8.102   1.00 0.38 ? 36 ASN A HD21 3  
ATOM 4913  H HD22 . ASN A 1 36 ? 7.631   1.923   6.647   1.00 0.38 ? 36 ASN A HD22 3  
ATOM 4914  N N    . PRO A 1 37 ? 5.960   7.063   6.896   1.00 0.37 ? 37 PRO A N    3  
ATOM 4915  C CA   . PRO A 1 37 ? 5.914   7.864   5.660   1.00 0.37 ? 37 PRO A CA   3  
ATOM 4916  C C    . PRO A 1 37 ? 7.174   7.623   4.822   1.00 0.37 ? 37 PRO A C    3  
ATOM 4917  O O    . PRO A 1 37 ? 8.280   7.668   5.322   1.00 0.37 ? 37 PRO A O    3  
ATOM 4918  C CB   . PRO A 1 37 ? 5.865   9.307   6.171   1.00 0.37 ? 37 PRO A CB   3  
ATOM 4919  C CG   . PRO A 1 37 ? 6.450   9.284   7.604   1.00 0.37 ? 37 PRO A CG   3  
ATOM 4920  C CD   . PRO A 1 37 ? 6.334   7.831   8.103   1.00 0.37 ? 37 PRO A CD   3  
ATOM 4921  H HA   . PRO A 1 37 ? 5.027   7.642   5.092   1.00 0.37 ? 37 PRO A HA   3  
ATOM 4922  H HB2  . PRO A 1 37 ? 6.463   9.945   5.533   1.00 0.37 ? 37 PRO A HB2  3  
ATOM 4923  H HB3  . PRO A 1 37 ? 4.846   9.658   6.200   1.00 0.37 ? 37 PRO A HB3  3  
ATOM 4924  H HG2  . PRO A 1 37 ? 7.487   9.591   7.585   1.00 0.37 ? 37 PRO A HG2  3  
ATOM 4925  H HG3  . PRO A 1 37 ? 5.881   9.936   8.248   1.00 0.37 ? 37 PRO A HG3  3  
ATOM 4926  H HD2  . PRO A 1 37 ? 7.283   7.489   8.492   1.00 0.37 ? 37 PRO A HD2  3  
ATOM 4927  H HD3  . PRO A 1 37 ? 5.562   7.748   8.851   1.00 0.37 ? 37 PRO A HD3  3  
ATOM 4928  N N    . ALA A 1 38 ? 7.014   7.365   3.553   1.00 0.33 ? 38 ALA A N    3  
ATOM 4929  C CA   . ALA A 1 38 ? 8.202   7.120   2.689   1.00 0.33 ? 38 ALA A CA   3  
ATOM 4930  C C    . ALA A 1 38 ? 7.899   7.572   1.259   1.00 0.33 ? 38 ALA A C    3  
ATOM 4931  O O    . ALA A 1 38 ? 6.785   7.933   0.934   1.00 0.33 ? 38 ALA A O    3  
ATOM 4932  C CB   . ALA A 1 38 ? 8.535   5.627   2.692   1.00 0.33 ? 38 ALA A CB   3  
ATOM 4933  H H    . ALA A 1 38 ? 6.112   7.332   3.169   1.00 0.33 ? 38 ALA A H    3  
ATOM 4934  H HA   . ALA A 1 38 ? 9.046   7.677   3.071   1.00 0.33 ? 38 ALA A HA   3  
ATOM 4935  H HB1  . ALA A 1 38 ? 7.631   5.057   2.536   1.00 0.33 ? 38 ALA A HB1  3  
ATOM 4936  H HB2  . ALA A 1 38 ? 9.238   5.413   1.900   1.00 0.33 ? 38 ALA A HB2  3  
ATOM 4937  H HB3  . ALA A 1 38 ? 8.971   5.357   3.642   1.00 0.33 ? 38 ALA A HB3  3  
ATOM 4938  N N    . VAL A 1 39 ? 8.883   7.555   0.401   1.00 0.30 ? 39 VAL A N    3  
ATOM 4939  C CA   . VAL A 1 39 ? 8.652   7.983   -1.008  1.00 0.30 ? 39 VAL A CA   3  
ATOM 4940  C C    . VAL A 1 39 ? 8.414   6.749   -1.882  1.00 0.30 ? 39 VAL A C    3  
ATOM 4941  O O    . VAL A 1 39 ? 8.668   5.631   -1.478  1.00 0.30 ? 39 VAL A O    3  
ATOM 4942  C CB   . VAL A 1 39 ? 9.877   8.746   -1.517  1.00 0.30 ? 39 VAL A CB   3  
ATOM 4943  C CG1  . VAL A 1 39 ? 9.802   8.890   -3.038  1.00 0.30 ? 39 VAL A CG1  3  
ATOM 4944  C CG2  . VAL A 1 39 ? 9.910   10.136  -0.878  1.00 0.30 ? 39 VAL A CG2  3  
ATOM 4945  H H    . VAL A 1 39 ? 9.774   7.260   0.683   1.00 0.30 ? 39 VAL A H    3  
ATOM 4946  H HA   . VAL A 1 39 ? 7.785   8.625   -1.050  1.00 0.30 ? 39 VAL A HA   3  
ATOM 4947  H HB   . VAL A 1 39 ? 10.774  8.205   -1.251  1.00 0.30 ? 39 VAL A HB   3  
ATOM 4948  H HG11 . VAL A 1 39 ? 8.863   9.350   -3.310  1.00 0.30 ? 39 VAL A HG11 3  
ATOM 4949  H HG12 . VAL A 1 39 ? 10.618  9.507   -3.383  1.00 0.30 ? 39 VAL A HG12 3  
ATOM 4950  H HG13 . VAL A 1 39 ? 9.870   7.914   -3.496  1.00 0.30 ? 39 VAL A HG13 3  
ATOM 4951  H HG21 . VAL A 1 39 ? 9.276   10.147  -0.004  1.00 0.30 ? 39 VAL A HG21 3  
ATOM 4952  H HG22 . VAL A 1 39 ? 10.923  10.377  -0.592  1.00 0.30 ? 39 VAL A HG22 3  
ATOM 4953  H HG23 . VAL A 1 39 ? 9.554   10.867  -1.590  1.00 0.30 ? 39 VAL A HG23 3  
ATOM 4954  N N    . VAL A 1 40 ? 7.929   6.944   -3.077  1.00 0.33 ? 40 VAL A N    3  
ATOM 4955  C CA   . VAL A 1 40 ? 7.674   5.785   -3.978  1.00 0.33 ? 40 VAL A CA   3  
ATOM 4956  C C    . VAL A 1 40 ? 7.963   6.195   -5.423  1.00 0.33 ? 40 VAL A C    3  
ATOM 4957  O O    . VAL A 1 40 ? 7.288   7.033   -5.988  1.00 0.33 ? 40 VAL A O    3  
ATOM 4958  C CB   . VAL A 1 40 ? 6.211   5.356   -3.847  1.00 0.33 ? 40 VAL A CB   3  
ATOM 4959  C CG1  . VAL A 1 40 ? 5.844   4.414   -4.996  1.00 0.33 ? 40 VAL A CG1  3  
ATOM 4960  C CG2  . VAL A 1 40 ? 6.012   4.631   -2.514  1.00 0.33 ? 40 VAL A CG2  3  
ATOM 4961  H H    . VAL A 1 40 ? 7.732   7.854   -3.383  1.00 0.33 ? 40 VAL A H    3  
ATOM 4962  H HA   . VAL A 1 40 ? 8.318   4.964   -3.699  1.00 0.33 ? 40 VAL A HA   3  
ATOM 4963  H HB   . VAL A 1 40 ? 5.576   6.229   -3.881  1.00 0.33 ? 40 VAL A HB   3  
ATOM 4964  H HG11 . VAL A 1 40 ? 6.638   3.696   -5.141  1.00 0.33 ? 40 VAL A HG11 3  
ATOM 4965  H HG12 . VAL A 1 40 ? 4.928   3.894   -4.757  1.00 0.33 ? 40 VAL A HG12 3  
ATOM 4966  H HG13 . VAL A 1 40 ? 5.707   4.987   -5.901  1.00 0.33 ? 40 VAL A HG13 3  
ATOM 4967  H HG21 . VAL A 1 40 ? 6.473   5.202   -1.721  1.00 0.33 ? 40 VAL A HG21 3  
ATOM 4968  H HG22 . VAL A 1 40 ? 4.956   4.526   -2.314  1.00 0.33 ? 40 VAL A HG22 3  
ATOM 4969  H HG23 . VAL A 1 40 ? 6.467   3.653   -2.564  1.00 0.33 ? 40 VAL A HG23 3  
ATOM 4970  N N    . PHE A 1 41 ? 8.962   5.612   -6.028  1.00 0.37 ? 41 PHE A N    3  
ATOM 4971  C CA   . PHE A 1 41 ? 9.293   5.970   -7.436  1.00 0.37 ? 41 PHE A CA   3  
ATOM 4972  C C    . PHE A 1 41 ? 8.515   5.065   -8.392  1.00 0.37 ? 41 PHE A C    3  
ATOM 4973  O O    . PHE A 1 41 ? 8.178   3.944   -8.066  1.00 0.37 ? 41 PHE A O    3  
ATOM 4974  C CB   . PHE A 1 41 ? 10.793  5.789   -7.669  1.00 0.37 ? 41 PHE A CB   3  
ATOM 4975  C CG   . PHE A 1 41 ? 11.541  6.965   -7.088  1.00 0.37 ? 41 PHE A CG   3  
ATOM 4976  C CD1  . PHE A 1 41 ? 11.662  8.150   -7.824  1.00 0.37 ? 41 PHE A CD1  3  
ATOM 4977  C CD2  . PHE A 1 41 ? 12.111  6.871   -5.813  1.00 0.37 ? 41 PHE A CD2  3  
ATOM 4978  C CE1  . PHE A 1 41 ? 12.354  9.241   -7.285  1.00 0.37 ? 41 PHE A CE1  3  
ATOM 4979  C CE2  . PHE A 1 41 ? 12.803  7.963   -5.275  1.00 0.37 ? 41 PHE A CE2  3  
ATOM 4980  C CZ   . PHE A 1 41 ? 12.925  9.147   -6.010  1.00 0.37 ? 41 PHE A CZ   3  
ATOM 4981  H H    . PHE A 1 41 ? 9.495   4.939   -5.556  1.00 0.37 ? 41 PHE A H    3  
ATOM 4982  H HA   . PHE A 1 41 ? 9.024   7.001   -7.617  1.00 0.37 ? 41 PHE A HA   3  
ATOM 4983  H HB2  . PHE A 1 41 ? 11.125  4.878   -7.189  1.00 0.37 ? 41 PHE A HB2  3  
ATOM 4984  H HB3  . PHE A 1 41 ? 10.988  5.728   -8.730  1.00 0.37 ? 41 PHE A HB3  3  
ATOM 4985  H HD1  . PHE A 1 41 ? 11.222  8.222   -8.808  1.00 0.37 ? 41 PHE A HD1  3  
ATOM 4986  H HD2  . PHE A 1 41 ? 12.018  5.958   -5.245  1.00 0.37 ? 41 PHE A HD2  3  
ATOM 4987  H HE1  . PHE A 1 41 ? 12.448  10.154  -7.853  1.00 0.37 ? 41 PHE A HE1  3  
ATOM 4988  H HE2  . PHE A 1 41 ? 13.243  7.890   -4.290  1.00 0.37 ? 41 PHE A HE2  3  
ATOM 4989  H HZ   . PHE A 1 41 ? 13.459  9.989   -5.594  1.00 0.37 ? 41 PHE A HZ   3  
ATOM 4990  N N    . VAL A 1 42 ? 8.226   5.543   -9.572  1.00 0.46 ? 42 VAL A N    3  
ATOM 4991  C CA   . VAL A 1 42 ? 7.470   4.711   -10.549 1.00 0.46 ? 42 VAL A CA   3  
ATOM 4992  C C    . VAL A 1 42 ? 8.126   4.825   -11.927 1.00 0.46 ? 42 VAL A C    3  
ATOM 4993  O O    . VAL A 1 42 ? 8.249   5.901   -12.479 1.00 0.46 ? 42 VAL A O    3  
ATOM 4994  C CB   . VAL A 1 42 ? 6.024   5.204   -10.631 1.00 0.46 ? 42 VAL A CB   3  
ATOM 4995  C CG1  . VAL A 1 42 ? 5.185   4.198   -11.419 1.00 0.46 ? 42 VAL A CG1  3  
ATOM 4996  C CG2  . VAL A 1 42 ? 5.456   5.343   -9.217  1.00 0.46 ? 42 VAL A CG2  3  
ATOM 4997  H H    . VAL A 1 42 ? 8.507   6.449   -9.815  1.00 0.46 ? 42 VAL A H    3  
ATOM 4998  H HA   . VAL A 1 42 ? 7.483   3.679   -10.230 1.00 0.46 ? 42 VAL A HA   3  
ATOM 4999  H HB   . VAL A 1 42 ? 5.999   6.163   -11.128 1.00 0.46 ? 42 VAL A HB   3  
ATOM 5000  H HG11 . VAL A 1 42 ? 5.605   3.210   -11.305 1.00 0.46 ? 42 VAL A HG11 3  
ATOM 5001  H HG12 . VAL A 1 42 ? 4.171   4.204   -11.047 1.00 0.46 ? 42 VAL A HG12 3  
ATOM 5002  H HG13 . VAL A 1 42 ? 5.186   4.470   -12.465 1.00 0.46 ? 42 VAL A HG13 3  
ATOM 5003  H HG21 . VAL A 1 42 ? 6.129   4.881   -8.511  1.00 0.46 ? 42 VAL A HG21 3  
ATOM 5004  H HG22 . VAL A 1 42 ? 5.344   6.391   -8.975  1.00 0.46 ? 42 VAL A HG22 3  
ATOM 5005  H HG23 . VAL A 1 42 ? 4.492   4.857   -9.167  1.00 0.46 ? 42 VAL A HG23 3  
ATOM 5006  N N    . THR A 1 43 ? 8.548   3.724   -12.486 1.00 0.54 ? 43 THR A N    3  
ATOM 5007  C CA   . THR A 1 43 ? 9.195   3.769   -13.827 1.00 0.54 ? 43 THR A CA   3  
ATOM 5008  C C    . THR A 1 43 ? 8.132   3.616   -14.916 1.00 0.54 ? 43 THR A C    3  
ATOM 5009  O O    . THR A 1 43 ? 6.995   3.282   -14.643 1.00 0.54 ? 43 THR A O    3  
ATOM 5010  C CB   . THR A 1 43 ? 10.211  2.630   -13.942 1.00 0.54 ? 43 THR A CB   3  
ATOM 5011  O OG1  . THR A 1 43 ? 9.535   1.385   -13.841 1.00 0.54 ? 43 THR A OG1  3  
ATOM 5012  C CG2  . THR A 1 43 ? 11.242  2.747   -12.818 1.00 0.54 ? 43 THR A CG2  3  
ATOM 5013  H H    . THR A 1 43 ? 8.439   2.866   -12.025 1.00 0.54 ? 43 THR A H    3  
ATOM 5014  H HA   . THR A 1 43 ? 9.702   4.716   -13.950 1.00 0.54 ? 43 THR A HA   3  
ATOM 5015  H HB   . THR A 1 43 ? 10.715  2.691   -14.894 1.00 0.54 ? 43 THR A HB   3  
ATOM 5016  H HG1  . THR A 1 43 ? 10.188  0.685   -13.921 1.00 0.54 ? 43 THR A HG1  3  
ATOM 5017  H HG21 . THR A 1 43 ? 11.089  3.674   -12.285 1.00 0.54 ? 43 THR A HG21 3  
ATOM 5018  H HG22 . THR A 1 43 ? 11.126  1.917   -12.136 1.00 0.54 ? 43 THR A HG22 3  
ATOM 5019  H HG23 . THR A 1 43 ? 12.236  2.732   -13.238 1.00 0.54 ? 43 THR A HG23 3  
ATOM 5020  N N    . ARG A 1 44 ? 8.489   3.855   -16.147 1.00 0.69 ? 44 ARG A N    3  
ATOM 5021  C CA   . ARG A 1 44 ? 7.497   3.723   -17.251 1.00 0.69 ? 44 ARG A CA   3  
ATOM 5022  C C    . ARG A 1 44 ? 6.935   2.300   -17.264 1.00 0.69 ? 44 ARG A C    3  
ATOM 5023  O O    . ARG A 1 44 ? 5.917   2.030   -17.870 1.00 0.69 ? 44 ARG A O    3  
ATOM 5024  C CB   . ARG A 1 44 ? 8.182   4.013   -18.589 1.00 0.69 ? 44 ARG A CB   3  
ATOM 5025  C CG   . ARG A 1 44 ? 8.919   5.351   -18.506 1.00 0.69 ? 44 ARG A CG   3  
ATOM 5026  C CD   . ARG A 1 44 ? 9.092   5.927   -19.913 1.00 0.69 ? 44 ARG A CD   3  
ATOM 5027  N NE   . ARG A 1 44 ? 9.501   4.841   -20.847 1.00 0.69 ? 44 ARG A NE   3  
ATOM 5028  C CZ   . ARG A 1 44 ? 10.595  4.959   -21.547 1.00 0.69 ? 44 ARG A CZ   3  
ATOM 5029  N NH1  . ARG A 1 44 ? 10.806  6.037   -22.252 1.00 0.69 ? 44 ARG A NH1  3  
ATOM 5030  N NH2  . ARG A 1 44 ? 11.480  4.000   -21.542 1.00 0.69 ? 44 ARG A NH2  3  
ATOM 5031  H H    . ARG A 1 44 ? 9.411   4.123   -16.346 1.00 0.69 ? 44 ARG A H    3  
ATOM 5032  H HA   . ARG A 1 44 ? 6.693   4.426   -17.098 1.00 0.69 ? 44 ARG A HA   3  
ATOM 5033  H HB2  . ARG A 1 44 ? 8.889   3.226   -18.809 1.00 0.69 ? 44 ARG A HB2  3  
ATOM 5034  H HB3  . ARG A 1 44 ? 7.439   4.060   -19.370 1.00 0.69 ? 44 ARG A HB3  3  
ATOM 5035  H HG2  . ARG A 1 44 ? 8.345   6.041   -17.902 1.00 0.69 ? 44 ARG A HG2  3  
ATOM 5036  H HG3  . ARG A 1 44 ? 9.889   5.202   -18.059 1.00 0.69 ? 44 ARG A HG3  3  
ATOM 5037  H HD2  . ARG A 1 44 ? 8.157   6.354   -20.245 1.00 0.69 ? 44 ARG A HD2  3  
ATOM 5038  H HD3  . ARG A 1 44 ? 9.852   6.694   -19.898 1.00 0.69 ? 44 ARG A HD3  3  
ATOM 5039  H HE   . ARG A 1 44 ? 8.946   4.037   -20.936 1.00 0.69 ? 44 ARG A HE   3  
ATOM 5040  H HH11 . ARG A 1 44 ? 10.128  6.772   -22.256 1.00 0.69 ? 44 ARG A HH11 3  
ATOM 5041  H HH12 . ARG A 1 44 ? 11.644  6.128   -22.788 1.00 0.69 ? 44 ARG A HH12 3  
ATOM 5042  H HH21 . ARG A 1 44 ? 11.319  3.174   -21.001 1.00 0.69 ? 44 ARG A HH21 3  
ATOM 5043  H HH22 . ARG A 1 44 ? 12.319  4.092   -22.078 1.00 0.69 ? 44 ARG A HH22 3  
ATOM 5044  N N    . LYS A 1 45 ? 7.590   1.387   -16.600 1.00 0.66 ? 45 LYS A N    3  
ATOM 5045  C CA   . LYS A 1 45 ? 7.092   -0.017  -16.575 1.00 0.66 ? 45 LYS A CA   3  
ATOM 5046  C C    . LYS A 1 45 ? 6.139   -0.199  -15.392 1.00 0.66 ? 45 LYS A C    3  
ATOM 5047  O O    . LYS A 1 45 ? 6.027   -1.272  -14.832 1.00 0.66 ? 45 LYS A O    3  
ATOM 5048  C CB   . LYS A 1 45 ? 8.275   -0.976  -16.429 1.00 0.66 ? 45 LYS A CB   3  
ATOM 5049  C CG   . LYS A 1 45 ? 8.786   -1.372  -17.816 1.00 0.66 ? 45 LYS A CG   3  
ATOM 5050  C CD   . LYS A 1 45 ? 9.248   -0.122  -18.567 1.00 0.66 ? 45 LYS A CD   3  
ATOM 5051  C CE   . LYS A 1 45 ? 9.975   -0.535  -19.848 1.00 0.66 ? 45 LYS A CE   3  
ATOM 5052  N NZ   . LYS A 1 45 ? 9.312   0.099   -21.022 1.00 0.66 ? 45 LYS A NZ   3  
ATOM 5053  H H    . LYS A 1 45 ? 8.410   1.625   -16.118 1.00 0.66 ? 45 LYS A H    3  
ATOM 5054  H HA   . LYS A 1 45 ? 6.568   -0.230  -17.495 1.00 0.66 ? 45 LYS A HA   3  
ATOM 5055  H HB2  . LYS A 1 45 ? 9.067   -0.489  -15.879 1.00 0.66 ? 45 LYS A HB2  3  
ATOM 5056  H HB3  . LYS A 1 45 ? 7.960   -1.860  -15.898 1.00 0.66 ? 45 LYS A HB3  3  
ATOM 5057  H HG2  . LYS A 1 45 ? 9.615   -2.058  -17.711 1.00 0.66 ? 45 LYS A HG2  3  
ATOM 5058  H HG3  . LYS A 1 45 ? 7.991   -1.849  -18.369 1.00 0.66 ? 45 LYS A HG3  3  
ATOM 5059  H HD2  . LYS A 1 45 ? 8.389   0.484   -18.818 1.00 0.66 ? 45 LYS A HD2  3  
ATOM 5060  H HD3  . LYS A 1 45 ? 9.919   0.446   -17.942 1.00 0.66 ? 45 LYS A HD3  3  
ATOM 5061  H HE2  . LYS A 1 45 ? 11.004  -0.213  -19.798 1.00 0.66 ? 45 LYS A HE2  3  
ATOM 5062  H HE3  . LYS A 1 45 ? 9.939   -1.610  -19.952 1.00 0.66 ? 45 LYS A HE3  3  
ATOM 5063  H HZ1  . LYS A 1 45 ? 8.863   0.989   -20.728 1.00 0.66 ? 45 LYS A HZ1  3  
ATOM 5064  H HZ2  . LYS A 1 45 ? 10.022  0.299   -21.755 1.00 0.66 ? 45 LYS A HZ2  3  
ATOM 5065  H HZ3  . LYS A 1 45 ? 8.591   -0.546  -21.404 1.00 0.66 ? 45 LYS A HZ3  3  
ATOM 5066  N N    . ASN A 1 46 ? 5.453   0.841   -15.004 1.00 0.61 ? 46 ASN A N    3  
ATOM 5067  C CA   . ASN A 1 46 ? 4.508   0.725   -13.857 1.00 0.61 ? 46 ASN A CA   3  
ATOM 5068  C C    . ASN A 1 46 ? 5.206   0.022   -12.692 1.00 0.61 ? 46 ASN A C    3  
ATOM 5069  O O    . ASN A 1 46 ? 4.577   -0.628  -11.881 1.00 0.61 ? 46 ASN A O    3  
ATOM 5070  C CB   . ASN A 1 46 ? 3.284   -0.087  -14.285 1.00 0.61 ? 46 ASN A CB   3  
ATOM 5071  C CG   . ASN A 1 46 ? 2.261   -0.105  -13.148 1.00 0.61 ? 46 ASN A CG   3  
ATOM 5072  O OD1  . ASN A 1 46 ? 1.628   0.893   -12.867 1.00 0.61 ? 46 ASN A OD1  3  
ATOM 5073  N ND2  . ASN A 1 46 ? 2.071   -1.208  -12.475 1.00 0.61 ? 46 ASN A ND2  3  
ATOM 5074  H H    . ASN A 1 46 ? 5.558   1.698   -15.468 1.00 0.61 ? 46 ASN A H    3  
ATOM 5075  H HA   . ASN A 1 46 ? 4.196   1.712   -13.548 1.00 0.61 ? 46 ASN A HA   3  
ATOM 5076  H HB2  . ASN A 1 46 ? 2.841   0.364   -15.162 1.00 0.61 ? 46 ASN A HB2  3  
ATOM 5077  H HB3  . ASN A 1 46 ? 3.585   -1.098  -14.513 1.00 0.61 ? 46 ASN A HB3  3  
ATOM 5078  H HD21 . ASN A 1 46 ? 2.583   -2.013  -12.701 1.00 0.61 ? 46 ASN A HD21 3  
ATOM 5079  H HD22 . ASN A 1 46 ? 1.419   -1.231  -11.744 1.00 0.61 ? 46 ASN A HD22 3  
ATOM 5080  N N    . ARG A 1 47 ? 6.501   0.147   -12.601 1.00 0.52 ? 47 ARG A N    3  
ATOM 5081  C CA   . ARG A 1 47 ? 7.237   -0.515  -11.487 1.00 0.52 ? 47 ARG A CA   3  
ATOM 5082  C C    . ARG A 1 47 ? 7.318   0.437   -10.293 1.00 0.52 ? 47 ARG A C    3  
ATOM 5083  O O    . ARG A 1 47 ? 7.871   1.516   -10.383 1.00 0.52 ? 47 ARG A O    3  
ATOM 5084  C CB   . ARG A 1 47 ? 8.650   -0.873  -11.950 1.00 0.52 ? 47 ARG A CB   3  
ATOM 5085  C CG   . ARG A 1 47 ? 8.836   -2.391  -11.899 1.00 0.52 ? 47 ARG A CG   3  
ATOM 5086  C CD   . ARG A 1 47 ? 9.780   -2.828  -13.020 1.00 0.52 ? 47 ARG A CD   3  
ATOM 5087  N NE   . ARG A 1 47 ? 11.094  -3.222  -12.438 1.00 0.52 ? 47 ARG A NE   3  
ATOM 5088  C CZ   . ARG A 1 47 ? 11.327  -4.471  -12.139 1.00 0.52 ? 47 ARG A CZ   3  
ATOM 5089  N NH1  . ARG A 1 47 ? 11.029  -4.925  -10.953 1.00 0.52 ? 47 ARG A NH1  3  
ATOM 5090  N NH2  . ARG A 1 47 ? 11.860  -5.266  -13.027 1.00 0.52 ? 47 ARG A NH2  3  
ATOM 5091  H H    . ARG A 1 47 ? 6.990   0.676   -13.265 1.00 0.52 ? 47 ARG A H    3  
ATOM 5092  H HA   . ARG A 1 47 ? 6.715   -1.415  -11.194 1.00 0.52 ? 47 ARG A HA   3  
ATOM 5093  H HB2  . ARG A 1 47 ? 8.796   -0.526  -12.963 1.00 0.52 ? 47 ARG A HB2  3  
ATOM 5094  H HB3  . ARG A 1 47 ? 9.373   -0.403  -11.301 1.00 0.52 ? 47 ARG A HB3  3  
ATOM 5095  H HG2  . ARG A 1 47 ? 9.257   -2.670  -10.944 1.00 0.52 ? 47 ARG A HG2  3  
ATOM 5096  H HG3  . ARG A 1 47 ? 7.880   -2.875  -12.027 1.00 0.52 ? 47 ARG A HG3  3  
ATOM 5097  H HD2  . ARG A 1 47 ? 9.352   -3.671  -13.544 1.00 0.52 ? 47 ARG A HD2  3  
ATOM 5098  H HD3  . ARG A 1 47 ? 9.923   -2.010  -13.710 1.00 0.52 ? 47 ARG A HD3  3  
ATOM 5099  H HE   . ARG A 1 47 ? 11.783  -2.544  -12.278 1.00 0.52 ? 47 ARG A HE   3  
ATOM 5100  H HH11 . ARG A 1 47 ? 10.622  -4.317  -10.272 1.00 0.52 ? 47 ARG A HH11 3  
ATOM 5101  H HH12 . ARG A 1 47 ? 11.208  -5.883  -10.724 1.00 0.52 ? 47 ARG A HH12 3  
ATOM 5102  H HH21 . ARG A 1 47 ? 12.088  -4.918  -13.937 1.00 0.52 ? 47 ARG A HH21 3  
ATOM 5103  H HH22 . ARG A 1 47 ? 12.038  -6.222  -12.799 1.00 0.52 ? 47 ARG A HH22 3  
ATOM 5104  N N    . GLN A 1 48 ? 6.770   0.050   -9.174  1.00 0.45 ? 48 GLN A N    3  
ATOM 5105  C CA   . GLN A 1 48 ? 6.816   0.934   -7.976  1.00 0.45 ? 48 GLN A CA   3  
ATOM 5106  C C    . GLN A 1 48 ? 8.029   0.569   -7.117  1.00 0.45 ? 48 GLN A C    3  
ATOM 5107  O O    . GLN A 1 48 ? 8.411   -0.581  -7.023  1.00 0.45 ? 48 GLN A O    3  
ATOM 5108  C CB   . GLN A 1 48 ? 5.537   0.749   -7.156  1.00 0.45 ? 48 GLN A CB   3  
ATOM 5109  C CG   . GLN A 1 48 ? 4.352   0.531   -8.099  1.00 0.45 ? 48 GLN A CG   3  
ATOM 5110  C CD   . GLN A 1 48 ? 4.119   1.795   -8.927  1.00 0.45 ? 48 GLN A CD   3  
ATOM 5111  O OE1  . GLN A 1 48 ? 4.843   2.762   -8.799  1.00 0.45 ? 48 GLN A OE1  3  
ATOM 5112  N NE2  . GLN A 1 48 ? 3.129   1.828   -9.779  1.00 0.45 ? 48 GLN A NE2  3  
ATOM 5113  H H    . GLN A 1 48 ? 6.329   -0.824  -9.122  1.00 0.45 ? 48 GLN A H    3  
ATOM 5114  H HA   . GLN A 1 48 ? 6.896   1.964   -8.292  1.00 0.45 ? 48 GLN A HA   3  
ATOM 5115  H HB2  . GLN A 1 48 ? 5.646   -0.108  -6.508  1.00 0.45 ? 48 GLN A HB2  3  
ATOM 5116  H HB3  . GLN A 1 48 ? 5.361   1.632   -6.559  1.00 0.45 ? 48 GLN A HB3  3  
ATOM 5117  H HG2  . GLN A 1 48 ? 4.567   -0.299  -8.759  1.00 0.45 ? 48 GLN A HG2  3  
ATOM 5118  H HG3  . GLN A 1 48 ? 3.467   0.312   -7.521  1.00 0.45 ? 48 GLN A HG3  3  
ATOM 5119  H HE21 . GLN A 1 48 ? 2.546   1.048   -9.883  1.00 0.45 ? 48 GLN A HE21 3  
ATOM 5120  H HE22 . GLN A 1 48 ? 2.971   2.634   -10.315 1.00 0.45 ? 48 GLN A HE22 3  
ATOM 5121  N N    . VAL A 1 49 ? 8.637   1.538   -6.491  1.00 0.37 ? 49 VAL A N    3  
ATOM 5122  C CA   . VAL A 1 49 ? 9.824   1.246   -5.639  1.00 0.37 ? 49 VAL A CA   3  
ATOM 5123  C C    . VAL A 1 49 ? 9.772   2.110   -4.378  1.00 0.37 ? 49 VAL A C    3  
ATOM 5124  O O    . VAL A 1 49 ? 9.249   3.206   -4.386  1.00 0.37 ? 49 VAL A O    3  
ATOM 5125  C CB   . VAL A 1 49 ? 11.102  1.561   -6.420  1.00 0.37 ? 49 VAL A CB   3  
ATOM 5126  C CG1  . VAL A 1 49 ? 12.303  1.517   -5.474  1.00 0.37 ? 49 VAL A CG1  3  
ATOM 5127  C CG2  . VAL A 1 49 ? 11.289  0.522   -7.528  1.00 0.37 ? 49 VAL A CG2  3  
ATOM 5128  H H    . VAL A 1 49 ? 8.313   2.459   -6.579  1.00 0.37 ? 49 VAL A H    3  
ATOM 5129  H HA   . VAL A 1 49 ? 9.820   0.202   -5.361  1.00 0.37 ? 49 VAL A HA   3  
ATOM 5130  H HB   . VAL A 1 49 ? 11.023  2.546   -6.855  1.00 0.37 ? 49 VAL A HB   3  
ATOM 5131  H HG11 . VAL A 1 49 ? 12.119  0.795   -4.691  1.00 0.37 ? 49 VAL A HG11 3  
ATOM 5132  H HG12 . VAL A 1 49 ? 13.186  1.231   -6.026  1.00 0.37 ? 49 VAL A HG12 3  
ATOM 5133  H HG13 . VAL A 1 49 ? 12.452  2.492   -5.036  1.00 0.37 ? 49 VAL A HG13 3  
ATOM 5134  H HG21 . VAL A 1 49 ? 10.363  0.404   -8.071  1.00 0.37 ? 49 VAL A HG21 3  
ATOM 5135  H HG22 . VAL A 1 49 ? 12.064  0.854   -8.205  1.00 0.37 ? 49 VAL A HG22 3  
ATOM 5136  H HG23 . VAL A 1 49 ? 11.574  -0.424  -7.091  1.00 0.37 ? 49 VAL A HG23 3  
ATOM 5137  N N    . CYS A 1 50 ? 10.310  1.626   -3.292  1.00 0.29 ? 50 CYS A N    3  
ATOM 5138  C CA   . CYS A 1 50 ? 10.289  2.422   -2.032  1.00 0.29 ? 50 CYS A CA   3  
ATOM 5139  C C    . CYS A 1 50 ? 11.629  3.139   -1.861  1.00 0.29 ? 50 CYS A C    3  
ATOM 5140  O O    . CYS A 1 50 ? 12.681  2.534   -1.920  1.00 0.29 ? 50 CYS A O    3  
ATOM 5141  C CB   . CYS A 1 50 ? 10.055  1.487   -0.843  1.00 0.29 ? 50 CYS A CB   3  
ATOM 5142  S SG   . CYS A 1 50 ? 8.569   0.497   -1.137  1.00 0.29 ? 50 CYS A SG   3  
ATOM 5143  H H    . CYS A 1 50 ? 10.727  0.739   -3.305  1.00 0.29 ? 50 CYS A H    3  
ATOM 5144  H HA   . CYS A 1 50 ? 9.494   3.150   -2.080  1.00 0.29 ? 50 CYS A HA   3  
ATOM 5145  H HB2  . CYS A 1 50 ? 10.906  0.833   -0.726  1.00 0.29 ? 50 CYS A HB2  3  
ATOM 5146  H HB3  . CYS A 1 50 ? 9.925   2.074   0.055   1.00 0.29 ? 50 CYS A HB3  3  
ATOM 5147  N N    . ALA A 1 51 ? 11.600  4.427   -1.650  1.00 0.23 ? 51 ALA A N    3  
ATOM 5148  C CA   . ALA A 1 51 ? 12.873  5.183   -1.475  1.00 0.23 ? 51 ALA A CA   3  
ATOM 5149  C C    . ALA A 1 51 ? 12.754  6.111   -0.266  1.00 0.23 ? 51 ALA A C    3  
ATOM 5150  O O    . ALA A 1 51 ? 11.748  6.763   -0.067  1.00 0.23 ? 51 ALA A O    3  
ATOM 5151  C CB   . ALA A 1 51 ? 13.148  6.013   -2.731  1.00 0.23 ? 51 ALA A CB   3  
ATOM 5152  H H    . ALA A 1 51 ? 10.741  4.897   -1.607  1.00 0.23 ? 51 ALA A H    3  
ATOM 5153  H HA   . ALA A 1 51 ? 13.685  4.489   -1.318  1.00 0.23 ? 51 ALA A HA   3  
ATOM 5154  H HB1  . ALA A 1 51 ? 12.987  5.405   -3.608  1.00 0.23 ? 51 ALA A HB1  3  
ATOM 5155  H HB2  . ALA A 1 51 ? 12.481  6.862   -2.753  1.00 0.23 ? 51 ALA A HB2  3  
ATOM 5156  H HB3  . ALA A 1 51 ? 14.172  6.360   -2.715  1.00 0.23 ? 51 ALA A HB3  3  
ATOM 5157  N N    . ASN A 1 52 ? 13.773  6.175   0.547   1.00 0.26 ? 52 ASN A N    3  
ATOM 5158  C CA   . ASN A 1 52 ? 13.717  7.062   1.743   1.00 0.26 ? 52 ASN A CA   3  
ATOM 5159  C C    . ASN A 1 52 ? 14.293  8.436   1.383   1.00 0.26 ? 52 ASN A C    3  
ATOM 5160  O O    . ASN A 1 52 ? 15.238  8.527   0.625   1.00 0.26 ? 52 ASN A O    3  
ATOM 5161  C CB   . ASN A 1 52 ? 14.543  6.441   2.873   1.00 0.26 ? 52 ASN A CB   3  
ATOM 5162  C CG   . ASN A 1 52 ? 14.665  7.439   4.026   1.00 0.26 ? 52 ASN A CG   3  
ATOM 5163  O OD1  . ASN A 1 52 ? 15.078  8.564   3.831   1.00 0.26 ? 52 ASN A OD1  3  
ATOM 5164  N ND2  . ASN A 1 52 ? 14.319  7.071   5.230   1.00 0.26 ? 52 ASN A ND2  3  
ATOM 5165  H H    . ASN A 1 52 ? 14.575  5.641   0.370   1.00 0.26 ? 52 ASN A H    3  
ATOM 5166  H HA   . ASN A 1 52 ? 12.692  7.169   2.062   1.00 0.26 ? 52 ASN A HA   3  
ATOM 5167  H HB2  . ASN A 1 52 ? 14.055  5.543   3.224   1.00 0.26 ? 52 ASN A HB2  3  
ATOM 5168  H HB3  . ASN A 1 52 ? 15.528  6.196   2.506   1.00 0.26 ? 52 ASN A HB3  3  
ATOM 5169  H HD21 . ASN A 1 52 ? 13.986  6.163   5.389   1.00 0.26 ? 52 ASN A HD21 3  
ATOM 5170  H HD22 . ASN A 1 52 ? 14.395  7.703   5.976   1.00 0.26 ? 52 ASN A HD22 3  
ATOM 5171  N N    . PRO A 1 53 ? 13.701  9.467   1.937   1.00 0.30 ? 53 PRO A N    3  
ATOM 5172  C CA   . PRO A 1 53 ? 14.130  10.856  1.695   1.00 0.30 ? 53 PRO A CA   3  
ATOM 5173  C C    . PRO A 1 53 ? 15.347  11.208  2.561   1.00 0.30 ? 53 PRO A C    3  
ATOM 5174  O O    . PRO A 1 53 ? 15.424  12.280  3.128   1.00 0.30 ? 53 PRO A O    3  
ATOM 5175  C CB   . PRO A 1 53 ? 12.914  11.683  2.118   1.00 0.30 ? 53 PRO A CB   3  
ATOM 5176  C CG   . PRO A 1 53 ? 12.101  10.797  3.094   1.00 0.30 ? 53 PRO A CG   3  
ATOM 5177  C CD   . PRO A 1 53 ? 12.545  9.343   2.848   1.00 0.30 ? 53 PRO A CD   3  
ATOM 5178  H HA   . PRO A 1 53 ? 14.342  11.017  0.651   1.00 0.30 ? 53 PRO A HA   3  
ATOM 5179  H HB2  . PRO A 1 53 ? 13.236  12.589  2.613   1.00 0.30 ? 53 PRO A HB2  3  
ATOM 5180  H HB3  . PRO A 1 53 ? 12.309  11.924  1.258   1.00 0.30 ? 53 PRO A HB3  3  
ATOM 5181  H HG2  . PRO A 1 53 ? 12.312  11.085  4.115   1.00 0.30 ? 53 PRO A HG2  3  
ATOM 5182  H HG3  . PRO A 1 53 ? 11.046  10.896  2.893   1.00 0.30 ? 53 PRO A HG3  3  
ATOM 5183  H HD2  . PRO A 1 53 ? 12.839  8.876   3.778   1.00 0.30 ? 53 PRO A HD2  3  
ATOM 5184  H HD3  . PRO A 1 53 ? 11.755  8.781   2.373   1.00 0.30 ? 53 PRO A HD3  3  
ATOM 5185  N N    . GLU A 1 54 ? 16.296  10.319  2.669   1.00 0.43 ? 54 GLU A N    3  
ATOM 5186  C CA   . GLU A 1 54 ? 17.500  10.612  3.498   1.00 0.43 ? 54 GLU A CA   3  
ATOM 5187  C C    . GLU A 1 54 ? 18.757  10.172  2.746   1.00 0.43 ? 54 GLU A C    3  
ATOM 5188  O O    . GLU A 1 54 ? 19.840  10.137  3.294   1.00 0.43 ? 54 GLU A O    3  
ATOM 5189  C CB   . GLU A 1 54 ? 17.404  9.851   4.822   1.00 0.43 ? 54 GLU A CB   3  
ATOM 5190  C CG   . GLU A 1 54 ? 16.376  10.530  5.729   1.00 0.43 ? 54 GLU A CG   3  
ATOM 5191  C CD   . GLU A 1 54 ? 17.089  11.157  6.929   1.00 0.43 ? 54 GLU A CD   3  
ATOM 5192  O OE1  . GLU A 1 54 ? 18.074  11.844  6.715   1.00 0.43 ? 54 GLU A OE1  3  
ATOM 5193  O OE2  . GLU A 1 54 ? 16.637  10.939  8.041   1.00 0.43 ? 54 GLU A OE2  3  
ATOM 5194  H H    . GLU A 1 54 ? 16.220  9.461   2.207   1.00 0.43 ? 54 GLU A H    3  
ATOM 5195  H HA   . GLU A 1 54 ? 17.551  11.673  3.695   1.00 0.43 ? 54 GLU A HA   3  
ATOM 5196  H HB2  . GLU A 1 54 ? 17.099  8.832   4.630   1.00 0.43 ? 54 GLU A HB2  3  
ATOM 5197  H HB3  . GLU A 1 54 ? 18.368  9.854   5.309   1.00 0.43 ? 54 GLU A HB3  3  
ATOM 5198  H HG2  . GLU A 1 54 ? 15.860  11.299  5.174   1.00 0.43 ? 54 GLU A HG2  3  
ATOM 5199  H HG3  . GLU A 1 54 ? 15.665  9.798   6.078   1.00 0.43 ? 54 GLU A HG3  3  
ATOM 5200  N N    . LYS A 1 55 ? 18.623  9.833   1.493   1.00 0.47 ? 55 LYS A N    3  
ATOM 5201  C CA   . LYS A 1 55 ? 19.810  9.394   0.707   1.00 0.47 ? 55 LYS A CA   3  
ATOM 5202  C C    . LYS A 1 55 ? 20.453  10.608  0.033   1.00 0.47 ? 55 LYS A C    3  
ATOM 5203  O O    . LYS A 1 55 ? 20.086  11.738  0.287   1.00 0.47 ? 55 LYS A O    3  
ATOM 5204  C CB   . LYS A 1 55 ? 19.374  8.390   -0.360  1.00 0.47 ? 55 LYS A CB   3  
ATOM 5205  C CG   . LYS A 1 55 ? 18.622  7.233   0.302   1.00 0.47 ? 55 LYS A CG   3  
ATOM 5206  C CD   . LYS A 1 55 ? 19.608  6.366   1.086   1.00 0.47 ? 55 LYS A CD   3  
ATOM 5207  C CE   . LYS A 1 55 ? 18.898  5.748   2.292   1.00 0.47 ? 55 LYS A CE   3  
ATOM 5208  N NZ   . LYS A 1 55 ? 19.889  5.011   3.128   1.00 0.47 ? 55 LYS A NZ   3  
ATOM 5209  H H    . LYS A 1 55 ? 17.739  9.867   1.068   1.00 0.47 ? 55 LYS A H    3  
ATOM 5210  H HA   . LYS A 1 55 ? 20.526  8.929   1.369   1.00 0.47 ? 55 LYS A HA   3  
ATOM 5211  H HB2  . LYS A 1 55 ? 18.726  8.880   -1.073  1.00 0.47 ? 55 LYS A HB2  3  
ATOM 5212  H HB3  . LYS A 1 55 ? 20.244  8.004   -0.870  1.00 0.47 ? 55 LYS A HB3  3  
ATOM 5213  H HG2  . LYS A 1 55 ? 17.875  7.629   0.975   1.00 0.47 ? 55 LYS A HG2  3  
ATOM 5214  H HG3  . LYS A 1 55 ? 18.142  6.633   -0.457  1.00 0.47 ? 55 LYS A HG3  3  
ATOM 5215  H HD2  . LYS A 1 55 ? 19.983  5.580   0.446   1.00 0.47 ? 55 LYS A HD2  3  
ATOM 5216  H HD3  . LYS A 1 55 ? 20.431  6.975   1.429   1.00 0.47 ? 55 LYS A HD3  3  
ATOM 5217  H HE2  . LYS A 1 55 ? 18.441  6.530   2.881   1.00 0.47 ? 55 LYS A HE2  3  
ATOM 5218  H HE3  . LYS A 1 55 ? 18.136  5.063   1.950   1.00 0.47 ? 55 LYS A HE3  3  
ATOM 5219  H HZ1  . LYS A 1 55 ? 20.830  5.437   3.008   1.00 0.47 ? 55 LYS A HZ1  3  
ATOM 5220  H HZ2  . LYS A 1 55 ? 19.607  5.068   4.129   1.00 0.47 ? 55 LYS A HZ2  3  
ATOM 5221  H HZ3  . LYS A 1 55 ? 19.920  4.015   2.832   1.00 0.47 ? 55 LYS A HZ3  3  
ATOM 5222  N N    . LYS A 1 56 ? 21.410  10.382  -0.824  1.00 0.58 ? 56 LYS A N    3  
ATOM 5223  C CA   . LYS A 1 56 ? 22.077  11.523  -1.514  1.00 0.58 ? 56 LYS A CA   3  
ATOM 5224  C C    . LYS A 1 56 ? 21.530  11.647  -2.939  1.00 0.58 ? 56 LYS A C    3  
ATOM 5225  O O    . LYS A 1 56 ? 21.721  12.647  -3.601  1.00 0.58 ? 56 LYS A O    3  
ATOM 5226  C CB   . LYS A 1 56 ? 23.586  11.274  -1.567  1.00 0.58 ? 56 LYS A CB   3  
ATOM 5227  C CG   . LYS A 1 56 ? 24.237  12.266  -2.532  1.00 0.58 ? 56 LYS A CG   3  
ATOM 5228  C CD   . LYS A 1 56 ? 23.935  13.695  -2.078  1.00 0.58 ? 56 LYS A CD   3  
ATOM 5229  C CE   . LYS A 1 56 ? 24.529  13.927  -0.688  1.00 0.58 ? 56 LYS A CE   3  
ATOM 5230  N NZ   . LYS A 1 56 ? 25.057  15.317  -0.598  1.00 0.58 ? 56 LYS A NZ   3  
ATOM 5231  H H    . LYS A 1 56 ? 21.691  9.463   -1.014  1.00 0.58 ? 56 LYS A H    3  
ATOM 5232  H HA   . LYS A 1 56 ? 21.881  12.436  -0.973  1.00 0.58 ? 56 LYS A HA   3  
ATOM 5233  H HB2  . LYS A 1 56 ? 24.005  11.403  -0.579  1.00 0.58 ? 56 LYS A HB2  3  
ATOM 5234  H HB3  . LYS A 1 56 ? 23.774  10.266  -1.908  1.00 0.58 ? 56 LYS A HB3  3  
ATOM 5235  H HG2  . LYS A 1 56 ? 25.306  12.108  -2.543  1.00 0.58 ? 56 LYS A HG2  3  
ATOM 5236  H HG3  . LYS A 1 56 ? 23.841  12.115  -3.525  1.00 0.58 ? 56 LYS A HG3  3  
ATOM 5237  H HD2  . LYS A 1 56 ? 24.370  14.395  -2.778  1.00 0.58 ? 56 LYS A HD2  3  
ATOM 5238  H HD3  . LYS A 1 56 ? 22.866  13.842  -2.039  1.00 0.58 ? 56 LYS A HD3  3  
ATOM 5239  H HE2  . LYS A 1 56 ? 23.762  13.783  0.060   1.00 0.58 ? 56 LYS A HE2  3  
ATOM 5240  H HE3  . LYS A 1 56 ? 25.333  13.225  -0.518  1.00 0.58 ? 56 LYS A HE3  3  
ATOM 5241  H HZ1  . LYS A 1 56 ? 24.625  15.901  -1.342  1.00 0.58 ? 56 LYS A HZ1  3  
ATOM 5242  H HZ2  . LYS A 1 56 ? 24.825  15.716  0.335   1.00 0.58 ? 56 LYS A HZ2  3  
ATOM 5243  H HZ3  . LYS A 1 56 ? 26.088  15.305  -0.724  1.00 0.58 ? 56 LYS A HZ3  3  
ATOM 5244  N N    . TRP A 1 57 ? 20.853  10.639  -3.415  1.00 0.41 ? 57 TRP A N    3  
ATOM 5245  C CA   . TRP A 1 57 ? 20.297  10.701  -4.795  1.00 0.41 ? 57 TRP A CA   3  
ATOM 5246  C C    . TRP A 1 57 ? 18.769  10.753  -4.730  1.00 0.41 ? 57 TRP A C    3  
ATOM 5247  O O    . TRP A 1 57 ? 18.120  11.303  -5.596  1.00 0.41 ? 57 TRP A O    3  
ATOM 5248  C CB   . TRP A 1 57 ? 20.731  9.459   -5.577  1.00 0.41 ? 57 TRP A CB   3  
ATOM 5249  C CG   . TRP A 1 57 ? 20.213  8.236   -4.892  1.00 0.41 ? 57 TRP A CG   3  
ATOM 5250  C CD1  . TRP A 1 57 ? 20.907  7.490   -4.003  1.00 0.41 ? 57 TRP A CD1  3  
ATOM 5251  C CD2  . TRP A 1 57 ? 18.906  7.606   -5.024  1.00 0.41 ? 57 TRP A CD2  3  
ATOM 5252  N NE1  . TRP A 1 57 ? 20.110  6.441   -3.580  1.00 0.41 ? 57 TRP A NE1  3  
ATOM 5253  C CE2  . TRP A 1 57 ? 18.867  6.470   -4.181  1.00 0.41 ? 57 TRP A CE2  3  
ATOM 5254  C CE3  . TRP A 1 57 ? 17.762  7.907   -5.785  1.00 0.41 ? 57 TRP A CE3  3  
ATOM 5255  C CZ2  . TRP A 1 57 ? 17.733  5.661   -4.096  1.00 0.41 ? 57 TRP A CZ2  3  
ATOM 5256  C CZ3  . TRP A 1 57 ? 16.619  7.095   -5.703  1.00 0.41 ? 57 TRP A CZ3  3  
ATOM 5257  C CH2  . TRP A 1 57 ? 16.605  5.975   -4.860  1.00 0.41 ? 57 TRP A CH2  3  
ATOM 5258  H H    . TRP A 1 57 ? 20.711  9.840   -2.865  1.00 0.41 ? 57 TRP A H    3  
ATOM 5259  H HA   . TRP A 1 57 ? 20.665  11.586  -5.293  1.00 0.41 ? 57 TRP A HA   3  
ATOM 5260  H HB2  . TRP A 1 57 ? 20.334  9.507   -6.579  1.00 0.41 ? 57 TRP A HB2  3  
ATOM 5261  H HB3  . TRP A 1 57 ? 21.810  9.419   -5.618  1.00 0.41 ? 57 TRP A HB3  3  
ATOM 5262  H HD1  . TRP A 1 57 ? 21.920  7.681   -3.677  1.00 0.41 ? 57 TRP A HD1  3  
ATOM 5263  H HE1  . TRP A 1 57 ? 20.375  5.754   -2.935  1.00 0.41 ? 57 TRP A HE1  3  
ATOM 5264  H HE3  . TRP A 1 57 ? 17.763  8.768   -6.437  1.00 0.41 ? 57 TRP A HE3  3  
ATOM 5265  H HZ2  . TRP A 1 57 ? 17.727  4.799   -3.446  1.00 0.41 ? 57 TRP A HZ2  3  
ATOM 5266  H HZ3  . TRP A 1 57 ? 15.747  7.335   -6.292  1.00 0.41 ? 57 TRP A HZ3  3  
ATOM 5267  H HH2  . TRP A 1 57 ? 15.723  5.355   -4.800  1.00 0.41 ? 57 TRP A HH2  3  
ATOM 5268  N N    . VAL A 1 58 ? 18.189  10.185  -3.707  1.00 0.32 ? 58 VAL A N    3  
ATOM 5269  C CA   . VAL A 1 58 ? 16.704  10.206  -3.589  1.00 0.32 ? 58 VAL A CA   3  
ATOM 5270  C C    . VAL A 1 58 ? 16.207  11.650  -3.670  1.00 0.32 ? 58 VAL A C    3  
ATOM 5271  O O    . VAL A 1 58 ? 15.505  12.026  -4.588  1.00 0.32 ? 58 VAL A O    3  
ATOM 5272  C CB   . VAL A 1 58 ? 16.288  9.597   -2.248  1.00 0.32 ? 58 VAL A CB   3  
ATOM 5273  C CG1  . VAL A 1 58 ? 14.764  9.614   -2.129  1.00 0.32 ? 58 VAL A CG1  3  
ATOM 5274  C CG2  . VAL A 1 58 ? 16.788  8.153   -2.169  1.00 0.32 ? 58 VAL A CG2  3  
ATOM 5275  H H    . VAL A 1 58 ? 18.730  9.746   -3.017  1.00 0.32 ? 58 VAL A H    3  
ATOM 5276  H HA   . VAL A 1 58 ? 16.271  9.631   -4.395  1.00 0.32 ? 58 VAL A HA   3  
ATOM 5277  H HB   . VAL A 1 58 ? 16.720  10.174  -1.442  1.00 0.32 ? 58 VAL A HB   3  
ATOM 5278  H HG11 . VAL A 1 58 ? 14.340  10.073  -3.010  1.00 0.32 ? 58 VAL A HG11 3  
ATOM 5279  H HG12 . VAL A 1 58 ? 14.398  8.602   -2.039  1.00 0.32 ? 58 VAL A HG12 3  
ATOM 5280  H HG13 . VAL A 1 58 ? 14.478  10.180  -1.255  1.00 0.32 ? 58 VAL A HG13 3  
ATOM 5281  H HG21 . VAL A 1 58 ? 17.793  8.097   -2.559  1.00 0.32 ? 58 VAL A HG21 3  
ATOM 5282  H HG22 . VAL A 1 58 ? 16.784  7.826   -1.139  1.00 0.32 ? 58 VAL A HG22 3  
ATOM 5283  H HG23 . VAL A 1 58 ? 16.140  7.515   -2.751  1.00 0.32 ? 58 VAL A HG23 3  
ATOM 5284  N N    . ARG A 1 59 ? 16.571  12.467  -2.718  1.00 0.34 ? 59 ARG A N    3  
ATOM 5285  C CA   . ARG A 1 59 ? 16.123  13.887  -2.745  1.00 0.34 ? 59 ARG A CA   3  
ATOM 5286  C C    . ARG A 1 59 ? 16.584  14.536  -4.052  1.00 0.34 ? 59 ARG A C    3  
ATOM 5287  O O    . ARG A 1 59 ? 16.009  15.502  -4.513  1.00 0.34 ? 59 ARG A O    3  
ATOM 5288  C CB   . ARG A 1 59 ? 16.733  14.638  -1.559  1.00 0.34 ? 59 ARG A CB   3  
ATOM 5289  C CG   . ARG A 1 59 ? 16.167  16.058  -1.509  1.00 0.34 ? 59 ARG A CG   3  
ATOM 5290  C CD   . ARG A 1 59 ? 17.314  17.067  -1.586  1.00 0.34 ? 59 ARG A CD   3  
ATOM 5291  N NE   . ARG A 1 59 ? 17.048  18.036  -2.687  1.00 0.34 ? 59 ARG A NE   3  
ATOM 5292  C CZ   . ARG A 1 59 ? 17.525  19.250  -2.617  1.00 0.34 ? 59 ARG A CZ   3  
ATOM 5293  N NH1  . ARG A 1 59 ? 16.848  20.183  -2.006  1.00 0.34 ? 59 ARG A NH1  3  
ATOM 5294  N NH2  . ARG A 1 59 ? 18.679  19.529  -3.159  1.00 0.34 ? 59 ARG A NH2  3  
ATOM 5295  H H    . ARG A 1 59 ? 17.141  12.146  -1.988  1.00 0.34 ? 59 ARG A H    3  
ATOM 5296  H HA   . ARG A 1 59 ? 15.045  13.927  -2.682  1.00 0.34 ? 59 ARG A HA   3  
ATOM 5297  H HB2  . ARG A 1 59 ? 16.490  14.119  -0.643  1.00 0.34 ? 59 ARG A HB2  3  
ATOM 5298  H HB3  . ARG A 1 59 ? 17.805  14.683  -1.674  1.00 0.34 ? 59 ARG A HB3  3  
ATOM 5299  H HG2  . ARG A 1 59 ? 15.496  16.208  -2.343  1.00 0.34 ? 59 ARG A HG2  3  
ATOM 5300  H HG3  . ARG A 1 59 ? 15.628  16.199  -0.583  1.00 0.34 ? 59 ARG A HG3  3  
ATOM 5301  H HD2  . ARG A 1 59 ? 17.390  17.599  -0.649  1.00 0.34 ? 59 ARG A HD2  3  
ATOM 5302  H HD3  . ARG A 1 59 ? 18.239  16.547  -1.781  1.00 0.34 ? 59 ARG A HD3  3  
ATOM 5303  H HE   . ARG A 1 59 ? 16.516  17.763  -3.463  1.00 0.34 ? 59 ARG A HE   3  
ATOM 5304  H HH11 . ARG A 1 59 ? 15.964  19.968  -1.591  1.00 0.34 ? 59 ARG A HH11 3  
ATOM 5305  H HH12 . ARG A 1 59 ? 17.213  21.112  -1.953  1.00 0.34 ? 59 ARG A HH12 3  
ATOM 5306  H HH21 . ARG A 1 59 ? 19.197  18.815  -3.627  1.00 0.34 ? 59 ARG A HH21 3  
ATOM 5307  H HH22 . ARG A 1 59 ? 19.044  20.459  -3.105  1.00 0.34 ? 59 ARG A HH22 3  
ATOM 5308  N N    . GLU A 1 60 ? 17.616  14.009  -4.651  1.00 0.37 ? 60 GLU A N    3  
ATOM 5309  C CA   . GLU A 1 60 ? 18.114  14.589  -5.929  1.00 0.37 ? 60 GLU A CA   3  
ATOM 5310  C C    . GLU A 1 60 ? 17.082  14.352  -7.031  1.00 0.37 ? 60 GLU A C    3  
ATOM 5311  O O    . GLU A 1 60 ? 16.880  15.181  -7.895  1.00 0.37 ? 60 GLU A O    3  
ATOM 5312  C CB   . GLU A 1 60 ? 19.434  13.916  -6.312  1.00 0.37 ? 60 GLU A CB   3  
ATOM 5313  C CG   . GLU A 1 60 ? 20.604  14.720  -5.739  1.00 0.37 ? 60 GLU A CG   3  
ATOM 5314  C CD   . GLU A 1 60 ? 21.911  13.965  -5.986  1.00 0.37 ? 60 GLU A CD   3  
ATOM 5315  O OE1  . GLU A 1 60 ? 22.014  13.319  -7.015  1.00 0.37 ? 60 GLU A OE1  3  
ATOM 5316  O OE2  . GLU A 1 60 ? 22.787  14.047  -5.141  1.00 0.37 ? 60 GLU A OE2  3  
ATOM 5317  H H    . GLU A 1 60 ? 18.062  13.229  -4.262  1.00 0.37 ? 60 GLU A H    3  
ATOM 5318  H HA   . GLU A 1 60 ? 18.273  15.650  -5.805  1.00 0.37 ? 60 GLU A HA   3  
ATOM 5319  H HB2  . GLU A 1 60 ? 19.456  12.914  -5.911  1.00 0.37 ? 60 GLU A HB2  3  
ATOM 5320  H HB3  . GLU A 1 60 ? 19.519  13.876  -7.387  1.00 0.37 ? 60 GLU A HB3  3  
ATOM 5321  H HG2  . GLU A 1 60 ? 20.647  15.685  -6.223  1.00 0.37 ? 60 GLU A HG2  3  
ATOM 5322  H HG3  . GLU A 1 60 ? 20.463  14.855  -4.678  1.00 0.37 ? 60 GLU A HG3  3  
ATOM 5323  N N    . TYR A 1 61 ? 16.424  13.225  -7.006  1.00 0.36 ? 61 TYR A N    3  
ATOM 5324  C CA   . TYR A 1 61 ? 15.403  12.934  -8.051  1.00 0.36 ? 61 TYR A CA   3  
ATOM 5325  C C    . TYR A 1 61 ? 14.142  13.750  -7.765  1.00 0.36 ? 61 TYR A C    3  
ATOM 5326  O O    . TYR A 1 61 ? 13.537  14.309  -8.659  1.00 0.36 ? 61 TYR A O    3  
ATOM 5327  C CB   . TYR A 1 61 ? 15.064  11.440  -8.032  1.00 0.36 ? 61 TYR A CB   3  
ATOM 5328  C CG   . TYR A 1 61 ? 16.128  10.656  -8.772  1.00 0.36 ? 61 TYR A CG   3  
ATOM 5329  C CD1  . TYR A 1 61 ? 17.310  11.284  -9.191  1.00 0.36 ? 61 TYR A CD1  3  
ATOM 5330  C CD2  . TYR A 1 61 ? 15.929  9.295   -9.037  1.00 0.36 ? 61 TYR A CD2  3  
ATOM 5331  C CE1  . TYR A 1 61 ? 18.289  10.552  -9.873  1.00 0.36 ? 61 TYR A CE1  3  
ATOM 5332  C CE2  . TYR A 1 61 ? 16.909  8.563   -9.720  1.00 0.36 ? 61 TYR A CE2  3  
ATOM 5333  C CZ   . TYR A 1 61 ? 18.088  9.191   -10.138 1.00 0.36 ? 61 TYR A CZ   3  
ATOM 5334  O OH   . TYR A 1 61 ? 19.054  8.471   -10.811 1.00 0.36 ? 61 TYR A OH   3  
ATOM 5335  H H    . TYR A 1 61 ? 16.601  12.570  -6.299  1.00 0.36 ? 61 TYR A H    3  
ATOM 5336  H HA   . TYR A 1 61 ? 15.793  13.203  -9.021  1.00 0.36 ? 61 TYR A HA   3  
ATOM 5337  H HB2  . TYR A 1 61 ? 15.013  11.098  -7.009  1.00 0.36 ? 61 TYR A HB2  3  
ATOM 5338  H HB3  . TYR A 1 61 ? 14.107  11.284  -8.509  1.00 0.36 ? 61 TYR A HB3  3  
ATOM 5339  H HD1  . TYR A 1 61 ? 17.465  12.333  -8.989  1.00 0.36 ? 61 TYR A HD1  3  
ATOM 5340  H HD2  . TYR A 1 61 ? 15.020  8.809   -8.714  1.00 0.36 ? 61 TYR A HD2  3  
ATOM 5341  H HE1  . TYR A 1 61 ? 19.198  11.036  -10.196 1.00 0.36 ? 61 TYR A HE1  3  
ATOM 5342  H HE2  . TYR A 1 61 ? 16.754  7.513   -9.923  1.00 0.36 ? 61 TYR A HE2  3  
ATOM 5343  H HH   . TYR A 1 61 ? 19.782  9.065   -11.009 1.00 0.36 ? 61 TYR A HH   3  
ATOM 5344  N N    . ILE A 1 62 ? 13.741  13.826  -6.526  1.00 0.38 ? 62 ILE A N    3  
ATOM 5345  C CA   . ILE A 1 62 ? 12.521  14.611  -6.187  1.00 0.38 ? 62 ILE A CA   3  
ATOM 5346  C C    . ILE A 1 62 ? 12.739  16.074  -6.575  1.00 0.38 ? 62 ILE A C    3  
ATOM 5347  O O    . ILE A 1 62 ? 11.834  16.749  -7.027  1.00 0.38 ? 62 ILE A O    3  
ATOM 5348  C CB   . ILE A 1 62 ? 12.255  14.514  -4.683  1.00 0.38 ? 62 ILE A CB   3  
ATOM 5349  C CG1  . ILE A 1 62 ? 11.744  13.111  -4.346  1.00 0.38 ? 62 ILE A CG1  3  
ATOM 5350  C CG2  . ILE A 1 62 ? 11.201  15.548  -4.283  1.00 0.38 ? 62 ILE A CG2  3  
ATOM 5351  C CD1  . ILE A 1 62 ? 12.661  12.471  -3.303  1.00 0.38 ? 62 ILE A CD1  3  
ATOM 5352  H H    . ILE A 1 62 ? 14.245  13.370  -5.819  1.00 0.38 ? 62 ILE A H    3  
ATOM 5353  H HA   . ILE A 1 62 ? 11.675  14.216  -6.729  1.00 0.38 ? 62 ILE A HA   3  
ATOM 5354  H HB   . ILE A 1 62 ? 13.170  14.706  -4.142  1.00 0.38 ? 62 ILE A HB   3  
ATOM 5355  H HG12 . ILE A 1 62 ? 10.740  13.179  -3.952  1.00 0.38 ? 62 ILE A HG12 3  
ATOM 5356  H HG13 . ILE A 1 62 ? 11.739  12.505  -5.240  1.00 0.38 ? 62 ILE A HG13 3  
ATOM 5357  H HG21 . ILE A 1 62 ? 10.839  16.055  -5.165  1.00 0.38 ? 62 ILE A HG21 3  
ATOM 5358  H HG22 . ILE A 1 62 ? 10.379  15.052  -3.790  1.00 0.38 ? 62 ILE A HG22 3  
ATOM 5359  H HG23 . ILE A 1 62 ? 11.642  16.270  -3.610  1.00 0.38 ? 62 ILE A HG23 3  
ATOM 5360  H HD11 . ILE A 1 62 ? 13.103  13.241  -2.690  1.00 0.38 ? 62 ILE A HD11 3  
ATOM 5361  H HD12 . ILE A 1 62 ? 12.086  11.802  -2.680  1.00 0.38 ? 62 ILE A HD12 3  
ATOM 5362  H HD13 . ILE A 1 62 ? 13.441  11.915  -3.802  1.00 0.38 ? 62 ILE A HD13 3  
ATOM 5363  N N    . ASN A 1 63 ? 13.934  16.570  -6.403  1.00 0.49 ? 63 ASN A N    3  
ATOM 5364  C CA   . ASN A 1 63 ? 14.213  17.989  -6.764  1.00 0.49 ? 63 ASN A CA   3  
ATOM 5365  C C    . ASN A 1 63 ? 14.267  18.126  -8.286  1.00 0.49 ? 63 ASN A C    3  
ATOM 5366  O O    . ASN A 1 63 ? 13.839  19.115  -8.845  1.00 0.49 ? 63 ASN A O    3  
ATOM 5367  C CB   . ASN A 1 63 ? 15.556  18.411  -6.164  1.00 0.49 ? 63 ASN A CB   3  
ATOM 5368  C CG   . ASN A 1 63 ? 15.984  19.752  -6.764  1.00 0.49 ? 63 ASN A CG   3  
ATOM 5369  O OD1  . ASN A 1 63 ? 15.209  20.687  -6.806  1.00 0.49 ? 63 ASN A OD1  3  
ATOM 5370  N ND2  . ASN A 1 63 ? 17.195  19.886  -7.234  1.00 0.49 ? 63 ASN A ND2  3  
ATOM 5371  H H    . ASN A 1 63 ? 14.649  16.008  -6.038  1.00 0.49 ? 63 ASN A H    3  
ATOM 5372  H HA   . ASN A 1 63 ? 13.429  18.621  -6.372  1.00 0.49 ? 63 ASN A HA   3  
ATOM 5373  H HB2  . ASN A 1 63 ? 15.457  18.510  -5.092  1.00 0.49 ? 63 ASN A HB2  3  
ATOM 5374  H HB3  . ASN A 1 63 ? 16.302  17.663  -6.390  1.00 0.49 ? 63 ASN A HB3  3  
ATOM 5375  H HD21 . ASN A 1 63 ? 17.819  19.132  -7.200  1.00 0.49 ? 63 ASN A HD21 3  
ATOM 5376  H HD22 . ASN A 1 63 ? 17.478  20.741  -7.619  1.00 0.49 ? 63 ASN A HD22 3  
ATOM 5377  N N    . SER A 1 64 ? 14.789  17.139  -8.961  1.00 0.55 ? 64 SER A N    3  
ATOM 5378  C CA   . SER A 1 64 ? 14.868  17.211  -10.448 1.00 0.55 ? 64 SER A CA   3  
ATOM 5379  C C    . SER A 1 64 ? 13.514  16.827  -11.047 1.00 0.55 ? 64 SER A C    3  
ATOM 5380  O O    . SER A 1 64 ? 13.277  16.992  -12.227 1.00 0.55 ? 64 SER A O    3  
ATOM 5381  C CB   . SER A 1 64 ? 15.942  16.244  -10.948 1.00 0.55 ? 64 SER A CB   3  
ATOM 5382  O OG   . SER A 1 64 ? 16.021  15.133  -10.066 1.00 0.55 ? 64 SER A OG   3  
ATOM 5383  H H    . SER A 1 64 ? 15.127  16.348  -8.491  1.00 0.55 ? 64 SER A H    3  
ATOM 5384  H HA   . SER A 1 64 ? 15.122  18.218  -10.745 1.00 0.55 ? 64 SER A HA   3  
ATOM 5385  H HB2  . SER A 1 64 ? 15.684  15.896  -11.935 1.00 0.55 ? 64 SER A HB2  3  
ATOM 5386  H HB3  . SER A 1 64 ? 16.895  16.755  -10.988 1.00 0.55 ? 64 SER A HB3  3  
ATOM 5387  H HG   . SER A 1 64 ? 16.482  14.425  -10.522 1.00 0.55 ? 64 SER A HG   3  
ATOM 5388  N N    . LEU A 1 65 ? 12.625  16.313  -10.242 1.00 0.53 ? 65 LEU A N    3  
ATOM 5389  C CA   . LEU A 1 65 ? 11.287  15.918  -10.764 1.00 0.53 ? 65 LEU A CA   3  
ATOM 5390  C C    . LEU A 1 65 ? 10.348  17.125  -10.723 1.00 0.53 ? 65 LEU A C    3  
ATOM 5391  O O    . LEU A 1 65 ? 9.736   17.480  -11.710 1.00 0.53 ? 65 LEU A O    3  
ATOM 5392  C CB   . LEU A 1 65 ? 10.713  14.798  -9.893  1.00 0.53 ? 65 LEU A CB   3  
ATOM 5393  C CG   . LEU A 1 65 ? 10.352  13.598  -10.769 1.00 0.53 ? 65 LEU A CG   3  
ATOM 5394  C CD1  . LEU A 1 65 ? 9.469   14.061  -11.930 1.00 0.53 ? 65 LEU A CD1  3  
ATOM 5395  C CD2  . LEU A 1 65 ? 11.632  12.969  -11.323 1.00 0.53 ? 65 LEU A CD2  3  
ATOM 5396  H H    . LEU A 1 65 ? 12.837  16.188  -9.294  1.00 0.53 ? 65 LEU A H    3  
ATOM 5397  H HA   . LEU A 1 65 ? 11.384  15.569  -11.781 1.00 0.53 ? 65 LEU A HA   3  
ATOM 5398  H HB2  . LEU A 1 65 ? 11.449  14.500  -9.160  1.00 0.53 ? 65 LEU A HB2  3  
ATOM 5399  H HB3  . LEU A 1 65 ? 9.828   15.153  -9.389  1.00 0.53 ? 65 LEU A HB3  3  
ATOM 5400  H HG   . LEU A 1 65 ? 9.816   12.869  -10.179 1.00 0.53 ? 65 LEU A HG   3  
ATOM 5401  H HD11 . LEU A 1 65 ? 9.259   15.115  -11.825 1.00 0.53 ? 65 LEU A HD11 3  
ATOM 5402  H HD12 . LEU A 1 65 ? 9.984   13.888  -12.864 1.00 0.53 ? 65 LEU A HD12 3  
ATOM 5403  H HD13 . LEU A 1 65 ? 8.543   13.506  -11.921 1.00 0.53 ? 65 LEU A HD13 3  
ATOM 5404  H HD21 . LEU A 1 65 ? 12.369  12.903  -10.536 1.00 0.53 ? 65 LEU A HD21 3  
ATOM 5405  H HD22 . LEU A 1 65 ? 11.414  11.979  -11.697 1.00 0.53 ? 65 LEU A HD22 3  
ATOM 5406  H HD23 . LEU A 1 65 ? 12.016  13.580  -12.126 1.00 0.53 ? 65 LEU A HD23 3  
ATOM 5407  N N    . GLU A 1 66 ? 10.230  17.757  -9.588  1.00 0.61 ? 66 GLU A N    3  
ATOM 5408  C CA   . GLU A 1 66 ? 9.330   18.942  -9.485  1.00 0.61 ? 66 GLU A CA   3  
ATOM 5409  C C    . GLU A 1 66 ? 10.081  20.193  -9.944  1.00 0.61 ? 66 GLU A C    3  
ATOM 5410  O O    . GLU A 1 66 ? 10.804  20.808  -9.186  1.00 0.61 ? 66 GLU A O    3  
ATOM 5411  C CB   . GLU A 1 66 ? 8.885   19.118  -8.032  1.00 0.61 ? 66 GLU A CB   3  
ATOM 5412  C CG   . GLU A 1 66 ? 8.037   17.917  -7.608  1.00 0.61 ? 66 GLU A CG   3  
ATOM 5413  C CD   . GLU A 1 66 ? 6.875   17.741  -8.588  1.00 0.61 ? 66 GLU A CD   3  
ATOM 5414  O OE1  . GLU A 1 66 ? 6.255   18.736  -8.926  1.00 0.61 ? 66 GLU A OE1  3  
ATOM 5415  O OE2  . GLU A 1 66 ? 6.626   16.614  -8.984  1.00 0.61 ? 66 GLU A OE2  3  
ATOM 5416  H H    . GLU A 1 66 ? 10.732  17.454  -8.803  1.00 0.61 ? 66 GLU A H    3  
ATOM 5417  H HA   . GLU A 1 66 ? 8.464   18.790  -10.112 1.00 0.61 ? 66 GLU A HA   3  
ATOM 5418  H HB2  . GLU A 1 66 ? 9.755   19.188  -7.395  1.00 0.61 ? 66 GLU A HB2  3  
ATOM 5419  H HB3  . GLU A 1 66 ? 8.299   20.020  -7.942  1.00 0.61 ? 66 GLU A HB3  3  
ATOM 5420  H HG2  . GLU A 1 66 ? 8.648   17.027  -7.609  1.00 0.61 ? 66 GLU A HG2  3  
ATOM 5421  H HG3  . GLU A 1 66 ? 7.645   18.085  -6.616  1.00 0.61 ? 66 GLU A HG3  3  
ATOM 5422  N N    . MET A 1 67 ? 9.914   20.575  -11.181 1.00 1.45 ? 67 MET A N    3  
ATOM 5423  C CA   . MET A 1 67 ? 10.618  21.787  -11.687 1.00 1.45 ? 67 MET A CA   3  
ATOM 5424  C C    . MET A 1 67 ? 9.936   23.041  -11.134 1.00 1.45 ? 67 MET A C    3  
ATOM 5425  O O    . MET A 1 67 ? 9.038   22.962  -10.320 1.00 1.45 ? 67 MET A O    3  
ATOM 5426  C CB   . MET A 1 67 ? 10.563  21.808  -13.215 1.00 1.45 ? 67 MET A CB   3  
ATOM 5427  C CG   . MET A 1 67 ? 11.929  22.217  -13.771 1.00 1.45 ? 67 MET A CG   3  
ATOM 5428  S SD   . MET A 1 67 ? 11.785  23.815  -14.609 1.00 1.45 ? 67 MET A SD   3  
ATOM 5429  C CE   . MET A 1 67 ? 12.113  23.221  -16.287 1.00 1.45 ? 67 MET A CE   3  
ATOM 5430  H H    . MET A 1 67 ? 9.326   20.066  -11.777 1.00 1.45 ? 67 MET A H    3  
ATOM 5431  H HA   . MET A 1 67 ? 11.649  21.767  -11.364 1.00 1.45 ? 67 MET A HA   3  
ATOM 5432  H HB2  . MET A 1 67 ? 10.305  20.824  -13.580 1.00 1.45 ? 67 MET A HB2  3  
ATOM 5433  H HB3  . MET A 1 67 ? 9.817   22.519  -13.540 1.00 1.45 ? 67 MET A HB3  3  
ATOM 5434  H HG2  . MET A 1 67 ? 12.637  22.299  -12.960 1.00 1.45 ? 67 MET A HG2  3  
ATOM 5435  H HG3  . MET A 1 67 ? 12.270  21.472  -14.473 1.00 1.45 ? 67 MET A HG3  3  
ATOM 5436  H HE1  . MET A 1 67 ? 12.837  22.420  -16.249 1.00 1.45 ? 67 MET A HE1  3  
ATOM 5437  H HE2  . MET A 1 67 ? 11.198  22.854  -16.725 1.00 1.45 ? 67 MET A HE2  3  
ATOM 5438  H HE3  . MET A 1 67 ? 12.497  24.034  -16.887 1.00 1.45 ? 67 MET A HE3  3  
ATOM 5439  N N    . SER A 1 68 ? 10.354  24.197  -11.571 1.00 2.84 ? 68 SER A N    3  
ATOM 5440  C CA   . SER A 1 68 ? 9.729   25.453  -11.071 1.00 2.84 ? 68 SER A CA   3  
ATOM 5441  C C    . SER A 1 68 ? 8.251   25.479  -11.464 1.00 2.84 ? 68 SER A C    3  
ATOM 5442  O O    . SER A 1 68 ? 7.420   25.489  -10.571 1.00 2.84 ? 68 SER A O    3  
ATOM 5443  C CB   . SER A 1 68 ? 10.441  26.658  -11.687 1.00 2.84 ? 68 SER A CB   3  
ATOM 5444  O OG   . SER A 1 68 ? 11.817  26.346  -11.870 1.00 2.84 ? 68 SER A OG   3  
ATOM 5445  O OXT  . SER A 1 68 ? 7.974   25.490  -12.653 1.00 2.84 ? 68 SER A OXT  3  
ATOM 5446  H H    . SER A 1 68 ? 11.079  24.239  -12.230 1.00 2.84 ? 68 SER A H    3  
ATOM 5447  H HA   . SER A 1 68 ? 9.816   25.495  -9.995  1.00 2.84 ? 68 SER A HA   3  
ATOM 5448  H HB2  . SER A 1 68 ? 10.000  26.891  -12.641 1.00 2.84 ? 68 SER A HB2  3  
ATOM 5449  H HB3  . SER A 1 68 ? 10.340  27.510  -11.028 1.00 2.84 ? 68 SER A HB3  3  
ATOM 5450  H HG   . SER A 1 68 ? 12.117  26.791  -12.666 1.00 2.84 ? 68 SER A HG   3  
ATOM 5451  N N    . SER B 1 1  ? 19.693  -4.398  -6.566  1.00 5.93 ? 1  SER B N    3  
ATOM 5452  C CA   . SER B 1 1  ? 18.223  -4.224  -6.736  1.00 5.93 ? 1  SER B CA   3  
ATOM 5453  C C    . SER B 1 1  ? 17.505  -5.512  -6.325  1.00 5.93 ? 1  SER B C    3  
ATOM 5454  O O    . SER B 1 1  ? 17.168  -6.326  -7.162  1.00 5.93 ? 1  SER B O    3  
ATOM 5455  C CB   . SER B 1 1  ? 17.913  -3.913  -8.201  1.00 5.93 ? 1  SER B CB   3  
ATOM 5456  O OG   . SER B 1 1  ? 16.594  -3.393  -8.302  1.00 5.93 ? 1  SER B OG   3  
ATOM 5457  H H1   . SER B 1 1  ? 19.875  -5.088  -5.809  1.00 5.93 ? 1  SER B H1   3  
ATOM 5458  H H2   . SER B 1 1  ? 20.108  -4.739  -7.455  1.00 5.93 ? 1  SER B H2   3  
ATOM 5459  H H3   . SER B 1 1  ? 20.124  -3.485  -6.314  1.00 5.93 ? 1  SER B H3   3  
ATOM 5460  H HA   . SER B 1 1  ? 17.883  -3.408  -6.115  1.00 5.93 ? 1  SER B HA   3  
ATOM 5461  H HB2  . SER B 1 1  ? 18.611  -3.182  -8.572  1.00 5.93 ? 1  SER B HB2  3  
ATOM 5462  H HB3  . SER B 1 1  ? 17.999  -4.819  -8.786  1.00 5.93 ? 1  SER B HB3  3  
ATOM 5463  H HG   . SER B 1 1  ? 16.641  -2.553  -8.762  1.00 5.93 ? 1  SER B HG   3  
ATOM 5464  N N    . PRO B 1 2  ? 17.294  -5.657  -5.041  1.00 3.89 ? 2  PRO B N    3  
ATOM 5465  C CA   . PRO B 1 2  ? 16.618  -6.837  -4.476  1.00 3.89 ? 2  PRO B CA   3  
ATOM 5466  C C    . PRO B 1 2  ? 15.103  -6.730  -4.675  1.00 3.89 ? 2  PRO B C    3  
ATOM 5467  O O    . PRO B 1 2  ? 14.627  -5.968  -5.493  1.00 3.89 ? 2  PRO B O    3  
ATOM 5468  C CB   . PRO B 1 2  ? 16.978  -6.779  -2.989  1.00 3.89 ? 2  PRO B CB   3  
ATOM 5469  C CG   . PRO B 1 2  ? 17.347  -5.306  -2.687  1.00 3.89 ? 2  PRO B CG   3  
ATOM 5470  C CD   . PRO B 1 2  ? 17.710  -4.657  -4.036  1.00 3.89 ? 2  PRO B CD   3  
ATOM 5471  H HA   . PRO B 1 2  ? 17.000  -7.744  -4.914  1.00 3.89 ? 2  PRO B HA   3  
ATOM 5472  H HB2  . PRO B 1 2  ? 16.130  -7.083  -2.390  1.00 3.89 ? 2  PRO B HB2  3  
ATOM 5473  H HB3  . PRO B 1 2  ? 17.826  -7.414  -2.786  1.00 3.89 ? 2  PRO B HB3  3  
ATOM 5474  H HG2  . PRO B 1 2  ? 16.502  -4.798  -2.244  1.00 3.89 ? 2  PRO B HG2  3  
ATOM 5475  H HG3  . PRO B 1 2  ? 18.197  -5.265  -2.023  1.00 3.89 ? 2  PRO B HG3  3  
ATOM 5476  H HD2  . PRO B 1 2  ? 17.165  -3.732  -4.169  1.00 3.89 ? 2  PRO B HD2  3  
ATOM 5477  H HD3  . PRO B 1 2  ? 18.773  -4.485  -4.100  1.00 3.89 ? 2  PRO B HD3  3  
ATOM 5478  N N    . TYR B 1 3  ? 14.342  -7.488  -3.933  1.00 2.56 ? 3  TYR B N    3  
ATOM 5479  C CA   . TYR B 1 3  ? 12.860  -7.430  -4.081  1.00 2.56 ? 3  TYR B CA   3  
ATOM 5480  C C    . TYR B 1 3  ? 12.230  -7.035  -2.744  1.00 2.56 ? 3  TYR B C    3  
ATOM 5481  O O    . TYR B 1 3  ? 11.211  -7.565  -2.347  1.00 2.56 ? 3  TYR B O    3  
ATOM 5482  C CB   . TYR B 1 3  ? 12.337  -8.803  -4.507  1.00 2.56 ? 3  TYR B CB   3  
ATOM 5483  C CG   . TYR B 1 3  ? 12.946  -9.185  -5.834  1.00 2.56 ? 3  TYR B CG   3  
ATOM 5484  C CD1  . TYR B 1 3  ? 12.426  -8.658  -7.022  1.00 2.56 ? 3  TYR B CD1  3  
ATOM 5485  C CD2  . TYR B 1 3  ? 14.033  -10.068 -5.877  1.00 2.56 ? 3  TYR B CD2  3  
ATOM 5486  C CE1  . TYR B 1 3  ? 12.992  -9.012  -8.252  1.00 2.56 ? 3  TYR B CE1  3  
ATOM 5487  C CE2  . TYR B 1 3  ? 14.599  -10.422 -7.107  1.00 2.56 ? 3  TYR B CE2  3  
ATOM 5488  C CZ   . TYR B 1 3  ? 14.078  -9.895  -8.295  1.00 2.56 ? 3  TYR B CZ   3  
ATOM 5489  O OH   . TYR B 1 3  ? 14.636  -10.244 -9.508  1.00 2.56 ? 3  TYR B OH   3  
ATOM 5490  H H    . TYR B 1 3  ? 14.746  -8.097  -3.279  1.00 2.56 ? 3  TYR B H    3  
ATOM 5491  H HA   . TYR B 1 3  ? 12.603  -6.697  -4.831  1.00 2.56 ? 3  TYR B HA   3  
ATOM 5492  H HB2  . TYR B 1 3  ? 12.604  -9.538  -3.762  1.00 2.56 ? 3  TYR B HB2  3  
ATOM 5493  H HB3  . TYR B 1 3  ? 11.262  -8.763  -4.604  1.00 2.56 ? 3  TYR B HB3  3  
ATOM 5494  H HD1  . TYR B 1 3  ? 11.588  -7.977  -6.989  1.00 2.56 ? 3  TYR B HD1  3  
ATOM 5495  H HD2  . TYR B 1 3  ? 14.434  -10.474 -4.961  1.00 2.56 ? 3  TYR B HD2  3  
ATOM 5496  H HE1  . TYR B 1 3  ? 12.590  -8.606  -9.168  1.00 2.56 ? 3  TYR B HE1  3  
ATOM 5497  H HE2  . TYR B 1 3  ? 15.437  -11.103 -7.140  1.00 2.56 ? 3  TYR B HE2  3  
ATOM 5498  H HH   . TYR B 1 3  ? 15.035  -9.458  -9.889  1.00 2.56 ? 3  TYR B HH   3  
ATOM 5499  N N    . SER B 1 4  ? 12.828  -6.109  -2.045  1.00 0.96 ? 4  SER B N    3  
ATOM 5500  C CA   . SER B 1 4  ? 12.263  -5.682  -0.735  1.00 0.96 ? 4  SER B CA   3  
ATOM 5501  C C    . SER B 1 4  ? 11.883  -4.201  -0.801  1.00 0.96 ? 4  SER B C    3  
ATOM 5502  O O    . SER B 1 4  ? 11.567  -3.586  0.198   1.00 0.96 ? 4  SER B O    3  
ATOM 5503  C CB   . SER B 1 4  ? 13.305  -5.892  0.363   1.00 0.96 ? 4  SER B CB   3  
ATOM 5504  O OG   . SER B 1 4  ? 12.684  -5.748  1.633   1.00 0.96 ? 4  SER B OG   3  
ATOM 5505  H H    . SER B 1 4  ? 13.649  -5.694  -2.383  1.00 0.96 ? 4  SER B H    3  
ATOM 5506  H HA   . SER B 1 4  ? 11.383  -6.269  -0.514  1.00 0.96 ? 4  SER B HA   3  
ATOM 5507  H HB2  . SER B 1 4  ? 13.720  -6.883  0.282   1.00 0.96 ? 4  SER B HB2  3  
ATOM 5508  H HB3  . SER B 1 4  ? 14.096  -5.163  0.252   1.00 0.96 ? 4  SER B HB3  3  
ATOM 5509  H HG   . SER B 1 4  ? 13.230  -5.163  2.165   1.00 0.96 ? 4  SER B HG   3  
ATOM 5510  N N    . SER B 1 5  ? 11.912  -3.622  -1.971  1.00 0.48 ? 5  SER B N    3  
ATOM 5511  C CA   . SER B 1 5  ? 11.553  -2.182  -2.098  1.00 0.48 ? 5  SER B CA   3  
ATOM 5512  C C    . SER B 1 5  ? 10.369  -2.034  -3.057  1.00 0.48 ? 5  SER B C    3  
ATOM 5513  O O    . SER B 1 5  ? 10.528  -1.663  -4.203  1.00 0.48 ? 5  SER B O    3  
ATOM 5514  C CB   . SER B 1 5  ? 12.751  -1.405  -2.645  1.00 0.48 ? 5  SER B CB   3  
ATOM 5515  O OG   . SER B 1 5  ? 13.105  -1.925  -3.920  1.00 0.48 ? 5  SER B OG   3  
ATOM 5516  H H    . SER B 1 5  ? 12.169  -4.135  -2.765  1.00 0.48 ? 5  SER B H    3  
ATOM 5517  H HA   . SER B 1 5  ? 11.283  -1.791  -1.129  1.00 0.48 ? 5  SER B HA   3  
ATOM 5518  H HB2  . SER B 1 5  ? 12.492  -0.364  -2.746  1.00 0.48 ? 5  SER B HB2  3  
ATOM 5519  H HB3  . SER B 1 5  ? 13.584  -1.502  -1.962  1.00 0.48 ? 5  SER B HB3  3  
ATOM 5520  H HG   . SER B 1 5  ? 14.011  -1.667  -4.105  1.00 0.48 ? 5  SER B HG   3  
ATOM 5521  N N    . ASP B 1 6  ? 9.182   -2.323  -2.597  1.00 0.37 ? 6  ASP B N    3  
ATOM 5522  C CA   . ASP B 1 6  ? 7.990   -2.200  -3.483  1.00 0.37 ? 6  ASP B CA   3  
ATOM 5523  C C    . ASP B 1 6  ? 6.769   -1.820  -2.644  1.00 0.37 ? 6  ASP B C    3  
ATOM 5524  O O    . ASP B 1 6  ? 6.429   -2.487  -1.687  1.00 0.37 ? 6  ASP B O    3  
ATOM 5525  C CB   . ASP B 1 6  ? 7.734   -3.536  -4.182  1.00 0.37 ? 6  ASP B CB   3  
ATOM 5526  C CG   . ASP B 1 6  ? 9.018   -4.011  -4.864  1.00 0.37 ? 6  ASP B CG   3  
ATOM 5527  O OD1  . ASP B 1 6  ? 9.574   -3.247  -5.634  1.00 0.37 ? 6  ASP B OD1  3  
ATOM 5528  O OD2  . ASP B 1 6  ? 9.423   -5.133  -4.603  1.00 0.37 ? 6  ASP B OD2  3  
ATOM 5529  H H    . ASP B 1 6  ? 9.075   -2.622  -1.670  1.00 0.37 ? 6  ASP B H    3  
ATOM 5530  H HA   . ASP B 1 6  ? 8.171   -1.434  -4.223  1.00 0.37 ? 6  ASP B HA   3  
ATOM 5531  H HB2  . ASP B 1 6  ? 7.419   -4.269  -3.453  1.00 0.37 ? 6  ASP B HB2  3  
ATOM 5532  H HB3  . ASP B 1 6  ? 6.960   -3.412  -4.924  1.00 0.37 ? 6  ASP B HB3  3  
ATOM 5533  N N    . THR B 1 7  ? 6.104   -0.753  -2.996  1.00 0.35 ? 7  THR B N    3  
ATOM 5534  C CA   . THR B 1 7  ? 4.905   -0.332  -2.219  1.00 0.35 ? 7  THR B CA   3  
ATOM 5535  C C    . THR B 1 7  ? 4.023   -1.552  -1.944  1.00 0.35 ? 7  THR B C    3  
ATOM 5536  O O    . THR B 1 7  ? 3.987   -2.491  -2.714  1.00 0.35 ? 7  THR B O    3  
ATOM 5537  C CB   . THR B 1 7  ? 4.111   0.699   -3.023  1.00 0.35 ? 7  THR B CB   3  
ATOM 5538  O OG1  . THR B 1 7  ? 3.479   0.057   -4.121  1.00 0.35 ? 7  THR B OG1  3  
ATOM 5539  C CG2  . THR B 1 7  ? 5.057   1.785   -3.539  1.00 0.35 ? 7  THR B CG2  3  
ATOM 5540  H H    . THR B 1 7  ? 6.394   -0.228  -3.771  1.00 0.35 ? 7  THR B H    3  
ATOM 5541  H HA   . THR B 1 7  ? 5.217   0.105   -1.282  1.00 0.35 ? 7  THR B HA   3  
ATOM 5542  H HB   . THR B 1 7  ? 3.363   1.152   -2.391  1.00 0.35 ? 7  THR B HB   3  
ATOM 5543  H HG1  . THR B 1 7  ? 4.162   -0.357  -4.656  1.00 0.35 ? 7  THR B HG1  3  
ATOM 5544  H HG21 . THR B 1 7  ? 6.068   1.553   -3.239  1.00 0.35 ? 7  THR B HG21 3  
ATOM 5545  H HG22 . THR B 1 7  ? 5.002   1.827   -4.617  1.00 0.35 ? 7  THR B HG22 3  
ATOM 5546  H HG23 . THR B 1 7  ? 4.768   2.740   -3.126  1.00 0.35 ? 7  THR B HG23 3  
ATOM 5547  N N    . THR B 1 8  ? 3.308   -1.545  -0.851  1.00 0.31 ? 8  THR B N    3  
ATOM 5548  C CA   . THR B 1 8  ? 2.429   -2.704  -0.529  1.00 0.31 ? 8  THR B CA   3  
ATOM 5549  C C    . THR B 1 8  ? 0.966   -2.313  -0.768  1.00 0.31 ? 8  THR B C    3  
ATOM 5550  O O    . THR B 1 8  ? 0.566   -1.210  -0.454  1.00 0.31 ? 8  THR B O    3  
ATOM 5551  C CB   . THR B 1 8  ? 2.620   -3.095  0.939   1.00 0.31 ? 8  THR B CB   3  
ATOM 5552  O OG1  . THR B 1 8  ? 3.919   -3.644  1.115   1.00 0.31 ? 8  THR B OG1  3  
ATOM 5553  C CG2  . THR B 1 8  ? 1.568   -4.132  1.336   1.00 0.31 ? 8  THR B CG2  3  
ATOM 5554  H H    . THR B 1 8  ? 3.351   -0.778  -0.242  1.00 0.31 ? 8  THR B H    3  
ATOM 5555  H HA   . THR B 1 8  ? 2.693   -3.538  -1.161  1.00 0.31 ? 8  THR B HA   3  
ATOM 5556  H HB   . THR B 1 8  ? 2.512   -2.221  1.561   1.00 0.31 ? 8  THR B HB   3  
ATOM 5557  H HG1  . THR B 1 8  ? 4.063   -4.293  0.422   1.00 0.31 ? 8  THR B HG1  3  
ATOM 5558  H HG21 . THR B 1 8  ? 0.594   -3.805  0.999   1.00 0.31 ? 8  THR B HG21 3  
ATOM 5559  H HG22 . THR B 1 8  ? 1.806   -5.081  0.881   1.00 0.31 ? 8  THR B HG22 3  
ATOM 5560  H HG23 . THR B 1 8  ? 1.558   -4.240  2.412   1.00 0.31 ? 8  THR B HG23 3  
ATOM 5561  N N    . PRO B 1 9  ? 0.210   -3.231  -1.318  1.00 0.34 ? 9  PRO B N    3  
ATOM 5562  C CA   . PRO B 1 9  ? -1.218  -3.011  -1.611  1.00 0.34 ? 9  PRO B CA   3  
ATOM 5563  C C    . PRO B 1 9  ? -2.049  -3.156  -0.334  1.00 0.34 ? 9  PRO B C    3  
ATOM 5564  O O    . PRO B 1 9  ? -2.787  -4.107  -0.167  1.00 0.34 ? 9  PRO B O    3  
ATOM 5565  C CB   . PRO B 1 9  ? -1.554  -4.120  -2.610  1.00 0.34 ? 9  PRO B CB   3  
ATOM 5566  C CG   . PRO B 1 9  ? -0.497  -5.232  -2.400  1.00 0.34 ? 9  PRO B CG   3  
ATOM 5567  C CD   . PRO B 1 9  ? 0.704   -4.570  -1.698  1.00 0.34 ? 9  PRO B CD   3  
ATOM 5568  H HA   . PRO B 1 9  ? -1.372  -2.045  -2.063  1.00 0.34 ? 9  PRO B HA   3  
ATOM 5569  H HB2  . PRO B 1 9  ? -2.546  -4.505  -2.414  1.00 0.34 ? 9  PRO B HB2  3  
ATOM 5570  H HB3  . PRO B 1 9  ? -1.491  -3.746  -3.619  1.00 0.34 ? 9  PRO B HB3  3  
ATOM 5571  H HG2  . PRO B 1 9  ? -0.906  -6.017  -1.779  1.00 0.34 ? 9  PRO B HG2  3  
ATOM 5572  H HG3  . PRO B 1 9  ? -0.188  -5.633  -3.352  1.00 0.34 ? 9  PRO B HG3  3  
ATOM 5573  H HD2  . PRO B 1 9  ? 0.986   -5.136  -0.821  1.00 0.34 ? 9  PRO B HD2  3  
ATOM 5574  H HD3  . PRO B 1 9  ? 1.537   -4.480  -2.378  1.00 0.34 ? 9  PRO B HD3  3  
ATOM 5575  N N    . CYS B 1 10 ? -1.934  -2.222  0.570   1.00 0.35 ? 10 CYS B N    3  
ATOM 5576  C CA   . CYS B 1 10 ? -2.713  -2.312  1.837   1.00 0.35 ? 10 CYS B CA   3  
ATOM 5577  C C    . CYS B 1 10 ? -4.045  -1.577  1.675   1.00 0.35 ? 10 CYS B C    3  
ATOM 5578  O O    . CYS B 1 10 ? -4.086  -0.376  1.499   1.00 0.35 ? 10 CYS B O    3  
ATOM 5579  C CB   . CYS B 1 10 ? -1.913  -1.671  2.972   1.00 0.35 ? 10 CYS B CB   3  
ATOM 5580  S SG   . CYS B 1 10 ? -0.429  -2.654  3.292   1.00 0.35 ? 10 CYS B SG   3  
ATOM 5581  H H    . CYS B 1 10 ? -1.331  -1.465  0.418   1.00 0.35 ? 10 CYS B H    3  
ATOM 5582  H HA   . CYS B 1 10 ? -2.900  -3.349  2.070   1.00 0.35 ? 10 CYS B HA   3  
ATOM 5583  H HB2  . CYS B 1 10 ? -1.627  -0.668  2.689   1.00 0.35 ? 10 CYS B HB2  3  
ATOM 5584  H HB3  . CYS B 1 10 ? -2.520  -1.634  3.864   1.00 0.35 ? 10 CYS B HB3  3  
ATOM 5585  N N    . CYS B 1 11 ? -5.137  -2.290  1.736   1.00 0.32 ? 11 CYS B N    3  
ATOM 5586  C CA   . CYS B 1 11 ? -6.466  -1.632  1.591   1.00 0.32 ? 11 CYS B CA   3  
ATOM 5587  C C    . CYS B 1 11 ? -7.098  -1.460  2.973   1.00 0.32 ? 11 CYS B C    3  
ATOM 5588  O O    . CYS B 1 11 ? -6.628  -2.002  3.953   1.00 0.32 ? 11 CYS B O    3  
ATOM 5589  C CB   . CYS B 1 11 ? -7.376  -2.500  0.719   1.00 0.32 ? 11 CYS B CB   3  
ATOM 5590  S SG   . CYS B 1 11 ? -7.253  -1.962  -1.004  1.00 0.32 ? 11 CYS B SG   3  
ATOM 5591  H H    . CYS B 1 11 ? -5.083  -3.259  1.882   1.00 0.32 ? 11 CYS B H    3  
ATOM 5592  H HA   . CYS B 1 11 ? -6.340  -0.664  1.129   1.00 0.32 ? 11 CYS B HA   3  
ATOM 5593  H HB2  . CYS B 1 11 ? -7.071  -3.533  0.797   1.00 0.32 ? 11 CYS B HB2  3  
ATOM 5594  H HB3  . CYS B 1 11 ? -8.397  -2.400  1.055   1.00 0.32 ? 11 CYS B HB3  3  
ATOM 5595  N N    . PHE B 1 12 ? -8.162  -0.710  3.059   1.00 0.28 ? 12 PHE B N    3  
ATOM 5596  C CA   . PHE B 1 12 ? -8.822  -0.504  4.378   1.00 0.28 ? 12 PHE B CA   3  
ATOM 5597  C C    . PHE B 1 12 ? -10.321 -0.276  4.173   1.00 0.28 ? 12 PHE B C    3  
ATOM 5598  O O    . PHE B 1 12 ? -11.140 -0.738  4.943   1.00 0.28 ? 12 PHE B O    3  
ATOM 5599  C CB   . PHE B 1 12 ? -8.208  0.715   5.069   1.00 0.28 ? 12 PHE B CB   3  
ATOM 5600  C CG   . PHE B 1 12 ? -6.713  0.712   4.857   1.00 0.28 ? 12 PHE B CG   3  
ATOM 5601  C CD1  . PHE B 1 12 ? -6.162  1.353   3.740   1.00 0.28 ? 12 PHE B CD1  3  
ATOM 5602  C CD2  . PHE B 1 12 ? -5.876  0.066   5.775   1.00 0.28 ? 12 PHE B CD2  3  
ATOM 5603  C CE1  . PHE B 1 12 ? -4.776  1.349   3.543   1.00 0.28 ? 12 PHE B CE1  3  
ATOM 5604  C CE2  . PHE B 1 12 ? -4.490  0.061   5.578   1.00 0.28 ? 12 PHE B CE2  3  
ATOM 5605  C CZ   . PHE B 1 12 ? -3.940  0.703   4.462   1.00 0.28 ? 12 PHE B CZ   3  
ATOM 5606  H H    . PHE B 1 12 ? -8.525  -0.282  2.256   1.00 0.28 ? 12 PHE B H    3  
ATOM 5607  H HA   . PHE B 1 12 ? -8.672  -1.379  4.995   1.00 0.28 ? 12 PHE B HA   3  
ATOM 5608  H HB2  . PHE B 1 12 ? -8.630  1.617   4.649   1.00 0.28 ? 12 PHE B HB2  3  
ATOM 5609  H HB3  . PHE B 1 12 ? -8.420  0.676   6.127   1.00 0.28 ? 12 PHE B HB3  3  
ATOM 5610  H HD1  . PHE B 1 12 ? -6.808  1.851   3.032   1.00 0.28 ? 12 PHE B HD1  3  
ATOM 5611  H HD2  . PHE B 1 12 ? -6.301  -0.429  6.636   1.00 0.28 ? 12 PHE B HD2  3  
ATOM 5612  H HE1  . PHE B 1 12 ? -4.352  1.844   2.682   1.00 0.28 ? 12 PHE B HE1  3  
ATOM 5613  H HE2  . PHE B 1 12 ? -3.845  -0.437  6.287   1.00 0.28 ? 12 PHE B HE2  3  
ATOM 5614  H HZ   . PHE B 1 12 ? -2.871  0.700   4.310   1.00 0.28 ? 12 PHE B HZ   3  
ATOM 5615  N N    . ALA B 1 13 ? -10.688 0.432   3.140   1.00 0.31 ? 13 ALA B N    3  
ATOM 5616  C CA   . ALA B 1 13 ? -12.134 0.687   2.888   1.00 0.31 ? 13 ALA B CA   3  
ATOM 5617  C C    . ALA B 1 13 ? -12.703 -0.426  2.007   1.00 0.31 ? 13 ALA B C    3  
ATOM 5618  O O    . ALA B 1 13 ? -11.974 -1.157  1.366   1.00 0.31 ? 13 ALA B O    3  
ATOM 5619  C CB   . ALA B 1 13 ? -12.298 2.034   2.179   1.00 0.31 ? 13 ALA B CB   3  
ATOM 5620  H H    . ALA B 1 13 ? -10.013 0.796   2.529   1.00 0.31 ? 13 ALA B H    3  
ATOM 5621  H HA   . ALA B 1 13 ? -12.665 0.709   3.828   1.00 0.31 ? 13 ALA B HA   3  
ATOM 5622  H HB1  . ALA B 1 13 ? -11.331 2.389   1.854   1.00 0.31 ? 13 ALA B HB1  3  
ATOM 5623  H HB2  . ALA B 1 13 ? -12.944 1.911   1.321   1.00 0.31 ? 13 ALA B HB2  3  
ATOM 5624  H HB3  . ALA B 1 13 ? -12.735 2.749   2.860   1.00 0.31 ? 13 ALA B HB3  3  
ATOM 5625  N N    . TYR B 1 14 ? -14.000 -0.561  1.969   1.00 0.29 ? 14 TYR B N    3  
ATOM 5626  C CA   . TYR B 1 14 ? -14.615 -1.628  1.129   1.00 0.29 ? 14 TYR B CA   3  
ATOM 5627  C C    . TYR B 1 14 ? -15.815 -1.053  0.372   1.00 0.29 ? 14 TYR B C    3  
ATOM 5628  O O    . TYR B 1 14 ? -16.764 -0.578  0.963   1.00 0.29 ? 14 TYR B O    3  
ATOM 5629  C CB   . TYR B 1 14 ? -15.080 -2.779  2.023   1.00 0.29 ? 14 TYR B CB   3  
ATOM 5630  C CG   . TYR B 1 14 ? -13.935 -3.234  2.895   1.00 0.29 ? 14 TYR B CG   3  
ATOM 5631  C CD1  . TYR B 1 14 ? -12.725 -3.629  2.312   1.00 0.29 ? 14 TYR B CD1  3  
ATOM 5632  C CD2  . TYR B 1 14 ? -14.082 -3.259  4.287   1.00 0.29 ? 14 TYR B CD2  3  
ATOM 5633  C CE1  . TYR B 1 14 ? -11.663 -4.051  3.120   1.00 0.29 ? 14 TYR B CE1  3  
ATOM 5634  C CE2  . TYR B 1 14 ? -13.020 -3.682  5.096   1.00 0.29 ? 14 TYR B CE2  3  
ATOM 5635  C CZ   . TYR B 1 14 ? -11.811 -4.078  4.512   1.00 0.29 ? 14 TYR B CZ   3  
ATOM 5636  O OH   . TYR B 1 14 ? -10.764 -4.494  5.310   1.00 0.29 ? 14 TYR B OH   3  
ATOM 5637  H H    . TYR B 1 14 ? -14.571 0.039   2.492   1.00 0.29 ? 14 TYR B H    3  
ATOM 5638  H HA   . TYR B 1 14 ? -13.885 -1.993  0.421   1.00 0.29 ? 14 TYR B HA   3  
ATOM 5639  H HB2  . TYR B 1 14 ? -15.896 -2.442  2.646   1.00 0.29 ? 14 TYR B HB2  3  
ATOM 5640  H HB3  . TYR B 1 14 ? -15.411 -3.601  1.407   1.00 0.29 ? 14 TYR B HB3  3  
ATOM 5641  H HD1  . TYR B 1 14 ? -12.611 -3.609  1.238   1.00 0.29 ? 14 TYR B HD1  3  
ATOM 5642  H HD2  . TYR B 1 14 ? -15.015 -2.954  4.737   1.00 0.29 ? 14 TYR B HD2  3  
ATOM 5643  H HE1  . TYR B 1 14 ? -10.730 -4.357  2.671   1.00 0.29 ? 14 TYR B HE1  3  
ATOM 5644  H HE2  . TYR B 1 14 ? -13.134 -3.702  6.170   1.00 0.29 ? 14 TYR B HE2  3  
ATOM 5645  H HH   . TYR B 1 14 ? -10.986 -5.358  5.663   1.00 0.29 ? 14 TYR B HH   3  
ATOM 5646  N N    . ILE B 1 15 ? -15.781 -1.094  -0.932  1.00 0.32 ? 15 ILE B N    3  
ATOM 5647  C CA   . ILE B 1 15 ? -16.920 -0.550  -1.723  1.00 0.32 ? 15 ILE B CA   3  
ATOM 5648  C C    . ILE B 1 15 ? -18.153 -1.431  -1.513  1.00 0.32 ? 15 ILE B C    3  
ATOM 5649  O O    . ILE B 1 15 ? -18.047 -2.602  -1.211  1.00 0.32 ? 15 ILE B O    3  
ATOM 5650  C CB   . ILE B 1 15 ? -16.551 -0.536  -3.208  1.00 0.32 ? 15 ILE B CB   3  
ATOM 5651  C CG1  . ILE B 1 15 ? -17.674 0.129   -4.006  1.00 0.32 ? 15 ILE B CG1  3  
ATOM 5652  C CG2  . ILE B 1 15 ? -16.358 -1.972  -3.699  1.00 0.32 ? 15 ILE B CG2  3  
ATOM 5653  C CD1  . ILE B 1 15 ? -17.279 0.199   -5.482  1.00 0.32 ? 15 ILE B CD1  3  
ATOM 5654  H H    . ILE B 1 15 ? -15.007 -1.482  -1.390  1.00 0.32 ? 15 ILE B H    3  
ATOM 5655  H HA   . ILE B 1 15 ? -17.137 0.457   -1.397  1.00 0.32 ? 15 ILE B HA   3  
ATOM 5656  H HB   . ILE B 1 15 ? -15.632 0.016   -3.344  1.00 0.32 ? 15 ILE B HB   3  
ATOM 5657  H HG12 . ILE B 1 15 ? -18.580 -0.449  -3.901  1.00 0.32 ? 15 ILE B HG12 3  
ATOM 5658  H HG13 . ILE B 1 15 ? -17.839 1.129   -3.632  1.00 0.32 ? 15 ILE B HG13 3  
ATOM 5659  H HG21 . ILE B 1 15 ? -16.677 -2.661  -2.932  1.00 0.32 ? 15 ILE B HG21 3  
ATOM 5660  H HG22 . ILE B 1 15 ? -16.947 -2.128  -4.591  1.00 0.32 ? 15 ILE B HG22 3  
ATOM 5661  H HG23 . ILE B 1 15 ? -15.316 -2.139  -3.923  1.00 0.32 ? 15 ILE B HG23 3  
ATOM 5662  H HD11 . ILE B 1 15 ? -16.203 0.182   -5.568  1.00 0.32 ? 15 ILE B HD11 3  
ATOM 5663  H HD12 . ILE B 1 15 ? -17.695 -0.648  -6.006  1.00 0.32 ? 15 ILE B HD12 3  
ATOM 5664  H HD13 . ILE B 1 15 ? -17.660 1.113   -5.913  1.00 0.32 ? 15 ILE B HD13 3  
ATOM 5665  N N    . ALA B 1 16 ? -19.324 -0.877  -1.671  1.00 0.38 ? 16 ALA B N    3  
ATOM 5666  C CA   . ALA B 1 16 ? -20.562 -1.683  -1.480  1.00 0.38 ? 16 ALA B CA   3  
ATOM 5667  C C    . ALA B 1 16 ? -21.020 -2.241  -2.829  1.00 0.38 ? 16 ALA B C    3  
ATOM 5668  O O    . ALA B 1 16 ? -21.427 -3.380  -2.934  1.00 0.38 ? 16 ALA B O    3  
ATOM 5669  C CB   . ALA B 1 16 ? -21.663 -0.798  -0.894  1.00 0.38 ? 16 ALA B CB   3  
ATOM 5670  H H    . ALA B 1 16 ? -19.389 0.070   -1.915  1.00 0.38 ? 16 ALA B H    3  
ATOM 5671  H HA   . ALA B 1 16 ? -20.359 -2.500  -0.803  1.00 0.38 ? 16 ALA B HA   3  
ATOM 5672  H HB1  . ALA B 1 16 ? -21.220 0.077   -0.441  1.00 0.38 ? 16 ALA B HB1  3  
ATOM 5673  H HB2  . ALA B 1 16 ? -22.337 -0.492  -1.681  1.00 0.38 ? 16 ALA B HB2  3  
ATOM 5674  H HB3  . ALA B 1 16 ? -22.211 -1.351  -0.146  1.00 0.38 ? 16 ALA B HB3  3  
ATOM 5675  N N    . ARG B 1 17 ? -20.955 -1.447  -3.863  1.00 0.42 ? 17 ARG B N    3  
ATOM 5676  C CA   . ARG B 1 17 ? -21.387 -1.933  -5.203  1.00 0.42 ? 17 ARG B CA   3  
ATOM 5677  C C    . ARG B 1 17 ? -20.319 -2.874  -5.771  1.00 0.42 ? 17 ARG B C    3  
ATOM 5678  O O    . ARG B 1 17 ? -19.144 -2.700  -5.518  1.00 0.42 ? 17 ARG B O    3  
ATOM 5679  C CB   . ARG B 1 17 ? -21.567 -0.740  -6.145  1.00 0.42 ? 17 ARG B CB   3  
ATOM 5680  C CG   . ARG B 1 17 ? -22.949 -0.121  -5.925  1.00 0.42 ? 17 ARG B CG   3  
ATOM 5681  C CD   . ARG B 1 17 ? -22.792 1.316   -5.424  1.00 0.42 ? 17 ARG B CD   3  
ATOM 5682  N NE   . ARG B 1 17 ? -23.207 2.263   -6.497  1.00 0.42 ? 17 ARG B NE   3  
ATOM 5683  C CZ   . ARG B 1 17 ? -24.430 2.715   -6.530  1.00 0.42 ? 17 ARG B CZ   3  
ATOM 5684  N NH1  . ARG B 1 17 ? -25.435 1.885   -6.453  1.00 0.42 ? 17 ARG B NH1  3  
ATOM 5685  N NH2  . ARG B 1 17 ? -24.650 3.997   -6.640  1.00 0.42 ? 17 ARG B NH2  3  
ATOM 5686  H H    . ARG B 1 17 ? -20.622 -0.530  -3.757  1.00 0.42 ? 17 ARG B H    3  
ATOM 5687  H HA   . ARG B 1 17 ? -22.323 -2.463  -5.110  1.00 0.42 ? 17 ARG B HA   3  
ATOM 5688  H HB2  . ARG B 1 17 ? -20.805 -0.002  -5.941  1.00 0.42 ? 17 ARG B HB2  3  
ATOM 5689  H HB3  . ARG B 1 17 ? -21.484 -1.073  -7.168  1.00 0.42 ? 17 ARG B HB3  3  
ATOM 5690  H HG2  . ARG B 1 17 ? -23.496 -0.121  -6.857  1.00 0.42 ? 17 ARG B HG2  3  
ATOM 5691  H HG3  . ARG B 1 17 ? -23.490 -0.699  -5.190  1.00 0.42 ? 17 ARG B HG3  3  
ATOM 5692  H HD2  . ARG B 1 17 ? -23.412 1.464   -4.553  1.00 0.42 ? 17 ARG B HD2  3  
ATOM 5693  H HD3  . ARG B 1 17 ? -21.758 1.496   -5.165  1.00 0.42 ? 17 ARG B HD3  3  
ATOM 5694  H HE   . ARG B 1 17 ? -22.562 2.547   -7.177  1.00 0.42 ? 17 ARG B HE   3  
ATOM 5695  H HH11 . ARG B 1 17 ? -25.267 0.903   -6.369  1.00 0.42 ? 17 ARG B HH11 3  
ATOM 5696  H HH12 . ARG B 1 17 ? -26.373 2.231   -6.479  1.00 0.42 ? 17 ARG B HH12 3  
ATOM 5697  H HH21 . ARG B 1 17 ? -23.881 4.633   -6.698  1.00 0.42 ? 17 ARG B HH21 3  
ATOM 5698  H HH22 . ARG B 1 17 ? -25.588 4.342   -6.665  1.00 0.42 ? 17 ARG B HH22 3  
ATOM 5699  N N    . PRO B 1 18 ? -20.766 -3.847  -6.525  1.00 0.41 ? 18 PRO B N    3  
ATOM 5700  C CA   . PRO B 1 18 ? -19.875 -4.841  -7.148  1.00 0.41 ? 18 PRO B CA   3  
ATOM 5701  C C    . PRO B 1 18 ? -19.194 -4.249  -8.385  1.00 0.41 ? 18 PRO B C    3  
ATOM 5702  O O    . PRO B 1 18 ? -19.521 -3.165  -8.828  1.00 0.41 ? 18 PRO B O    3  
ATOM 5703  C CB   . PRO B 1 18 ? -20.823 -5.977  -7.538  1.00 0.41 ? 18 PRO B CB   3  
ATOM 5704  C CG   . PRO B 1 18 ? -22.235 -5.352  -7.640  1.00 0.41 ? 18 PRO B CG   3  
ATOM 5705  C CD   . PRO B 1 18 ? -22.198 -4.046  -6.824  1.00 0.41 ? 18 PRO B CD   3  
ATOM 5706  H HA   . PRO B 1 18 ? -19.144 -5.195  -6.441  1.00 0.41 ? 18 PRO B HA   3  
ATOM 5707  H HB2  . PRO B 1 18 ? -20.528 -6.395  -8.492  1.00 0.41 ? 18 PRO B HB2  3  
ATOM 5708  H HB3  . PRO B 1 18 ? -20.818 -6.743  -6.778  1.00 0.41 ? 18 PRO B HB3  3  
ATOM 5709  H HG2  . PRO B 1 18 ? -22.472 -5.141  -8.674  1.00 0.41 ? 18 PRO B HG2  3  
ATOM 5710  H HG3  . PRO B 1 18 ? -22.969 -6.023  -7.220  1.00 0.41 ? 18 PRO B HG3  3  
ATOM 5711  H HD2  . PRO B 1 18 ? -22.584 -3.224  -7.412  1.00 0.41 ? 18 PRO B HD2  3  
ATOM 5712  H HD3  . PRO B 1 18 ? -22.759 -4.155  -5.908  1.00 0.41 ? 18 PRO B HD3  3  
ATOM 5713  N N    . LEU B 1 19 ? -18.248 -4.952  -8.945  1.00 0.45 ? 19 LEU B N    3  
ATOM 5714  C CA   . LEU B 1 19 ? -17.545 -4.432  -10.153 1.00 0.45 ? 19 LEU B CA   3  
ATOM 5715  C C    . LEU B 1 19 ? -17.783 -5.382  -11.329 1.00 0.45 ? 19 LEU B C    3  
ATOM 5716  O O    . LEU B 1 19 ? -18.253 -6.487  -11.145 1.00 0.45 ? 19 LEU B O    3  
ATOM 5717  C CB   . LEU B 1 19 ? -16.039 -4.330  -9.878  1.00 0.45 ? 19 LEU B CB   3  
ATOM 5718  C CG   . LEU B 1 19 ? -15.642 -5.303  -8.763  1.00 0.45 ? 19 LEU B CG   3  
ATOM 5719  C CD1  . LEU B 1 19 ? -14.126 -5.505  -8.777  1.00 0.45 ? 19 LEU B CD1  3  
ATOM 5720  C CD2  . LEU B 1 19 ? -16.065 -4.725  -7.411  1.00 0.45 ? 19 LEU B CD2  3  
ATOM 5721  H H    . LEU B 1 19 ? -18.000 -5.823  -8.572  1.00 0.45 ? 19 LEU B H    3  
ATOM 5722  H HA   . LEU B 1 19 ? -17.930 -3.454  -10.400 1.00 0.45 ? 19 LEU B HA   3  
ATOM 5723  H HB2  . LEU B 1 19 ? -15.493 -4.577  -10.778 1.00 0.45 ? 19 LEU B HB2  3  
ATOM 5724  H HB3  . LEU B 1 19 ? -15.795 -3.322  -9.575  1.00 0.45 ? 19 LEU B HB3  3  
ATOM 5725  H HG   . LEU B 1 19 ? -16.133 -6.252  -8.923  1.00 0.45 ? 19 LEU B HG   3  
ATOM 5726  H HD11 . LEU B 1 19 ? -13.749 -5.339  -9.776  1.00 0.45 ? 19 LEU B HD11 3  
ATOM 5727  H HD12 . LEU B 1 19 ? -13.663 -4.806  -8.097  1.00 0.45 ? 19 LEU B HD12 3  
ATOM 5728  H HD13 . LEU B 1 19 ? -13.894 -6.514  -8.468  1.00 0.45 ? 19 LEU B HD13 3  
ATOM 5729  H HD21 . LEU B 1 19 ? -16.143 -3.651  -7.487  1.00 0.45 ? 19 LEU B HD21 3  
ATOM 5730  H HD22 . LEU B 1 19 ? -17.022 -5.137  -7.127  1.00 0.45 ? 19 LEU B HD22 3  
ATOM 5731  H HD23 . LEU B 1 19 ? -15.328 -4.981  -6.664  1.00 0.45 ? 19 LEU B HD23 3  
ATOM 5732  N N    . PRO B 1 20 ? -17.447 -4.922  -12.507 1.00 0.58 ? 20 PRO B N    3  
ATOM 5733  C CA   . PRO B 1 20 ? -17.609 -5.708  -13.743 1.00 0.58 ? 20 PRO B CA   3  
ATOM 5734  C C    . PRO B 1 20 ? -16.490 -6.745  -13.867 1.00 0.58 ? 20 PRO B C    3  
ATOM 5735  O O    . PRO B 1 20 ? -15.391 -6.439  -14.284 1.00 0.58 ? 20 PRO B O    3  
ATOM 5736  C CB   . PRO B 1 20 ? -17.508 -4.657  -14.852 1.00 0.58 ? 20 PRO B CB   3  
ATOM 5737  C CG   . PRO B 1 20 ? -16.743 -3.456  -14.247 1.00 0.58 ? 20 PRO B CG   3  
ATOM 5738  C CD   . PRO B 1 20 ? -16.875 -3.575  -12.717 1.00 0.58 ? 20 PRO B CD   3  
ATOM 5739  H HA   . PRO B 1 20 ? -18.577 -6.182  -13.771 1.00 0.58 ? 20 PRO B HA   3  
ATOM 5740  H HB2  . PRO B 1 20 ? -16.966 -5.061  -15.697 1.00 0.58 ? 20 PRO B HB2  3  
ATOM 5741  H HB3  . PRO B 1 20 ? -18.493 -4.344  -15.159 1.00 0.58 ? 20 PRO B HB3  3  
ATOM 5742  H HG2  . PRO B 1 20 ? -15.701 -3.498  -14.537 1.00 0.58 ? 20 PRO B HG2  3  
ATOM 5743  H HG3  . PRO B 1 20 ? -17.184 -2.529  -14.579 1.00 0.58 ? 20 PRO B HG3  3  
ATOM 5744  H HD2  . PRO B 1 20 ? -15.904 -3.496  -12.248 1.00 0.58 ? 20 PRO B HD2  3  
ATOM 5745  H HD3  . PRO B 1 20 ? -17.545 -2.823  -12.334 1.00 0.58 ? 20 PRO B HD3  3  
ATOM 5746  N N    . ARG B 1 21 ? -16.760 -7.969  -13.505 1.00 0.75 ? 21 ARG B N    3  
ATOM 5747  C CA   . ARG B 1 21 ? -15.711 -9.024  -13.600 1.00 0.75 ? 21 ARG B CA   3  
ATOM 5748  C C    . ARG B 1 21 ? -15.117 -9.031  -15.010 1.00 0.75 ? 21 ARG B C    3  
ATOM 5749  O O    . ARG B 1 21 ? -13.970 -9.378  -15.209 1.00 0.75 ? 21 ARG B O    3  
ATOM 5750  C CB   . ARG B 1 21 ? -16.336 -10.390 -13.304 1.00 0.75 ? 21 ARG B CB   3  
ATOM 5751  C CG   . ARG B 1 21 ? -15.233 -11.389 -12.948 1.00 0.75 ? 21 ARG B CG   3  
ATOM 5752  C CD   . ARG B 1 21 ? -15.497 -12.716 -13.661 1.00 0.75 ? 21 ARG B CD   3  
ATOM 5753  N NE   . ARG B 1 21 ? -14.305 -13.598 -13.526 1.00 0.75 ? 21 ARG B NE   3  
ATOM 5754  C CZ   . ARG B 1 21 ? -13.562 -13.856 -14.568 1.00 0.75 ? 21 ARG B CZ   3  
ATOM 5755  N NH1  . ARG B 1 21 ? -12.933 -12.887 -15.176 1.00 0.75 ? 21 ARG B NH1  3  
ATOM 5756  N NH2  . ARG B 1 21 ? -13.448 -15.081 -15.002 1.00 0.75 ? 21 ARG B NH2  3  
ATOM 5757  H H    . ARG B 1 21 ? -17.652 -8.195  -13.170 1.00 0.75 ? 21 ARG B H    3  
ATOM 5758  H HA   . ARG B 1 21 ? -14.931 -8.822  -12.882 1.00 0.75 ? 21 ARG B HA   3  
ATOM 5759  H HB2  . ARG B 1 21 ? -17.022 -10.299 -12.475 1.00 0.75 ? 21 ARG B HB2  3  
ATOM 5760  H HB3  . ARG B 1 21 ? -16.867 -10.740 -14.176 1.00 0.75 ? 21 ARG B HB3  3  
ATOM 5761  H HG2  . ARG B 1 21 ? -14.276 -10.996 -13.259 1.00 0.75 ? 21 ARG B HG2  3  
ATOM 5762  H HG3  . ARG B 1 21 ? -15.225 -11.551 -11.881 1.00 0.75 ? 21 ARG B HG3  3  
ATOM 5763  H HD2  . ARG B 1 21 ? -16.355 -13.199 -13.216 1.00 0.75 ? 21 ARG B HD2  3  
ATOM 5764  H HD3  . ARG B 1 21 ? -15.691 -12.530 -14.707 1.00 0.75 ? 21 ARG B HD3  3  
ATOM 5765  H HE   . ARG B 1 21 ? -14.078 -13.987 -12.655 1.00 0.75 ? 21 ARG B HE   3  
ATOM 5766  H HH11 . ARG B 1 21 ? -13.020 -11.948 -14.842 1.00 0.75 ? 21 ARG B HH11 3  
ATOM 5767  H HH12 . ARG B 1 21 ? -12.364 -13.083 -15.973 1.00 0.75 ? 21 ARG B HH12 3  
ATOM 5768  H HH21 . ARG B 1 21 ? -13.931 -15.823 -14.537 1.00 0.75 ? 21 ARG B HH21 3  
ATOM 5769  H HH22 . ARG B 1 21 ? -12.879 -15.277 -15.801 1.00 0.75 ? 21 ARG B HH22 3  
ATOM 5770  N N    . ALA B 1 22 ? -15.888 -8.649  -15.992 1.00 0.89 ? 22 ALA B N    3  
ATOM 5771  C CA   . ALA B 1 22 ? -15.366 -8.635  -17.387 1.00 0.89 ? 22 ALA B CA   3  
ATOM 5772  C C    . ALA B 1 22 ? -14.177 -7.676  -17.479 1.00 0.89 ? 22 ALA B C    3  
ATOM 5773  O O    . ALA B 1 22 ? -13.178 -7.968  -18.106 1.00 0.89 ? 22 ALA B O    3  
ATOM 5774  C CB   . ALA B 1 22 ? -16.470 -8.171  -18.340 1.00 0.89 ? 22 ALA B CB   3  
ATOM 5775  H H    . ALA B 1 22 ? -16.811 -8.373  -15.811 1.00 0.89 ? 22 ALA B H    3  
ATOM 5776  H HA   . ALA B 1 22 ? -15.047 -9.630  -17.663 1.00 0.89 ? 22 ALA B HA   3  
ATOM 5777  H HB1  . ALA B 1 22 ? -17.003 -7.343  -17.897 1.00 0.89 ? 22 ALA B HB1  3  
ATOM 5778  H HB2  . ALA B 1 22 ? -16.030 -7.857  -19.275 1.00 0.89 ? 22 ALA B HB2  3  
ATOM 5779  H HB3  . ALA B 1 22 ? -17.156 -8.986  -18.520 1.00 0.89 ? 22 ALA B HB3  3  
ATOM 5780  N N    . HIS B 1 23 ? -14.277 -6.532  -16.858 1.00 0.71 ? 23 HIS B N    3  
ATOM 5781  C CA   . HIS B 1 23 ? -13.153 -5.555  -16.912 1.00 0.71 ? 23 HIS B CA   3  
ATOM 5782  C C    . HIS B 1 23 ? -12.205 -5.797  -15.734 1.00 0.71 ? 23 HIS B C    3  
ATOM 5783  O O    . HIS B 1 23 ? -11.269 -5.053  -15.517 1.00 0.71 ? 23 HIS B O    3  
ATOM 5784  C CB   . HIS B 1 23 ? -13.711 -4.132  -16.832 1.00 0.71 ? 23 HIS B CB   3  
ATOM 5785  C CG   . HIS B 1 23 ? -14.713 -3.924  -17.935 1.00 0.71 ? 23 HIS B CG   3  
ATOM 5786  N ND1  . HIS B 1 23 ? -14.794 -2.736  -18.643 1.00 0.71 ? 23 HIS B ND1  3  
ATOM 5787  C CD2  . HIS B 1 23 ? -15.682 -4.742  -18.460 1.00 0.71 ? 23 HIS B CD2  3  
ATOM 5788  C CE1  . HIS B 1 23 ? -15.781 -2.870  -19.549 1.00 0.71 ? 23 HIS B CE1  3  
ATOM 5789  N NE2  . HIS B 1 23 ? -16.355 -4.074  -19.479 1.00 0.71 ? 23 HIS B NE2  3  
ATOM 5790  H H    . HIS B 1 23 ? -15.092 -6.315  -16.359 1.00 0.71 ? 23 HIS B H    3  
ATOM 5791  H HA   . HIS B 1 23 ? -12.614 -5.678  -17.840 1.00 0.71 ? 23 HIS B HA   3  
ATOM 5792  H HB2  . HIS B 1 23 ? -14.192 -3.988  -15.876 1.00 0.71 ? 23 HIS B HB2  3  
ATOM 5793  H HB3  . HIS B 1 23 ? -12.904 -3.423  -16.940 1.00 0.71 ? 23 HIS B HB3  3  
ATOM 5794  H HD1  . HIS B 1 23 ? -14.234 -1.942  -18.511 1.00 0.71 ? 23 HIS B HD1  3  
ATOM 5795  H HD2  . HIS B 1 23 ? -15.891 -5.749  -18.133 1.00 0.71 ? 23 HIS B HD2  3  
ATOM 5796  H HE1  . HIS B 1 23 ? -16.072 -2.099  -20.246 1.00 0.71 ? 23 HIS B HE1  3  
ATOM 5797  N N    . ILE B 1 24 ? -12.435 -6.832  -14.973 1.00 0.56 ? 24 ILE B N    3  
ATOM 5798  C CA   . ILE B 1 24 ? -11.544 -7.117  -13.814 1.00 0.56 ? 24 ILE B CA   3  
ATOM 5799  C C    . ILE B 1 24 ? -10.415 -8.051  -14.255 1.00 0.56 ? 24 ILE B C    3  
ATOM 5800  O O    . ILE B 1 24 ? -10.538 -9.259  -14.199 1.00 0.56 ? 24 ILE B O    3  
ATOM 5801  C CB   . ILE B 1 24 ? -12.353 -7.783  -12.697 1.00 0.56 ? 24 ILE B CB   3  
ATOM 5802  C CG1  . ILE B 1 24 ? -13.253 -6.740  -12.031 1.00 0.56 ? 24 ILE B CG1  3  
ATOM 5803  C CG2  . ILE B 1 24 ? -11.403 -8.372  -11.653 1.00 0.56 ? 24 ILE B CG2  3  
ATOM 5804  C CD1  . ILE B 1 24 ? -14.020 -7.389  -10.877 1.00 0.56 ? 24 ILE B CD1  3  
ATOM 5805  H H    . ILE B 1 24 ? -13.195 -7.422  -15.165 1.00 0.56 ? 24 ILE B H    3  
ATOM 5806  H HA   . ILE B 1 24 ? -11.123 -6.191  -13.449 1.00 0.56 ? 24 ILE B HA   3  
ATOM 5807  H HB   . ILE B 1 24 ? -12.962 -8.571  -13.116 1.00 0.56 ? 24 ILE B HB   3  
ATOM 5808  H HG12 . ILE B 1 24 ? -12.645 -5.931  -11.650 1.00 0.56 ? 24 ILE B HG12 3  
ATOM 5809  H HG13 . ILE B 1 24 ? -13.955 -6.353  -12.753 1.00 0.56 ? 24 ILE B HG13 3  
ATOM 5810  H HG21 . ILE B 1 24 ? -10.588 -7.685  -11.479 1.00 0.56 ? 24 ILE B HG21 3  
ATOM 5811  H HG22 . ILE B 1 24 ? -11.939 -8.538  -10.730 1.00 0.56 ? 24 ILE B HG22 3  
ATOM 5812  H HG23 . ILE B 1 24 ? -11.010 -9.311  -12.015 1.00 0.56 ? 24 ILE B HG23 3  
ATOM 5813  H HD11 . ILE B 1 24 ? -14.329 -8.383  -11.164 1.00 0.56 ? 24 ILE B HD11 3  
ATOM 5814  H HD12 . ILE B 1 24 ? -13.380 -7.448  -10.008 1.00 0.56 ? 24 ILE B HD12 3  
ATOM 5815  H HD13 . ILE B 1 24 ? -14.891 -6.794  -10.643 1.00 0.56 ? 24 ILE B HD13 3  
ATOM 5816  N N    . LYS B 1 25 ? -9.316  -7.502  -14.695 1.00 0.59 ? 25 LYS B N    3  
ATOM 5817  C CA   . LYS B 1 25 ? -8.181  -8.357  -15.139 1.00 0.59 ? 25 LYS B CA   3  
ATOM 5818  C C    . LYS B 1 25 ? -7.886  -9.412  -14.072 1.00 0.59 ? 25 LYS B C    3  
ATOM 5819  O O    . LYS B 1 25 ? -8.037  -10.596 -14.298 1.00 0.59 ? 25 LYS B O    3  
ATOM 5820  C CB   . LYS B 1 25 ? -6.942  -7.486  -15.348 1.00 0.59 ? 25 LYS B CB   3  
ATOM 5821  C CG   . LYS B 1 25 ? -6.078  -8.089  -16.455 1.00 0.59 ? 25 LYS B CG   3  
ATOM 5822  C CD   . LYS B 1 25 ? -4.752  -7.330  -16.543 1.00 0.59 ? 25 LYS B CD   3  
ATOM 5823  C CE   . LYS B 1 25 ? -4.375  -7.128  -18.011 1.00 0.59 ? 25 LYS B CE   3  
ATOM 5824  N NZ   . LYS B 1 25 ? -2.894  -7.016  -18.131 1.00 0.59 ? 25 LYS B NZ   3  
ATOM 5825  H H    . LYS B 1 25 ? -9.236  -6.527  -14.733 1.00 0.59 ? 25 LYS B H    3  
ATOM 5826  H HA   . LYS B 1 25 ? -8.439  -8.844  -16.068 1.00 0.59 ? 25 LYS B HA   3  
ATOM 5827  H HB2  . LYS B 1 25 ? -7.246  -6.488  -15.630 1.00 0.59 ? 25 LYS B HB2  3  
ATOM 5828  H HB3  . LYS B 1 25 ? -6.371  -7.443  -14.432 1.00 0.59 ? 25 LYS B HB3  3  
ATOM 5829  H HG2  . LYS B 1 25 ? -5.885  -9.129  -16.233 1.00 0.59 ? 25 LYS B HG2  3  
ATOM 5830  H HG3  . LYS B 1 25 ? -6.597  -8.013  -17.398 1.00 0.59 ? 25 LYS B HG3  3  
ATOM 5831  H HD2  . LYS B 1 25 ? -4.857  -6.368  -16.061 1.00 0.59 ? 25 LYS B HD2  3  
ATOM 5832  H HD3  . LYS B 1 25 ? -3.979  -7.897  -16.048 1.00 0.59 ? 25 LYS B HD3  3  
ATOM 5833  H HE2  . LYS B 1 25 ? -4.721  -7.971  -18.590 1.00 0.59 ? 25 LYS B HE2  3  
ATOM 5834  H HE3  . LYS B 1 25 ? -4.835  -6.224  -18.380 1.00 0.59 ? 25 LYS B HE3  3  
ATOM 5835  H HZ1  . LYS B 1 25 ? -2.441  -7.700  -17.492 1.00 0.59 ? 25 LYS B HZ1  3  
ATOM 5836  H HZ2  . LYS B 1 25 ? -2.608  -7.219  -19.110 1.00 0.59 ? 25 LYS B HZ2  3  
ATOM 5837  H HZ3  . LYS B 1 25 ? -2.597  -6.052  -17.875 1.00 0.59 ? 25 LYS B HZ3  3  
ATOM 5838  N N    . GLU B 1 26 ? -7.466  -8.993  -12.910 1.00 0.53 ? 26 GLU B N    3  
ATOM 5839  C CA   . GLU B 1 26 ? -7.160  -9.974  -11.832 1.00 0.53 ? 26 GLU B CA   3  
ATOM 5840  C C    . GLU B 1 26 ? -7.165  -9.263  -10.477 1.00 0.53 ? 26 GLU B C    3  
ATOM 5841  O O    . GLU B 1 26 ? -7.183  -8.051  -10.401 1.00 0.53 ? 26 GLU B O    3  
ATOM 5842  C CB   . GLU B 1 26 ? -5.781  -10.589 -12.079 1.00 0.53 ? 26 GLU B CB   3  
ATOM 5843  C CG   . GLU B 1 26 ? -4.729  -9.480  -12.127 1.00 0.53 ? 26 GLU B CG   3  
ATOM 5844  C CD   . GLU B 1 26 ? -3.520  -9.958  -12.933 1.00 0.53 ? 26 GLU B CD   3  
ATOM 5845  O OE1  . GLU B 1 26 ? -3.334  -11.160 -13.029 1.00 0.53 ? 26 GLU B OE1  3  
ATOM 5846  O OE2  . GLU B 1 26 ? -2.799  -9.114  -13.440 1.00 0.53 ? 26 GLU B OE2  3  
ATOM 5847  H H    . GLU B 1 26 ? -7.349  -8.032  -12.749 1.00 0.53 ? 26 GLU B H    3  
ATOM 5848  H HA   . GLU B 1 26 ? -7.908  -10.753 -11.832 1.00 0.53 ? 26 GLU B HA   3  
ATOM 5849  H HB2  . GLU B 1 26 ? -5.546  -11.277 -11.279 1.00 0.53 ? 26 GLU B HB2  3  
ATOM 5850  H HB3  . GLU B 1 26 ? -5.787  -11.118 -13.020 1.00 0.53 ? 26 GLU B HB3  3  
ATOM 5851  H HG2  . GLU B 1 26 ? -5.152  -8.603  -12.596 1.00 0.53 ? 26 GLU B HG2  3  
ATOM 5852  H HG3  . GLU B 1 26 ? -4.416  -9.237  -11.122 1.00 0.53 ? 26 GLU B HG3  3  
ATOM 5853  N N    . TYR B 1 27 ? -7.147  -10.009 -9.405  1.00 0.39 ? 27 TYR B N    3  
ATOM 5854  C CA   . TYR B 1 27 ? -7.150  -9.374  -8.057  1.00 0.39 ? 27 TYR B CA   3  
ATOM 5855  C C    . TYR B 1 27 ? -6.111  -10.061 -7.167  1.00 0.39 ? 27 TYR B C    3  
ATOM 5856  O O    . TYR B 1 27 ? -5.320  -10.862 -7.624  1.00 0.39 ? 27 TYR B O    3  
ATOM 5857  C CB   . TYR B 1 27 ? -8.541  -9.515  -7.430  1.00 0.39 ? 27 TYR B CB   3  
ATOM 5858  C CG   . TYR B 1 27 ? -8.756  -10.941 -6.979  1.00 0.39 ? 27 TYR B CG   3  
ATOM 5859  C CD1  . TYR B 1 27 ? -9.179  -11.909 -7.896  1.00 0.39 ? 27 TYR B CD1  3  
ATOM 5860  C CD2  . TYR B 1 27 ? -8.531  -11.293 -5.643  1.00 0.39 ? 27 TYR B CD2  3  
ATOM 5861  C CE1  . TYR B 1 27 ? -9.378  -13.230 -7.479  1.00 0.39 ? 27 TYR B CE1  3  
ATOM 5862  C CE2  . TYR B 1 27 ? -8.729  -12.615 -5.225  1.00 0.39 ? 27 TYR B CE2  3  
ATOM 5863  C CZ   . TYR B 1 27 ? -9.153  -13.583 -6.143  1.00 0.39 ? 27 TYR B CZ   3  
ATOM 5864  O OH   . TYR B 1 27 ? -9.349  -14.885 -5.730  1.00 0.39 ? 27 TYR B OH   3  
ATOM 5865  H H    . TYR B 1 27 ? -7.132  -10.984 -9.488  1.00 0.39 ? 27 TYR B H    3  
ATOM 5866  H HA   . TYR B 1 27 ? -6.903  -8.327  -8.152  1.00 0.39 ? 27 TYR B HA   3  
ATOM 5867  H HB2  . TYR B 1 27 ? -8.619  -8.854  -6.579  1.00 0.39 ? 27 TYR B HB2  3  
ATOM 5868  H HB3  . TYR B 1 27 ? -9.292  -9.251  -8.159  1.00 0.39 ? 27 TYR B HB3  3  
ATOM 5869  H HD1  . TYR B 1 27 ? -9.354  -11.637 -8.928  1.00 0.39 ? 27 TYR B HD1  3  
ATOM 5870  H HD2  . TYR B 1 27 ? -8.204  -10.547 -4.934  1.00 0.39 ? 27 TYR B HD2  3  
ATOM 5871  H HE1  . TYR B 1 27 ? -9.706  -13.976 -8.186  1.00 0.39 ? 27 TYR B HE1  3  
ATOM 5872  H HE2  . TYR B 1 27 ? -8.555  -12.887 -4.194  1.00 0.39 ? 27 TYR B HE2  3  
ATOM 5873  H HH   . TYR B 1 27 ? -8.636  -15.420 -6.089  1.00 0.39 ? 27 TYR B HH   3  
ATOM 5874  N N    . PHE B 1 28 ? -6.111  -9.756  -5.900  1.00 0.35 ? 28 PHE B N    3  
ATOM 5875  C CA   . PHE B 1 28 ? -5.127  -10.390 -4.980  1.00 0.35 ? 28 PHE B CA   3  
ATOM 5876  C C    . PHE B 1 28 ? -5.406  -9.934  -3.546  1.00 0.35 ? 28 PHE B C    3  
ATOM 5877  O O    . PHE B 1 28 ? -6.026  -8.914  -3.320  1.00 0.35 ? 28 PHE B O    3  
ATOM 5878  C CB   . PHE B 1 28 ? -3.709  -9.978  -5.382  1.00 0.35 ? 28 PHE B CB   3  
ATOM 5879  C CG   . PHE B 1 28 ? -3.687  -8.507  -5.717  1.00 0.35 ? 28 PHE B CG   3  
ATOM 5880  C CD1  . PHE B 1 28 ? -3.706  -7.555  -4.690  1.00 0.35 ? 28 PHE B CD1  3  
ATOM 5881  C CD2  . PHE B 1 28 ? -3.643  -8.092  -7.053  1.00 0.35 ? 28 PHE B CD2  3  
ATOM 5882  C CE1  . PHE B 1 28 ? -3.683  -6.190  -5.000  1.00 0.35 ? 28 PHE B CE1  3  
ATOM 5883  C CE2  . PHE B 1 28 ? -3.621  -6.728  -7.364  1.00 0.35 ? 28 PHE B CE2  3  
ATOM 5884  C CZ   . PHE B 1 28 ? -3.640  -5.776  -6.337  1.00 0.35 ? 28 PHE B CZ   3  
ATOM 5885  H H    . PHE B 1 28 ? -6.759  -9.109  -5.553  1.00 0.35 ? 28 PHE B H    3  
ATOM 5886  H HA   . PHE B 1 28 ? -5.219  -11.464 -5.040  1.00 0.35 ? 28 PHE B HA   3  
ATOM 5887  H HB2  . PHE B 1 28 ? -3.032  -10.171 -4.563  1.00 0.35 ? 28 PHE B HB2  3  
ATOM 5888  H HB3  . PHE B 1 28 ? -3.400  -10.547 -6.246  1.00 0.35 ? 28 PHE B HB3  3  
ATOM 5889  H HD1  . PHE B 1 28 ? -3.740  -7.874  -3.659  1.00 0.35 ? 28 PHE B HD1  3  
ATOM 5890  H HD2  . PHE B 1 28 ? -3.628  -8.827  -7.846  1.00 0.35 ? 28 PHE B HD2  3  
ATOM 5891  H HE1  . PHE B 1 28 ? -3.699  -5.456  -4.208  1.00 0.35 ? 28 PHE B HE1  3  
ATOM 5892  H HE2  . PHE B 1 28 ? -3.587  -6.409  -8.395  1.00 0.35 ? 28 PHE B HE2  3  
ATOM 5893  H HZ   . PHE B 1 28 ? -3.622  -4.723  -6.576  1.00 0.35 ? 28 PHE B HZ   3  
ATOM 5894  N N    . TYR B 1 29 ? -4.956  -10.682 -2.577  1.00 0.32 ? 29 TYR B N    3  
ATOM 5895  C CA   . TYR B 1 29 ? -5.200  -10.291 -1.160  1.00 0.32 ? 29 TYR B CA   3  
ATOM 5896  C C    . TYR B 1 29 ? -4.019  -9.466  -0.646  1.00 0.32 ? 29 TYR B C    3  
ATOM 5897  O O    . TYR B 1 29 ? -2.967  -9.422  -1.253  1.00 0.32 ? 29 TYR B O    3  
ATOM 5898  C CB   . TYR B 1 29 ? -5.354  -11.549 -0.303  1.00 0.32 ? 29 TYR B CB   3  
ATOM 5899  C CG   . TYR B 1 29 ? -6.621  -12.271 -0.693  1.00 0.32 ? 29 TYR B CG   3  
ATOM 5900  C CD1  . TYR B 1 29 ? -6.629  -13.121 -1.805  1.00 0.32 ? 29 TYR B CD1  3  
ATOM 5901  C CD2  . TYR B 1 29 ? -7.789  -12.091 0.058   1.00 0.32 ? 29 TYR B CD2  3  
ATOM 5902  C CE1  . TYR B 1 29 ? -7.804  -13.791 -2.167  1.00 0.32 ? 29 TYR B CE1  3  
ATOM 5903  C CE2  . TYR B 1 29 ? -8.964  -12.761 -0.303  1.00 0.32 ? 29 TYR B CE2  3  
ATOM 5904  C CZ   . TYR B 1 29 ? -8.972  -13.611 -1.415  1.00 0.32 ? 29 TYR B CZ   3  
ATOM 5905  O OH   . TYR B 1 29 ? -10.130 -14.271 -1.771  1.00 0.32 ? 29 TYR B OH   3  
ATOM 5906  H H    . TYR B 1 29 ? -4.459  -11.501 -2.781  1.00 0.32 ? 29 TYR B H    3  
ATOM 5907  H HA   . TYR B 1 29 ? -6.103  -9.702  -1.100  1.00 0.32 ? 29 TYR B HA   3  
ATOM 5908  H HB2  . TYR B 1 29 ? -4.506  -12.198 -0.462  1.00 0.32 ? 29 TYR B HB2  3  
ATOM 5909  H HB3  . TYR B 1 29 ? -5.405  -11.271 0.739   1.00 0.32 ? 29 TYR B HB3  3  
ATOM 5910  H HD1  . TYR B 1 29 ? -5.729  -13.260 -2.385  1.00 0.32 ? 29 TYR B HD1  3  
ATOM 5911  H HD2  . TYR B 1 29 ? -7.783  -11.435 0.916   1.00 0.32 ? 29 TYR B HD2  3  
ATOM 5912  H HE1  . TYR B 1 29 ? -7.810  -14.447 -3.024  1.00 0.32 ? 29 TYR B HE1  3  
ATOM 5913  H HE2  . TYR B 1 29 ? -9.865  -12.622 0.277   1.00 0.32 ? 29 TYR B HE2  3  
ATOM 5914  H HH   . TYR B 1 29 ? -10.442 -14.758 -1.004  1.00 0.32 ? 29 TYR B HH   3  
ATOM 5915  N N    . THR B 1 30 ? -4.183  -8.810  0.471   1.00 0.37 ? 30 THR B N    3  
ATOM 5916  C CA   . THR B 1 30 ? -3.070  -7.989  1.024   1.00 0.37 ? 30 THR B CA   3  
ATOM 5917  C C    . THR B 1 30 ? -3.137  -8.001  2.552   1.00 0.37 ? 30 THR B C    3  
ATOM 5918  O O    . THR B 1 30 ? -4.202  -7.951  3.136   1.00 0.37 ? 30 THR B O    3  
ATOM 5919  C CB   . THR B 1 30 ? -3.198  -6.550  0.520   1.00 0.37 ? 30 THR B CB   3  
ATOM 5920  O OG1  . THR B 1 30 ? -4.053  -5.820  1.390   1.00 0.37 ? 30 THR B OG1  3  
ATOM 5921  C CG2  . THR B 1 30 ? -3.785  -6.549  -0.892  1.00 0.37 ? 30 THR B CG2  3  
ATOM 5922  H H    . THR B 1 30 ? -5.038  -8.860  0.947   1.00 0.37 ? 30 THR B H    3  
ATOM 5923  H HA   . THR B 1 30 ? -2.125  -8.401  0.702   1.00 0.37 ? 30 THR B HA   3  
ATOM 5924  H HB   . THR B 1 30 ? -2.224  -6.087  0.501   1.00 0.37 ? 30 THR B HB   3  
ATOM 5925  H HG1  . THR B 1 30 ? -3.504  -5.260  1.944   1.00 0.37 ? 30 THR B HG1  3  
ATOM 5926  H HG21 . THR B 1 30 ? -4.738  -7.057  -0.885  1.00 0.37 ? 30 THR B HG21 3  
ATOM 5927  H HG22 . THR B 1 30 ? -3.922  -5.531  -1.224  1.00 0.37 ? 30 THR B HG22 3  
ATOM 5928  H HG23 . THR B 1 30 ? -3.109  -7.060  -1.563  1.00 0.37 ? 30 THR B HG23 3  
ATOM 5929  N N    . SER B 1 31 ? -2.008  -8.065  3.204   1.00 0.47 ? 31 SER B N    3  
ATOM 5930  C CA   . SER B 1 31 ? -2.009  -8.078  4.694   1.00 0.47 ? 31 SER B CA   3  
ATOM 5931  C C    . SER B 1 31 ? -0.566  -8.039  5.203   1.00 0.47 ? 31 SER B C    3  
ATOM 5932  O O    . SER B 1 31 ? 0.362   -7.812  4.452   1.00 0.47 ? 31 SER B O    3  
ATOM 5933  C CB   . SER B 1 31 ? -2.692  -9.352  5.193   1.00 0.47 ? 31 SER B CB   3  
ATOM 5934  O OG   . SER B 1 31 ? -3.158  -9.145  6.519   1.00 0.47 ? 31 SER B OG   3  
ATOM 5935  H H    . SER B 1 31 ? -1.162  -8.104  2.714   1.00 0.47 ? 31 SER B H    3  
ATOM 5936  H HA   . SER B 1 31 ? -2.542  -7.215  5.060   1.00 0.47 ? 31 SER B HA   3  
ATOM 5937  H HB2  . SER B 1 31 ? -3.527  -9.589  4.556   1.00 0.47 ? 31 SER B HB2  3  
ATOM 5938  H HB3  . SER B 1 31 ? -1.984  -10.171 5.172   1.00 0.47 ? 31 SER B HB3  3  
ATOM 5939  H HG   . SER B 1 31 ? -3.409  -9.998  6.883   1.00 0.47 ? 31 SER B HG   3  
ATOM 5940  N N    . GLY B 1 32 ? -0.369  -8.257  6.475   1.00 0.60 ? 32 GLY B N    3  
ATOM 5941  C CA   . GLY B 1 32 ? 1.012   -8.229  7.031   1.00 0.60 ? 32 GLY B CA   3  
ATOM 5942  C C    . GLY B 1 32 ? 1.454   -6.778  7.227   1.00 0.60 ? 32 GLY B C    3  
ATOM 5943  O O    . GLY B 1 32 ? 1.451   -6.261  8.326   1.00 0.60 ? 32 GLY B O    3  
ATOM 5944  H H    . GLY B 1 32 ? -1.131  -8.438  7.064   1.00 0.60 ? 32 GLY B H    3  
ATOM 5945  H HA2  . GLY B 1 32 ? 1.029   -8.744  7.981   1.00 0.60 ? 32 GLY B HA2  3  
ATOM 5946  H HA3  . GLY B 1 32 ? 1.687   -8.718  6.344   1.00 0.60 ? 32 GLY B HA3  3  
ATOM 5947  N N    . LYS B 1 33 ? 1.828   -6.115  6.167   1.00 0.55 ? 33 LYS B N    3  
ATOM 5948  C CA   . LYS B 1 33 ? 2.265   -4.696  6.291   1.00 0.55 ? 33 LYS B CA   3  
ATOM 5949  C C    . LYS B 1 33 ? 1.050   -3.777  6.153   1.00 0.55 ? 33 LYS B C    3  
ATOM 5950  O O    . LYS B 1 33 ? 1.126   -2.717  5.566   1.00 0.55 ? 33 LYS B O    3  
ATOM 5951  C CB   . LYS B 1 33 ? 3.275   -4.376  5.187   1.00 0.55 ? 33 LYS B CB   3  
ATOM 5952  C CG   . LYS B 1 33 ? 4.503   -5.276  5.342   1.00 0.55 ? 33 LYS B CG   3  
ATOM 5953  C CD   . LYS B 1 33 ? 5.734   -4.559  4.786   1.00 0.55 ? 33 LYS B CD   3  
ATOM 5954  C CE   . LYS B 1 33 ? 6.609   -5.558  4.028   1.00 0.55 ? 33 LYS B CE   3  
ATOM 5955  N NZ   . LYS B 1 33 ? 7.454   -4.828  3.040   1.00 0.55 ? 33 LYS B NZ   3  
ATOM 5956  H H    . LYS B 1 33 ? 1.821   -6.550  5.289   1.00 0.55 ? 33 LYS B H    3  
ATOM 5957  H HA   . LYS B 1 33 ? 2.726   -4.544  7.256   1.00 0.55 ? 33 LYS B HA   3  
ATOM 5958  H HB2  . LYS B 1 33 ? 2.820   -4.549  4.222   1.00 0.55 ? 33 LYS B HB2  3  
ATOM 5959  H HB3  . LYS B 1 33 ? 3.577   -3.342  5.264   1.00 0.55 ? 33 LYS B HB3  3  
ATOM 5960  H HG2  . LYS B 1 33 ? 4.656   -5.501  6.387   1.00 0.55 ? 33 LYS B HG2  3  
ATOM 5961  H HG3  . LYS B 1 33 ? 4.347   -6.195  4.796   1.00 0.55 ? 33 LYS B HG3  3  
ATOM 5962  H HD2  . LYS B 1 33 ? 5.419   -3.773  4.116   1.00 0.55 ? 33 LYS B HD2  3  
ATOM 5963  H HD3  . LYS B 1 33 ? 6.300   -4.133  5.601   1.00 0.55 ? 33 LYS B HD3  3  
ATOM 5964  H HE2  . LYS B 1 33 ? 7.244   -6.083  4.726   1.00 0.55 ? 33 LYS B HE2  3  
ATOM 5965  H HE3  . LYS B 1 33 ? 5.980   -6.267  3.510   1.00 0.55 ? 33 LYS B HE3  3  
ATOM 5966  H HZ1  . LYS B 1 33 ? 7.815   -3.954  3.471   1.00 0.55 ? 33 LYS B HZ1  3  
ATOM 5967  H HZ2  . LYS B 1 33 ? 8.252   -5.431  2.756   1.00 0.55 ? 33 LYS B HZ2  3  
ATOM 5968  H HZ3  . LYS B 1 33 ? 6.883   -4.590  2.205   1.00 0.55 ? 33 LYS B HZ3  3  
ATOM 5969  N N    . CYS B 1 34 ? -0.071  -4.177  6.688   1.00 0.46 ? 34 CYS B N    3  
ATOM 5970  C CA   . CYS B 1 34 ? -1.291  -3.328  6.585   1.00 0.46 ? 34 CYS B CA   3  
ATOM 5971  C C    . CYS B 1 34 ? -2.066  -3.386  7.903   1.00 0.46 ? 34 CYS B C    3  
ATOM 5972  O O    . CYS B 1 34 ? -1.861  -4.264  8.716   1.00 0.46 ? 34 CYS B O    3  
ATOM 5973  C CB   . CYS B 1 34 ? -2.177  -3.846  5.451   1.00 0.46 ? 34 CYS B CB   3  
ATOM 5974  S SG   . CYS B 1 34 ? -1.139  -4.378  4.067   1.00 0.46 ? 34 CYS B SG   3  
ATOM 5975  H H    . CYS B 1 34 ? -0.111  -5.037  7.156   1.00 0.46 ? 34 CYS B H    3  
ATOM 5976  H HA   . CYS B 1 34 ? -1.004  -2.307  6.380   1.00 0.46 ? 34 CYS B HA   3  
ATOM 5977  H HB2  . CYS B 1 34 ? -2.762  -4.681  5.804   1.00 0.46 ? 34 CYS B HB2  3  
ATOM 5978  H HB3  . CYS B 1 34 ? -2.839  -3.058  5.122   1.00 0.46 ? 34 CYS B HB3  3  
ATOM 5979  N N    . SER B 1 35 ? -2.956  -2.455  8.119   1.00 0.42 ? 35 SER B N    3  
ATOM 5980  C CA   . SER B 1 35 ? -3.744  -2.459  9.384   1.00 0.42 ? 35 SER B CA   3  
ATOM 5981  C C    . SER B 1 35 ? -4.658  -3.686  9.409   1.00 0.42 ? 35 SER B C    3  
ATOM 5982  O O    . SER B 1 35 ? -4.883  -4.284  10.442  1.00 0.42 ? 35 SER B O    3  
ATOM 5983  C CB   . SER B 1 35 ? -4.591  -1.189  9.460   1.00 0.42 ? 35 SER B CB   3  
ATOM 5984  O OG   . SER B 1 35 ? -3.819  -0.082  9.013   1.00 0.42 ? 35 SER B OG   3  
ATOM 5985  H H    . SER B 1 35 ? -3.106  -1.756  7.450   1.00 0.42 ? 35 SER B H    3  
ATOM 5986  H HA   . SER B 1 35 ? -3.070  -2.495  10.228  1.00 0.42 ? 35 SER B HA   3  
ATOM 5987  H HB2  . SER B 1 35 ? -5.458  -1.294  8.830   1.00 0.42 ? 35 SER B HB2  3  
ATOM 5988  H HB3  . SER B 1 35 ? -4.909  -1.031  10.482  1.00 0.42 ? 35 SER B HB3  3  
ATOM 5989  H HG   . SER B 1 35 ? -3.334  0.264   9.765   1.00 0.42 ? 35 SER B HG   3  
ATOM 5990  N N    . ASN B 1 36 ? -5.189  -4.063  8.278   1.00 0.38 ? 36 ASN B N    3  
ATOM 5991  C CA   . ASN B 1 36 ? -6.088  -5.251  8.236   1.00 0.38 ? 36 ASN B CA   3  
ATOM 5992  C C    . ASN B 1 36 ? -5.977  -5.927  6.866   1.00 0.38 ? 36 ASN B C    3  
ATOM 5993  O O    . ASN B 1 36 ? -5.659  -5.286  5.885   1.00 0.38 ? 36 ASN B O    3  
ATOM 5994  C CB   . ASN B 1 36 ? -7.533  -4.803  8.470   1.00 0.38 ? 36 ASN B CB   3  
ATOM 5995  C CG   . ASN B 1 36 ? -7.982  -3.906  7.316   1.00 0.38 ? 36 ASN B CG   3  
ATOM 5996  O OD1  . ASN B 1 36 ? -8.662  -4.352  6.412   1.00 0.38 ? 36 ASN B OD1  3  
ATOM 5997  N ND2  . ASN B 1 36 ? -7.630  -2.649  7.307   1.00 0.38 ? 36 ASN B ND2  3  
ATOM 5998  H H    . ASN B 1 36 ? -4.994  -3.567  7.456   1.00 0.38 ? 36 ASN B H    3  
ATOM 5999  H HA   . ASN B 1 36 ? -5.798  -5.949  9.007   1.00 0.38 ? 36 ASN B HA   3  
ATOM 6000  H HB2  . ASN B 1 36 ? -8.174  -5.671  8.522   1.00 0.38 ? 36 ASN B HB2  3  
ATOM 6001  H HB3  . ASN B 1 36 ? -7.594  -4.253  9.396   1.00 0.38 ? 36 ASN B HB3  3  
ATOM 6002  H HD21 . ASN B 1 36 ? -7.081  -2.289  8.036   1.00 0.38 ? 36 ASN B HD21 3  
ATOM 6003  H HD22 . ASN B 1 36 ? -7.912  -2.065  6.572   1.00 0.38 ? 36 ASN B HD22 3  
ATOM 6004  N N    . PRO B 1 37 ? -6.247  -7.207  6.844   1.00 0.37 ? 37 PRO B N    3  
ATOM 6005  C CA   . PRO B 1 37 ? -6.190  -8.010  5.610   1.00 0.37 ? 37 PRO B CA   3  
ATOM 6006  C C    . PRO B 1 37 ? -7.440  -7.768  4.759   1.00 0.37 ? 37 PRO B C    3  
ATOM 6007  O O    . PRO B 1 37 ? -8.552  -7.812  5.247   1.00 0.37 ? 37 PRO B O    3  
ATOM 6008  C CB   . PRO B 1 37 ? -6.147  -9.452  6.122   1.00 0.37 ? 37 PRO B CB   3  
ATOM 6009  C CG   . PRO B 1 37 ? -6.745  -9.427  7.549   1.00 0.37 ? 37 PRO B CG   3  
ATOM 6010  C CD   . PRO B 1 37 ? -6.634  -7.973  8.047   1.00 0.37 ? 37 PRO B CD   3  
ATOM 6011  H HA   . PRO B 1 37 ? -5.296  -7.789  5.050   1.00 0.37 ? 37 PRO B HA   3  
ATOM 6012  H HB2  . PRO B 1 37 ? -6.738  -10.090 5.478   1.00 0.37 ? 37 PRO B HB2  3  
ATOM 6013  H HB3  . PRO B 1 37 ? -5.128  -9.803  6.161   1.00 0.37 ? 37 PRO B HB3  3  
ATOM 6014  H HG2  . PRO B 1 37 ? -7.783  -9.732  7.519   1.00 0.37 ? 37 PRO B HG2  3  
ATOM 6015  H HG3  . PRO B 1 37 ? -6.184  -10.078 8.199   1.00 0.37 ? 37 PRO B HG3  3  
ATOM 6016  H HD2  . PRO B 1 37 ? -7.587  -7.631  8.428   1.00 0.37 ? 37 PRO B HD2  3  
ATOM 6017  H HD3  . PRO B 1 37 ? -5.870  -7.890  8.804   1.00 0.37 ? 37 PRO B HD3  3  
ATOM 6018  N N    . ALA B 1 38 ? -7.267  -7.511  3.491   1.00 0.33 ? 38 ALA B N    3  
ATOM 6019  C CA   . ALA B 1 38 ? -8.447  -7.266  2.614   1.00 0.33 ? 38 ALA B CA   3  
ATOM 6020  C C    . ALA B 1 38 ? -8.130  -7.720  1.188   1.00 0.33 ? 38 ALA B C    3  
ATOM 6021  O O    . ALA B 1 38 ? -7.013  -8.082  0.875   1.00 0.33 ? 38 ALA B O    3  
ATOM 6022  C CB   . ALA B 1 38 ? -8.779  -5.773  2.613   1.00 0.33 ? 38 ALA B CB   3  
ATOM 6023  H H    . ALA B 1 38 ? -6.362  -7.479  3.116   1.00 0.33 ? 38 ALA B H    3  
ATOM 6024  H HA   . ALA B 1 38 ? -9.295  -7.822  2.989   1.00 0.33 ? 38 ALA B HA   3  
ATOM 6025  H HB1  . ALA B 1 38 ? -7.873  -5.203  2.465   1.00 0.33 ? 38 ALA B HB1  3  
ATOM 6026  H HB2  . ALA B 1 38 ? -9.473  -5.559  1.814   1.00 0.33 ? 38 ALA B HB2  3  
ATOM 6027  H HB3  . ALA B 1 38 ? -9.224  -5.502  3.558   1.00 0.33 ? 38 ALA B HB3  3  
ATOM 6028  N N    . VAL B 1 39 ? -9.105  -7.703  0.320   1.00 0.30 ? 39 VAL B N    3  
ATOM 6029  C CA   . VAL B 1 39 ? -8.860  -8.132  -1.086  1.00 0.30 ? 39 VAL B CA   3  
ATOM 6030  C C    . VAL B 1 39 ? -8.613  -6.900  -1.959  1.00 0.30 ? 39 VAL B C    3  
ATOM 6031  O O    . VAL B 1 39 ? -8.870  -5.782  -1.558  1.00 0.30 ? 39 VAL B O    3  
ATOM 6032  C CB   . VAL B 1 39 ? -10.081 -8.896  -1.606  1.00 0.30 ? 39 VAL B CB   3  
ATOM 6033  C CG1  . VAL B 1 39 ? -9.990  -9.041  -3.127  1.00 0.30 ? 39 VAL B CG1  3  
ATOM 6034  C CG2  . VAL B 1 39 ? -10.121 -10.286 -0.967  1.00 0.30 ? 39 VAL B CG2  3  
ATOM 6035  H H    . VAL B 1 39 ? -9.999  -7.408  0.593   1.00 0.30 ? 39 VAL B H    3  
ATOM 6036  H HA   . VAL B 1 39 ? -7.992  -8.776  -1.119  1.00 0.30 ? 39 VAL B HA   3  
ATOM 6037  H HB   . VAL B 1 39 ? -10.980 -8.354  -1.350  1.00 0.30 ? 39 VAL B HB   3  
ATOM 6038  H HG11 . VAL B 1 39 ? -9.049  -9.502  -3.389  1.00 0.30 ? 39 VAL B HG11 3  
ATOM 6039  H HG12 . VAL B 1 39 ? -10.803 -9.658  -3.479  1.00 0.30 ? 39 VAL B HG12 3  
ATOM 6040  H HG13 . VAL B 1 39 ? -10.053 -8.065  -3.585  1.00 0.30 ? 39 VAL B HG13 3  
ATOM 6041  H HG21 . VAL B 1 39 ? -9.496  -10.295 -0.086  1.00 0.30 ? 39 VAL B HG21 3  
ATOM 6042  H HG22 . VAL B 1 39 ? -11.137 -10.525 -0.690  1.00 0.30 ? 39 VAL B HG22 3  
ATOM 6043  H HG23 . VAL B 1 39 ? -9.759  -11.017 -1.674  1.00 0.30 ? 39 VAL B HG23 3  
ATOM 6044  N N    . VAL B 1 40 ? -8.115  -7.097  -3.149  1.00 0.33 ? 40 VAL B N    3  
ATOM 6045  C CA   . VAL B 1 40 ? -7.851  -5.938  -4.047  1.00 0.33 ? 40 VAL B CA   3  
ATOM 6046  C C    . VAL B 1 40 ? -8.125  -6.349  -5.497  1.00 0.33 ? 40 VAL B C    3  
ATOM 6047  O O    . VAL B 1 40 ? -7.446  -7.188  -6.054  1.00 0.33 ? 40 VAL B O    3  
ATOM 6048  C CB   . VAL B 1 40 ? -6.388  -5.509  -3.902  1.00 0.33 ? 40 VAL B CB   3  
ATOM 6049  C CG1  . VAL B 1 40 ? -6.009  -4.570  -5.049  1.00 0.33 ? 40 VAL B CG1  3  
ATOM 6050  C CG2  . VAL B 1 40 ? -6.202  -4.783  -2.568  1.00 0.33 ? 40 VAL B CG2  3  
ATOM 6051  H H    . VAL B 1 40 ? -7.916  -8.006  -3.452  1.00 0.33 ? 40 VAL B H    3  
ATOM 6052  H HA   . VAL B 1 40 ? -8.497  -5.116  -3.778  1.00 0.33 ? 40 VAL B HA   3  
ATOM 6053  H HB   . VAL B 1 40 ? -5.754  -6.383  -3.930  1.00 0.33 ? 40 VAL B HB   3  
ATOM 6054  H HG11 . VAL B 1 40 ? -6.802  -3.852  -5.203  1.00 0.33 ? 40 VAL B HG11 3  
ATOM 6055  H HG12 . VAL B 1 40 ? -5.096  -4.049  -4.800  1.00 0.33 ? 40 VAL B HG12 3  
ATOM 6056  H HG13 . VAL B 1 40 ? -5.863  -5.144  -5.951  1.00 0.33 ? 40 VAL B HG13 3  
ATOM 6057  H HG21 . VAL B 1 40 ? -6.672  -5.354  -1.780  1.00 0.33 ? 40 VAL B HG21 3  
ATOM 6058  H HG22 . VAL B 1 40 ? -5.148  -4.680  -2.358  1.00 0.33 ? 40 VAL B HG22 3  
ATOM 6059  H HG23 . VAL B 1 40 ? -6.657  -3.805  -2.624  1.00 0.33 ? 40 VAL B HG23 3  
ATOM 6060  N N    . PHE B 1 41 ? -9.118  -5.765  -6.111  1.00 0.37 ? 41 PHE B N    3  
ATOM 6061  C CA   . PHE B 1 41 ? -9.435  -6.126  -7.522  1.00 0.37 ? 41 PHE B CA   3  
ATOM 6062  C C    . PHE B 1 41 ? -8.646  -5.222  -8.472  1.00 0.37 ? 41 PHE B C    3  
ATOM 6063  O O    . PHE B 1 41 ? -8.312  -4.101  -8.143  1.00 0.37 ? 41 PHE B O    3  
ATOM 6064  C CB   . PHE B 1 41 ? -10.932 -5.943  -7.770  1.00 0.37 ? 41 PHE B CB   3  
ATOM 6065  C CG   . PHE B 1 41 ? -11.686 -7.119  -7.196  1.00 0.37 ? 41 PHE B CG   3  
ATOM 6066  C CD1  . PHE B 1 41 ? -11.802 -8.304  -7.932  1.00 0.37 ? 41 PHE B CD1  3  
ATOM 6067  C CD2  . PHE B 1 41 ? -12.270 -7.023  -5.927  1.00 0.37 ? 41 PHE B CD2  3  
ATOM 6068  C CE1  . PHE B 1 41 ? -12.499 -9.394  -7.399  1.00 0.37 ? 41 PHE B CE1  3  
ATOM 6069  C CE2  . PHE B 1 41 ? -12.968 -8.114  -5.394  1.00 0.37 ? 41 PHE B CE2  3  
ATOM 6070  C CZ   . PHE B 1 41 ? -13.083 -9.299  -6.130  1.00 0.37 ? 41 PHE B CZ   3  
ATOM 6071  H H    . PHE B 1 41 ? -9.656  -5.092  -5.645  1.00 0.37 ? 41 PHE B H    3  
ATOM 6072  H HA   . PHE B 1 41 ? -9.163  -7.157  -7.699  1.00 0.37 ? 41 PHE B HA   3  
ATOM 6073  H HB2  . PHE B 1 41 ? -11.267 -5.033  -7.295  1.00 0.37 ? 41 PHE B HB2  3  
ATOM 6074  H HB3  . PHE B 1 41 ? -11.117 -5.883  -8.833  1.00 0.37 ? 41 PHE B HB3  3  
ATOM 6075  H HD1  . PHE B 1 41 ? -11.351 -8.378  -8.911  1.00 0.37 ? 41 PHE B HD1  3  
ATOM 6076  H HD2  . PHE B 1 41 ? -12.180 -6.109  -5.359  1.00 0.37 ? 41 PHE B HD2  3  
ATOM 6077  H HE1  . PHE B 1 41 ? -12.589 -10.309 -7.967  1.00 0.37 ? 41 PHE B HE1  3  
ATOM 6078  H HE2  . PHE B 1 41 ? -13.418 -8.040  -4.414  1.00 0.37 ? 41 PHE B HE2  3  
ATOM 6079  H HZ   . PHE B 1 41 ? -13.622 -10.140 -5.719  1.00 0.37 ? 41 PHE B HZ   3  
ATOM 6080  N N    . VAL B 1 42 ? -8.346  -5.701  -9.647  1.00 0.46 ? 42 VAL B N    3  
ATOM 6081  C CA   . VAL B 1 42 ? -7.579  -4.871  -10.618 1.00 0.46 ? 42 VAL B CA   3  
ATOM 6082  C C    . VAL B 1 42 ? -8.222  -4.986  -12.002 1.00 0.46 ? 42 VAL B C    3  
ATOM 6083  O O    . VAL B 1 42 ? -8.340  -6.062  -12.555 1.00 0.46 ? 42 VAL B O    3  
ATOM 6084  C CB   . VAL B 1 42 ? -6.134  -5.365  -10.684 1.00 0.46 ? 42 VAL B CB   3  
ATOM 6085  C CG1  . VAL B 1 42 ? -5.285  -4.361  -11.466 1.00 0.46 ? 42 VAL B CG1  3  
ATOM 6086  C CG2  . VAL B 1 42 ? -5.578  -5.504  -9.264  1.00 0.46 ? 42 VAL B CG2  3  
ATOM 6087  H H    . VAL B 1 42 ? -8.625  -6.608  -9.892  1.00 0.46 ? 42 VAL B H    3  
ATOM 6088  H HA   . VAL B 1 42 ? -7.594  -3.839  -10.300 1.00 0.46 ? 42 VAL B HA   3  
ATOM 6089  H HB   . VAL B 1 42 ? -6.104  -6.325  -11.180 1.00 0.46 ? 42 VAL B HB   3  
ATOM 6090  H HG11 . VAL B 1 42 ? -5.706  -3.372  -11.356 1.00 0.46 ? 42 VAL B HG11 3  
ATOM 6091  H HG12 . VAL B 1 42 ? -4.276  -4.367  -11.083 1.00 0.46 ? 42 VAL B HG12 3  
ATOM 6092  H HG13 . VAL B 1 42 ? -5.276  -4.634  -12.511 1.00 0.46 ? 42 VAL B HG13 3  
ATOM 6093  H HG21 . VAL B 1 42 ? -6.258  -5.040  -8.565  1.00 0.46 ? 42 VAL B HG21 3  
ATOM 6094  H HG22 . VAL B 1 42 ? -5.470  -6.550  -9.021  1.00 0.46 ? 42 VAL B HG22 3  
ATOM 6095  H HG23 . VAL B 1 42 ? -4.615  -5.019  -9.206  1.00 0.46 ? 42 VAL B HG23 3  
ATOM 6096  N N    . THR B 1 43 ? -8.637  -3.885  -12.567 1.00 0.54 ? 43 THR B N    3  
ATOM 6097  C CA   . THR B 1 43 ? -9.271  -3.932  -13.915 1.00 0.54 ? 43 THR B CA   3  
ATOM 6098  C C    . THR B 1 43 ? -8.196  -3.779  -14.991 1.00 0.54 ? 43 THR B C    3  
ATOM 6099  O O    . THR B 1 43 ? -7.063  -3.446  -14.709 1.00 0.54 ? 43 THR B O    3  
ATOM 6100  C CB   . THR B 1 43 ? -10.285 -2.792  -14.040 1.00 0.54 ? 43 THR B CB   3  
ATOM 6101  O OG1  . THR B 1 43 ? -9.609  -1.546  -13.934 1.00 0.54 ? 43 THR B OG1  3  
ATOM 6102  C CG2  . THR B 1 43 ? -11.327 -2.906  -12.927 1.00 0.54 ? 43 THR B CG2  3  
ATOM 6103  H H    . THR B 1 43 ? -8.532  -3.028  -12.105 1.00 0.54 ? 43 THR B H    3  
ATOM 6104  H HA   . THR B 1 43 ? -9.777  -4.878  -14.041 1.00 0.54 ? 43 THR B HA   3  
ATOM 6105  H HB   . THR B 1 43 ? -10.779 -2.853  -14.998 1.00 0.54 ? 43 THR B HB   3  
ATOM 6106  H HG1  . THR B 1 43 ? -10.260 -0.846  -14.023 1.00 0.54 ? 43 THR B HG1  3  
ATOM 6107  H HG21 . THR B 1 43 ? -11.180 -3.833  -12.391 1.00 0.54 ? 43 THR B HG21 3  
ATOM 6108  H HG22 . THR B 1 43 ? -11.218 -2.076  -12.245 1.00 0.54 ? 43 THR B HG22 3  
ATOM 6109  H HG23 . THR B 1 43 ? -12.317 -2.892  -13.357 1.00 0.54 ? 43 THR B HG23 3  
ATOM 6110  N N    . ARG B 1 44 ? -8.542  -4.021  -16.227 1.00 0.69 ? 44 ARG B N    3  
ATOM 6111  C CA   . ARG B 1 44 ? -7.539  -3.890  -17.320 1.00 0.69 ? 44 ARG B CA   3  
ATOM 6112  C C    . ARG B 1 44 ? -6.975  -2.467  -17.329 1.00 0.69 ? 44 ARG B C    3  
ATOM 6113  O O    . ARG B 1 44 ? -5.951  -2.199  -17.925 1.00 0.69 ? 44 ARG B O    3  
ATOM 6114  C CB   . ARG B 1 44 ? -8.209  -4.181  -18.665 1.00 0.69 ? 44 ARG B CB   3  
ATOM 6115  C CG   . ARG B 1 44 ? -8.948  -5.519  -18.589 1.00 0.69 ? 44 ARG B CG   3  
ATOM 6116  C CD   . ARG B 1 44 ? -9.107  -6.095  -19.996 1.00 0.69 ? 44 ARG B CD   3  
ATOM 6117  N NE   . ARG B 1 44 ? -9.505  -5.010  -20.936 1.00 0.69 ? 44 ARG B NE   3  
ATOM 6118  C CZ   . ARG B 1 44 ? -10.594 -5.128  -21.647 1.00 0.69 ? 44 ARG B CZ   3  
ATOM 6119  N NH1  . ARG B 1 44 ? -10.797 -6.207  -22.353 1.00 0.69 ? 44 ARG B NH1  3  
ATOM 6120  N NH2  . ARG B 1 44 ? -11.478 -4.169  -21.651 1.00 0.69 ? 44 ARG B NH2  3  
ATOM 6121  H H    . ARG B 1 44 ? -9.461  -4.288  -16.435 1.00 0.69 ? 44 ARG B H    3  
ATOM 6122  H HA   . ARG B 1 44 ? -6.736  -4.593  -17.160 1.00 0.69 ? 44 ARG B HA   3  
ATOM 6123  H HB2  . ARG B 1 44 ? -8.913  -3.392  -18.894 1.00 0.69 ? 44 ARG B HB2  3  
ATOM 6124  H HB3  . ARG B 1 44 ? -7.459  -4.230  -19.439 1.00 0.69 ? 44 ARG B HB3  3  
ATOM 6125  H HG2  . ARG B 1 44 ? -8.381  -6.207  -17.978 1.00 0.69 ? 44 ARG B HG2  3  
ATOM 6126  H HG3  . ARG B 1 44 ? -9.923  -5.367  -18.151 1.00 0.69 ? 44 ARG B HG3  3  
ATOM 6127  H HD2  . ARG B 1 44 ? -8.169  -6.523  -20.319 1.00 0.69 ? 44 ARG B HD2  3  
ATOM 6128  H HD3  . ARG B 1 44 ? -9.869  -6.861  -19.988 1.00 0.69 ? 44 ARG B HD3  3  
ATOM 6129  H HE   . ARG B 1 44 ? -8.951  -4.206  -21.020 1.00 0.69 ? 44 ARG B HE   3  
ATOM 6130  H HH11 . ARG B 1 44 ? -10.120 -6.943  -22.349 1.00 0.69 ? 44 ARG B HH11 3  
ATOM 6131  H HH12 . ARG B 1 44 ? -11.631 -6.298  -22.897 1.00 0.69 ? 44 ARG B HH12 3  
ATOM 6132  H HH21 . ARG B 1 44 ? -11.322 -3.342  -21.110 1.00 0.69 ? 44 ARG B HH21 3  
ATOM 6133  H HH22 . ARG B 1 44 ? -12.311 -4.260  -22.196 1.00 0.69 ? 44 ARG B HH22 3  
ATOM 6134  N N    . LYS B 1 45 ? -7.636  -1.553  -16.673 1.00 0.66 ? 45 LYS B N    3  
ATOM 6135  C CA   . LYS B 1 45 ? -7.137  -0.149  -16.644 1.00 0.66 ? 45 LYS B CA   3  
ATOM 6136  C C    . LYS B 1 45 ? -6.197  0.033   -15.451 1.00 0.66 ? 45 LYS B C    3  
ATOM 6137  O O    . LYS B 1 45 ? -6.089  1.107   -14.892 1.00 0.66 ? 45 LYS B O    3  
ATOM 6138  C CB   . LYS B 1 45 ? -8.322  0.810   -16.512 1.00 0.66 ? 45 LYS B CB   3  
ATOM 6139  C CG   . LYS B 1 45 ? -8.818  1.205   -17.904 1.00 0.66 ? 45 LYS B CG   3  
ATOM 6140  C CD   . LYS B 1 45 ? -9.272  -0.045  -18.658 1.00 0.66 ? 45 LYS B CD   3  
ATOM 6141  C CE   . LYS B 1 45 ? -9.986  0.368   -19.947 1.00 0.66 ? 45 LYS B CE   3  
ATOM 6142  N NZ   . LYS B 1 45 ? -9.313  -0.269  -21.114 1.00 0.66 ? 45 LYS B NZ   3  
ATOM 6143  H H    . LYS B 1 45 ? -8.460  -1.789  -16.199 1.00 0.66 ? 45 LYS B H    3  
ATOM 6144  H HA   . LYS B 1 45 ? -6.604  0.062   -17.559 1.00 0.66 ? 45 LYS B HA   3  
ATOM 6145  H HB2  . LYS B 1 45 ? -9.119  0.324   -15.969 1.00 0.66 ? 45 LYS B HB2  3  
ATOM 6146  H HB3  . LYS B 1 45 ? -8.010  1.695   -15.978 1.00 0.66 ? 45 LYS B HB3  3  
ATOM 6147  H HG2  . LYS B 1 45 ? -9.647  1.892   -17.809 1.00 0.66 ? 45 LYS B HG2  3  
ATOM 6148  H HG3  . LYS B 1 45 ? -8.017  1.682   -18.449 1.00 0.66 ? 45 LYS B HG3  3  
ATOM 6149  H HD2  . LYS B 1 45 ? -8.412  -0.652  -18.901 1.00 0.66 ? 45 LYS B HD2  3  
ATOM 6150  H HD3  . LYS B 1 45 ? -9.950  -0.612  -18.040 1.00 0.66 ? 45 LYS B HD3  3  
ATOM 6151  H HE2  . LYS B 1 45 ? -11.017 0.046   -19.906 1.00 0.66 ? 45 LYS B HE2  3  
ATOM 6152  H HE3  . LYS B 1 45 ? -9.949  1.442   -20.052 1.00 0.66 ? 45 LYS B HE3  3  
ATOM 6153  H HZ1  . LYS B 1 45 ? -8.866  -1.158  -20.814 1.00 0.66 ? 45 LYS B HZ1  3  
ATOM 6154  H HZ2  . LYS B 1 45 ? -10.015 -0.468  -21.854 1.00 0.66 ? 45 LYS B HZ2  3  
ATOM 6155  H HZ3  . LYS B 1 45 ? -8.587  0.376   -21.488 1.00 0.66 ? 45 LYS B HZ3  3  
ATOM 6156  N N    . ASN B 1 46 ? -5.514  -1.006  -15.057 1.00 0.61 ? 46 ASN B N    3  
ATOM 6157  C CA   . ASN B 1 46 ? -4.582  -0.891  -13.901 1.00 0.61 ? 46 ASN B CA   3  
ATOM 6158  C C    . ASN B 1 46 ? -5.290  -0.186  -12.742 1.00 0.61 ? 46 ASN B C    3  
ATOM 6159  O O    . ASN B 1 46 ? -4.669  0.465   -11.926 1.00 0.61 ? 46 ASN B O    3  
ATOM 6160  C CB   . ASN B 1 46 ? -3.352  -0.081  -14.316 1.00 0.61 ? 46 ASN B CB   3  
ATOM 6161  C CG   . ASN B 1 46 ? -2.341  -0.060  -13.168 1.00 0.61 ? 46 ASN B CG   3  
ATOM 6162  O OD1  . ASN B 1 46 ? -1.712  -1.059  -12.881 1.00 0.61 ? 46 ASN B OD1  3  
ATOM 6163  N ND2  . ASN B 1 46 ? -2.158  1.042   -12.495 1.00 0.61 ? 46 ASN B ND2  3  
ATOM 6164  H H    . ASN B 1 46 ? -5.615  -1.863  -15.521 1.00 0.61 ? 46 ASN B H    3  
ATOM 6165  H HA   . ASN B 1 46 ? -4.273  -1.877  -13.586 1.00 0.61 ? 46 ASN B HA   3  
ATOM 6166  H HB2  . ASN B 1 46 ? -2.901  -0.532  -15.188 1.00 0.61 ? 46 ASN B HB2  3  
ATOM 6167  H HB3  . ASN B 1 46 ? -3.650  0.931   -14.548 1.00 0.61 ? 46 ASN B HB3  3  
ATOM 6168  H HD21 . ASN B 1 46 ? -2.665  1.847   -12.727 1.00 0.61 ? 46 ASN B HD21 3  
ATOM 6169  H HD22 . ASN B 1 46 ? -1.512  1.065   -11.759 1.00 0.61 ? 46 ASN B HD22 3  
ATOM 6170  N N    . ARG B 1 47 ? -6.587  -0.310  -12.665 1.00 0.52 ? 47 ARG B N    3  
ATOM 6171  C CA   . ARG B 1 47 ? -7.333  0.354   -11.559 1.00 0.52 ? 47 ARG B CA   3  
ATOM 6172  C C    . ARG B 1 47 ? -7.427  -0.598  -10.365 1.00 0.52 ? 47 ARG B C    3  
ATOM 6173  O O    . ARG B 1 47 ? -7.980  -1.675  -10.459 1.00 0.52 ? 47 ARG B O    3  
ATOM 6174  C CB   . ARG B 1 47 ? -8.742  0.713   -12.036 1.00 0.52 ? 47 ARG B CB   3  
ATOM 6175  C CG   . ARG B 1 47 ? -8.926  2.230   -11.988 1.00 0.52 ? 47 ARG B CG   3  
ATOM 6176  C CD   . ARG B 1 47 ? -9.860  2.667   -13.120 1.00 0.52 ? 47 ARG B CD   3  
ATOM 6177  N NE   . ARG B 1 47 ? -11.178 3.063   -12.550 1.00 0.52 ? 47 ARG B NE   3  
ATOM 6178  C CZ   . ARG B 1 47 ? -11.414 4.312   -12.257 1.00 0.52 ? 47 ARG B CZ   3  
ATOM 6179  N NH1  . ARG B 1 47 ? -11.127 4.768   -11.068 1.00 0.52 ? 47 ARG B NH1  3  
ATOM 6180  N NH2  . ARG B 1 47 ? -11.936 5.106   -13.151 1.00 0.52 ? 47 ARG B NH2  3  
ATOM 6181  H H    . ARG B 1 47 ? -7.070  -0.838  -13.333 1.00 0.52 ? 47 ARG B H    3  
ATOM 6182  H HA   . ARG B 1 47 ? -6.814  1.253   -11.263 1.00 0.52 ? 47 ARG B HA   3  
ATOM 6183  H HB2  . ARG B 1 47 ? -8.877  0.364   -13.050 1.00 0.52 ? 47 ARG B HB2  3  
ATOM 6184  H HB3  . ARG B 1 47 ? -9.471  0.243   -11.394 1.00 0.52 ? 47 ARG B HB3  3  
ATOM 6185  H HG2  . ARG B 1 47 ? -9.356  2.511   -11.038 1.00 0.52 ? 47 ARG B HG2  3  
ATOM 6186  H HG3  . ARG B 1 47 ? -7.969  2.714   -12.108 1.00 0.52 ? 47 ARG B HG3  3  
ATOM 6187  H HD2  . ARG B 1 47 ? -9.425  3.509   -13.640 1.00 0.52 ? 47 ARG B HD2  3  
ATOM 6188  H HD3  . ARG B 1 47 ? -9.996  1.849   -13.810 1.00 0.52 ? 47 ARG B HD3  3  
ATOM 6189  H HE   . ARG B 1 47 ? -11.870 2.385   -12.398 1.00 0.52 ? 47 ARG B HE   3  
ATOM 6190  H HH11 . ARG B 1 47 ? -10.727 4.159   -10.382 1.00 0.52 ? 47 ARG B HH11 3  
ATOM 6191  H HH12 . ARG B 1 47 ? -11.308 5.725   -10.842 1.00 0.52 ? 47 ARG B HH12 3  
ATOM 6192  H HH21 . ARG B 1 47 ? -12.156 4.757   -14.062 1.00 0.52 ? 47 ARG B HH21 3  
ATOM 6193  H HH22 . ARG B 1 47 ? -12.118 6.064   -12.925 1.00 0.52 ? 47 ARG B HH22 3  
ATOM 6194  N N    . GLN B 1 48 ? -6.890  -0.209  -9.240  1.00 0.45 ? 48 GLN B N    3  
ATOM 6195  C CA   . GLN B 1 48 ? -6.949  -1.092  -8.041  1.00 0.45 ? 48 GLN B CA   3  
ATOM 6196  C C    . GLN B 1 48 ? -8.170  -0.725  -7.196  1.00 0.45 ? 48 GLN B C    3  
ATOM 6197  O O    . GLN B 1 48 ? -8.553  0.425   -7.107  1.00 0.45 ? 48 GLN B O    3  
ATOM 6198  C CB   . GLN B 1 48 ? -5.678  -0.908  -7.209  1.00 0.45 ? 48 GLN B CB   3  
ATOM 6199  C CG   . GLN B 1 48 ? -4.484  -0.691  -8.141  1.00 0.45 ? 48 GLN B CG   3  
ATOM 6200  C CD   . GLN B 1 48 ? -4.243  -1.956  -8.966  1.00 0.45 ? 48 GLN B CD   3  
ATOM 6201  O OE1  . GLN B 1 48 ? -4.968  -2.922  -8.844  1.00 0.45 ? 48 GLN B OE1  3  
ATOM 6202  N NE2  . GLN B 1 48 ? -3.245  -1.991  -9.807  1.00 0.45 ? 48 GLN B NE2  3  
ATOM 6203  H H    . GLN B 1 48 ? -6.449  0.664   -9.185  1.00 0.45 ? 48 GLN B H    3  
ATOM 6204  H HA   . GLN B 1 48 ? -7.026  -2.122  -8.357  1.00 0.45 ? 48 GLN B HA   3  
ATOM 6205  H HB2  . GLN B 1 48 ? -5.793  -0.049  -6.563  1.00 0.45 ? 48 GLN B HB2  3  
ATOM 6206  H HB3  . GLN B 1 48 ? -5.509  -1.789  -6.610  1.00 0.45 ? 48 GLN B HB3  3  
ATOM 6207  H HG2  . GLN B 1 48 ? -4.691  0.138   -8.803  1.00 0.45 ? 48 GLN B HG2  3  
ATOM 6208  H HG3  . GLN B 1 48 ? -3.604  -0.472  -7.554  1.00 0.45 ? 48 GLN B HG3  3  
ATOM 6209  H HE21 . GLN B 1 48 ? -2.660  -1.211  -9.906  1.00 0.45 ? 48 GLN B HE21 3  
ATOM 6210  H HE22 . GLN B 1 48 ? -3.082  -2.797  -10.340 1.00 0.45 ? 48 GLN B HE22 3  
ATOM 6211  N N    . VAL B 1 49 ? -8.786  -1.694  -6.575  1.00 0.37 ? 49 VAL B N    3  
ATOM 6212  C CA   . VAL B 1 49 ? -9.981  -1.399  -5.735  1.00 0.37 ? 49 VAL B CA   3  
ATOM 6213  C C    . VAL B 1 49 ? -9.942  -2.262  -4.473  1.00 0.37 ? 49 VAL B C    3  
ATOM 6214  O O    . VAL B 1 49 ? -9.419  -3.358  -4.475  1.00 0.37 ? 49 VAL B O    3  
ATOM 6215  C CB   . VAL B 1 49 ? -11.251 -1.714  -6.529  1.00 0.37 ? 49 VAL B CB   3  
ATOM 6216  C CG1  . VAL B 1 49 ? -12.461 -1.668  -5.594  1.00 0.37 ? 49 VAL B CG1  3  
ATOM 6217  C CG2  . VAL B 1 49 ? -11.426 -0.676  -7.640  1.00 0.37 ? 49 VAL B CG2  3  
ATOM 6218  H H    . VAL B 1 49 ? -8.461  -2.614  -6.660  1.00 0.37 ? 49 VAL B H    3  
ATOM 6219  H HA   . VAL B 1 49 ? -9.979  -0.356  -5.458  1.00 0.37 ? 49 VAL B HA   3  
ATOM 6220  H HB   . VAL B 1 49 ? -11.168 -2.699  -6.962  1.00 0.37 ? 49 VAL B HB   3  
ATOM 6221  H HG11 . VAL B 1 49 ? -12.285 -0.946  -4.811  1.00 0.37 ? 49 VAL B HG11 3  
ATOM 6222  H HG12 . VAL B 1 49 ? -13.338 -1.382  -6.156  1.00 0.37 ? 49 VAL B HG12 3  
ATOM 6223  H HG13 . VAL B 1 49 ? -12.615 -2.643  -5.157  1.00 0.37 ? 49 VAL B HG13 3  
ATOM 6224  H HG21 . VAL B 1 49 ? -10.495 -0.559  -8.173  1.00 0.37 ? 49 VAL B HG21 3  
ATOM 6225  H HG22 . VAL B 1 49 ? -12.193 -1.009  -8.324  1.00 0.37 ? 49 VAL B HG22 3  
ATOM 6226  H HG23 . VAL B 1 49 ? -11.715 0.269   -7.207  1.00 0.37 ? 49 VAL B HG23 3  
ATOM 6227  N N    . CYS B 1 50 ? -10.490 -1.776  -3.393  1.00 0.29 ? 50 CYS B N    3  
ATOM 6228  C CA   . CYS B 1 50 ? -10.483 -2.570  -2.132  1.00 0.29 ? 50 CYS B CA   3  
ATOM 6229  C C    . CYS B 1 50 ? -11.825 -3.288  -1.974  1.00 0.29 ? 50 CYS B C    3  
ATOM 6230  O O    . CYS B 1 50 ? -12.875 -2.682  -2.043  1.00 0.29 ? 50 CYS B O    3  
ATOM 6231  C CB   . CYS B 1 50 ? -10.260 -1.636  -0.941  1.00 0.29 ? 50 CYS B CB   3  
ATOM 6232  S SG   . CYS B 1 50 ? -8.770  -0.646  -1.223  1.00 0.29 ? 50 CYS B SG   3  
ATOM 6233  H H    . CYS B 1 50 ? -10.907 -0.890  -3.411  1.00 0.29 ? 50 CYS B H    3  
ATOM 6234  H HA   . CYS B 1 50 ? -9.687  -3.301  -2.171  1.00 0.29 ? 50 CYS B HA   3  
ATOM 6235  H HB2  . CYS B 1 50 ? -11.112 -0.981  -0.834  1.00 0.29 ? 50 CYS B HB2  3  
ATOM 6236  H HB3  . CYS B 1 50 ? -10.139 -2.221  -0.043  1.00 0.29 ? 50 CYS B HB3  3  
ATOM 6237  N N    . ALA B 1 51 ? -11.799 -4.575  -1.762  1.00 0.23 ? 51 ALA B N    3  
ATOM 6238  C CA   . ALA B 1 51 ? -13.074 -5.330  -1.599  1.00 0.23 ? 51 ALA B CA   3  
ATOM 6239  C C    . ALA B 1 51 ? -12.968 -6.256  -0.387  1.00 0.23 ? 51 ALA B C    3  
ATOM 6240  O O    . ALA B 1 51 ? -11.964 -6.909  -0.178  1.00 0.23 ? 51 ALA B O    3  
ATOM 6241  C CB   . ALA B 1 51 ? -13.337 -6.162  -2.855  1.00 0.23 ? 51 ALA B CB   3  
ATOM 6242  H H    . ALA B 1 51 ? -10.941 -5.046  -1.709  1.00 0.23 ? 51 ALA B H    3  
ATOM 6243  H HA   . ALA B 1 51 ? -13.888 -4.635  -1.451  1.00 0.23 ? 51 ALA B HA   3  
ATOM 6244  H HB1  . ALA B 1 51 ? -13.167 -5.555  -3.732  1.00 0.23 ? 51 ALA B HB1  3  
ATOM 6245  H HB2  . ALA B 1 51 ? -12.670 -7.012  -2.871  1.00 0.23 ? 51 ALA B HB2  3  
ATOM 6246  H HB3  . ALA B 1 51 ? -14.361 -6.508  -2.850  1.00 0.23 ? 51 ALA B HB3  3  
ATOM 6247  N N    . ASN B 1 52 ? -13.996 -6.319  0.415   1.00 0.26 ? 52 ASN B N    3  
ATOM 6248  C CA   . ASN B 1 52 ? -13.953 -7.205  1.612   1.00 0.26 ? 52 ASN B CA   3  
ATOM 6249  C C    . ASN B 1 52 ? -14.525 -8.579  1.248   1.00 0.26 ? 52 ASN B C    3  
ATOM 6250  O O    . ASN B 1 52 ? -15.463 -8.672  0.481   1.00 0.26 ? 52 ASN B O    3  
ATOM 6251  C CB   . ASN B 1 52 ? -14.789 -6.583  2.734   1.00 0.26 ? 52 ASN B CB   3  
ATOM 6252  C CG   . ASN B 1 52 ? -14.923 -7.579  3.887   1.00 0.26 ? 52 ASN B CG   3  
ATOM 6253  O OD1  . ASN B 1 52 ? -15.335 -8.704  3.689   1.00 0.26 ? 52 ASN B OD1  3  
ATOM 6254  N ND2  . ASN B 1 52 ? -14.590 -7.211  5.094   1.00 0.26 ? 52 ASN B ND2  3  
ATOM 6255  H H    . ASN B 1 52 ? -14.796 -5.785  0.229   1.00 0.26 ? 52 ASN B H    3  
ATOM 6256  H HA   . ASN B 1 52 ? -12.930 -7.312  1.942   1.00 0.26 ? 52 ASN B HA   3  
ATOM 6257  H HB2  . ASN B 1 52 ? -14.303 -5.685  3.089   1.00 0.26 ? 52 ASN B HB2  3  
ATOM 6258  H HB3  . ASN B 1 52 ? -15.770 -6.337  2.357   1.00 0.26 ? 52 ASN B HB3  3  
ATOM 6259  H HD21 . ASN B 1 52 ? -14.257 -6.303  5.255   1.00 0.26 ? 52 ASN B HD21 3  
ATOM 6260  H HD22 . ASN B 1 52 ? -14.672 -7.841  5.839   1.00 0.26 ? 52 ASN B HD22 3  
ATOM 6261  N N    . PRO B 1 53 ? -13.940 -9.610  1.809   1.00 0.30 ? 53 PRO B N    3  
ATOM 6262  C CA   . PRO B 1 53 ? -14.368 -11.000 1.565   1.00 0.30 ? 53 PRO B CA   3  
ATOM 6263  C C    . PRO B 1 53 ? -15.593 -11.350 2.419   1.00 0.30 ? 53 PRO B C    3  
ATOM 6264  O O    . PRO B 1 53 ? -15.676 -12.421 2.986   1.00 0.30 ? 53 PRO B O    3  
ATOM 6265  C CB   . PRO B 1 53 ? -13.155 -11.826 2.001   1.00 0.30 ? 53 PRO B CB   3  
ATOM 6266  C CG   . PRO B 1 53 ? -12.352 -10.941 2.984   1.00 0.30 ? 53 PRO B CG   3  
ATOM 6267  C CD   . PRO B 1 53 ? -12.792 -9.486  2.732   1.00 0.30 ? 53 PRO B CD   3  
ATOM 6268  H HA   . PRO B 1 53 ? -14.568 -11.161 0.519   1.00 0.30 ? 53 PRO B HA   3  
ATOM 6269  H HB2  . PRO B 1 53 ? -13.484 -12.732 2.494   1.00 0.30 ? 53 PRO B HB2  3  
ATOM 6270  H HB3  . PRO B 1 53 ? -12.543 -12.068 1.147   1.00 0.30 ? 53 PRO B HB3  3  
ATOM 6271  H HG2  . PRO B 1 53 ? -12.574 -11.226 4.003   1.00 0.30 ? 53 PRO B HG2  3  
ATOM 6272  H HG3  . PRO B 1 53 ? -11.295 -11.039 2.793   1.00 0.30 ? 53 PRO B HG3  3  
ATOM 6273  H HD2  . PRO B 1 53 ? -13.096 -9.018  3.658   1.00 0.30 ? 53 PRO B HD2  3  
ATOM 6274  H HD3  . PRO B 1 53 ? -11.998 -8.925  2.264   1.00 0.30 ? 53 PRO B HD3  3  
ATOM 6275  N N    . GLU B 1 54 ? -16.543 -10.460 2.516   1.00 0.43 ? 54 GLU B N    3  
ATOM 6276  C CA   . GLU B 1 54 ? -17.755 -10.751 3.333   1.00 0.43 ? 54 GLU B CA   3  
ATOM 6277  C C    . GLU B 1 54 ? -19.004 -10.310 2.568   1.00 0.43 ? 54 GLU B C    3  
ATOM 6278  O O    . GLU B 1 54 ? -20.093 -10.276 3.106   1.00 0.43 ? 54 GLU B O    3  
ATOM 6279  C CB   . GLU B 1 54 ? -17.672 -9.989  4.657   1.00 0.43 ? 54 GLU B CB   3  
ATOM 6280  C CG   . GLU B 1 54 ? -16.654 -10.668 5.576   1.00 0.43 ? 54 GLU B CG   3  
ATOM 6281  C CD   . GLU B 1 54 ? -17.379 -11.292 6.768   1.00 0.43 ? 54 GLU B CD   3  
ATOM 6282  O OE1  . GLU B 1 54 ? -18.363 -11.980 6.546   1.00 0.43 ? 54 GLU B OE1  3  
ATOM 6283  O OE2  . GLU B 1 54 ? -16.938 -11.074 7.885   1.00 0.43 ? 54 GLU B OE2  3  
ATOM 6284  H H    . GLU B 1 54 ? -16.462 -9.602  2.053   1.00 0.43 ? 54 GLU B H    3  
ATOM 6285  H HA   . GLU B 1 54 ? -17.809 -11.812 3.531   1.00 0.43 ? 54 GLU B HA   3  
ATOM 6286  H HB2  . GLU B 1 54 ? -17.365 -8.971  4.468   1.00 0.43 ? 54 GLU B HB2  3  
ATOM 6287  H HB3  . GLU B 1 54 ? -18.641 -9.990  5.134   1.00 0.43 ? 54 GLU B HB3  3  
ATOM 6288  H HG2  . GLU B 1 54 ? -16.131 -11.438 5.027   1.00 0.43 ? 54 GLU B HG2  3  
ATOM 6289  H HG3  . GLU B 1 54 ? -15.945 -9.936  5.931   1.00 0.43 ? 54 GLU B HG3  3  
ATOM 6290  N N    . LYS B 1 55 ? -18.857 -9.973  1.315   1.00 0.47 ? 55 LYS B N    3  
ATOM 6291  C CA   . LYS B 1 55 ? -20.036 -9.534  0.518   1.00 0.47 ? 55 LYS B CA   3  
ATOM 6292  C C    . LYS B 1 55 ? -20.673 -10.748 -0.161  1.00 0.47 ? 55 LYS B C    3  
ATOM 6293  O O    . LYS B 1 55 ? -20.309 -11.878 0.097   1.00 0.47 ? 55 LYS B O    3  
ATOM 6294  C CB   . LYS B 1 55 ? -19.588 -8.531  -0.546  1.00 0.47 ? 55 LYS B CB   3  
ATOM 6295  C CG   . LYS B 1 55 ? -18.842 -7.375  0.123   1.00 0.47 ? 55 LYS B CG   3  
ATOM 6296  C CD   . LYS B 1 55 ? -19.836 -6.506  0.896   1.00 0.47 ? 55 LYS B CD   3  
ATOM 6297  C CE   . LYS B 1 55 ? -19.137 -5.887  2.108   1.00 0.47 ? 55 LYS B CE   3  
ATOM 6298  N NZ   . LYS B 1 55 ? -20.136 -5.149  2.934   1.00 0.47 ? 55 LYS B NZ   3  
ATOM 6299  H H    . LYS B 1 55 ? -17.970 -10.008 0.900   1.00 0.47 ? 55 LYS B H    3  
ATOM 6300  H HA   . LYS B 1 55 ? -20.759 -9.068  1.171   1.00 0.47 ? 55 LYS B HA   3  
ATOM 6301  H HB2  . LYS B 1 55 ? -18.934 -9.023  -1.251  1.00 0.47 ? 55 LYS B HB2  3  
ATOM 6302  H HB3  . LYS B 1 55 ? -20.453 -8.147  -1.066  1.00 0.47 ? 55 LYS B HB3  3  
ATOM 6303  H HG2  . LYS B 1 55 ? -18.102 -7.770  0.803   1.00 0.47 ? 55 LYS B HG2  3  
ATOM 6304  H HG3  . LYS B 1 55 ? -18.355 -6.776  -0.632  1.00 0.47 ? 55 LYS B HG3  3  
ATOM 6305  H HD2  . LYS B 1 55 ? -20.204 -5.720  0.252   1.00 0.47 ? 55 LYS B HD2  3  
ATOM 6306  H HD3  . LYS B 1 55 ? -20.662 -7.114  1.231   1.00 0.47 ? 55 LYS B HD3  3  
ATOM 6307  H HE2  . LYS B 1 55 ? -18.687 -6.669  2.703   1.00 0.47 ? 55 LYS B HE2  3  
ATOM 6308  H HE3  . LYS B 1 55 ? -18.371 -5.204  1.773   1.00 0.47 ? 55 LYS B HE3  3  
ATOM 6309  H HZ1  . LYS B 1 55 ? -21.075 -5.574  2.804   1.00 0.47 ? 55 LYS B HZ1  3  
ATOM 6310  H HZ2  . LYS B 1 55 ? -19.864 -5.205  3.936   1.00 0.47 ? 55 LYS B HZ2  3  
ATOM 6311  H HZ3  . LYS B 1 55 ? -20.163 -4.154  2.636   1.00 0.47 ? 55 LYS B HZ3  3  
ATOM 6312  N N    . LYS B 1 56 ? -21.621 -10.522 -1.029  1.00 0.58 ? 56 LYS B N    3  
ATOM 6313  C CA   . LYS B 1 56 ? -22.282 -11.663 -1.724  1.00 0.58 ? 56 LYS B CA   3  
ATOM 6314  C C    . LYS B 1 56 ? -21.721 -11.789 -3.142  1.00 0.58 ? 56 LYS B C    3  
ATOM 6315  O O    . LYS B 1 56 ? -21.906 -12.790 -3.806  1.00 0.58 ? 56 LYS B O    3  
ATOM 6316  C CB   . LYS B 1 56 ? -23.790 -11.413 -1.791  1.00 0.58 ? 56 LYS B CB   3  
ATOM 6317  C CG   . LYS B 1 56 ? -24.432 -12.406 -2.763  1.00 0.58 ? 56 LYS B CG   3  
ATOM 6318  C CD   . LYS B 1 56 ? -24.135 -13.835 -2.305  1.00 0.58 ? 56 LYS B CD   3  
ATOM 6319  C CE   . LYS B 1 56 ? -24.744 -14.065 -0.920  1.00 0.58 ? 56 LYS B CE   3  
ATOM 6320  N NZ   . LYS B 1 56 ? -25.273 -15.454 -0.834  1.00 0.58 ? 56 LYS B NZ   3  
ATOM 6321  H H    . LYS B 1 56 ? -21.899 -9.603  -1.222  1.00 0.58 ? 56 LYS B H    3  
ATOM 6322  H HA   . LYS B 1 56 ? -22.092 -12.576 -1.180  1.00 0.58 ? 56 LYS B HA   3  
ATOM 6323  H HB2  . LYS B 1 56 ? -24.220 -11.542 -0.808  1.00 0.58 ? 56 LYS B HB2  3  
ATOM 6324  H HB3  . LYS B 1 56 ? -23.973 -10.407 -2.135  1.00 0.58 ? 56 LYS B HB3  3  
ATOM 6325  H HG2  . LYS B 1 56 ? -25.501 -12.248 -2.785  1.00 0.58 ? 56 LYS B HG2  3  
ATOM 6326  H HG3  . LYS B 1 56 ? -24.025 -12.256 -3.752  1.00 0.58 ? 56 LYS B HG3  3  
ATOM 6327  H HD2  . LYS B 1 56 ? -24.563 -14.535 -3.008  1.00 0.58 ? 56 LYS B HD2  3  
ATOM 6328  H HD3  . LYS B 1 56 ? -23.067 -13.983 -2.255  1.00 0.58 ? 56 LYS B HD3  3  
ATOM 6329  H HE2  . LYS B 1 56 ? -23.984 -13.921 -0.165  1.00 0.58 ? 56 LYS B HE2  3  
ATOM 6330  H HE3  . LYS B 1 56 ? -25.548 -13.362 -0.759  1.00 0.58 ? 56 LYS B HE3  3  
ATOM 6331  H HZ1  . LYS B 1 56 ? -24.834 -16.040 -1.572  1.00 0.58 ? 56 LYS B HZ1  3  
ATOM 6332  H HZ2  . LYS B 1 56 ? -25.052 -15.853 0.102   1.00 0.58 ? 56 LYS B HZ2  3  
ATOM 6333  H HZ3  . LYS B 1 56 ? -26.304 -15.443 -0.971  1.00 0.58 ? 56 LYS B HZ3  3  
ATOM 6334  N N    . TRP B 1 57 ? -21.038 -10.782 -3.613  1.00 0.41 ? 57 TRP B N    3  
ATOM 6335  C CA   . TRP B 1 57 ? -20.468 -10.846 -4.988  1.00 0.41 ? 57 TRP B CA   3  
ATOM 6336  C C    . TRP B 1 57 ? -18.941 -10.900 -4.906  1.00 0.41 ? 57 TRP B C    3  
ATOM 6337  O O    . TRP B 1 57 ? -18.284 -11.451 -5.766  1.00 0.41 ? 57 TRP B O    3  
ATOM 6338  C CB   . TRP B 1 57 ? -20.894 -9.605  -5.774  1.00 0.41 ? 57 TRP B CB   3  
ATOM 6339  C CG   . TRP B 1 57 ? -20.381 -8.381  -5.087  1.00 0.41 ? 57 TRP B CG   3  
ATOM 6340  C CD1  . TRP B 1 57 ? -21.084 -7.634  -4.205  1.00 0.41 ? 57 TRP B CD1  3  
ATOM 6341  C CD2  . TRP B 1 57 ? -19.073 -7.752  -5.205  1.00 0.41 ? 57 TRP B CD2  3  
ATOM 6342  N NE1  . TRP B 1 57 ? -20.290 -6.585  -3.775  1.00 0.41 ? 57 TRP B NE1  3  
ATOM 6343  C CE2  . TRP B 1 57 ? -19.041 -6.616  -4.364  1.00 0.41 ? 57 TRP B CE2  3  
ATOM 6344  C CE3  . TRP B 1 57 ? -17.922 -8.055  -5.955  1.00 0.41 ? 57 TRP B CE3  3  
ATOM 6345  C CZ2  . TRP B 1 57 ? -17.907 -5.808  -4.268  1.00 0.41 ? 57 TRP B CZ2  3  
ATOM 6346  C CZ3  . TRP B 1 57 ? -16.779 -7.245  -5.861  1.00 0.41 ? 57 TRP B CZ3  3  
ATOM 6347  C CH2  . TRP B 1 57 ? -16.772 -6.123  -5.019  1.00 0.41 ? 57 TRP B CH2  3  
ATOM 6348  H H    . TRP B 1 57 ? -20.901 -9.983  -3.062  1.00 0.41 ? 57 TRP B H    3  
ATOM 6349  H HA   . TRP B 1 57 ? -20.832 -11.732 -5.488  1.00 0.41 ? 57 TRP B HA   3  
ATOM 6350  H HB2  . TRP B 1 57 ? -20.486 -9.655  -6.774  1.00 0.41 ? 57 TRP B HB2  3  
ATOM 6351  H HB3  . TRP B 1 57 ? -21.971 -9.564  -5.827  1.00 0.41 ? 57 TRP B HB3  3  
ATOM 6352  H HD1  . TRP B 1 57 ? -22.100 -7.824  -3.889  1.00 0.41 ? 57 TRP B HD1  3  
ATOM 6353  H HE1  . TRP B 1 57 ? -20.563 -5.897  -3.133  1.00 0.41 ? 57 TRP B HE1  3  
ATOM 6354  H HE3  . TRP B 1 57 ? -17.916 -8.916  -6.606  1.00 0.41 ? 57 TRP B HE3  3  
ATOM 6355  H HZ2  . TRP B 1 57 ? -17.907 -4.946  -3.618  1.00 0.41 ? 57 TRP B HZ2  3  
ATOM 6356  H HZ3  . TRP B 1 57 ? -15.900 -7.485  -6.441  1.00 0.41 ? 57 TRP B HZ3  3  
ATOM 6357  H HH2  . TRP B 1 57 ? -15.890 -5.503  -4.952  1.00 0.41 ? 57 TRP B HH2  3  
ATOM 6358  N N    . VAL B 1 58 ? -18.371 -10.331 -3.879  1.00 0.32 ? 58 VAL B N    3  
ATOM 6359  C CA   . VAL B 1 58 ? -16.887 -10.353 -3.747  1.00 0.32 ? 58 VAL B CA   3  
ATOM 6360  C C    . VAL B 1 58 ? -16.391 -11.798 -3.820  1.00 0.32 ? 58 VAL B C    3  
ATOM 6361  O O    . VAL B 1 58 ? -15.678 -12.175 -4.730  1.00 0.32 ? 58 VAL B O    3  
ATOM 6362  C CB   . VAL B 1 58 ? -16.485 -9.743  -2.402  1.00 0.32 ? 58 VAL B CB   3  
ATOM 6363  C CG1  . VAL B 1 58 ? -14.962 -9.760  -2.267  1.00 0.32 ? 58 VAL B CG1  3  
ATOM 6364  C CG2  . VAL B 1 58 ? -16.984 -8.298  -2.328  1.00 0.32 ? 58 VAL B CG2  3  
ATOM 6365  H H    . VAL B 1 58 ? -18.918 -9.892  -3.195  1.00 0.32 ? 58 VAL B H    3  
ATOM 6366  H HA   . VAL B 1 58 ? -16.445 -9.779  -4.548  1.00 0.32 ? 58 VAL B HA   3  
ATOM 6367  H HB   . VAL B 1 58 ? -16.924 -10.319 -1.600  1.00 0.32 ? 58 VAL B HB   3  
ATOM 6368  H HG11 . VAL B 1 58 ? -14.529 -10.221 -3.143  1.00 0.32 ? 58 VAL B HG11 3  
ATOM 6369  H HG12 . VAL B 1 58 ? -14.597 -8.748  -2.174  1.00 0.32 ? 58 VAL B HG12 3  
ATOM 6370  H HG13 . VAL B 1 58 ? -14.685 -10.326 -1.390  1.00 0.32 ? 58 VAL B HG13 3  
ATOM 6371  H HG21 . VAL B 1 58 ? -17.985 -8.242  -2.729  1.00 0.32 ? 58 VAL B HG21 3  
ATOM 6372  H HG22 . VAL B 1 58 ? -16.990 -7.971  -1.299  1.00 0.32 ? 58 VAL B HG22 3  
ATOM 6373  H HG23 . VAL B 1 58 ? -16.329 -7.661  -2.906  1.00 0.32 ? 58 VAL B HG23 3  
ATOM 6374  N N    . ARG B 1 59 ? -16.765 -12.612 -2.872  1.00 0.34 ? 59 ARG B N    3  
ATOM 6375  C CA   . ARG B 1 59 ? -16.317 -14.033 -2.892  1.00 0.34 ? 59 ARG B CA   3  
ATOM 6376  C C    . ARG B 1 59 ? -16.765 -14.683 -4.203  1.00 0.34 ? 59 ARG B C    3  
ATOM 6377  O O    . ARG B 1 59 ? -16.187 -15.650 -4.658  1.00 0.34 ? 59 ARG B O    3  
ATOM 6378  C CB   . ARG B 1 59 ? -16.939 -14.782 -1.712  1.00 0.34 ? 59 ARG B CB   3  
ATOM 6379  C CG   . ARG B 1 59 ? -16.375 -16.203 -1.654  1.00 0.34 ? 59 ARG B CG   3  
ATOM 6380  C CD   . ARG B 1 59 ? -17.521 -17.212 -1.743  1.00 0.34 ? 59 ARG B CD   3  
ATOM 6381  N NE   . ARG B 1 59 ? -17.246 -18.182 -2.839  1.00 0.34 ? 59 ARG B NE   3  
ATOM 6382  C CZ   . ARG B 1 59 ? -17.724 -19.395 -2.773  1.00 0.34 ? 59 ARG B CZ   3  
ATOM 6383  N NH1  . ARG B 1 59 ? -17.054 -20.327 -2.154  1.00 0.34 ? 59 ARG B NH1  3  
ATOM 6384  N NH2  . ARG B 1 59 ? -18.873 -19.675 -3.326  1.00 0.34 ? 59 ARG B NH2  3  
ATOM 6385  H H    . ARG B 1 59 ? -17.341 -12.291 -2.148  1.00 0.34 ? 59 ARG B H    3  
ATOM 6386  H HA   . ARG B 1 59 ? -15.241 -14.074 -2.819  1.00 0.34 ? 59 ARG B HA   3  
ATOM 6387  H HB2  . ARG B 1 59 ? -16.705 -14.264 -0.793  1.00 0.34 ? 59 ARG B HB2  3  
ATOM 6388  H HB3  . ARG B 1 59 ? -18.010 -14.827 -1.838  1.00 0.34 ? 59 ARG B HB3  3  
ATOM 6389  H HG2  . ARG B 1 59 ? -15.696 -16.355 -2.482  1.00 0.34 ? 59 ARG B HG2  3  
ATOM 6390  H HG3  . ARG B 1 59 ? -15.846 -16.343 -0.724  1.00 0.34 ? 59 ARG B HG3  3  
ATOM 6391  H HD2  . ARG B 1 59 ? -17.607 -17.743 -0.806  1.00 0.34 ? 59 ARG B HD2  3  
ATOM 6392  H HD3  . ARG B 1 59 ? -18.445 -16.691 -1.947  1.00 0.34 ? 59 ARG B HD3  3  
ATOM 6393  H HE   . ARG B 1 59 ? -16.706 -17.910 -3.610  1.00 0.34 ? 59 ARG B HE   3  
ATOM 6394  H HH11 . ARG B 1 59 ? -16.174 -20.114 -1.731  1.00 0.34 ? 59 ARG B HH11 3  
ATOM 6395  H HH12 . ARG B 1 59 ? -17.421 -21.257 -2.103  1.00 0.34 ? 59 ARG B HH12 3  
ATOM 6396  H HH21 . ARG B 1 59 ? -19.386 -18.959 -3.800  1.00 0.34 ? 59 ARG B HH21 3  
ATOM 6397  H HH22 . ARG B 1 59 ? -19.239 -20.603 -3.275  1.00 0.34 ? 59 ARG B HH22 3  
ATOM 6398  N N    . GLU B 1 60 ? -17.791 -14.155 -4.814  1.00 0.37 ? 60 GLU B N    3  
ATOM 6399  C CA   . GLU B 1 60 ? -18.277 -14.738 -6.095  1.00 0.37 ? 60 GLU B CA   3  
ATOM 6400  C C    . GLU B 1 60 ? -17.233 -14.501 -7.187  1.00 0.37 ? 60 GLU B C    3  
ATOM 6401  O O    . GLU B 1 60 ? -17.023 -15.332 -8.049  1.00 0.37 ? 60 GLU B O    3  
ATOM 6402  C CB   . GLU B 1 60 ? -19.593 -14.063 -6.492  1.00 0.37 ? 60 GLU B CB   3  
ATOM 6403  C CG   . GLU B 1 60 ? -20.768 -14.866 -5.931  1.00 0.37 ? 60 GLU B CG   3  
ATOM 6404  C CD   . GLU B 1 60 ? -22.072 -14.111 -6.191  1.00 0.37 ? 60 GLU B CD   3  
ATOM 6405  O OE1  . GLU B 1 60 ? -22.164 -13.465 -7.222  1.00 0.37 ? 60 GLU B OE1  3  
ATOM 6406  O OE2  . GLU B 1 60 ? -22.957 -14.190 -5.355  1.00 0.37 ? 60 GLU B OE2  3  
ATOM 6407  H H    . GLU B 1 60 ? -18.241 -13.375 -4.428  1.00 0.37 ? 60 GLU B H    3  
ATOM 6408  H HA   . GLU B 1 60 ? -18.437 -15.799 -5.972  1.00 0.37 ? 60 GLU B HA   3  
ATOM 6409  H HB2  . GLU B 1 60 ? -19.617 -13.060 -6.093  1.00 0.37 ? 60 GLU B HB2  3  
ATOM 6410  H HB3  . GLU B 1 60 ? -19.666 -14.025 -7.568  1.00 0.37 ? 60 GLU B HB3  3  
ATOM 6411  H HG2  . GLU B 1 60 ? -20.807 -15.832 -6.414  1.00 0.37 ? 60 GLU B HG2  3  
ATOM 6412  H HG3  . GLU B 1 60 ? -20.637 -15.000 -4.868  1.00 0.37 ? 60 GLU B HG3  3  
ATOM 6413  N N    . TYR B 1 61 ? -16.575 -13.375 -7.157  1.00 0.36 ? 61 TYR B N    3  
ATOM 6414  C CA   . TYR B 1 61 ? -15.543 -13.086 -8.192  1.00 0.36 ? 61 TYR B CA   3  
ATOM 6415  C C    . TYR B 1 61 ? -14.285 -13.903 -7.893  1.00 0.36 ? 61 TYR B C    3  
ATOM 6416  O O    . TYR B 1 61 ? -13.672 -14.463 -8.779  1.00 0.36 ? 61 TYR B O    3  
ATOM 6417  C CB   . TYR B 1 61 ? -15.203 -11.593 -8.171  1.00 0.36 ? 61 TYR B CB   3  
ATOM 6418  C CG   . TYR B 1 61 ? -16.259 -10.808 -8.922  1.00 0.36 ? 61 TYR B CG   3  
ATOM 6419  C CD1  . TYR B 1 61 ? -17.437 -11.435 -9.354  1.00 0.36 ? 61 TYR B CD1  3  
ATOM 6420  C CD2  . TYR B 1 61 ? -16.057 -9.448  -9.187  1.00 0.36 ? 61 TYR B CD2  3  
ATOM 6421  C CE1  . TYR B 1 61 ? -18.408 -10.703 -10.046 1.00 0.36 ? 61 TYR B CE1  3  
ATOM 6422  C CE2  . TYR B 1 61 ? -17.029 -8.715  -9.880  1.00 0.36 ? 61 TYR B CE2  3  
ATOM 6423  C CZ   . TYR B 1 61 ? -18.205 -9.344  -10.310 1.00 0.36 ? 61 TYR B CZ   3  
ATOM 6424  O OH   . TYR B 1 61 ? -19.162 -8.624  -10.992 1.00 0.36 ? 61 TYR B OH   3  
ATOM 6425  H H    . TYR B 1 61 ? -16.759 -12.720 -6.452  1.00 0.36 ? 61 TYR B H    3  
ATOM 6426  H HA   . TYR B 1 61 ? -15.924 -13.356 -9.165  1.00 0.36 ? 61 TYR B HA   3  
ATOM 6427  H HB2  . TYR B 1 61 ? -15.162 -11.249 -7.147  1.00 0.36 ? 61 TYR B HB2  3  
ATOM 6428  H HB3  . TYR B 1 61 ? -14.242 -11.437 -8.639  1.00 0.36 ? 61 TYR B HB3  3  
ATOM 6429  H HD1  . TYR B 1 61 ? -17.595 -12.485 -9.151  1.00 0.36 ? 61 TYR B HD1  3  
ATOM 6430  H HD2  . TYR B 1 61 ? -15.151 -8.962  -8.856  1.00 0.36 ? 61 TYR B HD2  3  
ATOM 6431  H HE1  . TYR B 1 61 ? -19.315 -11.187 -10.378 1.00 0.36 ? 61 TYR B HE1  3  
ATOM 6432  H HE2  . TYR B 1 61 ? -16.872 -7.666  -10.083 1.00 0.36 ? 61 TYR B HE2  3  
ATOM 6433  H HH   . TYR B 1 61 ? -19.889 -9.217  -11.198 1.00 0.36 ? 61 TYR B HH   3  
ATOM 6434  N N    . ILE B 1 62 ? -13.897 -13.978 -6.650  1.00 0.38 ? 62 ILE B N    3  
ATOM 6435  C CA   . ILE B 1 62 ? -12.682 -14.763 -6.297  1.00 0.38 ? 62 ILE B CA   3  
ATOM 6436  C C    . ILE B 1 62 ? -12.896 -16.227 -6.685  1.00 0.38 ? 62 ILE B C    3  
ATOM 6437  O O    . ILE B 1 62 ? -11.988 -16.903 -7.128  1.00 0.38 ? 62 ILE B O    3  
ATOM 6438  C CB   . ILE B 1 62 ? -12.430 -14.666 -4.791  1.00 0.38 ? 62 ILE B CB   3  
ATOM 6439  C CG1  . ILE B 1 62 ? -11.921 -13.262 -4.450  1.00 0.38 ? 62 ILE B CG1  3  
ATOM 6440  C CG2  . ILE B 1 62 ? -11.381 -15.700 -4.378  1.00 0.38 ? 62 ILE B CG2  3  
ATOM 6441  C CD1  . ILE B 1 62 ? -12.849 -12.619 -3.416  1.00 0.38 ? 62 ILE B CD1  3  
ATOM 6442  H H    . ILE B 1 62 ? -14.408 -13.521 -5.948  1.00 0.38 ? 62 ILE B H    3  
ATOM 6443  H HA   . ILE B 1 62 ? -11.829 -14.369 -6.832  1.00 0.38 ? 62 ILE B HA   3  
ATOM 6444  H HB   . ILE B 1 62 ? -13.351 -14.856 -4.259  1.00 0.38 ? 62 ILE B HB   3  
ATOM 6445  H HG12 . ILE B 1 62 ? -10.922 -13.330 -4.045  1.00 0.38 ? 62 ILE B HG12 3  
ATOM 6446  H HG13 . ILE B 1 62 ? -11.908 -12.657 -5.344  1.00 0.38 ? 62 ILE B HG13 3  
ATOM 6447  H HG21 . ILE B 1 62 ? -11.011 -16.207 -5.257  1.00 0.38 ? 62 ILE B HG21 3  
ATOM 6448  H HG22 . ILE B 1 62 ? -10.563 -15.203 -3.877  1.00 0.38 ? 62 ILE B HG22 3  
ATOM 6449  H HG23 . ILE B 1 62 ? -11.829 -16.419 -3.709  1.00 0.38 ? 62 ILE B HG23 3  
ATOM 6450  H HD11 . ILE B 1 62 ? -13.297 -13.390 -2.807  1.00 0.38 ? 62 ILE B HD11 3  
ATOM 6451  H HD12 . ILE B 1 62 ? -12.279 -11.950 -2.789  1.00 0.38 ? 62 ILE B HD12 3  
ATOM 6452  H HD13 . ILE B 1 62 ? -13.623 -12.065 -3.925  1.00 0.38 ? 62 ILE B HD13 3  
ATOM 6453  N N    . ASN B 1 63 ? -14.093 -16.721 -6.526  1.00 0.49 ? 63 ASN B N    3  
ATOM 6454  C CA   . ASN B 1 63 ? -14.369 -18.140 -6.887  1.00 0.49 ? 63 ASN B CA   3  
ATOM 6455  C C    . ASN B 1 63 ? -14.408 -18.279 -8.410  1.00 0.49 ? 63 ASN B C    3  
ATOM 6456  O O    . ASN B 1 63 ? -13.975 -19.269 -8.965  1.00 0.49 ? 63 ASN B O    3  
ATOM 6457  C CB   . ASN B 1 63 ? -15.719 -18.561 -6.301  1.00 0.49 ? 63 ASN B CB   3  
ATOM 6458  C CG   . ASN B 1 63 ? -16.142 -19.903 -6.903  1.00 0.49 ? 63 ASN B CG   3  
ATOM 6459  O OD1  . ASN B 1 63 ? -15.368 -20.838 -6.937  1.00 0.49 ? 63 ASN B OD1  3  
ATOM 6460  N ND2  . ASN B 1 63 ? -17.347 -20.037 -7.386  1.00 0.49 ? 63 ASN B ND2  3  
ATOM 6461  H H    . ASN B 1 63 ? -14.812 -16.159 -6.169  1.00 0.49 ? 63 ASN B H    3  
ATOM 6462  H HA   . ASN B 1 63 ? -13.591 -18.773 -6.487  1.00 0.49 ? 63 ASN B HA   3  
ATOM 6463  H HB2  . ASN B 1 63 ? -15.631 -18.659 -5.229  1.00 0.49 ? 63 ASN B HB2  3  
ATOM 6464  H HB3  . ASN B 1 63 ? -16.462 -17.813 -6.535  1.00 0.49 ? 63 ASN B HB3  3  
ATOM 6465  H HD21 . ASN B 1 63 ? -17.972 -19.282 -7.359  1.00 0.49 ? 63 ASN B HD21 3  
ATOM 6466  H HD22 . ASN B 1 63 ? -17.628 -20.891 -7.773  1.00 0.49 ? 63 ASN B HD22 3  
ATOM 6467  N N    . SER B 1 64 ? -14.923 -17.292 -9.091  1.00 0.55 ? 64 SER B N    3  
ATOM 6468  C CA   . SER B 1 64 ? -14.987 -17.366 -10.578 1.00 0.55 ? 64 SER B CA   3  
ATOM 6469  C C    . SER B 1 64 ? -13.628 -16.983 -11.165 1.00 0.55 ? 64 SER B C    3  
ATOM 6470  O O    . SER B 1 64 ? -13.378 -17.151 -12.342 1.00 0.55 ? 64 SER B O    3  
ATOM 6471  C CB   . SER B 1 64 ? -16.054 -16.399 -11.091 1.00 0.55 ? 64 SER B CB   3  
ATOM 6472  O OG   . SER B 1 64 ? -16.142 -15.286 -10.211 1.00 0.55 ? 64 SER B OG   3  
ATOM 6473  H H    . SER B 1 64 ? -15.265 -16.501 -8.625  1.00 0.55 ? 64 SER B H    3  
ATOM 6474  H HA   . SER B 1 64 ? -15.238 -18.373 -10.879 1.00 0.55 ? 64 SER B HA   3  
ATOM 6475  H HB2  . SER B 1 64 ? -15.786 -16.052 -12.076 1.00 0.55 ? 64 SER B HB2  3  
ATOM 6476  H HB3  . SER B 1 64 ? -17.008 -16.908 -11.140 1.00 0.55 ? 64 SER B HB3  3  
ATOM 6477  H HG   . SER B 1 64 ? -16.599 -14.579 -10.672 1.00 0.55 ? 64 SER B HG   3  
ATOM 6478  N N    . LEU B 1 65 ? -12.745 -16.469 -10.352 1.00 0.53 ? 65 LEU B N    3  
ATOM 6479  C CA   . LEU B 1 65 ? -11.402 -16.075 -10.860 1.00 0.53 ? 65 LEU B CA   3  
ATOM 6480  C C    . LEU B 1 65 ? -10.465 -17.283 -10.809 1.00 0.53 ? 65 LEU B C    3  
ATOM 6481  O O    . LEU B 1 65 ? -9.843  -17.640 -11.790 1.00 0.53 ? 65 LEU B O    3  
ATOM 6482  C CB   . LEU B 1 65 ? -10.837 -14.955 -9.984  1.00 0.53 ? 65 LEU B CB   3  
ATOM 6483  C CG   . LEU B 1 65 ? -10.465 -13.757 -10.859 1.00 0.53 ? 65 LEU B CG   3  
ATOM 6484  C CD1  . LEU B 1 65 ? -9.572  -14.221 -12.010 1.00 0.53 ? 65 LEU B CD1  3  
ATOM 6485  C CD2  . LEU B 1 65 ? -11.740 -13.127 -11.426 1.00 0.53 ? 65 LEU B CD2  3  
ATOM 6486  H H    . LEU B 1 65 ? -12.967 -16.343 -9.406  1.00 0.53 ? 65 LEU B H    3  
ATOM 6487  H HA   . LEU B 1 65 ? -11.489 -15.728 -11.878 1.00 0.53 ? 65 LEU B HA   3  
ATOM 6488  H HB2  . LEU B 1 65 ? -11.580 -14.656 -9.259  1.00 0.53 ? 65 LEU B HB2  3  
ATOM 6489  H HB3  . LEU B 1 65 ? -9.955  -15.310 -9.471  1.00 0.53 ? 65 LEU B HB3  3  
ATOM 6490  H HG   . LEU B 1 65 ? -9.935  -13.028 -10.263 1.00 0.53 ? 65 LEU B HG   3  
ATOM 6491  H HD11 . LEU B 1 65 ? -9.363  -15.275 -11.902 1.00 0.53 ? 65 LEU B HD11 3  
ATOM 6492  H HD12 . LEU B 1 65 ? -10.076 -14.049 -12.950 1.00 0.53 ? 65 LEU B HD12 3  
ATOM 6493  H HD13 . LEU B 1 65 ? -8.645  -13.667 -11.992 1.00 0.53 ? 65 LEU B HD13 3  
ATOM 6494  H HD21 . LEU B 1 65 ? -12.484 -13.060 -10.647 1.00 0.53 ? 65 LEU B HD21 3  
ATOM 6495  H HD22 . LEU B 1 65 ? -11.517 -12.138 -11.797 1.00 0.53 ? 65 LEU B HD22 3  
ATOM 6496  H HD23 . LEU B 1 65 ? -12.116 -13.739 -12.232 1.00 0.53 ? 65 LEU B HD23 3  
ATOM 6497  N N    . GLU B 1 66 ? -10.358 -17.915 -9.672  1.00 0.61 ? 66 GLU B N    3  
ATOM 6498  C CA   . GLU B 1 66 ? -9.461  -19.099 -9.559  1.00 0.61 ? 66 GLU B CA   3  
ATOM 6499  C C    . GLU B 1 66 ? -10.207 -20.351 -10.024 1.00 0.61 ? 66 GLU B C    3  
ATOM 6500  O O    . GLU B 1 66 ? -10.938 -20.964 -9.272  1.00 0.61 ? 66 GLU B O    3  
ATOM 6501  C CB   . GLU B 1 66 ? -9.030  -19.275 -8.101  1.00 0.61 ? 66 GLU B CB   3  
ATOM 6502  C CG   . GLU B 1 66 ? -8.184  -18.074 -7.670  1.00 0.61 ? 66 GLU B CG   3  
ATOM 6503  C CD   . GLU B 1 66 ? -7.014  -17.900 -8.638  1.00 0.61 ? 66 GLU B CD   3  
ATOM 6504  O OE1  . GLU B 1 66 ? -6.391  -18.895 -8.969  1.00 0.61 ? 66 GLU B OE1  3  
ATOM 6505  O OE2  . GLU B 1 66 ? -6.759  -16.774 -9.033  1.00 0.61 ? 66 GLU B OE2  3  
ATOM 6506  H H    . GLU B 1 66 ? -10.868 -17.610 -8.892  1.00 0.61 ? 66 GLU B H    3  
ATOM 6507  H HA   . GLU B 1 66 ? -8.588  -18.949 -10.176 1.00 0.61 ? 66 GLU B HA   3  
ATOM 6508  H HB2  . GLU B 1 66 ? -9.906  -19.344 -7.473  1.00 0.61 ? 66 GLU B HB2  3  
ATOM 6509  H HB3  . GLU B 1 66 ? -8.445  -20.177 -8.005  1.00 0.61 ? 66 GLU B HB3  3  
ATOM 6510  H HG2  . GLU B 1 66 ? -8.796  -17.183 -7.677  1.00 0.61 ? 66 GLU B HG2  3  
ATOM 6511  H HG3  . GLU B 1 66 ? -7.804  -18.242 -6.674  1.00 0.61 ? 66 GLU B HG3  3  
ATOM 6512  N N    . MET B 1 67 ? -10.029 -20.735 -11.258 1.00 1.45 ? 67 MET B N    3  
ATOM 6513  C CA   . MET B 1 67 ? -10.728 -21.946 -11.770 1.00 1.45 ? 67 MET B CA   3  
ATOM 6514  C C    . MET B 1 67 ? -10.052 -23.200 -11.210 1.00 1.45 ? 67 MET B C    3  
ATOM 6515  O O    . MET B 1 67 ? -9.163  -23.121 -10.386 1.00 1.45 ? 67 MET B O    3  
ATOM 6516  C CB   . MET B 1 67 ? -10.657 -21.969 -13.299 1.00 1.45 ? 67 MET B CB   3  
ATOM 6517  C CG   . MET B 1 67 ? -12.017 -22.378 -13.867 1.00 1.45 ? 67 MET B CG   3  
ATOM 6518  S SD   . MET B 1 67 ? -11.867 -23.976 -14.702 1.00 1.45 ? 67 MET B SD   3  
ATOM 6519  C CE   . MET B 1 67 ? -12.177 -23.383 -16.384 1.00 1.45 ? 67 MET B CE   3  
ATOM 6520  H H    . MET B 1 67 ? -9.435  -20.226 -11.848 1.00 1.45 ? 67 MET B H    3  
ATOM 6521  H HA   . MET B 1 67 ? -11.762 -21.925 -11.458 1.00 1.45 ? 67 MET B HA   3  
ATOM 6522  H HB2  . MET B 1 67 ? -10.395 -20.986 -13.660 1.00 1.45 ? 67 MET B HB2  3  
ATOM 6523  H HB3  . MET B 1 67 ? -9.909  -22.681 -13.614 1.00 1.45 ? 67 MET B HB3  3  
ATOM 6524  H HG2  . MET B 1 67 ? -12.734 -22.457 -13.063 1.00 1.45 ? 67 MET B HG2  3  
ATOM 6525  H HG3  . MET B 1 67 ? -12.351 -21.632 -14.574 1.00 1.45 ? 67 MET B HG3  3  
ATOM 6526  H HE1  . MET B 1 67 ? -12.902 -22.582 -16.354 1.00 1.45 ? 67 MET B HE1  3  
ATOM 6527  H HE2  . MET B 1 67 ? -11.258 -23.018 -16.813 1.00 1.45 ? 67 MET B HE2  3  
ATOM 6528  H HE3  . MET B 1 67 ? -12.555 -24.197 -16.987 1.00 1.45 ? 67 MET B HE3  3  
ATOM 6529  N N    . SER B 1 68 ? -10.467 -24.356 -11.650 1.00 2.84 ? 68 SER B N    3  
ATOM 6530  C CA   . SER B 1 68 ? -9.848  -25.612 -11.142 1.00 2.84 ? 68 SER B CA   3  
ATOM 6531  C C    . SER B 1 68 ? -8.366  -25.640 -11.520 1.00 2.84 ? 68 SER B C    3  
ATOM 6532  O O    . SER B 1 68 ? -7.544  -25.648 -10.619 1.00 2.84 ? 68 SER B O    3  
ATOM 6533  C CB   . SER B 1 68 ? -10.555 -26.817 -11.763 1.00 2.84 ? 68 SER B CB   3  
ATOM 6534  O OG   . SER B 1 68 ? -11.927 -26.505 -11.961 1.00 2.84 ? 68 SER B OG   3  
ATOM 6535  O OXT  . SER B 1 68 ? -8.077  -25.651 -12.706 1.00 2.84 ? 68 SER B OXT  3  
ATOM 6536  H H    . SER B 1 68 ? -11.186 -24.398 -12.314 1.00 2.84 ? 68 SER B H    3  
ATOM 6537  H HA   . SER B 1 68 ? -9.946  -25.653 -10.067 1.00 2.84 ? 68 SER B HA   3  
ATOM 6538  H HB2  . SER B 1 68 ? -10.104 -27.051 -12.713 1.00 2.84 ? 68 SER B HB2  3  
ATOM 6539  H HB3  . SER B 1 68 ? -10.461 -27.669 -11.103 1.00 2.84 ? 68 SER B HB3  3  
ATOM 6540  H HG   . SER B 1 68 ? -12.221 -26.950 -12.760 1.00 2.84 ? 68 SER B HG   3  
ATOM 6541  N N    . SER A 1 1  ? -19.102 12.177  2.505   1.00 5.93 ? 1  SER A N    4  
ATOM 6542  C CA   . SER A 1 1  ? -18.317 11.375  1.523   1.00 5.93 ? 1  SER A CA   4  
ATOM 6543  C C    . SER A 1 1  ? -17.457 10.352  2.270   1.00 5.93 ? 1  SER A C    4  
ATOM 6544  O O    . SER A 1 1  ? -17.036 10.594  3.384   1.00 5.93 ? 1  SER A O    4  
ATOM 6545  C CB   . SER A 1 1  ? -17.413 12.306  0.713   1.00 5.93 ? 1  SER A CB   4  
ATOM 6546  O OG   . SER A 1 1  ? -17.960 12.475  -0.589  1.00 5.93 ? 1  SER A OG   4  
ATOM 6547  H H1   . SER A 1 1  ? -18.896 11.842  3.468   1.00 5.93 ? 1  SER A H1   4  
ATOM 6548  H H2   . SER A 1 1  ? -18.840 13.180  2.423   1.00 5.93 ? 1  SER A H2   4  
ATOM 6549  H H3   . SER A 1 1  ? -20.116 12.069  2.308   1.00 5.93 ? 1  SER A H3   4  
ATOM 6550  H HA   . SER A 1 1  ? -18.992 10.860  0.857   1.00 5.93 ? 1  SER A HA   4  
ATOM 6551  H HB2  . SER A 1 1  ? -17.351 13.265  1.199   1.00 5.93 ? 1  SER A HB2  4  
ATOM 6552  H HB3  . SER A 1 1  ? -16.423 11.875  0.645   1.00 5.93 ? 1  SER A HB3  4  
ATOM 6553  H HG   . SER A 1 1  ? -18.567 13.218  -0.561  1.00 5.93 ? 1  SER A HG   4  
ATOM 6554  N N    . PRO A 1 2  ? -17.222 9.236   1.630   1.00 3.89 ? 2  PRO A N    4  
ATOM 6555  C CA   . PRO A 1 2  ? -16.414 8.145   2.202   1.00 3.89 ? 2  PRO A CA   4  
ATOM 6556  C C    . PRO A 1 2  ? -14.922 8.474   2.100   1.00 3.89 ? 2  PRO A C    4  
ATOM 6557  O O    . PRO A 1 2  ? -14.537 9.617   1.951   1.00 3.89 ? 2  PRO A O    4  
ATOM 6558  C CB   . PRO A 1 2  ? -16.769 6.939   1.329   1.00 3.89 ? 2  PRO A CB   4  
ATOM 6559  C CG   . PRO A 1 2  ? -17.298 7.509   -0.008  1.00 3.89 ? 2  PRO A CG   4  
ATOM 6560  C CD   . PRO A 1 2  ? -17.742 8.957   0.274   1.00 3.89 ? 2  PRO A CD   4  
ATOM 6561  H HA   . PRO A 1 2  ? -16.696 7.957   3.225   1.00 3.89 ? 2  PRO A HA   4  
ATOM 6562  H HB2  . PRO A 1 2  ? -15.888 6.334   1.158   1.00 3.89 ? 2  PRO A HB2  4  
ATOM 6563  H HB3  . PRO A 1 2  ? -17.539 6.350   1.803   1.00 3.89 ? 2  PRO A HB3  4  
ATOM 6564  H HG2  . PRO A 1 2  ? -16.512 7.496   -0.751  1.00 3.89 ? 2  PRO A HG2  4  
ATOM 6565  H HG3  . PRO A 1 2  ? -18.142 6.929   -0.351  1.00 3.89 ? 2  PRO A HG3  4  
ATOM 6566  H HD2  . PRO A 1 2  ? -17.304 9.633   -0.448  1.00 3.89 ? 2  PRO A HD2  4  
ATOM 6567  H HD3  . PRO A 1 2  ? -18.818 9.032   0.265   1.00 3.89 ? 2  PRO A HD3  4  
ATOM 6568  N N    . TYR A 1 3  ? -14.079 7.481   2.178   1.00 2.56 ? 3  TYR A N    4  
ATOM 6569  C CA   . TYR A 1 3  ? -12.614 7.738   2.086   1.00 2.56 ? 3  TYR A CA   4  
ATOM 6570  C C    . TYR A 1 3  ? -12.120 7.379   0.683   1.00 2.56 ? 3  TYR A C    4  
ATOM 6571  O O    . TYR A 1 3  ? -12.079 8.211   -0.202  1.00 2.56 ? 3  TYR A O    4  
ATOM 6572  C CB   . TYR A 1 3  ? -11.880 6.882   3.120   1.00 2.56 ? 3  TYR A CB   4  
ATOM 6573  C CG   . TYR A 1 3  ? -11.808 7.626   4.432   1.00 2.56 ? 3  TYR A CG   4  
ATOM 6574  C CD1  . TYR A 1 3  ? -10.994 8.760   4.550   1.00 2.56 ? 3  TYR A CD1  4  
ATOM 6575  C CD2  . TYR A 1 3  ? -12.556 7.184   5.530   1.00 2.56 ? 3  TYR A CD2  4  
ATOM 6576  C CE1  . TYR A 1 3  ? -10.928 9.450   5.766   1.00 2.56 ? 3  TYR A CE1  4  
ATOM 6577  C CE2  . TYR A 1 3  ? -12.490 7.874   6.746   1.00 2.56 ? 3  TYR A CE2  4  
ATOM 6578  C CZ   . TYR A 1 3  ? -11.676 9.008   6.864   1.00 2.56 ? 3  TYR A CZ   4  
ATOM 6579  O OH   . TYR A 1 3  ? -11.610 9.689   8.062   1.00 2.56 ? 3  TYR A OH   4  
ATOM 6580  H H    . TYR A 1 3  ? -14.409 6.566   2.299   1.00 2.56 ? 3  TYR A H    4  
ATOM 6581  H HA   . TYR A 1 3  ? -12.419 8.783   2.280   1.00 2.56 ? 3  TYR A HA   4  
ATOM 6582  H HB2  . TYR A 1 3  ? -12.413 5.953   3.262   1.00 2.56 ? 3  TYR A HB2  4  
ATOM 6583  H HB3  . TYR A 1 3  ? -10.879 6.673   2.770   1.00 2.56 ? 3  TYR A HB3  4  
ATOM 6584  H HD1  . TYR A 1 3  ? -10.418 9.101   3.703   1.00 2.56 ? 3  TYR A HD1  4  
ATOM 6585  H HD2  . TYR A 1 3  ? -13.184 6.310   5.439   1.00 2.56 ? 3  TYR A HD2  4  
ATOM 6586  H HE1  . TYR A 1 3  ? -10.300 10.324  5.857   1.00 2.56 ? 3  TYR A HE1  4  
ATOM 6587  H HE2  . TYR A 1 3  ? -13.067 7.533   7.593   1.00 2.56 ? 3  TYR A HE2  4  
ATOM 6588  H HH   . TYR A 1 3  ? -11.956 9.114   8.750   1.00 2.56 ? 3  TYR A HH   4  
ATOM 6589  N N    . SER A 1 4  ? -11.744 6.147   0.474   1.00 0.96 ? 4  SER A N    4  
ATOM 6590  C CA   . SER A 1 4  ? -11.253 5.738   -0.872  1.00 0.96 ? 4  SER A CA   4  
ATOM 6591  C C    . SER A 1 4  ? -11.214 4.211   -0.957  1.00 0.96 ? 4  SER A C    4  
ATOM 6592  O O    . SER A 1 4  ? -10.537 3.553   -0.191  1.00 0.96 ? 4  SER A O    4  
ATOM 6593  C CB   . SER A 1 4  ? -9.846  6.297   -1.093  1.00 0.96 ? 4  SER A CB   4  
ATOM 6594  O OG   . SER A 1 4  ? -9.915  7.713   -1.195  1.00 0.96 ? 4  SER A OG   4  
ATOM 6595  H H    . SER A 1 4  ? -11.784 5.492   1.202   1.00 0.96 ? 4  SER A H    4  
ATOM 6596  H HA   . SER A 1 4  ? -11.917 6.124   -1.631  1.00 0.96 ? 4  SER A HA   4  
ATOM 6597  H HB2  . SER A 1 4  ? -9.216  6.031   -0.261  1.00 0.96 ? 4  SER A HB2  4  
ATOM 6598  H HB3  . SER A 1 4  ? -9.433  5.879   -2.002  1.00 0.96 ? 4  SER A HB3  4  
ATOM 6599  H HG   . SER A 1 4  ? -9.059  8.070   -0.947  1.00 0.96 ? 4  SER A HG   4  
ATOM 6600  N N    . SER A 1 5  ? -11.935 3.639   -1.882  1.00 0.48 ? 5  SER A N    4  
ATOM 6601  C CA   . SER A 1 5  ? -11.939 2.155   -2.014  1.00 0.48 ? 5  SER A CA   4  
ATOM 6602  C C    . SER A 1 5  ? -10.837 1.726   -2.985  1.00 0.48 ? 5  SER A C    4  
ATOM 6603  O O    . SER A 1 5  ? -11.096 1.113   -4.001  1.00 0.48 ? 5  SER A O    4  
ATOM 6604  C CB   . SER A 1 5  ? -13.296 1.695   -2.548  1.00 0.48 ? 5  SER A CB   4  
ATOM 6605  O OG   . SER A 1 5  ? -13.565 2.355   -3.777  1.00 0.48 ? 5  SER A OG   4  
ATOM 6606  H H    . SER A 1 5  ? -12.474 4.187   -2.489  1.00 0.48 ? 5  SER A H    4  
ATOM 6607  H HA   . SER A 1 5  ? -11.762 1.708   -1.047  1.00 0.48 ? 5  SER A HA   4  
ATOM 6608  H HB2  . SER A 1 5  ? -13.278 0.631   -2.713  1.00 0.48 ? 5  SER A HB2  4  
ATOM 6609  H HB3  . SER A 1 5  ? -14.065 1.932   -1.824  1.00 0.48 ? 5  SER A HB3  4  
ATOM 6610  H HG   . SER A 1 5  ? -14.499 2.575   -3.797  1.00 0.48 ? 5  SER A HG   4  
ATOM 6611  N N    . ASP A 1 6  ? -9.608  2.043   -2.679  1.00 0.37 ? 6  ASP A N    4  
ATOM 6612  C CA   . ASP A 1 6  ? -8.491  1.652   -3.585  1.00 0.37 ? 6  ASP A CA   4  
ATOM 6613  C C    . ASP A 1 6  ? -7.267  1.273   -2.749  1.00 0.37 ? 6  ASP A C    4  
ATOM 6614  O O    . ASP A 1 6  ? -7.124  1.689   -1.615  1.00 0.37 ? 6  ASP A O    4  
ATOM 6615  C CB   . ASP A 1 6  ? -8.141  2.828   -4.500  1.00 0.37 ? 6  ASP A CB   4  
ATOM 6616  C CG   . ASP A 1 6  ? -9.428  3.484   -5.002  1.00 0.37 ? 6  ASP A CG   4  
ATOM 6617  O OD1  . ASP A 1 6  ? -10.170 2.823   -5.710  1.00 0.37 ? 6  ASP A OD1  4  
ATOM 6618  O OD2  . ASP A 1 6  ? -9.650  4.637   -4.671  1.00 0.37 ? 6  ASP A OD2  4  
ATOM 6619  H H    . ASP A 1 6  ? -9.420  2.538   -1.854  1.00 0.37 ? 6  ASP A H    4  
ATOM 6620  H HA   . ASP A 1 6  ? -8.793  0.806   -4.185  1.00 0.37 ? 6  ASP A HA   4  
ATOM 6621  H HB2  . ASP A 1 6  ? -7.558  3.551   -3.949  1.00 0.37 ? 6  ASP A HB2  4  
ATOM 6622  H HB3  . ASP A 1 6  ? -7.570  2.471   -5.343  1.00 0.37 ? 6  ASP A HB3  4  
ATOM 6623  N N    . THR A 1 7  ? -6.381  0.488   -3.298  1.00 0.35 ? 7  THR A N    4  
ATOM 6624  C CA   . THR A 1 7  ? -5.168  0.085   -2.534  1.00 0.35 ? 7  THR A CA   4  
ATOM 6625  C C    . THR A 1 7  ? -4.272  1.305   -2.315  1.00 0.35 ? 7  THR A C    4  
ATOM 6626  O O    . THR A 1 7  ? -4.234  2.211   -3.124  1.00 0.35 ? 7  THR A O    4  
ATOM 6627  C CB   . THR A 1 7  ? -4.398  -0.978  -3.322  1.00 0.35 ? 7  THR A CB   4  
ATOM 6628  O OG1  . THR A 1 7  ? -4.348  -0.603  -4.692  1.00 0.35 ? 7  THR A OG1  4  
ATOM 6629  C CG2  . THR A 1 7  ? -5.103  -2.328  -3.185  1.00 0.35 ? 7  THR A CG2  4  
ATOM 6630  H H    . THR A 1 7  ? -6.515  0.164   -4.213  1.00 0.35 ? 7  THR A H    4  
ATOM 6631  H HA   . THR A 1 7  ? -5.464  -0.321  -1.577  1.00 0.35 ? 7  THR A HA   4  
ATOM 6632  H HB   . THR A 1 7  ? -3.395  -1.059  -2.934  1.00 0.35 ? 7  THR A HB   4  
ATOM 6633  H HG1  . THR A 1 7  ? -3.427  -0.583  -4.961  1.00 0.35 ? 7  THR A HG1  4  
ATOM 6634  H HG21 . THR A 1 7  ? -6.129  -2.234  -3.512  1.00 0.35 ? 7  THR A HG21 4  
ATOM 6635  H HG22 . THR A 1 7  ? -4.596  -3.062  -3.796  1.00 0.35 ? 7  THR A HG22 4  
ATOM 6636  H HG23 . THR A 1 7  ? -5.081  -2.643  -2.153  1.00 0.35 ? 7  THR A HG23 4  
ATOM 6637  N N    . THR A 1 8  ? -3.552  1.337   -1.227  1.00 0.31 ? 8  THR A N    4  
ATOM 6638  C CA   . THR A 1 8  ? -2.660  2.500   -0.959  1.00 0.31 ? 8  THR A CA   4  
ATOM 6639  C C    . THR A 1 8  ? -1.197  2.062   -1.106  1.00 0.31 ? 8  THR A C    4  
ATOM 6640  O O    . THR A 1 8  ? -0.829  0.991   -0.666  1.00 0.31 ? 8  THR A O    4  
ATOM 6641  C CB   . THR A 1 8  ? -2.900  3.007   0.466   1.00 0.31 ? 8  THR A CB   4  
ATOM 6642  O OG1  . THR A 1 8  ? -4.165  3.653   0.529   1.00 0.31 ? 8  THR A OG1  4  
ATOM 6643  C CG2  . THR A 1 8  ? -1.800  3.997   0.853   1.00 0.31 ? 8  THR A CG2  4  
ATOM 6644  H H    . THR A 1 8  ? -3.597  0.596   -0.588  1.00 0.31 ? 8  THR A H    4  
ATOM 6645  H HA   . THR A 1 8  ? -2.878  3.287   -1.664  1.00 0.31 ? 8  THR A HA   4  
ATOM 6646  H HB   . THR A 1 8  ? -2.886  2.174   1.151   1.00 0.31 ? 8  THR A HB   4  
ATOM 6647  H HG1  . THR A 1 8  ? -4.843  2.988   0.390   1.00 0.31 ? 8  THR A HG1  4  
ATOM 6648  H HG21 . THR A 1 8  ? -0.833  3.556   0.660   1.00 0.31 ? 8  THR A HG21 4  
ATOM 6649  H HG22 . THR A 1 8  ? -1.906  4.900   0.271   1.00 0.31 ? 8  THR A HG22 4  
ATOM 6650  H HG23 . THR A 1 8  ? -1.884  4.234   1.904   1.00 0.31 ? 8  THR A HG23 4  
ATOM 6651  N N    . PRO A 1 9  ? -0.404  2.906   -1.720  1.00 0.34 ? 9  PRO A N    4  
ATOM 6652  C CA   . PRO A 1 9  ? 1.027   2.631   -1.937  1.00 0.34 ? 9  PRO A CA   4  
ATOM 6653  C C    . PRO A 1 9  ? 1.816   2.885   -0.651  1.00 0.34 ? 9  PRO A C    4  
ATOM 6654  O O    . PRO A 1 9  ? 2.148   4.007   -0.326  1.00 0.34 ? 9  PRO A O    4  
ATOM 6655  C CB   . PRO A 1 9  ? 1.423   3.631   -3.027  1.00 0.34 ? 9  PRO A CB   4  
ATOM 6656  C CG   . PRO A 1 9  ? 0.383   4.775   -2.966  1.00 0.34 ? 9  PRO A CG   4  
ATOM 6657  C CD   . PRO A 1 9  ? -0.857  4.207   -2.252  1.00 0.34 ? 9  PRO A CD   4  
ATOM 6658  H HA   . PRO A 1 9  ? 1.175   1.623   -2.287  1.00 0.34 ? 9  PRO A HA   4  
ATOM 6659  H HB2  . PRO A 1 9  ? 2.416   4.015   -2.835  1.00 0.34 ? 9  PRO A HB2  4  
ATOM 6660  H HB3  . PRO A 1 9  ? 1.387   3.159   -3.997  1.00 0.34 ? 9  PRO A HB3  4  
ATOM 6661  H HG2  . PRO A 1 9  ? 0.786   5.610   -2.409  1.00 0.34 ? 9  PRO A HG2  4  
ATOM 6662  H HG3  . PRO A 1 9  ? 0.118   5.089   -3.965  1.00 0.34 ? 9  PRO A HG3  4  
ATOM 6663  H HD2  . PRO A 1 9  ? -1.163  4.863   -1.448  1.00 0.34 ? 9  PRO A HD2  4  
ATOM 6664  H HD3  . PRO A 1 9  ? -1.665  4.062   -2.953  1.00 0.34 ? 9  PRO A HD3  4  
ATOM 6665  N N    . CYS A 1 10 ? 2.117   1.851   0.087   1.00 0.35 ? 10 CYS A N    4  
ATOM 6666  C CA   . CYS A 1 10 ? 2.879   2.037   1.352   1.00 0.35 ? 10 CYS A CA   4  
ATOM 6667  C C    . CYS A 1 10 ? 4.280   1.442   1.201   1.00 0.35 ? 10 CYS A C    4  
ATOM 6668  O O    . CYS A 1 10 ? 4.441   0.259   0.971   1.00 0.35 ? 10 CYS A O    4  
ATOM 6669  C CB   . CYS A 1 10 ? 2.147   1.331   2.495   1.00 0.35 ? 10 CYS A CB   4  
ATOM 6670  S SG   . CYS A 1 10 ? 0.567   2.162   2.800   1.00 0.35 ? 10 CYS A SG   4  
ATOM 6671  H H    . CYS A 1 10 ? 1.837   0.954   -0.191  1.00 0.35 ? 10 CYS A H    4  
ATOM 6672  H HA   . CYS A 1 10 ? 2.959   3.091   1.573   1.00 0.35 ? 10 CYS A HA   4  
ATOM 6673  H HB2  . CYS A 1 10 ? 1.967   0.301   2.227   1.00 0.35 ? 10 CYS A HB2  4  
ATOM 6674  H HB3  . CYS A 1 10 ? 2.752   1.370   3.389   1.00 0.35 ? 10 CYS A HB3  4  
ATOM 6675  N N    . CYS A 1 11 ? 5.295   2.251   1.329   1.00 0.32 ? 11 CYS A N    4  
ATOM 6676  C CA   . CYS A 1 11 ? 6.684   1.733   1.195   1.00 0.32 ? 11 CYS A CA   4  
ATOM 6677  C C    . CYS A 1 11 ? 7.330   1.648   2.580   1.00 0.32 ? 11 CYS A C    4  
ATOM 6678  O O    . CYS A 1 11 ? 7.351   2.607   3.325   1.00 0.32 ? 11 CYS A O    4  
ATOM 6679  C CB   . CYS A 1 11 ? 7.498   2.675   0.308   1.00 0.32 ? 11 CYS A CB   4  
ATOM 6680  S SG   . CYS A 1 11 ? 7.479   2.068   -1.396  1.00 0.32 ? 11 CYS A SG   4  
ATOM 6681  H H    . CYS A 1 11 ? 5.142   3.201   1.517   1.00 0.32 ? 11 CYS A H    4  
ATOM 6682  H HA   . CYS A 1 11 ? 6.660   0.749   0.749   1.00 0.32 ? 11 CYS A HA   4  
ATOM 6683  H HB2  . CYS A 1 11 ? 7.067   3.665   0.344   1.00 0.32 ? 11 CYS A HB2  4  
ATOM 6684  H HB3  . CYS A 1 11 ? 8.517   2.715   0.665   1.00 0.32 ? 11 CYS A HB3  4  
ATOM 6685  N N    . PHE A 1 12 ? 7.854   0.506   2.930   1.00 0.28 ? 12 PHE A N    4  
ATOM 6686  C CA   . PHE A 1 12 ? 8.495   0.359   4.267   1.00 0.28 ? 12 PHE A CA   4  
ATOM 6687  C C    . PHE A 1 12 ? 9.988   0.075   4.089   1.00 0.28 ? 12 PHE A C    4  
ATOM 6688  O O    . PHE A 1 12 ? 10.790  0.346   4.960   1.00 0.28 ? 12 PHE A O    4  
ATOM 6689  C CB   . PHE A 1 12 ? 7.840   -0.800  5.022   1.00 0.28 ? 12 PHE A CB   4  
ATOM 6690  C CG   . PHE A 1 12 ? 6.373   -0.870  4.664   1.00 0.28 ? 12 PHE A CG   4  
ATOM 6691  C CD1  . PHE A 1 12 ? 5.968   -1.537  3.502   1.00 0.28 ? 12 PHE A CD1  4  
ATOM 6692  C CD2  . PHE A 1 12 ? 5.420   -0.267  5.494   1.00 0.28 ? 12 PHE A CD2  4  
ATOM 6693  C CE1  . PHE A 1 12 ? 4.609   -1.601  3.168   1.00 0.28 ? 12 PHE A CE1  4  
ATOM 6694  C CE2  . PHE A 1 12 ? 4.061   -0.331  5.160   1.00 0.28 ? 12 PHE A CE2  4  
ATOM 6695  C CZ   . PHE A 1 12 ? 3.656   -0.998  3.997   1.00 0.28 ? 12 PHE A CZ   4  
ATOM 6696  H H    . PHE A 1 12 ? 7.824   -0.257  2.315   1.00 0.28 ? 12 PHE A H    4  
ATOM 6697  H HA   . PHE A 1 12 ? 8.367   1.273   4.830   1.00 0.28 ? 12 PHE A HA   4  
ATOM 6698  H HB2  . PHE A 1 12 ? 8.322   -1.727  4.748   1.00 0.28 ? 12 PHE A HB2  4  
ATOM 6699  H HB3  . PHE A 1 12 ? 7.942   -0.641  6.085   1.00 0.28 ? 12 PHE A HB3  4  
ATOM 6700  H HD1  . PHE A 1 12 ? 6.704   -2.001  2.861   1.00 0.28 ? 12 PHE A HD1  4  
ATOM 6701  H HD2  . PHE A 1 12 ? 5.733   0.247   6.391   1.00 0.28 ? 12 PHE A HD2  4  
ATOM 6702  H HE1  . PHE A 1 12 ? 4.297   -2.115  2.271   1.00 0.28 ? 12 PHE A HE1  4  
ATOM 6703  H HE2  . PHE A 1 12 ? 3.326   0.133   5.800   1.00 0.28 ? 12 PHE A HE2  4  
ATOM 6704  H HZ   . PHE A 1 12 ? 2.608   -1.047  3.741   1.00 0.28 ? 12 PHE A HZ   4  
ATOM 6705  N N    . ALA A 1 13 ? 10.367  -0.469  2.965   1.00 0.31 ? 13 ALA A N    4  
ATOM 6706  C CA   . ALA A 1 13 ? 11.807  -0.770  2.731   1.00 0.31 ? 13 ALA A CA   4  
ATOM 6707  C C    . ALA A 1 13 ? 12.480  0.438   2.074   1.00 0.31 ? 13 ALA A C    4  
ATOM 6708  O O    . ALA A 1 13 ? 11.826  1.370   1.650   1.00 0.31 ? 13 ALA A O    4  
ATOM 6709  C CB   . ALA A 1 13 ? 11.931  -1.985  1.809   1.00 0.31 ? 13 ALA A CB   4  
ATOM 6710  H H    . ALA A 1 13 ? 9.704   -0.680  2.275   1.00 0.31 ? 13 ALA A H    4  
ATOM 6711  H HA   . ALA A 1 13 ? 12.289  -0.982  3.674   1.00 0.31 ? 13 ALA A HA   4  
ATOM 6712  H HB1  . ALA A 1 13 ? 10.961  -2.444  1.686   1.00 0.31 ? 13 ALA A HB1  4  
ATOM 6713  H HB2  . ALA A 1 13 ? 12.305  -1.670  0.846   1.00 0.31 ? 13 ALA A HB2  4  
ATOM 6714  H HB3  . ALA A 1 13 ? 12.615  -2.699  2.245   1.00 0.31 ? 13 ALA A HB3  4  
ATOM 6715  N N    . TYR A 1 14 ? 13.782  0.428   1.986   1.00 0.29 ? 14 TYR A N    4  
ATOM 6716  C CA   . TYR A 1 14 ? 14.494  1.576   1.356   1.00 0.29 ? 14 TYR A CA   4  
ATOM 6717  C C    . TYR A 1 14 ? 15.643  1.050   0.493   1.00 0.29 ? 14 TYR A C    4  
ATOM 6718  O O    . TYR A 1 14 ? 16.547  0.398   0.977   1.00 0.29 ? 14 TYR A O    4  
ATOM 6719  C CB   . TYR A 1 14 ? 15.055  2.491   2.447   1.00 0.29 ? 14 TYR A CB   4  
ATOM 6720  C CG   . TYR A 1 14 ? 13.915  3.114   3.217   1.00 0.29 ? 14 TYR A CG   4  
ATOM 6721  C CD1  . TYR A 1 14 ? 12.837  3.688   2.530   1.00 0.29 ? 14 TYR A CD1  4  
ATOM 6722  C CD2  . TYR A 1 14 ? 13.936  3.121   4.617   1.00 0.29 ? 14 TYR A CD2  4  
ATOM 6723  C CE1  . TYR A 1 14 ? 11.780  4.267   3.243   1.00 0.29 ? 14 TYR A CE1  4  
ATOM 6724  C CE2  . TYR A 1 14 ? 12.879  3.700   5.329   1.00 0.29 ? 14 TYR A CE2  4  
ATOM 6725  C CZ   . TYR A 1 14 ? 11.801  4.272   4.644   1.00 0.29 ? 14 TYR A CZ   4  
ATOM 6726  O OH   . TYR A 1 14 ? 10.760  4.843   5.346   1.00 0.29 ? 14 TYR A OH   4  
ATOM 6727  H H    . TYR A 1 14 ? 14.291  -0.333  2.333   1.00 0.29 ? 14 TYR A H    4  
ATOM 6728  H HA   . TYR A 1 14 ? 13.805  2.133   0.738   1.00 0.29 ? 14 TYR A HA   4  
ATOM 6729  H HB2  . TYR A 1 14 ? 15.670  1.913   3.121   1.00 0.29 ? 14 TYR A HB2  4  
ATOM 6730  H HB3  . TYR A 1 14 ? 15.650  3.270   1.995   1.00 0.29 ? 14 TYR A HB3  4  
ATOM 6731  H HD1  . TYR A 1 14 ? 12.821  3.683   1.450   1.00 0.29 ? 14 TYR A HD1  4  
ATOM 6732  H HD2  . TYR A 1 14 ? 14.766  2.679   5.146   1.00 0.29 ? 14 TYR A HD2  4  
ATOM 6733  H HE1  . TYR A 1 14 ? 10.950  4.709   2.714   1.00 0.29 ? 14 TYR A HE1  4  
ATOM 6734  H HE2  . TYR A 1 14 ? 12.895  3.704   6.409   1.00 0.29 ? 14 TYR A HE2  4  
ATOM 6735  H HH   . TYR A 1 14 ? 10.896  5.793   5.359   1.00 0.29 ? 14 TYR A HH   4  
ATOM 6736  N N    . ILE A 1 15 ? 15.616  1.328   -0.782  1.00 0.32 ? 15 ILE A N    4  
ATOM 6737  C CA   . ILE A 1 15 ? 16.707  0.842   -1.673  1.00 0.32 ? 15 ILE A CA   4  
ATOM 6738  C C    . ILE A 1 15 ? 17.997  1.602   -1.361  1.00 0.32 ? 15 ILE A C    4  
ATOM 6739  O O    . ILE A 1 15 ? 17.972  2.718   -0.881  1.00 0.32 ? 15 ILE A O    4  
ATOM 6740  C CB   . ILE A 1 15 ? 16.317  1.077   -3.134  1.00 0.32 ? 15 ILE A CB   4  
ATOM 6741  C CG1  . ILE A 1 15 ? 17.338  0.398   -4.049  1.00 0.32 ? 15 ILE A CG1  4  
ATOM 6742  C CG2  . ILE A 1 15 ? 16.295  2.579   -3.422  1.00 0.32 ? 15 ILE A CG2  4  
ATOM 6743  C CD1  . ILE A 1 15 ? 16.632  -0.142  -5.292  1.00 0.32 ? 15 ILE A CD1  4  
ATOM 6744  H H    . ILE A 1 15 ? 14.878  1.855   -1.153  1.00 0.32 ? 15 ILE A H    4  
ATOM 6745  H HA   . ILE A 1 15 ? 16.863  -0.214  -1.508  1.00 0.32 ? 15 ILE A HA   4  
ATOM 6746  H HB   . ILE A 1 15 ? 15.335  0.662   -3.315  1.00 0.32 ? 15 ILE A HB   4  
ATOM 6747  H HG12 . ILE A 1 15 ? 18.090  1.117   -4.344  1.00 0.32 ? 15 ILE A HG12 4  
ATOM 6748  H HG13 . ILE A 1 15 ? 17.809  -0.418  -3.521  1.00 0.32 ? 15 ILE A HG13 4  
ATOM 6749  H HG21 . ILE A 1 15 ? 15.977  3.111   -2.538  1.00 0.32 ? 15 ILE A HG21 4  
ATOM 6750  H HG22 . ILE A 1 15 ? 17.285  2.906   -3.701  1.00 0.32 ? 15 ILE A HG22 4  
ATOM 6751  H HG23 . ILE A 1 15 ? 15.608  2.781   -4.230  1.00 0.32 ? 15 ILE A HG23 4  
ATOM 6752  H HD11 . ILE A 1 15 ? 15.859  -0.836  -4.995  1.00 0.32 ? 15 ILE A HD11 4  
ATOM 6753  H HD12 . ILE A 1 15 ? 16.188  0.677   -5.839  1.00 0.32 ? 15 ILE A HD12 4  
ATOM 6754  H HD13 . ILE A 1 15 ? 17.348  -0.649  -5.922  1.00 0.32 ? 15 ILE A HD13 4  
ATOM 6755  N N    . ALA A 1 16 ? 19.127  1.006   -1.632  1.00 0.38 ? 16 ALA A N    4  
ATOM 6756  C CA   . ALA A 1 16 ? 20.418  1.694   -1.352  1.00 0.38 ? 16 ALA A CA   4  
ATOM 6757  C C    . ALA A 1 16 ? 20.986  2.261   -2.655  1.00 0.38 ? 16 ALA A C    4  
ATOM 6758  O O    . ALA A 1 16 ? 21.636  3.287   -2.666  1.00 0.38 ? 16 ALA A O    4  
ATOM 6759  C CB   . ALA A 1 16 ? 21.410  0.693   -0.757  1.00 0.38 ? 16 ALA A CB   4  
ATOM 6760  H H    . ALA A 1 16 ? 19.125  0.106   -2.019  1.00 0.38 ? 16 ALA A H    4  
ATOM 6761  H HA   . ALA A 1 16 ? 20.254  2.499   -0.651  1.00 0.38 ? 16 ALA A HA   4  
ATOM 6762  H HB1  . ALA A 1 16 ? 21.203  -0.293  -1.144  1.00 0.38 ? 16 ALA A HB1  4  
ATOM 6763  H HB2  . ALA A 1 16 ? 22.416  0.981   -1.025  1.00 0.38 ? 16 ALA A HB2  4  
ATOM 6764  H HB3  . ALA A 1 16 ? 21.313  0.685   0.318   1.00 0.38 ? 16 ALA A HB3  4  
ATOM 6765  N N    . ARG A 1 17 ? 20.743  1.601   -3.754  1.00 0.42 ? 17 ARG A N    4  
ATOM 6766  C CA   . ARG A 1 17 ? 21.268  2.102   -5.056  1.00 0.42 ? 17 ARG A CA   4  
ATOM 6767  C C    . ARG A 1 17 ? 20.228  3.019   -5.706  1.00 0.42 ? 17 ARG A C    4  
ATOM 6768  O O    . ARG A 1 17 ? 19.042  2.827   -5.533  1.00 0.42 ? 17 ARG A O    4  
ATOM 6769  C CB   . ARG A 1 17 ? 21.554  0.917   -5.980  1.00 0.42 ? 17 ARG A CB   4  
ATOM 6770  C CG   . ARG A 1 17 ? 22.997  0.448   -5.778  1.00 0.42 ? 17 ARG A CG   4  
ATOM 6771  C CD   . ARG A 1 17 ? 23.766  0.581   -7.093  1.00 0.42 ? 17 ARG A CD   4  
ATOM 6772  N NE   . ARG A 1 17 ? 24.581  -0.647  -7.317  1.00 0.42 ? 17 ARG A NE   4  
ATOM 6773  C CZ   . ARG A 1 17 ? 25.809  -0.546  -7.748  1.00 0.42 ? 17 ARG A CZ   4  
ATOM 6774  N NH1  . ARG A 1 17 ? 26.040  -0.171  -8.976  1.00 0.42 ? 17 ARG A NH1  4  
ATOM 6775  N NH2  . ARG A 1 17 ? 26.805  -0.820  -6.950  1.00 0.42 ? 17 ARG A NH2  4  
ATOM 6776  H H    . ARG A 1 17 ? 20.216  0.775   -3.724  1.00 0.42 ? 17 ARG A H    4  
ATOM 6777  H HA   . ARG A 1 17 ? 22.181  2.655   -4.887  1.00 0.42 ? 17 ARG A HA   4  
ATOM 6778  H HB2  . ARG A 1 17 ? 20.877  0.108   -5.750  1.00 0.42 ? 17 ARG A HB2  4  
ATOM 6779  H HB3  . ARG A 1 17 ? 21.418  1.220   -7.007  1.00 0.42 ? 17 ARG A HB3  4  
ATOM 6780  H HG2  . ARG A 1 17 ? 23.470  1.057   -5.020  1.00 0.42 ? 17 ARG A HG2  4  
ATOM 6781  H HG3  . ARG A 1 17 ? 23.000  -0.585  -5.464  1.00 0.42 ? 17 ARG A HG3  4  
ATOM 6782  H HD2  . ARG A 1 17 ? 23.069  0.703   -7.908  1.00 0.42 ? 17 ARG A HD2  4  
ATOM 6783  H HD3  . ARG A 1 17 ? 24.418  1.441   -7.045  1.00 0.42 ? 17 ARG A HD3  4  
ATOM 6784  H HE   . ARG A 1 17 ? 24.195  -1.531  -7.140  1.00 0.42 ? 17 ARG A HE   4  
ATOM 6785  H HH11 . ARG A 1 17 ? 25.277  0.039   -9.587  1.00 0.42 ? 17 ARG A HH11 4  
ATOM 6786  H HH12 . ARG A 1 17 ? 26.981  -0.094  -9.306  1.00 0.42 ? 17 ARG A HH12 4  
ATOM 6787  H HH21 . ARG A 1 17 ? 26.627  -1.108  -6.010  1.00 0.42 ? 17 ARG A HH21 4  
ATOM 6788  H HH22 . ARG A 1 17 ? 27.746  -0.743  -7.281  1.00 0.42 ? 17 ARG A HH22 4  
ATOM 6789  N N    . PRO A 1 18 ? 20.711  3.991   -6.437  1.00 0.41 ? 18 PRO A N    4  
ATOM 6790  C CA   . PRO A 1 18 ? 19.850  4.965   -7.132  1.00 0.41 ? 18 PRO A CA   4  
ATOM 6791  C C    . PRO A 1 18 ? 19.265  4.349   -8.408  1.00 0.41 ? 18 PRO A C    4  
ATOM 6792  O O    . PRO A 1 18 ? 19.538  3.214   -8.743  1.00 0.41 ? 18 PRO A O    4  
ATOM 6793  C CB   . PRO A 1 18 ? 20.807  6.112   -7.468  1.00 0.41 ? 18 PRO A CB   4  
ATOM 6794  C CG   . PRO A 1 18 ? 22.232  5.508   -7.465  1.00 0.41 ? 18 PRO A CG   4  
ATOM 6795  C CD   . PRO A 1 18 ? 22.158  4.211   -6.638  1.00 0.41 ? 18 PRO A CD   4  
ATOM 6796  H HA   . PRO A 1 18 ? 19.067  5.316   -6.482  1.00 0.41 ? 18 PRO A HA   4  
ATOM 6797  H HB2  . PRO A 1 18 ? 20.573  6.515   -8.445  1.00 0.41 ? 18 PRO A HB2  4  
ATOM 6798  H HB3  . PRO A 1 18 ? 20.738  6.885   -6.720  1.00 0.41 ? 18 PRO A HB3  4  
ATOM 6799  H HG2  . PRO A 1 18 ? 22.542  5.288   -8.477  1.00 0.41 ? 18 PRO A HG2  4  
ATOM 6800  H HG3  . PRO A 1 18 ? 22.925  6.194   -7.003  1.00 0.41 ? 18 PRO A HG3  4  
ATOM 6801  H HD2  . PRO A 1 18 ? 22.596  3.388   -7.187  1.00 0.41 ? 18 PRO A HD2  4  
ATOM 6802  H HD3  . PRO A 1 18 ? 22.650  4.339   -5.687  1.00 0.41 ? 18 PRO A HD3  4  
ATOM 6803  N N    . LEU A 1 19 ? 18.463  5.093   -9.120  1.00 0.45 ? 19 LEU A N    4  
ATOM 6804  C CA   . LEU A 1 19 ? 17.859  4.555   -10.372 1.00 0.45 ? 19 LEU A CA   4  
ATOM 6805  C C    . LEU A 1 19 ? 18.117  5.542   -11.516 1.00 0.45 ? 19 LEU A C    4  
ATOM 6806  O O    . LEU A 1 19 ? 18.622  6.624   -11.292 1.00 0.45 ? 19 LEU A O    4  
ATOM 6807  C CB   . LEU A 1 19 ? 16.346  4.370   -10.190 1.00 0.45 ? 19 LEU A CB   4  
ATOM 6808  C CG   . LEU A 1 19 ? 16.002  4.274   -8.699  1.00 0.45 ? 19 LEU A CG   4  
ATOM 6809  C CD1  . LEU A 1 19 ? 16.071  5.665   -8.068  1.00 0.45 ? 19 LEU A CD1  4  
ATOM 6810  C CD2  . LEU A 1 19 ? 14.587  3.714   -8.540  1.00 0.45 ? 19 LEU A CD2  4  
ATOM 6811  H H    . LEU A 1 19 ? 18.258  6.007   -8.830  1.00 0.45 ? 19 LEU A H    4  
ATOM 6812  H HA   . LEU A 1 19 ? 18.313  3.604   -10.610 1.00 0.45 ? 19 LEU A HA   4  
ATOM 6813  H HB2  . LEU A 1 19 ? 15.827  5.213   -10.623 1.00 0.45 ? 19 LEU A HB2  4  
ATOM 6814  H HB3  . LEU A 1 19 ? 16.034  3.463   -10.685 1.00 0.45 ? 19 LEU A HB3  4  
ATOM 6815  H HG   . LEU A 1 19 ? 16.708  3.620   -8.209  1.00 0.45 ? 19 LEU A HG   4  
ATOM 6816  H HD11 . LEU A 1 19 ? 16.070  6.414   -8.845  1.00 0.45 ? 19 LEU A HD11 4  
ATOM 6817  H HD12 . LEU A 1 19 ? 15.216  5.812   -7.426  1.00 0.45 ? 19 LEU A HD12 4  
ATOM 6818  H HD13 . LEU A 1 19 ? 16.977  5.751   -7.486  1.00 0.45 ? 19 LEU A HD13 4  
ATOM 6819  H HD21 . LEU A 1 19 ? 14.143  3.574   -9.514  1.00 0.45 ? 19 LEU A HD21 4  
ATOM 6820  H HD22 . LEU A 1 19 ? 14.631  2.766   -8.025  1.00 0.45 ? 19 LEU A HD22 4  
ATOM 6821  H HD23 . LEU A 1 19 ? 13.988  4.407   -7.968  1.00 0.45 ? 19 LEU A HD23 4  
ATOM 6822  N N    . PRO A 1 20 ? 17.761  5.139   -12.709 1.00 0.58 ? 20 PRO A N    4  
ATOM 6823  C CA   . PRO A 1 20 ? 17.942  5.969   -13.912 1.00 0.58 ? 20 PRO A CA   4  
ATOM 6824  C C    . PRO A 1 20 ? 16.849  7.039   -13.988 1.00 0.58 ? 20 PRO A C    4  
ATOM 6825  O O    . PRO A 1 20 ? 15.690  6.742   -14.196 1.00 0.58 ? 20 PRO A O    4  
ATOM 6826  C CB   . PRO A 1 20 ? 17.812  4.968   -15.063 1.00 0.58 ? 20 PRO A CB   4  
ATOM 6827  C CG   . PRO A 1 20 ? 17.017  3.764   -14.504 1.00 0.58 ? 20 PRO A CG   4  
ATOM 6828  C CD   . PRO A 1 20 ? 17.148  3.821   -12.970 1.00 0.58 ? 20 PRO A CD   4  
ATOM 6829  H HA   . PRO A 1 20 ? 18.921  6.420   -13.922 1.00 0.58 ? 20 PRO A HA   4  
ATOM 6830  H HB2  . PRO A 1 20 ? 17.278  5.420   -15.887 1.00 0.58 ? 20 PRO A HB2  4  
ATOM 6831  H HB3  . PRO A 1 20 ? 18.788  4.641   -15.384 1.00 0.58 ? 20 PRO A HB3  4  
ATOM 6832  H HG2  . PRO A 1 20 ? 15.977  3.841   -14.793 1.00 0.58 ? 20 PRO A HG2  4  
ATOM 6833  H HG3  . PRO A 1 20 ? 17.437  2.840   -14.871 1.00 0.58 ? 20 PRO A HG3  4  
ATOM 6834  H HD2  . PRO A 1 20 ? 16.173  3.756   -12.508 1.00 0.58 ? 20 PRO A HD2  4  
ATOM 6835  H HD3  . PRO A 1 20 ? 17.792  3.032   -12.614 1.00 0.58 ? 20 PRO A HD3  4  
ATOM 6836  N N    . ARG A 1 21 ? 17.209  8.282   -13.820 1.00 0.75 ? 21 ARG A N    4  
ATOM 6837  C CA   . ARG A 1 21 ? 16.191  9.369   -13.880 1.00 0.75 ? 21 ARG A CA   4  
ATOM 6838  C C    . ARG A 1 21 ? 15.614  9.452   -15.294 1.00 0.75 ? 21 ARG A C    4  
ATOM 6839  O O    . ARG A 1 21 ? 14.639  10.136  -15.537 1.00 0.75 ? 21 ARG A O    4  
ATOM 6840  C CB   . ARG A 1 21 ? 16.848  10.702  -13.519 1.00 0.75 ? 21 ARG A CB   4  
ATOM 6841  C CG   . ARG A 1 21 ? 18.154  10.856  -14.300 1.00 0.75 ? 21 ARG A CG   4  
ATOM 6842  C CD   . ARG A 1 21 ? 19.321  11.005  -13.320 1.00 0.75 ? 21 ARG A CD   4  
ATOM 6843  N NE   . ARG A 1 21 ? 19.791  12.419  -13.320 1.00 0.75 ? 21 ARG A NE   4  
ATOM 6844  C CZ   . ARG A 1 21 ? 21.063  12.684  -13.454 1.00 0.75 ? 21 ARG A CZ   4  
ATOM 6845  N NH1  . ARG A 1 21 ? 21.705  12.277  -14.514 1.00 0.75 ? 21 ARG A NH1  4  
ATOM 6846  N NH2  . ARG A 1 21 ? 21.690  13.353  -12.526 1.00 0.75 ? 21 ARG A NH2  4  
ATOM 6847  H H    . ARG A 1 21 ? 18.149  8.501   -13.652 1.00 0.75 ? 21 ARG A H    4  
ATOM 6848  H HA   . ARG A 1 21 ? 15.397  9.158   -13.179 1.00 0.75 ? 21 ARG A HA   4  
ATOM 6849  H HB2  . ARG A 1 21 ? 16.180  11.513  -13.771 1.00 0.75 ? 21 ARG A HB2  4  
ATOM 6850  H HB3  . ARG A 1 21 ? 17.059  10.725  -12.460 1.00 0.75 ? 21 ARG A HB3  4  
ATOM 6851  H HG2  . ARG A 1 21 ? 18.311  9.983   -14.915 1.00 0.75 ? 21 ARG A HG2  4  
ATOM 6852  H HG3  . ARG A 1 21 ? 18.099  11.734  -14.926 1.00 0.75 ? 21 ARG A HG3  4  
ATOM 6853  H HD2  . ARG A 1 21 ? 18.993  10.735  -12.327 1.00 0.75 ? 21 ARG A HD2  4  
ATOM 6854  H HD3  . ARG A 1 21 ? 20.129  10.356  -13.622 1.00 0.75 ? 21 ARG A HD3  4  
ATOM 6855  H HE   . ARG A 1 21 ? 19.146  13.151  -13.221 1.00 0.75 ? 21 ARG A HE   4  
ATOM 6856  H HH11 . ARG A 1 21 ? 21.224  11.764  -15.225 1.00 0.75 ? 21 ARG A HH11 4  
ATOM 6857  H HH12 . ARG A 1 21 ? 22.679  12.480  -14.617 1.00 0.75 ? 21 ARG A HH12 4  
ATOM 6858  H HH21 . ARG A 1 21 ? 21.198  13.663  -11.713 1.00 0.75 ? 21 ARG A HH21 4  
ATOM 6859  H HH22 . ARG A 1 21 ? 22.664  13.555  -12.628 1.00 0.75 ? 21 ARG A HH22 4  
ATOM 6860  N N    . ALA A 1 22 ? 16.207  8.762   -16.229 1.00 0.89 ? 22 ALA A N    4  
ATOM 6861  C CA   . ALA A 1 22 ? 15.691  8.805   -17.626 1.00 0.89 ? 22 ALA A CA   4  
ATOM 6862  C C    . ALA A 1 22 ? 14.394  7.997   -17.717 1.00 0.89 ? 22 ALA A C    4  
ATOM 6863  O O    . ALA A 1 22 ? 13.579  8.210   -18.592 1.00 0.89 ? 22 ALA A O    4  
ATOM 6864  C CB   . ALA A 1 22 ? 16.732  8.205   -18.573 1.00 0.89 ? 22 ALA A CB   4  
ATOM 6865  H H    . ALA A 1 22 ? 16.992  8.217   -16.014 1.00 0.89 ? 22 ALA A H    4  
ATOM 6866  H HA   . ALA A 1 22 ? 15.496  9.829   -17.908 1.00 0.89 ? 22 ALA A HA   4  
ATOM 6867  H HB1  . ALA A 1 22 ? 17.189  7.345   -18.107 1.00 0.89 ? 22 ALA A HB1  4  
ATOM 6868  H HB2  . ALA A 1 22 ? 16.251  7.903   -19.493 1.00 0.89 ? 22 ALA A HB2  4  
ATOM 6869  H HB3  . ALA A 1 22 ? 17.490  8.944   -18.789 1.00 0.89 ? 22 ALA A HB3  4  
ATOM 6870  N N    . HIS A 1 23 ? 14.198  7.070   -16.820 1.00 0.71 ? 23 HIS A N    4  
ATOM 6871  C CA   . HIS A 1 23 ? 12.955  6.249   -16.856 1.00 0.71 ? 23 HIS A CA   4  
ATOM 6872  C C    . HIS A 1 23 ? 12.118  6.531   -15.607 1.00 0.71 ? 23 HIS A C    4  
ATOM 6873  O O    . HIS A 1 23 ? 11.257  5.757   -15.237 1.00 0.71 ? 23 HIS A O    4  
ATOM 6874  C CB   . HIS A 1 23 ? 13.325  4.764   -16.896 1.00 0.71 ? 23 HIS A CB   4  
ATOM 6875  C CG   . HIS A 1 23 ? 14.160  4.488   -18.115 1.00 0.71 ? 23 HIS A CG   4  
ATOM 6876  N ND1  . HIS A 1 23 ? 13.958  3.372   -18.911 1.00 0.71 ? 23 HIS A ND1  4  
ATOM 6877  C CD2  . HIS A 1 23 ? 15.204  5.172   -18.687 1.00 0.71 ? 23 HIS A CD2  4  
ATOM 6878  C CE1  . HIS A 1 23 ? 14.860  3.416   -19.909 1.00 0.71 ? 23 HIS A CE1  4  
ATOM 6879  N NE2  . HIS A 1 23 ? 15.645  4.494   -19.820 1.00 0.71 ? 23 HIS A NE2  4  
ATOM 6880  H H    . HIS A 1 23 ? 14.869  6.913   -16.123 1.00 0.71 ? 23 HIS A H    4  
ATOM 6881  H HA   . HIS A 1 23 ? 12.384  6.501   -17.737 1.00 0.71 ? 23 HIS A HA   4  
ATOM 6882  H HB2  . HIS A 1 23 ? 13.886  4.510   -16.009 1.00 0.71 ? 23 HIS A HB2  4  
ATOM 6883  H HB3  . HIS A 1 23 ? 12.424  4.170   -16.935 1.00 0.71 ? 23 HIS A HB3  4  
ATOM 6884  H HD1  . HIS A 1 23 ? 13.282  2.675   -18.774 1.00 0.71 ? 23 HIS A HD1  4  
ATOM 6885  H HD2  . HIS A 1 23 ? 15.618  6.096   -18.315 1.00 0.71 ? 23 HIS A HD2  4  
ATOM 6886  H HE1  . HIS A 1 23 ? 14.940  2.672   -20.687 1.00 0.71 ? 23 HIS A HE1  4  
ATOM 6887  N N    . ILE A 1 24 ? 12.363  7.633   -14.951 1.00 0.56 ? 24 ILE A N    4  
ATOM 6888  C CA   . ILE A 1 24 ? 11.580  7.960   -13.725 1.00 0.56 ? 24 ILE A CA   4  
ATOM 6889  C C    . ILE A 1 24 ? 10.450  8.927   -14.084 1.00 0.56 ? 24 ILE A C    4  
ATOM 6890  O O    . ILE A 1 24 ? 10.567  10.125  -13.913 1.00 0.56 ? 24 ILE A O    4  
ATOM 6891  C CB   . ILE A 1 24 ? 12.501  8.609   -12.691 1.00 0.56 ? 24 ILE A CB   4  
ATOM 6892  C CG1  . ILE A 1 24 ? 13.441  7.549   -12.111 1.00 0.56 ? 24 ILE A CG1  4  
ATOM 6893  C CG2  . ILE A 1 24 ? 11.660  9.214   -11.564 1.00 0.56 ? 24 ILE A CG2  4  
ATOM 6894  C CD1  . ILE A 1 24 ? 14.248  8.155   -10.960 1.00 0.56 ? 24 ILE A CD1  4  
ATOM 6895  H H    . ILE A 1 24 ? 13.062  8.244   -15.264 1.00 0.56 ? 24 ILE A H    4  
ATOM 6896  H HA   . ILE A 1 24 ? 11.161  7.054   -13.314 1.00 0.56 ? 24 ILE A HA   4  
ATOM 6897  H HB   . ILE A 1 24 ? 13.081  9.389   -13.164 1.00 0.56 ? 24 ILE A HB   4  
ATOM 6898  H HG12 . ILE A 1 24 ? 12.860  6.716   -11.744 1.00 0.56 ? 24 ILE A HG12 4  
ATOM 6899  H HG13 . ILE A 1 24 ? 14.116  7.208   -12.880 1.00 0.56 ? 24 ILE A HG13 4  
ATOM 6900  H HG21 . ILE A 1 24 ? 10.891  8.514   -11.274 1.00 0.56 ? 24 ILE A HG21 4  
ATOM 6901  H HG22 . ILE A 1 24 ? 12.294  9.425   -10.716 1.00 0.56 ? 24 ILE A HG22 4  
ATOM 6902  H HG23 . ILE A 1 24 ? 11.203  10.130  -11.908 1.00 0.56 ? 24 ILE A HG23 4  
ATOM 6903  H HD11 . ILE A 1 24 ? 13.955  9.185   -10.819 1.00 0.56 ? 24 ILE A HD11 4  
ATOM 6904  H HD12 . ILE A 1 24 ? 14.055  7.598   -10.054 1.00 0.56 ? 24 ILE A HD12 4  
ATOM 6905  H HD13 . ILE A 1 24 ? 15.301  8.108   -11.194 1.00 0.56 ? 24 ILE A HD13 4  
ATOM 6906  N N    . LYS A 1 25 ? 9.356   8.418   -14.580 1.00 0.59 ? 25 LYS A N    4  
ATOM 6907  C CA   . LYS A 1 25 ? 8.220   9.308   -14.949 1.00 0.59 ? 25 LYS A CA   4  
ATOM 6908  C C    . LYS A 1 25 ? 7.993   10.337  -13.840 1.00 0.59 ? 25 LYS A C    4  
ATOM 6909  O O    . LYS A 1 25 ? 8.152   11.524  -14.040 1.00 0.59 ? 25 LYS A O    4  
ATOM 6910  C CB   . LYS A 1 25 ? 6.954   8.468   -15.129 1.00 0.59 ? 25 LYS A CB   4  
ATOM 6911  C CG   . LYS A 1 25 ? 6.053   9.124   -16.176 1.00 0.59 ? 25 LYS A CG   4  
ATOM 6912  C CD   . LYS A 1 25 ? 4.750   8.332   -16.298 1.00 0.59 ? 25 LYS A CD   4  
ATOM 6913  C CE   . LYS A 1 25 ? 3.591   9.293   -16.569 1.00 0.59 ? 25 LYS A CE   4  
ATOM 6914  N NZ   . LYS A 1 25 ? 3.138   9.140   -17.980 1.00 0.59 ? 25 LYS A NZ   4  
ATOM 6915  H H    . LYS A 1 25 ? 9.281   7.451   -14.710 1.00 0.59 ? 25 LYS A H    4  
ATOM 6916  H HA   . LYS A 1 25 ? 8.448   9.818   -15.873 1.00 0.59 ? 25 LYS A HA   4  
ATOM 6917  H HB2  . LYS A 1 25 ? 7.226   7.475   -15.458 1.00 0.59 ? 25 LYS A HB2  4  
ATOM 6918  H HB3  . LYS A 1 25 ? 6.426   8.405   -14.190 1.00 0.59 ? 25 LYS A HB3  4  
ATOM 6919  H HG2  . LYS A 1 25 ? 5.833   10.139  -15.873 1.00 0.59 ? 25 LYS A HG2  4  
ATOM 6920  H HG3  . LYS A 1 25 ? 6.558   9.134   -17.129 1.00 0.59 ? 25 LYS A HG3  4  
ATOM 6921  H HD2  . LYS A 1 25 ? 4.834   7.628   -17.113 1.00 0.59 ? 25 LYS A HD2  4  
ATOM 6922  H HD3  . LYS A 1 25 ? 4.566   7.799   -15.378 1.00 0.59 ? 25 LYS A HD3  4  
ATOM 6923  H HE2  . LYS A 1 25 ? 2.774   9.067   -15.901 1.00 0.59 ? 25 LYS A HE2  4  
ATOM 6924  H HE3  . LYS A 1 25 ? 3.920   10.309  -16.403 1.00 0.59 ? 25 LYS A HE3  4  
ATOM 6925  H HZ1  . LYS A 1 25 ? 3.772   8.480   -18.477 1.00 0.59 ? 25 LYS A HZ1  4  
ATOM 6926  H HZ2  . LYS A 1 25 ? 2.168   8.768   -17.994 1.00 0.59 ? 25 LYS A HZ2  4  
ATOM 6927  H HZ3  . LYS A 1 25 ? 3.160   10.065  -18.453 1.00 0.59 ? 25 LYS A HZ3  4  
ATOM 6928  N N    . GLU A 1 26 ? 7.621   9.891   -12.671 1.00 0.53 ? 26 GLU A N    4  
ATOM 6929  C CA   . GLU A 1 26 ? 7.383   10.845  -11.552 1.00 0.53 ? 26 GLU A CA   4  
ATOM 6930  C C    . GLU A 1 26 ? 7.402   10.088  -10.223 1.00 0.53 ? 26 GLU A C    4  
ATOM 6931  O O    . GLU A 1 26 ? 7.218   8.888   -10.180 1.00 0.53 ? 26 GLU A O    4  
ATOM 6932  C CB   . GLU A 1 26 ? 6.022   11.519  -11.736 1.00 0.53 ? 26 GLU A CB   4  
ATOM 6933  C CG   . GLU A 1 26 ? 4.937   10.450  -11.871 1.00 0.53 ? 26 GLU A CG   4  
ATOM 6934  C CD   . GLU A 1 26 ? 3.615   11.110  -12.268 1.00 0.53 ? 26 GLU A CD   4  
ATOM 6935  O OE1  . GLU A 1 26 ? 3.598   12.322  -12.405 1.00 0.53 ? 26 GLU A OE1  4  
ATOM 6936  O OE2  . GLU A 1 26 ? 2.642   10.391  -12.430 1.00 0.53 ? 26 GLU A OE2  4  
ATOM 6937  H H    . GLU A 1 26 ? 7.497   8.929   -12.529 1.00 0.53 ? 26 GLU A H    4  
ATOM 6938  H HA   . GLU A 1 26 ? 8.159   11.597  -11.550 1.00 0.53 ? 26 GLU A HA   4  
ATOM 6939  H HB2  . GLU A 1 26 ? 5.810   12.142  -10.879 1.00 0.53 ? 26 GLU A HB2  4  
ATOM 6940  H HB3  . GLU A 1 26 ? 6.037   12.126  -12.629 1.00 0.53 ? 26 GLU A HB3  4  
ATOM 6941  H HG2  . GLU A 1 26 ? 5.226   9.736   -12.628 1.00 0.53 ? 26 GLU A HG2  4  
ATOM 6942  H HG3  . GLU A 1 26 ? 4.812   9.941   -10.926 1.00 0.53 ? 26 GLU A HG3  4  
ATOM 6943  N N    . TYR A 1 27 ? 7.622   10.779  -9.137  1.00 0.39 ? 27 TYR A N    4  
ATOM 6944  C CA   . TYR A 1 27 ? 7.653   10.094  -7.814  1.00 0.39 ? 27 TYR A CA   4  
ATOM 6945  C C    . TYR A 1 27 ? 6.624   10.738  -6.879  1.00 0.39 ? 27 TYR A C    4  
ATOM 6946  O O    . TYR A 1 27 ? 5.851   11.584  -7.278  1.00 0.39 ? 27 TYR A O    4  
ATOM 6947  C CB   . TYR A 1 27 ? 9.055   10.217  -7.208  1.00 0.39 ? 27 TYR A CB   4  
ATOM 6948  C CG   . TYR A 1 27 ? 9.255   11.610  -6.652  1.00 0.39 ? 27 TYR A CG   4  
ATOM 6949  C CD1  . TYR A 1 27 ? 9.658   12.651  -7.497  1.00 0.39 ? 27 TYR A CD1  4  
ATOM 6950  C CD2  . TYR A 1 27 ? 9.037   11.856  -5.292  1.00 0.39 ? 27 TYR A CD2  4  
ATOM 6951  C CE1  . TYR A 1 27 ? 9.841   13.939  -6.980  1.00 0.39 ? 27 TYR A CE1  4  
ATOM 6952  C CE2  . TYR A 1 27 ? 9.220   13.145  -4.775  1.00 0.39 ? 27 TYR A CE2  4  
ATOM 6953  C CZ   . TYR A 1 27 ? 9.623   14.186  -5.620  1.00 0.39 ? 27 TYR A CZ   4  
ATOM 6954  O OH   . TYR A 1 27 ? 9.804   15.456  -5.111  1.00 0.39 ? 27 TYR A OH   4  
ATOM 6955  H H    . TYR A 1 27 ? 7.768   11.747  -9.192  1.00 0.39 ? 27 TYR A H    4  
ATOM 6956  H HA   . TYR A 1 27 ? 7.411   9.049   -7.947  1.00 0.39 ? 27 TYR A HA   4  
ATOM 6957  H HB2  . TYR A 1 27 ? 9.166   9.495   -6.412  1.00 0.39 ? 27 TYR A HB2  4  
ATOM 6958  H HB3  . TYR A 1 27 ? 9.794   10.026  -7.972  1.00 0.39 ? 27 TYR A HB3  4  
ATOM 6959  H HD1  . TYR A 1 27 ? 9.827   12.461  -8.547  1.00 0.39 ? 27 TYR A HD1  4  
ATOM 6960  H HD2  . TYR A 1 27 ? 8.726   11.053  -4.640  1.00 0.39 ? 27 TYR A HD2  4  
ATOM 6961  H HE1  . TYR A 1 27 ? 10.152  14.743  -7.631  1.00 0.39 ? 27 TYR A HE1  4  
ATOM 6962  H HE2  . TYR A 1 27 ? 9.051   13.335  -3.726  1.00 0.39 ? 27 TYR A HE2  4  
ATOM 6963  H HH   . TYR A 1 27 ? 9.710   16.081  -5.833  1.00 0.39 ? 27 TYR A HH   4  
ATOM 6964  N N    . PHE A 1 28 ? 6.615   10.342  -5.635  1.00 0.35 ? 28 PHE A N    4  
ATOM 6965  C CA   . PHE A 1 28 ? 5.642   10.931  -4.673  1.00 0.35 ? 28 PHE A CA   4  
ATOM 6966  C C    . PHE A 1 28 ? 5.861   10.314  -3.290  1.00 0.35 ? 28 PHE A C    4  
ATOM 6967  O O    . PHE A 1 28 ? 6.386   9.225   -3.162  1.00 0.35 ? 28 PHE A O    4  
ATOM 6968  C CB   . PHE A 1 28 ? 4.215   10.643  -5.143  1.00 0.35 ? 28 PHE A CB   4  
ATOM 6969  C CG   . PHE A 1 28 ? 4.116   9.213   -5.618  1.00 0.35 ? 28 PHE A CG   4  
ATOM 6970  C CD1  . PHE A 1 28 ? 4.199   8.162   -4.697  1.00 0.35 ? 28 PHE A CD1  4  
ATOM 6971  C CD2  . PHE A 1 28 ? 3.941   8.940   -6.980  1.00 0.35 ? 28 PHE A CD2  4  
ATOM 6972  C CE1  . PHE A 1 28 ? 4.107   6.837   -5.138  1.00 0.35 ? 28 PHE A CE1  4  
ATOM 6973  C CE2  . PHE A 1 28 ? 3.849   7.614   -7.421  1.00 0.35 ? 28 PHE A CE2  4  
ATOM 6974  C CZ   . PHE A 1 28 ? 3.931   6.563   -6.500  1.00 0.35 ? 28 PHE A CZ   4  
ATOM 6975  H H    . PHE A 1 28 ? 7.249   9.660   -5.333  1.00 0.35 ? 28 PHE A H    4  
ATOM 6976  H HA   . PHE A 1 28 ? 5.793   11.999  -4.616  1.00 0.35 ? 28 PHE A HA   4  
ATOM 6977  H HB2  . PHE A 1 28 ? 3.528   10.798  -4.323  1.00 0.35 ? 28 PHE A HB2  4  
ATOM 6978  H HB3  . PHE A 1 28 ? 3.961   11.310  -5.954  1.00 0.35 ? 28 PHE A HB3  4  
ATOM 6979  H HD1  . PHE A 1 28 ? 4.334   8.374   -3.647  1.00 0.35 ? 28 PHE A HD1  4  
ATOM 6980  H HD2  . PHE A 1 28 ? 3.878   9.750   -7.689  1.00 0.35 ? 28 PHE A HD2  4  
ATOM 6981  H HE1  . PHE A 1 28 ? 4.171   6.026   -4.428  1.00 0.35 ? 28 PHE A HE1  4  
ATOM 6982  H HE2  . PHE A 1 28 ? 3.714   7.403   -8.471  1.00 0.35 ? 28 PHE A HE2  4  
ATOM 6983  H HZ   . PHE A 1 28 ? 3.860   5.541   -6.840  1.00 0.35 ? 28 PHE A HZ   4  
ATOM 6984  N N    . TYR A 1 29 ? 5.466   11.000  -2.254  1.00 0.32 ? 29 TYR A N    4  
ATOM 6985  C CA   . TYR A 1 29 ? 5.654   10.453  -0.881  1.00 0.32 ? 29 TYR A CA   4  
ATOM 6986  C C    . TYR A 1 29 ? 4.426   9.631   -0.484  1.00 0.32 ? 29 TYR A C    4  
ATOM 6987  O O    . TYR A 1 29 ? 3.305   9.979   -0.800  1.00 0.32 ? 29 TYR A O    4  
ATOM 6988  C CB   . TYR A 1 29 ? 5.837   11.606  0.107   1.00 0.32 ? 29 TYR A CB   4  
ATOM 6989  C CG   . TYR A 1 29 ? 7.108   12.353  -0.220  1.00 0.32 ? 29 TYR A CG   4  
ATOM 6990  C CD1  . TYR A 1 29 ? 7.131   13.266  -1.281  1.00 0.32 ? 29 TYR A CD1  4  
ATOM 6991  C CD2  . TYR A 1 29 ? 8.264   12.134  0.539   1.00 0.32 ? 29 TYR A CD2  4  
ATOM 6992  C CE1  . TYR A 1 29 ? 8.309   13.960  -1.582  1.00 0.32 ? 29 TYR A CE1  4  
ATOM 6993  C CE2  . TYR A 1 29 ? 9.442   12.828  0.237   1.00 0.32 ? 29 TYR A CE2  4  
ATOM 6994  C CZ   . TYR A 1 29 ? 9.465   13.740  -0.825  1.00 0.32 ? 29 TYR A CZ   4  
ATOM 6995  O OH   . TYR A 1 29 ? 10.625  14.424  -1.123  1.00 0.32 ? 29 TYR A OH   4  
ATOM 6996  H H    . TYR A 1 29 ? 5.045   11.877  -2.378  1.00 0.32 ? 29 TYR A H    4  
ATOM 6997  H HA   . TYR A 1 29 ? 6.530   9.821   -0.864  1.00 0.32 ? 29 TYR A HA   4  
ATOM 6998  H HB2  . TYR A 1 29 ? 4.995   12.279  0.036   1.00 0.32 ? 29 TYR A HB2  4  
ATOM 6999  H HB3  . TYR A 1 29 ? 5.899   11.214  1.112   1.00 0.32 ? 29 TYR A HB3  4  
ATOM 7000  H HD1  . TYR A 1 29 ? 6.240   13.436  -1.866  1.00 0.32 ? 29 TYR A HD1  4  
ATOM 7001  H HD2  . TYR A 1 29 ? 8.248   11.430  1.357   1.00 0.32 ? 29 TYR A HD2  4  
ATOM 7002  H HE1  . TYR A 1 29 ? 8.326   14.664  -2.401  1.00 0.32 ? 29 TYR A HE1  4  
ATOM 7003  H HE2  . TYR A 1 29 ? 10.334  12.658  0.822   1.00 0.32 ? 29 TYR A HE2  4  
ATOM 7004  H HH   . TYR A 1 29 ? 11.137  14.506  -0.314  1.00 0.32 ? 29 TYR A HH   4  
ATOM 7005  N N    . THR A 1 30 ? 4.628   8.543   0.207   1.00 0.37 ? 30 THR A N    4  
ATOM 7006  C CA   . THR A 1 30 ? 3.474   7.699   0.625   1.00 0.37 ? 30 THR A CA   4  
ATOM 7007  C C    . THR A 1 30 ? 3.394   7.668   2.152   1.00 0.37 ? 30 THR A C    4  
ATOM 7008  O O    . THR A 1 30 ? 4.398   7.632   2.836   1.00 0.37 ? 30 THR A O    4  
ATOM 7009  C CB   . THR A 1 30 ? 3.665   6.276   0.095   1.00 0.37 ? 30 THR A CB   4  
ATOM 7010  O OG1  . THR A 1 30 ? 5.041   5.928   0.165   1.00 0.37 ? 30 THR A OG1  4  
ATOM 7011  C CG2  . THR A 1 30 ? 3.191   6.202   -1.357  1.00 0.37 ? 30 THR A CG2  4  
ATOM 7012  H H    . THR A 1 30 ? 5.540   8.280   0.451   1.00 0.37 ? 30 THR A H    4  
ATOM 7013  H HA   . THR A 1 30 ? 2.561   8.113   0.224   1.00 0.37 ? 30 THR A HA   4  
ATOM 7014  H HB   . THR A 1 30 ? 3.088   5.588   0.693   1.00 0.37 ? 30 THR A HB   4  
ATOM 7015  H HG1  . THR A 1 30 ? 5.308   5.958   1.087   1.00 0.37 ? 30 THR A HG1  4  
ATOM 7016  H HG21 . THR A 1 30 ? 3.745   6.911   -1.953  1.00 0.37 ? 30 THR A HG21 4  
ATOM 7017  H HG22 . THR A 1 30 ? 3.355   5.205   -1.738  1.00 0.37 ? 30 THR A HG22 4  
ATOM 7018  H HG23 . THR A 1 30 ? 2.138   6.437   -1.404  1.00 0.37 ? 30 THR A HG23 4  
ATOM 7019  N N    . SER A 1 31 ? 2.206   7.680   2.694   1.00 0.47 ? 31 SER A N    4  
ATOM 7020  C CA   . SER A 1 31 ? 2.063   7.650   4.176   1.00 0.47 ? 31 SER A CA   4  
ATOM 7021  C C    . SER A 1 31 ? 0.578   7.654   4.546   1.00 0.47 ? 31 SER A C    4  
ATOM 7022  O O    . SER A 1 31 ? -0.265  7.246   3.773   1.00 0.47 ? 31 SER A O    4  
ATOM 7023  C CB   . SER A 1 31 ? 2.740   8.883   4.778   1.00 0.47 ? 31 SER A CB   4  
ATOM 7024  O OG   . SER A 1 31 ? 3.036   8.634   6.146   1.00 0.47 ? 31 SER A OG   4  
ATOM 7025  H H    . SER A 1 31 ? 1.408   7.708   2.125   1.00 0.47 ? 31 SER A H    4  
ATOM 7026  H HA   . SER A 1 31 ? 2.528   6.757   4.565   1.00 0.47 ? 31 SER A HA   4  
ATOM 7027  H HB2  . SER A 1 31 ? 3.656   9.087   4.249   1.00 0.47 ? 31 SER A HB2  4  
ATOM 7028  H HB3  . SER A 1 31 ? 2.078   9.734   4.690   1.00 0.47 ? 31 SER A HB3  4  
ATOM 7029  H HG   . SER A 1 31 ? 3.939   8.312   6.201   1.00 0.47 ? 31 SER A HG   4  
ATOM 7030  N N    . GLY A 1 32 ? 0.251   8.112   5.724   1.00 0.60 ? 32 GLY A N    4  
ATOM 7031  C CA   . GLY A 1 32 ? -1.180  8.141   6.143   1.00 0.60 ? 32 GLY A CA   4  
ATOM 7032  C C    . GLY A 1 32 ? -1.664  6.715   6.409   1.00 0.60 ? 32 GLY A C    4  
ATOM 7033  O O    . GLY A 1 32 ? -1.669  6.250   7.531   1.00 0.60 ? 32 GLY A O    4  
ATOM 7034  H H    . GLY A 1 32 ? 0.947   8.437   6.333   1.00 0.60 ? 32 GLY A H    4  
ATOM 7035  H HA2  . GLY A 1 32 ? -1.278  8.731   7.044   1.00 0.60 ? 32 GLY A HA2  4  
ATOM 7036  H HA3  . GLY A 1 32 ? -1.776  8.580   5.357   1.00 0.60 ? 32 GLY A HA3  4  
ATOM 7037  N N    . LYS A 1 33 ? -2.072  6.017   5.384   1.00 0.55 ? 33 LYS A N    4  
ATOM 7038  C CA   . LYS A 1 33 ? -2.556  4.621   5.578   1.00 0.55 ? 33 LYS A CA   4  
ATOM 7039  C C    . LYS A 1 33 ? -1.371  3.656   5.511   1.00 0.55 ? 33 LYS A C    4  
ATOM 7040  O O    . LYS A 1 33 ? -1.458  2.590   4.937   1.00 0.55 ? 33 LYS A O    4  
ATOM 7041  C CB   . LYS A 1 33 ? -3.558  4.274   4.476   1.00 0.55 ? 33 LYS A CB   4  
ATOM 7042  C CG   . LYS A 1 33 ? -4.738  5.246   4.535   1.00 0.55 ? 33 LYS A CG   4  
ATOM 7043  C CD   . LYS A 1 33 ? -6.033  4.492   4.228   1.00 0.55 ? 33 LYS A CD   4  
ATOM 7044  C CE   . LYS A 1 33 ? -7.068  5.466   3.660   1.00 0.55 ? 33 LYS A CE   4  
ATOM 7045  N NZ   . LYS A 1 33 ? -8.091  4.708   2.887   1.00 0.55 ? 33 LYS A NZ   4  
ATOM 7046  H H    . LYS A 1 33 ? -2.061  6.411   4.488   1.00 0.55 ? 33 LYS A H    4  
ATOM 7047  H HA   . LYS A 1 33 ? -3.037  4.536   6.541   1.00 0.55 ? 33 LYS A HA   4  
ATOM 7048  H HB2  . LYS A 1 33 ? -3.074  4.351   3.513   1.00 0.55 ? 33 LYS A HB2  4  
ATOM 7049  H HB3  . LYS A 1 33 ? -3.916  3.266   4.620   1.00 0.55 ? 33 LYS A HB3  4  
ATOM 7050  H HG2  . LYS A 1 33 ? -4.797  5.681   5.521   1.00 0.55 ? 33 LYS A HG2  4  
ATOM 7051  H HG3  . LYS A 1 33 ? -4.597  6.028   3.804   1.00 0.55 ? 33 LYS A HG3  4  
ATOM 7052  H HD2  . LYS A 1 33 ? -5.834  3.714   3.506   1.00 0.55 ? 33 LYS A HD2  4  
ATOM 7053  H HD3  . LYS A 1 33 ? -6.417  4.052   5.137   1.00 0.55 ? 33 LYS A HD3  4  
ATOM 7054  H HE2  . LYS A 1 33 ? -7.548  5.994   4.471   1.00 0.55 ? 33 LYS A HE2  4  
ATOM 7055  H HE3  . LYS A 1 33 ? -6.577  6.174   3.010   1.00 0.55 ? 33 LYS A HE3  4  
ATOM 7056  H HZ1  . LYS A 1 33 ? -8.075  3.708   3.176   1.00 0.55 ? 33 LYS A HZ1  4  
ATOM 7057  H HZ2  . LYS A 1 33 ? -9.033  5.108   3.072   1.00 0.55 ? 33 LYS A HZ2  4  
ATOM 7058  H HZ3  . LYS A 1 33 ? -7.880  4.775   1.871   1.00 0.55 ? 33 LYS A HZ3  4  
ATOM 7059  N N    . CYS A 1 34 ? -0.263  4.022   6.094   1.00 0.46 ? 34 CYS A N    4  
ATOM 7060  C CA   . CYS A 1 34 ? 0.927   3.125   6.062   1.00 0.46 ? 34 CYS A CA   4  
ATOM 7061  C C    . CYS A 1 34 ? 1.574   3.086   7.448   1.00 0.46 ? 34 CYS A C    4  
ATOM 7062  O O    . CYS A 1 34 ? 0.992   3.507   8.427   1.00 0.46 ? 34 CYS A O    4  
ATOM 7063  C CB   . CYS A 1 34 ? 1.937   3.655   5.043   1.00 0.46 ? 34 CYS A CB   4  
ATOM 7064  S SG   . CYS A 1 34 ? 1.093   3.990   3.477   1.00 0.46 ? 34 CYS A SG   4  
ATOM 7065  H H    . CYS A 1 34 ? -0.212  4.887   6.551   1.00 0.46 ? 34 CYS A H    4  
ATOM 7066  H HA   . CYS A 1 34 ? 0.620   2.129   5.780   1.00 0.46 ? 34 CYS A HA   4  
ATOM 7067  H HB2  . CYS A 1 34 ? 2.381   4.567   5.416   1.00 0.46 ? 34 CYS A HB2  4  
ATOM 7068  H HB3  . CYS A 1 34 ? 2.710   2.917   4.885   1.00 0.46 ? 34 CYS A HB3  4  
ATOM 7069  N N    . SER A 1 35 ? 2.774   2.583   7.537   1.00 0.42 ? 35 SER A N    4  
ATOM 7070  C CA   . SER A 1 35 ? 3.458   2.517   8.859   1.00 0.42 ? 35 SER A CA   4  
ATOM 7071  C C    . SER A 1 35 ? 4.446   3.679   8.981   1.00 0.42 ? 35 SER A C    4  
ATOM 7072  O O    . SER A 1 35 ? 4.679   4.197   10.054  1.00 0.42 ? 35 SER A O    4  
ATOM 7073  C CB   . SER A 1 35 ? 4.213   1.192   8.977   1.00 0.42 ? 35 SER A CB   4  
ATOM 7074  O OG   . SER A 1 35 ? 4.402   0.882   10.351  1.00 0.42 ? 35 SER A OG   4  
ATOM 7075  H H    . SER A 1 35 ? 3.227   2.248   6.734   1.00 0.42 ? 35 SER A H    4  
ATOM 7076  H HA   . SER A 1 35 ? 2.724   2.585   9.648   1.00 0.42 ? 35 SER A HA   4  
ATOM 7077  H HB2  . SER A 1 35 ? 3.641   0.407   8.511   1.00 0.42 ? 35 SER A HB2  4  
ATOM 7078  H HB3  . SER A 1 35 ? 5.170   1.279   8.481   1.00 0.42 ? 35 SER A HB3  4  
ATOM 7079  H HG   . SER A 1 35 ? 3.539   0.847   10.770  1.00 0.42 ? 35 SER A HG   4  
ATOM 7080  N N    . ASN A 1 36 ? 5.029   4.091   7.888   1.00 0.38 ? 36 ASN A N    4  
ATOM 7081  C CA   . ASN A 1 36 ? 6.002   5.220   7.944   1.00 0.38 ? 36 ASN A CA   4  
ATOM 7082  C C    . ASN A 1 36 ? 5.972   5.986   6.619   1.00 0.38 ? 36 ASN A C    4  
ATOM 7083  O O    . ASN A 1 36 ? 5.748   5.406   5.575   1.00 0.38 ? 36 ASN A O    4  
ATOM 7084  C CB   . ASN A 1 36 ? 7.412   4.671   8.182   1.00 0.38 ? 36 ASN A CB   4  
ATOM 7085  C CG   . ASN A 1 36 ? 7.333   3.384   9.006   1.00 0.38 ? 36 ASN A CG   4  
ATOM 7086  O OD1  . ASN A 1 36 ? 7.069   3.423   10.192  1.00 0.38 ? 36 ASN A OD1  4  
ATOM 7087  N ND2  . ASN A 1 36 ? 7.555   2.237   8.424   1.00 0.38 ? 36 ASN A ND2  4  
ATOM 7088  H H    . ASN A 1 36 ? 4.827   3.660   7.031   1.00 0.38 ? 36 ASN A H    4  
ATOM 7089  H HA   . ASN A 1 36 ? 5.734   5.885   8.751   1.00 0.38 ? 36 ASN A HA   4  
ATOM 7090  H HB2  . ASN A 1 36 ? 7.879   4.461   7.230   1.00 0.38 ? 36 ASN A HB2  4  
ATOM 7091  H HB3  . ASN A 1 36 ? 7.997   5.403   8.717   1.00 0.38 ? 36 ASN A HB3  4  
ATOM 7092  H HD21 . ASN A 1 36 ? 7.769   2.205   7.468   1.00 0.38 ? 36 ASN A HD21 4  
ATOM 7093  H HD22 . ASN A 1 36 ? 7.507   1.407   8.943   1.00 0.38 ? 36 ASN A HD22 4  
ATOM 7094  N N    . PRO A 1 37 ? 6.203   7.272   6.702   1.00 0.37 ? 37 PRO A N    4  
ATOM 7095  C CA   . PRO A 1 37 ? 6.214   8.154   5.523   1.00 0.37 ? 37 PRO A CA   4  
ATOM 7096  C C    . PRO A 1 37 ? 7.536   8.006   4.762   1.00 0.37 ? 37 PRO A C    4  
ATOM 7097  O O    . PRO A 1 37 ? 8.604   8.096   5.333   1.00 0.37 ? 37 PRO A O    4  
ATOM 7098  C CB   . PRO A 1 37 ? 6.084   9.557   6.123   1.00 0.37 ? 37 PRO A CB   4  
ATOM 7099  C CG   . PRO A 1 37 ? 6.571   9.452   7.588   1.00 0.37 ? 37 PRO A CG   4  
ATOM 7100  C CD   . PRO A 1 37 ? 6.473   7.964   7.979   1.00 0.37 ? 37 PRO A CD   4  
ATOM 7101  H HA   . PRO A 1 37 ? 5.375   7.946   4.880   1.00 0.37 ? 37 PRO A HA   4  
ATOM 7102  H HB2  . PRO A 1 37 ? 6.701   10.254  5.571   1.00 0.37 ? 37 PRO A HB2  4  
ATOM 7103  H HB3  . PRO A 1 37 ? 5.054   9.875   6.104   1.00 0.37 ? 37 PRO A HB3  4  
ATOM 7104  H HG2  . PRO A 1 37 ? 7.596   9.790   7.661   1.00 0.37 ? 37 PRO A HG2  4  
ATOM 7105  H HG3  . PRO A 1 37 ? 5.938   10.040  8.233   1.00 0.37 ? 37 PRO A HG3  4  
ATOM 7106  H HD2  . PRO A 1 37 ? 7.407   7.625   8.407   1.00 0.37 ? 37 PRO A HD2  4  
ATOM 7107  H HD3  . PRO A 1 37 ? 5.658   7.806   8.668   1.00 0.37 ? 37 PRO A HD3  4  
ATOM 7108  N N    . ALA A 1 38 ? 7.472   7.777   3.479   1.00 0.33 ? 38 ALA A N    4  
ATOM 7109  C CA   . ALA A 1 38 ? 8.725   7.621   2.687   1.00 0.33 ? 38 ALA A CA   4  
ATOM 7110  C C    . ALA A 1 38 ? 8.508   8.161   1.273   1.00 0.33 ? 38 ALA A C    4  
ATOM 7111  O O    . ALA A 1 38 ? 7.508   8.788   0.984   1.00 0.33 ? 38 ALA A O    4  
ATOM 7112  C CB   . ALA A 1 38 ? 9.099   6.140   2.615   1.00 0.33 ? 38 ALA A CB   4  
ATOM 7113  H H    . ALA A 1 38 ? 6.599   7.706   3.036   1.00 0.33 ? 38 ALA A H    4  
ATOM 7114  H HA   . ALA A 1 38 ? 9.523   8.172   3.165   1.00 0.33 ? 38 ALA A HA   4  
ATOM 7115  H HB1  . ALA A 1 38 ? 8.231   5.562   2.340   1.00 0.33 ? 38 ALA A HB1  4  
ATOM 7116  H HB2  . ALA A 1 38 ? 9.874   6.001   1.875   1.00 0.33 ? 38 ALA A HB2  4  
ATOM 7117  H HB3  . ALA A 1 38 ? 9.460   5.813   3.580   1.00 0.33 ? 38 ALA A HB3  4  
ATOM 7118  N N    . VAL A 1 39 ? 9.437   7.923   0.388   1.00 0.30 ? 39 VAL A N    4  
ATOM 7119  C CA   . VAL A 1 39 ? 9.282   8.422   -1.007  1.00 0.30 ? 39 VAL A CA   4  
ATOM 7120  C C    . VAL A 1 39 ? 9.016   7.240   -1.942  1.00 0.30 ? 39 VAL A C    4  
ATOM 7121  O O    . VAL A 1 39 ? 9.240   6.097   -1.592  1.00 0.30 ? 39 VAL A O    4  
ATOM 7122  C CB   . VAL A 1 39 ? 10.563  9.137   -1.438  1.00 0.30 ? 39 VAL A CB   4  
ATOM 7123  C CG1  . VAL A 1 39 ? 10.534  9.377   -2.950  1.00 0.30 ? 39 VAL A CG1  4  
ATOM 7124  C CG2  . VAL A 1 39 ? 10.663  10.482  -0.714  1.00 0.30 ? 39 VAL A CG2  4  
ATOM 7125  H H    . VAL A 1 39 ? 10.236  7.416   0.641   1.00 0.30 ? 39 VAL A H    4  
ATOM 7126  H HA   . VAL A 1 39 ? 8.451   9.110   -1.053  1.00 0.30 ? 39 VAL A HA   4  
ATOM 7127  H HB   . VAL A 1 39 ? 11.418  8.528   -1.187  1.00 0.30 ? 39 VAL A HB   4  
ATOM 7128  H HG11 . VAL A 1 39 ? 9.643   9.929   -3.209  1.00 0.30 ? 39 VAL A HG11 4  
ATOM 7129  H HG12 . VAL A 1 39 ? 11.406  9.943   -3.242  1.00 0.30 ? 39 VAL A HG12 4  
ATOM 7130  H HG13 . VAL A 1 39 ? 10.531  8.427   -3.464  1.00 0.30 ? 39 VAL A HG13 4  
ATOM 7131  H HG21 . VAL A 1 39 ? 10.117  10.430  0.217   1.00 0.30 ? 39 VAL A HG21 4  
ATOM 7132  H HG22 . VAL A 1 39 ? 11.699  10.707  -0.512  1.00 0.30 ? 39 VAL A HG22 4  
ATOM 7133  H HG23 . VAL A 1 39 ? 10.241  11.258  -1.336  1.00 0.30 ? 39 VAL A HG23 4  
ATOM 7134  N N    . VAL A 1 40 ? 8.542   7.503   -3.127  1.00 0.33 ? 40 VAL A N    4  
ATOM 7135  C CA   . VAL A 1 40 ? 8.262   6.395   -4.081  1.00 0.33 ? 40 VAL A CA   4  
ATOM 7136  C C    . VAL A 1 40 ? 8.609   6.845   -5.502  1.00 0.33 ? 40 VAL A C    4  
ATOM 7137  O O    . VAL A 1 40 ? 8.023   7.769   -6.030  1.00 0.33 ? 40 VAL A O    4  
ATOM 7138  C CB   . VAL A 1 40 ? 6.781   6.022   -4.009  1.00 0.33 ? 40 VAL A CB   4  
ATOM 7139  C CG1  . VAL A 1 40 ? 6.425   5.107   -5.182  1.00 0.33 ? 40 VAL A CG1  4  
ATOM 7140  C CG2  . VAL A 1 40 ? 6.503   5.293   -2.692  1.00 0.33 ? 40 VAL A CG2  4  
ATOM 7141  H H    . VAL A 1 40 ? 8.368   8.431   -3.390  1.00 0.33 ? 40 VAL A H    4  
ATOM 7142  H HA   . VAL A 1 40 ? 8.863   5.535   -3.820  1.00 0.33 ? 40 VAL A HA   4  
ATOM 7143  H HB   . VAL A 1 40 ? 6.182   6.920   -4.059  1.00 0.33 ? 40 VAL A HB   4  
ATOM 7144  H HG11 . VAL A 1 40 ? 7.292   4.528   -5.463  1.00 0.33 ? 40 VAL A HG11 4  
ATOM 7145  H HG12 . VAL A 1 40 ? 5.627   4.440   -4.889  1.00 0.33 ? 40 VAL A HG12 4  
ATOM 7146  H HG13 . VAL A 1 40 ? 6.103   5.705   -6.021  1.00 0.33 ? 40 VAL A HG13 4  
ATOM 7147  H HG21 . VAL A 1 40 ? 7.387   4.752   -2.388  1.00 0.33 ? 40 VAL A HG21 4  
ATOM 7148  H HG22 . VAL A 1 40 ? 6.241   6.013   -1.931  1.00 0.33 ? 40 VAL A HG22 4  
ATOM 7149  H HG23 . VAL A 1 40 ? 5.685   4.601   -2.830  1.00 0.33 ? 40 VAL A HG23 4  
ATOM 7150  N N    . PHE A 1 41 ? 9.556   6.199   -6.124  1.00 0.37 ? 41 PHE A N    4  
ATOM 7151  C CA   . PHE A 1 41 ? 9.938   6.591   -7.510  1.00 0.37 ? 41 PHE A CA   4  
ATOM 7152  C C    . PHE A 1 41 ? 9.183   5.719   -8.515  1.00 0.37 ? 41 PHE A C    4  
ATOM 7153  O O    . PHE A 1 41 ? 9.330   4.513   -8.539  1.00 0.37 ? 41 PHE A O    4  
ATOM 7154  C CB   . PHE A 1 41 ? 11.444  6.397   -7.698  1.00 0.37 ? 41 PHE A CB   4  
ATOM 7155  C CG   . PHE A 1 41 ? 12.184  7.531   -7.029  1.00 0.37 ? 41 PHE A CG   4  
ATOM 7156  C CD1  . PHE A 1 41 ? 12.262  8.781   -7.654  1.00 0.37 ? 41 PHE A CD1  4  
ATOM 7157  C CD2  . PHE A 1 41 ? 12.793  7.332   -5.784  1.00 0.37 ? 41 PHE A CD2  4  
ATOM 7158  C CE1  . PHE A 1 41 ? 12.948  9.832   -7.034  1.00 0.37 ? 41 PHE A CE1  4  
ATOM 7159  C CE2  . PHE A 1 41 ? 13.479  8.383   -5.164  1.00 0.37 ? 41 PHE A CE2  4  
ATOM 7160  C CZ   . PHE A 1 41 ? 13.556  9.633   -5.789  1.00 0.37 ? 41 PHE A CZ   4  
ATOM 7161  H H    . PHE A 1 41 ? 10.016  5.456   -5.681  1.00 0.37 ? 41 PHE A H    4  
ATOM 7162  H HA   . PHE A 1 41 ? 9.686   7.628   -7.674  1.00 0.37 ? 41 PHE A HA   4  
ATOM 7163  H HB2  . PHE A 1 41 ? 11.745  5.459   -7.254  1.00 0.37 ? 41 PHE A HB2  4  
ATOM 7164  H HB3  . PHE A 1 41 ? 11.678  6.388   -8.752  1.00 0.37 ? 41 PHE A HB3  4  
ATOM 7165  H HD1  . PHE A 1 41 ? 11.793  8.935   -8.615  1.00 0.37 ? 41 PHE A HD1  4  
ATOM 7166  H HD2  . PHE A 1 41 ? 12.733  6.367   -5.302  1.00 0.37 ? 41 PHE A HD2  4  
ATOM 7167  H HE1  . PHE A 1 41 ? 13.008  10.797  -7.516  1.00 0.37 ? 41 PHE A HE1  4  
ATOM 7168  H HE2  . PHE A 1 41 ? 13.948  8.229   -4.203  1.00 0.37 ? 41 PHE A HE2  4  
ATOM 7169  H HZ   . PHE A 1 41 ? 14.085  10.443  -5.310  1.00 0.37 ? 41 PHE A HZ   4  
ATOM 7170  N N    . VAL A 1 42 ? 8.375   6.319   -9.345  1.00 0.46 ? 42 VAL A N    4  
ATOM 7171  C CA   . VAL A 1 42 ? 7.610   5.525   -10.347 1.00 0.46 ? 42 VAL A CA   4  
ATOM 7172  C C    . VAL A 1 42 ? 8.194   5.767   -11.741 1.00 0.46 ? 42 VAL A C    4  
ATOM 7173  O O    . VAL A 1 42 ? 8.304   6.890   -12.193 1.00 0.46 ? 42 VAL A O    4  
ATOM 7174  C CB   . VAL A 1 42 ? 6.142   5.955   -10.328 1.00 0.46 ? 42 VAL A CB   4  
ATOM 7175  C CG1  . VAL A 1 42 ? 5.312   4.973   -11.157 1.00 0.46 ? 42 VAL A CG1  4  
ATOM 7176  C CG2  . VAL A 1 42 ? 5.633   5.958   -8.884  1.00 0.46 ? 42 VAL A CG2  4  
ATOM 7177  H H    . VAL A 1 42 ? 8.271   7.293   -9.309  1.00 0.46 ? 42 VAL A H    4  
ATOM 7178  H HA   . VAL A 1 42 ? 7.682   4.475   -10.104 1.00 0.46 ? 42 VAL A HA   4  
ATOM 7179  H HB   . VAL A 1 42 ? 6.052   6.946   -10.746 1.00 0.46 ? 42 VAL A HB   4  
ATOM 7180  H HG11 . VAL A 1 42 ? 5.704   4.930   -12.162 1.00 0.46 ? 42 VAL A HG11 4  
ATOM 7181  H HG12 . VAL A 1 42 ? 5.362   3.991   -10.710 1.00 0.46 ? 42 VAL A HG12 4  
ATOM 7182  H HG13 . VAL A 1 42 ? 4.285   5.305   -11.185 1.00 0.46 ? 42 VAL A HG13 4  
ATOM 7183  H HG21 . VAL A 1 42 ? 6.129   5.178   -8.325  1.00 0.46 ? 42 VAL A HG21 4  
ATOM 7184  H HG22 . VAL A 1 42 ? 5.845   6.915   -8.431  1.00 0.46 ? 42 VAL A HG22 4  
ATOM 7185  H HG23 . VAL A 1 42 ? 4.567   5.784   -8.878  1.00 0.46 ? 42 VAL A HG23 4  
ATOM 7186  N N    . THR A 1 43 ? 8.570   4.721   -12.426 1.00 0.54 ? 43 THR A N    4  
ATOM 7187  C CA   . THR A 1 43 ? 9.148   4.888   -13.789 1.00 0.54 ? 43 THR A CA   4  
ATOM 7188  C C    . THR A 1 43 ? 8.025   4.849   -14.828 1.00 0.54 ? 43 THR A C    4  
ATOM 7189  O O    . THR A 1 43 ? 6.871   4.651   -14.503 1.00 0.54 ? 43 THR A O    4  
ATOM 7190  C CB   . THR A 1 43 ? 10.139  3.755   -14.066 1.00 0.54 ? 43 THR A CB   4  
ATOM 7191  O OG1  . THR A 1 43 ? 9.549   2.514   -13.705 1.00 0.54 ? 43 THR A OG1  4  
ATOM 7192  C CG2  . THR A 1 43 ? 11.411  3.976   -13.246 1.00 0.54 ? 43 THR A CG2  4  
ATOM 7193  H H    . THR A 1 43 ? 8.473   3.824   -12.042 1.00 0.54 ? 43 THR A H    4  
ATOM 7194  H HA   . THR A 1 43 ? 9.660   5.837   -13.848 1.00 0.54 ? 43 THR A HA   4  
ATOM 7195  H HB   . THR A 1 43 ? 10.388  3.744   -15.115 1.00 0.54 ? 43 THR A HB   4  
ATOM 7196  H HG1  . THR A 1 43 ? 9.516   1.962   -14.489 1.00 0.54 ? 43 THR A HG1  4  
ATOM 7197  H HG21 . THR A 1 43 ? 11.387  4.960   -12.803 1.00 0.54 ? 43 THR A HG21 4  
ATOM 7198  H HG22 . THR A 1 43 ? 11.469  3.232   -12.465 1.00 0.54 ? 43 THR A HG22 4  
ATOM 7199  H HG23 . THR A 1 43 ? 12.273  3.891   -13.890 1.00 0.54 ? 43 THR A HG23 4  
ATOM 7200  N N    . ARG A 1 44 ? 8.353   5.036   -16.077 1.00 0.69 ? 44 ARG A N    4  
ATOM 7201  C CA   . ARG A 1 44 ? 7.306   5.010   -17.137 1.00 0.69 ? 44 ARG A CA   4  
ATOM 7202  C C    . ARG A 1 44 ? 6.753   3.589   -17.273 1.00 0.69 ? 44 ARG A C    4  
ATOM 7203  O O    . ARG A 1 44 ? 5.702   3.374   -17.844 1.00 0.69 ? 44 ARG A O    4  
ATOM 7204  C CB   . ARG A 1 44 ? 7.916   5.450   -18.469 1.00 0.69 ? 44 ARG A CB   4  
ATOM 7205  C CG   . ARG A 1 44 ? 8.595   6.809   -18.295 1.00 0.69 ? 44 ARG A CG   4  
ATOM 7206  C CD   . ARG A 1 44 ? 8.904   7.406   -19.669 1.00 0.69 ? 44 ARG A CD   4  
ATOM 7207  N NE   . ARG A 1 44 ? 8.416   8.813   -19.722 1.00 0.69 ? 44 ARG A NE   4  
ATOM 7208  C CZ   . ARG A 1 44 ? 9.214   9.793   -19.397 1.00 0.69 ? 44 ARG A CZ   4  
ATOM 7209  N NH1  . ARG A 1 44 ? 10.250  10.065  -20.143 1.00 0.69 ? 44 ARG A NH1  4  
ATOM 7210  N NH2  . ARG A 1 44 ? 8.976   10.502  -18.328 1.00 0.69 ? 44 ARG A NH2  4  
ATOM 7211  H H    . ARG A 1 44 ? 9.290   5.194   -16.319 1.00 0.69 ? 44 ARG A H    4  
ATOM 7212  H HA   . ARG A 1 44 ? 6.505   5.682   -16.867 1.00 0.69 ? 44 ARG A HA   4  
ATOM 7213  H HB2  . ARG A 1 44 ? 8.646   4.720   -18.789 1.00 0.69 ? 44 ARG A HB2  4  
ATOM 7214  H HB3  . ARG A 1 44 ? 7.138   5.531   -19.212 1.00 0.69 ? 44 ARG A HB3  4  
ATOM 7215  H HG2  . ARG A 1 44 ? 7.937   7.473   -17.753 1.00 0.69 ? 44 ARG A HG2  4  
ATOM 7216  H HG3  . ARG A 1 44 ? 9.515   6.685   -17.744 1.00 0.69 ? 44 ARG A HG3  4  
ATOM 7217  H HD2  . ARG A 1 44 ? 9.970   7.389   -19.838 1.00 0.69 ? 44 ARG A HD2  4  
ATOM 7218  H HD3  . ARG A 1 44 ? 8.409   6.825   -20.434 1.00 0.69 ? 44 ARG A HD3  4  
ATOM 7219  H HE   . ARG A 1 44 ? 7.496   9.002   -19.999 1.00 0.69 ? 44 ARG A HE   4  
ATOM 7220  H HH11 . ARG A 1 44 ? 10.432  9.521   -20.964 1.00 0.69 ? 44 ARG A HH11 4  
ATOM 7221  H HH12 . ARG A 1 44 ? 10.862  10.815  -19.895 1.00 0.69 ? 44 ARG A HH12 4  
ATOM 7222  H HH21 . ARG A 1 44 ? 8.182   10.295  -17.756 1.00 0.69 ? 44 ARG A HH21 4  
ATOM 7223  H HH22 . ARG A 1 44 ? 9.589   11.253  -18.080 1.00 0.69 ? 44 ARG A HH22 4  
ATOM 7224  N N    . LYS A 1 45 ? 7.451   2.617   -16.752 1.00 0.66 ? 45 LYS A N    4  
ATOM 7225  C CA   . LYS A 1 45 ? 6.964   1.213   -16.853 1.00 0.66 ? 45 LYS A CA   4  
ATOM 7226  C C    . LYS A 1 45 ? 6.066   0.898   -15.655 1.00 0.66 ? 45 LYS A C    4  
ATOM 7227  O O    . LYS A 1 45 ? 5.865   -0.246  -15.302 1.00 0.66 ? 45 LYS A O    4  
ATOM 7228  C CB   . LYS A 1 45 ? 8.159   0.257   -16.858 1.00 0.66 ? 45 LYS A CB   4  
ATOM 7229  C CG   . LYS A 1 45 ? 9.175   0.714   -17.908 1.00 0.66 ? 45 LYS A CG   4  
ATOM 7230  C CD   . LYS A 1 45 ? 8.481   0.855   -19.264 1.00 0.66 ? 45 LYS A CD   4  
ATOM 7231  C CE   . LYS A 1 45 ? 9.250   0.054   -20.316 1.00 0.66 ? 45 LYS A CE   4  
ATOM 7232  N NZ   . LYS A 1 45 ? 8.654   0.302   -21.660 1.00 0.66 ? 45 LYS A NZ   4  
ATOM 7233  H H    . LYS A 1 45 ? 8.296   2.811   -16.295 1.00 0.66 ? 45 LYS A H    4  
ATOM 7234  H HA   . LYS A 1 45 ? 6.402   1.091   -17.767 1.00 0.66 ? 45 LYS A HA   4  
ATOM 7235  H HB2  . LYS A 1 45 ? 8.624   0.256   -15.883 1.00 0.66 ? 45 LYS A HB2  4  
ATOM 7236  H HB3  . LYS A 1 45 ? 7.822   -0.739  -17.098 1.00 0.66 ? 45 LYS A HB3  4  
ATOM 7237  H HG2  . LYS A 1 45 ? 9.590   1.668   -17.614 1.00 0.66 ? 45 LYS A HG2  4  
ATOM 7238  H HG3  . LYS A 1 45 ? 9.967   -0.015  -17.984 1.00 0.66 ? 45 LYS A HG3  4  
ATOM 7239  H HD2  . LYS A 1 45 ? 7.470   0.478   -19.191 1.00 0.66 ? 45 LYS A HD2  4  
ATOM 7240  H HD3  . LYS A 1 45 ? 8.458   1.895   -19.551 1.00 0.66 ? 45 LYS A HD3  4  
ATOM 7241  H HE2  . LYS A 1 45 ? 10.285  0.363   -20.318 1.00 0.66 ? 45 LYS A HE2  4  
ATOM 7242  H HE3  . LYS A 1 45 ? 9.188   -0.998  -20.084 1.00 0.66 ? 45 LYS A HE3  4  
ATOM 7243  H HZ1  . LYS A 1 45 ? 7.650   0.030   -21.650 1.00 0.66 ? 45 LYS A HZ1  4  
ATOM 7244  H HZ2  . LYS A 1 45 ? 8.738   1.311   -21.896 1.00 0.66 ? 45 LYS A HZ2  4  
ATOM 7245  H HZ3  . LYS A 1 45 ? 9.160   -0.262  -22.372 1.00 0.66 ? 45 LYS A HZ3  4  
ATOM 7246  N N    . ASN A 1 46 ? 5.522   1.905   -15.028 1.00 0.61 ? 46 ASN A N    4  
ATOM 7247  C CA   . ASN A 1 46 ? 4.637   1.663   -13.854 1.00 0.61 ? 46 ASN A CA   4  
ATOM 7248  C C    . ASN A 1 46 ? 5.425   0.933   -12.765 1.00 0.61 ? 46 ASN A C    4  
ATOM 7249  O O    . ASN A 1 46 ? 4.878   0.168   -11.995 1.00 0.61 ? 46 ASN A O    4  
ATOM 7250  C CB   . ASN A 1 46 ? 3.445   0.804   -14.283 1.00 0.61 ? 46 ASN A CB   4  
ATOM 7251  C CG   . ASN A 1 46 ? 2.820   1.394   -15.548 1.00 0.61 ? 46 ASN A CG   4  
ATOM 7252  O OD1  . ASN A 1 46 ? 3.368   1.271   -16.625 1.00 0.61 ? 46 ASN A OD1  4  
ATOM 7253  N ND2  . ASN A 1 46 ? 1.687   2.035   -15.463 1.00 0.61 ? 46 ASN A ND2  4  
ATOM 7254  H H    . ASN A 1 46 ? 5.696   2.821   -15.329 1.00 0.61 ? 46 ASN A H    4  
ATOM 7255  H HA   . ASN A 1 46 ? 4.281   2.607   -13.470 1.00 0.61 ? 46 ASN A HA   4  
ATOM 7256  H HB2  . ASN A 1 46 ? 3.781   -0.203  -14.482 1.00 0.61 ? 46 ASN A HB2  4  
ATOM 7257  H HB3  . ASN A 1 46 ? 2.710   0.790   -13.493 1.00 0.61 ? 46 ASN A HB3  4  
ATOM 7258  H HD21 . ASN A 1 46 ? 1.244   2.134   -14.595 1.00 0.61 ? 46 ASN A HD21 4  
ATOM 7259  H HD22 . ASN A 1 46 ? 1.278   2.417   -16.268 1.00 0.61 ? 46 ASN A HD22 4  
ATOM 7260  N N    . ARG A 1 47 ? 6.708   1.161   -12.693 1.00 0.52 ? 47 ARG A N    4  
ATOM 7261  C CA   . ARG A 1 47 ? 7.530   0.480   -11.654 1.00 0.52 ? 47 ARG A CA   4  
ATOM 7262  C C    . ARG A 1 47 ? 7.564   1.339   -10.388 1.00 0.52 ? 47 ARG A C    4  
ATOM 7263  O O    . ARG A 1 47 ? 8.108   2.425   -10.379 1.00 0.52 ? 47 ARG A O    4  
ATOM 7264  C CB   . ARG A 1 47 ? 8.955   0.283   -12.176 1.00 0.52 ? 47 ARG A CB   4  
ATOM 7265  C CG   . ARG A 1 47 ? 9.370   -1.177  -11.988 1.00 0.52 ? 47 ARG A CG   4  
ATOM 7266  C CD   . ARG A 1 47 ? 10.596  -1.245  -11.076 1.00 0.52 ? 47 ARG A CD   4  
ATOM 7267  N NE   . ARG A 1 47 ? 11.419  -2.432  -11.439 1.00 0.52 ? 47 ARG A NE   4  
ATOM 7268  C CZ   . ARG A 1 47 ? 12.266  -2.928  -10.577 1.00 0.52 ? 47 ARG A CZ   4  
ATOM 7269  N NH1  . ARG A 1 47 ? 13.072  -2.136  -9.925  1.00 0.52 ? 47 ARG A NH1  4  
ATOM 7270  N NH2  . ARG A 1 47 ? 12.305  -4.216  -10.369 1.00 0.52 ? 47 ARG A NH2  4  
ATOM 7271  H H    . ARG A 1 47 ? 7.132   1.781   -13.324 1.00 0.52 ? 47 ARG A H    4  
ATOM 7272  H HA   . ARG A 1 47 ? 7.094   -0.481  -11.424 1.00 0.52 ? 47 ARG A HA   4  
ATOM 7273  H HB2  . ARG A 1 47 ? 8.991   0.537   -13.226 1.00 0.52 ? 47 ARG A HB2  4  
ATOM 7274  H HB3  . ARG A 1 47 ? 9.630   0.921   -11.627 1.00 0.52 ? 47 ARG A HB3  4  
ATOM 7275  H HG2  . ARG A 1 47 ? 8.556   -1.727  -11.541 1.00 0.52 ? 47 ARG A HG2  4  
ATOM 7276  H HG3  . ARG A 1 47 ? 9.614   -1.608  -12.948 1.00 0.52 ? 47 ARG A HG3  4  
ATOM 7277  H HD2  . ARG A 1 47 ? 11.185  -0.348  -11.197 1.00 0.52 ? 47 ARG A HD2  4  
ATOM 7278  H HD3  . ARG A 1 47 ? 10.276  -1.329  -10.048 1.00 0.52 ? 47 ARG A HD3  4  
ATOM 7279  H HE   . ARG A 1 47 ? 11.325  -2.842  -12.325 1.00 0.52 ? 47 ARG A HE   4  
ATOM 7280  H HH11 . ARG A 1 47 ? 13.041  -1.150  -10.085 1.00 0.52 ? 47 ARG A HH11 4  
ATOM 7281  H HH12 . ARG A 1 47 ? 13.719  -2.516  -9.265  1.00 0.52 ? 47 ARG A HH12 4  
ATOM 7282  H HH21 . ARG A 1 47 ? 11.687  -4.823  -10.869 1.00 0.52 ? 47 ARG A HH21 4  
ATOM 7283  H HH22 . ARG A 1 47 ? 12.953  -4.595  -9.709  1.00 0.52 ? 47 ARG A HH22 4  
ATOM 7284  N N    . GLN A 1 48 ? 6.988   0.861   -9.320  1.00 0.45 ? 48 GLN A N    4  
ATOM 7285  C CA   . GLN A 1 48 ? 6.988   1.651   -8.056  1.00 0.45 ? 48 GLN A CA   4  
ATOM 7286  C C    . GLN A 1 48 ? 8.160   1.209   -7.178  1.00 0.45 ? 48 GLN A C    4  
ATOM 7287  O O    . GLN A 1 48 ? 8.339   0.038   -6.909  1.00 0.45 ? 48 GLN A O    4  
ATOM 7288  C CB   . GLN A 1 48 ? 5.674   1.417   -7.308  1.00 0.45 ? 48 GLN A CB   4  
ATOM 7289  C CG   . GLN A 1 48 ? 4.507   1.476   -8.296  1.00 0.45 ? 48 GLN A CG   4  
ATOM 7290  C CD   . GLN A 1 48 ? 4.150   2.936   -8.580  1.00 0.45 ? 48 GLN A CD   4  
ATOM 7291  O OE1  . GLN A 1 48 ? 4.570   3.825   -7.868  1.00 0.45 ? 48 GLN A OE1  4  
ATOM 7292  N NE2  . GLN A 1 48 ? 3.386   3.221   -9.599  1.00 0.45 ? 48 GLN A NE2  4  
ATOM 7293  H H    . GLN A 1 48 ? 6.555   -0.018  -9.348  1.00 0.45 ? 48 GLN A H    4  
ATOM 7294  H HA   . GLN A 1 48 ? 7.089   2.701   -8.288  1.00 0.45 ? 48 GLN A HA   4  
ATOM 7295  H HB2  . GLN A 1 48 ? 5.697   0.446   -6.834  1.00 0.45 ? 48 GLN A HB2  4  
ATOM 7296  H HB3  . GLN A 1 48 ? 5.546   2.182   -6.557  1.00 0.45 ? 48 GLN A HB3  4  
ATOM 7297  H HG2  . GLN A 1 48 ? 4.791   0.987   -9.218  1.00 0.45 ? 48 GLN A HG2  4  
ATOM 7298  H HG3  . GLN A 1 48 ? 3.651   0.974   -7.872  1.00 0.45 ? 48 GLN A HG3  4  
ATOM 7299  H HE21 . GLN A 1 48 ? 3.046   2.503   -10.173 1.00 0.45 ? 48 GLN A HE21 4  
ATOM 7300  H HE22 . GLN A 1 48 ? 3.152   4.153   -9.789  1.00 0.45 ? 48 GLN A HE22 4  
ATOM 7301  N N    . VAL A 1 49 ? 8.960   2.136   -6.729  1.00 0.37 ? 49 VAL A N    4  
ATOM 7302  C CA   . VAL A 1 49 ? 10.119  1.769   -5.869  1.00 0.37 ? 49 VAL A CA   4  
ATOM 7303  C C    . VAL A 1 49 ? 10.087  2.604   -4.588  1.00 0.37 ? 49 VAL A C    4  
ATOM 7304  O O    . VAL A 1 49 ? 9.475   3.653   -4.536  1.00 0.37 ? 49 VAL A O    4  
ATOM 7305  C CB   . VAL A 1 49 ? 11.421  2.041   -6.623  1.00 0.37 ? 49 VAL A CB   4  
ATOM 7306  C CG1  . VAL A 1 49 ? 12.607  1.886   -5.670  1.00 0.37 ? 49 VAL A CG1  4  
ATOM 7307  C CG2  . VAL A 1 49 ? 11.561  1.040   -7.773  1.00 0.37 ? 49 VAL A CG2  4  
ATOM 7308  H H    . VAL A 1 49 ? 8.798   3.076   -6.958  1.00 0.37 ? 49 VAL A H    4  
ATOM 7309  H HA   . VAL A 1 49 ? 10.061  0.720   -5.615  1.00 0.37 ? 49 VAL A HA   4  
ATOM 7310  H HB   . VAL A 1 49 ? 11.405  3.046   -7.019  1.00 0.37 ? 49 VAL A HB   4  
ATOM 7311  H HG11 . VAL A 1 49 ? 12.440  1.040   -5.021  1.00 0.37 ? 49 VAL A HG11 4  
ATOM 7312  H HG12 . VAL A 1 49 ? 13.511  1.730   -6.241  1.00 0.37 ? 49 VAL A HG12 4  
ATOM 7313  H HG13 . VAL A 1 49 ? 12.708  2.782   -5.074  1.00 0.37 ? 49 VAL A HG13 4  
ATOM 7314  H HG21 . VAL A 1 49 ? 11.083  0.111   -7.502  1.00 0.37 ? 49 VAL A HG21 4  
ATOM 7315  H HG22 . VAL A 1 49 ? 11.090  1.441   -8.659  1.00 0.37 ? 49 VAL A HG22 4  
ATOM 7316  H HG23 . VAL A 1 49 ? 12.607  0.862   -7.971  1.00 0.37 ? 49 VAL A HG23 4  
ATOM 7317  N N    . CYS A 1 50 ? 10.740  2.149   -3.554  1.00 0.29 ? 50 CYS A N    4  
ATOM 7318  C CA   . CYS A 1 50 ? 10.744  2.919   -2.278  1.00 0.29 ? 50 CYS A CA   4  
ATOM 7319  C C    . CYS A 1 50 ? 12.104  3.597   -2.095  1.00 0.29 ? 50 CYS A C    4  
ATOM 7320  O O    . CYS A 1 50 ? 13.137  3.020   -2.366  1.00 0.29 ? 50 CYS A O    4  
ATOM 7321  C CB   . CYS A 1 50 ? 10.487  1.968   -1.108  1.00 0.29 ? 50 CYS A CB   4  
ATOM 7322  S SG   . CYS A 1 50 ? 9.104   0.874   -1.514  1.00 0.29 ? 50 CYS A SG   4  
ATOM 7323  H H    . CYS A 1 50 ? 11.226  1.301   -3.616  1.00 0.29 ? 50 CYS A H    4  
ATOM 7324  H HA   . CYS A 1 50 ? 9.969   3.670   -2.308  1.00 0.29 ? 50 CYS A HA   4  
ATOM 7325  H HB2  . CYS A 1 50 ? 11.372  1.376   -0.923  1.00 0.29 ? 50 CYS A HB2  4  
ATOM 7326  H HB3  . CYS A 1 50 ? 10.246  2.540   -0.224  1.00 0.29 ? 50 CYS A HB3  4  
ATOM 7327  N N    . ALA A 1 51 ? 12.110  4.818   -1.636  1.00 0.23 ? 51 ALA A N    4  
ATOM 7328  C CA   . ALA A 1 51 ? 13.402  5.532   -1.435  1.00 0.23 ? 51 ALA A CA   4  
ATOM 7329  C C    . ALA A 1 51 ? 13.313  6.402   -0.179  1.00 0.23 ? 51 ALA A C    4  
ATOM 7330  O O    . ALA A 1 51 ? 12.332  7.081   0.050   1.00 0.23 ? 51 ALA A O    4  
ATOM 7331  C CB   . ALA A 1 51 ? 13.690  6.417   -2.649  1.00 0.23 ? 51 ALA A CB   4  
ATOM 7332  H H    . ALA A 1 51 ? 11.265  5.266   -1.423  1.00 0.23 ? 51 ALA A H    4  
ATOM 7333  H HA   . ALA A 1 51 ? 14.197  4.812   -1.318  1.00 0.23 ? 51 ALA A HA   4  
ATOM 7334  H HB1  . ALA A 1 51 ? 12.760  6.802   -3.042  1.00 0.23 ? 51 ALA A HB1  4  
ATOM 7335  H HB2  . ALA A 1 51 ? 14.322  7.240   -2.353  1.00 0.23 ? 51 ALA A HB2  4  
ATOM 7336  H HB3  . ALA A 1 51 ? 14.188  5.835   -3.409  1.00 0.23 ? 51 ALA A HB3  4  
ATOM 7337  N N    . ASN A 1 52 ? 14.332  6.386   0.637   1.00 0.26 ? 52 ASN A N    4  
ATOM 7338  C CA   . ASN A 1 52 ? 14.305  7.212   1.877   1.00 0.26 ? 52 ASN A CA   4  
ATOM 7339  C C    . ASN A 1 52 ? 14.942  8.577   1.593   1.00 0.26 ? 52 ASN A C    4  
ATOM 7340  O O    . ASN A 1 52 ? 15.898  8.666   0.847   1.00 0.26 ? 52 ASN A O    4  
ATOM 7341  C CB   . ASN A 1 52 ? 15.093  6.498   2.978   1.00 0.26 ? 52 ASN A CB   4  
ATOM 7342  C CG   . ASN A 1 52 ? 15.245  7.426   4.184   1.00 0.26 ? 52 ASN A CG   4  
ATOM 7343  O OD1  . ASN A 1 52 ? 15.713  8.540   4.053   1.00 0.26 ? 52 ASN A OD1  4  
ATOM 7344  N ND2  . ASN A 1 52 ? 14.865  7.012   5.362   1.00 0.26 ? 52 ASN A ND2  4  
ATOM 7345  H H    . ASN A 1 52 ? 15.114  5.831   0.434   1.00 0.26 ? 52 ASN A H    4  
ATOM 7346  H HA   . ASN A 1 52 ? 13.282  7.347   2.195   1.00 0.26 ? 52 ASN A HA   4  
ATOM 7347  H HB2  . ASN A 1 52 ? 14.565  5.603   3.276   1.00 0.26 ? 52 ASN A HB2  4  
ATOM 7348  H HB3  . ASN A 1 52 ? 16.071  6.232   2.605   1.00 0.26 ? 52 ASN A HB3  4  
ATOM 7349  H HD21 . ASN A 1 52 ? 14.487  6.115   5.468   1.00 0.26 ? 52 ASN A HD21 4  
ATOM 7350  H HD22 . ASN A 1 52 ? 14.958  7.600   6.141   1.00 0.26 ? 52 ASN A HD22 4  
ATOM 7351  N N    . PRO A 1 53 ? 14.391  9.602   2.196   1.00 0.30 ? 53 PRO A N    4  
ATOM 7352  C CA   . PRO A 1 53 ? 14.882  10.982  2.030   1.00 0.30 ? 53 PRO A CA   4  
ATOM 7353  C C    . PRO A 1 53 ? 16.106  11.235  2.921   1.00 0.30 ? 53 PRO A C    4  
ATOM 7354  O O    . PRO A 1 53 ? 16.225  12.274  3.541   1.00 0.30 ? 53 PRO A O    4  
ATOM 7355  C CB   . PRO A 1 53 ? 13.699  11.839  2.488   1.00 0.30 ? 53 PRO A CB   4  
ATOM 7356  C CG   . PRO A 1 53 ? 12.840  10.940  3.411   1.00 0.30 ? 53 PRO A CG   4  
ATOM 7357  C CD   . PRO A 1 53 ? 13.222  9.483   3.090   1.00 0.30 ? 53 PRO A CD   4  
ATOM 7358  H HA   . PRO A 1 53 ? 15.109  11.188  0.997   1.00 0.30 ? 53 PRO A HA   4  
ATOM 7359  H HB2  . PRO A 1 53 ? 14.056  12.702  3.032   1.00 0.30 ? 53 PRO A HB2  4  
ATOM 7360  H HB3  . PRO A 1 53 ? 13.113  12.149  1.636   1.00 0.30 ? 53 PRO A HB3  4  
ATOM 7361  H HG2  . PRO A 1 53 ? 13.056  11.164  4.447   1.00 0.30 ? 53 PRO A HG2  4  
ATOM 7362  H HG3  . PRO A 1 53 ? 11.792  11.094  3.208   1.00 0.30 ? 53 PRO A HG3  4  
ATOM 7363  H HD2  . PRO A 1 53 ? 13.487  8.955   3.996   1.00 0.30 ? 53 PRO A HD2  4  
ATOM 7364  H HD3  . PRO A 1 53 ? 12.413  8.982   2.582   1.00 0.30 ? 53 PRO A HD3  4  
ATOM 7365  N N    . GLU A 1 54 ? 17.013  10.299  2.992   1.00 0.43 ? 54 GLU A N    4  
ATOM 7366  C CA   . GLU A 1 54 ? 18.219  10.496  3.844   1.00 0.43 ? 54 GLU A CA   4  
ATOM 7367  C C    . GLU A 1 54 ? 19.462  10.027  3.084   1.00 0.43 ? 54 GLU A C    4  
ATOM 7368  O O    . GLU A 1 54 ? 20.502  9.787   3.664   1.00 0.43 ? 54 GLU A O    4  
ATOM 7369  C CB   . GLU A 1 54 ? 18.073  9.683   5.132   1.00 0.43 ? 54 GLU A CB   4  
ATOM 7370  C CG   . GLU A 1 54 ? 17.006  10.322  6.021   1.00 0.43 ? 54 GLU A CG   4  
ATOM 7371  C CD   . GLU A 1 54 ? 17.097  9.735   7.431   1.00 0.43 ? 54 GLU A CD   4  
ATOM 7372  O OE1  . GLU A 1 54 ? 17.973  10.154  8.170   1.00 0.43 ? 54 GLU A OE1  4  
ATOM 7373  O OE2  . GLU A 1 54 ? 16.290  8.877   7.748   1.00 0.43 ? 54 GLU A OE2  4  
ATOM 7374  H H    . GLU A 1 54 ? 16.902  9.469   2.487   1.00 0.43 ? 54 GLU A H    4  
ATOM 7375  H HA   . GLU A 1 54 ? 18.320  11.543  4.089   1.00 0.43 ? 54 GLU A HA   4  
ATOM 7376  H HB2  . GLU A 1 54 ? 17.781  8.671   4.887   1.00 0.43 ? 54 GLU A HB2  4  
ATOM 7377  H HB3  . GLU A 1 54 ? 19.015  9.669   5.657   1.00 0.43 ? 54 GLU A HB3  4  
ATOM 7378  H HG2  . GLU A 1 54 ? 17.164  11.390  6.064   1.00 0.43 ? 54 GLU A HG2  4  
ATOM 7379  H HG3  . GLU A 1 54 ? 16.027  10.119  5.612   1.00 0.43 ? 54 GLU A HG3  4  
ATOM 7380  N N    . LYS A 1 55 ? 19.362  9.895   1.789   1.00 0.47 ? 55 LYS A N    4  
ATOM 7381  C CA   . LYS A 1 55 ? 20.538  9.441   0.994   1.00 0.47 ? 55 LYS A CA   4  
ATOM 7382  C C    . LYS A 1 55 ? 21.199  10.649  0.326   1.00 0.47 ? 55 LYS A C    4  
ATOM 7383  O O    . LYS A 1 55 ? 20.842  11.783  0.580   1.00 0.47 ? 55 LYS A O    4  
ATOM 7384  C CB   . LYS A 1 55 ? 20.077  8.453   -0.080  1.00 0.47 ? 55 LYS A CB   4  
ATOM 7385  C CG   . LYS A 1 55 ? 20.091  7.035   0.492   1.00 0.47 ? 55 LYS A CG   4  
ATOM 7386  C CD   . LYS A 1 55 ? 21.496  6.444   0.360   1.00 0.47 ? 55 LYS A CD   4  
ATOM 7387  C CE   . LYS A 1 55 ? 21.796  5.563   1.574   1.00 0.47 ? 55 LYS A CE   4  
ATOM 7388  N NZ   . LYS A 1 55 ? 23.271  5.422   1.733   1.00 0.47 ? 55 LYS A NZ   4  
ATOM 7389  H H    . LYS A 1 55 ? 18.514  10.093  1.341   1.00 0.47 ? 55 LYS A H    4  
ATOM 7390  H HA   . LYS A 1 55 ? 21.250  8.957   1.647   1.00 0.47 ? 55 LYS A HA   4  
ATOM 7391  H HB2  . LYS A 1 55 ? 19.075  8.706   -0.395  1.00 0.47 ? 55 LYS A HB2  4  
ATOM 7392  H HB3  . LYS A 1 55 ? 20.745  8.504   -0.927  1.00 0.47 ? 55 LYS A HB3  4  
ATOM 7393  H HG2  . LYS A 1 55 ? 19.809  7.065   1.535   1.00 0.47 ? 55 LYS A HG2  4  
ATOM 7394  H HG3  . LYS A 1 55 ? 19.391  6.419   -0.054  1.00 0.47 ? 55 LYS A HG3  4  
ATOM 7395  H HD2  . LYS A 1 55 ? 21.553  5.849   -0.540  1.00 0.47 ? 55 LYS A HD2  4  
ATOM 7396  H HD3  . LYS A 1 55 ? 22.219  7.243   0.310   1.00 0.47 ? 55 LYS A HD3  4  
ATOM 7397  H HE2  . LYS A 1 55 ? 21.381  6.019   2.461   1.00 0.47 ? 55 LYS A HE2  4  
ATOM 7398  H HE3  . LYS A 1 55 ? 21.355  4.588   1.430   1.00 0.47 ? 55 LYS A HE3  4  
ATOM 7399  H HZ1  . LYS A 1 55 ? 23.698  6.362   1.859   1.00 0.47 ? 55 LYS A HZ1  4  
ATOM 7400  H HZ2  . LYS A 1 55 ? 23.476  4.837   2.567   1.00 0.47 ? 55 LYS A HZ2  4  
ATOM 7401  H HZ3  . LYS A 1 55 ? 23.669  4.970   0.884   1.00 0.47 ? 55 LYS A HZ3  4  
ATOM 7402  N N    . LYS A 1 56 ? 22.160  10.416  -0.526  1.00 0.58 ? 56 LYS A N    4  
ATOM 7403  C CA   . LYS A 1 56 ? 22.841  11.551  -1.208  1.00 0.58 ? 56 LYS A CA   4  
ATOM 7404  C C    . LYS A 1 56 ? 22.270  11.717  -2.618  1.00 0.58 ? 56 LYS A C    4  
ATOM 7405  O O    . LYS A 1 56 ? 22.462  12.730  -3.260  1.00 0.58 ? 56 LYS A O    4  
ATOM 7406  C CB   . LYS A 1 56 ? 24.343  11.265  -1.297  1.00 0.58 ? 56 LYS A CB   4  
ATOM 7407  C CG   . LYS A 1 56 ? 24.796  10.517  -0.042  1.00 0.58 ? 56 LYS A CG   4  
ATOM 7408  C CD   . LYS A 1 56 ? 26.260  10.102  -0.196  1.00 0.58 ? 56 LYS A CD   4  
ATOM 7409  C CE   . LYS A 1 56 ? 26.690  9.282   1.021   1.00 0.58 ? 56 LYS A CE   4  
ATOM 7410  N NZ   . LYS A 1 56 ? 26.861  10.184  2.194   1.00 0.58 ? 56 LYS A NZ   4  
ATOM 7411  H H    . LYS A 1 56 ? 22.433  9.494   -0.716  1.00 0.58 ? 56 LYS A H    4  
ATOM 7412  H HA   . LYS A 1 56 ? 22.681  12.459  -0.645  1.00 0.58 ? 56 LYS A HA   4  
ATOM 7413  H HB2  . LYS A 1 56 ? 24.543  10.662  -2.170  1.00 0.58 ? 56 LYS A HB2  4  
ATOM 7414  H HB3  . LYS A 1 56 ? 24.882  12.198  -1.372  1.00 0.58 ? 56 LYS A HB3  4  
ATOM 7415  H HG2  . LYS A 1 56 ? 24.692  11.161  0.819   1.00 0.58 ? 56 LYS A HG2  4  
ATOM 7416  H HG3  . LYS A 1 56 ? 24.187  9.636   0.092   1.00 0.58 ? 56 LYS A HG3  4  
ATOM 7417  H HD2  . LYS A 1 56 ? 26.374  9.508   -1.091  1.00 0.58 ? 56 LYS A HD2  4  
ATOM 7418  H HD3  . LYS A 1 56 ? 26.879  10.984  -0.268  1.00 0.58 ? 56 LYS A HD3  4  
ATOM 7419  H HE2  . LYS A 1 56 ? 25.935  8.543   1.242   1.00 0.58 ? 56 LYS A HE2  4  
ATOM 7420  H HE3  . LYS A 1 56 ? 27.626  8.786   0.810   1.00 0.58 ? 56 LYS A HE3  4  
ATOM 7421  H HZ1  . LYS A 1 56 ? 26.308  11.053  2.046   1.00 0.58 ? 56 LYS A HZ1  4  
ATOM 7422  H HZ2  . LYS A 1 56 ? 26.527  9.704   3.054   1.00 0.58 ? 56 LYS A HZ2  4  
ATOM 7423  H HZ3  . LYS A 1 56 ? 27.865  10.427  2.303   1.00 0.58 ? 56 LYS A HZ3  4  
ATOM 7424  N N    . TRP A 1 57 ? 21.572  10.729  -3.106  1.00 0.41 ? 57 TRP A N    4  
ATOM 7425  C CA   . TRP A 1 57 ? 20.992  10.832  -4.474  1.00 0.41 ? 57 TRP A CA   4  
ATOM 7426  C C    . TRP A 1 57 ? 19.469  10.948  -4.377  1.00 0.41 ? 57 TRP A C    4  
ATOM 7427  O O    . TRP A 1 57 ? 18.829  11.552  -5.215  1.00 0.41 ? 57 TRP A O    4  
ATOM 7428  C CB   . TRP A 1 57 ? 21.358  9.583   -5.279  1.00 0.41 ? 57 TRP A CB   4  
ATOM 7429  C CG   . TRP A 1 57 ? 20.654  8.395   -4.707  1.00 0.41 ? 57 TRP A CG   4  
ATOM 7430  C CD1  . TRP A 1 57 ? 21.158  7.576   -3.756  1.00 0.41 ? 57 TRP A CD1  4  
ATOM 7431  C CD2  . TRP A 1 57 ? 19.330  7.880   -5.031  1.00 0.41 ? 57 TRP A CD2  4  
ATOM 7432  N NE1  . TRP A 1 57 ? 20.228  6.591   -3.475  1.00 0.41 ? 57 TRP A NE1  4  
ATOM 7433  C CE2  . TRP A 1 57 ? 19.084  6.735   -4.236  1.00 0.41 ? 57 TRP A CE2  4  
ATOM 7434  C CE3  . TRP A 1 57 ? 18.328  8.291   -5.929  1.00 0.41 ? 57 TRP A CE3  4  
ATOM 7435  C CZ2  . TRP A 1 57 ? 17.889  6.024   -4.328  1.00 0.41 ? 57 TRP A CZ2  4  
ATOM 7436  C CZ3  . TRP A 1 57 ? 17.122  7.576   -6.024  1.00 0.41 ? 57 TRP A CZ3  4  
ATOM 7437  C CH2  . TRP A 1 57 ? 16.903  6.445   -5.226  1.00 0.41 ? 57 TRP A CH2  4  
ATOM 7438  H H    . TRP A 1 57 ? 21.429  9.919   -2.572  1.00 0.41 ? 57 TRP A H    4  
ATOM 7439  H HA   . TRP A 1 57 ? 21.388  11.707  -4.968  1.00 0.41 ? 57 TRP A HA   4  
ATOM 7440  H HB2  . TRP A 1 57 ? 21.059  9.718   -6.308  1.00 0.41 ? 57 TRP A HB2  4  
ATOM 7441  H HB3  . TRP A 1 57 ? 22.426  9.424   -5.232  1.00 0.41 ? 57 TRP A HB3  4  
ATOM 7442  H HD1  . TRP A 1 57 ? 22.128  7.676   -3.291  1.00 0.41 ? 57 TRP A HD1  4  
ATOM 7443  H HE1  . TRP A 1 57 ? 20.347  5.871   -2.822  1.00 0.41 ? 57 TRP A HE1  4  
ATOM 7444  H HE3  . TRP A 1 57 ? 18.487  9.160   -6.549  1.00 0.41 ? 57 TRP A HE3  4  
ATOM 7445  H HZ2  . TRP A 1 57 ? 17.724  5.152   -3.711  1.00 0.41 ? 57 TRP A HZ2  4  
ATOM 7446  H HZ3  . TRP A 1 57 ? 16.359  7.900   -6.717  1.00 0.41 ? 57 TRP A HZ3  4  
ATOM 7447  H HH2  . TRP A 1 57 ? 15.974  5.900   -5.304  1.00 0.41 ? 57 TRP A HH2  4  
ATOM 7448  N N    . VAL A 1 58 ? 18.883  10.377  -3.360  1.00 0.32 ? 58 VAL A N    4  
ATOM 7449  C CA   . VAL A 1 58 ? 17.403  10.460  -3.212  1.00 0.32 ? 58 VAL A CA   4  
ATOM 7450  C C    . VAL A 1 58 ? 16.973  11.929  -3.241  1.00 0.32 ? 58 VAL A C    4  
ATOM 7451  O O    . VAL A 1 58 ? 16.246  12.357  -4.117  1.00 0.32 ? 58 VAL A O    4  
ATOM 7452  C CB   . VAL A 1 58 ? 16.986  9.833   -1.880  1.00 0.32 ? 58 VAL A CB   4  
ATOM 7453  C CG1  . VAL A 1 58 ? 15.480  10.017  -1.678  1.00 0.32 ? 58 VAL A CG1  4  
ATOM 7454  C CG2  . VAL A 1 58 ? 17.317  8.340   -1.896  1.00 0.32 ? 58 VAL A CG2  4  
ATOM 7455  H H    . VAL A 1 58 ? 19.416  9.896   -2.693  1.00 0.32 ? 58 VAL A H    4  
ATOM 7456  H HA   . VAL A 1 58 ? 16.929  9.930   -4.025  1.00 0.32 ? 58 VAL A HA   4  
ATOM 7457  H HB   . VAL A 1 58 ? 17.518  10.315  -1.073  1.00 0.32 ? 58 VAL A HB   4  
ATOM 7458  H HG11 . VAL A 1 58 ? 14.989  10.048  -2.639  1.00 0.32 ? 58 VAL A HG11 4  
ATOM 7459  H HG12 . VAL A 1 58 ? 15.091  9.191   -1.101  1.00 0.32 ? 58 VAL A HG12 4  
ATOM 7460  H HG13 . VAL A 1 58 ? 15.299  10.942  -1.150  1.00 0.32 ? 58 VAL A HG13 4  
ATOM 7461  H HG21 . VAL A 1 58 ? 18.316  8.196   -2.283  1.00 0.32 ? 58 VAL A HG21 4  
ATOM 7462  H HG22 . VAL A 1 58 ? 17.261  7.947   -0.892  1.00 0.32 ? 58 VAL A HG22 4  
ATOM 7463  H HG23 . VAL A 1 58 ? 16.610  7.820   -2.526  1.00 0.32 ? 58 VAL A HG23 4  
ATOM 7464  N N    . ARG A 1 59 ? 17.421  12.706  -2.293  1.00 0.34 ? 59 ARG A N    4  
ATOM 7465  C CA   . ARG A 1 59 ? 17.041  14.145  -2.270  1.00 0.34 ? 59 ARG A CA   4  
ATOM 7466  C C    . ARG A 1 59 ? 17.509  14.809  -3.566  1.00 0.34 ? 59 ARG A C    4  
ATOM 7467  O O    . ARG A 1 59 ? 17.013  15.845  -3.961  1.00 0.34 ? 59 ARG A O    4  
ATOM 7468  C CB   . ARG A 1 59 ? 17.708  14.831  -1.074  1.00 0.34 ? 59 ARG A CB   4  
ATOM 7469  C CG   . ARG A 1 59 ? 17.297  16.304  -1.035  1.00 0.34 ? 59 ARG A CG   4  
ATOM 7470  C CD   . ARG A 1 59 ? 18.545  17.184  -1.092  1.00 0.34 ? 59 ARG A CD   4  
ATOM 7471  N NE   . ARG A 1 59 ? 18.545  17.964  -2.363  1.00 0.34 ? 59 ARG A NE   4  
ATOM 7472  C CZ   . ARG A 1 59 ? 19.334  18.995  -2.496  1.00 0.34 ? 59 ARG A CZ   4  
ATOM 7473  N NH1  . ARG A 1 59 ? 19.067  20.106  -1.868  1.00 0.34 ? 59 ARG A NH1  4  
ATOM 7474  N NH2  . ARG A 1 59 ? 20.391  18.914  -3.257  1.00 0.34 ? 59 ARG A NH2  4  
ATOM 7475  H H    . ARG A 1 59 ? 18.008  12.343  -1.597  1.00 0.34 ? 59 ARG A H    4  
ATOM 7476  H HA   . ARG A 1 59 ? 15.968  14.235  -2.185  1.00 0.34 ? 59 ARG A HA   4  
ATOM 7477  H HB2  . ARG A 1 59 ? 17.397  14.343  -0.162  1.00 0.34 ? 59 ARG A HB2  4  
ATOM 7478  H HB3  . ARG A 1 59 ? 18.781  14.761  -1.172  1.00 0.34 ? 59 ARG A HB3  4  
ATOM 7479  H HG2  . ARG A 1 59 ? 16.660  16.522  -1.880  1.00 0.34 ? 59 ARG A HG2  4  
ATOM 7480  H HG3  . ARG A 1 59 ? 16.760  16.503  -0.119  1.00 0.34 ? 59 ARG A HG3  4  
ATOM 7481  H HD2  . ARG A 1 59 ? 18.546  17.865  -0.253  1.00 0.34 ? 59 ARG A HD2  4  
ATOM 7482  H HD3  . ARG A 1 59 ? 19.427  16.562  -1.053  1.00 0.34 ? 59 ARG A HD3  4  
ATOM 7483  H HE   . ARG A 1 59 ? 17.952  17.702  -3.098  1.00 0.34 ? 59 ARG A HE   4  
ATOM 7484  H HH11 . ARG A 1 59 ? 18.257  20.168  -1.285  1.00 0.34 ? 59 ARG A HH11 4  
ATOM 7485  H HH12 . ARG A 1 59 ? 19.671  20.897  -1.970  1.00 0.34 ? 59 ARG A HH12 4  
ATOM 7486  H HH21 . ARG A 1 59 ? 20.595  18.061  -3.739  1.00 0.34 ? 59 ARG A HH21 4  
ATOM 7487  H HH22 . ARG A 1 59 ? 20.995  19.704  -3.360  1.00 0.34 ? 59 ARG A HH22 4  
ATOM 7488  N N    . GLU A 1 60 ? 18.461  14.216  -4.233  1.00 0.37 ? 60 GLU A N    4  
ATOM 7489  C CA   . GLU A 1 60 ? 18.962  14.807  -5.505  1.00 0.37 ? 60 GLU A CA   4  
ATOM 7490  C C    . GLU A 1 60 ? 17.910  14.619  -6.601  1.00 0.37 ? 60 GLU A C    4  
ATOM 7491  O O    . GLU A 1 60 ? 17.755  15.449  -7.474  1.00 0.37 ? 60 GLU A O    4  
ATOM 7492  C CB   . GLU A 1 60 ? 20.259  14.106  -5.916  1.00 0.37 ? 60 GLU A CB   4  
ATOM 7493  C CG   . GLU A 1 60 ? 21.454  14.844  -5.309  1.00 0.37 ? 60 GLU A CG   4  
ATOM 7494  C CD   . GLU A 1 60 ? 22.739  14.072  -5.612  1.00 0.37 ? 60 GLU A CD   4  
ATOM 7495  O OE1  . GLU A 1 60 ? 22.657  13.070  -6.303  1.00 0.37 ? 60 GLU A OE1  4  
ATOM 7496  O OE2  . GLU A 1 60 ? 23.785  14.496  -5.148  1.00 0.37 ? 60 GLU A OE2  4  
ATOM 7497  H H    . GLU A 1 60 ? 18.846  13.379  -3.898  1.00 0.37 ? 60 GLU A H    4  
ATOM 7498  H HA   . GLU A 1 60 ? 19.151  15.861  -5.364  1.00 0.37 ? 60 GLU A HA   4  
ATOM 7499  H HB2  . GLU A 1 60 ? 20.245  13.086  -5.557  1.00 0.37 ? 60 GLU A HB2  4  
ATOM 7500  H HB3  . GLU A 1 60 ? 20.346  14.109  -6.991  1.00 0.37 ? 60 GLU A HB3  4  
ATOM 7501  H HG2  . GLU A 1 60 ? 21.518  15.835  -5.736  1.00 0.37 ? 60 GLU A HG2  4  
ATOM 7502  H HG3  . GLU A 1 60 ? 21.325  14.919  -4.240  1.00 0.37 ? 60 GLU A HG3  4  
ATOM 7503  N N    . TYR A 1 61 ? 17.187  13.534  -6.559  1.00 0.36 ? 61 TYR A N    4  
ATOM 7504  C CA   . TYR A 1 61 ? 16.145  13.293  -7.595  1.00 0.36 ? 61 TYR A CA   4  
ATOM 7505  C C    . TYR A 1 61 ? 14.914  14.147  -7.287  1.00 0.36 ? 61 TYR A C    4  
ATOM 7506  O O    . TYR A 1 61 ? 14.334  14.756  -8.163  1.00 0.36 ? 61 TYR A O    4  
ATOM 7507  C CB   . TYR A 1 61 ? 15.754  11.811  -7.590  1.00 0.36 ? 61 TYR A CB   4  
ATOM 7508  C CG   . TYR A 1 61 ? 16.676  11.032  -8.504  1.00 0.36 ? 61 TYR A CG   4  
ATOM 7509  C CD1  . TYR A 1 61 ? 17.886  11.593  -8.935  1.00 0.36 ? 61 TYR A CD1  4  
ATOM 7510  C CD2  . TYR A 1 61 ? 16.318  9.742   -8.918  1.00 0.36 ? 61 TYR A CD2  4  
ATOM 7511  C CE1  . TYR A 1 61 ? 18.734  10.867  -9.779  1.00 0.36 ? 61 TYR A CE1  4  
ATOM 7512  C CE2  . TYR A 1 61 ? 17.167  9.017   -9.761  1.00 0.36 ? 61 TYR A CE2  4  
ATOM 7513  C CZ   . TYR A 1 61 ? 18.375  9.579   -10.192 1.00 0.36 ? 61 TYR A CZ   4  
ATOM 7514  O OH   . TYR A 1 61 ? 19.213  8.863   -11.023 1.00 0.36 ? 61 TYR A OH   4  
ATOM 7515  H H    . TYR A 1 61 ? 17.327  12.878  -5.845  1.00 0.36 ? 61 TYR A H    4  
ATOM 7516  H HA   . TYR A 1 61 ? 16.534  13.559  -8.567  1.00 0.36 ? 61 TYR A HA   4  
ATOM 7517  H HB2  . TYR A 1 61 ? 15.833  11.424  -6.585  1.00 0.36 ? 61 TYR A HB2  4  
ATOM 7518  H HB3  . TYR A 1 61 ? 14.736  11.708  -7.937  1.00 0.36 ? 61 TYR A HB3  4  
ATOM 7519  H HD1  . TYR A 1 61 ? 18.164  12.587  -8.617  1.00 0.36 ? 61 TYR A HD1  4  
ATOM 7520  H HD2  . TYR A 1 61 ? 15.387  9.308   -8.587  1.00 0.36 ? 61 TYR A HD2  4  
ATOM 7521  H HE1  . TYR A 1 61 ? 19.666  11.300  -10.110 1.00 0.36 ? 61 TYR A HE1  4  
ATOM 7522  H HE2  . TYR A 1 61 ? 16.890  8.022   -10.080 1.00 0.36 ? 61 TYR A HE2  4  
ATOM 7523  H HH   . TYR A 1 61 ? 20.117  9.104   -10.811 1.00 0.36 ? 61 TYR A HH   4  
ATOM 7524  N N    . ILE A 1 62 ? 14.514  14.200  -6.046  1.00 0.38 ? 62 ILE A N    4  
ATOM 7525  C CA   . ILE A 1 62 ? 13.323  15.019  -5.684  1.00 0.38 ? 62 ILE A CA   4  
ATOM 7526  C C    . ILE A 1 62 ? 13.599  16.487  -6.014  1.00 0.38 ? 62 ILE A C    4  
ATOM 7527  O O    . ILE A 1 62 ? 12.773  17.172  -6.583  1.00 0.38 ? 62 ILE A O    4  
ATOM 7528  C CB   . ILE A 1 62 ? 13.040  14.876  -4.187  1.00 0.38 ? 62 ILE A CB   4  
ATOM 7529  C CG1  . ILE A 1 62 ? 12.521  13.466  -3.900  1.00 0.38 ? 62 ILE A CG1  4  
ATOM 7530  C CG2  . ILE A 1 62 ? 11.985  15.901  -3.768  1.00 0.38 ? 62 ILE A CG2  4  
ATOM 7531  C CD1  . ILE A 1 62 ? 13.479  12.754  -2.943  1.00 0.38 ? 62 ILE A CD1  4  
ATOM 7532  H H    . ILE A 1 62 ? 14.997  13.702  -5.352  1.00 0.38 ? 62 ILE A H    4  
ATOM 7533  H HA   . ILE A 1 62 ? 12.466  14.677  -6.247  1.00 0.38 ? 62 ILE A HA   4  
ATOM 7534  H HB   . ILE A 1 62 ? 13.950  15.047  -3.631  1.00 0.38 ? 62 ILE A HB   4  
ATOM 7535  H HG12 . ILE A 1 62 ? 11.540  13.528  -3.449  1.00 0.38 ? 62 ILE A HG12 4  
ATOM 7536  H HG13 . ILE A 1 62 ? 12.457  12.909  -4.823  1.00 0.38 ? 62 ILE A HG13 4  
ATOM 7537  H HG21 . ILE A 1 62 ? 11.713  16.507  -4.619  1.00 0.38 ? 62 ILE A HG21 4  
ATOM 7538  H HG22 . ILE A 1 62 ? 11.111  15.387  -3.398  1.00 0.38 ? 62 ILE A HG22 4  
ATOM 7539  H HG23 . ILE A 1 62 ? 12.388  16.534  -2.990  1.00 0.38 ? 62 ILE A HG23 4  
ATOM 7540  H HD11 . ILE A 1 62 ? 14.204  13.461  -2.567  1.00 0.38 ? 62 ILE A HD11 4  
ATOM 7541  H HD12 . ILE A 1 62 ? 12.921  12.337  -2.118  1.00 0.38 ? 62 ILE A HD12 4  
ATOM 7542  H HD13 . ILE A 1 62 ? 13.990  11.960  -3.469  1.00 0.38 ? 62 ILE A HD13 4  
ATOM 7543  N N    . ASN A 1 63 ? 14.758  16.973  -5.664  1.00 0.49 ? 63 ASN A N    4  
ATOM 7544  C CA   . ASN A 1 63 ? 15.091  18.395  -5.959  1.00 0.49 ? 63 ASN A CA   4  
ATOM 7545  C C    . ASN A 1 63 ? 15.205  18.585  -7.472  1.00 0.49 ? 63 ASN A C    4  
ATOM 7546  O O    . ASN A 1 63 ? 14.824  19.605  -8.010  1.00 0.49 ? 63 ASN A O    4  
ATOM 7547  C CB   . ASN A 1 63 ? 16.422  18.754  -5.295  1.00 0.49 ? 63 ASN A CB   4  
ATOM 7548  C CG   . ASN A 1 63 ? 16.919  20.096  -5.836  1.00 0.49 ? 63 ASN A CG   4  
ATOM 7549  O OD1  . ASN A 1 63 ? 16.205  21.079  -5.802  1.00 0.49 ? 63 ASN A OD1  4  
ATOM 7550  N ND2  . ASN A 1 63 ? 18.121  20.180  -6.336  1.00 0.49 ? 63 ASN A ND2  4  
ATOM 7551  H H    . ASN A 1 63 ? 15.411  16.402  -5.207  1.00 0.49 ? 63 ASN A H    4  
ATOM 7552  H HA   . ASN A 1 63 ? 14.311  19.034  -5.572  1.00 0.49 ? 63 ASN A HA   4  
ATOM 7553  H HB2  . ASN A 1 63 ? 16.284  18.824  -4.225  1.00 0.49 ? 63 ASN A HB2  4  
ATOM 7554  H HB3  . ASN A 1 63 ? 17.152  17.988  -5.514  1.00 0.49 ? 63 ASN A HB3  4  
ATOM 7555  H HD21 . ASN A 1 63 ? 18.696  19.387  -6.364  1.00 0.49 ? 63 ASN A HD21 4  
ATOM 7556  H HD22 . ASN A 1 63 ? 18.447  21.036  -6.684  1.00 0.49 ? 63 ASN A HD22 4  
ATOM 7557  N N    . SER A 1 64 ? 15.726  17.608  -8.164  1.00 0.55 ? 64 SER A N    4  
ATOM 7558  C CA   . SER A 1 64 ? 15.863  17.732  -9.642  1.00 0.55 ? 64 SER A CA   4  
ATOM 7559  C C    . SER A 1 64 ? 14.497  17.515  -10.296 1.00 0.55 ? 64 SER A C    4  
ATOM 7560  O O    . SER A 1 64 ? 14.292  17.838  -11.450 1.00 0.55 ? 64 SER A O    4  
ATOM 7561  C CB   . SER A 1 64 ? 16.846  16.678  -10.153 1.00 0.55 ? 64 SER A CB   4  
ATOM 7562  O OG   . SER A 1 64 ? 16.588  15.440  -9.503  1.00 0.55 ? 64 SER A OG   4  
ATOM 7563  H H    . SER A 1 64 ? 16.026  16.792  -7.711  1.00 0.55 ? 64 SER A H    4  
ATOM 7564  H HA   . SER A 1 64 ? 16.230  18.717  -9.889  1.00 0.55 ? 64 SER A HA   4  
ATOM 7565  H HB2  . SER A 1 64 ? 16.722  16.552  -11.216 1.00 0.55 ? 64 SER A HB2  4  
ATOM 7566  H HB3  . SER A 1 64 ? 17.858  17.001  -9.946  1.00 0.55 ? 64 SER A HB3  4  
ATOM 7567  H HG   . SER A 1 64 ? 15.803  15.055  -9.900  1.00 0.55 ? 64 SER A HG   4  
ATOM 7568  N N    . LEU A 1 65 ? 13.561  16.972  -9.567  1.00 0.53 ? 65 LEU A N    4  
ATOM 7569  C CA   . LEU A 1 65 ? 12.208  16.736  -10.144 1.00 0.53 ? 65 LEU A CA   4  
ATOM 7570  C C    . LEU A 1 65 ? 11.407  18.039  -10.111 1.00 0.53 ? 65 LEU A C    4  
ATOM 7571  O O    . LEU A 1 65 ? 10.836  18.454  -11.101 1.00 0.53 ? 65 LEU A O    4  
ATOM 7572  C CB   . LEU A 1 65 ? 11.482  15.669  -9.322  1.00 0.53 ? 65 LEU A CB   4  
ATOM 7573  C CG   . LEU A 1 65 ? 10.930  14.591  -10.255 1.00 0.53 ? 65 LEU A CG   4  
ATOM 7574  C CD1  . LEU A 1 65 ? 10.112  15.249  -11.369 1.00 0.53 ? 65 LEU A CD1  4  
ATOM 7575  C CD2  . LEU A 1 65 ? 12.090  13.807  -10.872 1.00 0.53 ? 65 LEU A CD2  4  
ATOM 7576  H H    . LEU A 1 65 ? 13.747  16.720  -8.639  1.00 0.53 ? 65 LEU A H    4  
ATOM 7577  H HA   . LEU A 1 65 ? 12.306  16.399  -11.166 1.00 0.53 ? 65 LEU A HA   4  
ATOM 7578  H HB2  . LEU A 1 65 ? 12.175  15.221  -8.623  1.00 0.53 ? 65 LEU A HB2  4  
ATOM 7579  H HB3  . LEU A 1 65 ? 10.668  16.124  -8.780  1.00 0.53 ? 65 LEU A HB3  4  
ATOM 7580  H HG   . LEU A 1 65 ? 10.296  13.919  -9.694  1.00 0.53 ? 65 LEU A HG   4  
ATOM 7581  H HD11 . LEU A 1 65 ? 9.881   16.267  -11.091 1.00 0.53 ? 65 LEU A HD11 4  
ATOM 7582  H HD12 . LEU A 1 65 ? 10.684  15.246  -12.285 1.00 0.53 ? 65 LEU A HD12 4  
ATOM 7583  H HD13 . LEU A 1 65 ? 9.195   14.699  -11.515 1.00 0.53 ? 65 LEU A HD13 4  
ATOM 7584  H HD21 . LEU A 1 65 ? 12.975  14.425  -10.885 1.00 0.53 ? 65 LEU A HD21 4  
ATOM 7585  H HD22 . LEU A 1 65 ? 12.279  12.922  -10.284 1.00 0.53 ? 65 LEU A HD22 4  
ATOM 7586  H HD23 . LEU A 1 65 ? 11.836  13.521  -11.882 1.00 0.53 ? 65 LEU A HD23 4  
ATOM 7587  N N    . GLU A 1 66 ? 11.360  18.688  -8.979  1.00 0.61 ? 66 GLU A N    4  
ATOM 7588  C CA   . GLU A 1 66 ? 10.598  19.964  -8.883  1.00 0.61 ? 66 GLU A CA   4  
ATOM 7589  C C    . GLU A 1 66 ? 11.521  21.137  -9.223  1.00 0.61 ? 66 GLU A C    4  
ATOM 7590  O O    . GLU A 1 66 ? 12.423  21.015  -10.027 1.00 0.61 ? 66 GLU A O    4  
ATOM 7591  C CB   . GLU A 1 66 ? 10.060  20.130  -7.460  1.00 0.61 ? 66 GLU A CB   4  
ATOM 7592  C CG   . GLU A 1 66 ? 9.283   18.876  -7.058  1.00 0.61 ? 66 GLU A CG   4  
ATOM 7593  C CD   . GLU A 1 66 ? 8.718   19.054  -5.647  1.00 0.61 ? 66 GLU A CD   4  
ATOM 7594  O OE1  . GLU A 1 66 ? 7.915   19.953  -5.461  1.00 0.61 ? 66 GLU A OE1  4  
ATOM 7595  O OE2  . GLU A 1 66 ? 9.100   18.288  -4.777  1.00 0.61 ? 66 GLU A OE2  4  
ATOM 7596  H H    . GLU A 1 66 ? 11.828  18.338  -8.194  1.00 0.61 ? 66 GLU A H    4  
ATOM 7597  H HA   . GLU A 1 66 ? 9.772   19.943  -9.580  1.00 0.61 ? 66 GLU A HA   4  
ATOM 7598  H HB2  . GLU A 1 66 ? 10.885  20.277  -6.779  1.00 0.61 ? 66 GLU A HB2  4  
ATOM 7599  H HB3  . GLU A 1 66 ? 9.404   20.986  -7.421  1.00 0.61 ? 66 GLU A HB3  4  
ATOM 7600  H HG2  . GLU A 1 66 ? 8.472   18.717  -7.754  1.00 0.61 ? 66 GLU A HG2  4  
ATOM 7601  H HG3  . GLU A 1 66 ? 9.943   18.022  -7.074  1.00 0.61 ? 66 GLU A HG3  4  
ATOM 7602  N N    . MET A 1 67 ? 11.303  22.272  -8.617  1.00 1.45 ? 67 MET A N    4  
ATOM 7603  C CA   . MET A 1 67 ? 12.169  23.449  -8.907  1.00 1.45 ? 67 MET A CA   4  
ATOM 7604  C C    . MET A 1 67 ? 13.311  23.509  -7.890  1.00 1.45 ? 67 MET A C    4  
ATOM 7605  O O    . MET A 1 67 ? 14.423  23.107  -8.167  1.00 1.45 ? 67 MET A O    4  
ATOM 7606  C CB   . MET A 1 67 ? 11.334  24.730  -8.817  1.00 1.45 ? 67 MET A CB   4  
ATOM 7607  C CG   . MET A 1 67 ? 11.504  25.536  -10.103 1.00 1.45 ? 67 MET A CG   4  
ATOM 7608  S SD   . MET A 1 67 ? 10.542  27.066  -9.991  1.00 1.45 ? 67 MET A SD   4  
ATOM 7609  C CE   . MET A 1 67 ? 9.027   26.335  -9.324  1.00 1.45 ? 67 MET A CE   4  
ATOM 7610  H H    . MET A 1 67 ? 10.570  22.352  -7.972  1.00 1.45 ? 67 MET A H    4  
ATOM 7611  H HA   . MET A 1 67 ? 12.579  23.357  -9.902  1.00 1.45 ? 67 MET A HA   4  
ATOM 7612  H HB2  . MET A 1 67 ? 10.294  24.473  -8.685  1.00 1.45 ? 67 MET A HB2  4  
ATOM 7613  H HB3  . MET A 1 67 ? 11.669  25.322  -7.979  1.00 1.45 ? 67 MET A HB3  4  
ATOM 7614  H HG2  . MET A 1 67 ? 12.548  25.777  -10.240 1.00 1.45 ? 67 MET A HG2  4  
ATOM 7615  H HG3  . MET A 1 67 ? 11.155  24.952  -10.941 1.00 1.45 ? 67 MET A HG3  4  
ATOM 7616  H HE1  . MET A 1 67 ? 8.823   25.402  -9.834  1.00 1.45 ? 67 MET A HE1  4  
ATOM 7617  H HE2  . MET A 1 67 ? 9.151   26.152  -8.265  1.00 1.45 ? 67 MET A HE2  4  
ATOM 7618  H HE3  . MET A 1 67 ? 8.201   27.011  -9.475  1.00 1.45 ? 67 MET A HE3  4  
ATOM 7619  N N    . SER A 1 68 ? 13.044  24.007  -6.714  1.00 2.84 ? 68 SER A N    4  
ATOM 7620  C CA   . SER A 1 68 ? 14.113  24.094  -5.679  1.00 2.84 ? 68 SER A CA   4  
ATOM 7621  C C    . SER A 1 68 ? 15.406  24.601  -6.321  1.00 2.84 ? 68 SER A C    4  
ATOM 7622  O O    . SER A 1 68 ? 15.331  25.138  -7.414  1.00 2.84 ? 68 SER A O    4  
ATOM 7623  C CB   . SER A 1 68 ? 14.354  22.708  -5.077  1.00 2.84 ? 68 SER A CB   4  
ATOM 7624  O OG   . SER A 1 68 ? 13.420  22.484  -4.029  1.00 2.84 ? 68 SER A OG   4  
ATOM 7625  O OXT  . SER A 1 68 ? 16.450  24.446  -5.707  1.00 2.84 ? 68 SER A OXT  4  
ATOM 7626  H H    . SER A 1 68 ? 12.141  24.325  -6.511  1.00 2.84 ? 68 SER A H    4  
ATOM 7627  H HA   . SER A 1 68 ? 13.806  24.775  -4.900  1.00 2.84 ? 68 SER A HA   4  
ATOM 7628  H HB2  . SER A 1 68 ? 14.222  21.956  -5.837  1.00 2.84 ? 68 SER A HB2  4  
ATOM 7629  H HB3  . SER A 1 68 ? 15.363  22.655  -4.692  1.00 2.84 ? 68 SER A HB3  4  
ATOM 7630  H HG   . SER A 1 68 ? 13.913  22.370  -3.213  1.00 2.84 ? 68 SER A HG   4  
ATOM 7631  N N    . SER B 1 1  ? 18.864  -12.309 2.706   1.00 5.93 ? 1  SER B N    4  
ATOM 7632  C CA   . SER B 1 1  ? 18.088  -11.511 1.716   1.00 5.93 ? 1  SER B CA   4  
ATOM 7633  C C    . SER B 1 1  ? 17.221  -10.485 2.453   1.00 5.93 ? 1  SER B C    4  
ATOM 7634  O O    . SER B 1 1  ? 16.790  -10.724 3.563   1.00 5.93 ? 1  SER B O    4  
ATOM 7635  C CB   . SER B 1 1  ? 17.193  -12.442 0.899   1.00 5.93 ? 1  SER B CB   4  
ATOM 7636  O OG   . SER B 1 1  ? 17.751  -12.614 -0.396  1.00 5.93 ? 1  SER B OG   4  
ATOM 7637  H H1   . SER B 1 1  ? 18.649  -11.971 3.667   1.00 5.93 ? 1  SER B H1   4  
ATOM 7638  H H2   . SER B 1 1  ? 18.604  -13.311 2.624   1.00 5.93 ? 1  SER B H2   4  
ATOM 7639  H H3   . SER B 1 1  ? 19.880  -12.201 2.520   1.00 5.93 ? 1  SER B H3   4  
ATOM 7640  H HA   . SER B 1 1  ? 18.771  -10.996 1.055   1.00 5.93 ? 1  SER B HA   4  
ATOM 7641  H HB2  . SER B 1 1  ? 17.127  -13.400 1.387   1.00 5.93 ? 1  SER B HB2  4  
ATOM 7642  H HB3  . SER B 1 1  ? 16.203  -12.011 0.821   1.00 5.93 ? 1  SER B HB3  4  
ATOM 7643  H HG   . SER B 1 1  ? 18.358  -13.357 -0.362  1.00 5.93 ? 1  SER B HG   4  
ATOM 7644  N N    . PRO B 1 2  ? 16.992  -9.370  1.807   1.00 3.89 ? 2  PRO B N    4  
ATOM 7645  C CA   . PRO B 1 2  ? 16.179  -8.278  2.370   1.00 3.89 ? 2  PRO B CA   4  
ATOM 7646  C C    . PRO B 1 2  ? 14.688  -8.608  2.254   1.00 3.89 ? 2  PRO B C    4  
ATOM 7647  O O    . PRO B 1 2  ? 14.304  -9.752  2.105   1.00 3.89 ? 2  PRO B O    4  
ATOM 7648  C CB   . PRO B 1 2  ? 16.542  -7.074  1.498   1.00 3.89 ? 2  PRO B CB   4  
ATOM 7649  C CG   . PRO B 1 2  ? 17.083  -7.647  0.167   1.00 3.89 ? 2  PRO B CG   4  
ATOM 7650  C CD   . PRO B 1 2  ? 17.524  -9.093  0.457   1.00 3.89 ? 2  PRO B CD   4  
ATOM 7651  H HA   . PRO B 1 2  ? 16.451  -8.088  3.396   1.00 3.89 ? 2  PRO B HA   4  
ATOM 7652  H HB2  . PRO B 1 2  ? 15.662  -6.470  1.317   1.00 3.89 ? 2  PRO B HB2  4  
ATOM 7653  H HB3  . PRO B 1 2  ? 17.307  -6.484  1.978   1.00 3.89 ? 2  PRO B HB3  4  
ATOM 7654  H HG2  . PRO B 1 2  ? 16.305  -7.636  -0.583  1.00 3.89 ? 2  PRO B HG2  4  
ATOM 7655  H HG3  . PRO B 1 2  ? 17.930  -7.068  -0.169  1.00 3.89 ? 2  PRO B HG3  4  
ATOM 7656  H HD2  . PRO B 1 2  ? 17.094  -9.771  -0.268  1.00 3.89 ? 2  PRO B HD2  4  
ATOM 7657  H HD3  . PRO B 1 2  ? 18.601  -9.169  0.457   1.00 3.89 ? 2  PRO B HD3  4  
ATOM 7658  N N    . TYR B 1 3  ? 13.844  -7.616  2.323   1.00 2.56 ? 3  TYR B N    4  
ATOM 7659  C CA   . TYR B 1 3  ? 12.380  -7.872  2.218   1.00 2.56 ? 3  TYR B CA   4  
ATOM 7660  C C    . TYR B 1 3  ? 11.899  -7.518  0.810   1.00 2.56 ? 3  TYR B C    4  
ATOM 7661  O O    . TYR B 1 3  ? 11.867  -8.350  -0.074  1.00 2.56 ? 3  TYR B O    4  
ATOM 7662  C CB   . TYR B 1 3  ? 11.636  -7.014  3.244   1.00 2.56 ? 3  TYR B CB   4  
ATOM 7663  C CG   . TYR B 1 3  ? 11.553  -7.756  4.556   1.00 2.56 ? 3  TYR B CG   4  
ATOM 7664  C CD1  . TYR B 1 3  ? 10.738  -8.889  4.669   1.00 2.56 ? 3  TYR B CD1  4  
ATOM 7665  C CD2  . TYR B 1 3  ? 12.291  -7.311  5.660   1.00 2.56 ? 3  TYR B CD2  4  
ATOM 7666  C CE1  . TYR B 1 3  ? 10.660  -9.576  5.885   1.00 2.56 ? 3  TYR B CE1  4  
ATOM 7667  C CE2  . TYR B 1 3  ? 12.213  -7.999  6.876   1.00 2.56 ? 3  TYR B CE2  4  
ATOM 7668  C CZ   . TYR B 1 3  ? 11.397  -9.132  6.990   1.00 2.56 ? 3  TYR B CZ   4  
ATOM 7669  O OH   . TYR B 1 3  ? 11.321  -9.810  8.189   1.00 2.56 ? 3  TYR B OH   4  
ATOM 7670  H H    . TYR B 1 3  ? 14.173  -6.700  2.445   1.00 2.56 ? 3  TYR B H    4  
ATOM 7671  H HA   . TYR B 1 3  ? 12.184  -8.917  2.412   1.00 2.56 ? 3  TYR B HA   4  
ATOM 7672  H HB2  . TYR B 1 3  ? 12.169  -6.085  3.387   1.00 2.56 ? 3  TYR B HB2  4  
ATOM 7673  H HB3  . TYR B 1 3  ? 10.640  -6.806  2.884   1.00 2.56 ? 3  TYR B HB3  4  
ATOM 7674  H HD1  . TYR B 1 3  ? 10.170  -9.231  3.817   1.00 2.56 ? 3  TYR B HD1  4  
ATOM 7675  H HD2  . TYR B 1 3  ? 12.919  -6.437  5.573   1.00 2.56 ? 3  TYR B HD2  4  
ATOM 7676  H HE1  . TYR B 1 3  ? 10.032  -10.450 5.973   1.00 2.56 ? 3  TYR B HE1  4  
ATOM 7677  H HE2  . TYR B 1 3  ? 12.781  -7.655  7.728   1.00 2.56 ? 3  TYR B HE2  4  
ATOM 7678  H HH   . TYR B 1 3  ? 11.660  -9.233  8.878   1.00 2.56 ? 3  TYR B HH   4  
ATOM 7679  N N    . SER B 1 4  ? 11.525  -6.286  0.594   1.00 0.96 ? 4  SER B N    4  
ATOM 7680  C CA   . SER B 1 4  ? 11.046  -5.879  -0.757  1.00 0.96 ? 4  SER B CA   4  
ATOM 7681  C C    . SER B 1 4  ? 11.007  -4.352  -0.845  1.00 0.96 ? 4  SER B C    4  
ATOM 7682  O O    . SER B 1 4  ? 10.323  -3.694  -0.087  1.00 0.96 ? 4  SER B O    4  
ATOM 7683  C CB   . SER B 1 4  ? 9.642   -6.439  -0.990  1.00 0.96 ? 4  SER B CB   4  
ATOM 7684  O OG   . SER B 1 4  ? 9.712   -7.854  -1.088  1.00 0.96 ? 4  SER B OG   4  
ATOM 7685  H H    . SER B 1 4  ? 11.558  -5.629  1.321   1.00 0.96 ? 4  SER B H    4  
ATOM 7686  H HA   . SER B 1 4  ? 11.717  -6.266  -1.509  1.00 0.96 ? 4  SER B HA   4  
ATOM 7687  H HB2  . SER B 1 4  ? 9.004   -6.171  -0.164  1.00 0.96 ? 4  SER B HB2  4  
ATOM 7688  H HB3  . SER B 1 4  ? 9.237   -6.024  -1.904  1.00 0.96 ? 4  SER B HB3  4  
ATOM 7689  H HG   . SER B 1 4  ? 8.853   -8.211  -0.848  1.00 0.96 ? 4  SER B HG   4  
ATOM 7690  N N    . SER B 1 5  ? 11.738  -3.783  -1.766  1.00 0.48 ? 5  SER B N    4  
ATOM 7691  C CA   . SER B 1 5  ? 11.743  -2.299  -1.901  1.00 0.48 ? 5  SER B CA   4  
ATOM 7692  C C    . SER B 1 5  ? 10.649  -1.872  -2.883  1.00 0.48 ? 5  SER B C    4  
ATOM 7693  O O    . SER B 1 5  ? 10.917  -1.261  -3.898  1.00 0.48 ? 5  SER B O    4  
ATOM 7694  C CB   . SER B 1 5  ? 13.104  -1.840  -2.423  1.00 0.48 ? 5  SER B CB   4  
ATOM 7695  O OG   . SER B 1 5  ? 13.385  -2.502  -3.648  1.00 0.48 ? 5  SER B OG   4  
ATOM 7696  H H    . SER B 1 5  ? 12.282  -4.332  -2.367  1.00 0.48 ? 5  SER B H    4  
ATOM 7697  H HA   . SER B 1 5  ? 11.556  -1.849  -0.937  1.00 0.48 ? 5  SER B HA   4  
ATOM 7698  H HB2  . SER B 1 5  ? 13.088  -0.776  -2.590  1.00 0.48 ? 5  SER B HB2  4  
ATOM 7699  H HB3  . SER B 1 5  ? 13.866  -2.074  -1.691  1.00 0.48 ? 5  SER B HB3  4  
ATOM 7700  H HG   . SER B 1 5  ? 14.319  -2.722  -3.659  1.00 0.48 ? 5  SER B HG   4  
ATOM 7701  N N    . ASP B 1 6  ? 9.418   -2.188  -2.588  1.00 0.37 ? 6  ASP B N    4  
ATOM 7702  C CA   . ASP B 1 6  ? 8.309   -1.800  -3.504  1.00 0.37 ? 6  ASP B CA   4  
ATOM 7703  C C    . ASP B 1 6  ? 7.077   -1.419  -2.681  1.00 0.37 ? 6  ASP B C    4  
ATOM 7704  O O    . ASP B 1 6  ? 6.924   -1.832  -1.548  1.00 0.37 ? 6  ASP B O    4  
ATOM 7705  C CB   . ASP B 1 6  ? 7.968   -2.978  -4.421  1.00 0.37 ? 6  ASP B CB   4  
ATOM 7706  C CG   . ASP B 1 6  ? 9.260   -3.635  -4.909  1.00 0.37 ? 6  ASP B CG   4  
ATOM 7707  O OD1  . ASP B 1 6  ? 10.008  -2.976  -5.612  1.00 0.37 ? 6  ASP B OD1  4  
ATOM 7708  O OD2  . ASP B 1 6  ? 9.479   -4.787  -4.573  1.00 0.37 ? 6  ASP B OD2  4  
ATOM 7709  H H    . ASP B 1 6  ? 9.222   -2.682  -1.764  1.00 0.37 ? 6  ASP B H    4  
ATOM 7710  H HA   . ASP B 1 6  ? 8.617   -0.955  -4.103  1.00 0.37 ? 6  ASP B HA   4  
ATOM 7711  H HB2  . ASP B 1 6  ? 7.380   -3.700  -3.873  1.00 0.37 ? 6  ASP B HB2  4  
ATOM 7712  H HB3  . ASP B 1 6  ? 7.404   -2.621  -5.269  1.00 0.37 ? 6  ASP B HB3  4  
ATOM 7713  N N    . THR B 1 7  ? 6.197   -0.635  -3.240  1.00 0.35 ? 7  THR B N    4  
ATOM 7714  C CA   . THR B 1 7  ? 4.976   -0.230  -2.488  1.00 0.35 ? 7  THR B CA   4  
ATOM 7715  C C    . THR B 1 7  ? 4.079   -1.451  -2.275  1.00 0.35 ? 7  THR B C    4  
ATOM 7716  O O    . THR B 1 7  ? 4.048   -2.358  -3.082  1.00 0.35 ? 7  THR B O    4  
ATOM 7717  C CB   . THR B 1 7  ? 4.214   0.830   -3.286  1.00 0.35 ? 7  THR B CB   4  
ATOM 7718  O OG1  . THR B 1 7  ? 4.176   0.452   -4.655  1.00 0.35 ? 7  THR B OG1  4  
ATOM 7719  C CG2  . THR B 1 7  ? 4.917   2.181   -3.146  1.00 0.35 ? 7  THR B CG2  4  
ATOM 7720  H H    . THR B 1 7  ? 6.339   -0.314  -4.154  1.00 0.35 ? 7  THR B H    4  
ATOM 7721  H HA   . THR B 1 7  ? 5.263   0.177   -1.529  1.00 0.35 ? 7  THR B HA   4  
ATOM 7722  H HB   . THR B 1 7  ? 3.207   0.913   -2.907  1.00 0.35 ? 7  THR B HB   4  
ATOM 7723  H HG1  . THR B 1 7  ? 3.257   0.431   -4.932  1.00 0.35 ? 7  THR B HG1  4  
ATOM 7724  H HG21 . THR B 1 7  ? 5.944   2.087   -3.463  1.00 0.35 ? 7  THR B HG21 4  
ATOM 7725  H HG22 . THR B 1 7  ? 4.416   2.913   -3.763  1.00 0.35 ? 7  THR B HG22 4  
ATOM 7726  H HG23 . THR B 1 7  ? 4.885   2.497   -2.114  1.00 0.35 ? 7  THR B HG23 4  
ATOM 7727  N N    . THR B 1 8  ? 3.348   -1.480  -1.194  1.00 0.31 ? 8  THR B N    4  
ATOM 7728  C CA   . THR B 1 8  ? 2.453   -2.643  -0.931  1.00 0.31 ? 8  THR B CA   4  
ATOM 7729  C C    . THR B 1 8  ? 0.992   -2.206  -1.092  1.00 0.31 ? 8  THR B C    4  
ATOM 7730  O O    . THR B 1 8  ? 0.620   -1.134  -0.659  1.00 0.31 ? 8  THR B O    4  
ATOM 7731  C CB   . THR B 1 8  ? 2.681   -3.147  0.497   1.00 0.31 ? 8  THR B CB   4  
ATOM 7732  O OG1  . THR B 1 8  ? 3.944   -3.791  0.573   1.00 0.31 ? 8  THR B OG1  4  
ATOM 7733  C CG2  . THR B 1 8  ? 1.578   -4.136  0.877   1.00 0.31 ? 8  THR B CG2  4  
ATOM 7734  H H    . THR B 1 8  ? 3.387   -0.738  -0.555  1.00 0.31 ? 8  THR B H    4  
ATOM 7735  H HA   . THR B 1 8  ? 2.680   -3.432  -1.631  1.00 0.31 ? 8  THR B HA   4  
ATOM 7736  H HB   . THR B 1 8  ? 2.661   -2.313  1.181   1.00 0.31 ? 8  THR B HB   4  
ATOM 7737  H HG1  . THR B 1 8  ? 4.625   -3.128  0.438   1.00 0.31 ? 8  THR B HG1  4  
ATOM 7738  H HG21 . THR B 1 8  ? 0.612   -3.695  0.674   1.00 0.31 ? 8  THR B HG21 4  
ATOM 7739  H HG22 . THR B 1 8  ? 1.689   -5.040  0.297   1.00 0.31 ? 8  THR B HG22 4  
ATOM 7740  H HG23 . THR B 1 8  ? 1.652   -4.371  1.929   1.00 0.31 ? 8  THR B HG23 4  
ATOM 7741  N N    . PRO B 1 9  ? 0.205   -3.051  -1.712  1.00 0.34 ? 9  PRO B N    4  
ATOM 7742  C CA   . PRO B 1 9  ? -1.224  -2.777  -1.944  1.00 0.34 ? 9  PRO B CA   4  
ATOM 7743  C C    . PRO B 1 9  ? -2.025  -3.028  -0.664  1.00 0.34 ? 9  PRO B C    4  
ATOM 7744  O O    . PRO B 1 9  ? -2.359  -4.150  -0.340  1.00 0.34 ? 9  PRO B O    4  
ATOM 7745  C CB   . PRO B 1 9  ? -1.609  -3.779  -3.035  1.00 0.34 ? 9  PRO B CB   4  
ATOM 7746  C CG   . PRO B 1 9  ? -0.570  -4.924  -2.962  1.00 0.34 ? 9  PRO B CG   4  
ATOM 7747  C CD   . PRO B 1 9  ? 0.664   -4.354  -2.238  1.00 0.34 ? 9  PRO B CD   4  
ATOM 7748  H HA   . PRO B 1 9  ? -1.369  -1.770  -2.297  1.00 0.34 ? 9  PRO B HA   4  
ATOM 7749  H HB2  . PRO B 1 9  ? -2.603  -4.162  -2.850  1.00 0.34 ? 9  PRO B HB2  4  
ATOM 7750  H HB3  . PRO B 1 9  ? -1.564  -3.309  -4.005  1.00 0.34 ? 9  PRO B HB3  4  
ATOM 7751  H HG2  . PRO B 1 9  ? -0.979  -5.757  -2.406  1.00 0.34 ? 9  PRO B HG2  4  
ATOM 7752  H HG3  . PRO B 1 9  ? -0.295  -5.240  -3.956  1.00 0.34 ? 9  PRO B HG3  4  
ATOM 7753  H HD2  . PRO B 1 9  ? 0.962   -5.007  -1.429  1.00 0.34 ? 9  PRO B HD2  4  
ATOM 7754  H HD3  . PRO B 1 9  ? 1.477   -4.210  -2.930  1.00 0.34 ? 9  PRO B HD3  4  
ATOM 7755  N N    . CYS B 1 10 ? -2.332  -1.993  0.069   1.00 0.35 ? 10 CYS B N    4  
ATOM 7756  C CA   . CYS B 1 10 ? -3.107  -2.176  1.328   1.00 0.35 ? 10 CYS B CA   4  
ATOM 7757  C C    . CYS B 1 10 ? -4.506  -1.581  1.161   1.00 0.35 ? 10 CYS B C    4  
ATOM 7758  O O    . CYS B 1 10 ? -4.666  -0.399  0.928   1.00 0.35 ? 10 CYS B O    4  
ATOM 7759  C CB   . CYS B 1 10 ? -2.385  -1.468  2.476   1.00 0.35 ? 10 CYS B CB   4  
ATOM 7760  S SG   . CYS B 1 10 ? -0.808  -2.297  2.797   1.00 0.35 ? 10 CYS B SG   4  
ATOM 7761  H H    . CYS B 1 10 ? -2.051  -1.095  -0.208  1.00 0.35 ? 10 CYS B H    4  
ATOM 7762  H HA   . CYS B 1 10 ? -3.188  -3.229  1.550   1.00 0.35 ? 10 CYS B HA   4  
ATOM 7763  H HB2  . CYS B 1 10 ? -2.202  -0.438  2.206   1.00 0.35 ? 10 CYS B HB2  4  
ATOM 7764  H HB3  . CYS B 1 10 ? -2.998  -1.504  3.364   1.00 0.35 ? 10 CYS B HB3  4  
ATOM 7765  N N    . CYS B 1 11 ? -5.522  -2.391  1.283   1.00 0.32 ? 11 CYS B N    4  
ATOM 7766  C CA   . CYS B 1 11 ? -6.910  -1.873  1.135   1.00 0.32 ? 11 CYS B CA   4  
ATOM 7767  C C    . CYS B 1 11 ? -7.569  -1.785  2.513   1.00 0.32 ? 11 CYS B C    4  
ATOM 7768  O O    . CYS B 1 11 ? -7.597  -2.742  3.260   1.00 0.32 ? 11 CYS B O    4  
ATOM 7769  C CB   . CYS B 1 11 ? -7.716  -2.819  0.242   1.00 0.32 ? 11 CYS B CB   4  
ATOM 7770  S SG   . CYS B 1 11 ? -7.680  -2.214  -1.463  1.00 0.32 ? 11 CYS B SG   4  
ATOM 7771  H H    . CYS B 1 11 ? -5.371  -3.341  1.474   1.00 0.32 ? 11 CYS B H    4  
ATOM 7772  H HA   . CYS B 1 11 ? -6.882  -0.890  0.687   1.00 0.32 ? 11 CYS B HA   4  
ATOM 7773  H HB2  . CYS B 1 11 ? -7.285  -3.807  0.283   1.00 0.32 ? 11 CYS B HB2  4  
ATOM 7774  H HB3  . CYS B 1 11 ? -8.738  -2.856  0.590   1.00 0.32 ? 11 CYS B HB3  4  
ATOM 7775  N N    . PHE B 1 12 ? -8.096  -0.642  2.856   1.00 0.28 ? 12 PHE B N    4  
ATOM 7776  C CA   . PHE B 1 12 ? -8.749  -0.494  4.187   1.00 0.28 ? 12 PHE B CA   4  
ATOM 7777  C C    . PHE B 1 12 ? -10.240 -0.209  3.993   1.00 0.28 ? 12 PHE B C    4  
ATOM 7778  O O    . PHE B 1 12 ? -11.050 -0.478  4.857   1.00 0.28 ? 12 PHE B O    4  
ATOM 7779  C CB   . PHE B 1 12 ? -8.101  0.668   4.944   1.00 0.28 ? 12 PHE B CB   4  
ATOM 7780  C CG   . PHE B 1 12 ? -6.632  0.737   4.600   1.00 0.28 ? 12 PHE B CG   4  
ATOM 7781  C CD1  . PHE B 1 12 ? -6.217  1.401   3.440   1.00 0.28 ? 12 PHE B CD1  4  
ATOM 7782  C CD2  . PHE B 1 12 ? -5.686  0.137   5.440   1.00 0.28 ? 12 PHE B CD2  4  
ATOM 7783  C CE1  . PHE B 1 12 ? -4.854  1.465   3.119   1.00 0.28 ? 12 PHE B CE1  4  
ATOM 7784  C CE2  . PHE B 1 12 ? -4.325  0.200   5.119   1.00 0.28 ? 12 PHE B CE2  4  
ATOM 7785  C CZ   . PHE B 1 12 ? -3.909  0.865   3.959   1.00 0.28 ? 12 PHE B CZ   4  
ATOM 7786  H H    . PHE B 1 12 ? -8.062  0.118   2.239   1.00 0.28 ? 12 PHE B H    4  
ATOM 7787  H HA   . PHE B 1 12 ? -8.627  -1.406  4.752   1.00 0.28 ? 12 PHE B HA   4  
ATOM 7788  H HB2  . PHE B 1 12 ? -8.582  1.594   4.664   1.00 0.28 ? 12 PHE B HB2  4  
ATOM 7789  H HB3  . PHE B 1 12 ? -8.214  0.512   6.007   1.00 0.28 ? 12 PHE B HB3  4  
ATOM 7790  H HD1  . PHE B 1 12 ? -6.946  1.865   2.792   1.00 0.28 ? 12 PHE B HD1  4  
ATOM 7791  H HD2  . PHE B 1 12 ? -6.007  -0.376  6.335   1.00 0.28 ? 12 PHE B HD2  4  
ATOM 7792  H HE1  . PHE B 1 12 ? -4.534  1.978   2.224   1.00 0.28 ? 12 PHE B HE1  4  
ATOM 7793  H HE2  . PHE B 1 12 ? -3.595  -0.263  5.767   1.00 0.28 ? 12 PHE B HE2  4  
ATOM 7794  H HZ   . PHE B 1 12 ? -2.859  0.914   3.712   1.00 0.28 ? 12 PHE B HZ   4  
ATOM 7795  N N    . ALA B 1 13 ? -10.609 0.332   2.864   1.00 0.31 ? 13 ALA B N    4  
ATOM 7796  C CA   . ALA B 1 13 ? -12.048 0.632   2.617   1.00 0.31 ? 13 ALA B CA   4  
ATOM 7797  C C    . ALA B 1 13 ? -12.714 -0.578  1.957   1.00 0.31 ? 13 ALA B C    4  
ATOM 7798  O O    . ALA B 1 13 ? -12.056 -1.511  1.541   1.00 0.31 ? 13 ALA B O    4  
ATOM 7799  C CB   . ALA B 1 13 ? -12.163 1.845   1.691   1.00 0.31 ? 13 ALA B CB   4  
ATOM 7800  H H    . ALA B 1 13 ? -9.940  0.541   2.180   1.00 0.31 ? 13 ALA B H    4  
ATOM 7801  H HA   . ALA B 1 13 ? -12.538 0.846   3.555   1.00 0.31 ? 13 ALA B HA   4  
ATOM 7802  H HB1  . ALA B 1 13 ? -11.192 2.305   1.576   1.00 0.31 ? 13 ALA B HB1  4  
ATOM 7803  H HB2  . ALA B 1 13 ? -12.528 1.528   0.725   1.00 0.31 ? 13 ALA B HB2  4  
ATOM 7804  H HB3  . ALA B 1 13 ? -12.851 2.560   2.119   1.00 0.31 ? 13 ALA B HB3  4  
ATOM 7805  N N    . TYR B 1 14 ? -14.015 -0.568  1.856   1.00 0.29 ? 14 TYR B N    4  
ATOM 7806  C CA   . TYR B 1 14 ? -14.721 -1.717  1.223   1.00 0.29 ? 14 TYR B CA   4  
ATOM 7807  C C    . TYR B 1 14 ? -15.863 -1.193  0.348   1.00 0.29 ? 14 TYR B C    4  
ATOM 7808  O O    . TYR B 1 14 ? -16.771 -0.541  0.821   1.00 0.29 ? 14 TYR B O    4  
ATOM 7809  C CB   . TYR B 1 14 ? -15.291 -2.630  2.311   1.00 0.29 ? 14 TYR B CB   4  
ATOM 7810  C CG   . TYR B 1 14 ? -14.159 -3.252  3.092   1.00 0.29 ? 14 TYR B CG   4  
ATOM 7811  C CD1  . TYR B 1 14 ? -13.075 -3.826  2.416   1.00 0.29 ? 14 TYR B CD1  4  
ATOM 7812  C CD2  . TYR B 1 14 ? -14.192 -3.255  4.491   1.00 0.29 ? 14 TYR B CD2  4  
ATOM 7813  C CE1  . TYR B 1 14 ? -12.025 -4.403  3.141   1.00 0.29 ? 14 TYR B CE1  4  
ATOM 7814  C CE2  . TYR B 1 14 ? -13.143 -3.831  5.216   1.00 0.29 ? 14 TYR B CE2  4  
ATOM 7815  C CZ   . TYR B 1 14 ? -12.059 -4.406  4.540   1.00 0.29 ? 14 TYR B CZ   4  
ATOM 7816  O OH   . TYR B 1 14 ? -11.024 -4.975  5.255   1.00 0.29 ? 14 TYR B OH   4  
ATOM 7817  H H    . TYR B 1 14 ? -14.527 0.194   2.197   1.00 0.29 ? 14 TYR B H    4  
ATOM 7818  H HA   . TYR B 1 14 ? -14.026 -2.275  0.612   1.00 0.29 ? 14 TYR B HA   4  
ATOM 7819  H HB2  . TYR B 1 14 ? -15.912 -2.050  2.977   1.00 0.29 ? 14 TYR B HB2  4  
ATOM 7820  H HB3  . TYR B 1 14 ? -15.882 -3.410  1.854   1.00 0.29 ? 14 TYR B HB3  4  
ATOM 7821  H HD1  . TYR B 1 14 ? -13.049 -3.824  1.337   1.00 0.29 ? 14 TYR B HD1  4  
ATOM 7822  H HD2  . TYR B 1 14 ? -15.028 -2.812  5.012   1.00 0.29 ? 14 TYR B HD2  4  
ATOM 7823  H HE1  . TYR B 1 14 ? -11.189 -4.846  2.620   1.00 0.29 ? 14 TYR B HE1  4  
ATOM 7824  H HE2  . TYR B 1 14 ? -13.169 -3.834  6.295   1.00 0.29 ? 14 TYR B HE2  4  
ATOM 7825  H HH   . TYR B 1 14 ? -11.160 -5.925  5.269   1.00 0.29 ? 14 TYR B HH   4  
ATOM 7826  N N    . ILE B 1 15 ? -15.823 -1.474  -0.926  1.00 0.32 ? 15 ILE B N    4  
ATOM 7827  C CA   . ILE B 1 15 ? -16.906 -0.990  -1.829  1.00 0.32 ? 15 ILE B CA   4  
ATOM 7828  C C    . ILE B 1 15 ? -18.199 -1.750  -1.528  1.00 0.32 ? 15 ILE B C    4  
ATOM 7829  O O    . ILE B 1 15 ? -18.178 -2.865  -1.045  1.00 0.32 ? 15 ILE B O    4  
ATOM 7830  C CB   . ILE B 1 15 ? -16.502 -1.228  -3.285  1.00 0.32 ? 15 ILE B CB   4  
ATOM 7831  C CG1  . ILE B 1 15 ? -17.516 -0.552  -4.211  1.00 0.32 ? 15 ILE B CG1  4  
ATOM 7832  C CG2  . ILE B 1 15 ? -16.477 -2.732  -3.570  1.00 0.32 ? 15 ILE B CG2  4  
ATOM 7833  C CD1  . ILE B 1 15 ? -16.797 -0.014  -5.450  1.00 0.32 ? 15 ILE B CD1  4  
ATOM 7834  H H    . ILE B 1 15 ? -15.082 -2.002  -1.290  1.00 0.32 ? 15 ILE B H    4  
ATOM 7835  H HA   . ILE B 1 15 ? -17.064 0.066   -1.667  1.00 0.32 ? 15 ILE B HA   4  
ATOM 7836  H HB   . ILE B 1 15 ? -15.520 -0.813  -3.458  1.00 0.32 ? 15 ILE B HB   4  
ATOM 7837  H HG12 . ILE B 1 15 ? -18.264 -1.271  -4.512  1.00 0.32 ? 15 ILE B HG12 4  
ATOM 7838  H HG13 . ILE B 1 15 ? -17.990 0.265   -3.689  1.00 0.32 ? 15 ILE B HG13 4  
ATOM 7839  H HG21 . ILE B 1 15 ? -16.168 -3.261  -2.681  1.00 0.32 ? 15 ILE B HG21 4  
ATOM 7840  H HG22 . ILE B 1 15 ? -17.466 -3.059  -3.858  1.00 0.32 ? 15 ILE B HG22 4  
ATOM 7841  H HG23 . ILE B 1 15 ? -15.782 -2.935  -4.371  1.00 0.32 ? 15 ILE B HG23 4  
ATOM 7842  H HD11 . ILE B 1 15 ? -16.028 0.681   -5.145  1.00 0.32 ? 15 ILE B HD11 4  
ATOM 7843  H HD12 . ILE B 1 15 ? -16.348 -0.834  -5.990  1.00 0.32 ? 15 ILE B HD12 4  
ATOM 7844  H HD13 . ILE B 1 15 ? -17.508 0.491   -6.087  1.00 0.32 ? 15 ILE B HD13 4  
ATOM 7845  N N    . ALA B 1 16 ? -19.326 -1.155  -1.810  1.00 0.38 ? 16 ALA B N    4  
ATOM 7846  C CA   . ALA B 1 16 ? -20.620 -1.843  -1.540  1.00 0.38 ? 16 ALA B CA   4  
ATOM 7847  C C    . ALA B 1 16 ? -21.175 -2.413  -2.848  1.00 0.38 ? 16 ALA B C    4  
ATOM 7848  O O    . ALA B 1 16 ? -21.825 -3.439  -2.862  1.00 0.38 ? 16 ALA B O    4  
ATOM 7849  C CB   . ALA B 1 16 ? -21.618 -0.841  -0.957  1.00 0.38 ? 16 ALA B CB   4  
ATOM 7850  H H    . ALA B 1 16 ? -19.321 -0.257  -2.199  1.00 0.38 ? 16 ALA B H    4  
ATOM 7851  H HA   . ALA B 1 16 ? -20.462 -2.646  -0.835  1.00 0.38 ? 16 ALA B HA   4  
ATOM 7852  H HB1  . ALA B 1 16 ? -21.407 0.144   -1.344  1.00 0.38 ? 16 ALA B HB1  4  
ATOM 7853  H HB2  . ALA B 1 16 ? -22.622 -1.129  -1.233  1.00 0.38 ? 16 ALA B HB2  4  
ATOM 7854  H HB3  . ALA B 1 16 ? -21.530 -0.830  0.120   1.00 0.38 ? 16 ALA B HB3  4  
ATOM 7855  N N    . ARG B 1 17 ? -20.923 -1.755  -3.945  1.00 0.42 ? 17 ARG B N    4  
ATOM 7856  C CA   . ARG B 1 17 ? -21.436 -2.258  -5.251  1.00 0.42 ? 17 ARG B CA   4  
ATOM 7857  C C    . ARG B 1 17 ? -20.389 -3.177  -5.889  1.00 0.42 ? 17 ARG B C    4  
ATOM 7858  O O    . ARG B 1 17 ? -19.204 -2.985  -5.705  1.00 0.42 ? 17 ARG B O    4  
ATOM 7859  C CB   . ARG B 1 17 ? -21.714 -1.076  -6.181  1.00 0.42 ? 17 ARG B CB   4  
ATOM 7860  C CG   . ARG B 1 17 ? -23.158 -0.607  -5.993  1.00 0.42 ? 17 ARG B CG   4  
ATOM 7861  C CD   . ARG B 1 17 ? -23.915 -0.742  -7.315  1.00 0.42 ? 17 ARG B CD   4  
ATOM 7862  N NE   . ARG B 1 17 ? -24.727 0.484   -7.549  1.00 0.42 ? 17 ARG B NE   4  
ATOM 7863  C CZ   . ARG B 1 17 ? -25.951 0.383   -7.990  1.00 0.42 ? 17 ARG B CZ   4  
ATOM 7864  N NH1  . ARG B 1 17 ? -26.171 0.004   -9.221  1.00 0.42 ? 17 ARG B NH1  4  
ATOM 7865  N NH2  . ARG B 1 17 ? -26.954 0.658   -7.204  1.00 0.42 ? 17 ARG B NH2  4  
ATOM 7866  H H    . ARG B 1 17 ? -20.396 -0.929  -3.913  1.00 0.42 ? 17 ARG B H    4  
ATOM 7867  H HA   . ARG B 1 17 ? -22.349 -2.811  -5.089  1.00 0.42 ? 17 ARG B HA   4  
ATOM 7868  H HB2  . ARG B 1 17 ? -21.037 -0.267  -5.945  1.00 0.42 ? 17 ARG B HB2  4  
ATOM 7869  H HB3  . ARG B 1 17 ? -21.567 -1.382  -7.206  1.00 0.42 ? 17 ARG B HB3  4  
ATOM 7870  H HG2  . ARG B 1 17 ? -23.638 -1.214  -5.238  1.00 0.42 ? 17 ARG B HG2  4  
ATOM 7871  H HG3  . ARG B 1 17 ? -23.163 0.427   -5.681  1.00 0.42 ? 17 ARG B HG3  4  
ATOM 7872  H HD2  . ARG B 1 17 ? -23.210 -0.867  -8.123  1.00 0.42 ? 17 ARG B HD2  4  
ATOM 7873  H HD3  . ARG B 1 17 ? -24.567 -1.603  -7.270  1.00 0.42 ? 17 ARG B HD3  4  
ATOM 7874  H HE   . ARG B 1 17 ? -24.343 1.368   -7.370  1.00 0.42 ? 17 ARG B HE   4  
ATOM 7875  H HH11 . ARG B 1 17 ? -25.403 -0.207  -9.824  1.00 0.42 ? 17 ARG B HH11 4  
ATOM 7876  H HH12 . ARG B 1 17 ? -27.109 -0.073  -9.559  1.00 0.42 ? 17 ARG B HH12 4  
ATOM 7877  H HH21 . ARG B 1 17 ? -26.786 0.948   -6.261  1.00 0.42 ? 17 ARG B HH21 4  
ATOM 7878  H HH22 . ARG B 1 17 ? -27.892 0.581   -7.542  1.00 0.42 ? 17 ARG B HH22 4  
ATOM 7879  N N    . PRO B 1 18 ? -20.865 -4.151  -6.623  1.00 0.41 ? 18 PRO B N    4  
ATOM 7880  C CA   . PRO B 1 18 ? -19.998 -5.126  -7.307  1.00 0.41 ? 18 PRO B CA   4  
ATOM 7881  C C    . PRO B 1 18 ? -19.401 -4.513  -8.579  1.00 0.41 ? 18 PRO B C    4  
ATOM 7882  O O    . PRO B 1 18 ? -19.671 -3.379  -8.919  1.00 0.41 ? 18 PRO B O    4  
ATOM 7883  C CB   . PRO B 1 18 ? -20.951 -6.274  -7.650  1.00 0.41 ? 18 PRO B CB   4  
ATOM 7884  C CG   . PRO B 1 18 ? -22.376 -5.671  -7.661  1.00 0.41 ? 18 PRO B CG   4  
ATOM 7885  C CD   . PRO B 1 18 ? -22.310 -4.371  -6.836  1.00 0.41 ? 18 PRO B CD   4  
ATOM 7886  H HA   . PRO B 1 18 ? -19.221 -5.476  -6.649  1.00 0.41 ? 18 PRO B HA   4  
ATOM 7887  H HB2  . PRO B 1 18 ? -20.708 -6.679  -8.623  1.00 0.41 ? 18 PRO B HB2  4  
ATOM 7888  H HB3  . PRO B 1 18 ? -20.889 -7.046  -6.899  1.00 0.41 ? 18 PRO B HB3  4  
ATOM 7889  H HG2  . PRO B 1 18 ? -22.677 -5.453  -8.677  1.00 0.41 ? 18 PRO B HG2  4  
ATOM 7890  H HG3  . PRO B 1 18 ? -23.073 -6.356  -7.205  1.00 0.41 ? 18 PRO B HG3  4  
ATOM 7891  H HD2  . PRO B 1 18 ? -22.743 -3.550  -7.391  1.00 0.41 ? 18 PRO B HD2  4  
ATOM 7892  H HD3  . PRO B 1 18 ? -22.811 -4.497  -5.889  1.00 0.41 ? 18 PRO B HD3  4  
ATOM 7893  N N    . LEU B 1 19 ? -18.593 -5.259  -9.281  1.00 0.45 ? 19 LEU B N    4  
ATOM 7894  C CA   . LEU B 1 19 ? -17.977 -4.723  -10.530 1.00 0.45 ? 19 LEU B CA   4  
ATOM 7895  C C    . LEU B 1 19 ? -18.224 -5.713  -11.674 1.00 0.45 ? 19 LEU B C    4  
ATOM 7896  O O    . LEU B 1 19 ? -18.731 -6.794  -11.453 1.00 0.45 ? 19 LEU B O    4  
ATOM 7897  C CB   . LEU B 1 19 ? -16.465 -4.537  -10.333 1.00 0.45 ? 19 LEU B CB   4  
ATOM 7898  C CG   . LEU B 1 19 ? -16.135 -4.438  -8.841  1.00 0.45 ? 19 LEU B CG   4  
ATOM 7899  C CD1  . LEU B 1 19 ? -16.210 -5.827  -8.206  1.00 0.45 ? 19 LEU B CD1  4  
ATOM 7900  C CD2  . LEU B 1 19 ? -14.722 -3.877  -8.669  1.00 0.45 ? 19 LEU B CD2  4  
ATOM 7901  H H    . LEU B 1 19 ? -18.389 -6.171  -8.988  1.00 0.45 ? 19 LEU B H    4  
ATOM 7902  H HA   . LEU B 1 19 ? -18.428 -3.772  -10.774 1.00 0.45 ? 19 LEU B HA   4  
ATOM 7903  H HB2  . LEU B 1 19 ? -15.942 -5.381  -10.761 1.00 0.45 ? 19 LEU B HB2  4  
ATOM 7904  H HB3  . LEU B 1 19 ? -16.149 -3.631  -10.828 1.00 0.45 ? 19 LEU B HB3  4  
ATOM 7905  H HG   . LEU B 1 19 ? -16.847 -3.783  -8.358  1.00 0.45 ? 19 LEU B HG   4  
ATOM 7906  H HD11 . LEU B 1 19 ? -16.202 -6.578  -8.983  1.00 0.45 ? 19 LEU B HD11 4  
ATOM 7907  H HD12 . LEU B 1 19 ? -15.361 -5.973  -7.555  1.00 0.45 ? 19 LEU B HD12 4  
ATOM 7908  H HD13 . LEU B 1 19 ? -17.121 -5.912  -7.633  1.00 0.45 ? 19 LEU B HD13 4  
ATOM 7909  H HD21 . LEU B 1 19 ? -14.268 -3.739  -9.640  1.00 0.45 ? 19 LEU B HD21 4  
ATOM 7910  H HD22 . LEU B 1 19 ? -14.771 -2.928  -8.157  1.00 0.45 ? 19 LEU B HD22 4  
ATOM 7911  H HD23 . LEU B 1 19 ? -14.128 -4.568  -8.090  1.00 0.45 ? 19 LEU B HD23 4  
ATOM 7912  N N    . PRO B 1 20 ? -17.857 -5.312  -12.864 1.00 0.58 ? 20 PRO B N    4  
ATOM 7913  C CA   . PRO B 1 20 ? -18.026 -6.145  -14.067 1.00 0.58 ? 20 PRO B CA   4  
ATOM 7914  C C    . PRO B 1 20 ? -16.932 -7.215  -14.130 1.00 0.58 ? 20 PRO B C    4  
ATOM 7915  O O    . PRO B 1 20 ? -15.771 -6.917  -14.328 1.00 0.58 ? 20 PRO B O    4  
ATOM 7916  C CB   . PRO B 1 20 ? -17.885 -5.146  -15.218 1.00 0.58 ? 20 PRO B CB   4  
ATOM 7917  C CG   . PRO B 1 20 ? -17.095 -3.940  -14.656 1.00 0.58 ? 20 PRO B CG   4  
ATOM 7918  C CD   . PRO B 1 20 ? -17.241 -3.994  -13.122 1.00 0.58 ? 20 PRO B CD   4  
ATOM 7919  H HA   . PRO B 1 20 ? -19.005 -6.595  -14.086 1.00 0.58 ? 20 PRO B HA   4  
ATOM 7920  H HB2  . PRO B 1 20 ? -17.344 -5.600  -16.038 1.00 0.58 ? 20 PRO B HB2  4  
ATOM 7921  H HB3  . PRO B 1 20 ? -18.859 -4.820  -15.550 1.00 0.58 ? 20 PRO B HB3  4  
ATOM 7922  H HG2  . PRO B 1 20 ? -16.054 -4.019  -14.936 1.00 0.58 ? 20 PRO B HG2  4  
ATOM 7923  H HG3  . PRO B 1 20 ? -17.513 -3.017  -15.028 1.00 0.58 ? 20 PRO B HG3  4  
ATOM 7924  H HD2  . PRO B 1 20 ? -16.270 -3.929  -12.652 1.00 0.58 ? 20 PRO B HD2  4  
ATOM 7925  H HD3  . PRO B 1 20 ? -17.889 -3.205  -12.774 1.00 0.58 ? 20 PRO B HD3  4  
ATOM 7926  N N    . ARG B 1 21 ? -17.294 -8.457  -13.963 1.00 0.75 ? 21 ARG B N    4  
ATOM 7927  C CA   . ARG B 1 21 ? -16.276 -9.544  -14.011 1.00 0.75 ? 21 ARG B CA   4  
ATOM 7928  C C    . ARG B 1 21 ? -15.685 -9.630  -15.420 1.00 0.75 ? 21 ARG B C    4  
ATOM 7929  O O    . ARG B 1 21 ? -14.709 -10.314 -15.653 1.00 0.75 ? 21 ARG B O    4  
ATOM 7930  C CB   . ARG B 1 21 ? -16.935 -10.877 -13.654 1.00 0.75 ? 21 ARG B CB   4  
ATOM 7931  C CG   . ARG B 1 21 ? -18.234 -11.032 -14.446 1.00 0.75 ? 21 ARG B CG   4  
ATOM 7932  C CD   . ARG B 1 21 ? -19.410 -11.180 -13.477 1.00 0.75 ? 21 ARG B CD   4  
ATOM 7933  N NE   . ARG B 1 21 ? -19.880 -12.594 -13.478 1.00 0.75 ? 21 ARG B NE   4  
ATOM 7934  C CZ   . ARG B 1 21 ? -21.149 -12.858 -13.622 1.00 0.75 ? 21 ARG B CZ   4  
ATOM 7935  N NH1  . ARG B 1 21 ? -21.783 -12.456 -14.691 1.00 0.75 ? 21 ARG B NH1  4  
ATOM 7936  N NH2  . ARG B 1 21 ? -21.786 -13.526 -12.699 1.00 0.75 ? 21 ARG B NH2  4  
ATOM 7937  H H    . ARG B 1 21 ? -18.236 -8.676  -13.803 1.00 0.75 ? 21 ARG B H    4  
ATOM 7938  H HA   . ARG B 1 21 ? -15.488 -9.331  -13.303 1.00 0.75 ? 21 ARG B HA   4  
ATOM 7939  H HB2  . ARG B 1 21 ? -16.264 -11.688 -13.897 1.00 0.75 ? 21 ARG B HB2  4  
ATOM 7940  H HB3  . ARG B 1 21 ? -17.156 -10.897 -12.597 1.00 0.75 ? 21 ARG B HB3  4  
ATOM 7941  H HG2  . ARG B 1 21 ? -18.385 -10.160 -15.065 1.00 0.75 ? 21 ARG B HG2  4  
ATOM 7942  H HG3  . ARG B 1 21 ? -18.173 -11.912 -15.070 1.00 0.75 ? 21 ARG B HG3  4  
ATOM 7943  H HD2  . ARG B 1 21 ? -19.091 -10.907 -12.481 1.00 0.75 ? 21 ARG B HD2  4  
ATOM 7944  H HD3  . ARG B 1 21 ? -20.216 -10.532 -13.787 1.00 0.75 ? 21 ARG B HD3  4  
ATOM 7945  H HE   . ARG B 1 21 ? -19.236 -13.324 -13.370 1.00 0.75 ? 21 ARG B HE   4  
ATOM 7946  H HH11 . ARG B 1 21 ? -21.295 -11.944 -15.397 1.00 0.75 ? 21 ARG B HH11 4  
ATOM 7947  H HH12 . ARG B 1 21 ? -22.756 -12.658 -14.801 1.00 0.75 ? 21 ARG B HH12 4  
ATOM 7948  H HH21 . ARG B 1 21 ? -21.301 -13.835 -11.881 1.00 0.75 ? 21 ARG B HH21 4  
ATOM 7949  H HH22 . ARG B 1 21 ? -22.760 -13.729 -12.811 1.00 0.75 ? 21 ARG B HH22 4  
ATOM 7950  N N    . ALA B 1 22 ? -16.269 -8.943  -16.362 1.00 0.89 ? 22 ALA B N    4  
ATOM 7951  C CA   . ALA B 1 22 ? -15.740 -8.988  -17.755 1.00 0.89 ? 22 ALA B CA   4  
ATOM 7952  C C    . ALA B 1 22 ? -14.443 -8.180  -17.834 1.00 0.89 ? 22 ALA B C    4  
ATOM 7953  O O    . ALA B 1 22 ? -13.619 -8.395  -18.701 1.00 0.89 ? 22 ALA B O    4  
ATOM 7954  C CB   . ALA B 1 22 ? -16.773 -8.390  -18.712 1.00 0.89 ? 22 ALA B CB   4  
ATOM 7955  H H    . ALA B 1 22 ? -17.057 -8.397  -16.154 1.00 0.89 ? 22 ALA B H    4  
ATOM 7956  H HA   . ALA B 1 22 ? -15.543 -10.013 -18.032 1.00 0.89 ? 22 ALA B HA   4  
ATOM 7957  H HB1  . ALA B 1 22 ? -17.234 -7.529  -18.252 1.00 0.89 ? 22 ALA B HB1  4  
ATOM 7958  H HB2  . ALA B 1 22 ? -16.284 -8.091  -19.627 1.00 0.89 ? 22 ALA B HB2  4  
ATOM 7959  H HB3  . ALA B 1 22 ? -17.529 -9.129  -18.932 1.00 0.89 ? 22 ALA B HB3  4  
ATOM 7960  N N    . HIS B 1 23 ? -14.256 -7.251  -16.937 1.00 0.71 ? 23 HIS B N    4  
ATOM 7961  C CA   . HIS B 1 23 ? -13.012 -6.430  -16.964 1.00 0.71 ? 23 HIS B CA   4  
ATOM 7962  C C    . HIS B 1 23 ? -12.187 -6.709  -15.706 1.00 0.71 ? 23 HIS B C    4  
ATOM 7963  O O    . HIS B 1 23 ? -11.330 -5.933  -15.330 1.00 0.71 ? 23 HIS B O    4  
ATOM 7964  C CB   . HIS B 1 23 ? -13.382 -4.945  -17.011 1.00 0.71 ? 23 HIS B CB   4  
ATOM 7965  C CG   . HIS B 1 23 ? -14.205 -4.671  -18.239 1.00 0.71 ? 23 HIS B CG   4  
ATOM 7966  N ND1  . HIS B 1 23 ? -13.997 -3.557  -19.036 1.00 0.71 ? 23 HIS B ND1  4  
ATOM 7967  C CD2  . HIS B 1 23 ? -15.244 -5.358  -18.819 1.00 0.71 ? 23 HIS B CD2  4  
ATOM 7968  C CE1  . HIS B 1 23 ? -14.890 -3.604  -20.041 1.00 0.71 ? 23 HIS B CE1  4  
ATOM 7969  N NE2  . HIS B 1 23 ? -15.674 -4.682  -19.957 1.00 0.71 ? 23 HIS B NE2  4  
ATOM 7970  H H    . HIS B 1 23 ? -14.932 -7.093  -16.247 1.00 0.71 ? 23 HIS B H    4  
ATOM 7971  H HA   . HIS B 1 23 ? -12.433 -6.684  -17.839 1.00 0.71 ? 23 HIS B HA   4  
ATOM 7972  H HB2  . HIS B 1 23 ? -13.952 -4.689  -16.130 1.00 0.71 ? 23 HIS B HB2  4  
ATOM 7973  H HB3  . HIS B 1 23 ? -12.481 -4.352  -17.042 1.00 0.71 ? 23 HIS B HB3  4  
ATOM 7974  H HD1  . HIS B 1 23 ? -13.322 -2.861  -18.892 1.00 0.71 ? 23 HIS B HD1  4  
ATOM 7975  H HD2  . HIS B 1 23 ? -15.663 -6.281  -18.448 1.00 0.71 ? 23 HIS B HD2  4  
ATOM 7976  H HE1  . HIS B 1 23 ? -14.963 -2.862  -20.822 1.00 0.71 ? 23 HIS B HE1  4  
ATOM 7977  N N    . ILE B 1 24 ? -12.437 -7.809  -15.051 1.00 0.56 ? 24 ILE B N    4  
ATOM 7978  C CA   . ILE B 1 24 ? -11.666 -8.134  -13.817 1.00 0.56 ? 24 ILE B CA   4  
ATOM 7979  C C    . ILE B 1 24 ? -10.533 -9.103  -14.163 1.00 0.56 ? 24 ILE B C    4  
ATOM 7980  O O    . ILE B 1 24 ? -10.652 -10.299 -13.991 1.00 0.56 ? 24 ILE B O    4  
ATOM 7981  C CB   . ILE B 1 24 ? -12.596 -8.782  -12.789 1.00 0.56 ? 24 ILE B CB   4  
ATOM 7982  C CG1  . ILE B 1 24 ? -13.542 -7.721  -12.220 1.00 0.56 ? 24 ILE B CG1  4  
ATOM 7983  C CG2  . ILE B 1 24 ? -11.767 -9.383  -11.654 1.00 0.56 ? 24 ILE B CG2  4  
ATOM 7984  C CD1  . ILE B 1 24 ? -14.358 -8.323  -11.076 1.00 0.56 ? 24 ILE B CD1  4  
ATOM 7985  H H    . ILE B 1 24 ? -13.133 -8.422  -15.369 1.00 0.56 ? 24 ILE B H    4  
ATOM 7986  H HA   . ILE B 1 24 ? -11.251 -7.226  -13.404 1.00 0.56 ? 24 ILE B HA   4  
ATOM 7987  H HB   . ILE B 1 24 ? -13.173 -9.562  -13.267 1.00 0.56 ? 24 ILE B HB   4  
ATOM 7988  H HG12 . ILE B 1 24 ? -12.964 -6.885  -11.851 1.00 0.56 ? 24 ILE B HG12 4  
ATOM 7989  H HG13 . ILE B 1 24 ? -14.210 -7.380  -12.997 1.00 0.56 ? 24 ILE B HG13 4  
ATOM 7990  H HG21 . ILE B 1 24 ? -10.999 -8.682  -11.358 1.00 0.56 ? 24 ILE B HG21 4  
ATOM 7991  H HG22 . ILE B 1 24 ? -12.408 -9.593  -10.810 1.00 0.56 ? 24 ILE B HG22 4  
ATOM 7992  H HG23 . ILE B 1 24 ? -11.306 -10.299 -11.992 1.00 0.56 ? 24 ILE B HG23 4  
ATOM 7993  H HD11 . ILE B 1 24 ? -14.068 -9.353  -10.930 1.00 0.56 ? 24 ILE B HD11 4  
ATOM 7994  H HD12 . ILE B 1 24 ? -14.176 -7.766  -10.170 1.00 0.56 ? 24 ILE B HD12 4  
ATOM 7995  H HD13 . ILE B 1 24 ? -15.410 -8.277  -11.320 1.00 0.56 ? 24 ILE B HD13 4  
ATOM 7996  N N    . LYS B 1 25 ? -9.434  -8.594  -14.650 1.00 0.59 ? 25 LYS B N    4  
ATOM 7997  C CA   . LYS B 1 25 ? -8.294  -9.484  -15.006 1.00 0.59 ? 25 LYS B CA   4  
ATOM 7998  C C    . LYS B 1 25 ? -8.077  -10.510 -13.893 1.00 0.59 ? 25 LYS B C    4  
ATOM 7999  O O    . LYS B 1 25 ? -8.234  -11.699 -14.091 1.00 0.59 ? 25 LYS B O    4  
ATOM 8000  C CB   . LYS B 1 25 ? -7.028  -8.643  -15.177 1.00 0.59 ? 25 LYS B CB   4  
ATOM 8001  C CG   . LYS B 1 25 ? -6.117  -9.303  -16.213 1.00 0.59 ? 25 LYS B CG   4  
ATOM 8002  C CD   . LYS B 1 25 ? -4.813  -8.511  -16.325 1.00 0.59 ? 25 LYS B CD   4  
ATOM 8003  C CE   . LYS B 1 25 ? -3.652  -9.471  -16.583 1.00 0.59 ? 25 LYS B CE   4  
ATOM 8004  N NZ   . LYS B 1 25 ? -3.186  -9.322  -17.990 1.00 0.59 ? 25 LYS B NZ   4  
ATOM 8005  H H    . LYS B 1 25 ? -9.358  -7.626  -14.782 1.00 0.59 ? 25 LYS B H    4  
ATOM 8006  H HA   . LYS B 1 25 ? -8.513  -9.997  -15.931 1.00 0.59 ? 25 LYS B HA   4  
ATOM 8007  H HB2  . LYS B 1 25 ? -7.296  -7.651  -15.511 1.00 0.59 ? 25 LYS B HB2  4  
ATOM 8008  H HB3  . LYS B 1 25 ? -6.508  -8.579  -14.233 1.00 0.59 ? 25 LYS B HB3  4  
ATOM 8009  H HG2  . LYS B 1 25 ? -5.899  -10.316 -15.906 1.00 0.59 ? 25 LYS B HG2  4  
ATOM 8010  H HG3  . LYS B 1 25 ? -6.613  -9.315  -17.171 1.00 0.59 ? 25 LYS B HG3  4  
ATOM 8011  H HD2  . LYS B 1 25 ? -4.889  -7.808  -17.143 1.00 0.59 ? 25 LYS B HD2  4  
ATOM 8012  H HD3  . LYS B 1 25 ? -4.637  -7.974  -15.405 1.00 0.59 ? 25 LYS B HD3  4  
ATOM 8013  H HE2  . LYS B 1 25 ? -2.839  -9.244  -15.908 1.00 0.59 ? 25 LYS B HE2  4  
ATOM 8014  H HE3  . LYS B 1 25 ? -3.981  -10.487 -16.419 1.00 0.59 ? 25 LYS B HE3  4  
ATOM 8015  H HZ1  . LYS B 1 25 ? -3.815  -8.663  -18.494 1.00 0.59 ? 25 LYS B HZ1  4  
ATOM 8016  H HZ2  . LYS B 1 25 ? -2.215  -8.949  -17.997 1.00 0.59 ? 25 LYS B HZ2  4  
ATOM 8017  H HZ3  . LYS B 1 25 ? -3.202  -10.247 -18.462 1.00 0.59 ? 25 LYS B HZ3  4  
ATOM 8018  N N    . GLU B 1 26 ? -7.716  -10.062 -12.722 1.00 0.53 ? 26 GLU B N    4  
ATOM 8019  C CA   . GLU B 1 26 ? -7.489  -11.015 -11.599 1.00 0.53 ? 26 GLU B CA   4  
ATOM 8020  C C    . GLU B 1 26 ? -7.520  -10.254 -10.272 1.00 0.53 ? 26 GLU B C    4  
ATOM 8021  O O    . GLU B 1 26 ? -7.337  -9.054  -10.229 1.00 0.53 ? 26 GLU B O    4  
ATOM 8022  C CB   . GLU B 1 26 ? -6.126  -11.688 -11.769 1.00 0.53 ? 26 GLU B CB   4  
ATOM 8023  C CG   . GLU B 1 26 ? -5.039  -10.618 -11.895 1.00 0.53 ? 26 GLU B CG   4  
ATOM 8024  C CD   . GLU B 1 26 ? -3.714  -11.279 -12.279 1.00 0.53 ? 26 GLU B CD   4  
ATOM 8025  O OE1  . GLU B 1 26 ? -3.696  -12.491 -12.413 1.00 0.53 ? 26 GLU B OE1  4  
ATOM 8026  O OE2  . GLU B 1 26 ? -2.740  -10.560 -12.433 1.00 0.53 ? 26 GLU B OE2  4  
ATOM 8027  H H    . GLU B 1 26 ? -7.594  -9.099  -12.581 1.00 0.53 ? 26 GLU B H    4  
ATOM 8028  H HA   . GLU B 1 26 ? -8.264  -11.766 -11.602 1.00 0.53 ? 26 GLU B HA   4  
ATOM 8029  H HB2  . GLU B 1 26 ? -5.922  -12.309 -10.909 1.00 0.53 ? 26 GLU B HB2  4  
ATOM 8030  H HB3  . GLU B 1 26 ? -6.134  -12.297 -12.660 1.00 0.53 ? 26 GLU B HB3  4  
ATOM 8031  H HG2  . GLU B 1 26 ? -5.322  -9.906  -12.657 1.00 0.53 ? 26 GLU B HG2  4  
ATOM 8032  H HG3  . GLU B 1 26 ? -4.924  -10.108 -10.950 1.00 0.53 ? 26 GLU B HG3  4  
ATOM 8033  N N    . TYR B 1 27 ? -7.750  -10.942 -9.186  1.00 0.39 ? 27 TYR B N    4  
ATOM 8034  C CA   . TYR B 1 27 ? -7.793  -10.254 -7.865  1.00 0.39 ? 27 TYR B CA   4  
ATOM 8035  C C    . TYR B 1 27 ? -6.774  -10.895 -6.918  1.00 0.39 ? 27 TYR B C    4  
ATOM 8036  O O    . TYR B 1 27 ? -5.996  -11.743 -7.310  1.00 0.39 ? 27 TYR B O    4  
ATOM 8037  C CB   . TYR B 1 27 ? -9.201  -10.377 -7.271  1.00 0.39 ? 27 TYR B CB   4  
ATOM 8038  C CG   . TYR B 1 27 ? -9.407  -11.767 -6.715  1.00 0.39 ? 27 TYR B CG   4  
ATOM 8039  C CD1  . TYR B 1 27 ? -9.801  -12.811 -7.560  1.00 0.39 ? 27 TYR B CD1  4  
ATOM 8040  C CD2  . TYR B 1 27 ? -9.201  -12.012 -5.351  1.00 0.39 ? 27 TYR B CD2  4  
ATOM 8041  C CE1  . TYR B 1 27 ? -9.989  -14.098 -7.043  1.00 0.39 ? 27 TYR B CE1  4  
ATOM 8042  C CE2  . TYR B 1 27 ? -9.389  -13.298 -4.834  1.00 0.39 ? 27 TYR B CE2  4  
ATOM 8043  C CZ   . TYR B 1 27 ? -9.783  -14.341 -5.679  1.00 0.39 ? 27 TYR B CZ   4  
ATOM 8044  O OH   . TYR B 1 27 ? -9.968  -15.610 -5.170  1.00 0.39 ? 27 TYR B OH   4  
ATOM 8045  H H    . TYR B 1 27 ? -7.896  -11.910 -9.240  1.00 0.39 ? 27 TYR B H    4  
ATOM 8046  H HA   . TYR B 1 27 ? -7.550  -9.210  -7.998  1.00 0.39 ? 27 TYR B HA   4  
ATOM 8047  H HB2  . TYR B 1 27 ? -9.321  -9.652  -6.478  1.00 0.39 ? 27 TYR B HB2  4  
ATOM 8048  H HB3  . TYR B 1 27 ? -9.934  -10.188 -8.042  1.00 0.39 ? 27 TYR B HB3  4  
ATOM 8049  H HD1  . TYR B 1 27 ? -9.961  -12.624 -8.613  1.00 0.39 ? 27 TYR B HD1  4  
ATOM 8050  H HD2  . TYR B 1 27 ? -8.896  -11.206 -4.699  1.00 0.39 ? 27 TYR B HD2  4  
ATOM 8051  H HE1  . TYR B 1 27 ? -10.293 -14.903 -7.695  1.00 0.39 ? 27 TYR B HE1  4  
ATOM 8052  H HE2  . TYR B 1 27 ? -9.229  -13.486 -3.783  1.00 0.39 ? 27 TYR B HE2  4  
ATOM 8053  H HH   . TYR B 1 27 ? -9.868  -16.237 -5.891  1.00 0.39 ? 27 TYR B HH   4  
ATOM 8054  N N    . PHE B 1 28 ? -6.775  -10.498 -5.676  1.00 0.35 ? 28 PHE B N    4  
ATOM 8055  C CA   . PHE B 1 28 ? -5.812  -11.084 -4.702  1.00 0.35 ? 28 PHE B CA   4  
ATOM 8056  C C    . PHE B 1 28 ? -6.043  -10.464 -3.324  1.00 0.35 ? 28 PHE B C    4  
ATOM 8057  O O    . PHE B 1 28 ? -6.570  -9.376  -3.203  1.00 0.35 ? 28 PHE B O    4  
ATOM 8058  C CB   . PHE B 1 28 ? -4.380  -10.797 -5.160  1.00 0.35 ? 28 PHE B CB   4  
ATOM 8059  C CG   . PHE B 1 28 ? -4.278  -9.368  -5.637  1.00 0.35 ? 28 PHE B CG   4  
ATOM 8060  C CD1  . PHE B 1 28 ? -4.370  -8.315  -4.720  1.00 0.35 ? 28 PHE B CD1  4  
ATOM 8061  C CD2  . PHE B 1 28 ? -4.090  -9.097  -6.999  1.00 0.35 ? 28 PHE B CD2  4  
ATOM 8062  C CE1  . PHE B 1 28 ? -4.273  -6.991  -5.164  1.00 0.35 ? 28 PHE B CE1  4  
ATOM 8063  C CE2  . PHE B 1 28 ? -3.994  -7.773  -7.441  1.00 0.35 ? 28 PHE B CE2  4  
ATOM 8064  C CZ   . PHE B 1 28 ? -4.085  -6.720  -6.524  1.00 0.35 ? 28 PHE B CZ   4  
ATOM 8065  H H    . PHE B 1 28 ? -7.413  -9.814  -5.381  1.00 0.35 ? 28 PHE B H    4  
ATOM 8066  H HA   . PHE B 1 28 ? -5.964  -12.152 -4.646  1.00 0.35 ? 28 PHE B HA   4  
ATOM 8067  H HB2  . PHE B 1 28 ? -3.701  -10.949 -4.334  1.00 0.35 ? 28 PHE B HB2  4  
ATOM 8068  H HB3  . PHE B 1 28 ? -4.120  -11.465 -5.967  1.00 0.35 ? 28 PHE B HB3  4  
ATOM 8069  H HD1  . PHE B 1 28 ? -4.514  -8.525  -3.670  1.00 0.35 ? 28 PHE B HD1  4  
ATOM 8070  H HD2  . PHE B 1 28 ? -4.020  -9.910  -7.706  1.00 0.35 ? 28 PHE B HD2  4  
ATOM 8071  H HE1  . PHE B 1 28 ? -4.343  -6.178  -4.455  1.00 0.35 ? 28 PHE B HE1  4  
ATOM 8072  H HE2  . PHE B 1 28 ? -3.849  -7.564  -8.491  1.00 0.35 ? 28 PHE B HE2  4  
ATOM 8073  H HZ   . PHE B 1 28 ? -4.010  -5.697  -6.866  1.00 0.35 ? 28 PHE B HZ   4  
ATOM 8074  N N    . TYR B 1 29 ? -5.657  -11.148 -2.282  1.00 0.32 ? 29 TYR B N    4  
ATOM 8075  C CA   . TYR B 1 29 ? -5.859  -10.598 -0.912  1.00 0.32 ? 29 TYR B CA   4  
ATOM 8076  C C    . TYR B 1 29 ? -4.634  -9.775  -0.506  1.00 0.32 ? 29 TYR B C    4  
ATOM 8077  O O    . TYR B 1 29 ? -3.512  -10.123 -0.810  1.00 0.32 ? 29 TYR B O    4  
ATOM 8078  C CB   . TYR B 1 29 ? -6.051  -11.748 0.076   1.00 0.32 ? 29 TYR B CB   4  
ATOM 8079  C CG   . TYR B 1 29 ? -7.319  -12.497 -0.261  1.00 0.32 ? 29 TYR B CG   4  
ATOM 8080  C CD1  . TYR B 1 29 ? -7.331  -13.413 -1.320  1.00 0.32 ? 29 TYR B CD1  4  
ATOM 8081  C CD2  . TYR B 1 29 ? -8.482  -12.276 0.487   1.00 0.32 ? 29 TYR B CD2  4  
ATOM 8082  C CE1  . TYR B 1 29 ? -8.506  -14.107 -1.631  1.00 0.32 ? 29 TYR B CE1  4  
ATOM 8083  C CE2  . TYR B 1 29 ? -9.658  -12.970 0.175   1.00 0.32 ? 29 TYR B CE2  4  
ATOM 8084  C CZ   . TYR B 1 29 ? -9.669  -13.886 -0.884  1.00 0.32 ? 29 TYR B CZ   4  
ATOM 8085  O OH   . TYR B 1 29 ? -10.828 -14.570 -1.191  1.00 0.32 ? 29 TYR B OH   4  
ATOM 8086  H H    . TYR B 1 29 ? -5.236  -12.024 -2.401  1.00 0.32 ? 29 TYR B H    4  
ATOM 8087  H HA   . TYR B 1 29 ? -6.735  -9.966  -0.905  1.00 0.32 ? 29 TYR B HA   4  
ATOM 8088  H HB2  . TYR B 1 29 ? -5.208  -12.421 0.014   1.00 0.32 ? 29 TYR B HB2  4  
ATOM 8089  H HB3  . TYR B 1 29 ? -6.123  -11.354 1.079   1.00 0.32 ? 29 TYR B HB3  4  
ATOM 8090  H HD1  . TYR B 1 29 ? -6.435  -13.583 -1.897  1.00 0.32 ? 29 TYR B HD1  4  
ATOM 8091  H HD2  . TYR B 1 29 ? -8.473  -11.569 1.304   1.00 0.32 ? 29 TYR B HD2  4  
ATOM 8092  H HE1  . TYR B 1 29 ? -8.516  -14.813 -2.448  1.00 0.32 ? 29 TYR B HE1  4  
ATOM 8093  H HE2  . TYR B 1 29 ? -10.555 -12.800 0.752   1.00 0.32 ? 29 TYR B HE2  4  
ATOM 8094  H HH   . TYR B 1 29 ? -11.346 -14.651 -0.387  1.00 0.32 ? 29 TYR B HH   4  
ATOM 8095  N N    . THR B 1 30 ? -4.844  -8.685  0.180   1.00 0.37 ? 30 THR B N    4  
ATOM 8096  C CA   . THR B 1 30 ? -3.694  -7.839  0.607   1.00 0.37 ? 30 THR B CA   4  
ATOM 8097  C C    . THR B 1 30 ? -3.627  -7.805  2.135   1.00 0.37 ? 30 THR B C    4  
ATOM 8098  O O    . THR B 1 30 ? -4.637  -7.768  2.810   1.00 0.37 ? 30 THR B O    4  
ATOM 8099  C CB   . THR B 1 30 ? -3.880  -6.418  0.072   1.00 0.37 ? 30 THR B CB   4  
ATOM 8100  O OG1  . THR B 1 30 ? -5.256  -6.070  0.129   1.00 0.37 ? 30 THR B OG1  4  
ATOM 8101  C CG2  . THR B 1 30 ? -3.393  -6.347  -1.375  1.00 0.37 ? 30 THR B CG2  4  
ATOM 8102  H H    . THR B 1 30 ? -5.757  -8.422  0.415   1.00 0.37 ? 30 THR B H    4  
ATOM 8103  H HA   . THR B 1 30 ? -2.777  -8.254  0.216   1.00 0.37 ? 30 THR B HA   4  
ATOM 8104  H HB   . THR B 1 30 ? -3.309  -5.728  0.675   1.00 0.37 ? 30 THR B HB   4  
ATOM 8105  H HG1  . THR B 1 30 ? -5.532  -6.098  1.048   1.00 0.37 ? 30 THR B HG1  4  
ATOM 8106  H HG21 . THR B 1 30 ? -3.942  -7.058  -1.975  1.00 0.37 ? 30 THR B HG21 4  
ATOM 8107  H HG22 . THR B 1 30 ? -3.554  -5.351  -1.760  1.00 0.37 ? 30 THR B HG22 4  
ATOM 8108  H HG23 . THR B 1 30 ? -2.339  -6.582  -1.412  1.00 0.37 ? 30 THR B HG23 4  
ATOM 8109  N N    . SER B 1 31 ? -2.444  -7.816  2.688   1.00 0.47 ? 31 SER B N    4  
ATOM 8110  C CA   . SER B 1 31 ? -2.315  -7.783  4.171   1.00 0.47 ? 31 SER B CA   4  
ATOM 8111  C C    . SER B 1 31 ? -0.833  -7.785  4.555   1.00 0.47 ? 31 SER B C    4  
ATOM 8112  O O    . SER B 1 31 ? 0.016   -7.378  3.788   1.00 0.47 ? 31 SER B O    4  
ATOM 8113  C CB   . SER B 1 31 ? -2.998  -9.014  4.769   1.00 0.47 ? 31 SER B CB   4  
ATOM 8114  O OG   . SER B 1 31 ? -3.306  -8.762  6.134   1.00 0.47 ? 31 SER B OG   4  
ATOM 8115  H H    . SER B 1 31 ? -1.641  -7.845  2.126   1.00 0.47 ? 31 SER B H    4  
ATOM 8116  H HA   . SER B 1 31 ? -2.785  -6.890  4.554   1.00 0.47 ? 31 SER B HA   4  
ATOM 8117  H HB2  . SER B 1 31 ? -3.909  -9.219  4.233   1.00 0.47 ? 31 SER B HB2  4  
ATOM 8118  H HB3  . SER B 1 31 ? -2.335  -9.867  4.690   1.00 0.47 ? 31 SER B HB3  4  
ATOM 8119  H HG   . SER B 1 31 ? -4.209  -8.441  6.180   1.00 0.47 ? 31 SER B HG   4  
ATOM 8120  N N    . GLY B 1 32 ? -0.518  -8.241  5.737   1.00 0.60 ? 32 GLY B N    4  
ATOM 8121  C CA   . GLY B 1 32 ? 0.908   -8.269  6.170   1.00 0.60 ? 32 GLY B CA   4  
ATOM 8122  C C    . GLY B 1 32 ? 1.391   -6.842  6.437   1.00 0.60 ? 32 GLY B C    4  
ATOM 8123  O O    . GLY B 1 32 ? 1.385   -6.374  7.558   1.00 0.60 ? 32 GLY B O    4  
ATOM 8124  H H    . GLY B 1 32 ? -1.219  -8.565  6.340   1.00 0.60 ? 32 GLY B H    4  
ATOM 8125  H HA2  . GLY B 1 32 ? 0.999   -8.857  7.072   1.00 0.60 ? 32 GLY B HA2  4  
ATOM 8126  H HA3  . GLY B 1 32 ? 1.512   -8.709  5.390   1.00 0.60 ? 32 GLY B HA3  4  
ATOM 8127  N N    . LYS B 1 33 ? 1.808   -6.146  5.415   1.00 0.55 ? 33 LYS B N    4  
ATOM 8128  C CA   . LYS B 1 33 ? 2.289   -4.750  5.609   1.00 0.55 ? 33 LYS B CA   4  
ATOM 8129  C C    . LYS B 1 33 ? 1.105   -3.785  5.530   1.00 0.55 ? 33 LYS B C    4  
ATOM 8130  O O    . LYS B 1 33 ? 1.198   -2.720  4.953   1.00 0.55 ? 33 LYS B O    4  
ATOM 8131  C CB   . LYS B 1 33 ? 3.301   -4.404  4.516   1.00 0.55 ? 33 LYS B CB   4  
ATOM 8132  C CG   . LYS B 1 33 ? 4.481   -5.376  4.588   1.00 0.55 ? 33 LYS B CG   4  
ATOM 8133  C CD   . LYS B 1 33 ? 5.779   -4.623  4.292   1.00 0.55 ? 33 LYS B CD   4  
ATOM 8134  C CE   . LYS B 1 33 ? 6.819   -5.597  3.736   1.00 0.55 ? 33 LYS B CE   4  
ATOM 8135  N NZ   . LYS B 1 33 ? 7.849   -4.841  2.970   1.00 0.55 ? 33 LYS B NZ   4  
ATOM 8136  H H    . LYS B 1 33 ? 1.804   -6.542  4.518   1.00 0.55 ? 33 LYS B H    4  
ATOM 8137  H HA   . LYS B 1 33 ? 2.761   -4.663  6.577   1.00 0.55 ? 33 LYS B HA   4  
ATOM 8138  H HB2  . LYS B 1 33 ? 2.826   -4.484  3.549   1.00 0.55 ? 33 LYS B HB2  4  
ATOM 8139  H HB3  . LYS B 1 33 ? 3.659   -3.396  4.661   1.00 0.55 ? 33 LYS B HB3  4  
ATOM 8140  H HG2  . LYS B 1 33 ? 4.532   -5.809  5.576   1.00 0.55 ? 33 LYS B HG2  4  
ATOM 8141  H HG3  . LYS B 1 33 ? 4.348   -6.159  3.857   1.00 0.55 ? 33 LYS B HG3  4  
ATOM 8142  H HD2  . LYS B 1 33 ? 5.587   -3.847  3.566   1.00 0.55 ? 33 LYS B HD2  4  
ATOM 8143  H HD3  . LYS B 1 33 ? 6.155   -4.181  5.202   1.00 0.55 ? 33 LYS B HD3  4  
ATOM 8144  H HE2  . LYS B 1 33 ? 7.292   -6.124  4.552   1.00 0.55 ? 33 LYS B HE2  4  
ATOM 8145  H HE3  . LYS B 1 33 ? 6.334   -6.307  3.082   1.00 0.55 ? 33 LYS B HE3  4  
ATOM 8146  H HZ1  . LYS B 1 33 ? 7.831   -3.842  3.256   1.00 0.55 ? 33 LYS B HZ1  4  
ATOM 8147  H HZ2  . LYS B 1 33 ? 8.790   -5.242  3.165   1.00 0.55 ? 33 LYS B HZ2  4  
ATOM 8148  H HZ3  . LYS B 1 33 ? 7.647   -4.911  1.953   1.00 0.55 ? 33 LYS B HZ3  4  
ATOM 8149  N N    . CYS B 1 34 ? -0.009  -4.150  6.102   1.00 0.46 ? 34 CYS B N    4  
ATOM 8150  C CA   . CYS B 1 34 ? -1.198  -3.254  6.058   1.00 0.46 ? 34 CYS B CA   4  
ATOM 8151  C C    . CYS B 1 34 ? -1.858  -3.211  7.437   1.00 0.46 ? 34 CYS B C    4  
ATOM 8152  O O    . CYS B 1 34 ? -1.286  -3.631  8.423   1.00 0.46 ? 34 CYS B O    4  
ATOM 8153  C CB   . CYS B 1 34 ? -2.198  -3.786  5.030   1.00 0.46 ? 34 CYS B CB   4  
ATOM 8154  S SG   . CYS B 1 34 ? -1.340  -4.124  3.473   1.00 0.46 ? 34 CYS B SG   4  
ATOM 8155  H H    . CYS B 1 34 ? -0.064  -5.014  6.562   1.00 0.46 ? 34 CYS B H    4  
ATOM 8156  H HA   . CYS B 1 34 ? -0.888  -2.258  5.776   1.00 0.46 ? 34 CYS B HA   4  
ATOM 8157  H HB2  . CYS B 1 34 ? -2.645  -4.697  5.401   1.00 0.46 ? 34 CYS B HB2  4  
ATOM 8158  H HB3  . CYS B 1 34 ? -2.970  -3.049  4.864   1.00 0.46 ? 34 CYS B HB3  4  
ATOM 8159  N N    . SER B 1 35 ? -3.059  -2.708  7.514   1.00 0.42 ? 35 SER B N    4  
ATOM 8160  C CA   . SER B 1 35 ? -3.755  -2.640  8.829   1.00 0.42 ? 35 SER B CA   4  
ATOM 8161  C C    . SER B 1 35 ? -4.744  -3.802  8.945   1.00 0.42 ? 35 SER B C    4  
ATOM 8162  O O    . SER B 1 35 ? -4.988  -4.317  10.018  1.00 0.42 ? 35 SER B O    4  
ATOM 8163  C CB   . SER B 1 35 ? -4.511  -1.315  8.938   1.00 0.42 ? 35 SER B CB   4  
ATOM 8164  O OG   . SER B 1 35 ? -4.713  -1.001  10.309  1.00 0.42 ? 35 SER B OG   4  
ATOM 8165  H H    . SER B 1 35 ? -3.503  -2.375  6.707   1.00 0.42 ? 35 SER B H    4  
ATOM 8166  H HA   . SER B 1 35 ? -3.028  -2.706  9.626   1.00 0.42 ? 35 SER B HA   4  
ATOM 8167  H HB2  . SER B 1 35 ? -3.935  -0.530  8.476   1.00 0.42 ? 35 SER B HB2  4  
ATOM 8168  H HB3  . SER B 1 35 ? -5.464  -1.403  8.434   1.00 0.42 ? 35 SER B HB3  4  
ATOM 8169  H HG   . SER B 1 35 ? -3.853  -0.965  10.736  1.00 0.42 ? 35 SER B HG   4  
ATOM 8170  N N    . ASN B 1 36 ? -5.316  -4.217  7.848   1.00 0.38 ? 36 ASN B N    4  
ATOM 8171  C CA   . ASN B 1 36 ? -6.290  -5.344  7.898   1.00 0.38 ? 36 ASN B CA   4  
ATOM 8172  C C    . ASN B 1 36 ? -6.248  -6.115  6.573   1.00 0.38 ? 36 ASN B C    4  
ATOM 8173  O O    . ASN B 1 36 ? -6.014  -5.536  5.530   1.00 0.38 ? 36 ASN B O    4  
ATOM 8174  C CB   . ASN B 1 36 ? -7.702  -4.796  8.121   1.00 0.38 ? 36 ASN B CB   4  
ATOM 8175  C CG   . ASN B 1 36 ? -7.632  -3.507  8.944   1.00 0.38 ? 36 ASN B CG   4  
ATOM 8176  O OD1  . ASN B 1 36 ? -7.378  -3.543  10.130  1.00 0.38 ? 36 ASN B OD1  4  
ATOM 8177  N ND2  . ASN B 1 36 ? -7.847  -2.362  8.357   1.00 0.38 ? 36 ASN B ND2  4  
ATOM 8178  H H    . ASN B 1 36 ? -5.107  -3.788  6.992   1.00 0.38 ? 36 ASN B H    4  
ATOM 8179  H HA   . ASN B 1 36 ? -6.030  -6.009  8.709   1.00 0.38 ? 36 ASN B HA   4  
ATOM 8180  H HB2  . ASN B 1 36 ? -8.161  -4.588  7.165   1.00 0.38 ? 36 ASN B HB2  4  
ATOM 8181  H HB3  . ASN B 1 36 ? -8.292  -5.527  8.651   1.00 0.38 ? 36 ASN B HB3  4  
ATOM 8182  H HD21 . ASN B 1 36 ? -8.053  -2.332  7.399   1.00 0.38 ? 36 ASN B HD21 4  
ATOM 8183  H HD22 . ASN B 1 36 ? -7.806  -1.530  8.874   1.00 0.38 ? 36 ASN B HD22 4  
ATOM 8184  N N    . PRO B 1 37 ? -6.479  -7.400  6.658   1.00 0.37 ? 37 PRO B N    4  
ATOM 8185  C CA   . PRO B 1 37 ? -6.480  -8.285  5.481   1.00 0.37 ? 37 PRO B CA   4  
ATOM 8186  C C    . PRO B 1 37 ? -7.794  -8.138  4.707   1.00 0.37 ? 37 PRO B C    4  
ATOM 8187  O O    . PRO B 1 37 ? -8.868  -8.227  5.268   1.00 0.37 ? 37 PRO B O    4  
ATOM 8188  C CB   . PRO B 1 37 ? -6.354  -9.686  6.085   1.00 0.37 ? 37 PRO B CB   4  
ATOM 8189  C CG   . PRO B 1 37 ? -6.855  -9.578  7.545   1.00 0.37 ? 37 PRO B CG   4  
ATOM 8190  C CD   . PRO B 1 37 ? -6.761  -8.090  7.933   1.00 0.37 ? 37 PRO B CD   4  
ATOM 8191  H HA   . PRO B 1 37 ? -5.634  -8.078  4.845   1.00 0.37 ? 37 PRO B HA   4  
ATOM 8192  H HB2  . PRO B 1 37 ? -6.966  -10.384 5.529   1.00 0.37 ? 37 PRO B HB2  4  
ATOM 8193  H HB3  . PRO B 1 37 ? -5.324  -10.005 6.077   1.00 0.37 ? 37 PRO B HB3  4  
ATOM 8194  H HG2  . PRO B 1 37 ? -7.880  -9.917  7.610   1.00 0.37 ? 37 PRO B HG2  4  
ATOM 8195  H HG3  . PRO B 1 37 ? -6.228  -10.164 8.197   1.00 0.37 ? 37 PRO B HG3  4  
ATOM 8196  H HD2  . PRO B 1 37 ? -7.698  -7.750  8.352   1.00 0.37 ? 37 PRO B HD2  4  
ATOM 8197  H HD3  . PRO B 1 37 ? -5.953  -7.930  8.630   1.00 0.37 ? 37 PRO B HD3  4  
ATOM 8198  N N    . ALA B 1 38 ? -7.717  -7.913  3.424   1.00 0.33 ? 38 ALA B N    4  
ATOM 8199  C CA   . ALA B 1 38 ? -8.963  -7.759  2.621   1.00 0.33 ? 38 ALA B CA   4  
ATOM 8200  C C    . ALA B 1 38 ? -8.733  -8.302  1.209   1.00 0.33 ? 38 ALA B C    4  
ATOM 8201  O O    . ALA B 1 38 ? -7.730  -8.929  0.931   1.00 0.33 ? 38 ALA B O    4  
ATOM 8202  C CB   . ALA B 1 38 ? -9.339  -6.278  2.542   1.00 0.33 ? 38 ALA B CB   4  
ATOM 8203  H H    . ALA B 1 38 ? -6.841  -7.842  2.989   1.00 0.33 ? 38 ALA B H    4  
ATOM 8204  H HA   . ALA B 1 38 ? -9.765  -8.307  3.091   1.00 0.33 ? 38 ALA B HA   4  
ATOM 8205  H HB1  . ALA B 1 38 ? -8.467  -5.700  2.274   1.00 0.33 ? 38 ALA B HB1  4  
ATOM 8206  H HB2  . ALA B 1 38 ? -10.106 -6.140  1.794   1.00 0.33 ? 38 ALA B HB2  4  
ATOM 8207  H HB3  . ALA B 1 38 ? -9.707  -5.949  3.502   1.00 0.33 ? 38 ALA B HB3  4  
ATOM 8208  N N    . VAL B 1 39 ? -9.654  -8.066  0.315   1.00 0.30 ? 39 VAL B N    4  
ATOM 8209  C CA   . VAL B 1 39 ? -9.486  -8.567  -1.077  1.00 0.30 ? 39 VAL B CA   4  
ATOM 8210  C C    . VAL B 1 39 ? -9.213  -7.387  -2.012  1.00 0.30 ? 39 VAL B C    4  
ATOM 8211  O O    . VAL B 1 39 ? -9.439  -6.244  -1.667  1.00 0.30 ? 39 VAL B O    4  
ATOM 8212  C CB   . VAL B 1 39 ? -10.763 -9.285  -1.519  1.00 0.30 ? 39 VAL B CB   4  
ATOM 8213  C CG1  . VAL B 1 39 ? -10.719 -9.527  -3.029  1.00 0.30 ? 39 VAL B CG1  4  
ATOM 8214  C CG2  . VAL B 1 39 ? -10.869 -10.627 -0.793  1.00 0.30 ? 39 VAL B CG2  4  
ATOM 8215  H H    . VAL B 1 39 ? -10.456 -7.557  0.560   1.00 0.30 ? 39 VAL B H    4  
ATOM 8216  H HA   . VAL B 1 39 ? -8.655  -9.256  -1.113  1.00 0.30 ? 39 VAL B HA   4  
ATOM 8217  H HB   . VAL B 1 39 ? -11.621 -8.673  -1.276  1.00 0.30 ? 39 VAL B HB   4  
ATOM 8218  H HG11 . VAL B 1 39 ? -9.827  -10.079 -3.279  1.00 0.30 ? 39 VAL B HG11 4  
ATOM 8219  H HG12 . VAL B 1 39 ? -11.589 -10.093 -3.328  1.00 0.30 ? 39 VAL B HG12 4  
ATOM 8220  H HG13 . VAL B 1 39 ? -10.713 -8.578  -3.545  1.00 0.30 ? 39 VAL B HG13 4  
ATOM 8221  H HG21 . VAL B 1 39 ? -10.332 -10.574 0.143   1.00 0.30 ? 39 VAL B HG21 4  
ATOM 8222  H HG22 . VAL B 1 39 ? -11.907 -10.852 -0.599  1.00 0.30 ? 39 VAL B HG22 4  
ATOM 8223  H HG23 . VAL B 1 39 ? -10.441 -11.404 -1.409  1.00 0.30 ? 39 VAL B HG23 4  
ATOM 8224  N N    . VAL B 1 40 ? -8.726  -7.654  -3.192  1.00 0.33 ? 40 VAL B N    4  
ATOM 8225  C CA   . VAL B 1 40 ? -8.438  -6.546  -4.146  1.00 0.33 ? 40 VAL B CA   4  
ATOM 8226  C C    . VAL B 1 40 ? -8.771  -7.000  -5.569  1.00 0.33 ? 40 VAL B C    4  
ATOM 8227  O O    . VAL B 1 40 ? -8.181  -7.926  -6.090  1.00 0.33 ? 40 VAL B O    4  
ATOM 8228  C CB   . VAL B 1 40 ? -6.957  -6.174  -4.061  1.00 0.33 ? 40 VAL B CB   4  
ATOM 8229  C CG1  . VAL B 1 40 ? -6.591  -5.261  -5.233  1.00 0.33 ? 40 VAL B CG1  4  
ATOM 8230  C CG2  . VAL B 1 40 ? -6.692  -5.441  -2.743  1.00 0.33 ? 40 VAL B CG2  4  
ATOM 8231  H H    . VAL B 1 40 ? -8.550  -8.583  -3.452  1.00 0.33 ? 40 VAL B H    4  
ATOM 8232  H HA   . VAL B 1 40 ? -9.041  -5.687  -3.893  1.00 0.33 ? 40 VAL B HA   4  
ATOM 8233  H HB   . VAL B 1 40 ? -6.358  -7.071  -4.104  1.00 0.33 ? 40 VAL B HB   4  
ATOM 8234  H HG11 . VAL B 1 40 ? -7.456  -4.683  -5.523  1.00 0.33 ? 40 VAL B HG11 4  
ATOM 8235  H HG12 . VAL B 1 40 ? -5.796  -4.594  -4.933  1.00 0.33 ? 40 VAL B HG12 4  
ATOM 8236  H HG13 . VAL B 1 40 ? -6.261  -5.862  -6.068  1.00 0.33 ? 40 VAL B HG13 4  
ATOM 8237  H HG21 . VAL B 1 40 ? -7.578  -4.900  -2.448  1.00 0.33 ? 40 VAL B HG21 4  
ATOM 8238  H HG22 . VAL B 1 40 ? -6.438  -6.159  -1.978  1.00 0.33 ? 40 VAL B HG22 4  
ATOM 8239  H HG23 . VAL B 1 40 ? -5.874  -4.750  -2.875  1.00 0.33 ? 40 VAL B HG23 4  
ATOM 8240  N N    . PHE B 1 41 ? -9.713  -6.356  -6.202  1.00 0.37 ? 41 PHE B N    4  
ATOM 8241  C CA   . PHE B 1 41 ? -10.083 -6.751  -7.590  1.00 0.37 ? 41 PHE B CA   4  
ATOM 8242  C C    . PHE B 1 41 ? -9.318  -5.881  -8.589  1.00 0.37 ? 41 PHE B C    4  
ATOM 8243  O O    . PHE B 1 41 ? -9.465  -4.675  -8.617  1.00 0.37 ? 41 PHE B O    4  
ATOM 8244  C CB   . PHE B 1 41 ? -11.587 -6.558  -7.791  1.00 0.37 ? 41 PHE B CB   4  
ATOM 8245  C CG   . PHE B 1 41 ? -12.333 -7.690  -7.127  1.00 0.37 ? 41 PHE B CG   4  
ATOM 8246  C CD1  . PHE B 1 41 ? -12.404 -8.941  -7.750  1.00 0.37 ? 41 PHE B CD1  4  
ATOM 8247  C CD2  . PHE B 1 41 ? -12.953 -7.488  -5.888  1.00 0.37 ? 41 PHE B CD2  4  
ATOM 8248  C CE1  . PHE B 1 41 ? -13.096 -9.992  -7.135  1.00 0.37 ? 41 PHE B CE1  4  
ATOM 8249  C CE2  . PHE B 1 41 ? -13.644 -8.538  -5.273  1.00 0.37 ? 41 PHE B CE2  4  
ATOM 8250  C CZ   . PHE B 1 41 ? -13.716 -9.790  -5.896  1.00 0.37 ? 41 PHE B CZ   4  
ATOM 8251  H H    . PHE B 1 41 ? -10.177 -5.612  -5.764  1.00 0.37 ? 41 PHE B H    4  
ATOM 8252  H HA   . PHE B 1 41 ? -9.829  -7.789  -7.748  1.00 0.37 ? 41 PHE B HA   4  
ATOM 8253  H HB2  . PHE B 1 41 ? -11.891 -5.619  -7.353  1.00 0.37 ? 41 PHE B HB2  4  
ATOM 8254  H HB3  . PHE B 1 41 ? -11.811 -6.551  -8.848  1.00 0.37 ? 41 PHE B HB3  4  
ATOM 8255  H HD1  . PHE B 1 41 ? -11.927 -9.097  -8.707  1.00 0.37 ? 41 PHE B HD1  4  
ATOM 8256  H HD2  . PHE B 1 41 ? -12.897 -6.523  -5.408  1.00 0.37 ? 41 PHE B HD2  4  
ATOM 8257  H HE1  . PHE B 1 41 ? -13.152 -10.957 -7.615  1.00 0.37 ? 41 PHE B HE1  4  
ATOM 8258  H HE2  . PHE B 1 41 ? -14.122 -8.383  -4.316  1.00 0.37 ? 41 PHE B HE2  4  
ATOM 8259  H HZ   . PHE B 1 41 ? -14.249 -10.600 -5.420  1.00 0.37 ? 41 PHE B HZ   4  
ATOM 8260  N N    . VAL B 1 42 ? -8.502  -6.483  -9.411  1.00 0.46 ? 42 VAL B N    4  
ATOM 8261  C CA   . VAL B 1 42 ? -7.729  -5.691  -10.408 1.00 0.46 ? 42 VAL B CA   4  
ATOM 8262  C C    . VAL B 1 42 ? -8.299  -5.935  -11.806 1.00 0.46 ? 42 VAL B C    4  
ATOM 8263  O O    . VAL B 1 42 ? -8.404  -7.059  -12.257 1.00 0.46 ? 42 VAL B O    4  
ATOM 8264  C CB   . VAL B 1 42 ? -6.260  -6.119  -10.373 1.00 0.46 ? 42 VAL B CB   4  
ATOM 8265  C CG1  . VAL B 1 42 ? -5.423  -5.140  -11.197 1.00 0.46 ? 42 VAL B CG1  4  
ATOM 8266  C CG2  . VAL B 1 42 ? -5.765  -6.121  -8.925  1.00 0.46 ? 42 VAL B CG2  4  
ATOM 8267  H H    . VAL B 1 42 ? -8.398  -7.457  -9.372  1.00 0.46 ? 42 VAL B H    4  
ATOM 8268  H HA   . VAL B 1 42 ? -7.803  -4.641  -10.168 1.00 0.46 ? 42 VAL B HA   4  
ATOM 8269  H HB   . VAL B 1 42 ? -6.166  -7.113  -10.789 1.00 0.46 ? 42 VAL B HB   4  
ATOM 8270  H HG11 . VAL B 1 42 ? -5.805  -5.099  -12.207 1.00 0.46 ? 42 VAL B HG11 4  
ATOM 8271  H HG12 . VAL B 1 42 ? -5.476  -4.157  -10.752 1.00 0.46 ? 42 VAL B HG12 4  
ATOM 8272  H HG13 . VAL B 1 42 ? -4.395  -5.472  -11.215 1.00 0.46 ? 42 VAL B HG13 4  
ATOM 8273  H HG21 . VAL B 1 42 ? -6.265  -5.339  -8.373  1.00 0.46 ? 42 VAL B HG21 4  
ATOM 8274  H HG22 . VAL B 1 42 ? -5.980  -7.076  -8.472  1.00 0.46 ? 42 VAL B HG22 4  
ATOM 8275  H HG23 . VAL B 1 42 ? -4.699  -5.946  -8.909  1.00 0.46 ? 42 VAL B HG23 4  
ATOM 8276  N N    . THR B 1 43 ? -8.668  -4.891  -12.496 1.00 0.54 ? 43 THR B N    4  
ATOM 8277  C CA   . THR B 1 43 ? -9.233  -5.062  -13.864 1.00 0.54 ? 43 THR B CA   4  
ATOM 8278  C C    . THR B 1 43 ? -8.102  -5.024  -14.894 1.00 0.54 ? 43 THR B C    4  
ATOM 8279  O O    . THR B 1 43 ? -6.951  -4.826  -14.557 1.00 0.54 ? 43 THR B O    4  
ATOM 8280  C CB   . THR B 1 43 ? -10.223 -3.929  -14.153 1.00 0.54 ? 43 THR B CB   4  
ATOM 8281  O OG1  . THR B 1 43 ? -9.636  -2.687  -13.790 1.00 0.54 ? 43 THR B OG1  4  
ATOM 8282  C CG2  . THR B 1 43 ? -11.502 -4.149  -13.345 1.00 0.54 ? 43 THR B CG2  4  
ATOM 8283  H H    . THR B 1 43 ? -8.576  -3.993  -12.114 1.00 0.54 ? 43 THR B H    4  
ATOM 8284  H HA   . THR B 1 43 ? -9.745  -6.011  -13.927 1.00 0.54 ? 43 THR B HA   4  
ATOM 8285  H HB   . THR B 1 43 ? -10.463 -3.920  -15.205 1.00 0.54 ? 43 THR B HB   4  
ATOM 8286  H HG1  . THR B 1 43 ? -9.596  -2.137  -14.575 1.00 0.54 ? 43 THR B HG1  4  
ATOM 8287  H HG21 . THR B 1 43 ? -11.483 -5.132  -12.901 1.00 0.54 ? 43 THR B HG21 4  
ATOM 8288  H HG22 . THR B 1 43 ? -11.568 -3.403  -12.567 1.00 0.54 ? 43 THR B HG22 4  
ATOM 8289  H HG23 . THR B 1 43 ? -12.358 -4.065  -13.997 1.00 0.54 ? 43 THR B HG23 4  
ATOM 8290  N N    . ARG B 1 44 ? -8.418  -5.214  -16.146 1.00 0.69 ? 44 ARG B N    4  
ATOM 8291  C CA   . ARG B 1 44 ? -7.361  -5.190  -17.195 1.00 0.69 ? 44 ARG B CA   4  
ATOM 8292  C C    . ARG B 1 44 ? -6.807  -3.770  -17.330 1.00 0.69 ? 44 ARG B C    4  
ATOM 8293  O O    . ARG B 1 44 ? -5.752  -3.556  -17.891 1.00 0.69 ? 44 ARG B O    4  
ATOM 8294  C CB   . ARG B 1 44 ? -7.958  -5.634  -18.532 1.00 0.69 ? 44 ARG B CB   4  
ATOM 8295  C CG   . ARG B 1 44 ? -8.639  -6.993  -18.361 1.00 0.69 ? 44 ARG B CG   4  
ATOM 8296  C CD   . ARG B 1 44 ? -8.935  -7.593  -19.737 1.00 0.69 ? 44 ARG B CD   4  
ATOM 8297  N NE   . ARG B 1 44 ? -8.446  -8.999  -19.782 1.00 0.69 ? 44 ARG B NE   4  
ATOM 8298  C CZ   . ARG B 1 44 ? -9.248  -9.979  -19.463 1.00 0.69 ? 44 ARG B CZ   4  
ATOM 8299  N NH1  . ARG B 1 44 ? -10.276 -10.252 -20.218 1.00 0.69 ? 44 ARG B NH1  4  
ATOM 8300  N NH2  . ARG B 1 44 ? -9.019  -10.685 -18.389 1.00 0.69 ? 44 ARG B NH2  4  
ATOM 8301  H H    . ARG B 1 44 ? -9.353  -5.373  -16.395 1.00 0.69 ? 44 ARG B H    4  
ATOM 8302  H HA   . ARG B 1 44 ? -6.562  -5.862  -16.917 1.00 0.69 ? 44 ARG B HA   4  
ATOM 8303  H HB2  . ARG B 1 44 ? -8.685  -4.904  -18.860 1.00 0.69 ? 44 ARG B HB2  4  
ATOM 8304  H HB3  . ARG B 1 44 ? -7.173  -5.715  -19.267 1.00 0.69 ? 44 ARG B HB3  4  
ATOM 8305  H HG2  . ARG B 1 44 ? -7.986  -7.656  -17.812 1.00 0.69 ? 44 ARG B HG2  4  
ATOM 8306  H HG3  . ARG B 1 44 ? -9.564  -6.867  -17.819 1.00 0.69 ? 44 ARG B HG3  4  
ATOM 8307  H HD2  . ARG B 1 44 ? -10.000 -7.576  -19.915 1.00 0.69 ? 44 ARG B HD2  4  
ATOM 8308  H HD3  . ARG B 1 44 ? -8.434  -7.013  -20.498 1.00 0.69 ? 44 ARG B HD3  4  
ATOM 8309  H HE   . ARG B 1 44 ? -7.523  -9.189  -20.050 1.00 0.69 ? 44 ARG B HE   4  
ATOM 8310  H HH11 . ARG B 1 44 ? -10.451 -9.712  -21.041 1.00 0.69 ? 44 ARG B HH11 4  
ATOM 8311  H HH12 . ARG B 1 44 ? -10.890 -11.003 -19.973 1.00 0.69 ? 44 ARG B HH12 4  
ATOM 8312  H HH21 . ARG B 1 44 ? -8.231  -10.477 -17.811 1.00 0.69 ? 44 ARG B HH21 4  
ATOM 8313  H HH22 . ARG B 1 44 ? -9.633  -11.436 -18.145 1.00 0.69 ? 44 ARG B HH22 4  
ATOM 8314  N N    . LYS B 1 45 ? -7.511  -2.797  -16.817 1.00 0.66 ? 45 LYS B N    4  
ATOM 8315  C CA   . LYS B 1 45 ? -7.023  -1.393  -16.917 1.00 0.66 ? 45 LYS B CA   4  
ATOM 8316  C C    . LYS B 1 45 ? -6.135  -1.075  -15.711 1.00 0.66 ? 45 LYS B C    4  
ATOM 8317  O O    . LYS B 1 45 ? -5.938  0.070   -15.359 1.00 0.66 ? 45 LYS B O    4  
ATOM 8318  C CB   . LYS B 1 45 ? -8.218  -0.437  -16.936 1.00 0.66 ? 45 LYS B CB   4  
ATOM 8319  C CG   . LYS B 1 45 ? -9.223  -0.897  -17.993 1.00 0.66 ? 45 LYS B CG   4  
ATOM 8320  C CD   . LYS B 1 45 ? -8.517  -1.040  -19.342 1.00 0.66 ? 45 LYS B CD   4  
ATOM 8321  C CE   . LYS B 1 45 ? -9.276  -0.243  -20.404 1.00 0.66 ? 45 LYS B CE   4  
ATOM 8322  N NZ   . LYS B 1 45 ? -8.669  -0.493  -21.741 1.00 0.66 ? 45 LYS B NZ   4  
ATOM 8323  H H    . LYS B 1 45 ? -8.359  -2.991  -16.368 1.00 0.66 ? 45 LYS B H    4  
ATOM 8324  H HA   . LYS B 1 45 ? -6.452  -1.273  -17.826 1.00 0.66 ? 45 LYS B HA   4  
ATOM 8325  H HB2  . LYS B 1 45 ? -8.691  -0.434  -15.964 1.00 0.66 ? 45 LYS B HB2  4  
ATOM 8326  H HB3  . LYS B 1 45 ? -7.879  0.559   -17.173 1.00 0.66 ? 45 LYS B HB3  4  
ATOM 8327  H HG2  . LYS B 1 45 ? -9.641  -1.851  -17.701 1.00 0.66 ? 45 LYS B HG2  4  
ATOM 8328  H HG3  . LYS B 1 45 ? -10.014 -0.169  -18.079 1.00 0.66 ? 45 LYS B HG3  4  
ATOM 8329  H HD2  . LYS B 1 45 ? -7.507  -0.664  -19.261 1.00 0.66 ? 45 LYS B HD2  4  
ATOM 8330  H HD3  . LYS B 1 45 ? -8.491  -2.082  -19.627 1.00 0.66 ? 45 LYS B HD3  4  
ATOM 8331  H HE2  . LYS B 1 45 ? -10.310 -0.552  -20.414 1.00 0.66 ? 45 LYS B HE2  4  
ATOM 8332  H HE3  . LYS B 1 45 ? -9.216  0.811   -20.173 1.00 0.66 ? 45 LYS B HE3  4  
ATOM 8333  H HZ1  . LYS B 1 45 ? -7.664  -0.220  -21.722 1.00 0.66 ? 45 LYS B HZ1  4  
ATOM 8334  H HZ2  . LYS B 1 45 ? -8.750  -1.502  -21.976 1.00 0.66 ? 45 LYS B HZ2  4  
ATOM 8335  H HZ3  . LYS B 1 45 ? -9.167  0.069   -22.459 1.00 0.66 ? 45 LYS B HZ3  4  
ATOM 8336  N N    . ASN B 1 46 ? -5.598  -2.080  -15.076 1.00 0.61 ? 46 ASN B N    4  
ATOM 8337  C CA   . ASN B 1 46 ? -4.724  -1.835  -13.895 1.00 0.61 ? 46 ASN B CA   4  
ATOM 8338  C C    . ASN B 1 46 ? -5.522  -1.103  -12.815 1.00 0.61 ? 46 ASN B C    4  
ATOM 8339  O O    . ASN B 1 46 ? -4.981  -0.337  -12.042 1.00 0.61 ? 46 ASN B O    4  
ATOM 8340  C CB   . ASN B 1 46 ? -3.528  -0.978  -14.315 1.00 0.61 ? 46 ASN B CB   4  
ATOM 8341  C CG   . ASN B 1 46 ? -2.890  -1.570  -15.573 1.00 0.61 ? 46 ASN B CG   4  
ATOM 8342  O OD1  . ASN B 1 46 ? -3.429  -1.449  -16.655 1.00 0.61 ? 46 ASN B OD1  4  
ATOM 8343  N ND2  . ASN B 1 46 ? -1.758  -2.211  -15.476 1.00 0.61 ? 46 ASN B ND2  4  
ATOM 8344  H H    . ASN B 1 46 ? -5.769  -2.998  -15.377 1.00 0.61 ? 46 ASN B H    4  
ATOM 8345  H HA   . ASN B 1 46 ? -4.372  -2.778  -13.505 1.00 0.61 ? 46 ASN B HA   4  
ATOM 8346  H HB2  . ASN B 1 46 ? -3.862  0.030   -14.519 1.00 0.61 ? 46 ASN B HB2  4  
ATOM 8347  H HB3  . ASN B 1 46 ? -2.800  -0.961  -13.518 1.00 0.61 ? 46 ASN B HB3  4  
ATOM 8348  H HD21 . ASN B 1 46 ? -1.323  -2.308  -14.603 1.00 0.61 ? 46 ASN B HD21 4  
ATOM 8349  H HD22 . ASN B 1 46 ? -1.342  -2.594  -16.276 1.00 0.61 ? 46 ASN B HD22 4  
ATOM 8350  N N    . ARG B 1 47 ? -6.806  -1.331  -12.754 1.00 0.52 ? 47 ARG B N    4  
ATOM 8351  C CA   . ARG B 1 47 ? -7.636  -0.649  -11.724 1.00 0.52 ? 47 ARG B CA   4  
ATOM 8352  C C    . ARG B 1 47 ? -7.683  -1.504  -10.457 1.00 0.52 ? 47 ARG B C    4  
ATOM 8353  O O    . ARG B 1 47 ? -8.227  -2.592  -10.451 1.00 0.52 ? 47 ARG B O    4  
ATOM 8354  C CB   . ARG B 1 47 ? -9.056  -0.454  -12.260 1.00 0.52 ? 47 ARG B CB   4  
ATOM 8355  C CG   . ARG B 1 47 ? -9.474  1.007   -12.080 1.00 0.52 ? 47 ARG B CG   4  
ATOM 8356  C CD   . ARG B 1 47 ? -10.709 1.077   -11.179 1.00 0.52 ? 47 ARG B CD   4  
ATOM 8357  N NE   . ARG B 1 47 ? -11.528 2.264   -11.552 1.00 0.52 ? 47 ARG B NE   4  
ATOM 8358  C CZ   . ARG B 1 47 ? -12.382 2.761   -10.699 1.00 0.52 ? 47 ARG B CZ   4  
ATOM 8359  N NH1  . ARG B 1 47 ? -13.195 1.971   -10.053 1.00 0.52 ? 47 ARG B NH1  4  
ATOM 8360  N NH2  . ARG B 1 47 ? -12.424 4.049   -10.494 1.00 0.52 ? 47 ARG B NH2  4  
ATOM 8361  H H    . ARG B 1 47 ? -7.223  -1.953  -13.388 1.00 0.52 ? 47 ARG B H    4  
ATOM 8362  H HA   . ARG B 1 47 ? -7.203  0.313   -11.492 1.00 0.52 ? 47 ARG B HA   4  
ATOM 8363  H HB2  . ARG B 1 47 ? -9.083  -0.709  -13.310 1.00 0.52 ? 47 ARG B HB2  4  
ATOM 8364  H HB3  . ARG B 1 47 ? -9.738  -1.090  -11.717 1.00 0.52 ? 47 ARG B HB3  4  
ATOM 8365  H HG2  . ARG B 1 47 ? -8.664  1.560   -11.626 1.00 0.52 ? 47 ARG B HG2  4  
ATOM 8366  H HG3  . ARG B 1 47 ? -9.709  1.437   -13.042 1.00 0.52 ? 47 ARG B HG3  4  
ATOM 8367  H HD2  . ARG B 1 47 ? -11.297 0.179   -11.303 1.00 0.52 ? 47 ARG B HD2  4  
ATOM 8368  H HD3  . ARG B 1 47 ? -10.398 1.163   -10.148 1.00 0.52 ? 47 ARG B HD3  4  
ATOM 8369  H HE   . ARG B 1 47 ? -11.427 2.670   -12.437 1.00 0.52 ? 47 ARG B HE   4  
ATOM 8370  H HH11 . ARG B 1 47 ? -13.162 0.983   -10.210 1.00 0.52 ? 47 ARG B HH11 4  
ATOM 8371  H HH12 . ARG B 1 47 ? -13.849 2.351   -9.400  1.00 0.52 ? 47 ARG B HH12 4  
ATOM 8372  H HH21 . ARG B 1 47 ? -11.802 4.655   -10.990 1.00 0.52 ? 47 ARG B HH21 4  
ATOM 8373  H HH22 . ARG B 1 47 ? -13.079 4.431   -9.841  1.00 0.52 ? 47 ARG B HH22 4  
ATOM 8374  N N    . GLN B 1 48 ? -7.117  -1.025  -9.384  1.00 0.45 ? 48 GLN B N    4  
ATOM 8375  C CA   . GLN B 1 48 ? -7.128  -1.811  -8.120  1.00 0.45 ? 48 GLN B CA   4  
ATOM 8376  C C    . GLN B 1 48 ? -8.308  -1.367  -7.253  1.00 0.45 ? 48 GLN B C    4  
ATOM 8377  O O    . GLN B 1 48 ? -8.489  -0.196  -6.988  1.00 0.45 ? 48 GLN B O    4  
ATOM 8378  C CB   . GLN B 1 48 ? -5.821  -1.576  -7.360  1.00 0.45 ? 48 GLN B CB   4  
ATOM 8379  C CG   . GLN B 1 48 ? -4.645  -1.636  -8.336  1.00 0.45 ? 48 GLN B CG   4  
ATOM 8380  C CD   . GLN B 1 48 ? -4.285  -3.096  -8.614  1.00 0.45 ? 48 GLN B CD   4  
ATOM 8381  O OE1  . GLN B 1 48 ? -4.712  -3.985  -7.904  1.00 0.45 ? 48 GLN B OE1  4  
ATOM 8382  N NE2  . GLN B 1 48 ? -3.511  -3.384  -9.624  1.00 0.45 ? 48 GLN B NE2  4  
ATOM 8383  H H    . GLN B 1 48 ? -6.683  -0.146  -9.411  1.00 0.45 ? 48 GLN B H    4  
ATOM 8384  H HA   . GLN B 1 48 ? -7.227  -2.862  -8.350  1.00 0.45 ? 48 GLN B HA   4  
ATOM 8385  H HB2  . GLN B 1 48 ? -5.849  -0.604  -6.888  1.00 0.45 ? 48 GLN B HB2  4  
ATOM 8386  H HB3  . GLN B 1 48 ? -5.700  -2.339  -6.606  1.00 0.45 ? 48 GLN B HB3  4  
ATOM 8387  H HG2  . GLN B 1 48 ? -4.920  -1.150  -9.262  1.00 0.45 ? 48 GLN B HG2  4  
ATOM 8388  H HG3  . GLN B 1 48 ? -3.792  -1.133  -7.905  1.00 0.45 ? 48 GLN B HG3  4  
ATOM 8389  H HE21 . GLN B 1 48 ? -3.167  -2.668  -10.198 1.00 0.45 ? 48 GLN B HE21 4  
ATOM 8390  H HE22 . GLN B 1 48 ? -3.276  -4.317  -9.812  1.00 0.45 ? 48 GLN B HE22 4  
ATOM 8391  N N    . VAL B 1 49 ? -9.112  -2.294  -6.810  1.00 0.37 ? 49 VAL B N    4  
ATOM 8392  C CA   . VAL B 1 49 ? -10.279 -1.925  -5.961  1.00 0.37 ? 49 VAL B CA   4  
ATOM 8393  C C    . VAL B 1 49 ? -10.259 -2.758  -4.678  1.00 0.37 ? 49 VAL B C    4  
ATOM 8394  O O    . VAL B 1 49 ? -9.648  -3.806  -4.617  1.00 0.37 ? 49 VAL B O    4  
ATOM 8395  C CB   . VAL B 1 49 ? -11.574 -2.198  -6.728  1.00 0.37 ? 49 VAL B CB   4  
ATOM 8396  C CG1  . VAL B 1 49 ? -12.769 -2.043  -5.785  1.00 0.37 ? 49 VAL B CG1  4  
ATOM 8397  C CG2  . VAL B 1 49 ? -11.704 -1.201  -7.880  1.00 0.37 ? 49 VAL B CG2  4  
ATOM 8398  H H    . VAL B 1 49 ? -8.948  -3.233  -7.035  1.00 0.37 ? 49 VAL B H    4  
ATOM 8399  H HA   . VAL B 1 49 ? -10.224 -0.876  -5.710  1.00 0.37 ? 49 VAL B HA   4  
ATOM 8400  H HB   . VAL B 1 49 ? -11.554 -3.205  -7.120  1.00 0.37 ? 49 VAL B HB   4  
ATOM 8401  H HG11 . VAL B 1 49 ? -12.608 -1.194  -5.136  1.00 0.37 ? 49 VAL B HG11 4  
ATOM 8402  H HG12 . VAL B 1 49 ? -13.667 -1.889  -6.365  1.00 0.37 ? 49 VAL B HG12 4  
ATOM 8403  H HG13 . VAL B 1 49 ? -12.875 -2.937  -5.188  1.00 0.37 ? 49 VAL B HG13 4  
ATOM 8404  H HG21 . VAL B 1 49 ? -11.228 -0.271  -7.607  1.00 0.37 ? 49 VAL B HG21 4  
ATOM 8405  H HG22 . VAL B 1 49 ? -11.224 -1.604  -8.761  1.00 0.37 ? 49 VAL B HG22 4  
ATOM 8406  H HG23 . VAL B 1 49 ? -12.748 -1.024  -8.088  1.00 0.37 ? 49 VAL B HG23 4  
ATOM 8407  N N    . CYS B 1 50 ? -10.922 -2.300  -3.651  1.00 0.29 ? 50 CYS B N    4  
ATOM 8408  C CA   . CYS B 1 50 ? -10.937 -3.067  -2.373  1.00 0.29 ? 50 CYS B CA   4  
ATOM 8409  C C    . CYS B 1 50 ? -12.298 -3.745  -2.202  1.00 0.29 ? 50 CYS B C    4  
ATOM 8410  O O    . CYS B 1 50 ? -13.330 -3.169  -2.484  1.00 0.29 ? 50 CYS B O    4  
ATOM 8411  C CB   . CYS B 1 50 ? -10.692 -2.114  -1.203  1.00 0.29 ? 50 CYS B CB   4  
ATOM 8412  S SG   . CYS B 1 50 ? -9.304  -1.020  -1.599  1.00 0.29 ? 50 CYS B SG   4  
ATOM 8413  H H    . CYS B 1 50 ? -11.407 -1.452  -3.720  1.00 0.29 ? 50 CYS B H    4  
ATOM 8414  H HA   . CYS B 1 50 ? -10.162 -3.819  -2.395  1.00 0.29 ? 50 CYS B HA   4  
ATOM 8415  H HB2  . CYS B 1 50 ? -11.578 -1.522  -1.028  1.00 0.29 ? 50 CYS B HB2  4  
ATOM 8416  H HB3  . CYS B 1 50 ? -10.459 -2.684  -0.316  1.00 0.29 ? 50 CYS B HB3  4  
ATOM 8417  N N    . ALA B 1 51 ? -12.308 -4.966  -1.740  1.00 0.23 ? 51 ALA B N    4  
ATOM 8418  C CA   . ALA B 1 51 ? -13.602 -5.679  -1.550  1.00 0.23 ? 51 ALA B CA   4  
ATOM 8419  C C    . ALA B 1 51 ? -13.525 -6.546  -0.291  1.00 0.23 ? 51 ALA B C    4  
ATOM 8420  O O    . ALA B 1 51 ? -12.546 -7.225  -0.051  1.00 0.23 ? 51 ALA B O    4  
ATOM 8421  C CB   . ALA B 1 51 ? -13.878 -6.568  -2.765  1.00 0.23 ? 51 ALA B CB   4  
ATOM 8422  H H    . ALA B 1 51 ? -11.465 -5.412  -1.519  1.00 0.23 ? 51 ALA B H    4  
ATOM 8423  H HA   . ALA B 1 51 ? -14.399 -4.958  -1.442  1.00 0.23 ? 51 ALA B HA   4  
ATOM 8424  H HB1  . ALA B 1 51 ? -12.946 -6.953  -3.148  1.00 0.23 ? 51 ALA B HB1  4  
ATOM 8425  H HB2  . ALA B 1 51 ? -14.515 -7.390  -2.472  1.00 0.23 ? 51 ALA B HB2  4  
ATOM 8426  H HB3  . ALA B 1 51 ? -14.370 -5.987  -3.531  1.00 0.23 ? 51 ALA B HB3  4  
ATOM 8427  N N    . ASN B 1 52 ? -14.550 -6.529  0.515   1.00 0.26 ? 52 ASN B N    4  
ATOM 8428  C CA   . ASN B 1 52 ? -14.535 -7.351  1.757   1.00 0.26 ? 52 ASN B CA   4  
ATOM 8429  C C    . ASN B 1 52 ? -15.171 -8.717  1.471   1.00 0.26 ? 52 ASN B C    4  
ATOM 8430  O O    . ASN B 1 52 ? -16.119 -8.808  0.716   1.00 0.26 ? 52 ASN B O    4  
ATOM 8431  C CB   . ASN B 1 52 ? -15.334 -6.636  2.850   1.00 0.26 ? 52 ASN B CB   4  
ATOM 8432  C CG   . ASN B 1 52 ? -15.497 -7.561  4.056   1.00 0.26 ? 52 ASN B CG   4  
ATOM 8433  O OD1  . ASN B 1 52 ? -15.964 -8.675  3.924   1.00 0.26 ? 52 ASN B OD1  4  
ATOM 8434  N ND2  . ASN B 1 52 ? -15.128 -7.145  5.237   1.00 0.26 ? 52 ASN B ND2  4  
ATOM 8435  H H    . ASN B 1 52 ? -15.331 -5.975  0.305   1.00 0.26 ? 52 ASN B H    4  
ATOM 8436  H HA   . ASN B 1 52 ? -13.516 -7.486  2.086   1.00 0.26 ? 52 ASN B HA   4  
ATOM 8437  H HB2  . ASN B 1 52 ? -14.809 -5.740  3.149   1.00 0.26 ? 52 ASN B HB2  4  
ATOM 8438  H HB3  . ASN B 1 52 ? -16.309 -6.371  2.468   1.00 0.26 ? 52 ASN B HB3  4  
ATOM 8439  H HD21 . ASN B 1 52 ? -14.751 -6.246  5.344   1.00 0.26 ? 52 ASN B HD21 4  
ATOM 8440  H HD22 . ASN B 1 52 ? -15.228 -7.731  6.017   1.00 0.26 ? 52 ASN B HD22 4  
ATOM 8441  N N    . PRO B 1 53 ? -14.625 -9.741  2.081   1.00 0.30 ? 53 PRO B N    4  
ATOM 8442  C CA   . PRO B 1 53 ? -15.114 -11.122 1.913   1.00 0.30 ? 53 PRO B CA   4  
ATOM 8443  C C    . PRO B 1 53 ? -16.345 -11.374 2.793   1.00 0.30 ? 53 PRO B C    4  
ATOM 8444  O O    . PRO B 1 53 ? -16.472 -12.411 3.415   1.00 0.30 ? 53 PRO B O    4  
ATOM 8445  C CB   . PRO B 1 53 ? -13.935 -11.977 2.384   1.00 0.30 ? 53 PRO B CB   4  
ATOM 8446  C CG   . PRO B 1 53 ? -13.085 -11.077 3.313   1.00 0.30 ? 53 PRO B CG   4  
ATOM 8447  C CD   . PRO B 1 53 ? -13.464 -9.620  2.986   1.00 0.30 ? 53 PRO B CD   4  
ATOM 8448  H HA   . PRO B 1 53 ? -15.331 -11.330 0.879   1.00 0.30 ? 53 PRO B HA   4  
ATOM 8449  H HB2  . PRO B 1 53 ? -14.297 -12.840 2.927   1.00 0.30 ? 53 PRO B HB2  4  
ATOM 8450  H HB3  . PRO B 1 53 ? -13.341 -12.289 1.539   1.00 0.30 ? 53 PRO B HB3  4  
ATOM 8451  H HG2  . PRO B 1 53 ? -13.310 -11.297 4.348   1.00 0.30 ? 53 PRO B HG2  4  
ATOM 8452  H HG3  . PRO B 1 53 ? -12.035 -11.232 3.121   1.00 0.30 ? 53 PRO B HG3  4  
ATOM 8453  H HD2  . PRO B 1 53 ? -13.736 -9.091  3.889   1.00 0.30 ? 53 PRO B HD2  4  
ATOM 8454  H HD3  . PRO B 1 53 ? -12.650 -9.120  2.483   1.00 0.30 ? 53 PRO B HD3  4  
ATOM 8455  N N    . GLU B 1 54 ? -17.254 -10.438 2.854   1.00 0.43 ? 54 GLU B N    4  
ATOM 8456  C CA   . GLU B 1 54 ? -18.468 -10.633 3.696   1.00 0.43 ? 54 GLU B CA   4  
ATOM 8457  C C    . GLU B 1 54 ? -19.704 -10.165 2.923   1.00 0.43 ? 54 GLU B C    4  
ATOM 8458  O O    . GLU B 1 54 ? -20.749 -9.925  3.493   1.00 0.43 ? 54 GLU B O    4  
ATOM 8459  C CB   . GLU B 1 54 ? -18.334 -9.817  4.983   1.00 0.43 ? 54 GLU B CB   4  
ATOM 8460  C CG   . GLU B 1 54 ? -17.274 -10.453 5.884   1.00 0.43 ? 54 GLU B CG   4  
ATOM 8461  C CD   . GLU B 1 54 ? -17.379 -9.864  7.291   1.00 0.43 ? 54 GLU B CD   4  
ATOM 8462  O OE1  . GLU B 1 54 ? -18.262 -10.281 8.023   1.00 0.43 ? 54 GLU B OE1  4  
ATOM 8463  O OE2  . GLU B 1 54 ? -16.574 -9.005  7.614   1.00 0.43 ? 54 GLU B OE2  4  
ATOM 8464  H H    . GLU B 1 54 ? -17.138 -9.608  2.349   1.00 0.43 ? 54 GLU B H    4  
ATOM 8465  H HA   . GLU B 1 54 ? -18.571 -11.679 3.942   1.00 0.43 ? 54 GLU B HA   4  
ATOM 8466  H HB2  . GLU B 1 54 ? -18.039 -8.806  4.739   1.00 0.43 ? 54 GLU B HB2  4  
ATOM 8467  H HB3  . GLU B 1 54 ? -19.281 -9.801  5.500   1.00 0.43 ? 54 GLU B HB3  4  
ATOM 8468  H HG2  . GLU B 1 54 ? -17.433 -11.522 5.927   1.00 0.43 ? 54 GLU B HG2  4  
ATOM 8469  H HG3  . GLU B 1 54 ? -16.292 -10.251 5.484   1.00 0.43 ? 54 GLU B HG3  4  
ATOM 8470  N N    . LYS B 1 55 ? -19.591 -10.036 1.629   1.00 0.47 ? 55 LYS B N    4  
ATOM 8471  C CA   . LYS B 1 55 ? -20.760 -9.584  0.822   1.00 0.47 ? 55 LYS B CA   4  
ATOM 8472  C C    . LYS B 1 55 ? -21.415 -10.794 0.150   1.00 0.47 ? 55 LYS B C    4  
ATOM 8473  O O    . LYS B 1 55 ? -21.060 -11.927 0.410   1.00 0.47 ? 55 LYS B O    4  
ATOM 8474  C CB   . LYS B 1 55 ? -20.289 -8.599  -0.249  1.00 0.47 ? 55 LYS B CB   4  
ATOM 8475  C CG   . LYS B 1 55 ? -20.308 -7.178  0.319   1.00 0.47 ? 55 LYS B CG   4  
ATOM 8476  C CD   . LYS B 1 55 ? -21.713 -6.589  0.173   1.00 0.47 ? 55 LYS B CD   4  
ATOM 8477  C CE   . LYS B 1 55 ? -22.024 -5.706  1.382   1.00 0.47 ? 55 LYS B CE   4  
ATOM 8478  N NZ   . LYS B 1 55 ? -23.501 -5.564  1.527   1.00 0.47 ? 55 LYS B NZ   4  
ATOM 8479  H H    . LYS B 1 55 ? -18.739 -10.235 1.188   1.00 0.47 ? 55 LYS B H    4  
ATOM 8480  H HA   . LYS B 1 55 ? -21.477 -9.099  1.467   1.00 0.47 ? 55 LYS B HA   4  
ATOM 8481  H HB2  . LYS B 1 55 ? -19.284 -8.852  -0.555  1.00 0.47 ? 55 LYS B HB2  4  
ATOM 8482  H HB3  . LYS B 1 55 ? -20.950 -8.652  -1.103  1.00 0.47 ? 55 LYS B HB3  4  
ATOM 8483  H HG2  . LYS B 1 55 ? -20.036 -7.206  1.365   1.00 0.47 ? 55 LYS B HG2  4  
ATOM 8484  H HG3  . LYS B 1 55 ? -19.604 -6.565  -0.222  1.00 0.47 ? 55 LYS B HG3  4  
ATOM 8485  H HD2  . LYS B 1 55 ? -21.761 -5.996  -0.730  1.00 0.47 ? 55 LYS B HD2  4  
ATOM 8486  H HD3  . LYS B 1 55 ? -22.436 -7.388  0.117   1.00 0.47 ? 55 LYS B HD3  4  
ATOM 8487  H HE2  . LYS B 1 55 ? -21.617 -6.159  2.273   1.00 0.47 ? 55 LYS B HE2  4  
ATOM 8488  H HE3  . LYS B 1 55 ? -21.582 -4.731  1.240   1.00 0.47 ? 55 LYS B HE3  4  
ATOM 8489  H HZ1  . LYS B 1 55 ? -23.929 -6.503  1.650   1.00 0.47 ? 55 LYS B HZ1  4  
ATOM 8490  H HZ2  . LYS B 1 55 ? -23.714 -4.977  2.357   1.00 0.47 ? 55 LYS B HZ2  4  
ATOM 8491  H HZ3  . LYS B 1 55 ? -23.891 -5.115  0.673   1.00 0.47 ? 55 LYS B HZ3  4  
ATOM 8492  N N    . LYS B 1 56 ? -22.367 -10.563 -0.710  1.00 0.58 ? 56 LYS B N    4  
ATOM 8493  C CA   . LYS B 1 56 ? -23.043 -11.700 -1.397  1.00 0.58 ? 56 LYS B CA   4  
ATOM 8494  C C    . LYS B 1 56 ? -22.459 -11.868 -2.801  1.00 0.58 ? 56 LYS B C    4  
ATOM 8495  O O    . LYS B 1 56 ? -22.644 -12.884 -3.442  1.00 0.58 ? 56 LYS B O    4  
ATOM 8496  C CB   . LYS B 1 56 ? -24.543 -11.415 -1.500  1.00 0.58 ? 56 LYS B CB   4  
ATOM 8497  C CG   . LYS B 1 56 ? -25.008 -10.663 -0.252  1.00 0.58 ? 56 LYS B CG   4  
ATOM 8498  C CD   . LYS B 1 56 ? -26.471 -10.250 -0.419  1.00 0.58 ? 56 LYS B CD   4  
ATOM 8499  C CE   . LYS B 1 56 ? -26.912 -9.427  0.792   1.00 0.58 ? 56 LYS B CE   4  
ATOM 8500  N NZ   . LYS B 1 56 ? -27.093 -10.327 1.965   1.00 0.58 ? 56 LYS B NZ   4  
ATOM 8501  H H    . LYS B 1 56 ? -22.638 -9.642  -0.905  1.00 0.58 ? 56 LYS B H    4  
ATOM 8502  H HA   . LYS B 1 56 ? -22.887 -12.606 -0.831  1.00 0.58 ? 56 LYS B HA   4  
ATOM 8503  H HB2  . LYS B 1 56 ? -24.735 -10.813 -2.376  1.00 0.58 ? 56 LYS B HB2  4  
ATOM 8504  H HB3  . LYS B 1 56 ? -25.081 -12.348 -1.578  1.00 0.58 ? 56 LYS B HB3  4  
ATOM 8505  H HG2  . LYS B 1 56 ? -24.911 -11.306 0.612   1.00 0.58 ? 56 LYS B HG2  4  
ATOM 8506  H HG3  . LYS B 1 56 ? -24.400 -9.782  -0.115  1.00 0.58 ? 56 LYS B HG3  4  
ATOM 8507  H HD2  . LYS B 1 56 ? -26.577 -9.657  -1.317  1.00 0.58 ? 56 LYS B HD2  4  
ATOM 8508  H HD3  . LYS B 1 56 ? -27.089 -11.132 -0.496  1.00 0.58 ? 56 LYS B HD3  4  
ATOM 8509  H HE2  . LYS B 1 56 ? -26.159 -8.687  1.018   1.00 0.58 ? 56 LYS B HE2  4  
ATOM 8510  H HE3  . LYS B 1 56 ? -27.846 -8.932  0.570   1.00 0.58 ? 56 LYS B HE3  4  
ATOM 8511  H HZ1  . LYS B 1 56 ? -26.539 -11.196 1.823   1.00 0.58 ? 56 LYS B HZ1  4  
ATOM 8512  H HZ2  . LYS B 1 56 ? -26.768 -9.843  2.827   1.00 0.58 ? 56 LYS B HZ2  4  
ATOM 8513  H HZ3  . LYS B 1 56 ? -28.099 -10.568 2.065   1.00 0.58 ? 56 LYS B HZ3  4  
ATOM 8514  N N    . TRP B 1 57 ? -21.756 -10.881 -3.285  1.00 0.41 ? 57 TRP B N    4  
ATOM 8515  C CA   . TRP B 1 57 ? -21.162 -10.987 -4.647  1.00 0.41 ? 57 TRP B CA   4  
ATOM 8516  C C    . TRP B 1 57 ? -19.641 -11.103 -4.535  1.00 0.41 ? 57 TRP B C    4  
ATOM 8517  O O    . TRP B 1 57 ? -18.993 -11.709 -5.365  1.00 0.41 ? 57 TRP B O    4  
ATOM 8518  C CB   . TRP B 1 57 ? -21.521 -9.740  -5.458  1.00 0.41 ? 57 TRP B CB   4  
ATOM 8519  C CG   . TRP B 1 57 ? -20.823 -8.551  -4.882  1.00 0.41 ? 57 TRP B CG   4  
ATOM 8520  C CD1  . TRP B 1 57 ? -21.336 -7.730  -3.938  1.00 0.41 ? 57 TRP B CD1  4  
ATOM 8521  C CD2  . TRP B 1 57 ? -19.496 -8.037  -5.196  1.00 0.41 ? 57 TRP B CD2  4  
ATOM 8522  N NE1  . TRP B 1 57 ? -20.409 -6.744  -3.651  1.00 0.41 ? 57 TRP B NE1  4  
ATOM 8523  C CE2  . TRP B 1 57 ? -19.258 -6.890  -4.401  1.00 0.41 ? 57 TRP B CE2  4  
ATOM 8524  C CE3  . TRP B 1 57 ? -18.486 -8.449  -6.083  1.00 0.41 ? 57 TRP B CE3  4  
ATOM 8525  C CZ2  . TRP B 1 57 ? -18.062 -6.177  -4.483  1.00 0.41 ? 57 TRP B CZ2  4  
ATOM 8526  C CZ3  . TRP B 1 57 ? -17.280 -7.734  -6.169  1.00 0.41 ? 57 TRP B CZ3  4  
ATOM 8527  C CH2  . TRP B 1 57 ? -17.068 -6.601  -5.371  1.00 0.41 ? 57 TRP B CH2  4  
ATOM 8528  H H    . TRP B 1 57 ? -21.619 -10.070 -2.751  1.00 0.41 ? 57 TRP B H    4  
ATOM 8529  H HA   . TRP B 1 57 ? -21.554 -11.864 -5.143  1.00 0.41 ? 57 TRP B HA   4  
ATOM 8530  H HB2  . TRP B 1 57 ? -21.213 -9.877  -6.484  1.00 0.41 ? 57 TRP B HB2  4  
ATOM 8531  H HB3  . TRP B 1 57 ? -22.590 -9.582  -5.422  1.00 0.41 ? 57 TRP B HB3  4  
ATOM 8532  H HD1  . TRP B 1 57 ? -22.310 -7.829  -3.482  1.00 0.41 ? 57 TRP B HD1  4  
ATOM 8533  H HE1  . TRP B 1 57 ? -20.535 -6.023  -3.000  1.00 0.41 ? 57 TRP B HE1  4  
ATOM 8534  H HE3  . TRP B 1 57 ? -18.639 -9.321  -6.702  1.00 0.41 ? 57 TRP B HE3  4  
ATOM 8535  H HZ2  . TRP B 1 57 ? -17.904 -5.306  -3.867  1.00 0.41 ? 57 TRP B HZ2  4  
ATOM 8536  H HZ3  . TRP B 1 57 ? -16.511 -8.059  -6.854  1.00 0.41 ? 57 TRP B HZ3  4  
ATOM 8537  H HH2  . TRP B 1 57 ? -16.139 -6.056  -5.441  1.00 0.41 ? 57 TRP B HH2  4  
ATOM 8538  N N    . VAL B 1 58 ? -19.065 -10.530 -3.514  1.00 0.32 ? 58 VAL B N    4  
ATOM 8539  C CA   . VAL B 1 58 ? -17.585 -10.613 -3.353  1.00 0.32 ? 58 VAL B CA   4  
ATOM 8540  C C    . VAL B 1 58 ? -17.156 -12.081 -3.374  1.00 0.32 ? 58 VAL B C    4  
ATOM 8541  O O    . VAL B 1 58 ? -16.421 -12.510 -4.242  1.00 0.32 ? 58 VAL B O    4  
ATOM 8542  C CB   . VAL B 1 58 ? -17.181 -9.982  -2.018  1.00 0.32 ? 58 VAL B CB   4  
ATOM 8543  C CG1  . VAL B 1 58 ? -15.677 -10.165 -1.802  1.00 0.32 ? 58 VAL B CG1  4  
ATOM 8544  C CG2  . VAL B 1 58 ? -17.513 -8.488  -2.041  1.00 0.32 ? 58 VAL B CG2  4  
ATOM 8545  H H    . VAL B 1 58 ? -19.604 -10.048 -2.853  1.00 0.32 ? 58 VAL B H    4  
ATOM 8546  H HA   . VAL B 1 58 ? -17.104 -10.085 -4.162  1.00 0.32 ? 58 VAL B HA   4  
ATOM 8547  H HB   . VAL B 1 58 ? -17.721 -10.462 -1.216  1.00 0.32 ? 58 VAL B HB   4  
ATOM 8548  H HG11 . VAL B 1 58 ? -15.177 -10.198 -2.758  1.00 0.32 ? 58 VAL B HG11 4  
ATOM 8549  H HG12 . VAL B 1 58 ? -15.294 -9.337  -1.223  1.00 0.32 ? 58 VAL B HG12 4  
ATOM 8550  H HG13 . VAL B 1 58 ? -15.500 -11.089 -1.270  1.00 0.32 ? 58 VAL B HG13 4  
ATOM 8551  H HG21 . VAL B 1 58 ? -18.507 -8.347  -2.437  1.00 0.32 ? 58 VAL B HG21 4  
ATOM 8552  H HG22 . VAL B 1 58 ? -17.466 -8.094  -1.036  1.00 0.32 ? 58 VAL B HG22 4  
ATOM 8553  H HG23 . VAL B 1 58 ? -16.800 -7.970  -2.665  1.00 0.32 ? 58 VAL B HG23 4  
ATOM 8554  N N    . ARG B 1 59 ? -17.611 -12.855 -2.428  1.00 0.34 ? 59 ARG B N    4  
ATOM 8555  C CA   . ARG B 1 59 ? -17.232 -14.295 -2.398  1.00 0.34 ? 59 ARG B CA   4  
ATOM 8556  C C    . ARG B 1 59 ? -17.688 -14.962 -3.698  1.00 0.34 ? 59 ARG B C    4  
ATOM 8557  O O    . ARG B 1 59 ? -17.187 -16.000 -4.085  1.00 0.34 ? 59 ARG B O    4  
ATOM 8558  C CB   . ARG B 1 59 ? -17.910 -14.978 -1.208  1.00 0.34 ? 59 ARG B CB   4  
ATOM 8559  C CG   . ARG B 1 59 ? -17.499 -16.451 -1.161  1.00 0.34 ? 59 ARG B CG   4  
ATOM 8560  C CD   . ARG B 1 59 ? -18.747 -17.332 -1.229  1.00 0.34 ? 59 ARG B CD   4  
ATOM 8561  N NE   . ARG B 1 59 ? -18.734 -18.114 -2.498  1.00 0.34 ? 59 ARG B NE   4  
ATOM 8562  C CZ   . ARG B 1 59 ? -19.522 -19.146 -2.636  1.00 0.34 ? 59 ARG B CZ   4  
ATOM 8563  N NH1  . ARG B 1 59 ? -19.259 -20.256 -2.003  1.00 0.34 ? 59 ARG B NH1  4  
ATOM 8564  N NH2  . ARG B 1 59 ? -20.571 -19.066 -3.407  1.00 0.34 ? 59 ARG B NH2  4  
ATOM 8565  H H    . ARG B 1 59 ? -18.205 -12.491 -1.739  1.00 0.34 ? 59 ARG B H    4  
ATOM 8566  H HA   . ARG B 1 59 ? -16.160 -14.384 -2.304  1.00 0.34 ? 59 ARG B HA   4  
ATOM 8567  H HB2  . ARG B 1 59 ? -17.608 -14.489 -0.294  1.00 0.34 ? 59 ARG B HB2  4  
ATOM 8568  H HB3  . ARG B 1 59 ? -18.982 -14.910 -1.317  1.00 0.34 ? 59 ARG B HB3  4  
ATOM 8569  H HG2  . ARG B 1 59 ? -16.854 -16.672 -2.000  1.00 0.34 ? 59 ARG B HG2  4  
ATOM 8570  H HG3  . ARG B 1 59 ? -16.970 -16.648 -0.240  1.00 0.34 ? 59 ARG B HG3  4  
ATOM 8571  H HD2  . ARG B 1 59 ? -18.755 -18.010 -0.388  1.00 0.34 ? 59 ARG B HD2  4  
ATOM 8572  H HD3  . ARG B 1 59 ? -19.629 -16.709 -1.198  1.00 0.34 ? 59 ARG B HD3  4  
ATOM 8573  H HE   . ARG B 1 59 ? -18.135 -17.853 -3.228  1.00 0.34 ? 59 ARG B HE   4  
ATOM 8574  H HH11 . ARG B 1 59 ? -18.455 -20.316 -1.411  1.00 0.34 ? 59 ARG B HH11 4  
ATOM 8575  H HH12 . ARG B 1 59 ? -19.863 -21.047 -2.109  1.00 0.34 ? 59 ARG B HH12 4  
ATOM 8576  H HH21 . ARG B 1 59 ? -20.773 -18.215 -3.892  1.00 0.34 ? 59 ARG B HH21 4  
ATOM 8577  H HH22 . ARG B 1 59 ? -21.175 -19.856 -3.513  1.00 0.34 ? 59 ARG B HH22 4  
ATOM 8578  N N    . GLU B 1 60 ? -18.634 -14.371 -4.375  1.00 0.37 ? 60 GLU B N    4  
ATOM 8579  C CA   . GLU B 1 60 ? -19.123 -14.965 -5.650  1.00 0.37 ? 60 GLU B CA   4  
ATOM 8580  C C    . GLU B 1 60 ? -18.061 -14.779 -6.736  1.00 0.37 ? 60 GLU B C    4  
ATOM 8581  O O    . GLU B 1 60 ? -17.897 -15.610 -7.607  1.00 0.37 ? 60 GLU B O    4  
ATOM 8582  C CB   . GLU B 1 60 ? -20.416 -14.264 -6.075  1.00 0.37 ? 60 GLU B CB   4  
ATOM 8583  C CG   . GLU B 1 60 ? -21.616 -15.001 -5.477  1.00 0.37 ? 60 GLU B CG   4  
ATOM 8584  C CD   . GLU B 1 60 ? -22.899 -14.230 -5.794  1.00 0.37 ? 60 GLU B CD   4  
ATOM 8585  O OE1  . GLU B 1 60 ? -22.810 -13.230 -6.486  1.00 0.37 ? 60 GLU B OE1  4  
ATOM 8586  O OE2  . GLU B 1 60 ? -23.949 -14.653 -5.339  1.00 0.37 ? 60 GLU B OE2  4  
ATOM 8587  H H    . GLU B 1 60 ? -19.022 -13.534 -4.045  1.00 0.37 ? 60 GLU B H    4  
ATOM 8588  H HA   . GLU B 1 60 ? -19.313 -16.018 -5.508  1.00 0.37 ? 60 GLU B HA   4  
ATOM 8589  H HB2  . GLU B 1 60 ? -20.405 -13.244 -5.719  1.00 0.37 ? 60 GLU B HB2  4  
ATOM 8590  H HB3  . GLU B 1 60 ? -20.493 -14.269 -7.151  1.00 0.37 ? 60 GLU B HB3  4  
ATOM 8591  H HG2  . GLU B 1 60 ? -21.677 -15.993 -5.902  1.00 0.37 ? 60 GLU B HG2  4  
ATOM 8592  H HG3  . GLU B 1 60 ? -21.497 -15.075 -4.407  1.00 0.37 ? 60 GLU B HG3  4  
ATOM 8593  N N    . TYR B 1 61 ? -17.338 -13.693 -6.691  1.00 0.36 ? 61 TYR B N    4  
ATOM 8594  C CA   . TYR B 1 61 ? -16.286 -13.454 -7.718  1.00 0.36 ? 61 TYR B CA   4  
ATOM 8595  C C    . TYR B 1 61 ? -15.059 -14.307 -7.396  1.00 0.36 ? 61 TYR B C    4  
ATOM 8596  O O    . TYR B 1 61 ? -14.470 -14.918 -8.265  1.00 0.36 ? 61 TYR B O    4  
ATOM 8597  C CB   . TYR B 1 61 ? -15.896 -11.973 -7.713  1.00 0.36 ? 61 TYR B CB   4  
ATOM 8598  C CG   . TYR B 1 61 ? -16.810 -11.195 -8.637  1.00 0.36 ? 61 TYR B CG   4  
ATOM 8599  C CD1  . TYR B 1 61 ? -18.015 -11.757 -9.077  1.00 0.36 ? 61 TYR B CD1  4  
ATOM 8600  C CD2  . TYR B 1 61 ? -16.448 -9.907  -9.050  1.00 0.36 ? 61 TYR B CD2  4  
ATOM 8601  C CE1  . TYR B 1 61 ? -18.856 -11.033 -9.930  1.00 0.36 ? 61 TYR B CE1  4  
ATOM 8602  C CE2  . TYR B 1 61 ? -17.290 -9.183  -9.903  1.00 0.36 ? 61 TYR B CE2  4  
ATOM 8603  C CZ   . TYR B 1 61 ? -18.494 -9.745  -10.343 1.00 0.36 ? 61 TYR B CZ   4  
ATOM 8604  O OH   . TYR B 1 61 ? -19.324 -9.032  -11.184 1.00 0.36 ? 61 TYR B OH   4  
ATOM 8605  H H    . TYR B 1 61 ? -17.485 -13.036 -5.979  1.00 0.36 ? 61 TYR B H    4  
ATOM 8606  H HA   . TYR B 1 61 ? -16.667 -13.723 -8.693  1.00 0.36 ? 61 TYR B HA   4  
ATOM 8607  H HB2  . TYR B 1 61 ? -15.984 -11.582 -6.709  1.00 0.36 ? 61 TYR B HB2  4  
ATOM 8608  H HB3  . TYR B 1 61 ? -14.876 -11.869 -8.049  1.00 0.36 ? 61 TYR B HB3  4  
ATOM 8609  H HD1  . TYR B 1 61 ? -18.295 -12.751 -8.760  1.00 0.36 ? 61 TYR B HD1  4  
ATOM 8610  H HD2  . TYR B 1 61 ? -15.520 -9.472  -8.710  1.00 0.36 ? 61 TYR B HD2  4  
ATOM 8611  H HE1  . TYR B 1 61 ? -19.785 -11.467 -10.270 1.00 0.36 ? 61 TYR B HE1  4  
ATOM 8612  H HE2  . TYR B 1 61 ? -17.010 -8.189  -10.222 1.00 0.36 ? 61 TYR B HE2  4  
ATOM 8613  H HH   . TYR B 1 61 ? -20.229 -9.273  -10.979 1.00 0.36 ? 61 TYR B HH   4  
ATOM 8614  N N    . ILE B 1 62 ? -14.670 -14.357 -6.151  1.00 0.38 ? 62 ILE B N    4  
ATOM 8615  C CA   . ILE B 1 62 ? -13.482 -15.175 -5.776  1.00 0.38 ? 62 ILE B CA   4  
ATOM 8616  C C    . ILE B 1 62 ? -13.755 -16.644 -6.106  1.00 0.38 ? 62 ILE B C    4  
ATOM 8617  O O    . ILE B 1 62 ? -12.923 -17.330 -6.665  1.00 0.38 ? 62 ILE B O    4  
ATOM 8618  C CB   . ILE B 1 62 ? -13.213 -15.029 -4.278  1.00 0.38 ? 62 ILE B CB   4  
ATOM 8619  C CG1  . ILE B 1 62 ? -12.697 -13.618 -3.988  1.00 0.38 ? 62 ILE B CG1  4  
ATOM 8620  C CG2  . ILE B 1 62 ? -12.162 -16.054 -3.846  1.00 0.38 ? 62 ILE B CG2  4  
ATOM 8621  C CD1  . ILE B 1 62 ? -13.664 -12.904 -3.042  1.00 0.38 ? 62 ILE B CD1  4  
ATOM 8622  H H    . ILE B 1 62 ? -15.159 -13.858 -5.464  1.00 0.38 ? 62 ILE B H    4  
ATOM 8623  H HA   . ILE B 1 62 ? -12.620 -14.835 -6.332  1.00 0.38 ? 62 ILE B HA   4  
ATOM 8624  H HB   . ILE B 1 62 ? -14.129 -15.200 -3.729  1.00 0.38 ? 62 ILE B HB   4  
ATOM 8625  H HG12 . ILE B 1 62 ? -11.721 -13.679 -3.528  1.00 0.38 ? 62 ILE B HG12 4  
ATOM 8626  H HG13 . ILE B 1 62 ? -12.625 -13.064 -4.911  1.00 0.38 ? 62 ILE B HG13 4  
ATOM 8627  H HG21 . ILE B 1 62 ? -11.883 -16.661 -4.694  1.00 0.38 ? 62 ILE B HG21 4  
ATOM 8628  H HG22 . ILE B 1 62 ? -11.291 -15.538 -3.468  1.00 0.38 ? 62 ILE B HG22 4  
ATOM 8629  H HG23 . ILE B 1 62 ? -12.572 -16.684 -3.071  1.00 0.38 ? 62 ILE B HG23 4  
ATOM 8630  H HD11 . ILE B 1 62 ? -14.392 -13.611 -2.671  1.00 0.38 ? 62 ILE B HD11 4  
ATOM 8631  H HD12 . ILE B 1 62 ? -13.114 -12.485 -2.213  1.00 0.38 ? 62 ILE B HD12 4  
ATOM 8632  H HD13 . ILE B 1 62 ? -14.170 -12.112 -3.575  1.00 0.38 ? 62 ILE B HD13 4  
ATOM 8633  N N    . ASN B 1 63 ? -14.918 -17.129 -5.765  1.00 0.49 ? 63 ASN B N    4  
ATOM 8634  C CA   . ASN B 1 63 ? -15.247 -18.552 -6.060  1.00 0.49 ? 63 ASN B CA   4  
ATOM 8635  C C    . ASN B 1 63 ? -15.347 -18.745 -7.575  1.00 0.49 ? 63 ASN B C    4  
ATOM 8636  O O    . ASN B 1 63 ? -14.961 -19.767 -8.107  1.00 0.49 ? 63 ASN B O    4  
ATOM 8637  C CB   . ASN B 1 63 ? -16.585 -18.910 -5.408  1.00 0.49 ? 63 ASN B CB   4  
ATOM 8638  C CG   . ASN B 1 63 ? -17.075 -20.253 -5.951  1.00 0.49 ? 63 ASN B CG   4  
ATOM 8639  O OD1  . ASN B 1 63 ? -16.362 -21.236 -5.908  1.00 0.49 ? 63 ASN B OD1  4  
ATOM 8640  N ND2  . ASN B 1 63 ? -18.273 -20.339 -6.462  1.00 0.49 ? 63 ASN B ND2  4  
ATOM 8641  H H    . ASN B 1 63 ? -15.574 -16.558 -5.317  1.00 0.49 ? 63 ASN B H    4  
ATOM 8642  H HA   . ASN B 1 63 ? -14.471 -19.191 -5.666  1.00 0.49 ? 63 ASN B HA   4  
ATOM 8643  H HB2  . ASN B 1 63 ? -16.456 -18.978 -4.338  1.00 0.49 ? 63 ASN B HB2  4  
ATOM 8644  H HB3  . ASN B 1 63 ? -17.312 -18.146 -5.635  1.00 0.49 ? 63 ASN B HB3  4  
ATOM 8645  H HD21 . ASN B 1 63 ? -18.849 -19.546 -6.497  1.00 0.49 ? 63 ASN B HD21 4  
ATOM 8646  H HD22 . ASN B 1 63 ? -18.597 -21.196 -6.812  1.00 0.49 ? 63 ASN B HD22 4  
ATOM 8647  N N    . SER B 1 64 ? -15.862 -17.770 -8.273  1.00 0.55 ? 64 SER B N    4  
ATOM 8648  C CA   . SER B 1 64 ? -15.985 -17.897 -9.752  1.00 0.55 ? 64 SER B CA   4  
ATOM 8649  C C    . SER B 1 64 ? -14.613 -17.682 -10.394 1.00 0.55 ? 64 SER B C    4  
ATOM 8650  O O    . SER B 1 64 ? -14.397 -18.008 -11.544 1.00 0.55 ? 64 SER B O    4  
ATOM 8651  C CB   . SER B 1 64 ? -16.963 -16.845 -10.275 1.00 0.55 ? 64 SER B CB   4  
ATOM 8652  O OG   . SER B 1 64 ? -16.711 -15.607 -9.624  1.00 0.55 ? 64 SER B OG   4  
ATOM 8653  H H    . SER B 1 64 ? -16.166 -16.954 -7.824  1.00 0.55 ? 64 SER B H    4  
ATOM 8654  H HA   . SER B 1 64 ? -16.349 -18.883 -10.001 1.00 0.55 ? 64 SER B HA   4  
ATOM 8655  H HB2  . SER B 1 64 ? -16.830 -16.722 -11.336 1.00 0.55 ? 64 SER B HB2  4  
ATOM 8656  H HB3  . SER B 1 64 ? -17.978 -17.168 -10.077 1.00 0.55 ? 64 SER B HB3  4  
ATOM 8657  H HG   . SER B 1 64 ? -15.923 -15.222 -10.015 1.00 0.55 ? 64 SER B HG   4  
ATOM 8658  N N    . LEU B 1 65 ? -13.683 -17.137 -9.658  1.00 0.53 ? 65 LEU B N    4  
ATOM 8659  C CA   . LEU B 1 65 ? -12.325 -16.902 -10.223 1.00 0.53 ? 65 LEU B CA   4  
ATOM 8660  C C    . LEU B 1 65 ? -11.525 -18.205 -10.179 1.00 0.53 ? 65 LEU B C    4  
ATOM 8661  O O    . LEU B 1 65 ? -10.945 -18.622 -11.162 1.00 0.53 ? 65 LEU B O    4  
ATOM 8662  C CB   . LEU B 1 65 ? -11.608 -15.833 -9.396  1.00 0.53 ? 65 LEU B CB   4  
ATOM 8663  C CG   . LEU B 1 65 ? -11.047 -14.757 -10.327 1.00 0.53 ? 65 LEU B CG   4  
ATOM 8664  C CD1  . LEU B 1 65 ? -10.219 -15.417 -11.431 1.00 0.53 ? 65 LEU B CD1  4  
ATOM 8665  C CD2  . LEU B 1 65 ? -12.202 -13.975 -10.955 1.00 0.53 ? 65 LEU B CD2  4  
ATOM 8666  H H    . LEU B 1 65 ? -13.879 -16.884 -8.731  1.00 0.53 ? 65 LEU B H    4  
ATOM 8667  H HA   . LEU B 1 65 ? -12.415 -16.568 -11.246 1.00 0.53 ? 65 LEU B HA   4  
ATOM 8668  H HB2  . LEU B 1 65 ? -12.307 -15.384 -8.705  1.00 0.53 ? 65 LEU B HB2  4  
ATOM 8669  H HB3  . LEU B 1 65 ? -10.798 -16.287 -8.845  1.00 0.53 ? 65 LEU B HB3  4  
ATOM 8670  H HG   . LEU B 1 65 ? -10.419 -14.084 -9.760  1.00 0.53 ? 65 LEU B HG   4  
ATOM 8671  H HD11 . LEU B 1 65 ? -9.990  -16.435 -11.149 1.00 0.53 ? 65 LEU B HD11 4  
ATOM 8672  H HD12 . LEU B 1 65 ? -10.782 -15.416 -12.352 1.00 0.53 ? 65 LEU B HD12 4  
ATOM 8673  H HD13 . LEU B 1 65 ? -9.301  -14.867 -11.569 1.00 0.53 ? 65 LEU B HD13 4  
ATOM 8674  H HD21 . LEU B 1 65 ? -13.087 -14.594 -10.976 1.00 0.53 ? 65 LEU B HD21 4  
ATOM 8675  H HD22 . LEU B 1 65 ? -12.395 -13.088 -10.371 1.00 0.53 ? 65 LEU B HD22 4  
ATOM 8676  H HD23 . LEU B 1 65 ? -11.937 -13.691 -11.964 1.00 0.53 ? 65 LEU B HD23 4  
ATOM 8677  N N    . GLU B 1 66 ? -11.489 -18.853 -9.046  1.00 0.61 ? 66 GLU B N    4  
ATOM 8678  C CA   . GLU B 1 66 ? -10.726 -20.128 -8.940  1.00 0.61 ? 66 GLU B CA   4  
ATOM 8679  C C    . GLU B 1 66 ? -11.646 -21.301 -9.285  1.00 0.61 ? 66 GLU B C    4  
ATOM 8680  O O    . GLU B 1 66 ? -12.541 -21.181 -10.098 1.00 0.61 ? 66 GLU B O    4  
ATOM 8681  C CB   . GLU B 1 66 ? -10.202 -20.290 -7.511  1.00 0.61 ? 66 GLU B CB   4  
ATOM 8682  C CG   . GLU B 1 66 ? -9.429  -19.034 -7.105  1.00 0.61 ? 66 GLU B CG   4  
ATOM 8683  C CD   . GLU B 1 66 ? -8.878  -19.210 -5.688  1.00 0.61 ? 66 GLU B CD   4  
ATOM 8684  O OE1  . GLU B 1 66 ? -8.076  -20.108 -5.493  1.00 0.61 ? 66 GLU B OE1  4  
ATOM 8685  O OE2  . GLU B 1 66 ? -9.267  -18.443 -4.823  1.00 0.61 ? 66 GLU B OE2  4  
ATOM 8686  H H    . GLU B 1 66 ? -11.964 -18.499 -8.264  1.00 0.61 ? 66 GLU B H    4  
ATOM 8687  H HA   . GLU B 1 66 ? -9.894  -20.107 -9.628  1.00 0.61 ? 66 GLU B HA   4  
ATOM 8688  H HB2  . GLU B 1 66 ? -11.034 -20.435 -6.838  1.00 0.61 ? 66 GLU B HB2  4  
ATOM 8689  H HB3  . GLU B 1 66 ? -9.545  -21.146 -7.463  1.00 0.61 ? 66 GLU B HB3  4  
ATOM 8690  H HG2  . GLU B 1 66 ? -8.611  -18.876 -7.793  1.00 0.61 ? 66 GLU B HG2  4  
ATOM 8691  H HG3  . GLU B 1 66 ? -10.090 -18.181 -7.128  1.00 0.61 ? 66 GLU B HG3  4  
ATOM 8692  N N    . MET B 1 67 ? -11.434 -22.435 -8.675  1.00 1.45 ? 67 MET B N    4  
ATOM 8693  C CA   . MET B 1 67 ? -12.296 -23.613 -8.970  1.00 1.45 ? 67 MET B CA   4  
ATOM 8694  C C    . MET B 1 67 ? -13.448 -23.670 -7.963  1.00 1.45 ? 67 MET B C    4  
ATOM 8695  O O    . MET B 1 67 ? -14.558 -23.269 -8.252  1.00 1.45 ? 67 MET B O    4  
ATOM 8696  C CB   . MET B 1 67 ? -11.463 -24.893 -8.870  1.00 1.45 ? 67 MET B CB   4  
ATOM 8697  C CG   . MET B 1 67 ? -11.620 -25.702 -10.155 1.00 1.45 ? 67 MET B CG   4  
ATOM 8698  S SD   . MET B 1 67 ? -10.659 -27.232 -10.030 1.00 1.45 ? 67 MET B SD   4  
ATOM 8699  C CE   . MET B 1 67 ? -9.150  -26.497 -9.351  1.00 1.45 ? 67 MET B CE   4  
ATOM 8700  H H    . MET B 1 67 ? -10.707 -22.512 -8.023  1.00 1.45 ? 67 MET B H    4  
ATOM 8701  H HA   . MET B 1 67 ? -12.697 -23.522 -9.969  1.00 1.45 ? 67 MET B HA   4  
ATOM 8702  H HB2  . MET B 1 67 ? -10.424 -24.636 -8.729  1.00 1.45 ? 67 MET B HB2  4  
ATOM 8703  H HB3  . MET B 1 67 ? -11.806 -25.484 -8.033  1.00 1.45 ? 67 MET B HB3  4  
ATOM 8704  H HG2  . MET B 1 67 ? -12.662 -25.943 -10.301 1.00 1.45 ? 67 MET B HG2  4  
ATOM 8705  H HG3  . MET B 1 67 ? -11.264 -25.119 -10.992 1.00 1.45 ? 67 MET B HG3  4  
ATOM 8706  H HE1  . MET B 1 67 ? -8.943  -25.567 -9.862  1.00 1.45 ? 67 MET B HE1  4  
ATOM 8707  H HE2  . MET B 1 67 ? -9.284  -26.314 -8.295  1.00 1.45 ? 67 MET B HE2  4  
ATOM 8708  H HE3  . MET B 1 67 ? -8.324  -27.175 -9.495  1.00 1.45 ? 67 MET B HE3  4  
ATOM 8709  N N    . SER B 1 68 ? -13.192 -24.166 -6.783  1.00 2.84 ? 68 SER B N    4  
ATOM 8710  C CA   . SER B 1 68 ? -14.272 -24.249 -5.759  1.00 2.84 ? 68 SER B CA   4  
ATOM 8711  C C    . SER B 1 68 ? -15.558 -24.760 -6.412  1.00 2.84 ? 68 SER B C    4  
ATOM 8712  O O    . SER B 1 68 ? -15.472 -25.298 -7.503  1.00 2.84 ? 68 SER B O    4  
ATOM 8713  C CB   . SER B 1 68 ? -14.517 -22.863 -5.163  1.00 2.84 ? 68 SER B CB   4  
ATOM 8714  O OG   . SER B 1 68 ? -13.593 -22.636 -4.106  1.00 2.84 ? 68 SER B OG   4  
ATOM 8715  O OXT  . SER B 1 68 ? -16.607 -24.603 -5.808  1.00 2.84 ? 68 SER B OXT  4  
ATOM 8716  H H    . SER B 1 68 ? -12.291 -24.484 -6.572  1.00 2.84 ? 68 SER B H    4  
ATOM 8717  H HA   . SER B 1 68 ? -13.971 -24.930 -4.976  1.00 2.84 ? 68 SER B HA   4  
ATOM 8718  H HB2  . SER B 1 68 ? -14.379 -22.112 -5.922  1.00 2.84 ? 68 SER B HB2  4  
ATOM 8719  H HB3  . SER B 1 68 ? -15.530 -22.810 -4.787  1.00 2.84 ? 68 SER B HB3  4  
ATOM 8720  H HG   . SER B 1 68 ? -14.093 -22.522 -3.295  1.00 2.84 ? 68 SER B HG   4  
ATOM 8721  N N    . SER A 1 1  ? -18.282 5.217   3.748   1.00 5.93 ? 1  SER A N    5  
ATOM 8722  C CA   . SER A 1 1  ? -17.658 6.425   3.139   1.00 5.93 ? 1  SER A CA   5  
ATOM 8723  C C    . SER A 1 1  ? -18.246 6.655   1.743   1.00 5.93 ? 1  SER A C    5  
ATOM 8724  O O    . SER A 1 1  ? -18.979 5.828   1.237   1.00 5.93 ? 1  SER A O    5  
ATOM 8725  C CB   . SER A 1 1  ? -16.147 6.217   3.028   1.00 5.93 ? 1  SER A CB   5  
ATOM 8726  O OG   . SER A 1 1  ? -15.486 7.094   3.931   1.00 5.93 ? 1  SER A OG   5  
ATOM 8727  H H1   . SER A 1 1  ? -19.307 5.228   3.570   1.00 5.93 ? 1  SER A H1   5  
ATOM 8728  H H2   . SER A 1 1  ? -17.865 4.362   3.327   1.00 5.93 ? 1  SER A H2   5  
ATOM 8729  H H3   . SER A 1 1  ? -18.112 5.217   4.773   1.00 5.93 ? 1  SER A H3   5  
ATOM 8730  H HA   . SER A 1 1  ? -17.859 7.286   3.760   1.00 5.93 ? 1  SER A HA   5  
ATOM 8731  H HB2  . SER A 1 1  ? -15.902 5.199   3.280   1.00 5.93 ? 1  SER A HB2  5  
ATOM 8732  H HB3  . SER A 1 1  ? -15.830 6.422   2.014   1.00 5.93 ? 1  SER A HB3  5  
ATOM 8733  H HG   . SER A 1 1  ? -15.774 7.989   3.740   1.00 5.93 ? 1  SER A HG   5  
ATOM 8734  N N    . PRO A 1 2  ? -17.903 7.776   1.162   1.00 3.89 ? 2  PRO A N    5  
ATOM 8735  C CA   . PRO A 1 2  ? -18.378 8.154   -0.180  1.00 3.89 ? 2  PRO A CA   5  
ATOM 8736  C C    . PRO A 1 2  ? -17.591 7.400   -1.257  1.00 3.89 ? 2  PRO A C    5  
ATOM 8737  O O    . PRO A 1 2  ? -17.986 6.340   -1.700  1.00 3.89 ? 2  PRO A O    5  
ATOM 8738  C CB   . PRO A 1 2  ? -18.097 9.658   -0.249  1.00 3.89 ? 2  PRO A CB   5  
ATOM 8739  C CG   . PRO A 1 2  ? -16.988 9.944   0.790   1.00 3.89 ? 2  PRO A CG   5  
ATOM 8740  C CD   . PRO A 1 2  ? -17.011 8.772   1.791   1.00 3.89 ? 2  PRO A CD   5  
ATOM 8741  H HA   . PRO A 1 2  ? -19.435 7.970   -0.278  1.00 3.89 ? 2  PRO A HA   5  
ATOM 8742  H HB2  . PRO A 1 2  ? -17.759 9.925   -1.242  1.00 3.89 ? 2  PRO A HB2  5  
ATOM 8743  H HB3  . PRO A 1 2  ? -18.986 10.214  0.004   1.00 3.89 ? 2  PRO A HB3  5  
ATOM 8744  H HG2  . PRO A 1 2  ? -16.026 9.996   0.299   1.00 3.89 ? 2  PRO A HG2  5  
ATOM 8745  H HG3  . PRO A 1 2  ? -17.193 10.867  1.307   1.00 3.89 ? 2  PRO A HG3  5  
ATOM 8746  H HD2  . PRO A 1 2  ? -16.016 8.367   1.919   1.00 3.89 ? 2  PRO A HD2  5  
ATOM 8747  H HD3  . PRO A 1 2  ? -17.416 9.090   2.739   1.00 3.89 ? 2  PRO A HD3  5  
ATOM 8748  N N    . TYR A 1 3  ? -16.481 7.940   -1.680  1.00 2.56 ? 3  TYR A N    5  
ATOM 8749  C CA   . TYR A 1 3  ? -15.672 7.254   -2.727  1.00 2.56 ? 3  TYR A CA   5  
ATOM 8750  C C    . TYR A 1 3  ? -14.218 7.154   -2.263  1.00 2.56 ? 3  TYR A C    5  
ATOM 8751  O O    . TYR A 1 3  ? -13.446 8.082   -2.402  1.00 2.56 ? 3  TYR A O    5  
ATOM 8752  C CB   . TYR A 1 3  ? -15.738 8.056   -4.029  1.00 2.56 ? 3  TYR A CB   5  
ATOM 8753  C CG   . TYR A 1 3  ? -15.463 9.511   -3.739  1.00 2.56 ? 3  TYR A CG   5  
ATOM 8754  C CD1  . TYR A 1 3  ? -16.489 10.336  -3.259  1.00 2.56 ? 3  TYR A CD1  5  
ATOM 8755  C CD2  . TYR A 1 3  ? -14.183 10.038  -3.949  1.00 2.56 ? 3  TYR A CD2  5  
ATOM 8756  C CE1  . TYR A 1 3  ? -16.234 11.686  -2.990  1.00 2.56 ? 3  TYR A CE1  5  
ATOM 8757  C CE2  . TYR A 1 3  ? -13.929 11.389  -3.679  1.00 2.56 ? 3  TYR A CE2  5  
ATOM 8758  C CZ   . TYR A 1 3  ? -14.954 12.212  -3.200  1.00 2.56 ? 3  TYR A CZ   5  
ATOM 8759  O OH   . TYR A 1 3  ? -14.703 13.543  -2.934  1.00 2.56 ? 3  TYR A OH   5  
ATOM 8760  H H    . TYR A 1 3  ? -16.180 8.797   -1.311  1.00 2.56 ? 3  TYR A H    5  
ATOM 8761  H HA   . TYR A 1 3  ? -16.066 6.263   -2.894  1.00 2.56 ? 3  TYR A HA   5  
ATOM 8762  H HB2  . TYR A 1 3  ? -14.998 7.680   -4.720  1.00 2.56 ? 3  TYR A HB2  5  
ATOM 8763  H HB3  . TYR A 1 3  ? -16.722 7.956   -4.464  1.00 2.56 ? 3  TYR A HB3  5  
ATOM 8764  H HD1  . TYR A 1 3  ? -17.477 9.929   -3.097  1.00 2.56 ? 3  TYR A HD1  5  
ATOM 8765  H HD2  . TYR A 1 3  ? -13.392 9.403   -4.318  1.00 2.56 ? 3  TYR A HD2  5  
ATOM 8766  H HE1  . TYR A 1 3  ? -17.026 12.321  -2.621  1.00 2.56 ? 3  TYR A HE1  5  
ATOM 8767  H HE2  . TYR A 1 3  ? -12.942 11.794  -3.841  1.00 2.56 ? 3  TYR A HE2  5  
ATOM 8768  H HH   . TYR A 1 3  ? -13.757 13.647  -2.814  1.00 2.56 ? 3  TYR A HH   5  
ATOM 8769  N N    . SER A 1 4  ? -13.837 6.034   -1.712  1.00 0.96 ? 4  SER A N    5  
ATOM 8770  C CA   . SER A 1 4  ? -12.433 5.875   -1.240  1.00 0.96 ? 4  SER A CA   5  
ATOM 8771  C C    . SER A 1 4  ? -12.090 4.386   -1.151  1.00 0.96 ? 4  SER A C    5  
ATOM 8772  O O    . SER A 1 4  ? -11.525 3.927   -0.179  1.00 0.96 ? 4  SER A O    5  
ATOM 8773  C CB   . SER A 1 4  ? -12.284 6.516   0.141   1.00 0.96 ? 4  SER A CB   5  
ATOM 8774  O OG   . SER A 1 4  ? -11.768 7.832   -0.006  1.00 0.96 ? 4  SER A OG   5  
ATOM 8775  H H    . SER A 1 4  ? -14.476 5.298   -1.608  1.00 0.96 ? 4  SER A H    5  
ATOM 8776  H HA   . SER A 1 4  ? -11.763 6.358   -1.935  1.00 0.96 ? 4  SER A HA   5  
ATOM 8777  H HB2  . SER A 1 4  ? -13.246 6.564   0.624   1.00 0.96 ? 4  SER A HB2  5  
ATOM 8778  H HB3  . SER A 1 4  ? -11.611 5.918   0.742   1.00 0.96 ? 4  SER A HB3  5  
ATOM 8779  H HG   . SER A 1 4  ? -11.896 8.294   0.826   1.00 0.96 ? 4  SER A HG   5  
ATOM 8780  N N    . SER A 1 5  ? -12.428 3.629   -2.159  1.00 0.48 ? 5  SER A N    5  
ATOM 8781  C CA   . SER A 1 5  ? -12.122 2.171   -2.131  1.00 0.48 ? 5  SER A CA   5  
ATOM 8782  C C    . SER A 1 5  ? -10.874 1.897   -2.972  1.00 0.48 ? 5  SER A C    5  
ATOM 8783  O O    . SER A 1 5  ? -10.900 1.114   -3.902  1.00 0.48 ? 5  SER A O    5  
ATOM 8784  C CB   . SER A 1 5  ? -13.306 1.391   -2.705  1.00 0.48 ? 5  SER A CB   5  
ATOM 8785  O OG   . SER A 1 5  ? -13.415 1.660   -4.096  1.00 0.48 ? 5  SER A OG   5  
ATOM 8786  H H    . SER A 1 5  ? -12.884 4.020   -2.933  1.00 0.48 ? 5  SER A H    5  
ATOM 8787  H HA   . SER A 1 5  ? -11.945 1.860   -1.112  1.00 0.48 ? 5  SER A HA   5  
ATOM 8788  H HB2  . SER A 1 5  ? -13.147 0.336   -2.559  1.00 0.48 ? 5  SER A HB2  5  
ATOM 8789  H HB3  . SER A 1 5  ? -14.212 1.691   -2.196  1.00 0.48 ? 5  SER A HB3  5  
ATOM 8790  H HG   . SER A 1 5  ? -14.299 1.996   -4.265  1.00 0.48 ? 5  SER A HG   5  
ATOM 8791  N N    . ASP A 1 6  ? -9.780  2.533   -2.654  1.00 0.37 ? 6  ASP A N    5  
ATOM 8792  C CA   . ASP A 1 6  ? -8.532  2.306   -3.435  1.00 0.37 ? 6  ASP A CA   5  
ATOM 8793  C C    . ASP A 1 6  ? -7.430  1.802   -2.502  1.00 0.37 ? 6  ASP A C    5  
ATOM 8794  O O    . ASP A 1 6  ? -7.469  2.017   -1.307  1.00 0.37 ? 6  ASP A O    5  
ATOM 8795  C CB   . ASP A 1 6  ? -8.091  3.620   -4.084  1.00 0.37 ? 6  ASP A CB   5  
ATOM 8796  C CG   . ASP A 1 6  ? -9.320  4.386   -4.575  1.00 0.37 ? 6  ASP A CG   5  
ATOM 8797  O OD1  . ASP A 1 6  ? -9.965  3.907   -5.493  1.00 0.37 ? 6  ASP A OD1  5  
ATOM 8798  O OD2  . ASP A 1 6  ? -9.597  5.440   -4.025  1.00 0.37 ? 6  ASP A OD2  5  
ATOM 8799  H H    . ASP A 1 6  ? -9.779  3.159   -1.901  1.00 0.37 ? 6  ASP A H    5  
ATOM 8800  H HA   . ASP A 1 6  ? -8.718  1.571   -4.204  1.00 0.37 ? 6  ASP A HA   5  
ATOM 8801  H HB2  . ASP A 1 6  ? -7.559  4.218   -3.357  1.00 0.37 ? 6  ASP A HB2  5  
ATOM 8802  H HB3  . ASP A 1 6  ? -7.443  3.409   -4.921  1.00 0.37 ? 6  ASP A HB3  5  
ATOM 8803  N N    . THR A 1 7  ? -6.447  1.132   -3.038  1.00 0.35 ? 7  THR A N    5  
ATOM 8804  C CA   . THR A 1 7  ? -5.343  0.614   -2.180  1.00 0.35 ? 7  THR A CA   5  
ATOM 8805  C C    . THR A 1 7  ? -4.388  1.756   -1.831  1.00 0.35 ? 7  THR A C    5  
ATOM 8806  O O    . THR A 1 7  ? -4.511  2.856   -2.330  1.00 0.35 ? 7  THR A O    5  
ATOM 8807  C CB   . THR A 1 7  ? -4.579  -0.476  -2.936  1.00 0.35 ? 7  THR A CB   5  
ATOM 8808  O OG1  . THR A 1 7  ? -3.967  0.089   -4.087  1.00 0.35 ? 7  THR A OG1  5  
ATOM 8809  C CG2  . THR A 1 7  ? -5.547  -1.581  -3.360  1.00 0.35 ? 7  THR A CG2  5  
ATOM 8810  H H    . THR A 1 7  ? -6.434  0.968   -4.004  1.00 0.35 ? 7  THR A H    5  
ATOM 8811  H HA   . THR A 1 7  ? -5.757  0.200   -1.273  1.00 0.35 ? 7  THR A HA   5  
ATOM 8812  H HB   . THR A 1 7  ? -3.820  -0.896  -2.293  1.00 0.35 ? 7  THR A HB   5  
ATOM 8813  H HG1  . THR A 1 7  ? -3.711  -0.629  -4.669  1.00 0.35 ? 7  THR A HG1  5  
ATOM 8814  H HG21 . THR A 1 7  ? -6.552  -1.186  -3.396  1.00 0.35 ? 7  THR A HG21 5  
ATOM 8815  H HG22 . THR A 1 7  ? -5.269  -1.947  -4.338  1.00 0.35 ? 7  THR A HG22 5  
ATOM 8816  H HG23 . THR A 1 7  ? -5.504  -2.391  -2.647  1.00 0.35 ? 7  THR A HG23 5  
ATOM 8817  N N    . THR A 1 8  ? -3.433  1.502   -0.977  1.00 0.31 ? 8  THR A N    5  
ATOM 8818  C CA   . THR A 1 8  ? -2.469  2.572   -0.598  1.00 0.31 ? 8  THR A CA   5  
ATOM 8819  C C    . THR A 1 8  ? -1.040  2.082   -0.870  1.00 0.31 ? 8  THR A C    5  
ATOM 8820  O O    . THR A 1 8  ? -0.669  1.010   -0.440  1.00 0.31 ? 8  THR A O    5  
ATOM 8821  C CB   . THR A 1 8  ? -2.622  2.890   0.893   1.00 0.31 ? 8  THR A CB   5  
ATOM 8822  O OG1  . THR A 1 8  ? -3.846  3.579   1.104   1.00 0.31 ? 8  THR A OG1  5  
ATOM 8823  C CG2  . THR A 1 8  ? -1.455  3.764   1.355   1.00 0.31 ? 8  THR A CG2  5  
ATOM 8824  H H    . THR A 1 8  ? -3.351  0.607   -0.587  1.00 0.31 ? 8  THR A H    5  
ATOM 8825  H HA   . THR A 1 8  ? -2.673  3.458   -1.176  1.00 0.31 ? 8  THR A HA   5  
ATOM 8826  H HB   . THR A 1 8  ? -2.624  1.971   1.459   1.00 0.31 ? 8  THR A HB   5  
ATOM 8827  H HG1  . THR A 1 8  ? -4.076  4.032   0.290   1.00 0.31 ? 8  THR A HG1  5  
ATOM 8828  H HG21 . THR A 1 8  ? -0.522  3.304   1.063   1.00 0.31 ? 8  THR A HG21 5  
ATOM 8829  H HG22 . THR A 1 8  ? -1.533  4.741   0.899   1.00 0.31 ? 8  THR A HG22 5  
ATOM 8830  H HG23 . THR A 1 8  ? -1.484  3.866   2.430   1.00 0.31 ? 8  THR A HG23 5  
ATOM 8831  N N    . PRO A 1 9  ? -0.278  2.883   -1.575  1.00 0.34 ? 9  PRO A N    5  
ATOM 8832  C CA   . PRO A 1 9  ? 1.115   2.548   -1.915  1.00 0.34 ? 9  PRO A CA   5  
ATOM 8833  C C    . PRO A 1 9  ? 2.026   2.790   -0.707  1.00 0.34 ? 9  PRO A C    5  
ATOM 8834  O O    . PRO A 1 9  ? 2.644   3.829   -0.581  1.00 0.34 ? 9  PRO A O    5  
ATOM 8835  C CB   . PRO A 1 9  ? 1.449   3.510   -3.057  1.00 0.34 ? 9  PRO A CB   5  
ATOM 8836  C CG   . PRO A 1 9  ? 0.463   4.696   -2.931  1.00 0.34 ? 9  PRO A CG   5  
ATOM 8837  C CD   . PRO A 1 9  ? -0.729  4.189   -2.097  1.00 0.34 ? 9  PRO A CD   5  
ATOM 8838  H HA   . PRO A 1 9  ? 1.193   1.528   -2.254  1.00 0.34 ? 9  PRO A HA   5  
ATOM 8839  H HB2  . PRO A 1 9  ? 2.469   3.858   -2.961  1.00 0.34 ? 9  PRO A HB2  5  
ATOM 8840  H HB3  . PRO A 1 9  ? 1.311   3.021   -4.008  1.00 0.34 ? 9  PRO A HB3  5  
ATOM 8841  H HG2  . PRO A 1 9  ? 0.944   5.525   -2.431  1.00 0.34 ? 9  PRO A HG2  5  
ATOM 8842  H HG3  . PRO A 1 9  ? 0.120   4.999   -3.908  1.00 0.34 ? 9  PRO A HG3  5  
ATOM 8843  H HD2  . PRO A 1 9  ? -0.938  4.873   -1.284  1.00 0.34 ? 9  PRO A HD2  5  
ATOM 8844  H HD3  . PRO A 1 9  ? -1.601  4.062   -2.720  1.00 0.34 ? 9  PRO A HD3  5  
ATOM 8845  N N    . CYS A 1 10 ? 2.107   1.840   0.183   1.00 0.35 ? 10 CYS A N    5  
ATOM 8846  C CA   . CYS A 1 10 ? 2.971   2.014   1.384   1.00 0.35 ? 10 CYS A CA   5  
ATOM 8847  C C    . CYS A 1 10 ? 4.372   1.475   1.094   1.00 0.35 ? 10 CYS A C    5  
ATOM 8848  O O    . CYS A 1 10 ? 4.537   0.469   0.433   1.00 0.35 ? 10 CYS A O    5  
ATOM 8849  C CB   . CYS A 1 10 ? 2.362   1.248   2.560   1.00 0.35 ? 10 CYS A CB   5  
ATOM 8850  S SG   . CYS A 1 10 ? 0.714   1.905   2.916   1.00 0.35 ? 10 CYS A SG   5  
ATOM 8851  H H    . CYS A 1 10 ? 1.596   1.013   0.063   1.00 0.35 ? 10 CYS A H    5  
ATOM 8852  H HA   . CYS A 1 10 ? 3.033   3.064   1.633   1.00 0.35 ? 10 CYS A HA   5  
ATOM 8853  H HB2  . CYS A 1 10 ? 2.286   0.201   2.306   1.00 0.35 ? 10 CYS A HB2  5  
ATOM 8854  H HB3  . CYS A 1 10 ? 2.992   1.363   3.429   1.00 0.35 ? 10 CYS A HB3  5  
ATOM 8855  N N    . CYS A 1 11 ? 5.383   2.136   1.587   1.00 0.32 ? 11 CYS A N    5  
ATOM 8856  C CA   . CYS A 1 11 ? 6.774   1.660   1.344   1.00 0.32 ? 11 CYS A CA   5  
ATOM 8857  C C    . CYS A 1 11 ? 7.510   1.544   2.680   1.00 0.32 ? 11 CYS A C    5  
ATOM 8858  O O    . CYS A 1 11 ? 7.802   2.530   3.327   1.00 0.32 ? 11 CYS A O    5  
ATOM 8859  C CB   . CYS A 1 11 ? 7.504   2.656   0.442   1.00 0.32 ? 11 CYS A CB   5  
ATOM 8860  S SG   . CYS A 1 11 ? 7.440   2.074   -1.270  1.00 0.32 ? 11 CYS A SG   5  
ATOM 8861  H H    . CYS A 1 11 ? 5.228   2.943   2.119   1.00 0.32 ? 11 CYS A H    5  
ATOM 8862  H HA   . CYS A 1 11 ? 6.745   0.694   0.865   1.00 0.32 ? 11 CYS A HA   5  
ATOM 8863  H HB2  . CYS A 1 11 ? 7.029   3.623   0.513   1.00 0.32 ? 11 CYS A HB2  5  
ATOM 8864  H HB3  . CYS A 1 11 ? 8.534   2.735   0.757   1.00 0.32 ? 11 CYS A HB3  5  
ATOM 8865  N N    . PHE A 1 12 ? 7.810   0.345   3.098   1.00 0.28 ? 12 PHE A N    5  
ATOM 8866  C CA   . PHE A 1 12 ? 8.524   0.165   4.392   1.00 0.28 ? 12 PHE A CA   5  
ATOM 8867  C C    . PHE A 1 12 ? 9.995   -0.161  4.122   1.00 0.28 ? 12 PHE A C    5  
ATOM 8868  O O    . PHE A 1 12 ? 10.856  0.082   4.943   1.00 0.28 ? 12 PHE A O    5  
ATOM 8869  C CB   . PHE A 1 12 ? 7.878   -0.983  5.172   1.00 0.28 ? 12 PHE A CB   5  
ATOM 8870  C CG   . PHE A 1 12 ? 6.387   -0.975  4.934   1.00 0.28 ? 12 PHE A CG   5  
ATOM 8871  C CD1  . PHE A 1 12 ? 5.864   -1.517  3.753   1.00 0.28 ? 12 PHE A CD1  5  
ATOM 8872  C CD2  . PHE A 1 12 ? 5.527   -0.426  5.892   1.00 0.28 ? 12 PHE A CD2  5  
ATOM 8873  C CE1  . PHE A 1 12 ? 4.481   -1.510  3.530   1.00 0.28 ? 12 PHE A CE1  5  
ATOM 8874  C CE2  . PHE A 1 12 ? 4.145   -0.418  5.670   1.00 0.28 ? 12 PHE A CE2  5  
ATOM 8875  C CZ   . PHE A 1 12 ? 3.622   -0.960  4.489   1.00 0.28 ? 12 PHE A CZ   5  
ATOM 8876  H H    . PHE A 1 12 ? 7.564   -0.437  2.561   1.00 0.28 ? 12 PHE A H    5  
ATOM 8877  H HA   . PHE A 1 12 ? 8.458   1.075   4.970   1.00 0.28 ? 12 PHE A HA   5  
ATOM 8878  H HB2  . PHE A 1 12 ? 8.293   -1.923  4.838   1.00 0.28 ? 12 PHE A HB2  5  
ATOM 8879  H HB3  . PHE A 1 12 ? 8.074   -0.857  6.227   1.00 0.28 ? 12 PHE A HB3  5  
ATOM 8880  H HD1  . PHE A 1 12 ? 6.527   -1.941  3.014   1.00 0.28 ? 12 PHE A HD1  5  
ATOM 8881  H HD2  . PHE A 1 12 ? 5.930   -0.008  6.803   1.00 0.28 ? 12 PHE A HD2  5  
ATOM 8882  H HE1  . PHE A 1 12 ? 4.078   -1.928  2.620   1.00 0.28 ? 12 PHE A HE1  5  
ATOM 8883  H HE2  . PHE A 1 12 ? 3.481   0.006   6.410   1.00 0.28 ? 12 PHE A HE2  5  
ATOM 8884  H HZ   . PHE A 1 12 ? 2.555   -0.954  4.318   1.00 0.28 ? 12 PHE A HZ   5  
ATOM 8885  N N    . ALA A 1 13 ? 10.288  -0.709  2.974   1.00 0.31 ? 13 ALA A N    5  
ATOM 8886  C CA   . ALA A 1 13 ? 11.702  -1.048  2.651   1.00 0.31 ? 13 ALA A CA   5  
ATOM 8887  C C    . ALA A 1 13 ? 12.367  0.145   1.960   1.00 0.31 ? 13 ALA A C    5  
ATOM 8888  O O    . ALA A 1 13 ? 11.716  1.105   1.597   1.00 0.31 ? 13 ALA A O    5  
ATOM 8889  C CB   . ALA A 1 13 ? 11.736  -2.260  1.718   1.00 0.31 ? 13 ALA A CB   5  
ATOM 8890  H H    . ALA A 1 13 ? 9.579   -0.895  2.324   1.00 0.31 ? 13 ALA A H    5  
ATOM 8891  H HA   . ALA A 1 13 ? 12.234  -1.279  3.561   1.00 0.31 ? 13 ALA A HA   5  
ATOM 8892  H HB1  . ALA A 1 13 ? 10.811  -2.312  1.161   1.00 0.31 ? 13 ALA A HB1  5  
ATOM 8893  H HB2  . ALA A 1 13 ? 12.564  -2.164  1.031   1.00 0.31 ? 13 ALA A HB2  5  
ATOM 8894  H HB3  . ALA A 1 13 ? 11.855  -3.161  2.301   1.00 0.31 ? 13 ALA A HB3  5  
ATOM 8895  N N    . TYR A 1 14 ? 13.658  0.094   1.777   1.00 0.29 ? 14 TYR A N    5  
ATOM 8896  C CA   . TYR A 1 14 ? 14.360  1.227   1.110   1.00 0.29 ? 14 TYR A CA   5  
ATOM 8897  C C    . TYR A 1 14 ? 15.452  0.679   0.189   1.00 0.29 ? 14 TYR A C    5  
ATOM 8898  O O    . TYR A 1 14 ? 16.084  -0.317  0.483   1.00 0.29 ? 14 TYR A O    5  
ATOM 8899  C CB   . TYR A 1 14 ? 14.994  2.130   2.171   1.00 0.29 ? 14 TYR A CB   5  
ATOM 8900  C CG   . TYR A 1 14 ? 13.911  2.897   2.892   1.00 0.29 ? 14 TYR A CG   5  
ATOM 8901  C CD1  . TYR A 1 14 ? 12.932  3.581   2.162   1.00 0.29 ? 14 TYR A CD1  5  
ATOM 8902  C CD2  . TYR A 1 14 ? 13.886  2.922   4.292   1.00 0.29 ? 14 TYR A CD2  5  
ATOM 8903  C CE1  . TYR A 1 14 ? 11.929  4.291   2.831   1.00 0.29 ? 14 TYR A CE1  5  
ATOM 8904  C CE2  . TYR A 1 14 ? 12.883  3.633   4.961   1.00 0.29 ? 14 TYR A CE2  5  
ATOM 8905  C CZ   . TYR A 1 14 ? 11.904  4.317   4.231   1.00 0.29 ? 14 TYR A CZ   5  
ATOM 8906  O OH   . TYR A 1 14 ? 10.915  5.019   4.890   1.00 0.29 ? 14 TYR A OH   5  
ATOM 8907  H H    . TYR A 1 14 ? 14.164  -0.688  2.077   1.00 0.29 ? 14 TYR A H    5  
ATOM 8908  H HA   . TYR A 1 14 ? 13.651  1.797   0.528   1.00 0.29 ? 14 TYR A HA   5  
ATOM 8909  H HB2  . TYR A 1 14 ? 15.540  1.524   2.879   1.00 0.29 ? 14 TYR A HB2  5  
ATOM 8910  H HB3  . TYR A 1 14 ? 15.669  2.825   1.694   1.00 0.29 ? 14 TYR A HB3  5  
ATOM 8911  H HD1  . TYR A 1 14 ? 12.949  3.560   1.082   1.00 0.29 ? 14 TYR A HD1  5  
ATOM 8912  H HD2  . TYR A 1 14 ? 14.642  2.395   4.855   1.00 0.29 ? 14 TYR A HD2  5  
ATOM 8913  H HE1  . TYR A 1 14 ? 11.174  4.818   2.268   1.00 0.29 ? 14 TYR A HE1  5  
ATOM 8914  H HE2  . TYR A 1 14 ? 12.865  3.654   6.041   1.00 0.29 ? 14 TYR A HE2  5  
ATOM 8915  H HH   . TYR A 1 14 ? 11.010  5.947   4.667   1.00 0.29 ? 14 TYR A HH   5  
ATOM 8916  N N    . ILE A 1 15 ? 15.680  1.320   -0.924  1.00 0.32 ? 15 ILE A N    5  
ATOM 8917  C CA   . ILE A 1 15 ? 16.731  0.836   -1.862  1.00 0.32 ? 15 ILE A CA   5  
ATOM 8918  C C    . ILE A 1 15 ? 18.002  1.665   -1.675  1.00 0.32 ? 15 ILE A C    5  
ATOM 8919  O O    . ILE A 1 15 ? 17.962  2.878   -1.623  1.00 0.32 ? 15 ILE A O    5  
ATOM 8920  C CB   . ILE A 1 15 ? 16.235  0.980   -3.302  1.00 0.32 ? 15 ILE A CB   5  
ATOM 8921  C CG1  . ILE A 1 15 ? 17.230  0.311   -4.252  1.00 0.32 ? 15 ILE A CG1  5  
ATOM 8922  C CG2  . ILE A 1 15 ? 16.115  2.464   -3.654  1.00 0.32 ? 15 ILE A CG2  5  
ATOM 8923  C CD1  . ILE A 1 15 ? 16.577  0.115   -5.622  1.00 0.32 ? 15 ILE A CD1  5  
ATOM 8924  H H    . ILE A 1 15 ? 15.159  2.122   -1.143  1.00 0.32 ? 15 ILE A H    5  
ATOM 8925  H HA   . ILE A 1 15 ? 16.945  -0.202  -1.657  1.00 0.32 ? 15 ILE A HA   5  
ATOM 8926  H HB   . ILE A 1 15 ? 15.268  0.508   -3.399  1.00 0.32 ? 15 ILE A HB   5  
ATOM 8927  H HG12 . ILE A 1 15 ? 18.106  0.937   -4.356  1.00 0.32 ? 15 ILE A HG12 5  
ATOM 8928  H HG13 . ILE A 1 15 ? 17.520  -0.649  -3.853  1.00 0.32 ? 15 ILE A HG13 5  
ATOM 8929  H HG21 . ILE A 1 15 ? 16.147  3.053   -2.749  1.00 0.32 ? 15 ILE A HG21 5  
ATOM 8930  H HG22 . ILE A 1 15 ? 16.933  2.749   -4.299  1.00 0.32 ? 15 ILE A HG22 5  
ATOM 8931  H HG23 . ILE A 1 15 ? 15.178  2.637   -4.164  1.00 0.32 ? 15 ILE A HG23 5  
ATOM 8932  H HD11 . ILE A 1 15 ? 15.614  0.603   -5.634  1.00 0.32 ? 15 ILE A HD11 5  
ATOM 8933  H HD12 . ILE A 1 15 ? 17.208  0.543   -6.386  1.00 0.32 ? 15 ILE A HD12 5  
ATOM 8934  H HD13 . ILE A 1 15 ? 16.449  -0.940  -5.811  1.00 0.32 ? 15 ILE A HD13 5  
ATOM 8935  N N    . ALA A 1 16 ? 19.133  1.020   -1.571  1.00 0.38 ? 16 ALA A N    5  
ATOM 8936  C CA   . ALA A 1 16 ? 20.405  1.772   -1.387  1.00 0.38 ? 16 ALA A CA   5  
ATOM 8937  C C    . ALA A 1 16 ? 20.918  2.251   -2.747  1.00 0.38 ? 16 ALA A C    5  
ATOM 8938  O O    . ALA A 1 16 ? 21.615  3.242   -2.845  1.00 0.38 ? 16 ALA A O    5  
ATOM 8939  C CB   . ALA A 1 16 ? 21.450  0.859   -0.741  1.00 0.38 ? 16 ALA A CB   5  
ATOM 8940  H H    . ALA A 1 16 ? 19.144  0.041   -1.615  1.00 0.38 ? 16 ALA A H    5  
ATOM 8941  H HA   . ALA A 1 16 ? 20.230  2.626   -0.748  1.00 0.38 ? 16 ALA A HA   5  
ATOM 8942  H HB1  . ALA A 1 16 ? 21.170  -0.173  -0.898  1.00 0.38 ? 16 ALA A HB1  5  
ATOM 8943  H HB2  . ALA A 1 16 ? 22.415  1.043   -1.188  1.00 0.38 ? 16 ALA A HB2  5  
ATOM 8944  H HB3  . ALA A 1 16 ? 21.499  1.062   0.318   1.00 0.38 ? 16 ALA A HB3  5  
ATOM 8945  N N    . ARG A 1 17 ? 20.580  1.555   -3.798  1.00 0.42 ? 17 ARG A N    5  
ATOM 8946  C CA   . ARG A 1 17 ? 21.049  1.970   -5.149  1.00 0.42 ? 17 ARG A CA   5  
ATOM 8947  C C    . ARG A 1 17 ? 19.994  2.870   -5.800  1.00 0.42 ? 17 ARG A C    5  
ATOM 8948  O O    . ARG A 1 17 ? 18.814  2.712   -5.562  1.00 0.42 ? 17 ARG A O    5  
ATOM 8949  C CB   . ARG A 1 17 ? 21.267  0.729   -6.018  1.00 0.42 ? 17 ARG A CB   5  
ATOM 8950  C CG   . ARG A 1 17 ? 22.357  -0.145  -5.395  1.00 0.42 ? 17 ARG A CG   5  
ATOM 8951  C CD   . ARG A 1 17 ? 23.199  -0.779  -6.503  1.00 0.42 ? 17 ARG A CD   5  
ATOM 8952  N NE   . ARG A 1 17 ? 24.641  -0.702  -6.137  1.00 0.42 ? 17 ARG A NE   5  
ATOM 8953  C CZ   . ARG A 1 17 ? 25.428  -1.717  -6.368  1.00 0.42 ? 17 ARG A CZ   5  
ATOM 8954  N NH1  . ARG A 1 17 ? 25.048  -2.924  -6.048  1.00 0.42 ? 17 ARG A NH1  5  
ATOM 8955  N NH2  . ARG A 1 17 ? 26.596  -1.525  -6.917  1.00 0.42 ? 17 ARG A NH2  5  
ATOM 8956  H H    . ARG A 1 17 ? 20.017  0.758   -3.697  1.00 0.42 ? 17 ARG A H    5  
ATOM 8957  H HA   . ARG A 1 17 ? 21.978  2.513   -5.056  1.00 0.42 ? 17 ARG A HA   5  
ATOM 8958  H HB2  . ARG A 1 17 ? 20.345  0.168   -6.081  1.00 0.42 ? 17 ARG A HB2  5  
ATOM 8959  H HB3  . ARG A 1 17 ? 21.573  1.031   -7.008  1.00 0.42 ? 17 ARG A HB3  5  
ATOM 8960  H HG2  . ARG A 1 17 ? 22.989  0.463   -4.764  1.00 0.42 ? 17 ARG A HG2  5  
ATOM 8961  H HG3  . ARG A 1 17 ? 21.900  -0.924  -4.803  1.00 0.42 ? 17 ARG A HG3  5  
ATOM 8962  H HD2  . ARG A 1 17 ? 22.913  -1.813  -6.625  1.00 0.42 ? 17 ARG A HD2  5  
ATOM 8963  H HD3  . ARG A 1 17 ? 23.034  -0.249  -7.429  1.00 0.42 ? 17 ARG A HD3  5  
ATOM 8964  H HE   . ARG A 1 17 ? 24.999  0.111   -5.722  1.00 0.42 ? 17 ARG A HE   5  
ATOM 8965  H HH11 . ARG A 1 17 ? 24.153  -3.071  -5.626  1.00 0.42 ? 17 ARG A HH11 5  
ATOM 8966  H HH12 . ARG A 1 17 ? 25.651  -3.701  -6.225  1.00 0.42 ? 17 ARG A HH12 5  
ATOM 8967  H HH21 . ARG A 1 17 ? 26.888  -0.601  -7.162  1.00 0.42 ? 17 ARG A HH21 5  
ATOM 8968  H HH22 . ARG A 1 17 ? 27.199  -2.303  -7.095  1.00 0.42 ? 17 ARG A HH22 5  
ATOM 8969  N N    . PRO A 1 18 ? 20.458  3.793   -6.605  1.00 0.41 ? 18 PRO A N    5  
ATOM 8970  C CA   . PRO A 1 18 ? 19.581  4.743   -7.313  1.00 0.41 ? 18 PRO A CA   5  
ATOM 8971  C C    . PRO A 1 18 ? 18.928  4.071   -8.523  1.00 0.41 ? 18 PRO A C    5  
ATOM 8972  O O    . PRO A 1 18 ? 19.232  2.944   -8.861  1.00 0.41 ? 18 PRO A O    5  
ATOM 8973  C CB   . PRO A 1 18 ? 20.540  5.853   -7.754  1.00 0.41 ? 18 PRO A CB   5  
ATOM 8974  C CG   . PRO A 1 18 ? 21.953  5.223   -7.784  1.00 0.41 ? 18 PRO A CG   5  
ATOM 8975  C CD   . PRO A 1 18 ? 21.897  3.973   -6.884  1.00 0.41 ? 18 PRO A CD   5  
ATOM 8976  H HA   . PRO A 1 18 ? 18.834  5.144   -6.647  1.00 0.41 ? 18 PRO A HA   5  
ATOM 8977  H HB2  . PRO A 1 18 ? 20.266  6.207   -8.740  1.00 0.41 ? 18 PRO A HB2  5  
ATOM 8978  H HB3  . PRO A 1 18 ? 20.519  6.666   -7.046  1.00 0.41 ? 18 PRO A HB3  5  
ATOM 8979  H HG2  . PRO A 1 18 ? 22.212  4.944   -8.796  1.00 0.41 ? 18 PRO A HG2  5  
ATOM 8980  H HG3  . PRO A 1 18 ? 22.678  5.920   -7.393  1.00 0.41 ? 18 PRO A HG3  5  
ATOM 8981  H HD2  . PRO A 1 18 ? 22.295  3.115   -7.408  1.00 0.41 ? 18 PRO A HD2  5  
ATOM 8982  H HD3  . PRO A 1 18 ? 22.436  4.142   -5.966  1.00 0.41 ? 18 PRO A HD3  5  
ATOM 8983  N N    . LEU A 1 19 ? 18.031  4.755   -9.179  1.00 0.45 ? 19 LEU A N    5  
ATOM 8984  C CA   . LEU A 1 19 ? 17.356  4.161   -10.369 1.00 0.45 ? 19 LEU A CA   5  
ATOM 8985  C C    . LEU A 1 19 ? 17.461  5.137   -11.544 1.00 0.45 ? 19 LEU A C    5  
ATOM 8986  O O    . LEU A 1 19 ? 17.911  6.253   -11.379 1.00 0.45 ? 19 LEU A O    5  
ATOM 8987  C CB   . LEU A 1 19 ? 15.877  3.898   -10.057 1.00 0.45 ? 19 LEU A CB   5  
ATOM 8988  C CG   . LEU A 1 19 ? 15.665  3.797   -8.543  1.00 0.45 ? 19 LEU A CG   5  
ATOM 8989  C CD1  . LEU A 1 19 ? 15.721  5.195   -7.924  1.00 0.45 ? 19 LEU A CD1  5  
ATOM 8990  C CD2  . LEU A 1 19 ? 14.297  3.173   -8.263  1.00 0.45 ? 19 LEU A CD2  5  
ATOM 8991  H H    . LEU A 1 19 ? 17.801  5.663   -8.889  1.00 0.45 ? 19 LEU A H    5  
ATOM 8992  H HA   . LEU A 1 19 ? 17.841  3.231   -10.629 1.00 0.45 ? 19 LEU A HA   5  
ATOM 8993  H HB2  . LEU A 1 19 ? 15.279  4.708   -10.448 1.00 0.45 ? 19 LEU A HB2  5  
ATOM 8994  H HB3  . LEU A 1 19 ? 15.572  2.972   -10.520 1.00 0.45 ? 19 LEU A HB3  5  
ATOM 8995  H HG   . LEU A 1 19 ? 16.441  3.180   -8.111  1.00 0.45 ? 19 LEU A HG   5  
ATOM 8996  H HD11 . LEU A 1 19 ? 15.605  5.937   -8.699  1.00 0.45 ? 19 LEU A HD11 5  
ATOM 8997  H HD12 . LEU A 1 19 ? 14.924  5.301   -7.203  1.00 0.45 ? 19 LEU A HD12 5  
ATOM 8998  H HD13 . LEU A 1 19 ? 16.673  5.332   -7.432  1.00 0.45 ? 19 LEU A HD13 5  
ATOM 8999  H HD21 . LEU A 1 19 ? 14.194  2.261   -8.832  1.00 0.45 ? 19 LEU A HD21 5  
ATOM 9000  H HD22 . LEU A 1 19 ? 14.210  2.952   -7.210  1.00 0.45 ? 19 LEU A HD22 5  
ATOM 9001  H HD23 . LEU A 1 19 ? 13.520  3.867   -8.551  1.00 0.45 ? 19 LEU A HD23 5  
ATOM 9002  N N    . PRO A 1 20 ? 17.041  4.688   -12.699 1.00 0.58 ? 20 PRO A N    5  
ATOM 9003  C CA   . PRO A 1 20 ? 17.074  5.502   -13.925 1.00 0.58 ? 20 PRO A CA   5  
ATOM 9004  C C    . PRO A 1 20 ? 15.908  6.496   -13.932 1.00 0.58 ? 20 PRO A C    5  
ATOM 9005  O O    . PRO A 1 20 ? 14.772  6.132   -14.162 1.00 0.58 ? 20 PRO A O    5  
ATOM 9006  C CB   . PRO A 1 20 ? 16.923  4.471   -15.045 1.00 0.58 ? 20 PRO A CB   5  
ATOM 9007  C CG   . PRO A 1 20 ? 16.256  3.228   -14.408 1.00 0.58 ? 20 PRO A CG   5  
ATOM 9008  C CD   . PRO A 1 20 ? 16.495  3.328   -12.890 1.00 0.58 ? 20 PRO A CD   5  
ATOM 9009  H HA   . PRO A 1 20 ? 18.016  6.016   -14.019 1.00 0.58 ? 20 PRO A HA   5  
ATOM 9010  H HB2  . PRO A 1 20 ? 16.299  4.868   -15.834 1.00 0.58 ? 20 PRO A HB2  5  
ATOM 9011  H HB3  . PRO A 1 20 ? 17.892  4.202   -15.437 1.00 0.58 ? 20 PRO A HB3  5  
ATOM 9012  H HG2  . PRO A 1 20 ? 15.195  3.230   -14.620 1.00 0.58 ? 20 PRO A HG2  5  
ATOM 9013  H HG3  . PRO A 1 20 ? 16.709  2.327   -14.789 1.00 0.58 ? 20 PRO A HG3  5  
ATOM 9014  H HD2  . PRO A 1 20 ? 15.563  3.213   -12.355 1.00 0.58 ? 20 PRO A HD2  5  
ATOM 9015  H HD3  . PRO A 1 20 ? 17.214  2.589   -12.569 1.00 0.58 ? 20 PRO A HD3  5  
ATOM 9016  N N    . ARG A 1 21 ? 16.181  7.747   -13.680 1.00 0.75 ? 21 ARG A N    5  
ATOM 9017  C CA   . ARG A 1 21 ? 15.089  8.761   -13.669 1.00 0.75 ? 21 ARG A CA   5  
ATOM 9018  C C    . ARG A 1 21 ? 14.505  8.896   -15.077 1.00 0.75 ? 21 ARG A C    5  
ATOM 9019  O O    . ARG A 1 21 ? 13.432  9.437   -15.265 1.00 0.75 ? 21 ARG A O    5  
ATOM 9020  C CB   . ARG A 1 21 ? 15.650  10.110  -13.218 1.00 0.75 ? 21 ARG A CB   5  
ATOM 9021  C CG   . ARG A 1 21 ? 16.875  10.465  -14.062 1.00 0.75 ? 21 ARG A CG   5  
ATOM 9022  C CD   . ARG A 1 21 ? 17.340  11.882  -13.718 1.00 0.75 ? 21 ARG A CD   5  
ATOM 9023  N NE   . ARG A 1 21 ? 16.357  12.868  -14.246 1.00 0.75 ? 21 ARG A NE   5  
ATOM 9024  C CZ   . ARG A 1 21 ? 16.735  13.765  -15.114 1.00 0.75 ? 21 ARG A CZ   5  
ATOM 9025  N NH1  . ARG A 1 21 ? 17.614  14.671  -14.778 1.00 0.75 ? 21 ARG A NH1  5  
ATOM 9026  N NH2  . ARG A 1 21 ? 16.235  13.758  -16.320 1.00 0.75 ? 21 ARG A NH2  5  
ATOM 9027  H H    . ARG A 1 21 ? 17.104  8.019   -13.494 1.00 0.75 ? 21 ARG A H    5  
ATOM 9028  H HA   . ARG A 1 21 ? 14.313  8.447   -12.987 1.00 0.75 ? 21 ARG A HA   5  
ATOM 9029  H HB2  . ARG A 1 21 ? 14.894  10.873  -13.340 1.00 0.75 ? 21 ARG A HB2  5  
ATOM 9030  H HB3  . ARG A 1 21 ? 15.936  10.051  -12.179 1.00 0.75 ? 21 ARG A HB3  5  
ATOM 9031  H HG2  . ARG A 1 21 ? 17.671  9.764   -13.854 1.00 0.75 ? 21 ARG A HG2  5  
ATOM 9032  H HG3  . ARG A 1 21 ? 16.617  10.418  -15.109 1.00 0.75 ? 21 ARG A HG3  5  
ATOM 9033  H HD2  . ARG A 1 21 ? 17.415  11.985  -12.646 1.00 0.75 ? 21 ARG A HD2  5  
ATOM 9034  H HD3  . ARG A 1 21 ? 18.306  12.061  -14.165 1.00 0.75 ? 21 ARG A HD3  5  
ATOM 9035  H HE   . ARG A 1 21 ? 15.426  12.845  -13.939 1.00 0.75 ? 21 ARG A HE   5  
ATOM 9036  H HH11 . ARG A 1 21 ? 17.997  14.676  -13.855 1.00 0.75 ? 21 ARG A HH11 5  
ATOM 9037  H HH12 . ARG A 1 21 ? 17.904  15.357  -15.444 1.00 0.75 ? 21 ARG A HH12 5  
ATOM 9038  H HH21 . ARG A 1 21 ? 15.561  13.065  -16.577 1.00 0.75 ? 21 ARG A HH21 5  
ATOM 9039  H HH22 . ARG A 1 21 ? 16.524  14.446  -16.986 1.00 0.75 ? 21 ARG A HH22 5  
ATOM 9040  N N    . ALA A 1 22 ? 15.199  8.408   -16.068 1.00 0.89 ? 22 ALA A N    5  
ATOM 9041  C CA   . ALA A 1 22 ? 14.680  8.509   -17.461 1.00 0.89 ? 22 ALA A CA   5  
ATOM 9042  C C    . ALA A 1 22 ? 13.506  7.546   -17.639 1.00 0.89 ? 22 ALA A C    5  
ATOM 9043  O O    . ALA A 1 22 ? 12.667  7.726   -18.500 1.00 0.89 ? 22 ALA A O    5  
ATOM 9044  C CB   . ALA A 1 22 ? 15.792  8.145   -18.447 1.00 0.89 ? 22 ALA A CB   5  
ATOM 9045  H H    . ALA A 1 22 ? 16.061  7.975   -15.897 1.00 0.89 ? 22 ALA A H    5  
ATOM 9046  H HA   . ALA A 1 22 ? 14.349  9.520   -17.649 1.00 0.89 ? 22 ALA A HA   5  
ATOM 9047  H HB1  . ALA A 1 22 ? 16.520  7.518   -17.953 1.00 0.89 ? 22 ALA A HB1  5  
ATOM 9048  H HB2  . ALA A 1 22 ? 15.369  7.613   -19.286 1.00 0.89 ? 22 ALA A HB2  5  
ATOM 9049  H HB3  . ALA A 1 22 ? 16.272  9.047   -18.797 1.00 0.89 ? 22 ALA A HB3  5  
ATOM 9050  N N    . HIS A 1 23 ? 13.439  6.523   -16.830 1.00 0.71 ? 23 HIS A N    5  
ATOM 9051  C CA   . HIS A 1 23 ? 12.318  5.549   -16.953 1.00 0.71 ? 23 HIS A CA   5  
ATOM 9052  C C    . HIS A 1 23 ? 11.369  5.706   -15.762 1.00 0.71 ? 23 HIS A C    5  
ATOM 9053  O O    . HIS A 1 23 ? 10.454  4.928   -15.579 1.00 0.71 ? 23 HIS A O    5  
ATOM 9054  C CB   . HIS A 1 23 ? 12.879  4.125   -16.972 1.00 0.71 ? 23 HIS A CB   5  
ATOM 9055  C CG   . HIS A 1 23 ? 13.884  3.999   -18.083 1.00 0.71 ? 23 HIS A CG   5  
ATOM 9056  N ND1  . HIS A 1 23 ? 13.959  2.873   -18.888 1.00 0.71 ? 23 HIS A ND1  5  
ATOM 9057  C CD2  . HIS A 1 23 ? 14.863  4.849   -18.535 1.00 0.71 ? 23 HIS A CD2  5  
ATOM 9058  C CE1  . HIS A 1 23 ? 14.952  3.074   -19.774 1.00 0.71 ? 23 HIS A CE1  5  
ATOM 9059  N NE2  . HIS A 1 23 ? 15.536  4.263   -19.603 1.00 0.71 ? 23 HIS A NE2  5  
ATOM 9060  H H    . HIS A 1 23 ? 14.124  6.395   -16.143 1.00 0.71 ? 23 HIS A H    5  
ATOM 9061  H HA   . HIS A 1 23 ? 11.778  5.735   -17.870 1.00 0.71 ? 23 HIS A HA   5  
ATOM 9062  H HB2  . HIS A 1 23 ? 13.358  3.915   -16.027 1.00 0.71 ? 23 HIS A HB2  5  
ATOM 9063  H HB3  . HIS A 1 23 ? 12.074  3.423   -17.133 1.00 0.71 ? 23 HIS A HB3  5  
ATOM 9064  H HD1  . HIS A 1 23 ? 13.393  2.076   -18.824 1.00 0.71 ? 23 HIS A HD1  5  
ATOM 9065  H HD2  . HIS A 1 23 ? 15.078  5.824   -18.124 1.00 0.71 ? 23 HIS A HD2  5  
ATOM 9066  H HE1  . HIS A 1 23 ? 15.241  2.360   -20.532 1.00 0.71 ? 23 HIS A HE1  5  
ATOM 9067  N N    . ILE A 1 24 ? 11.579  6.706   -14.950 1.00 0.56 ? 24 ILE A N    5  
ATOM 9068  C CA   . ILE A 1 24 ? 10.687  6.908   -13.774 1.00 0.56 ? 24 ILE A CA   5  
ATOM 9069  C C    . ILE A 1 24 ? 9.515   7.809   -14.171 1.00 0.56 ? 24 ILE A C    5  
ATOM 9070  O O    . ILE A 1 24 ? 9.635   9.017   -14.216 1.00 0.56 ? 24 ILE A O    5  
ATOM 9071  C CB   . ILE A 1 24 ? 11.477  7.568   -12.642 1.00 0.56 ? 24 ILE A CB   5  
ATOM 9072  C CG1  . ILE A 1 24 ? 12.456  6.553   -12.046 1.00 0.56 ? 24 ILE A CG1  5  
ATOM 9073  C CG2  . ILE A 1 24 ? 10.513  8.045   -11.554 1.00 0.56 ? 24 ILE A CG2  5  
ATOM 9074  C CD1  . ILE A 1 24 ? 13.188  7.186   -10.861 1.00 0.56 ? 24 ILE A CD1  5  
ATOM 9075  H H    . ILE A 1 24 ? 12.322  7.324   -15.113 1.00 0.56 ? 24 ILE A H    5  
ATOM 9076  H HA   . ILE A 1 24 ? 10.310  5.954   -13.439 1.00 0.56 ? 24 ILE A HA   5  
ATOM 9077  H HB   . ILE A 1 24 ? 12.026  8.414   -13.032 1.00 0.56 ? 24 ILE A HB   5  
ATOM 9078  H HG12 . ILE A 1 24 ? 11.910  5.682   -11.710 1.00 0.56 ? 24 ILE A HG12 5  
ATOM 9079  H HG13 . ILE A 1 24 ? 13.174  6.262   -12.797 1.00 0.56 ? 24 ILE A HG13 5  
ATOM 9080  H HG21 . ILE A 1 24 ? 9.723   7.317   -11.429 1.00 0.56 ? 24 ILE A HG21 5  
ATOM 9081  H HG22 . ILE A 1 24 ? 11.048  8.158   -10.622 1.00 0.56 ? 24 ILE A HG22 5  
ATOM 9082  H HG23 . ILE A 1 24 ? 10.086  8.994   -11.842 1.00 0.56 ? 24 ILE A HG23 5  
ATOM 9083  H HD11 . ILE A 1 24 ? 12.475  7.688   -10.223 1.00 0.56 ? 24 ILE A HD11 5  
ATOM 9084  H HD12 . ILE A 1 24 ? 13.695  6.415   -10.298 1.00 0.56 ? 24 ILE A HD12 5  
ATOM 9085  H HD13 . ILE A 1 24 ? 13.912  7.900   -11.224 1.00 0.56 ? 24 ILE A HD13 5  
ATOM 9086  N N    . LYS A 1 25 ? 8.383   7.230   -14.460 1.00 0.59 ? 25 LYS A N    5  
ATOM 9087  C CA   . LYS A 1 25 ? 7.205   8.050   -14.855 1.00 0.59 ? 25 LYS A CA   5  
ATOM 9088  C C    . LYS A 1 25 ? 6.944   9.117   -13.791 1.00 0.59 ? 25 LYS A C    5  
ATOM 9089  O O    . LYS A 1 25 ? 7.057   10.300  -14.043 1.00 0.59 ? 25 LYS A O    5  
ATOM 9090  C CB   . LYS A 1 25 ? 5.977   7.147   -14.982 1.00 0.59 ? 25 LYS A CB   5  
ATOM 9091  C CG   . LYS A 1 25 ? 5.061   7.690   -16.077 1.00 0.59 ? 25 LYS A CG   5  
ATOM 9092  C CD   . LYS A 1 25 ? 3.836   6.783   -16.216 1.00 0.59 ? 25 LYS A CD   5  
ATOM 9093  C CE   . LYS A 1 25 ? 2.642   7.425   -15.509 1.00 0.59 ? 25 LYS A CE   5  
ATOM 9094  N NZ   . LYS A 1 25 ? 1.439   6.562   -15.681 1.00 0.59 ? 25 LYS A NZ   5  
ATOM 9095  H H    . LYS A 1 25 ? 8.305   6.254   -14.419 1.00 0.59 ? 25 LYS A H    5  
ATOM 9096  H HA   . LYS A 1 25 ? 7.400   8.528   -15.803 1.00 0.59 ? 25 LYS A HA   5  
ATOM 9097  H HB2  . LYS A 1 25 ? 6.292   6.145   -15.237 1.00 0.59 ? 25 LYS A HB2  5  
ATOM 9098  H HB3  . LYS A 1 25 ? 5.444   7.130   -14.044 1.00 0.59 ? 25 LYS A HB3  5  
ATOM 9099  H HG2  . LYS A 1 25 ? 4.743   8.690   -15.816 1.00 0.59 ? 25 LYS A HG2  5  
ATOM 9100  H HG3  . LYS A 1 25 ? 5.596   7.715   -17.014 1.00 0.59 ? 25 LYS A HG3  5  
ATOM 9101  H HD2  . LYS A 1 25 ? 3.606   6.648   -17.264 1.00 0.59 ? 25 LYS A HD2  5  
ATOM 9102  H HD3  . LYS A 1 25 ? 4.045   5.824   -15.767 1.00 0.59 ? 25 LYS A HD3  5  
ATOM 9103  H HE2  . LYS A 1 25 ? 2.861   7.532   -14.456 1.00 0.59 ? 25 LYS A HE2  5  
ATOM 9104  H HE3  . LYS A 1 25 ? 2.451   8.398   -15.937 1.00 0.59 ? 25 LYS A HE3  5  
ATOM 9105  H HZ1  . LYS A 1 25 ? 1.417   6.187   -16.651 1.00 0.59 ? 25 LYS A HZ1  5  
ATOM 9106  H HZ2  . LYS A 1 25 ? 1.480   5.772   -15.004 1.00 0.59 ? 25 LYS A HZ2  5  
ATOM 9107  H HZ3  . LYS A 1 25 ? 0.581   7.123   -15.509 1.00 0.59 ? 25 LYS A HZ3  5  
ATOM 9108  N N    . GLU A 1 26 ? 6.591   8.708   -12.603 1.00 0.53 ? 26 GLU A N    5  
ATOM 9109  C CA   . GLU A 1 26 ? 6.320   9.700   -11.526 1.00 0.53 ? 26 GLU A CA   5  
ATOM 9110  C C    . GLU A 1 26 ? 6.453   9.024   -10.161 1.00 0.53 ? 26 GLU A C    5  
ATOM 9111  O O    . GLU A 1 26 ? 6.233   7.837   -10.022 1.00 0.53 ? 26 GLU A O    5  
ATOM 9112  C CB   . GLU A 1 26 ? 4.900   10.246  -11.685 1.00 0.53 ? 26 GLU A CB   5  
ATOM 9113  C CG   . GLU A 1 26 ? 3.895   9.100   -11.547 1.00 0.53 ? 26 GLU A CG   5  
ATOM 9114  C CD   . GLU A 1 26 ? 2.531   9.550   -12.074 1.00 0.53 ? 26 GLU A CD   5  
ATOM 9115  O OE1  . GLU A 1 26 ? 2.443   9.847   -13.253 1.00 0.53 ? 26 GLU A OE1  5  
ATOM 9116  O OE2  . GLU A 1 26 ? 1.598   9.589   -11.289 1.00 0.53 ? 26 GLU A OE2  5  
ATOM 9117  H H    . GLU A 1 26 ? 6.503   7.749   -12.420 1.00 0.53 ? 26 GLU A H    5  
ATOM 9118  H HA   . GLU A 1 26 ? 7.027   10.512  -11.598 1.00 0.53 ? 26 GLU A HA   5  
ATOM 9119  H HB2  . GLU A 1 26 ? 4.712   10.987  -10.922 1.00 0.53 ? 26 GLU A HB2  5  
ATOM 9120  H HB3  . GLU A 1 26 ? 4.795   10.699  -12.660 1.00 0.53 ? 26 GLU A HB3  5  
ATOM 9121  H HG2  . GLU A 1 26 ? 4.241   8.250   -12.116 1.00 0.53 ? 26 GLU A HG2  5  
ATOM 9122  H HG3  . GLU A 1 26 ? 3.805   8.825   -10.506 1.00 0.53 ? 26 GLU A HG3  5  
ATOM 9123  N N    . TYR A 1 27 ? 6.809   9.769   -9.151  1.00 0.39 ? 27 TYR A N    5  
ATOM 9124  C CA   . TYR A 1 27 ? 6.952   9.167   -7.795  1.00 0.39 ? 27 TYR A CA   5  
ATOM 9125  C C    . TYR A 1 27 ? 5.953   9.825   -6.839  1.00 0.39 ? 27 TYR A C    5  
ATOM 9126  O O    . TYR A 1 27 ? 5.135   10.629  -7.240  1.00 0.39 ? 27 TYR A O    5  
ATOM 9127  C CB   . TYR A 1 27 ? 8.380   9.389   -7.284  1.00 0.39 ? 27 TYR A CB   5  
ATOM 9128  C CG   . TYR A 1 27 ? 8.558   10.833  -6.875  1.00 0.39 ? 27 TYR A CG   5  
ATOM 9129  C CD1  . TYR A 1 27 ? 8.954   11.786  -7.819  1.00 0.39 ? 27 TYR A CD1  5  
ATOM 9130  C CD2  . TYR A 1 27 ? 8.325   11.216  -5.548  1.00 0.39 ? 27 TYR A CD2  5  
ATOM 9131  C CE1  . TYR A 1 27 ? 9.119   13.123  -7.439  1.00 0.39 ? 27 TYR A CE1  5  
ATOM 9132  C CE2  . TYR A 1 27 ? 8.489   12.553  -5.166  1.00 0.39 ? 27 TYR A CE2  5  
ATOM 9133  C CZ   . TYR A 1 27 ? 8.885   13.507  -6.112  1.00 0.39 ? 27 TYR A CZ   5  
ATOM 9134  O OH   . TYR A 1 27 ? 9.047   14.824  -5.735  1.00 0.39 ? 27 TYR A OH   5  
ATOM 9135  H H    . TYR A 1 27 ? 6.979   10.725  -9.283  1.00 0.39 ? 27 TYR A H    5  
ATOM 9136  H HA   . TYR A 1 27 ? 6.751   8.107   -7.851  1.00 0.39 ? 27 TYR A HA   5  
ATOM 9137  H HB2  . TYR A 1 27 ? 8.561   8.749   -6.434  1.00 0.39 ? 27 TYR A HB2  5  
ATOM 9138  H HB3  . TYR A 1 27 ? 9.083   9.151   -8.069  1.00 0.39 ? 27 TYR A HB3  5  
ATOM 9139  H HD1  . TYR A 1 27 ? 9.134   11.491  -8.843  1.00 0.39 ? 27 TYR A HD1  5  
ATOM 9140  H HD2  . TYR A 1 27 ? 8.019   10.480  -4.820  1.00 0.39 ? 27 TYR A HD2  5  
ATOM 9141  H HE1  . TYR A 1 27 ? 9.425   13.859  -8.167  1.00 0.39 ? 27 TYR A HE1  5  
ATOM 9142  H HE2  . TYR A 1 27 ? 8.309   12.848  -4.144  1.00 0.39 ? 27 TYR A HE2  5  
ATOM 9143  H HH   . TYR A 1 27 ? 8.343   15.047  -5.123  1.00 0.39 ? 27 TYR A HH   5  
ATOM 9144  N N    . PHE A 1 28 ? 6.012   9.491   -5.580  1.00 0.35 ? 28 PHE A N    5  
ATOM 9145  C CA   . PHE A 1 28 ? 5.065   10.101  -4.603  1.00 0.35 ? 28 PHE A CA   5  
ATOM 9146  C C    . PHE A 1 28 ? 5.359   9.563   -3.200  1.00 0.35 ? 28 PHE A C    5  
ATOM 9147  O O    . PHE A 1 28 ? 5.861   8.470   -3.038  1.00 0.35 ? 28 PHE A O    5  
ATOM 9148  C CB   . PHE A 1 28 ? 3.629   9.745   -4.997  1.00 0.35 ? 28 PHE A CB   5  
ATOM 9149  C CG   . PHE A 1 28 ? 3.477   8.244   -5.051  1.00 0.35 ? 28 PHE A CG   5  
ATOM 9150  C CD1  . PHE A 1 28 ? 3.455   7.501   -3.865  1.00 0.35 ? 28 PHE A CD1  5  
ATOM 9151  C CD2  . PHE A 1 28 ? 3.356   7.596   -6.286  1.00 0.35 ? 28 PHE A CD2  5  
ATOM 9152  C CE1  . PHE A 1 28 ? 3.312   6.109   -3.914  1.00 0.35 ? 28 PHE A CE1  5  
ATOM 9153  C CE2  . PHE A 1 28 ? 3.212   6.205   -6.334  1.00 0.35 ? 28 PHE A CE2  5  
ATOM 9154  C CZ   . PHE A 1 28 ? 3.190   5.461   -5.149  1.00 0.35 ? 28 PHE A CZ   5  
ATOM 9155  H H    . PHE A 1 28 ? 6.679   8.840   -5.275  1.00 0.35 ? 28 PHE A H    5  
ATOM 9156  H HA   . PHE A 1 28 ? 5.184   11.173  -4.609  1.00 0.35 ? 28 PHE A HA   5  
ATOM 9157  H HB2  . PHE A 1 28 ? 2.945   10.151  -4.266  1.00 0.35 ? 28 PHE A HB2  5  
ATOM 9158  H HB3  . PHE A 1 28 ? 3.408   10.163  -5.967  1.00 0.35 ? 28 PHE A HB3  5  
ATOM 9159  H HD1  . PHE A 1 28 ? 3.549   8.001   -2.912  1.00 0.35 ? 28 PHE A HD1  5  
ATOM 9160  H HD2  . PHE A 1 28 ? 3.373   8.170   -7.201  1.00 0.35 ? 28 PHE A HD2  5  
ATOM 9161  H HE1  . PHE A 1 28 ? 3.295   5.536   -2.999  1.00 0.35 ? 28 PHE A HE1  5  
ATOM 9162  H HE2  . PHE A 1 28 ? 3.120   5.704   -7.288  1.00 0.35 ? 28 PHE A HE2  5  
ATOM 9163  H HZ   . PHE A 1 28 ? 3.080   4.387   -5.187  1.00 0.35 ? 28 PHE A HZ   5  
ATOM 9164  N N    . TYR A 1 29 ? 5.050   10.324  -2.187  1.00 0.32 ? 29 TYR A N    5  
ATOM 9165  C CA   . TYR A 1 29 ? 5.315   9.857   -0.796  1.00 0.32 ? 29 TYR A CA   5  
ATOM 9166  C C    . TYR A 1 29 ? 4.095   9.096   -0.271  1.00 0.32 ? 29 TYR A C    5  
ATOM 9167  O O    . TYR A 1 29 ? 3.013   9.183   -0.817  1.00 0.32 ? 29 TYR A O    5  
ATOM 9168  C CB   . TYR A 1 29 ? 5.585   11.063  0.106   1.00 0.32 ? 29 TYR A CB   5  
ATOM 9169  C CG   . TYR A 1 29 ? 6.808   11.800  -0.383  1.00 0.32 ? 29 TYR A CG   5  
ATOM 9170  C CD1  . TYR A 1 29 ? 6.708   12.689  -1.460  1.00 0.32 ? 29 TYR A CD1  5  
ATOM 9171  C CD2  . TYR A 1 29 ? 8.044   11.599  0.244   1.00 0.32 ? 29 TYR A CD2  5  
ATOM 9172  C CE1  . TYR A 1 29 ? 7.842   13.375  -1.910  1.00 0.32 ? 29 TYR A CE1  5  
ATOM 9173  C CE2  . TYR A 1 29 ? 9.178   12.285  -0.206  1.00 0.32 ? 29 TYR A CE2  5  
ATOM 9174  C CZ   . TYR A 1 29 ? 9.077   13.173  -1.283  1.00 0.32 ? 29 TYR A CZ   5  
ATOM 9175  O OH   . TYR A 1 29 ? 10.195  13.850  -1.727  1.00 0.32 ? 29 TYR A OH   5  
ATOM 9176  H H    . TYR A 1 29 ? 4.646   11.204  -2.339  1.00 0.32 ? 29 TYR A H    5  
ATOM 9177  H HA   . TYR A 1 29 ? 6.175   9.205   -0.792  1.00 0.32 ? 29 TYR A HA   5  
ATOM 9178  H HB2  . TYR A 1 29 ? 4.732   11.727  0.083   1.00 0.32 ? 29 TYR A HB2  5  
ATOM 9179  H HB3  . TYR A 1 29 ? 5.750   10.726  1.118   1.00 0.32 ? 29 TYR A HB3  5  
ATOM 9180  H HD1  . TYR A 1 29 ? 5.756   12.845  -1.944  1.00 0.32 ? 29 TYR A HD1  5  
ATOM 9181  H HD2  . TYR A 1 29 ? 8.123   10.912  1.074   1.00 0.32 ? 29 TYR A HD2  5  
ATOM 9182  H HE1  . TYR A 1 29 ? 7.764   14.061  -2.742  1.00 0.32 ? 29 TYR A HE1  5  
ATOM 9183  H HE2  . TYR A 1 29 ? 10.131  12.129  0.278   1.00 0.32 ? 29 TYR A HE2  5  
ATOM 9184  H HH   . TYR A 1 29 ? 10.956  13.505  -1.256  1.00 0.32 ? 29 TYR A HH   5  
ATOM 9185  N N    . THR A 1 30 ? 4.262   8.350   0.787   1.00 0.37 ? 30 THR A N    5  
ATOM 9186  C CA   . THR A 1 30 ? 3.114   7.583   1.350   1.00 0.37 ? 30 THR A CA   5  
ATOM 9187  C C    . THR A 1 30 ? 3.345   7.348   2.844   1.00 0.37 ? 30 THR A C    5  
ATOM 9188  O O    . THR A 1 30 ? 4.462   7.173   3.288   1.00 0.37 ? 30 THR A O    5  
ATOM 9189  C CB   . THR A 1 30 ? 2.999   6.236   0.633   1.00 0.37 ? 30 THR A CB   5  
ATOM 9190  O OG1  . THR A 1 30 ? 4.263   5.880   0.092   1.00 0.37 ? 30 THR A OG1  5  
ATOM 9191  C CG2  . THR A 1 30 ? 1.969   6.342   -0.492  1.00 0.37 ? 30 THR A CG2  5  
ATOM 9192  H H    . THR A 1 30 ? 5.143   8.294   1.212   1.00 0.37 ? 30 THR A H    5  
ATOM 9193  H HA   . THR A 1 30 ? 2.203   8.145   1.211   1.00 0.37 ? 30 THR A HA   5  
ATOM 9194  H HB   . THR A 1 30 ? 2.680   5.481   1.336   1.00 0.37 ? 30 THR A HB   5  
ATOM 9195  H HG1  . THR A 1 30 ? 4.524   5.039   0.477   1.00 0.37 ? 30 THR A HG1  5  
ATOM 9196  H HG21 . THR A 1 30 ? 1.564   7.342   -0.517  1.00 0.37 ? 30 THR A HG21 5  
ATOM 9197  H HG22 . THR A 1 30 ? 2.446   6.124   -1.437  1.00 0.37 ? 30 THR A HG22 5  
ATOM 9198  H HG23 . THR A 1 30 ? 1.172   5.634   -0.319  1.00 0.37 ? 30 THR A HG23 5  
ATOM 9199  N N    . SER A 1 31 ? 2.299   7.344   3.625   1.00 0.47 ? 31 SER A N    5  
ATOM 9200  C CA   . SER A 1 31 ? 2.467   7.120   5.089   1.00 0.47 ? 31 SER A CA   5  
ATOM 9201  C C    . SER A 1 31 ? 1.100   7.144   5.776   1.00 0.47 ? 31 SER A C    5  
ATOM 9202  O O    . SER A 1 31 ? 0.880   6.470   6.762   1.00 0.47 ? 31 SER A O    5  
ATOM 9203  C CB   . SER A 1 31 ? 3.350   8.223   5.674   1.00 0.47 ? 31 SER A CB   5  
ATOM 9204  O OG   . SER A 1 31 ? 2.529   9.301   6.106   1.00 0.47 ? 31 SER A OG   5  
ATOM 9205  H H    . SER A 1 31 ? 1.405   7.487   3.249   1.00 0.47 ? 31 SER A H    5  
ATOM 9206  H HA   . SER A 1 31 ? 2.935   6.161   5.254   1.00 0.47 ? 31 SER A HA   5  
ATOM 9207  H HB2  . SER A 1 31 ? 3.902   7.837   6.514   1.00 0.47 ? 31 SER A HB2  5  
ATOM 9208  H HB3  . SER A 1 31 ? 4.044   8.567   4.918   1.00 0.47 ? 31 SER A HB3  5  
ATOM 9209  H HG   . SER A 1 31 ? 2.806   9.547   6.992   1.00 0.47 ? 31 SER A HG   5  
ATOM 9210  N N    . GLY A 1 32 ? 0.179   7.917   5.266   1.00 0.60 ? 32 GLY A N    5  
ATOM 9211  C CA   . GLY A 1 32 ? -1.170  7.983   5.894   1.00 0.60 ? 32 GLY A CA   5  
ATOM 9212  C C    . GLY A 1 32 ? -1.639  6.572   6.253   1.00 0.60 ? 32 GLY A C    5  
ATOM 9213  O O    . GLY A 1 32 ? -1.611  6.170   7.400   1.00 0.60 ? 32 GLY A O    5  
ATOM 9214  H H    . GLY A 1 32 ? 0.377   8.455   4.472   1.00 0.60 ? 32 GLY A H    5  
ATOM 9215  H HA2  . GLY A 1 32 ? -1.121  8.586   6.790   1.00 0.60 ? 32 GLY A HA2  5  
ATOM 9216  H HA3  . GLY A 1 32 ? -1.870  8.425   5.201   1.00 0.60 ? 32 GLY A HA3  5  
ATOM 9217  N N    . LYS A 1 33 ? -2.070  5.815   5.281   1.00 0.55 ? 33 LYS A N    5  
ATOM 9218  C CA   . LYS A 1 33 ? -2.540  4.430   5.565   1.00 0.55 ? 33 LYS A CA   5  
ATOM 9219  C C    . LYS A 1 33 ? -1.343  3.478   5.569   1.00 0.55 ? 33 LYS A C    5  
ATOM 9220  O O    . LYS A 1 33 ? -1.382  2.413   4.985   1.00 0.55 ? 33 LYS A O    5  
ATOM 9221  C CB   . LYS A 1 33 ? -3.526  3.997   4.481   1.00 0.55 ? 33 LYS A CB   5  
ATOM 9222  C CG   . LYS A 1 33 ? -4.434  5.173   4.118   1.00 0.55 ? 33 LYS A CG   5  
ATOM 9223  C CD   . LYS A 1 33 ? -5.872  4.676   3.959   1.00 0.55 ? 33 LYS A CD   5  
ATOM 9224  C CE   . LYS A 1 33 ? -6.658  5.654   3.084   1.00 0.55 ? 33 LYS A CE   5  
ATOM 9225  N NZ   . LYS A 1 33 ? -7.336  4.905   1.988   1.00 0.55 ? 33 LYS A NZ   5  
ATOM 9226  H H    . LYS A 1 33 ? -2.084  6.158   4.363   1.00 0.55 ? 33 LYS A H    5  
ATOM 9227  H HA   . LYS A 1 33 ? -3.027  4.403   6.528   1.00 0.55 ? 33 LYS A HA   5  
ATOM 9228  H HB2  . LYS A 1 33 ? -2.979  3.679   3.607   1.00 0.55 ? 33 LYS A HB2  5  
ATOM 9229  H HB3  . LYS A 1 33 ? -4.128  3.180   4.847   1.00 0.55 ? 33 LYS A HB3  5  
ATOM 9230  H HG2  . LYS A 1 33 ? -4.392  5.915   4.901   1.00 0.55 ? 33 LYS A HG2  5  
ATOM 9231  H HG3  . LYS A 1 33 ? -4.102  5.611   3.188   1.00 0.55 ? 33 LYS A HG3  5  
ATOM 9232  H HD2  . LYS A 1 33 ? -5.866  3.700   3.496   1.00 0.55 ? 33 LYS A HD2  5  
ATOM 9233  H HD3  . LYS A 1 33 ? -6.339  4.610   4.930   1.00 0.55 ? 33 LYS A HD3  5  
ATOM 9234  H HE2  . LYS A 1 33 ? -7.397  6.161   3.685   1.00 0.55 ? 33 LYS A HE2  5  
ATOM 9235  H HE3  . LYS A 1 33 ? -5.981  6.379   2.657   1.00 0.55 ? 33 LYS A HE3  5  
ATOM 9236  H HZ1  . LYS A 1 33 ? -6.639  4.320   1.484   1.00 0.55 ? 33 LYS A HZ1  5  
ATOM 9237  H HZ2  . LYS A 1 33 ? -8.073  4.292   2.391   1.00 0.55 ? 33 LYS A HZ2  5  
ATOM 9238  H HZ3  . LYS A 1 33 ? -7.769  5.579   1.325   1.00 0.55 ? 33 LYS A HZ3  5  
ATOM 9239  N N    . CYS A 1 34 ? -0.278  3.853   6.223   1.00 0.46 ? 34 CYS A N    5  
ATOM 9240  C CA   . CYS A 1 34 ? 0.922   2.972   6.262   1.00 0.46 ? 34 CYS A CA   5  
ATOM 9241  C C    . CYS A 1 34 ? 1.562   3.036   7.650   1.00 0.46 ? 34 CYS A C    5  
ATOM 9242  O O    . CYS A 1 34 ? 0.953   3.472   8.606   1.00 0.46 ? 34 CYS A O    5  
ATOM 9243  C CB   . CYS A 1 34 ? 1.930   3.443   5.213   1.00 0.46 ? 34 CYS A CB   5  
ATOM 9244  S SG   . CYS A 1 34 ? 1.071   3.751   3.651   1.00 0.46 ? 34 CYS A SG   5  
ATOM 9245  H H    . CYS A 1 34 ? -0.269  4.716   6.684   1.00 0.46 ? 34 CYS A H    5  
ATOM 9246  H HA   . CYS A 1 34 ? 0.629   1.954   6.047   1.00 0.46 ? 34 CYS A HA   5  
ATOM 9247  H HB2  . CYS A 1 34 ? 2.402   4.354   5.552   1.00 0.46 ? 34 CYS A HB2  5  
ATOM 9248  H HB3  . CYS A 1 34 ? 2.682   2.682   5.068   1.00 0.46 ? 34 CYS A HB3  5  
ATOM 9249  N N    . SER A 1 35 ? 2.788   2.603   7.767   1.00 0.42 ? 35 SER A N    5  
ATOM 9250  C CA   . SER A 1 35 ? 3.467   2.637   9.092   1.00 0.42 ? 35 SER A CA   5  
ATOM 9251  C C    . SER A 1 35 ? 4.517   3.750   9.097   1.00 0.42 ? 35 SER A C    5  
ATOM 9252  O O    . SER A 1 35 ? 4.626   4.510   10.040  1.00 0.42 ? 35 SER A O    5  
ATOM 9253  C CB   . SER A 1 35 ? 4.148   1.294   9.351   1.00 0.42 ? 35 SER A CB   5  
ATOM 9254  O OG   . SER A 1 35 ? 4.361   1.136   10.748  1.00 0.42 ? 35 SER A OG   5  
ATOM 9255  H H    . SER A 1 35 ? 3.261   2.254   6.983   1.00 0.42 ? 35 SER A H    5  
ATOM 9256  H HA   . SER A 1 35 ? 2.738   2.827   9.866   1.00 0.42 ? 35 SER A HA   5  
ATOM 9257  H HB2  . SER A 1 35 ? 3.520   0.494   8.996   1.00 0.42 ? 35 SER A HB2  5  
ATOM 9258  H HB3  . SER A 1 35 ? 5.095   1.264   8.827   1.00 0.42 ? 35 SER A HB3  5  
ATOM 9259  H HG   . SER A 1 35 ? 5.171   1.597   10.979  1.00 0.42 ? 35 SER A HG   5  
ATOM 9260  N N    . ASN A 1 36 ? 5.292   3.854   8.052   1.00 0.38 ? 36 ASN A N    5  
ATOM 9261  C CA   . ASN A 1 36 ? 6.334   4.919   7.999   1.00 0.38 ? 36 ASN A CA   5  
ATOM 9262  C C    . ASN A 1 36 ? 6.241   5.659   6.661   1.00 0.38 ? 36 ASN A C    5  
ATOM 9263  O O    . ASN A 1 36 ? 5.828   5.092   5.668   1.00 0.38 ? 36 ASN A O    5  
ATOM 9264  C CB   . ASN A 1 36 ? 7.721   4.284   8.134   1.00 0.38 ? 36 ASN A CB   5  
ATOM 9265  C CG   . ASN A 1 36 ? 7.636   3.058   9.046   1.00 0.38 ? 36 ASN A CG   5  
ATOM 9266  O OD1  . ASN A 1 36 ? 7.414   3.184   10.233  1.00 0.38 ? 36 ASN A OD1  5  
ATOM 9267  N ND2  . ASN A 1 36 ? 7.806   1.868   8.537   1.00 0.38 ? 36 ASN A ND2  5  
ATOM 9268  H H    . ASN A 1 36 ? 5.188   3.232   7.301   1.00 0.38 ? 36 ASN A H    5  
ATOM 9269  H HA   . ASN A 1 36 ? 6.178   5.616   8.807   1.00 0.38 ? 36 ASN A HA   5  
ATOM 9270  H HB2  . ASN A 1 36 ? 8.075   3.984   7.158   1.00 0.38 ? 36 ASN A HB2  5  
ATOM 9271  H HB3  . ASN A 1 36 ? 8.405   5.001   8.560   1.00 0.38 ? 36 ASN A HB3  5  
ATOM 9272  H HD21 . ASN A 1 36 ? 7.985   1.766   7.578   1.00 0.38 ? 36 ASN A HD21 5  
ATOM 9273  H HD22 . ASN A 1 36 ? 7.754   1.077   9.113   1.00 0.38 ? 36 ASN A HD22 5  
ATOM 9274  N N    . PRO A 1 37 ? 6.632   6.907   6.677   1.00 0.37 ? 37 PRO A N    5  
ATOM 9275  C CA   . PRO A 1 37 ? 6.608   7.763   5.478   1.00 0.37 ? 37 PRO A CA   5  
ATOM 9276  C C    . PRO A 1 37 ? 7.800   7.444   4.570   1.00 0.37 ? 37 PRO A C    5  
ATOM 9277  O O    . PRO A 1 37 ? 8.940   7.480   4.991   1.00 0.37 ? 37 PRO A O    5  
ATOM 9278  C CB   . PRO A 1 37 ? 6.719   9.180   6.046   1.00 0.37 ? 37 PRO A CB   5  
ATOM 9279  C CG   . PRO A 1 37 ? 7.360   9.039   7.447   1.00 0.37 ? 37 PRO A CG   5  
ATOM 9280  C CD   . PRO A 1 37 ? 7.131   7.582   7.892   1.00 0.37 ? 37 PRO A CD   5  
ATOM 9281  H HA   . PRO A 1 37 ? 5.679   7.649   4.944   1.00 0.37 ? 37 PRO A HA   5  
ATOM 9282  H HB2  . PRO A 1 37 ? 7.345   9.787   5.406   1.00 0.37 ? 37 PRO A HB2  5  
ATOM 9283  H HB3  . PRO A 1 37 ? 5.739   9.621   6.138   1.00 0.37 ? 37 PRO A HB3  5  
ATOM 9284  H HG2  . PRO A 1 37 ? 8.420   9.251   7.391   1.00 0.37 ? 37 PRO A HG2  5  
ATOM 9285  H HG3  . PRO A 1 37 ? 6.884   9.712   8.144   1.00 0.37 ? 37 PRO A HG3  5  
ATOM 9286  H HD2  . PRO A 1 37 ? 8.062   7.137   8.220   1.00 0.37 ? 37 PRO A HD2  5  
ATOM 9287  H HD3  . PRO A 1 37 ? 6.390   7.537   8.675   1.00 0.37 ? 37 PRO A HD3  5  
ATOM 9288  N N    . ALA A 1 38 ? 7.546   7.130   3.330   1.00 0.33 ? 38 ALA A N    5  
ATOM 9289  C CA   . ALA A 1 38 ? 8.665   6.809   2.399   1.00 0.33 ? 38 ALA A CA   5  
ATOM 9290  C C    . ALA A 1 38 ? 8.317   7.303   0.993   1.00 0.33 ? 38 ALA A C    5  
ATOM 9291  O O    . ALA A 1 38 ? 7.185   7.640   0.705   1.00 0.33 ? 38 ALA A O    5  
ATOM 9292  C CB   . ALA A 1 38 ? 8.883   5.295   2.367   1.00 0.33 ? 38 ALA A CB   5  
ATOM 9293  H H    . ALA A 1 38 ? 6.620   7.106   3.009   1.00 0.33 ? 38 ALA A H    5  
ATOM 9294  H HA   . ALA A 1 38 ? 9.567   7.295   2.739   1.00 0.33 ? 38 ALA A HA   5  
ATOM 9295  H HB1  . ALA A 1 38 ? 7.928   4.794   2.311   1.00 0.33 ? 38 ALA A HB1  5  
ATOM 9296  H HB2  . ALA A 1 38 ? 9.477   5.034   1.503   1.00 0.33 ? 38 ALA A HB2  5  
ATOM 9297  H HB3  . ALA A 1 38 ? 9.400   4.987   3.264   1.00 0.33 ? 38 ALA A HB3  5  
ATOM 9298  N N    . VAL A 1 39 ? 9.282   7.350   0.116   1.00 0.30 ? 39 VAL A N    5  
ATOM 9299  C CA   . VAL A 1 39 ? 9.006   7.822   -1.270  1.00 0.30 ? 39 VAL A CA   5  
ATOM 9300  C C    . VAL A 1 39 ? 8.693   6.622   -2.166  1.00 0.30 ? 39 VAL A C    5  
ATOM 9301  O O    . VAL A 1 39 ? 9.033   5.497   -1.854  1.00 0.30 ? 39 VAL A O    5  
ATOM 9302  C CB   . VAL A 1 39 ? 10.233  8.557   -1.814  1.00 0.30 ? 39 VAL A CB   5  
ATOM 9303  C CG1  . VAL A 1 39 ? 10.075  8.777   -3.319  1.00 0.30 ? 39 VAL A CG1  5  
ATOM 9304  C CG2  . VAL A 1 39 ? 10.367  9.911   -1.114  1.00 0.30 ? 39 VAL A CG2  5  
ATOM 9305  H H    . VAL A 1 39 ? 10.187  7.074   0.368   1.00 0.30 ? 39 VAL A H    5  
ATOM 9306  H HA   . VAL A 1 39 ? 8.160   8.494   -1.261  1.00 0.30 ? 39 VAL A HA   5  
ATOM 9307  H HB   . VAL A 1 39 ? 11.117  7.965   -1.628  1.00 0.30 ? 39 VAL A HB   5  
ATOM 9308  H HG11 . VAL A 1 39 ? 9.179   9.350   -3.507  1.00 0.30 ? 39 VAL A HG11 5  
ATOM 9309  H HG12 . VAL A 1 39 ? 10.932  9.314   -3.697  1.00 0.30 ? 39 VAL A HG12 5  
ATOM 9310  H HG13 . VAL A 1 39 ? 10.001  7.821   -3.817  1.00 0.30 ? 39 VAL A HG13 5  
ATOM 9311  H HG21 . VAL A 1 39 ? 9.827   9.887   -0.178  1.00 0.30 ? 39 VAL A HG21 5  
ATOM 9312  H HG22 . VAL A 1 39 ? 11.410  10.116  -0.923  1.00 0.30 ? 39 VAL A HG22 5  
ATOM 9313  H HG23 . VAL A 1 39 ? 9.956   10.685  -1.746  1.00 0.30 ? 39 VAL A HG23 5  
ATOM 9314  N N    . VAL A 1 40 ? 8.047   6.851   -3.275  1.00 0.33 ? 40 VAL A N    5  
ATOM 9315  C CA   . VAL A 1 40 ? 7.710   5.726   -4.191  1.00 0.33 ? 40 VAL A CA   5  
ATOM 9316  C C    . VAL A 1 40 ? 8.049   6.120   -5.629  1.00 0.33 ? 40 VAL A C    5  
ATOM 9317  O O    . VAL A 1 40 ? 7.430   6.991   -6.205  1.00 0.33 ? 40 VAL A O    5  
ATOM 9318  C CB   . VAL A 1 40 ? 6.215   5.416   -4.089  1.00 0.33 ? 40 VAL A CB   5  
ATOM 9319  C CG1  . VAL A 1 40 ? 5.815   4.458   -5.211  1.00 0.33 ? 40 VAL A CG1  5  
ATOM 9320  C CG2  . VAL A 1 40 ? 5.921   4.766   -2.735  1.00 0.33 ? 40 VAL A CG2  5  
ATOM 9321  H H    . VAL A 1 40 ? 7.782   7.766   -3.507  1.00 0.33 ? 40 VAL A H    5  
ATOM 9322  H HA   . VAL A 1 40 ? 8.279   4.851   -3.912  1.00 0.33 ? 40 VAL A HA   5  
ATOM 9323  H HB   . VAL A 1 40 ? 5.652   6.333   -4.180  1.00 0.33 ? 40 VAL A HB   5  
ATOM 9324  H HG11 . VAL A 1 40 ? 6.697   3.973   -5.604  1.00 0.33 ? 40 VAL A HG11 5  
ATOM 9325  H HG12 . VAL A 1 40 ? 5.137   3.712   -4.823  1.00 0.33 ? 40 VAL A HG12 5  
ATOM 9326  H HG13 . VAL A 1 40 ? 5.327   5.012   -6.001  1.00 0.33 ? 40 VAL A HG13 5  
ATOM 9327  H HG21 . VAL A 1 40 ? 6.792   4.224   -2.399  1.00 0.33 ? 40 VAL A HG21 5  
ATOM 9328  H HG22 . VAL A 1 40 ? 5.674   5.532   -2.014  1.00 0.33 ? 40 VAL A HG22 5  
ATOM 9329  H HG23 . VAL A 1 40 ? 5.089   4.085   -2.836  1.00 0.33 ? 40 VAL A HG23 5  
ATOM 9330  N N    . PHE A 1 41 ? 9.030   5.486   -6.212  1.00 0.37 ? 41 PHE A N    5  
ATOM 9331  C CA   . PHE A 1 41 ? 9.407   5.828   -7.613  1.00 0.37 ? 41 PHE A CA   5  
ATOM 9332  C C    . PHE A 1 41 ? 8.650   4.917   -8.582  1.00 0.37 ? 41 PHE A C    5  
ATOM 9333  O O    . PHE A 1 41 ? 8.994   3.766   -8.763  1.00 0.37 ? 41 PHE A O    5  
ATOM 9334  C CB   . PHE A 1 41 ? 10.913  5.631   -7.798  1.00 0.37 ? 41 PHE A CB   5  
ATOM 9335  C CG   . PHE A 1 41 ? 11.650  6.817   -7.223  1.00 0.37 ? 41 PHE A CG   5  
ATOM 9336  C CD1  . PHE A 1 41 ? 11.518  8.078   -7.817  1.00 0.37 ? 41 PHE A CD1  5  
ATOM 9337  C CD2  . PHE A 1 41 ? 12.466  6.656   -6.096  1.00 0.37 ? 41 PHE A CD2  5  
ATOM 9338  C CE1  . PHE A 1 41 ? 12.201  9.178   -7.284  1.00 0.37 ? 41 PHE A CE1  5  
ATOM 9339  C CE2  . PHE A 1 41 ? 13.148  7.755   -5.564  1.00 0.37 ? 41 PHE A CE2  5  
ATOM 9340  C CZ   . PHE A 1 41 ? 13.016  9.016   -6.157  1.00 0.37 ? 41 PHE A CZ   5  
ATOM 9341  H H    . PHE A 1 41 ? 9.517   4.786   -5.730  1.00 0.37 ? 41 PHE A H    5  
ATOM 9342  H HA   . PHE A 1 41 ? 9.151   6.858   -7.813  1.00 0.37 ? 41 PHE A HA   5  
ATOM 9343  H HB2  . PHE A 1 41 ? 11.224  4.731   -7.287  1.00 0.37 ? 41 PHE A HB2  5  
ATOM 9344  H HB3  . PHE A 1 41 ? 11.139  5.544   -8.850  1.00 0.37 ? 41 PHE A HB3  5  
ATOM 9345  H HD1  . PHE A 1 41 ? 10.889  8.202   -8.686  1.00 0.37 ? 41 PHE A HD1  5  
ATOM 9346  H HD2  . PHE A 1 41 ? 12.567  5.683   -5.638  1.00 0.37 ? 41 PHE A HD2  5  
ATOM 9347  H HE1  . PHE A 1 41 ? 12.100  10.150  -7.742  1.00 0.37 ? 41 PHE A HE1  5  
ATOM 9348  H HE2  . PHE A 1 41 ? 13.778  7.631   -4.695  1.00 0.37 ? 41 PHE A HE2  5  
ATOM 9349  H HZ   . PHE A 1 41 ? 13.544  9.865   -5.746  1.00 0.37 ? 41 PHE A HZ   5  
ATOM 9350  N N    . VAL A 1 42 ? 7.624   5.424   -9.207  1.00 0.46 ? 42 VAL A N    5  
ATOM 9351  C CA   . VAL A 1 42 ? 6.847   4.587   -10.165 1.00 0.46 ? 42 VAL A CA   5  
ATOM 9352  C C    . VAL A 1 42 ? 7.446   4.727   -11.566 1.00 0.46 ? 42 VAL A C    5  
ATOM 9353  O O    . VAL A 1 42 ? 7.514   5.808   -12.118 1.00 0.46 ? 42 VAL A O    5  
ATOM 9354  C CB   . VAL A 1 42 ? 5.389   5.053   -10.185 1.00 0.46 ? 42 VAL A CB   5  
ATOM 9355  C CG1  . VAL A 1 42 ? 4.539   4.036   -10.946 1.00 0.46 ? 42 VAL A CG1  5  
ATOM 9356  C CG2  . VAL A 1 42 ? 4.875   5.174   -8.748  1.00 0.46 ? 42 VAL A CG2  5  
ATOM 9357  H H    . VAL A 1 42 ? 7.363   6.354   -9.048  1.00 0.46 ? 42 VAL A H    5  
ATOM 9358  H HA   . VAL A 1 42 ? 6.890   3.553   -9.857  1.00 0.46 ? 42 VAL A HA   5  
ATOM 9359  H HB   . VAL A 1 42 ? 5.325   6.014   -10.675 1.00 0.46 ? 42 VAL A HB   5  
ATOM 9360  H HG11 . VAL A 1 42 ? 4.997   3.060   -10.877 1.00 0.46 ? 42 VAL A HG11 5  
ATOM 9361  H HG12 . VAL A 1 42 ? 3.548   4.000   -10.515 1.00 0.46 ? 42 VAL A HG12 5  
ATOM 9362  H HG13 . VAL A 1 42 ? 4.469   4.328   -11.983 1.00 0.46 ? 42 VAL A HG13 5  
ATOM 9363  H HG21 . VAL A 1 42 ? 5.625   4.803   -8.065  1.00 0.46 ? 42 VAL A HG21 5  
ATOM 9364  H HG22 . VAL A 1 42 ? 4.666   6.210   -8.528  1.00 0.46 ? 42 VAL A HG22 5  
ATOM 9365  H HG23 . VAL A 1 42 ? 3.971   4.593   -8.640  1.00 0.46 ? 42 VAL A HG23 5  
ATOM 9366  N N    . THR A 1 43 ? 7.882   3.643   -12.145 1.00 0.54 ? 43 THR A N    5  
ATOM 9367  C CA   . THR A 1 43 ? 8.478   3.713   -13.509 1.00 0.54 ? 43 THR A CA   5  
ATOM 9368  C C    . THR A 1 43 ? 7.379   3.526   -14.557 1.00 0.54 ? 43 THR A C    5  
ATOM 9369  O O    . THR A 1 43 ? 6.215   3.404   -14.234 1.00 0.54 ? 43 THR A O    5  
ATOM 9370  C CB   . THR A 1 43 ? 9.526   2.609   -13.665 1.00 0.54 ? 43 THR A CB   5  
ATOM 9371  O OG1  . THR A 1 43 ? 8.873   1.370   -13.905 1.00 0.54 ? 43 THR A OG1  5  
ATOM 9372  C CG2  . THR A 1 43 ? 10.362  2.510   -12.388 1.00 0.54 ? 43 THR A CG2  5  
ATOM 9373  H H    . THR A 1 43 ? 7.819   2.780   -11.683 1.00 0.54 ? 43 THR A H    5  
ATOM 9374  H HA   . THR A 1 43 ? 8.948   4.676   -13.648 1.00 0.54 ? 43 THR A HA   5  
ATOM 9375  H HB   . THR A 1 43 ? 10.174  2.841   -14.496 1.00 0.54 ? 43 THR A HB   5  
ATOM 9376  H HG1  . THR A 1 43 ? 9.489   0.665   -13.694 1.00 0.54 ? 43 THR A HG1  5  
ATOM 9377  H HG21 . THR A 1 43 ? 10.200  3.390   -11.784 1.00 0.54 ? 43 THR A HG21 5  
ATOM 9378  H HG22 . THR A 1 43 ? 10.066  1.632   -11.832 1.00 0.54 ? 43 THR A HG22 5  
ATOM 9379  H HG23 . THR A 1 43 ? 11.407  2.437   -12.647 1.00 0.54 ? 43 THR A HG23 5  
ATOM 9380  N N    . ARG A 1 44 ? 7.741   3.502   -15.811 1.00 0.69 ? 44 ARG A N    5  
ATOM 9381  C CA   . ARG A 1 44 ? 6.716   3.324   -16.878 1.00 0.69 ? 44 ARG A CA   5  
ATOM 9382  C C    . ARG A 1 44 ? 6.221   1.876   -16.873 1.00 0.69 ? 44 ARG A C    5  
ATOM 9383  O O    . ARG A 1 44 ? 5.235   1.545   -17.501 1.00 0.69 ? 44 ARG A O    5  
ATOM 9384  C CB   . ARG A 1 44 ? 7.337   3.645   -18.239 1.00 0.69 ? 44 ARG A CB   5  
ATOM 9385  C CG   . ARG A 1 44 ? 7.920   5.060   -18.214 1.00 0.69 ? 44 ARG A CG   5  
ATOM 9386  C CD   . ARG A 1 44 ? 8.356   5.458   -19.625 1.00 0.69 ? 44 ARG A CD   5  
ATOM 9387  N NE   . ARG A 1 44 ? 9.177   4.364   -20.218 1.00 0.69 ? 44 ARG A NE   5  
ATOM 9388  C CZ   . ARG A 1 44 ? 8.601   3.419   -20.910 1.00 0.69 ? 44 ARG A CZ   5  
ATOM 9389  N NH1  . ARG A 1 44 ? 7.663   3.717   -21.767 1.00 0.69 ? 44 ARG A NH1  5  
ATOM 9390  N NH2  . ARG A 1 44 ? 8.965   2.177   -20.747 1.00 0.69 ? 44 ARG A NH2  5  
ATOM 9391  H H    . ARG A 1 44 ? 8.685   3.603   -16.051 1.00 0.69 ? 44 ARG A H    5  
ATOM 9392  H HA   . ARG A 1 44 ? 5.886   3.988   -16.695 1.00 0.69 ? 44 ARG A HA   5  
ATOM 9393  H HB2  . ARG A 1 44 ? 8.122   2.934   -18.454 1.00 0.69 ? 44 ARG A HB2  5  
ATOM 9394  H HB3  . ARG A 1 44 ? 6.577   3.585   -19.005 1.00 0.69 ? 44 ARG A HB3  5  
ATOM 9395  H HG2  . ARG A 1 44 ? 7.170   5.751   -17.859 1.00 0.69 ? 44 ARG A HG2  5  
ATOM 9396  H HG3  . ARG A 1 44 ? 8.774   5.085   -17.554 1.00 0.69 ? 44 ARG A HG3  5  
ATOM 9397  H HD2  . ARG A 1 44 ? 7.483   5.626   -20.237 1.00 0.69 ? 44 ARG A HD2  5  
ATOM 9398  H HD3  . ARG A 1 44 ? 8.944   6.362   -19.578 1.00 0.69 ? 44 ARG A HD3  5  
ATOM 9399  H HE   . ARG A 1 44 ? 10.148  4.355   -20.089 1.00 0.69 ? 44 ARG A HE   5  
ATOM 9400  H HH11 . ARG A 1 44 ? 7.384   4.669   -21.892 1.00 0.69 ? 44 ARG A HH11 5  
ATOM 9401  H HH12 . ARG A 1 44 ? 7.221   2.992   -22.297 1.00 0.69 ? 44 ARG A HH12 5  
ATOM 9402  H HH21 . ARG A 1 44 ? 9.684   1.948   -20.090 1.00 0.69 ? 44 ARG A HH21 5  
ATOM 9403  H HH22 . ARG A 1 44 ? 8.523   1.452   -21.276 1.00 0.69 ? 44 ARG A HH22 5  
ATOM 9404  N N    . LYS A 1 45 ? 6.898   1.010   -16.168 1.00 0.66 ? 45 LYS A N    5  
ATOM 9405  C CA   . LYS A 1 45 ? 6.465   -0.415  -16.125 1.00 0.66 ? 45 LYS A CA   5  
ATOM 9406  C C    . LYS A 1 45 ? 5.544   -0.631  -14.922 1.00 0.66 ? 45 LYS A C    5  
ATOM 9407  O O    . LYS A 1 45 ? 5.321   -1.745  -14.491 1.00 0.66 ? 45 LYS A O    5  
ATOM 9408  C CB   . LYS A 1 45 ? 7.693   -1.318  -15.995 1.00 0.66 ? 45 LYS A CB   5  
ATOM 9409  C CG   . LYS A 1 45 ? 8.595   -1.131  -17.217 1.00 0.66 ? 45 LYS A CG   5  
ATOM 9410  C CD   . LYS A 1 45 ? 7.836   -1.543  -18.480 1.00 0.66 ? 45 LYS A CD   5  
ATOM 9411  C CE   . LYS A 1 45 ? 8.834   -1.911  -19.578 1.00 0.66 ? 45 LYS A CE   5  
ATOM 9412  N NZ   . LYS A 1 45 ? 8.393   -3.166  -20.251 1.00 0.66 ? 45 LYS A NZ   5  
ATOM 9413  H H    . LYS A 1 45 ? 7.690   1.298   -15.669 1.00 0.66 ? 45 LYS A H    5  
ATOM 9414  H HA   . LYS A 1 45 ? 5.933   -0.658  -17.032 1.00 0.66 ? 45 LYS A HA   5  
ATOM 9415  H HB2  . LYS A 1 45 ? 8.240   -1.055  -15.101 1.00 0.66 ? 45 LYS A HB2  5  
ATOM 9416  H HB3  . LYS A 1 45 ? 7.378   -2.348  -15.936 1.00 0.66 ? 45 LYS A HB3  5  
ATOM 9417  H HG2  . LYS A 1 45 ? 8.887   -0.094  -17.293 1.00 0.66 ? 45 LYS A HG2  5  
ATOM 9418  H HG3  . LYS A 1 45 ? 9.476   -1.746  -17.113 1.00 0.66 ? 45 LYS A HG3  5  
ATOM 9419  H HD2  . LYS A 1 45 ? 7.210   -2.395  -18.260 1.00 0.66 ? 45 LYS A HD2  5  
ATOM 9420  H HD3  . LYS A 1 45 ? 7.222   -0.721  -18.815 1.00 0.66 ? 45 LYS A HD3  5  
ATOM 9421  H HE2  . LYS A 1 45 ? 8.882   -1.113  -20.304 1.00 0.66 ? 45 LYS A HE2  5  
ATOM 9422  H HE3  . LYS A 1 45 ? 9.811   -2.061  -19.143 1.00 0.66 ? 45 LYS A HE3  5  
ATOM 9423  H HZ1  . LYS A 1 45 ? 7.355   -3.212  -20.253 1.00 0.66 ? 45 LYS A HZ1  5  
ATOM 9424  H HZ2  . LYS A 1 45 ? 8.740   -3.177  -21.230 1.00 0.66 ? 45 LYS A HZ2  5  
ATOM 9425  H HZ3  . LYS A 1 45 ? 8.776   -3.987  -19.737 1.00 0.66 ? 45 LYS A HZ3  5  
ATOM 9426  N N    . ASN A 1 46 ? 5.007   0.426   -14.376 1.00 0.61 ? 46 ASN A N    5  
ATOM 9427  C CA   . ASN A 1 46 ? 4.102   0.279   -13.202 1.00 0.61 ? 46 ASN A CA   5  
ATOM 9428  C C    . ASN A 1 46 ? 4.888   -0.292  -12.020 1.00 0.61 ? 46 ASN A C    5  
ATOM 9429  O O    . ASN A 1 46 ? 4.338   -0.936  -11.148 1.00 0.61 ? 46 ASN A O    5  
ATOM 9430  C CB   . ASN A 1 46 ? 2.955   -0.668  -13.558 1.00 0.61 ? 46 ASN A CB   5  
ATOM 9431  C CG   . ASN A 1 46 ? 1.711   -0.291  -12.750 1.00 0.61 ? 46 ASN A CG   5  
ATOM 9432  O OD1  . ASN A 1 46 ? 1.130   0.755   -12.960 1.00 0.61 ? 46 ASN A OD1  5  
ATOM 9433  N ND2  . ASN A 1 46 ? 1.276   -1.105  -11.828 1.00 0.61 ? 46 ASN A ND2  5  
ATOM 9434  H H    . ASN A 1 46 ? 5.200   1.316   -14.738 1.00 0.61 ? 46 ASN A H    5  
ATOM 9435  H HA   . ASN A 1 46 ? 3.701   1.246   -12.933 1.00 0.61 ? 46 ASN A HA   5  
ATOM 9436  H HB2  . ASN A 1 46 ? 2.737   -0.590  -14.612 1.00 0.61 ? 46 ASN A HB2  5  
ATOM 9437  H HB3  . ASN A 1 46 ? 3.240   -1.682  -13.323 1.00 0.61 ? 46 ASN A HB3  5  
ATOM 9438  H HD21 . ASN A 1 46 ? 1.744   -1.949  -11.658 1.00 0.61 ? 46 ASN A HD21 5  
ATOM 9439  H HD22 . ASN A 1 46 ? 0.480   -0.873  -11.305 1.00 0.61 ? 46 ASN A HD22 5  
ATOM 9440  N N    . ARG A 1 47 ? 6.173   -0.063  -11.984 1.00 0.52 ? 47 ARG A N    5  
ATOM 9441  C CA   . ARG A 1 47 ? 6.992   -0.594  -10.858 1.00 0.52 ? 47 ARG A CA   5  
ATOM 9442  C C    . ARG A 1 47 ? 7.034   0.437   -9.728  1.00 0.52 ? 47 ARG A C    5  
ATOM 9443  O O    . ARG A 1 47 ? 7.516   1.539   -9.898  1.00 0.52 ? 47 ARG A O    5  
ATOM 9444  C CB   . ARG A 1 47 ? 8.415   -0.871  -11.349 1.00 0.52 ? 47 ARG A CB   5  
ATOM 9445  C CG   . ARG A 1 47 ? 8.518   -2.321  -11.826 1.00 0.52 ? 47 ARG A CG   5  
ATOM 9446  C CD   . ARG A 1 47 ? 8.764   -3.237  -10.626 1.00 0.52 ? 47 ARG A CD   5  
ATOM 9447  N NE   . ARG A 1 47 ? 10.166  -3.739  -10.663 1.00 0.52 ? 47 ARG A NE   5  
ATOM 9448  C CZ   . ARG A 1 47 ? 10.769  -4.076  -9.556  1.00 0.52 ? 47 ARG A CZ   5  
ATOM 9449  N NH1  . ARG A 1 47 ? 10.830  -3.231  -8.563  1.00 0.52 ? 47 ARG A NH1  5  
ATOM 9450  N NH2  . ARG A 1 47 ? 11.312  -5.258  -9.442  1.00 0.52 ? 47 ARG A NH2  5  
ATOM 9451  H H    . ARG A 1 47 ? 6.598   0.458   -12.697 1.00 0.52 ? 47 ARG A H    5  
ATOM 9452  H HA   . ARG A 1 47 ? 6.552   -1.511  -10.493 1.00 0.52 ? 47 ARG A HA   5  
ATOM 9453  H HB2  . ARG A 1 47 ? 8.649   -0.205  -12.167 1.00 0.52 ? 47 ARG A HB2  5  
ATOM 9454  H HB3  . ARG A 1 47 ? 9.112   -0.709  -10.541 1.00 0.52 ? 47 ARG A HB3  5  
ATOM 9455  H HG2  . ARG A 1 47 ? 7.597   -2.606  -12.314 1.00 0.52 ? 47 ARG A HG2  5  
ATOM 9456  H HG3  . ARG A 1 47 ? 9.338   -2.414  -12.521 1.00 0.52 ? 47 ARG A HG3  5  
ATOM 9457  H HD2  . ARG A 1 47 ? 8.604   -2.684  -9.712  1.00 0.52 ? 47 ARG A HD2  5  
ATOM 9458  H HD3  . ARG A 1 47 ? 8.082   -4.073  -10.664 1.00 0.52 ? 47 ARG A HD3  5  
ATOM 9459  H HE   . ARG A 1 47 ? 10.636  -3.817  -11.520 1.00 0.52 ? 47 ARG A HE   5  
ATOM 9460  H HH11 . ARG A 1 47 ? 10.414  -2.326  -8.651  1.00 0.52 ? 47 ARG A HH11 5  
ATOM 9461  H HH12 . ARG A 1 47 ? 11.292  -3.489  -7.714  1.00 0.52 ? 47 ARG A HH12 5  
ATOM 9462  H HH21 . ARG A 1 47 ? 11.265  -5.904  -10.202 1.00 0.52 ? 47 ARG A HH21 5  
ATOM 9463  H HH22 . ARG A 1 47 ? 11.774  -5.516  -8.593  1.00 0.52 ? 47 ARG A HH22 5  
ATOM 9464  N N    . GLN A 1 48 ? 6.530   0.088   -8.576  1.00 0.45 ? 48 GLN A N    5  
ATOM 9465  C CA   . GLN A 1 48 ? 6.541   1.049   -7.438  1.00 0.45 ? 48 GLN A CA   5  
ATOM 9466  C C    . GLN A 1 48 ? 7.714   0.728   -6.510  1.00 0.45 ? 48 GLN A C    5  
ATOM 9467  O O    . GLN A 1 48 ? 7.624   -0.131  -5.654  1.00 0.45 ? 48 GLN A O    5  
ATOM 9468  C CB   . GLN A 1 48 ? 5.228   0.933   -6.660  1.00 0.45 ? 48 GLN A CB   5  
ATOM 9469  C CG   . GLN A 1 48 ? 4.088   0.605   -7.627  1.00 0.45 ? 48 GLN A CG   5  
ATOM 9470  C CD   . GLN A 1 48 ? 3.792   1.827   -8.499  1.00 0.45 ? 48 GLN A CD   5  
ATOM 9471  O OE1  . GLN A 1 48 ? 4.679   2.596   -8.809  1.00 0.45 ? 48 GLN A OE1  5  
ATOM 9472  N NE2  . GLN A 1 48 ? 2.571   2.039   -8.911  1.00 0.45 ? 48 GLN A NE2  5  
ATOM 9473  H H    . GLN A 1 48 ? 6.145   -0.805  -8.460  1.00 0.45 ? 48 GLN A H    5  
ATOM 9474  H HA   . GLN A 1 48 ? 6.646   2.055   -7.817  1.00 0.45 ? 48 GLN A HA   5  
ATOM 9475  H HB2  . GLN A 1 48 ? 5.314   0.145   -5.925  1.00 0.45 ? 48 GLN A HB2  5  
ATOM 9476  H HB3  . GLN A 1 48 ? 5.019   1.868   -6.164  1.00 0.45 ? 48 GLN A HB3  5  
ATOM 9477  H HG2  . GLN A 1 48 ? 4.375   -0.225  -8.254  1.00 0.45 ? 48 GLN A HG2  5  
ATOM 9478  H HG3  . GLN A 1 48 ? 3.203   0.344   -7.065  1.00 0.45 ? 48 GLN A HG3  5  
ATOM 9479  H HE21 . GLN A 1 48 ? 1.855   1.418   -8.661  1.00 0.45 ? 48 GLN A HE21 5  
ATOM 9480  H HE22 . GLN A 1 48 ? 2.372   2.818   -9.470  1.00 0.45 ? 48 GLN A HE22 5  
ATOM 9481  N N    . VAL A 1 49 ? 8.814   1.412   -6.671  1.00 0.37 ? 49 VAL A N    5  
ATOM 9482  C CA   . VAL A 1 49 ? 9.990   1.144   -5.796  1.00 0.37 ? 49 VAL A CA   5  
ATOM 9483  C C    . VAL A 1 49 ? 9.923   2.044   -4.561  1.00 0.37 ? 49 VAL A C    5  
ATOM 9484  O O    . VAL A 1 49 ? 9.158   2.988   -4.509  1.00 0.37 ? 49 VAL A O    5  
ATOM 9485  C CB   . VAL A 1 49 ? 11.277  1.437   -6.570  1.00 0.37 ? 49 VAL A CB   5  
ATOM 9486  C CG1  . VAL A 1 49 ? 12.482  1.244   -5.649  1.00 0.37 ? 49 VAL A CG1  5  
ATOM 9487  C CG2  . VAL A 1 49 ? 11.386  0.477   -7.758  1.00 0.37 ? 49 VAL A CG2  5  
ATOM 9488  H H    . VAL A 1 49 ? 8.865   2.100   -7.366  1.00 0.37 ? 49 VAL A H    5  
ATOM 9489  H HA   . VAL A 1 49 ? 9.983   0.110   -5.488  1.00 0.37 ? 49 VAL A HA   5  
ATOM 9490  H HB   . VAL A 1 49 ? 11.257  2.456   -6.929  1.00 0.37 ? 49 VAL A HB   5  
ATOM 9491  H HG11 . VAL A 1 49 ? 12.348  0.348   -5.062  1.00 0.37 ? 49 VAL A HG11 5  
ATOM 9492  H HG12 . VAL A 1 49 ? 13.380  1.155   -6.243  1.00 0.37 ? 49 VAL A HG12 5  
ATOM 9493  H HG13 . VAL A 1 49 ? 12.571  2.095   -4.989  1.00 0.37 ? 49 VAL A HG13 5  
ATOM 9494  H HG21 . VAL A 1 49 ? 10.835  -0.426  -7.542  1.00 0.37 ? 49 VAL A HG21 5  
ATOM 9495  H HG22 . VAL A 1 49 ? 10.976  0.947   -8.640  1.00 0.37 ? 49 VAL A HG22 5  
ATOM 9496  H HG23 . VAL A 1 49 ? 12.423  0.234   -7.930  1.00 0.37 ? 49 VAL A HG23 5  
ATOM 9497  N N    . CYS A 1 50 ? 10.716  1.761   -3.565  1.00 0.29 ? 50 CYS A N    5  
ATOM 9498  C CA   . CYS A 1 50 ? 10.696  2.600   -2.334  1.00 0.29 ? 50 CYS A CA   5  
ATOM 9499  C C    . CYS A 1 50 ? 12.043  3.305   -2.172  1.00 0.29 ? 50 CYS A C    5  
ATOM 9500  O O    . CYS A 1 50 ? 13.088  2.725   -2.392  1.00 0.29 ? 50 CYS A O    5  
ATOM 9501  C CB   . CYS A 1 50 ? 10.436  1.713   -1.115  1.00 0.29 ? 50 CYS A CB   5  
ATOM 9502  S SG   . CYS A 1 50 ? 8.941   0.730   -1.393  1.00 0.29 ? 50 CYS A SG   5  
ATOM 9503  H H    . CYS A 1 50 ? 11.325  0.995   -3.626  1.00 0.29 ? 50 CYS A H    5  
ATOM 9504  H HA   . CYS A 1 50 ? 9.911   3.338   -2.415  1.00 0.29 ? 50 CYS A HA   5  
ATOM 9505  H HB2  . CYS A 1 50 ? 11.278  1.053   -0.964  1.00 0.29 ? 50 CYS A HB2  5  
ATOM 9506  H HB3  . CYS A 1 50 ? 10.303  2.332   -0.241  1.00 0.29 ? 50 CYS A HB3  5  
ATOM 9507  N N    . ALA A 1 51 ? 12.028  4.552   -1.789  1.00 0.23 ? 51 ALA A N    5  
ATOM 9508  C CA   . ALA A 1 51 ? 13.309  5.293   -1.612  1.00 0.23 ? 51 ALA A CA   5  
ATOM 9509  C C    . ALA A 1 51 ? 13.201  6.214   -0.395  1.00 0.23 ? 51 ALA A C    5  
ATOM 9510  O O    . ALA A 1 51 ? 12.204  6.878   -0.195  1.00 0.23 ? 51 ALA A O    5  
ATOM 9511  C CB   . ALA A 1 51 ? 13.591  6.129   -2.861  1.00 0.23 ? 51 ALA A CB   5  
ATOM 9512  H H    . ALA A 1 51 ? 11.174  5.002   -1.616  1.00 0.23 ? 51 ALA A H    5  
ATOM 9513  H HA   . ALA A 1 51 ? 14.115  4.590   -1.461  1.00 0.23 ? 51 ALA A HA   5  
ATOM 9514  H HB1  . ALA A 1 51 ? 13.280  5.582   -3.739  1.00 0.23 ? 51 ALA A HB1  5  
ATOM 9515  H HB2  . ALA A 1 51 ? 13.043  7.059   -2.804  1.00 0.23 ? 51 ALA A HB2  5  
ATOM 9516  H HB3  . ALA A 1 51 ? 14.649  6.338   -2.924  1.00 0.23 ? 51 ALA A HB3  5  
ATOM 9517  N N    . ASN A 1 52 ? 14.218  6.260   0.420   1.00 0.26 ? 52 ASN A N    5  
ATOM 9518  C CA   . ASN A 1 52 ? 14.169  7.139   1.622   1.00 0.26 ? 52 ASN A CA   5  
ATOM 9519  C C    . ASN A 1 52 ? 14.738  8.517   1.269   1.00 0.26 ? 52 ASN A C    5  
ATOM 9520  O O    . ASN A 1 52 ? 15.657  8.622   0.481   1.00 0.26 ? 52 ASN A O    5  
ATOM 9521  C CB   . ASN A 1 52 ? 15.001  6.516   2.744   1.00 0.26 ? 52 ASN A CB   5  
ATOM 9522  C CG   . ASN A 1 52 ? 14.301  6.741   4.085   1.00 0.26 ? 52 ASN A CG   5  
ATOM 9523  O OD1  . ASN A 1 52 ? 13.089  6.711   4.164   1.00 0.26 ? 52 ASN A OD1  5  
ATOM 9524  N ND2  . ASN A 1 52 ? 15.018  6.967   5.152   1.00 0.26 ? 52 ASN A ND2  5  
ATOM 9525  H H    . ASN A 1 52 ? 15.014  5.717   0.241   1.00 0.26 ? 52 ASN A H    5  
ATOM 9526  H HA   . ASN A 1 52 ? 13.145  7.243   1.947   1.00 0.26 ? 52 ASN A HA   5  
ATOM 9527  H HB2  . ASN A 1 52 ? 15.108  5.455   2.567   1.00 0.26 ? 52 ASN A HB2  5  
ATOM 9528  H HB3  . ASN A 1 52 ? 15.977  6.976   2.768   1.00 0.26 ? 52 ASN A HB3  5  
ATOM 9529  H HD21 . ASN A 1 52 ? 15.995  6.991   5.089   1.00 0.26 ? 52 ASN A HD21 5  
ATOM 9530  H HD22 . ASN A 1 52 ? 14.577  7.113   6.016   1.00 0.26 ? 52 ASN A HD22 5  
ATOM 9531  N N    . PRO A 1 53 ? 14.172  9.536   1.865   1.00 0.30 ? 53 PRO A N    5  
ATOM 9532  C CA   . PRO A 1 53 ? 14.600  10.927  1.636   1.00 0.30 ? 53 PRO A CA   5  
ATOM 9533  C C    . PRO A 1 53 ? 15.878  11.229  2.423   1.00 0.30 ? 53 PRO A C    5  
ATOM 9534  O O    . PRO A 1 53 ? 16.357  12.345  2.443   1.00 0.30 ? 53 PRO A O    5  
ATOM 9535  C CB   . PRO A 1 53 ? 13.424  11.755  2.164   1.00 0.30 ? 53 PRO A CB   5  
ATOM 9536  C CG   . PRO A 1 53 ? 12.664  10.847  3.161   1.00 0.30 ? 53 PRO A CG   5  
ATOM 9537  C CD   . PRO A 1 53 ? 13.055  9.396   2.822   1.00 0.30 ? 53 PRO A CD   5  
ATOM 9538  H HA   . PRO A 1 53 ? 14.743  11.115  0.585   1.00 0.30 ? 53 PRO A HA   5  
ATOM 9539  H HB2  . PRO A 1 53 ? 13.792  12.639  2.667   1.00 0.30 ? 53 PRO A HB2  5  
ATOM 9540  H HB3  . PRO A 1 53 ? 12.770  12.032  1.352   1.00 0.30 ? 53 PRO A HB3  5  
ATOM 9541  H HG2  . PRO A 1 53 ? 12.956  11.086  4.173   1.00 0.30 ? 53 PRO A HG2  5  
ATOM 9542  H HG3  . PRO A 1 53 ? 11.600  10.976  3.040   1.00 0.30 ? 53 PRO A HG3  5  
ATOM 9543  H HD2  . PRO A 1 53 ? 13.378  8.876   3.713   1.00 0.30 ? 53 PRO A HD2  5  
ATOM 9544  H HD3  . PRO A 1 53 ? 12.229  8.880   2.357   1.00 0.30 ? 53 PRO A HD3  5  
ATOM 9545  N N    . GLU A 1 54 ? 16.436  10.241  3.069   1.00 0.43 ? 54 GLU A N    5  
ATOM 9546  C CA   . GLU A 1 54 ? 17.682  10.473  3.853   1.00 0.43 ? 54 GLU A CA   5  
ATOM 9547  C C    . GLU A 1 54 ? 18.898  10.102  2.999   1.00 0.43 ? 54 GLU A C    5  
ATOM 9548  O O    . GLU A 1 54 ? 20.014  10.060  3.477   1.00 0.43 ? 54 GLU A O    5  
ATOM 9549  C CB   . GLU A 1 54 ? 17.660  9.606   5.114   1.00 0.43 ? 54 GLU A CB   5  
ATOM 9550  C CG   . GLU A 1 54 ? 16.926  10.348  6.231   1.00 0.43 ? 54 GLU A CG   5  
ATOM 9551  C CD   . GLU A 1 54 ? 16.990  9.526   7.519   1.00 0.43 ? 54 GLU A CD   5  
ATOM 9552  O OE1  . GLU A 1 54 ? 17.511  8.424   7.469   1.00 0.43 ? 54 GLU A OE1  5  
ATOM 9553  O OE2  . GLU A 1 54 ? 16.517  10.011  8.533   1.00 0.43 ? 54 GLU A OE2  5  
ATOM 9554  H H    . GLU A 1 54 ? 16.034  9.348   3.040   1.00 0.43 ? 54 GLU A H    5  
ATOM 9555  H HA   . GLU A 1 54 ? 17.744  11.514  4.132   1.00 0.43 ? 54 GLU A HA   5  
ATOM 9556  H HB2  . GLU A 1 54 ? 17.152  8.676   4.902   1.00 0.43 ? 54 GLU A HB2  5  
ATOM 9557  H HB3  . GLU A 1 54 ? 18.673  9.399   5.427   1.00 0.43 ? 54 GLU A HB3  5  
ATOM 9558  H HG2  . GLU A 1 54 ? 17.392  11.308  6.392   1.00 0.43 ? 54 GLU A HG2  5  
ATOM 9559  H HG3  . GLU A 1 54 ? 15.893  10.492  5.950   1.00 0.43 ? 54 GLU A HG3  5  
ATOM 9560  N N    . LYS A 1 55 ? 18.690  9.831   1.740   1.00 0.47 ? 55 LYS A N    5  
ATOM 9561  C CA   . LYS A 1 55 ? 19.833  9.463   0.857   1.00 0.47 ? 55 LYS A CA   5  
ATOM 9562  C C    . LYS A 1 55 ? 20.363  10.717  0.159   1.00 0.47 ? 55 LYS A C    5  
ATOM 9563  O O    . LYS A 1 55 ? 19.933  11.820  0.434   1.00 0.47 ? 55 LYS A O    5  
ATOM 9564  C CB   . LYS A 1 55 ? 19.363  8.454   -0.193  1.00 0.47 ? 55 LYS A CB   5  
ATOM 9565  C CG   . LYS A 1 55 ? 19.758  7.041   0.243   1.00 0.47 ? 55 LYS A CG   5  
ATOM 9566  C CD   . LYS A 1 55 ? 21.243  6.813   -0.048  1.00 0.47 ? 55 LYS A CD   5  
ATOM 9567  C CE   . LYS A 1 55 ? 21.537  5.312   -0.056  1.00 0.47 ? 55 LYS A CE   5  
ATOM 9568  N NZ   . LYS A 1 55 ? 22.265  4.942   1.192   1.00 0.47 ? 55 LYS A NZ   5  
ATOM 9569  H H    . LYS A 1 55 ? 17.782  9.869   1.373   1.00 0.47 ? 55 LYS A H    5  
ATOM 9570  H HA   . LYS A 1 55 ? 20.620  9.022   1.452   1.00 0.47 ? 55 LYS A HA   5  
ATOM 9571  H HB2  . LYS A 1 55 ? 18.289  8.514   -0.293  1.00 0.47 ? 55 LYS A HB2  5  
ATOM 9572  H HB3  . LYS A 1 55 ? 19.827  8.679   -1.141  1.00 0.47 ? 55 LYS A HB3  5  
ATOM 9573  H HG2  . LYS A 1 55 ? 19.575  6.927   1.302   1.00 0.47 ? 55 LYS A HG2  5  
ATOM 9574  H HG3  . LYS A 1 55 ? 19.171  6.319   -0.305  1.00 0.47 ? 55 LYS A HG3  5  
ATOM 9575  H HD2  . LYS A 1 55 ? 21.490  7.234   -1.012  1.00 0.47 ? 55 LYS A HD2  5  
ATOM 9576  H HD3  . LYS A 1 55 ? 21.837  7.291   0.717   1.00 0.47 ? 55 LYS A HD3  5  
ATOM 9577  H HE2  . LYS A 1 55 ? 20.608  4.764   -0.106  1.00 0.47 ? 55 LYS A HE2  5  
ATOM 9578  H HE3  . LYS A 1 55 ? 22.146  5.069   -0.913  1.00 0.47 ? 55 LYS A HE3  5  
ATOM 9579  H HZ1  . LYS A 1 55 ? 22.028  5.618   1.945   1.00 0.47 ? 55 LYS A HZ1  5  
ATOM 9580  H HZ2  . LYS A 1 55 ? 21.984  3.987   1.487   1.00 0.47 ? 55 LYS A HZ2  5  
ATOM 9581  H HZ3  . LYS A 1 55 ? 23.290  4.964   1.014   1.00 0.47 ? 55 LYS A HZ3  5  
ATOM 9582  N N    . LYS A 1 56 ? 21.293  10.558  -0.742  1.00 0.58 ? 56 LYS A N    5  
ATOM 9583  C CA   . LYS A 1 56 ? 21.849  11.741  -1.456  1.00 0.58 ? 56 LYS A CA   5  
ATOM 9584  C C    . LYS A 1 56 ? 21.175  11.873  -2.823  1.00 0.58 ? 56 LYS A C    5  
ATOM 9585  O O    . LYS A 1 56 ? 20.772  12.946  -3.227  1.00 0.58 ? 56 LYS A O    5  
ATOM 9586  C CB   . LYS A 1 56 ? 23.357  11.561  -1.644  1.00 0.58 ? 56 LYS A CB   5  
ATOM 9587  C CG   . LYS A 1 56 ? 23.879  12.606  -2.632  1.00 0.58 ? 56 LYS A CG   5  
ATOM 9588  C CD   . LYS A 1 56 ? 25.136  13.265  -2.061  1.00 0.58 ? 56 LYS A CD   5  
ATOM 9589  C CE   . LYS A 1 56 ? 24.735  14.398  -1.115  1.00 0.58 ? 56 LYS A CE   5  
ATOM 9590  N NZ   . LYS A 1 56 ? 25.562  15.603  -1.406  1.00 0.58 ? 56 LYS A NZ   5  
ATOM 9591  H H    . LYS A 1 56 ? 21.627  9.660   -0.948  1.00 0.58 ? 56 LYS A H    5  
ATOM 9592  H HA   . LYS A 1 56 ? 21.663  12.633  -0.876  1.00 0.58 ? 56 LYS A HA   5  
ATOM 9593  H HB2  . LYS A 1 56 ? 23.855  11.682  -0.693  1.00 0.58 ? 56 LYS A HB2  5  
ATOM 9594  H HB3  . LYS A 1 56 ? 23.555  10.573  -2.032  1.00 0.58 ? 56 LYS A HB3  5  
ATOM 9595  H HG2  . LYS A 1 56 ? 24.117  12.126  -3.570  1.00 0.58 ? 56 LYS A HG2  5  
ATOM 9596  H HG3  . LYS A 1 56 ? 23.122  13.359  -2.793  1.00 0.58 ? 56 LYS A HG3  5  
ATOM 9597  H HD2  . LYS A 1 56 ? 25.713  12.529  -1.518  1.00 0.58 ? 56 LYS A HD2  5  
ATOM 9598  H HD3  . LYS A 1 56 ? 25.731  13.666  -2.868  1.00 0.58 ? 56 LYS A HD3  5  
ATOM 9599  H HE2  . LYS A 1 56 ? 23.691  14.634  -1.259  1.00 0.58 ? 56 LYS A HE2  5  
ATOM 9600  H HE3  . LYS A 1 56 ? 24.897  14.089  -0.093  1.00 0.58 ? 56 LYS A HE3  5  
ATOM 9601  H HZ1  . LYS A 1 56 ? 25.964  15.527  -2.361  1.00 0.58 ? 56 LYS A HZ1  5  
ATOM 9602  H HZ2  . LYS A 1 56 ? 24.966  16.455  -1.351  1.00 0.58 ? 56 LYS A HZ2  5  
ATOM 9603  H HZ3  . LYS A 1 56 ? 26.332  15.672  -0.709  1.00 0.58 ? 56 LYS A HZ3  5  
ATOM 9604  N N    . TRP A 1 57 ? 21.050  10.790  -3.540  1.00 0.41 ? 57 TRP A N    5  
ATOM 9605  C CA   . TRP A 1 57 ? 20.404  10.852  -4.880  1.00 0.41 ? 57 TRP A CA   5  
ATOM 9606  C C    . TRP A 1 57 ? 18.882  10.873  -4.714  1.00 0.41 ? 57 TRP A C    5  
ATOM 9607  O O    . TRP A 1 57 ? 18.174  11.499  -5.477  1.00 0.41 ? 57 TRP A O    5  
ATOM 9608  C CB   . TRP A 1 57 ? 20.810  9.625   -5.697  1.00 0.41 ? 57 TRP A CB   5  
ATOM 9609  C CG   . TRP A 1 57 ? 20.271  8.394   -5.042  1.00 0.41 ? 57 TRP A CG   5  
ATOM 9610  C CD1  . TRP A 1 57 ? 20.928  7.654   -4.120  1.00 0.41 ? 57 TRP A CD1  5  
ATOM 9611  C CD2  . TRP A 1 57 ? 18.980  7.748   -5.242  1.00 0.41 ? 57 TRP A CD2  5  
ATOM 9612  N NE1  . TRP A 1 57 ? 20.122  6.595   -3.740  1.00 0.41 ? 57 TRP A NE1  5  
ATOM 9613  C CE2  . TRP A 1 57 ? 18.911  6.610   -4.404  1.00 0.41 ? 57 TRP A CE2  5  
ATOM 9614  C CE3  . TRP A 1 57 ? 17.874  8.037   -6.061  1.00 0.41 ? 57 TRP A CE3  5  
ATOM 9615  C CZ2  . TRP A 1 57 ? 17.785  5.787   -4.380  1.00 0.41 ? 57 TRP A CZ2  5  
ATOM 9616  C CZ3  . TRP A 1 57 ? 16.738  7.212   -6.039  1.00 0.41 ? 57 TRP A CZ3  5  
ATOM 9617  C CH2  . TRP A 1 57 ? 16.694  6.090   -5.200  1.00 0.41 ? 57 TRP A CH2  5  
ATOM 9618  H H    . TRP A 1 57 ? 21.382  9.935   -3.195  1.00 0.41 ? 57 TRP A H    5  
ATOM 9619  H HA   . TRP A 1 57 ? 20.722  11.748  -5.394  1.00 0.41 ? 57 TRP A HA   5  
ATOM 9620  H HB2  . TRP A 1 57 ? 20.407  9.707   -6.696  1.00 0.41 ? 57 TRP A HB2  5  
ATOM 9621  H HB3  . TRP A 1 57 ? 21.886  9.565   -5.746  1.00 0.41 ? 57 TRP A HB3  5  
ATOM 9622  H HD1  . TRP A 1 57 ? 21.919  7.856   -3.741  1.00 0.41 ? 57 TRP A HD1  5  
ATOM 9623  H HE1  . TRP A 1 57 ? 20.363  5.909   -3.083  1.00 0.41 ? 57 TRP A HE1  5  
ATOM 9624  H HE3  . TRP A 1 57 ? 17.898  8.900   -6.710  1.00 0.41 ? 57 TRP A HE3  5  
ATOM 9625  H HZ2  . TRP A 1 57 ? 17.755  4.924   -3.731  1.00 0.41 ? 57 TRP A HZ2  5  
ATOM 9626  H HZ3  . TRP A 1 57 ? 15.894  7.443   -6.671  1.00 0.41 ? 57 TRP A HZ3  5  
ATOM 9627  H HH2  . TRP A 1 57 ? 15.818  5.458   -5.187  1.00 0.41 ? 57 TRP A HH2  5  
ATOM 9628  N N    . VAL A 1 58 ? 18.373  10.194  -3.722  1.00 0.32 ? 58 VAL A N    5  
ATOM 9629  C CA   . VAL A 1 58 ? 16.898  10.176  -3.511  1.00 0.32 ? 58 VAL A CA   5  
ATOM 9630  C C    . VAL A 1 58 ? 16.360  11.607  -3.555  1.00 0.32 ? 58 VAL A C    5  
ATOM 9631  O O    . VAL A 1 58 ? 15.524  11.941  -4.371  1.00 0.32 ? 58 VAL A O    5  
ATOM 9632  C CB   . VAL A 1 58 ? 16.584  9.554   -2.149  1.00 0.32 ? 58 VAL A CB   5  
ATOM 9633  C CG1  . VAL A 1 58 ? 15.090  9.696   -1.855  1.00 0.32 ? 58 VAL A CG1  5  
ATOM 9634  C CG2  . VAL A 1 58 ? 16.959  8.071   -2.169  1.00 0.32 ? 58 VAL A CG2  5  
ATOM 9635  H H    . VAL A 1 58 ? 18.962  9.695   -3.117  1.00 0.32 ? 58 VAL A H    5  
ATOM 9636  H HA   . VAL A 1 58 ? 16.430  9.592   -4.290  1.00 0.32 ? 58 VAL A HA   5  
ATOM 9637  H HB   . VAL A 1 58 ? 17.151  10.062  -1.382  1.00 0.32 ? 58 VAL A HB   5  
ATOM 9638  H HG11 . VAL A 1 58 ? 14.557  9.874   -2.778  1.00 0.32 ? 58 VAL A HG11 5  
ATOM 9639  H HG12 . VAL A 1 58 ? 14.724  8.789   -1.398  1.00 0.32 ? 58 VAL A HG12 5  
ATOM 9640  H HG13 . VAL A 1 58 ? 14.932  10.527  -1.183  1.00 0.32 ? 58 VAL A HG13 5  
ATOM 9641  H HG21 . VAL A 1 58 ? 16.434  7.578   -2.973  1.00 0.32 ? 58 VAL A HG21 5  
ATOM 9642  H HG22 . VAL A 1 58 ? 18.024  7.971   -2.319  1.00 0.32 ? 58 VAL A HG22 5  
ATOM 9643  H HG23 . VAL A 1 58 ? 16.684  7.618   -1.227  1.00 0.32 ? 58 VAL A HG23 5  
ATOM 9644  N N    . ARG A 1 59 ? 16.835  12.457  -2.685  1.00 0.34 ? 59 ARG A N    5  
ATOM 9645  C CA   . ARG A 1 59 ? 16.350  13.865  -2.683  1.00 0.34 ? 59 ARG A CA   5  
ATOM 9646  C C    . ARG A 1 59 ? 16.687  14.516  -4.025  1.00 0.34 ? 59 ARG A C    5  
ATOM 9647  O O    . ARG A 1 59 ? 16.042  15.453  -4.454  1.00 0.34 ? 59 ARG A O    5  
ATOM 9648  C CB   . ARG A 1 59 ? 17.037  14.640  -1.555  1.00 0.34 ? 59 ARG A CB   5  
ATOM 9649  C CG   . ARG A 1 59 ? 16.454  16.052  -1.475  1.00 0.34 ? 59 ARG A CG   5  
ATOM 9650  C CD   . ARG A 1 59 ? 17.530  17.021  -0.984  1.00 0.34 ? 59 ARG A CD   5  
ATOM 9651  N NE   . ARG A 1 59 ? 18.350  17.482  -2.141  1.00 0.34 ? 59 ARG A NE   5  
ATOM 9652  C CZ   . ARG A 1 59 ? 18.277  18.722  -2.540  1.00 0.34 ? 59 ARG A CZ   5  
ATOM 9653  N NH1  . ARG A 1 59 ? 18.649  19.687  -1.745  1.00 0.34 ? 59 ARG A NH1  5  
ATOM 9654  N NH2  . ARG A 1 59 ? 17.832  18.996  -3.735  1.00 0.34 ? 59 ARG A NH2  5  
ATOM 9655  H H    . ARG A 1 59 ? 17.510  12.168  -2.036  1.00 0.34 ? 59 ARG A H    5  
ATOM 9656  H HA   . ARG A 1 59 ? 15.281  13.880  -2.532  1.00 0.34 ? 59 ARG A HA   5  
ATOM 9657  H HB2  . ARG A 1 59 ? 16.873  14.128  -0.617  1.00 0.34 ? 59 ARG A HB2  5  
ATOM 9658  H HB3  . ARG A 1 59 ? 18.096  14.700  -1.752  1.00 0.34 ? 59 ARG A HB3  5  
ATOM 9659  H HG2  . ARG A 1 59 ? 16.114  16.356  -2.455  1.00 0.34 ? 59 ARG A HG2  5  
ATOM 9660  H HG3  . ARG A 1 59 ? 15.623  16.060  -0.787  1.00 0.34 ? 59 ARG A HG3  5  
ATOM 9661  H HD2  . ARG A 1 59 ? 17.060  17.874  -0.515  1.00 0.34 ? 59 ARG A HD2  5  
ATOM 9662  H HD3  . ARG A 1 59 ? 18.166  16.522  -0.268  1.00 0.34 ? 59 ARG A HD3  5  
ATOM 9663  H HE   . ARG A 1 59 ? 18.944  16.853  -2.601  1.00 0.34 ? 59 ARG A HE   5  
ATOM 9664  H HH11 . ARG A 1 59 ? 18.990  19.476  -0.828  1.00 0.34 ? 59 ARG A HH11 5  
ATOM 9665  H HH12 . ARG A 1 59 ? 18.593  20.636  -2.051  1.00 0.34 ? 59 ARG A HH12 5  
ATOM 9666  H HH21 . ARG A 1 59 ? 17.546  18.257  -4.345  1.00 0.34 ? 59 ARG A HH21 5  
ATOM 9667  H HH22 . ARG A 1 59 ? 17.775  19.947  -4.042  1.00 0.34 ? 59 ARG A HH22 5  
ATOM 9668  N N    . GLU A 1 60 ? 17.693  14.021  -4.696  1.00 0.37 ? 60 GLU A N    5  
ATOM 9669  C CA   . GLU A 1 60 ? 18.073  14.605  -6.012  1.00 0.37 ? 60 GLU A CA   5  
ATOM 9670  C C    . GLU A 1 60 ? 16.987  14.285  -7.041  1.00 0.37 ? 60 GLU A C    5  
ATOM 9671  O O    . GLU A 1 60 ? 16.768  15.028  -7.978  1.00 0.37 ? 60 GLU A O    5  
ATOM 9672  C CB   . GLU A 1 60 ? 19.403  14.000  -6.467  1.00 0.37 ? 60 GLU A CB   5  
ATOM 9673  C CG   . GLU A 1 60 ? 20.555  14.902  -6.022  1.00 0.37 ? 60 GLU A CG   5  
ATOM 9674  C CD   . GLU A 1 60 ? 21.862  14.109  -6.040  1.00 0.37 ? 60 GLU A CD   5  
ATOM 9675  O OE1  . GLU A 1 60 ? 22.009  13.268  -6.912  1.00 0.37 ? 60 GLU A OE1  5  
ATOM 9676  O OE2  . GLU A 1 60 ? 22.694  14.355  -5.183  1.00 0.37 ? 60 GLU A OE2  5  
ATOM 9677  H H    . GLU A 1 60 ? 18.197  13.264  -4.331  1.00 0.37 ? 60 GLU A H    5  
ATOM 9678  H HA   . GLU A 1 60 ? 18.177  15.676  -5.916  1.00 0.37 ? 60 GLU A HA   5  
ATOM 9679  H HB2  . GLU A 1 60 ? 19.520  13.021  -6.027  1.00 0.37 ? 60 GLU A HB2  5  
ATOM 9680  H HB3  . GLU A 1 60 ? 19.411  13.913  -7.542  1.00 0.37 ? 60 GLU A HB3  5  
ATOM 9681  H HG2  . GLU A 1 60 ? 20.633  15.743  -6.695  1.00 0.37 ? 60 GLU A HG2  5  
ATOM 9682  H HG3  . GLU A 1 60 ? 20.367  15.259  -5.019  1.00 0.37 ? 60 GLU A HG3  5  
ATOM 9683  N N    . TYR A 1 61 ? 16.306  13.186  -6.874  1.00 0.36 ? 61 TYR A N    5  
ATOM 9684  C CA   . TYR A 1 61 ? 15.233  12.816  -7.840  1.00 0.36 ? 61 TYR A CA   5  
ATOM 9685  C C    . TYR A 1 61 ? 13.954  13.582  -7.499  1.00 0.36 ? 61 TYR A C    5  
ATOM 9686  O O    . TYR A 1 61 ? 13.316  14.159  -8.357  1.00 0.36 ? 61 TYR A O    5  
ATOM 9687  C CB   . TYR A 1 61 ? 14.966  11.311  -7.752  1.00 0.36 ? 61 TYR A CB   5  
ATOM 9688  C CG   . TYR A 1 61 ? 15.916  10.564  -8.663  1.00 0.36 ? 61 TYR A CG   5  
ATOM 9689  C CD1  . TYR A 1 61 ? 17.099  11.175  -9.102  1.00 0.36 ? 61 TYR A CD1  5  
ATOM 9690  C CD2  . TYR A 1 61 ? 15.614  9.257   -9.066  1.00 0.36 ? 61 TYR A CD2  5  
ATOM 9691  C CE1  . TYR A 1 61 ? 17.975  10.480  -9.944  1.00 0.36 ? 61 TYR A CE1  5  
ATOM 9692  C CE2  . TYR A 1 61 ? 16.491  8.563   -9.907  1.00 0.36 ? 61 TYR A CE2  5  
ATOM 9693  C CZ   . TYR A 1 61 ? 17.672  9.174   -10.346 1.00 0.36 ? 61 TYR A CZ   5  
ATOM 9694  O OH   . TYR A 1 61 ? 18.536  8.490   -11.175 1.00 0.36 ? 61 TYR A OH   5  
ATOM 9695  H H    . TYR A 1 61 ? 16.499  12.602  -6.111  1.00 0.36 ? 61 TYR A H    5  
ATOM 9696  H HA   . TYR A 1 61 ? 15.549  13.068  -8.842  1.00 0.36 ? 61 TYR A HA   5  
ATOM 9697  H HB2  . TYR A 1 61 ? 15.110  10.980  -6.734  1.00 0.36 ? 61 TYR A HB2  5  
ATOM 9698  H HB3  . TYR A 1 61 ? 13.949  11.109  -8.054  1.00 0.36 ? 61 TYR A HB3  5  
ATOM 9699  H HD1  . TYR A 1 61 ? 17.334  12.182  -8.793  1.00 0.36 ? 61 TYR A HD1  5  
ATOM 9700  H HD2  . TYR A 1 61 ? 14.703  8.787   -8.727  1.00 0.36 ? 61 TYR A HD2  5  
ATOM 9701  H HE1  . TYR A 1 61 ? 18.886  10.951  -10.283 1.00 0.36 ? 61 TYR A HE1  5  
ATOM 9702  H HE2  . TYR A 1 61 ? 16.257  7.554   -10.217 1.00 0.36 ? 61 TYR A HE2  5  
ATOM 9703  H HH   . TYR A 1 61 ? 19.422  8.829   -11.025 1.00 0.36 ? 61 TYR A HH   5  
ATOM 9704  N N    . ILE A 1 62 ? 13.573  13.591  -6.251  1.00 0.38 ? 62 ILE A N    5  
ATOM 9705  C CA   . ILE A 1 62 ? 12.335  14.320  -5.855  1.00 0.38 ? 62 ILE A CA   5  
ATOM 9706  C C    . ILE A 1 62 ? 12.479  15.801  -6.210  1.00 0.38 ? 62 ILE A C    5  
ATOM 9707  O O    . ILE A 1 62 ? 11.533  16.445  -6.619  1.00 0.38 ? 62 ILE A O    5  
ATOM 9708  C CB   . ILE A 1 62 ? 12.119  14.176  -4.347  1.00 0.38 ? 62 ILE A CB   5  
ATOM 9709  C CG1  . ILE A 1 62 ? 11.857  12.707  -4.009  1.00 0.38 ? 62 ILE A CG1  5  
ATOM 9710  C CG2  . ILE A 1 62 ? 10.916  15.018  -3.921  1.00 0.38 ? 62 ILE A CG2  5  
ATOM 9711  C CD1  . ILE A 1 62 ? 13.033  12.149  -3.205  1.00 0.38 ? 62 ILE A CD1  5  
ATOM 9712  H H    . ILE A 1 62 ? 14.102  13.119  -5.573  1.00 0.38 ? 62 ILE A H    5  
ATOM 9713  H HA   . ILE A 1 62 ? 11.489  13.904  -6.381  1.00 0.38 ? 62 ILE A HA   5  
ATOM 9714  H HB   . ILE A 1 62 ? 13.000  14.517  -3.824  1.00 0.38 ? 62 ILE A HB   5  
ATOM 9715  H HG12 . ILE A 1 62 ? 10.951  12.629  -3.425  1.00 0.38 ? 62 ILE A HG12 5  
ATOM 9716  H HG13 . ILE A 1 62 ? 11.747  12.141  -4.922  1.00 0.38 ? 62 ILE A HG13 5  
ATOM 9717  H HG21 . ILE A 1 62 ? 10.696  15.746  -4.688  1.00 0.38 ? 62 ILE A HG21 5  
ATOM 9718  H HG22 . ILE A 1 62 ? 10.059  14.377  -3.778  1.00 0.38 ? 62 ILE A HG22 5  
ATOM 9719  H HG23 . ILE A 1 62 ? 11.142  15.528  -2.996  1.00 0.38 ? 62 ILE A HG23 5  
ATOM 9720  H HD11 . ILE A 1 62 ? 13.702  12.955  -2.941  1.00 0.38 ? 62 ILE A HD11 5  
ATOM 9721  H HD12 . ILE A 1 62 ? 12.665  11.678  -2.307  1.00 0.38 ? 62 ILE A HD12 5  
ATOM 9722  H HD13 . ILE A 1 62 ? 13.565  11.422  -3.802  1.00 0.38 ? 62 ILE A HD13 5  
ATOM 9723  N N    . ASN A 1 63 ? 13.654  16.346  -6.058  1.00 0.49 ? 63 ASN A N    5  
ATOM 9724  C CA   . ASN A 1 63 ? 13.857  17.785  -6.387  1.00 0.49 ? 63 ASN A CA   5  
ATOM 9725  C C    . ASN A 1 63 ? 14.041  17.942  -7.898  1.00 0.49 ? 63 ASN A C    5  
ATOM 9726  O O    . ASN A 1 63 ? 13.679  18.948  -8.476  1.00 0.49 ? 63 ASN A O    5  
ATOM 9727  C CB   . ASN A 1 63 ? 15.103  18.303  -5.665  1.00 0.49 ? 63 ASN A CB   5  
ATOM 9728  C CG   . ASN A 1 63 ? 15.479  19.679  -6.217  1.00 0.49 ? 63 ASN A CG   5  
ATOM 9729  O OD1  . ASN A 1 63 ? 14.738  20.630  -6.066  1.00 0.49 ? 63 ASN A OD1  5  
ATOM 9730  N ND2  . ASN A 1 63 ? 16.608  19.827  -6.856  1.00 0.49 ? 63 ASN A ND2  5  
ATOM 9731  H H    . ASN A 1 63 ? 14.404  15.809  -5.726  1.00 0.49 ? 63 ASN A H    5  
ATOM 9732  H HA   . ASN A 1 63 ? 12.995  18.352  -6.068  1.00 0.49 ? 63 ASN A HA   5  
ATOM 9733  H HB2  . ASN A 1 63 ? 14.900  18.381  -4.607  1.00 0.49 ? 63 ASN A HB2  5  
ATOM 9734  H HB3  . ASN A 1 63 ? 15.923  17.617  -5.824  1.00 0.49 ? 63 ASN A HB3  5  
ATOM 9735  H HD21 . ASN A 1 63 ? 17.205  19.060  -6.979  1.00 0.49 ? 63 ASN A HD21 5  
ATOM 9736  H HD22 . ASN A 1 63 ? 16.856  20.704  -7.214  1.00 0.49 ? 63 ASN A HD22 5  
ATOM 9737  N N    . SER A 1 64 ? 14.601  16.955  -8.543  1.00 0.55 ? 64 SER A N    5  
ATOM 9738  C CA   . SER A 1 64 ? 14.807  17.047  -10.015 1.00 0.55 ? 64 SER A CA   5  
ATOM 9739  C C    . SER A 1 64 ? 13.463  16.884  -10.729 1.00 0.55 ? 64 SER A C    5  
ATOM 9740  O O    . SER A 1 64 ? 13.300  17.280  -11.866 1.00 0.55 ? 64 SER A O    5  
ATOM 9741  C CB   . SER A 1 64 ? 15.762  15.943  -10.467 1.00 0.55 ? 64 SER A CB   5  
ATOM 9742  O OG   . SER A 1 64 ? 15.188  14.677  -10.174 1.00 0.55 ? 64 SER A OG   5  
ATOM 9743  H H    . SER A 1 64 ? 14.885  16.151  -8.057  1.00 0.55 ? 64 SER A H    5  
ATOM 9744  H HA   . SER A 1 64 ? 15.228  18.012  -10.259 1.00 0.55 ? 64 SER A HA   5  
ATOM 9745  H HB2  . SER A 1 64 ? 15.928  16.020  -11.528 1.00 0.55 ? 64 SER A HB2  5  
ATOM 9746  H HB3  . SER A 1 64 ? 16.706  16.051  -9.949  1.00 0.55 ? 64 SER A HB3  5  
ATOM 9747  H HG   . SER A 1 64 ? 15.762  13.999  -10.539 1.00 0.55 ? 64 SER A HG   5  
ATOM 9748  N N    . LEU A 1 65 ? 12.498  16.302  -10.070 1.00 0.53 ? 65 LEU A N    5  
ATOM 9749  C CA   . LEU A 1 65 ? 11.167  16.113  -10.711 1.00 0.53 ? 65 LEU A CA   5  
ATOM 9750  C C    . LEU A 1 65 ? 10.285  17.329  -10.422 1.00 0.53 ? 65 LEU A C    5  
ATOM 9751  O O    . LEU A 1 65 ? 9.663   17.882  -11.307 1.00 0.53 ? 65 LEU A O    5  
ATOM 9752  C CB   . LEU A 1 65 ? 10.502  14.856  -10.145 1.00 0.53 ? 65 LEU A CB   5  
ATOM 9753  C CG   . LEU A 1 65 ? 9.985   13.991  -11.295 1.00 0.53 ? 65 LEU A CG   5  
ATOM 9754  C CD1  . LEU A 1 65 ? 10.829  12.720  -11.399 1.00 0.53 ? 65 LEU A CD1  5  
ATOM 9755  C CD2  . LEU A 1 65 ? 8.526   13.613  -11.029 1.00 0.53 ? 65 LEU A CD2  5  
ATOM 9756  H H    . LEU A 1 65 ? 12.649  15.989  -9.154  1.00 0.53 ? 65 LEU A H    5  
ATOM 9757  H HA   . LEU A 1 65 ? 11.293  16.005  -11.778 1.00 0.53 ? 65 LEU A HA   5  
ATOM 9758  H HB2  . LEU A 1 65 ? 11.225  14.295  -9.569  1.00 0.53 ? 65 LEU A HB2  5  
ATOM 9759  H HB3  . LEU A 1 65 ? 9.677   15.139  -9.511  1.00 0.53 ? 65 LEU A HB3  5  
ATOM 9760  H HG   . LEU A 1 65 ? 10.053  14.545  -12.221 1.00 0.53 ? 65 LEU A HG   5  
ATOM 9761  H HD11 . LEU A 1 65 ? 10.845  12.219  -10.441 1.00 0.53 ? 65 LEU A HD11 5  
ATOM 9762  H HD12 . LEU A 1 65 ? 10.400  12.062  -12.141 1.00 0.53 ? 65 LEU A HD12 5  
ATOM 9763  H HD13 . LEU A 1 65 ? 11.837  12.980  -11.687 1.00 0.53 ? 65 LEU A HD13 5  
ATOM 9764  H HD21 . LEU A 1 65 ? 8.360   13.544  -9.964  1.00 0.53 ? 65 LEU A HD21 5  
ATOM 9765  H HD22 . LEU A 1 65 ? 7.876   14.367  -11.448 1.00 0.53 ? 65 LEU A HD22 5  
ATOM 9766  H HD23 . LEU A 1 65 ? 8.311   12.658  -11.488 1.00 0.53 ? 65 LEU A HD23 5  
ATOM 9767  N N    . GLU A 1 66 ? 10.224  17.751  -9.188  1.00 0.61 ? 66 GLU A N    5  
ATOM 9768  C CA   . GLU A 1 66 ? 9.383   18.931  -8.843  1.00 0.61 ? 66 GLU A CA   5  
ATOM 9769  C C    . GLU A 1 66 ? 10.209  20.210  -8.998  1.00 0.61 ? 66 GLU A C    5  
ATOM 9770  O O    . GLU A 1 66 ? 10.276  21.028  -8.103  1.00 0.61 ? 66 GLU A O    5  
ATOM 9771  C CB   . GLU A 1 66 ? 8.899   18.807  -7.397  1.00 0.61 ? 66 GLU A CB   5  
ATOM 9772  C CG   . GLU A 1 66 ? 7.720   17.835  -7.334  1.00 0.61 ? 66 GLU A CG   5  
ATOM 9773  C CD   . GLU A 1 66 ? 6.431   18.569  -7.708  1.00 0.61 ? 66 GLU A CD   5  
ATOM 9774  O OE1  . GLU A 1 66 ? 6.408   19.182  -8.762  1.00 0.61 ? 66 GLU A OE1  5  
ATOM 9775  O OE2  . GLU A 1 66 ? 5.490   18.505  -6.935  1.00 0.61 ? 66 GLU A OE2  5  
ATOM 9776  H H    . GLU A 1 66 ? 10.734  17.291  -8.488  1.00 0.61 ? 66 GLU A H    5  
ATOM 9777  H HA   . GLU A 1 66 ? 8.530   18.970  -9.505  1.00 0.61 ? 66 GLU A HA   5  
ATOM 9778  H HB2  . GLU A 1 66 ? 9.705   18.438  -6.779  1.00 0.61 ? 66 GLU A HB2  5  
ATOM 9779  H HB3  . GLU A 1 66 ? 8.584   19.776  -7.038  1.00 0.61 ? 66 GLU A HB3  5  
ATOM 9780  H HG2  . GLU A 1 66 ? 7.887   17.022  -8.024  1.00 0.61 ? 66 GLU A HG2  5  
ATOM 9781  H HG3  . GLU A 1 66 ? 7.630   17.443  -6.331  1.00 0.61 ? 66 GLU A HG3  5  
ATOM 9782  N N    . MET A 1 67 ? 10.838  20.387  -10.127 1.00 1.45 ? 67 MET A N    5  
ATOM 9783  C CA   . MET A 1 67 ? 11.658  21.613  -10.338 1.00 1.45 ? 67 MET A CA   5  
ATOM 9784  C C    . MET A 1 67 ? 10.815  22.851  -10.026 1.00 1.45 ? 67 MET A C    5  
ATOM 9785  O O    . MET A 1 67 ? 9.602   22.797  -10.001 1.00 1.45 ? 67 MET A O    5  
ATOM 9786  C CB   . MET A 1 67 ? 12.128  21.669  -11.794 1.00 1.45 ? 67 MET A CB   5  
ATOM 9787  C CG   . MET A 1 67 ? 13.652  21.779  -11.835 1.00 1.45 ? 67 MET A CG   5  
ATOM 9788  S SD   . MET A 1 67 ? 14.218  21.686  -13.551 1.00 1.45 ? 67 MET A SD   5  
ATOM 9789  C CE   . MET A 1 67 ? 15.985  21.524  -13.200 1.00 1.45 ? 67 MET A CE   5  
ATOM 9790  H H    . MET A 1 67 ? 10.770  19.715  -10.837 1.00 1.45 ? 67 MET A H    5  
ATOM 9791  H HA   . MET A 1 67 ? 12.517  21.588  -9.684  1.00 1.45 ? 67 MET A HA   5  
ATOM 9792  H HB2  . MET A 1 67 ? 11.816  20.771  -12.307 1.00 1.45 ? 67 MET A HB2  5  
ATOM 9793  H HB3  . MET A 1 67 ? 11.693  22.530  -12.279 1.00 1.45 ? 67 MET A HB3  5  
ATOM 9794  H HG2  . MET A 1 67 ? 13.957  22.722  -11.406 1.00 1.45 ? 67 MET A HG2  5  
ATOM 9795  H HG3  . MET A 1 67 ? 14.088  20.969  -11.269 1.00 1.45 ? 67 MET A HG3  5  
ATOM 9796  H HE1  . MET A 1 67 ? 16.194  21.920  -12.216 1.00 1.45 ? 67 MET A HE1  5  
ATOM 9797  H HE2  . MET A 1 67 ? 16.265  20.481  -13.242 1.00 1.45 ? 67 MET A HE2  5  
ATOM 9798  H HE3  . MET A 1 67 ? 16.552  22.075  -13.933 1.00 1.45 ? 67 MET A HE3  5  
ATOM 9799  N N    . SER A 1 68 ? 11.447  23.967  -9.790  1.00 2.84 ? 68 SER A N    5  
ATOM 9800  C CA   . SER A 1 68 ? 10.681  25.207  -9.480  1.00 2.84 ? 68 SER A CA   5  
ATOM 9801  C C    . SER A 1 68 ? 10.092  25.778  -10.772 1.00 2.84 ? 68 SER A C    5  
ATOM 9802  O O    . SER A 1 68 ? 8.983   26.284  -10.721 1.00 2.84 ? 68 SER A O    5  
ATOM 9803  C CB   . SER A 1 68 ? 11.615  26.239  -8.846  1.00 2.84 ? 68 SER A CB   5  
ATOM 9804  O OG   . SER A 1 68 ? 10.844  27.321  -8.342  1.00 2.84 ? 68 SER A OG   5  
ATOM 9805  O OXT  . SER A 1 68 ? 10.761  25.701  -11.789 1.00 2.84 ? 68 SER A OXT  5  
ATOM 9806  H H    . SER A 1 68 ? 12.427  23.990  -9.816  1.00 2.84 ? 68 SER A H    5  
ATOM 9807  H HA   . SER A 1 68 ? 9.882   24.974  -8.793  1.00 2.84 ? 68 SER A HA   5  
ATOM 9808  H HB2  . SER A 1 68 ? 12.160  25.784  -8.037  1.00 2.84 ? 68 SER A HB2  5  
ATOM 9809  H HB3  . SER A 1 68 ? 12.313  26.596  -9.592  1.00 2.84 ? 68 SER A HB3  5  
ATOM 9810  H HG   . SER A 1 68 ? 11.430  28.075  -8.230  1.00 2.84 ? 68 SER A HG   5  
ATOM 9811  N N    . SER B 1 1  ? 18.032  -5.353  3.931   1.00 5.93 ? 1  SER B N    5  
ATOM 9812  C CA   . SER B 1 1  ? 17.414  -6.562  3.319   1.00 5.93 ? 1  SER B CA   5  
ATOM 9813  C C    . SER B 1 1  ? 18.014  -6.795  1.929   1.00 5.93 ? 1  SER B C    5  
ATOM 9814  O O    . SER B 1 1  ? 18.752  -5.969  1.428   1.00 5.93 ? 1  SER B O    5  
ATOM 9815  C CB   . SER B 1 1  ? 15.904  -6.355  3.193   1.00 5.93 ? 1  SER B CB   5  
ATOM 9816  O OG   . SER B 1 1  ? 15.233  -7.229  4.092   1.00 5.93 ? 1  SER B OG   5  
ATOM 9817  H H1   . SER B 1 1  ? 19.057  -5.364  3.762   1.00 5.93 ? 1  SER B H1   5  
ATOM 9818  H H2   . SER B 1 1  ? 17.619  -4.499  3.504   1.00 5.93 ? 1  SER B H2   5  
ATOM 9819  H H3   . SER B 1 1  ? 17.851  -5.351  4.954   1.00 5.93 ? 1  SER B H3   5  
ATOM 9820  H HA   . SER B 1 1  ? 17.608  -7.421  3.944   1.00 5.93 ? 1  SER B HA   5  
ATOM 9821  H HB2  . SER B 1 1  ? 15.656  -5.336  3.440   1.00 5.93 ? 1  SER B HB2  5  
ATOM 9822  H HB3  . SER B 1 1  ? 15.596  -6.561  2.177   1.00 5.93 ? 1  SER B HB3  5  
ATOM 9823  H HG   . SER B 1 1  ? 15.523  -8.125  3.905   1.00 5.93 ? 1  SER B HG   5  
ATOM 9824  N N    . PRO B 1 2  ? 17.677  -7.918  1.348   1.00 3.89 ? 2  PRO B N    5  
ATOM 9825  C CA   . PRO B 1 2  ? 18.164  -8.298  0.011   1.00 3.89 ? 2  PRO B CA   5  
ATOM 9826  C C    . PRO B 1 2  ? 17.388  -7.548  -1.075  1.00 3.89 ? 2  PRO B C    5  
ATOM 9827  O O    . PRO B 1 2  ? 17.786  -6.489  -1.517  1.00 3.89 ? 2  PRO B O    5  
ATOM 9828  C CB   . PRO B 1 2  ? 17.884  -9.802  -0.058  1.00 3.89 ? 2  PRO B CB   5  
ATOM 9829  C CG   . PRO B 1 2  ? 16.765  -10.086 0.972   1.00 3.89 ? 2  PRO B CG   5  
ATOM 9830  C CD   . PRO B 1 2  ? 16.778  -8.912  1.971   1.00 3.89 ? 2  PRO B CD   5  
ATOM 9831  H HA   . PRO B 1 2  ? 19.222  -8.115  -0.078  1.00 3.89 ? 2  PRO B HA   5  
ATOM 9832  H HB2  . PRO B 1 2  ? 17.555  -10.072 -1.053  1.00 3.89 ? 2  PRO B HB2  5  
ATOM 9833  H HB3  . PRO B 1 2  ? 18.770  -10.358 0.205   1.00 3.89 ? 2  PRO B HB3  5  
ATOM 9834  H HG2  . PRO B 1 2  ? 15.808  -10.140 0.472   1.00 3.89 ? 2  PRO B HG2  5  
ATOM 9835  H HG3  . PRO B 1 2  ? 16.964  -11.009 1.493   1.00 3.89 ? 2  PRO B HG3  5  
ATOM 9836  H HD2  . PRO B 1 2  ? 15.783  -8.506  2.088   1.00 3.89 ? 2  PRO B HD2  5  
ATOM 9837  H HD3  . PRO B 1 2  ? 17.175  -9.229  2.923   1.00 3.89 ? 2  PRO B HD3  5  
ATOM 9838  N N    . TYR B 1 3  ? 16.282  -8.088  -1.508  1.00 2.56 ? 3  TYR B N    5  
ATOM 9839  C CA   . TYR B 1 3  ? 15.483  -7.405  -2.564  1.00 2.56 ? 3  TYR B CA   5  
ATOM 9840  C C    . TYR B 1 3  ? 14.024  -7.303  -2.113  1.00 2.56 ? 3  TYR B C    5  
ATOM 9841  O O    . TYR B 1 3  ? 13.253  -8.232  -2.258  1.00 2.56 ? 3  TYR B O    5  
ATOM 9842  C CB   . TYR B 1 3  ? 15.560  -8.209  -3.863  1.00 2.56 ? 3  TYR B CB   5  
ATOM 9843  C CG   . TYR B 1 3  ? 15.284  -9.664  -3.572  1.00 2.56 ? 3  TYR B CG   5  
ATOM 9844  C CD1  . TYR B 1 3  ? 16.304  -10.487 -3.082  1.00 2.56 ? 3  TYR B CD1  5  
ATOM 9845  C CD2  . TYR B 1 3  ? 14.005  -10.192 -3.793  1.00 2.56 ? 3  TYR B CD2  5  
ATOM 9846  C CE1  . TYR B 1 3  ? 16.047  -11.836 -2.811  1.00 2.56 ? 3  TYR B CE1  5  
ATOM 9847  C CE2  . TYR B 1 3  ? 13.747  -11.541 -3.522  1.00 2.56 ? 3  TYR B CE2  5  
ATOM 9848  C CZ   . TYR B 1 3  ? 14.769  -12.364 -3.032  1.00 2.56 ? 3  TYR B CZ   5  
ATOM 9849  O OH   . TYR B 1 3  ? 14.515  -13.693 -2.766  1.00 2.56 ? 3  TYR B OH   5  
ATOM 9850  H H    . TYR B 1 3  ? 15.977  -8.944  -1.139  1.00 2.56 ? 3  TYR B H    5  
ATOM 9851  H HA   . TYR B 1 3  ? 15.878  -6.414  -2.730  1.00 2.56 ? 3  TYR B HA   5  
ATOM 9852  H HB2  . TYR B 1 3  ? 14.827  -7.835  -4.562  1.00 2.56 ? 3  TYR B HB2  5  
ATOM 9853  H HB3  . TYR B 1 3  ? 16.548  -8.110  -4.289  1.00 2.56 ? 3  TYR B HB3  5  
ATOM 9854  H HD1  . TYR B 1 3  ? 17.290  -10.081 -2.911  1.00 2.56 ? 3  TYR B HD1  5  
ATOM 9855  H HD2  . TYR B 1 3  ? 13.217  -9.556  -4.171  1.00 2.56 ? 3  TYR B HD2  5  
ATOM 9856  H HE1  . TYR B 1 3  ? 16.834  -12.472 -2.433  1.00 2.56 ? 3  TYR B HE1  5  
ATOM 9857  H HE2  . TYR B 1 3  ? 12.761  -11.947 -3.693  1.00 2.56 ? 3  TYR B HE2  5  
ATOM 9858  H HH   . TYR B 1 3  ? 13.568  -13.799 -2.654  1.00 2.56 ? 3  TYR B HH   5  
ATOM 9859  N N    . SER B 1 4  ? 13.638  -6.182  -1.568  1.00 0.96 ? 4  SER B N    5  
ATOM 9860  C CA   . SER B 1 4  ? 12.229  -6.022  -1.110  1.00 0.96 ? 4  SER B CA   5  
ATOM 9861  C C    . SER B 1 4  ? 11.886  -4.533  -1.028  1.00 0.96 ? 4  SER B C    5  
ATOM 9862  O O    . SER B 1 4  ? 11.312  -4.071  -0.062  1.00 0.96 ? 4  SER B O    5  
ATOM 9863  C CB   . SER B 1 4  ? 12.067  -6.659  0.271   1.00 0.96 ? 4  SER B CB   5  
ATOM 9864  O OG   . SER B 1 4  ? 11.552  -7.975  0.122   1.00 0.96 ? 4  SER B OG   5  
ATOM 9865  H H    . SER B 1 4  ? 14.275  -5.445  -1.461  1.00 0.96 ? 4  SER B H    5  
ATOM 9866  H HA   . SER B 1 4  ? 11.565  -6.507  -1.810  1.00 0.96 ? 4  SER B HA   5  
ATOM 9867  H HB2  . SER B 1 4  ? 13.025  -6.706  0.762   1.00 0.96 ? 4  SER B HB2  5  
ATOM 9868  H HB3  . SER B 1 4  ? 11.390  -6.061  0.865   1.00 0.96 ? 4  SER B HB3  5  
ATOM 9869  H HG   . SER B 1 4  ? 11.672  -8.437  0.956   1.00 0.96 ? 4  SER B HG   5  
ATOM 9870  N N    . SER B 1 5  ? 12.234  -3.779  -2.034  1.00 0.48 ? 5  SER B N    5  
ATOM 9871  C CA   . SER B 1 5  ? 11.927  -2.321  -2.013  1.00 0.48 ? 5  SER B CA   5  
ATOM 9872  C C    . SER B 1 5  ? 10.687  -2.047  -2.866  1.00 0.48 ? 5  SER B C    5  
ATOM 9873  O O    . SER B 1 5  ? 10.722  -1.267  -3.797  1.00 0.48 ? 5  SER B O    5  
ATOM 9874  C CB   . SER B 1 5  ? 13.116  -1.542  -2.577  1.00 0.48 ? 5  SER B CB   5  
ATOM 9875  O OG   . SER B 1 5  ? 13.239  -1.814  -3.966  1.00 0.48 ? 5  SER B OG   5  
ATOM 9876  H H    . SER B 1 5  ? 12.696  -4.171  -2.804  1.00 0.48 ? 5  SER B H    5  
ATOM 9877  H HA   . SER B 1 5  ? 11.741  -2.007  -0.996  1.00 0.48 ? 5  SER B HA   5  
ATOM 9878  H HB2  . SER B 1 5  ? 12.957  -0.486  -2.436  1.00 0.48 ? 5  SER B HB2  5  
ATOM 9879  H HB3  . SER B 1 5  ? 14.019  -1.840  -2.060  1.00 0.48 ? 5  SER B HB3  5  
ATOM 9880  H HG   . SER B 1 5  ? 14.124  -2.150  -4.126  1.00 0.48 ? 5  SER B HG   5  
ATOM 9881  N N    . ASP B 1 6  ? 9.590   -2.683  -2.556  1.00 0.37 ? 6  ASP B N    5  
ATOM 9882  C CA   . ASP B 1 6  ? 8.350   -2.458  -3.351  1.00 0.37 ? 6  ASP B CA   5  
ATOM 9883  C C    . ASP B 1 6  ? 7.239   -1.952  -2.429  1.00 0.37 ? 6  ASP B C    5  
ATOM 9884  O O    . ASP B 1 6  ? 7.267   -2.164  -1.233  1.00 0.37 ? 6  ASP B O    5  
ATOM 9885  C CB   . ASP B 1 6  ? 7.914   -3.773  -4.000  1.00 0.37 ? 6  ASP B CB   5  
ATOM 9886  C CG   . ASP B 1 6  ? 9.148   -4.541  -4.477  1.00 0.37 ? 6  ASP B CG   5  
ATOM 9887  O OD1  . ASP B 1 6  ? 9.801   -4.063  -5.391  1.00 0.37 ? 6  ASP B OD1  5  
ATOM 9888  O OD2  . ASP B 1 6  ? 9.419   -5.593  -3.923  1.00 0.37 ? 6  ASP B OD2  5  
ATOM 9889  H H    . ASP B 1 6  ? 9.582   -3.308  -1.802  1.00 0.37 ? 6  ASP B H    5  
ATOM 9890  H HA   . ASP B 1 6  ? 8.542   -1.724  -4.119  1.00 0.37 ? 6  ASP B HA   5  
ATOM 9891  H HB2  . ASP B 1 6  ? 7.376   -4.370  -3.278  1.00 0.37 ? 6  ASP B HB2  5  
ATOM 9892  H HB3  . ASP B 1 6  ? 7.274   -3.564  -4.844  1.00 0.37 ? 6  ASP B HB3  5  
ATOM 9893  N N    . THR B 1 7  ? 6.260   -1.283  -2.975  1.00 0.35 ? 7  THR B N    5  
ATOM 9894  C CA   . THR B 1 7  ? 5.149   -0.762  -2.129  1.00 0.35 ? 7  THR B CA   5  
ATOM 9895  C C    . THR B 1 7  ? 4.190   -1.904  -1.786  1.00 0.35 ? 7  THR B C    5  
ATOM 9896  O O    . THR B 1 7  ? 4.318   -3.006  -2.282  1.00 0.35 ? 7  THR B O    5  
ATOM 9897  C CB   . THR B 1 7  ? 4.393   0.326   -2.894  1.00 0.35 ? 7  THR B CB   5  
ATOM 9898  O OG1  . THR B 1 7  ? 3.791   -0.242  -4.050  1.00 0.35 ? 7  THR B OG1  5  
ATOM 9899  C CG2  . THR B 1 7  ? 5.365   1.430   -3.313  1.00 0.35 ? 7  THR B CG2  5  
ATOM 9900  H H    . THR B 1 7  ? 6.257   -1.122  -3.941  1.00 0.35 ? 7  THR B H    5  
ATOM 9901  H HA   . THR B 1 7  ? 5.554   -0.346  -1.219  1.00 0.35 ? 7  THR B HA   5  
ATOM 9902  H HB   . THR B 1 7  ? 3.628   0.747   -2.260  1.00 0.35 ? 7  THR B HB   5  
ATOM 9903  H HG1  . THR B 1 7  ? 3.540   0.475   -4.637  1.00 0.35 ? 7  THR B HG1  5  
ATOM 9904  H HG21 . THR B 1 7  ? 6.369   1.034   -3.338  1.00 0.35 ? 7  THR B HG21 5  
ATOM 9905  H HG22 . THR B 1 7  ? 5.096   1.793   -4.294  1.00 0.35 ? 7  THR B HG22 5  
ATOM 9906  H HG23 . THR B 1 7  ? 5.314   2.241   -2.602  1.00 0.35 ? 7  THR B HG23 5  
ATOM 9907  N N    . THR B 1 8  ? 3.228   -1.648  -0.942  1.00 0.31 ? 8  THR B N    5  
ATOM 9908  C CA   . THR B 1 8  ? 2.260   -2.717  -0.569  1.00 0.31 ? 8  THR B CA   5  
ATOM 9909  C C    . THR B 1 8  ? 0.834   -2.229  -0.856  1.00 0.31 ? 8  THR B C    5  
ATOM 9910  O O    . THR B 1 8  ? 0.458   -1.154  -0.432  1.00 0.31 ? 8  THR B O    5  
ATOM 9911  C CB   . THR B 1 8  ? 2.399   -3.031  0.923   1.00 0.31 ? 8  THR B CB   5  
ATOM 9912  O OG1  . THR B 1 8  ? 3.621   -3.720  1.148   1.00 0.31 ? 8  THR B OG1  5  
ATOM 9913  C CG2  . THR B 1 8  ? 1.227   -3.904  1.377   1.00 0.31 ? 8  THR B CG2  5  
ATOM 9914  H H    . THR B 1 8  ? 3.141   -0.752  -0.555  1.00 0.31 ? 8  THR B H    5  
ATOM 9915  H HA   . THR B 1 8  ? 2.470   -3.604  -1.144  1.00 0.31 ? 8  THR B HA   5  
ATOM 9916  H HB   . THR B 1 8  ? 2.396   -2.111  1.487   1.00 0.31 ? 8  THR B HB   5  
ATOM 9917  H HG1  . THR B 1 8  ? 3.858   -4.176  0.336   1.00 0.31 ? 8  THR B HG1  5  
ATOM 9918  H HG21 . THR B 1 8  ? 0.298   -3.445  1.075   1.00 0.31 ? 8  THR B HG21 5  
ATOM 9919  H HG22 . THR B 1 8  ? 1.310   -4.881  0.924   1.00 0.31 ? 8  THR B HG22 5  
ATOM 9920  H HG23 . THR B 1 8  ? 1.247   -4.004  2.452   1.00 0.31 ? 8  THR B HG23 5  
ATOM 9921  N N    . PRO B 1 9  ? 0.079   -3.030  -1.566  1.00 0.34 ? 9  PRO B N    5  
ATOM 9922  C CA   . PRO B 1 9  ? -1.312  -2.696  -1.920  1.00 0.34 ? 9  PRO B CA   5  
ATOM 9923  C C    . PRO B 1 9  ? -2.234  -2.936  -0.722  1.00 0.34 ? 9  PRO B C    5  
ATOM 9924  O O    . PRO B 1 9  ? -2.854  -3.973  -0.598  1.00 0.34 ? 9  PRO B O    5  
ATOM 9925  C CB   . PRO B 1 9  ? -1.634  -3.661  -3.064  1.00 0.34 ? 9  PRO B CB   5  
ATOM 9926  C CG   . PRO B 1 9  ? -0.650  -4.846  -2.925  1.00 0.34 ? 9  PRO B CG   5  
ATOM 9927  C CD   . PRO B 1 9  ? 0.535   -4.338  -2.081  1.00 0.34 ? 9  PRO B CD   5  
ATOM 9928  H HA   . PRO B 1 9  ? -1.386  -1.677  -2.263  1.00 0.34 ? 9  PRO B HA   5  
ATOM 9929  H HB2  . PRO B 1 9  ? -2.656  -4.009  -2.976  1.00 0.34 ? 9  PRO B HB2  5  
ATOM 9930  H HB3  . PRO B 1 9  ? -1.486  -3.174  -4.014  1.00 0.34 ? 9  PRO B HB3  5  
ATOM 9931  H HG2  . PRO B 1 9  ? -1.136  -5.674  -2.428  1.00 0.34 ? 9  PRO B HG2  5  
ATOM 9932  H HG3  . PRO B 1 9  ? -0.298  -5.151  -3.898  1.00 0.34 ? 9  PRO B HG3  5  
ATOM 9933  H HD2  . PRO B 1 9  ? 0.736   -5.019  -1.266  1.00 0.34 ? 9  PRO B HD2  5  
ATOM 9934  H HD3  . PRO B 1 9  ? 1.412   -4.211  -2.696  1.00 0.34 ? 9  PRO B HD3  5  
ATOM 9935  N N    . CYS B 1 10 ? -2.323  -1.983  0.167   1.00 0.35 ? 10 CYS B N    5  
ATOM 9936  C CA   . CYS B 1 10 ? -3.198  -2.155  1.359   1.00 0.35 ? 10 CYS B CA   5  
ATOM 9937  C C    . CYS B 1 10 ? -4.596  -1.615  1.056   1.00 0.35 ? 10 CYS B C    5  
ATOM 9938  O O    . CYS B 1 10 ? -4.755  -0.611  0.391   1.00 0.35 ? 10 CYS B O    5  
ATOM 9939  C CB   . CYS B 1 10 ? -2.601  -1.385  2.539   1.00 0.35 ? 10 CYS B CB   5  
ATOM 9940  S SG   . CYS B 1 10 ? -0.956  -2.042  2.912   1.00 0.35 ? 10 CYS B SG   5  
ATOM 9941  H H    . CYS B 1 10 ? -1.811  -1.155  0.049   1.00 0.35 ? 10 CYS B H    5  
ATOM 9942  H HA   . CYS B 1 10 ? -3.263  -3.203  1.610   1.00 0.35 ? 10 CYS B HA   5  
ATOM 9943  H HB2  . CYS B 1 10 ? -2.522  -0.339  2.284   1.00 0.35 ? 10 CYS B HB2  5  
ATOM 9944  H HB3  . CYS B 1 10 ? -3.238  -1.499  3.403   1.00 0.35 ? 10 CYS B HB3  5  
ATOM 9945  N N    . CYS B 1 11 ? -5.612  -2.275  1.540   1.00 0.32 ? 11 CYS B N    5  
ATOM 9946  C CA   . CYS B 1 11 ? -7.000  -1.800  1.283   1.00 0.32 ? 11 CYS B CA   5  
ATOM 9947  C C    . CYS B 1 11 ? -7.749  -1.681  2.612   1.00 0.32 ? 11 CYS B C    5  
ATOM 9948  O O    . CYS B 1 11 ? -8.047  -2.665  3.258   1.00 0.32 ? 11 CYS B O    5  
ATOM 9949  C CB   . CYS B 1 11 ? -7.722  -2.797  0.376   1.00 0.32 ? 11 CYS B CB   5  
ATOM 9950  S SG   . CYS B 1 11 ? -7.641  -2.220  -1.337  1.00 0.32 ? 11 CYS B SG   5  
ATOM 9951  H H    . CYS B 1 11 ? -5.462  -3.082  2.076   1.00 0.32 ? 11 CYS B H    5  
ATOM 9952  H HA   . CYS B 1 11 ? -6.967  -0.834  0.802   1.00 0.32 ? 11 CYS B HA   5  
ATOM 9953  H HB2  . CYS B 1 11 ? -7.248  -3.765  0.455   1.00 0.32 ? 11 CYS B HB2  5  
ATOM 9954  H HB3  . CYS B 1 11 ? -8.755  -2.877  0.682   1.00 0.32 ? 11 CYS B HB3  5  
ATOM 9955  N N    . PHE B 1 12 ? -8.053  -0.482  3.024   1.00 0.28 ? 12 PHE B N    5  
ATOM 9956  C CA   . PHE B 1 12 ? -8.780  -0.298  4.311   1.00 0.28 ? 12 PHE B CA   5  
ATOM 9957  C C    . PHE B 1 12 ? -10.246 0.028   4.026   1.00 0.28 ? 12 PHE B C    5  
ATOM 9958  O O    . PHE B 1 12 ? -11.116 -0.213  4.841   1.00 0.28 ? 12 PHE B O    5  
ATOM 9959  C CB   . PHE B 1 12 ? -8.141  0.851   5.095   1.00 0.28 ? 12 PHE B CB   5  
ATOM 9960  C CG   . PHE B 1 12 ? -6.648  0.843   4.869   1.00 0.28 ? 12 PHE B CG   5  
ATOM 9961  C CD1  . PHE B 1 12 ? -6.113  1.382   3.693   1.00 0.28 ? 12 PHE B CD1  5  
ATOM 9962  C CD2  . PHE B 1 12 ? -5.797  0.296   5.838   1.00 0.28 ? 12 PHE B CD2  5  
ATOM 9963  C CE1  . PHE B 1 12 ? -4.728  1.374   3.485   1.00 0.28 ? 12 PHE B CE1  5  
ATOM 9964  C CE2  . PHE B 1 12 ? -4.412  0.288   5.629   1.00 0.28 ? 12 PHE B CE2  5  
ATOM 9965  C CZ   . PHE B 1 12 ? -3.878  0.827   4.452   1.00 0.28 ? 12 PHE B CZ   5  
ATOM 9966  H H    . PHE B 1 12 ? -7.802  0.299   2.488   1.00 0.28 ? 12 PHE B H    5  
ATOM 9967  H HA   . PHE B 1 12 ? -8.719  -1.207  4.892   1.00 0.28 ? 12 PHE B HA   5  
ATOM 9968  H HB2  . PHE B 1 12 ? -8.552  1.791   4.755   1.00 0.28 ? 12 PHE B HB2  5  
ATOM 9969  H HB3  . PHE B 1 12 ? -8.347  0.727   6.147   1.00 0.28 ? 12 PHE B HB3  5  
ATOM 9970  H HD1  . PHE B 1 12 ? -6.769  1.805   2.946   1.00 0.28 ? 12 PHE B HD1  5  
ATOM 9971  H HD2  . PHE B 1 12 ? -6.208  -0.120  6.746   1.00 0.28 ? 12 PHE B HD2  5  
ATOM 9972  H HE1  . PHE B 1 12 ? -4.316  1.790   2.576   1.00 0.28 ? 12 PHE B HE1  5  
ATOM 9973  H HE2  . PHE B 1 12 ? -3.756  -0.135  6.376   1.00 0.28 ? 12 PHE B HE2  5  
ATOM 9974  H HZ   . PHE B 1 12 ? -2.810  0.820   4.291   1.00 0.28 ? 12 PHE B HZ   5  
ATOM 9975  N N    . ALA B 1 13 ? -10.530 0.573   2.875   1.00 0.31 ? 13 ALA B N    5  
ATOM 9976  C CA   . ALA B 1 13 ? -11.941 0.912   2.537   1.00 0.31 ? 13 ALA B CA   5  
ATOM 9977  C C    . ALA B 1 13 ? -12.599 -0.284  1.844   1.00 0.31 ? 13 ALA B C    5  
ATOM 9978  O O    . ALA B 1 13 ? -11.945 -1.244  1.488   1.00 0.31 ? 13 ALA B O    5  
ATOM 9979  C CB   . ALA B 1 13 ? -11.965 2.121   1.601   1.00 0.31 ? 13 ALA B CB   5  
ATOM 9980  H H    . ALA B 1 13 ? -9.814  0.758   2.231   1.00 0.31 ? 13 ALA B H    5  
ATOM 9981  H HA   . ALA B 1 13 ? -12.482 1.145   3.442   1.00 0.31 ? 13 ALA B HA   5  
ATOM 9982  H HB1  . ALA B 1 13 ? -11.036 2.171   1.053   1.00 0.31 ? 13 ALA B HB1  5  
ATOM 9983  H HB2  . ALA B 1 13 ? -12.787 2.023   0.907   1.00 0.31 ? 13 ALA B HB2  5  
ATOM 9984  H HB3  . ALA B 1 13 ? -12.090 3.023   2.182   1.00 0.31 ? 13 ALA B HB3  5  
ATOM 9985  N N    . TYR B 1 14 ? -13.888 -0.233  1.648   1.00 0.29 ? 14 TYR B N    5  
ATOM 9986  C CA   . TYR B 1 14 ? -14.584 -1.367  0.977   1.00 0.29 ? 14 TYR B CA   5  
ATOM 9987  C C    . TYR B 1 14 ? -15.667 -0.821  0.045   1.00 0.29 ? 14 TYR B C    5  
ATOM 9988  O O    . TYR B 1 14 ? -16.302 0.175   0.331   1.00 0.29 ? 14 TYR B O    5  
ATOM 9989  C CB   . TYR B 1 14 ? -15.228 -2.268  2.033   1.00 0.29 ? 14 TYR B CB   5  
ATOM 9990  C CG   . TYR B 1 14 ? -14.152 -3.032  2.767   1.00 0.29 ? 14 TYR B CG   5  
ATOM 9991  C CD1  . TYR B 1 14 ? -13.165 -3.718  2.047   1.00 0.29 ? 14 TYR B CD1  5  
ATOM 9992  C CD2  . TYR B 1 14 ? -14.140 -3.056  4.166   1.00 0.29 ? 14 TYR B CD2  5  
ATOM 9993  C CE1  . TYR B 1 14 ? -12.169 -4.427  2.728   1.00 0.29 ? 14 TYR B CE1  5  
ATOM 9994  C CE2  . TYR B 1 14 ? -13.144 -3.765  4.847   1.00 0.29 ? 14 TYR B CE2  5  
ATOM 9995  C CZ   . TYR B 1 14 ? -12.158 -4.450  4.128   1.00 0.29 ? 14 TYR B CZ   5  
ATOM 9996  O OH   . TYR B 1 14 ? -11.175 -5.150  4.797   1.00 0.29 ? 14 TYR B OH   5  
ATOM 9997  H H    . TYR B 1 14 ? -14.398 0.550   1.942   1.00 0.29 ? 14 TYR B H    5  
ATOM 9998  H HA   . TYR B 1 14 ? -13.870 -1.938  0.403   1.00 0.29 ? 14 TYR B HA   5  
ATOM 9999  H HB2  . TYR B 1 14 ? -15.780 -1.661  2.735   1.00 0.29 ? 14 TYR B HB2  5  
ATOM 10000 H HB3  . TYR B 1 14 ? -15.898 -2.964  1.553   1.00 0.29 ? 14 TYR B HB3  5  
ATOM 10001 H HD1  . TYR B 1 14 ? -13.174 -3.700  0.968   1.00 0.29 ? 14 TYR B HD1  5  
ATOM 10002 H HD2  . TYR B 1 14 ? -14.901 -2.527  4.722   1.00 0.29 ? 14 TYR B HD2  5  
ATOM 10003 H HE1  . TYR B 1 14 ? -11.409 -4.956  2.173   1.00 0.29 ? 14 TYR B HE1  5  
ATOM 10004 H HE2  . TYR B 1 14 ? -13.135 -3.783  5.927   1.00 0.29 ? 14 TYR B HE2  5  
ATOM 10005 H HH   . TYR B 1 14 ? -11.268 -6.079  4.576   1.00 0.29 ? 14 TYR B HH   5  
ATOM 10006 N N    . ILE B 1 15 ? -15.884 -1.465  -1.069  1.00 0.32 ? 15 ILE B N    5  
ATOM 10007 C CA   . ILE B 1 15 ? -16.927 -0.983  -2.018  1.00 0.32 ? 15 ILE B CA   5  
ATOM 10008 C C    . ILE B 1 15 ? -18.200 -1.812  -1.841  1.00 0.32 ? 15 ILE B C    5  
ATOM 10009 O O    . ILE B 1 15 ? -18.160 -3.024  -1.786  1.00 0.32 ? 15 ILE B O    5  
ATOM 10010 C CB   . ILE B 1 15 ? -16.417 -1.131  -3.453  1.00 0.32 ? 15 ILE B CB   5  
ATOM 10011 C CG1  . ILE B 1 15 ? -17.404 -0.463  -4.415  1.00 0.32 ? 15 ILE B CG1  5  
ATOM 10012 C CG2  . ILE B 1 15 ? -16.294 -2.615  -3.801  1.00 0.32 ? 15 ILE B CG2  5  
ATOM 10013 C CD1  . ILE B 1 15 ? -16.738 -0.271  -5.777  1.00 0.32 ? 15 ILE B CD1  5  
ATOM 10014 H H    . ILE B 1 15 ? -15.362 -2.267  -1.281  1.00 0.32 ? 15 ILE B H    5  
ATOM 10015 H HA   . ILE B 1 15 ? -17.142 0.056   -1.818  1.00 0.32 ? 15 ILE B HA   5  
ATOM 10016 H HB   . ILE B 1 15 ? -15.450 -0.658  -3.542  1.00 0.32 ? 15 ILE B HB   5  
ATOM 10017 H HG12 . ILE B 1 15 ? -18.278 -1.089  -4.525  1.00 0.32 ? 15 ILE B HG12 5  
ATOM 10018 H HG13 . ILE B 1 15 ? -17.697 0.498   -4.020  1.00 0.32 ? 15 ILE B HG13 5  
ATOM 10019 H HG21 . ILE B 1 15 ? -16.334 -3.201  -2.895  1.00 0.32 ? 15 ILE B HG21 5  
ATOM 10020 H HG22 . ILE B 1 15 ? -17.106 -2.901  -4.452  1.00 0.32 ? 15 ILE B HG22 5  
ATOM 10021 H HG23 . ILE B 1 15 ? -15.353 -2.790  -4.302  1.00 0.32 ? 15 ILE B HG23 5  
ATOM 10022 H HD11 . ILE B 1 15 ? -15.775 -0.759  -5.780  1.00 0.32 ? 15 ILE B HD11 5  
ATOM 10023 H HD12 . ILE B 1 15 ? -17.362 -0.700  -6.547  1.00 0.32 ? 15 ILE B HD12 5  
ATOM 10024 H HD13 . ILE B 1 15 ? -16.607 0.785   -5.968  1.00 0.32 ? 15 ILE B HD13 5  
ATOM 10025 N N    . ALA B 1 16 ? -19.332 -1.167  -1.749  1.00 0.38 ? 16 ALA B N    5  
ATOM 10026 C CA   . ALA B 1 16 ? -20.606 -1.919  -1.576  1.00 0.38 ? 16 ALA B CA   5  
ATOM 10027 C C    . ALA B 1 16 ? -21.106 -2.399  -2.939  1.00 0.38 ? 16 ALA B C    5  
ATOM 10028 O O    . ALA B 1 16 ? -21.801 -3.390  -3.041  1.00 0.38 ? 16 ALA B O    5  
ATOM 10029 C CB   . ALA B 1 16 ? -21.655 -1.004  -0.941  1.00 0.38 ? 16 ALA B CB   5  
ATOM 10030 H H    . ALA B 1 16 ? -19.342 -0.187  -1.795  1.00 0.38 ? 16 ALA B H    5  
ATOM 10031 H HA   . ALA B 1 16 ? -20.437 -2.770  -0.934  1.00 0.38 ? 16 ALA B HA   5  
ATOM 10032 H HB1  . ALA B 1 16 ? -21.375 0.028   -1.098  1.00 0.38 ? 16 ALA B HB1  5  
ATOM 10033 H HB2  . ALA B 1 16 ? -22.617 -1.188  -1.397  1.00 0.38 ? 16 ALA B HB2  5  
ATOM 10034 H HB3  . ALA B 1 16 ? -21.715 -1.203  0.118   1.00 0.38 ? 16 ALA B HB3  5  
ATOM 10035 N N    . ARG B 1 17 ? -20.757 -1.705  -3.988  1.00 0.42 ? 17 ARG B N    5  
ATOM 10036 C CA   . ARG B 1 17 ? -21.214 -2.124  -5.343  1.00 0.42 ? 17 ARG B CA   5  
ATOM 10037 C C    . ARG B 1 17 ? -20.153 -3.026  -5.982  1.00 0.42 ? 17 ARG B C    5  
ATOM 10038 O O    . ARG B 1 17 ? -18.975 -2.867  -5.733  1.00 0.42 ? 17 ARG B O    5  
ATOM 10039 C CB   . ARG B 1 17 ? -21.424 -0.885  -6.216  1.00 0.42 ? 17 ARG B CB   5  
ATOM 10040 C CG   . ARG B 1 17 ? -22.519 -0.010  -5.606  1.00 0.42 ? 17 ARG B CG   5  
ATOM 10041 C CD   . ARG B 1 17 ? -23.351 0.623   -6.724  1.00 0.42 ? 17 ARG B CD   5  
ATOM 10042 N NE   . ARG B 1 17 ? -24.797 0.546   -6.371  1.00 0.42 ? 17 ARG B NE   5  
ATOM 10043 C CZ   . ARG B 1 17 ? -25.581 1.561   -6.612  1.00 0.42 ? 17 ARG B CZ   5  
ATOM 10044 N NH1  . ARG B 1 17 ? -25.204 2.768   -6.291  1.00 0.42 ? 17 ARG B NH1  5  
ATOM 10045 N NH2  . ARG B 1 17 ? -26.744 1.367   -7.173  1.00 0.42 ? 17 ARG B NH2  5  
ATOM 10046 H H    . ARG B 1 17 ? -20.195 -0.909  -3.885  1.00 0.42 ? 17 ARG B H    5  
ATOM 10047 H HA   . ARG B 1 17 ? -22.144 -2.666  -5.258  1.00 0.42 ? 17 ARG B HA   5  
ATOM 10048 H HB2  . ARG B 1 17 ? -20.502 -0.324  -6.272  1.00 0.42 ? 17 ARG B HB2  5  
ATOM 10049 H HB3  . ARG B 1 17 ? -21.720 -1.190  -7.208  1.00 0.42 ? 17 ARG B HB3  5  
ATOM 10050 H HG2  . ARG B 1 17 ? -23.158 -0.617  -4.979  1.00 0.42 ? 17 ARG B HG2  5  
ATOM 10051 H HG3  . ARG B 1 17 ? -22.068 0.771   -5.012  1.00 0.42 ? 17 ARG B HG3  5  
ATOM 10052 H HD2  . ARG B 1 17 ? -23.065 1.656   -6.845  1.00 0.42 ? 17 ARG B HD2  5  
ATOM 10053 H HD3  . ARG B 1 17 ? -23.177 0.089   -7.647  1.00 0.42 ? 17 ARG B HD3  5  
ATOM 10054 H HE   . ARG B 1 17 ? -25.159 -0.267  -5.958  1.00 0.42 ? 17 ARG B HE   5  
ATOM 10055 H HH11 . ARG B 1 17 ? -24.314 2.916   -5.861  1.00 0.42 ? 17 ARG B HH11 5  
ATOM 10056 H HH12 . ARG B 1 17 ? -25.806 3.545   -6.476  1.00 0.42 ? 17 ARG B HH12 5  
ATOM 10057 H HH21 . ARG B 1 17 ? -27.034 0.442   -7.417  1.00 0.42 ? 17 ARG B HH21 5  
ATOM 10058 H HH22 . ARG B 1 17 ? -27.345 2.145   -7.357  1.00 0.42 ? 17 ARG B HH22 5  
ATOM 10059 N N    . PRO B 1 18 ? -20.609 -3.950  -6.790  1.00 0.41 ? 18 PRO B N    5  
ATOM 10060 C CA   . PRO B 1 18 ? -19.727 -4.902  -7.486  1.00 0.41 ? 18 PRO B CA   5  
ATOM 10061 C C    . PRO B 1 18 ? -19.061 -4.233  -8.693  1.00 0.41 ? 18 PRO B C    5  
ATOM 10062 O O    . PRO B 1 18 ? -19.363 -3.107  -9.035  1.00 0.41 ? 18 PRO B O    5  
ATOM 10063 C CB   . PRO B 1 18 ? -20.681 -6.013  -7.934  1.00 0.41 ? 18 PRO B CB   5  
ATOM 10064 C CG   . PRO B 1 18 ? -22.093 -5.383  -7.979  1.00 0.41 ? 18 PRO B CG   5  
ATOM 10065 C CD   . PRO B 1 18 ? -22.046 -4.131  -7.083  1.00 0.41 ? 18 PRO B CD   5  
ATOM 10066 H HA   . PRO B 1 18 ? -18.986 -5.301  -6.813  1.00 0.41 ? 18 PRO B HA   5  
ATOM 10067 H HB2  . PRO B 1 18 ? -20.398 -6.369  -8.916  1.00 0.41 ? 18 PRO B HB2  5  
ATOM 10068 H HB3  . PRO B 1 18 ? -20.667 -6.824  -7.225  1.00 0.41 ? 18 PRO B HB3  5  
ATOM 10069 H HG2  . PRO B 1 18 ? -22.343 -5.106  -8.994  1.00 0.41 ? 18 PRO B HG2  5  
ATOM 10070 H HG3  . PRO B 1 18 ? -22.822 -6.080  -7.594  1.00 0.41 ? 18 PRO B HG3  5  
ATOM 10071 H HD2  . PRO B 1 18 ? -22.439 -3.274  -7.611  1.00 0.41 ? 18 PRO B HD2  5  
ATOM 10072 H HD3  . PRO B 1 18 ? -22.594 -4.298  -6.168  1.00 0.41 ? 18 PRO B HD3  5  
ATOM 10073 N N    . LEU B 1 19 ? -18.159 -4.919  -9.339  1.00 0.45 ? 19 LEU B N    5  
ATOM 10074 C CA   . LEU B 1 19 ? -17.473 -4.327  -10.523 1.00 0.45 ? 19 LEU B CA   5  
ATOM 10075 C C    . LEU B 1 19 ? -17.567 -5.307  -11.697 1.00 0.45 ? 19 LEU B C    5  
ATOM 10076 O O    . LEU B 1 19 ? -18.018 -6.422  -11.534 1.00 0.45 ? 19 LEU B O    5  
ATOM 10077 C CB   . LEU B 1 19 ? -15.995 -4.064  -10.198 1.00 0.45 ? 19 LEU B CB   5  
ATOM 10078 C CG   . LEU B 1 19 ? -15.798 -3.960  -8.683  1.00 0.45 ? 19 LEU B CG   5  
ATOM 10079 C CD1  . LEU B 1 19 ? -15.860 -5.356  -8.060  1.00 0.45 ? 19 LEU B CD1  5  
ATOM 10080 C CD2  . LEU B 1 19 ? -14.433 -3.335  -8.391  1.00 0.45 ? 19 LEU B CD2  5  
ATOM 10081 H H    . LEU B 1 19 ? -17.932 -5.827  -9.045  1.00 0.45 ? 19 LEU B H    5  
ATOM 10082 H HA   . LEU B 1 19 ? -17.955 -3.398  -10.790 1.00 0.45 ? 19 LEU B HA   5  
ATOM 10083 H HB2  . LEU B 1 19 ? -15.395 -4.874  -10.582 1.00 0.45 ? 19 LEU B HB2  5  
ATOM 10084 H HB3  . LEU B 1 19 ? -15.687 -3.139  -10.659 1.00 0.45 ? 19 LEU B HB3  5  
ATOM 10085 H HG   . LEU B 1 19 ? -16.578 -3.342  -8.259  1.00 0.45 ? 19 LEU B HG   5  
ATOM 10086 H HD11 . LEU B 1 19 ? -15.738 -6.100  -8.833  1.00 0.45 ? 19 LEU B HD11 5  
ATOM 10087 H HD12 . LEU B 1 19 ? -15.070 -5.460  -7.331  1.00 0.45 ? 19 LEU B HD12 5  
ATOM 10088 H HD13 . LEU B 1 19 ? -16.817 -5.492  -7.577  1.00 0.45 ? 19 LEU B HD13 5  
ATOM 10089 H HD21 . LEU B 1 19 ? -14.325 -2.424  -8.960  1.00 0.45 ? 19 LEU B HD21 5  
ATOM 10090 H HD22 . LEU B 1 19 ? -14.356 -3.112  -7.337  1.00 0.45 ? 19 LEU B HD22 5  
ATOM 10091 H HD23 . LEU B 1 19 ? -13.654 -4.029  -8.670  1.00 0.45 ? 19 LEU B HD23 5  
ATOM 10092 N N    . PRO B 1 20 ? -17.136 -4.859  -12.849 1.00 0.58 ? 20 PRO B N    5  
ATOM 10093 C CA   . PRO B 1 20 ? -17.157 -5.677  -14.073 1.00 0.58 ? 20 PRO B CA   5  
ATOM 10094 C C    . PRO B 1 20 ? -15.991 -6.670  -14.067 1.00 0.58 ? 20 PRO B C    5  
ATOM 10095 O O    . PRO B 1 20 ? -14.853 -6.307  -14.288 1.00 0.58 ? 20 PRO B O    5  
ATOM 10096 C CB   . PRO B 1 20 ? -16.995 -4.647  -15.195 1.00 0.58 ? 20 PRO B CB   5  
ATOM 10097 C CG   . PRO B 1 20 ? -16.333 -3.403  -14.554 1.00 0.58 ? 20 PRO B CG   5  
ATOM 10098 C CD   . PRO B 1 20 ? -16.588 -3.500  -13.038 1.00 0.58 ? 20 PRO B CD   5  
ATOM 10099 H HA   . PRO B 1 20 ? -18.098 -6.190  -14.175 1.00 0.58 ? 20 PRO B HA   5  
ATOM 10100 H HB2  . PRO B 1 20 ? -16.363 -5.048  -15.976 1.00 0.58 ? 20 PRO B HB2  5  
ATOM 10101 H HB3  . PRO B 1 20 ? -17.961 -4.380  -15.596 1.00 0.58 ? 20 PRO B HB3  5  
ATOM 10102 H HG2  . PRO B 1 20 ? -15.271 -3.406  -14.755 1.00 0.58 ? 20 PRO B HG2  5  
ATOM 10103 H HG3  . PRO B 1 20 ? -16.784 -2.503  -14.942 1.00 0.58 ? 20 PRO B HG3  5  
ATOM 10104 H HD2  . PRO B 1 20 ? -15.661 -3.383  -12.494 1.00 0.58 ? 20 PRO B HD2  5  
ATOM 10105 H HD3  . PRO B 1 20 ? -17.309 -2.760  -12.726 1.00 0.58 ? 20 PRO B HD3  5  
ATOM 10106 N N    . ARG B 1 21 ? -16.266 -7.920  -13.814 1.00 0.75 ? 21 ARG B N    5  
ATOM 10107 C CA   . ARG B 1 21 ? -15.175 -8.935  -13.791 1.00 0.75 ? 21 ARG B CA   5  
ATOM 10108 C C    . ARG B 1 21 ? -14.577 -9.073  -15.193 1.00 0.75 ? 21 ARG B C    5  
ATOM 10109 O O    . ARG B 1 21 ? -13.503 -9.614  -15.370 1.00 0.75 ? 21 ARG B O    5  
ATOM 10110 C CB   . ARG B 1 21 ? -15.739 -10.283 -13.342 1.00 0.75 ? 21 ARG B CB   5  
ATOM 10111 C CG   . ARG B 1 21 ? -16.957 -10.640 -14.197 1.00 0.75 ? 21 ARG B CG   5  
ATOM 10112 C CD   . ARG B 1 21 ? -17.426 -12.055 -13.854 1.00 0.75 ? 21 ARG B CD   5  
ATOM 10113 N NE   . ARG B 1 21 ? -16.438 -13.044 -14.370 1.00 0.75 ? 21 ARG B NE   5  
ATOM 10114 C CZ   . ARG B 1 21 ? -16.807 -13.943 -15.240 1.00 0.75 ? 21 ARG B CZ   5  
ATOM 10115 N NH1  . ARG B 1 21 ? -17.689 -14.846 -14.911 1.00 0.75 ? 21 ARG B NH1  5  
ATOM 10116 N NH2  . ARG B 1 21 ? -16.296 -13.938 -16.441 1.00 0.75 ? 21 ARG B NH2  5  
ATOM 10117 H H    . ARG B 1 21 ? -17.190 -8.191  -13.637 1.00 0.75 ? 21 ARG B H    5  
ATOM 10118 H HA   . ARG B 1 21 ? -14.406 -8.619  -13.102 1.00 0.75 ? 21 ARG B HA   5  
ATOM 10119 H HB2  . ARG B 1 21 ? -14.983 -11.046 -13.456 1.00 0.75 ? 21 ARG B HB2  5  
ATOM 10120 H HB3  . ARG B 1 21 ? -16.036 -10.222 -12.305 1.00 0.75 ? 21 ARG B HB3  5  
ATOM 10121 H HG2  . ARG B 1 21 ? -17.754 -9.939  -13.999 1.00 0.75 ? 21 ARG B HG2  5  
ATOM 10122 H HG3  . ARG B 1 21 ? -16.689 -10.595 -15.241 1.00 0.75 ? 21 ARG B HG3  5  
ATOM 10123 H HD2  . ARG B 1 21 ? -17.510 -12.157 -12.782 1.00 0.75 ? 21 ARG B HD2  5  
ATOM 10124 H HD3  . ARG B 1 21 ? -18.387 -12.236 -14.310 1.00 0.75 ? 21 ARG B HD3  5  
ATOM 10125 H HE   . ARG B 1 21 ? -15.510 -13.019 -14.055 1.00 0.75 ? 21 ARG B HE   5  
ATOM 10126 H HH11 . ARG B 1 21 ? -18.082 -14.850 -13.990 1.00 0.75 ? 21 ARG B HH11 5  
ATOM 10127 H HH12 . ARG B 1 21 ? -17.973 -15.535 -15.578 1.00 0.75 ? 21 ARG B HH12 5  
ATOM 10128 H HH21 . ARG B 1 21 ? -15.620 -13.245 -16.694 1.00 0.75 ? 21 ARG B HH21 5  
ATOM 10129 H HH22 . ARG B 1 21 ? -16.580 -14.627 -17.108 1.00 0.75 ? 21 ARG B HH22 5  
ATOM 10130 N N    . ALA B 1 22 ? -15.262 -8.588  -16.192 1.00 0.89 ? 22 ALA B N    5  
ATOM 10131 C CA   . ALA B 1 22 ? -14.731 -8.692  -17.580 1.00 0.89 ? 22 ALA B CA   5  
ATOM 10132 C C    . ALA B 1 22 ? -13.553 -7.729  -17.749 1.00 0.89 ? 22 ALA B C    5  
ATOM 10133 O O    . ALA B 1 22 ? -12.707 -7.910  -18.600 1.00 0.89 ? 22 ALA B O    5  
ATOM 10134 C CB   . ALA B 1 22 ? -15.833 -8.329  -18.577 1.00 0.89 ? 22 ALA B CB   5  
ATOM 10135 H H    . ALA B 1 22 ? -16.126 -8.154  -16.029 1.00 0.89 ? 22 ALA B H    5  
ATOM 10136 H HA   . ALA B 1 22 ? -14.397 -9.703  -17.763 1.00 0.89 ? 22 ALA B HA   5  
ATOM 10137 H HB1  . ALA B 1 22 ? -16.565 -7.701  -18.092 1.00 0.89 ? 22 ALA B HB1  5  
ATOM 10138 H HB2  . ALA B 1 22 ? -15.401 -7.800  -19.414 1.00 0.89 ? 22 ALA B HB2  5  
ATOM 10139 H HB3  . ALA B 1 22 ? -16.310 -9.232  -18.930 1.00 0.89 ? 22 ALA B HB3  5  
ATOM 10140 N N    . HIS B 1 23 ? -13.494 -6.704  -16.941 1.00 0.71 ? 23 HIS B N    5  
ATOM 10141 C CA   . HIS B 1 23 ? -12.372 -5.730  -17.056 1.00 0.71 ? 23 HIS B CA   5  
ATOM 10142 C C    . HIS B 1 23 ? -11.435 -5.885  -15.856 1.00 0.71 ? 23 HIS B C    5  
ATOM 10143 O O    . HIS B 1 23 ? -10.522 -5.106  -15.667 1.00 0.71 ? 23 HIS B O    5  
ATOM 10144 C CB   . HIS B 1 23 ? -12.933 -4.307  -17.084 1.00 0.71 ? 23 HIS B CB   5  
ATOM 10145 C CG   . HIS B 1 23 ? -13.928 -4.183  -18.205 1.00 0.71 ? 23 HIS B CG   5  
ATOM 10146 N ND1  . HIS B 1 23 ? -13.996 -3.059  -19.013 1.00 0.71 ? 23 HIS B ND1  5  
ATOM 10147 C CD2  . HIS B 1 23 ? -14.903 -5.034  -18.664 1.00 0.71 ? 23 HIS B CD2  5  
ATOM 10148 C CE1  . HIS B 1 23 ? -14.980 -3.262  -19.908 1.00 0.71 ? 23 HIS B CE1  5  
ATOM 10149 N NE2  . HIS B 1 23 ? -15.566 -4.450  -19.740 1.00 0.71 ? 23 HIS B NE2  5  
ATOM 10150 H H    . HIS B 1 23 ? -14.187 -6.575  -16.262 1.00 0.71 ? 23 HIS B H    5  
ATOM 10151 H HA   . HIS B 1 23 ? -11.825 -5.919  -17.967 1.00 0.71 ? 23 HIS B HA   5  
ATOM 10152 H HB2  . HIS B 1 23 ? -13.420 -4.094  -16.144 1.00 0.71 ? 23 HIS B HB2  5  
ATOM 10153 H HB3  . HIS B 1 23 ? -12.128 -3.605  -17.240 1.00 0.71 ? 23 HIS B HB3  5  
ATOM 10154 H HD1  . HIS B 1 23 ? -13.429 -2.262  -18.945 1.00 0.71 ? 23 HIS B HD1  5  
ATOM 10155 H HD2  . HIS B 1 23 ? -15.120 -6.008  -18.252 1.00 0.71 ? 23 HIS B HD2  5  
ATOM 10156 H HE1  . HIS B 1 23 ? -15.262 -2.550  -20.670 1.00 0.71 ? 23 HIS B HE1  5  
ATOM 10157 N N    . ILE B 1 24 ? -11.652 -6.883  -15.044 1.00 0.56 ? 24 ILE B N    5  
ATOM 10158 C CA   . ILE B 1 24 ? -10.772 -7.083  -13.858 1.00 0.56 ? 24 ILE B CA   5  
ATOM 10159 C C    . ILE B 1 24 ? -9.596  -7.984  -14.243 1.00 0.56 ? 24 ILE B C    5  
ATOM 10160 O O    . ILE B 1 24 ? -9.716  -9.192  -14.286 1.00 0.56 ? 24 ILE B O    5  
ATOM 10161 C CB   . ILE B 1 24 ? -11.572 -7.740  -12.733 1.00 0.56 ? 24 ILE B CB   5  
ATOM 10162 C CG1  . ILE B 1 24 ? -12.557 -6.724  -12.148 1.00 0.56 ? 24 ILE B CG1  5  
ATOM 10163 C CG2  . ILE B 1 24 ? -10.619 -8.213  -11.634 1.00 0.56 ? 24 ILE B CG2  5  
ATOM 10164 C CD1  . ILE B 1 24 ? -13.300 -7.353  -10.968 1.00 0.56 ? 24 ILE B CD1  5  
ATOM 10165 H H    . ILE B 1 24 ? -12.393 -7.501  -15.213 1.00 0.56 ? 24 ILE B H    5  
ATOM 10166 H HA   . ILE B 1 24 ? -10.397 -6.127  -13.523 1.00 0.56 ? 24 ILE B HA   5  
ATOM 10167 H HB   . ILE B 1 24 ? -12.117 -8.587  -13.126 1.00 0.56 ? 24 ILE B HB   5  
ATOM 10168 H HG12 . ILE B 1 24 ? -12.015 -5.852  -11.810 1.00 0.56 ? 24 ILE B HG12 5  
ATOM 10169 H HG13 . ILE B 1 24 ? -13.268 -6.434  -12.907 1.00 0.56 ? 24 ILE B HG13 5  
ATOM 10170 H HG21 . ILE B 1 24 ? -9.830  -7.487  -11.504 1.00 0.56 ? 24 ILE B HG21 5  
ATOM 10171 H HG22 . ILE B 1 24 ? -11.163 -8.325  -10.709 1.00 0.56 ? 24 ILE B HG22 5  
ATOM 10172 H HG23 . ILE B 1 24 ? -10.189 -9.163  -11.916 1.00 0.56 ? 24 ILE B HG23 5  
ATOM 10173 H HD11 . ILE B 1 24 ? -12.594 -7.854  -10.323 1.00 0.56 ? 24 ILE B HD11 5  
ATOM 10174 H HD12 . ILE B 1 24 ? -13.812 -6.581  -10.412 1.00 0.56 ? 24 ILE B HD12 5  
ATOM 10175 H HD13 . ILE B 1 24 ? -14.020 -8.069  -11.338 1.00 0.56 ? 24 ILE B HD13 5  
ATOM 10176 N N    . LYS B 1 25 ? -8.461  -7.406  -14.523 1.00 0.59 ? 25 LYS B N    5  
ATOM 10177 C CA   . LYS B 1 25 ? -7.279  -8.227  -14.905 1.00 0.59 ? 25 LYS B CA   5  
ATOM 10178 C C    . LYS B 1 25 ? -7.029  -9.291  -13.835 1.00 0.59 ? 25 LYS B C    5  
ATOM 10179 O O    . LYS B 1 25 ? -7.139  -10.475 -14.086 1.00 0.59 ? 25 LYS B O    5  
ATOM 10180 C CB   . LYS B 1 25 ? -6.051  -7.325  -15.022 1.00 0.59 ? 25 LYS B CB   5  
ATOM 10181 C CG   . LYS B 1 25 ? -5.124  -7.869  -16.107 1.00 0.59 ? 25 LYS B CG   5  
ATOM 10182 C CD   . LYS B 1 25 ? -3.899  -6.964  -16.238 1.00 0.59 ? 25 LYS B CD   5  
ATOM 10183 C CE   . LYS B 1 25 ? -2.710  -7.604  -15.517 1.00 0.59 ? 25 LYS B CE   5  
ATOM 10184 N NZ   . LYS B 1 25 ? -1.506  -6.741  -15.680 1.00 0.59 ? 25 LYS B NZ   5  
ATOM 10185 H H    . LYS B 1 25 ? -8.384  -6.431  -14.484 1.00 0.59 ? 25 LYS B H    5  
ATOM 10186 H HA   . LYS B 1 25 ? -7.466  -8.707  -15.854 1.00 0.59 ? 25 LYS B HA   5  
ATOM 10187 H HB2  . LYS B 1 25 ? -6.363  -6.323  -15.283 1.00 0.59 ? 25 LYS B HB2  5  
ATOM 10188 H HB3  . LYS B 1 25 ? -5.526  -7.305  -14.079 1.00 0.59 ? 25 LYS B HB3  5  
ATOM 10189 H HG2  . LYS B 1 25 ? -4.809  -8.868  -15.841 1.00 0.59 ? 25 LYS B HG2  5  
ATOM 10190 H HG3  . LYS B 1 25 ? -5.651  -7.897  -17.049 1.00 0.59 ? 25 LYS B HG3  5  
ATOM 10191 H HD2  . LYS B 1 25 ? -3.659  -6.831  -17.282 1.00 0.59 ? 25 LYS B HD2  5  
ATOM 10192 H HD3  . LYS B 1 25 ? -4.111  -6.004  -15.792 1.00 0.59 ? 25 LYS B HD3  5  
ATOM 10193 H HE2  . LYS B 1 25 ? -2.939  -7.708  -14.467 1.00 0.59 ? 25 LYS B HE2  5  
ATOM 10194 H HE3  . LYS B 1 25 ? -2.516  -8.578  -15.940 1.00 0.59 ? 25 LYS B HE3  5  
ATOM 10195 H HZ1  . LYS B 1 25 ? -1.475  -6.369  -16.650 1.00 0.59 ? 25 LYS B HZ1  5  
ATOM 10196 H HZ2  . LYS B 1 25 ? -1.553  -5.951  -15.005 1.00 0.59 ? 25 LYS B HZ2  5  
ATOM 10197 H HZ3  . LYS B 1 25 ? -0.650  -7.301  -15.498 1.00 0.59 ? 25 LYS B HZ3  5  
ATOM 10198 N N    . GLU B 1 26 ? -6.687  -8.880  -12.645 1.00 0.53 ? 26 GLU B N    5  
ATOM 10199 C CA   . GLU B 1 26 ? -6.426  -9.870  -11.564 1.00 0.53 ? 26 GLU B CA   5  
ATOM 10200 C C    . GLU B 1 26 ? -6.572  -9.190  -10.202 1.00 0.53 ? 26 GLU B C    5  
ATOM 10201 O O    . GLU B 1 26 ? -6.354  -8.003  -10.063 1.00 0.53 ? 26 GLU B O    5  
ATOM 10202 C CB   . GLU B 1 26 ? -5.005  -10.416 -11.708 1.00 0.53 ? 26 GLU B CB   5  
ATOM 10203 C CG   . GLU B 1 26 ? -4.002  -9.270  -11.563 1.00 0.53 ? 26 GLU B CG   5  
ATOM 10204 C CD   . GLU B 1 26 ? -2.633  -9.720  -12.076 1.00 0.53 ? 26 GLU B CD   5  
ATOM 10205 O OE1  . GLU B 1 26 ? -2.533  -10.020 -13.255 1.00 0.53 ? 26 GLU B OE1  5  
ATOM 10206 O OE2  . GLU B 1 26 ? -1.707  -9.758  -11.282 1.00 0.53 ? 26 GLU B OE2  5  
ATOM 10207 H H    . GLU B 1 26 ? -6.601  -7.921  -12.464 1.00 0.53 ? 26 GLU B H    5  
ATOM 10208 H HA   . GLU B 1 26 ? -7.133  -10.682 -11.640 1.00 0.53 ? 26 GLU B HA   5  
ATOM 10209 H HB2  . GLU B 1 26 ? -4.823  -11.155 -10.941 1.00 0.53 ? 26 GLU B HB2  5  
ATOM 10210 H HB3  . GLU B 1 26 ? -4.890  -10.871 -12.681 1.00 0.53 ? 26 GLU B HB3  5  
ATOM 10211 H HG2  . GLU B 1 26 ? -4.342  -8.420  -12.138 1.00 0.53 ? 26 GLU B HG2  5  
ATOM 10212 H HG3  . GLU B 1 26 ? -3.920  -8.993  -10.522 1.00 0.53 ? 26 GLU B HG3  5  
ATOM 10213 N N    . TYR B 1 27 ? -6.937  -9.933  -9.193  1.00 0.39 ? 27 TYR B N    5  
ATOM 10214 C CA   . TYR B 1 27 ? -7.093  -9.328  -7.841  1.00 0.39 ? 27 TYR B CA   5  
ATOM 10215 C C    . TYR B 1 27 ? -6.103  -9.983  -6.874  1.00 0.39 ? 27 TYR B C    5  
ATOM 10216 O O    . TYR B 1 27 ? -5.281  -10.788 -7.264  1.00 0.39 ? 27 TYR B O    5  
ATOM 10217 C CB   . TYR B 1 27 ? -8.526  -9.549  -7.343  1.00 0.39 ? 27 TYR B CB   5  
ATOM 10218 C CG   . TYR B 1 27 ? -8.707  -10.991 -6.931  1.00 0.39 ? 27 TYR B CG   5  
ATOM 10219 C CD1  . TYR B 1 27 ? -9.095  -11.947 -7.877  1.00 0.39 ? 27 TYR B CD1  5  
ATOM 10220 C CD2  . TYR B 1 27 ? -8.487  -11.372 -5.602  1.00 0.39 ? 27 TYR B CD2  5  
ATOM 10221 C CE1  . TYR B 1 27 ? -9.263  -13.284 -7.494  1.00 0.39 ? 27 TYR B CE1  5  
ATOM 10222 C CE2  . TYR B 1 27 ? -8.656  -12.707 -5.219  1.00 0.39 ? 27 TYR B CE2  5  
ATOM 10223 C CZ   . TYR B 1 27 ? -9.043  -13.663 -6.165  1.00 0.39 ? 27 TYR B CZ   5  
ATOM 10224 O OH   . TYR B 1 27 ? -9.208  -14.980 -5.788  1.00 0.39 ? 27 TYR B OH   5  
ATOM 10225 H H    . TYR B 1 27 ? -7.107  -10.889 -9.324  1.00 0.39 ? 27 TYR B H    5  
ATOM 10226 H HA   . TYR B 1 27 ? -6.892  -8.269  -7.897  1.00 0.39 ? 27 TYR B HA   5  
ATOM 10227 H HB2  . TYR B 1 27 ? -8.715  -8.908  -6.495  1.00 0.39 ? 27 TYR B HB2  5  
ATOM 10228 H HB3  . TYR B 1 27 ? -9.221  -9.312  -8.134  1.00 0.39 ? 27 TYR B HB3  5  
ATOM 10229 H HD1  . TYR B 1 27 ? -9.265  -11.654 -8.903  1.00 0.39 ? 27 TYR B HD1  5  
ATOM 10230 H HD2  . TYR B 1 27 ? -8.188  -10.634 -4.872  1.00 0.39 ? 27 TYR B HD2  5  
ATOM 10231 H HE1  . TYR B 1 27 ? -9.563  -14.020 -8.224  1.00 0.39 ? 27 TYR B HE1  5  
ATOM 10232 H HE2  . TYR B 1 27 ? -8.486  -13.000 -4.193  1.00 0.39 ? 27 TYR B HE2  5  
ATOM 10233 H HH   . TYR B 1 27 ? -8.509  -15.202 -5.168  1.00 0.39 ? 27 TYR B HH   5  
ATOM 10234 N N    . PHE B 1 28 ? -6.174  -9.647  -5.614  1.00 0.35 ? 28 PHE B N    5  
ATOM 10235 C CA   . PHE B 1 28 ? -5.236  -10.254 -4.628  1.00 0.35 ? 28 PHE B CA   5  
ATOM 10236 C C    . PHE B 1 28 ? -5.544  -9.714  -3.231  1.00 0.35 ? 28 PHE B C    5  
ATOM 10237 O O    . PHE B 1 28 ? -6.047  -8.619  -3.074  1.00 0.35 ? 28 PHE B O    5  
ATOM 10238 C CB   . PHE B 1 28 ? -3.797  -9.900  -5.009  1.00 0.35 ? 28 PHE B CB   5  
ATOM 10239 C CG   . PHE B 1 28 ? -3.644  -8.400  -5.065  1.00 0.35 ? 28 PHE B CG   5  
ATOM 10240 C CD1  . PHE B 1 28 ? -3.633  -7.653  -3.881  1.00 0.35 ? 28 PHE B CD1  5  
ATOM 10241 C CD2  . PHE B 1 28 ? -3.511  -7.754  -6.301  1.00 0.35 ? 28 PHE B CD2  5  
ATOM 10242 C CE1  . PHE B 1 28 ? -3.490  -6.261  -3.932  1.00 0.35 ? 28 PHE B CE1  5  
ATOM 10243 C CE2  . PHE B 1 28 ? -3.367  -6.363  -6.352  1.00 0.35 ? 28 PHE B CE2  5  
ATOM 10244 C CZ   . PHE B 1 28 ? -3.356  -5.616  -5.167  1.00 0.35 ? 28 PHE B CZ   5  
ATOM 10245 H H    . PHE B 1 28 ? -6.844  -8.996  -5.317  1.00 0.35 ? 28 PHE B H    5  
ATOM 10246 H HA   . PHE B 1 28 ? -5.355  -11.327 -4.633  1.00 0.35 ? 28 PHE B HA   5  
ATOM 10247 H HB2  . PHE B 1 28 ? -3.120  -10.304 -4.271  1.00 0.35 ? 28 PHE B HB2  5  
ATOM 10248 H HB3  . PHE B 1 28 ? -3.567  -10.321 -5.976  1.00 0.35 ? 28 PHE B HB3  5  
ATOM 10249 H HD1  . PHE B 1 28 ? -3.735  -8.150  -2.928  1.00 0.35 ? 28 PHE B HD1  5  
ATOM 10250 H HD2  . PHE B 1 28 ? -3.519  -8.330  -7.214  1.00 0.35 ? 28 PHE B HD2  5  
ATOM 10251 H HE1  . PHE B 1 28 ? -3.482  -5.686  -3.018  1.00 0.35 ? 28 PHE B HE1  5  
ATOM 10252 H HE2  . PHE B 1 28 ? -3.265  -5.865  -7.304  1.00 0.35 ? 28 PHE B HE2  5  
ATOM 10253 H HZ   . PHE B 1 28 ? -3.245  -4.542  -5.207  1.00 0.35 ? 28 PHE B HZ   5  
ATOM 10254 N N    . TYR B 1 29 ? -5.244  -10.473 -2.211  1.00 0.32 ? 29 TYR B N    5  
ATOM 10255 C CA   . TYR B 1 29 ? -5.521  -10.002 -0.825  1.00 0.32 ? 29 TYR B CA   5  
ATOM 10256 C C    . TYR B 1 29 ? -4.307  -9.239  -0.290  1.00 0.32 ? 29 TYR B C    5  
ATOM 10257 O O    . TYR B 1 29 ? -3.221  -9.329  -0.825  1.00 0.32 ? 29 TYR B O    5  
ATOM 10258 C CB   . TYR B 1 29 ? -5.801  -11.207 0.078   1.00 0.32 ? 29 TYR B CB   5  
ATOM 10259 C CG   . TYR B 1 29 ? -7.020  -11.944 -0.421  1.00 0.32 ? 29 TYR B CG   5  
ATOM 10260 C CD1  . TYR B 1 29 ? -6.909  -12.836 -1.495  1.00 0.32 ? 29 TYR B CD1  5  
ATOM 10261 C CD2  . TYR B 1 29 ? -8.262  -11.741 0.194   1.00 0.32 ? 29 TYR B CD2  5  
ATOM 10262 C CE1  . TYR B 1 29 ? -8.039  -13.523 -1.955  1.00 0.32 ? 29 TYR B CE1  5  
ATOM 10263 C CE2  . TYR B 1 29 ? -9.391  -12.429 -0.265  1.00 0.32 ? 29 TYR B CE2  5  
ATOM 10264 C CZ   . TYR B 1 29 ? -9.280  -13.320 -1.340  1.00 0.32 ? 29 TYR B CZ   5  
ATOM 10265 O OH   . TYR B 1 29 ? -10.394 -13.997 -1.792  1.00 0.32 ? 29 TYR B OH   5  
ATOM 10266 H H    . TYR B 1 29 ? -4.839  -11.353 -2.358  1.00 0.32 ? 29 TYR B H    5  
ATOM 10267 H HA   . TYR B 1 29 ? -6.383  -9.350  -0.831  1.00 0.32 ? 29 TYR B HA   5  
ATOM 10268 H HB2  . TYR B 1 29 ? -4.948  -11.870 0.065   1.00 0.32 ? 29 TYR B HB2  5  
ATOM 10269 H HB3  . TYR B 1 29 ? -5.975  -10.866 1.087   1.00 0.32 ? 29 TYR B HB3  5  
ATOM 10270 H HD1  . TYR B 1 29 ? -5.952  -12.993 -1.970  1.00 0.32 ? 29 TYR B HD1  5  
ATOM 10271 H HD2  . TYR B 1 29 ? -8.348  -11.053 1.021   1.00 0.32 ? 29 TYR B HD2  5  
ATOM 10272 H HE1  . TYR B 1 29 ? -7.953  -14.210 -2.783  1.00 0.32 ? 29 TYR B HE1  5  
ATOM 10273 H HE2  . TYR B 1 29 ? -10.349 -12.271 0.209   1.00 0.32 ? 29 TYR B HE2  5  
ATOM 10274 H HH   . TYR B 1 29 ? -11.159 -13.651 -1.329  1.00 0.32 ? 29 TYR B HH   5  
ATOM 10275 N N    . THR B 1 30 ? -4.484  -8.491  0.764   1.00 0.37 ? 30 THR B N    5  
ATOM 10276 C CA   . THR B 1 30 ? -3.342  -7.723  1.337   1.00 0.37 ? 30 THR B CA   5  
ATOM 10277 C C    . THR B 1 30 ? -3.587  -7.485  2.828   1.00 0.37 ? 30 THR B C    5  
ATOM 10278 O O    . THR B 1 30 ? -4.708  -7.308  3.262   1.00 0.37 ? 30 THR B O    5  
ATOM 10279 C CB   . THR B 1 30 ? -3.219  -6.377  0.619   1.00 0.37 ? 30 THR B CB   5  
ATOM 10280 O OG1  . THR B 1 30 ? -4.478  -6.022  0.064   1.00 0.37 ? 30 THR B OG1  5  
ATOM 10281 C CG2  . THR B 1 30 ? -2.180  -6.487  -0.498  1.00 0.37 ? 30 THR B CG2  5  
ATOM 10282 H H    . THR B 1 30 ? -5.369  -8.434  1.181   1.00 0.37 ? 30 THR B H    5  
ATOM 10283 H HA   . THR B 1 30 ? -2.429  -8.286  1.207   1.00 0.37 ? 30 THR B HA   5  
ATOM 10284 H HB   . THR B 1 30 ? -2.907  -5.622  1.322   1.00 0.37 ? 30 THR B HB   5  
ATOM 10285 H HG1  . THR B 1 30 ? -4.743  -5.181  0.445   1.00 0.37 ? 30 THR B HG1  5  
ATOM 10286 H HG21 . THR B 1 30 ? -1.773  -7.487  -0.515  1.00 0.37 ? 30 THR B HG21 5  
ATOM 10287 H HG22 . THR B 1 30 ? -2.646  -6.271  -1.447  1.00 0.37 ? 30 THR B HG22 5  
ATOM 10288 H HG23 . THR B 1 30 ? -1.384  -5.778  -0.318  1.00 0.37 ? 30 THR B HG23 5  
ATOM 10289 N N    . SER B 1 31 ? -2.548  -7.479  3.619   1.00 0.47 ? 31 SER B N    5  
ATOM 10290 C CA   . SER B 1 31 ? -2.730  -7.252  5.080   1.00 0.47 ? 31 SER B CA   5  
ATOM 10291 C C    . SER B 1 31 ? -1.369  -7.274  5.781   1.00 0.47 ? 31 SER B C    5  
ATOM 10292 O O    . SER B 1 31 ? -1.158  -6.598  6.767   1.00 0.47 ? 31 SER B O    5  
ATOM 10293 C CB   . SER B 1 31 ? -3.617  -8.354  5.660   1.00 0.47 ? 31 SER B CB   5  
ATOM 10294 O OG   . SER B 1 31 ? -2.802  -9.430  6.104   1.00 0.47 ? 31 SER B OG   5  
ATOM 10295 H H    . SER B 1 31 ? -1.650  -7.623  3.252   1.00 0.47 ? 31 SER B H    5  
ATOM 10296 H HA   . SER B 1 31 ? -3.198  -6.292  5.239   1.00 0.47 ? 31 SER B HA   5  
ATOM 10297 H HB2  . SER B 1 31 ? -4.177  -7.966  6.495   1.00 0.47 ? 31 SER B HB2  5  
ATOM 10298 H HB3  . SER B 1 31 ? -4.305  -8.698  4.898   1.00 0.47 ? 31 SER B HB3  5  
ATOM 10299 H HG   . SER B 1 31 ? -3.087  -9.675  6.986   1.00 0.47 ? 31 SER B HG   5  
ATOM 10300 N N    . GLY B 1 32 ? -0.444  -8.048  5.281   1.00 0.60 ? 32 GLY B N    5  
ATOM 10301 C CA   . GLY B 1 32 ? 0.900   -8.113  5.923   1.00 0.60 ? 32 GLY B CA   5  
ATOM 10302 C C    . GLY B 1 32 ? 1.365   -6.701  6.282   1.00 0.60 ? 32 GLY B C    5  
ATOM 10303 O O    . GLY B 1 32 ? 1.327   -6.297  7.427   1.00 0.60 ? 32 GLY B O    5  
ATOM 10304 H H    . GLY B 1 32 ? -0.634  -8.589  4.487   1.00 0.60 ? 32 GLY B H    5  
ATOM 10305 H HA2  . GLY B 1 32 ? 0.842   -8.714  6.818   1.00 0.60 ? 32 GLY B HA2  5  
ATOM 10306 H HA3  . GLY B 1 32 ? 1.605   -8.556  5.236   1.00 0.60 ? 32 GLY B HA3  5  
ATOM 10307 N N    . LYS B 1 33 ? 1.806   -5.947  5.312   1.00 0.55 ? 33 LYS B N    5  
ATOM 10308 C CA   . LYS B 1 33 ? 2.272   -4.561  5.598   1.00 0.55 ? 33 LYS B CA   5  
ATOM 10309 C C    . LYS B 1 33 ? 1.076   -3.608  5.590   1.00 0.55 ? 33 LYS B C    5  
ATOM 10310 O O    . LYS B 1 33 ? 1.120   -2.545  5.002   1.00 0.55 ? 33 LYS B O    5  
ATOM 10311 C CB   . LYS B 1 33 ? 3.269   -4.130  4.522   1.00 0.55 ? 33 LYS B CB   5  
ATOM 10312 C CG   . LYS B 1 33 ? 4.181   -5.307  4.170   1.00 0.55 ? 33 LYS B CG   5  
ATOM 10313 C CD   . LYS B 1 33 ? 5.620   -4.811  4.025   1.00 0.55 ? 33 LYS B CD   5  
ATOM 10314 C CE   . LYS B 1 33 ? 6.414   -5.790  3.159   1.00 0.55 ? 33 LYS B CE   5  
ATOM 10315 N NZ   . LYS B 1 33 ? 7.103   -5.044  2.068   1.00 0.55 ? 33 LYS B NZ   5  
ATOM 10316 H H    . LYS B 1 33 ? 1.828   -6.292  4.395   1.00 0.55 ? 33 LYS B H    5  
ATOM 10317 H HA   . LYS B 1 33 ? 2.751   -4.532  6.565   1.00 0.55 ? 33 LYS B HA   5  
ATOM 10318 H HB2  . LYS B 1 33 ? 2.730   -3.814  3.642   1.00 0.55 ? 33 LYS B HB2  5  
ATOM 10319 H HB3  . LYS B 1 33 ? 3.868   -3.312  4.893   1.00 0.55 ? 33 LYS B HB3  5  
ATOM 10320 H HG2  . LYS B 1 33 ? 4.132   -6.048  4.955   1.00 0.55 ? 33 LYS B HG2  5  
ATOM 10321 H HG3  . LYS B 1 33 ? 3.857   -5.747  3.238   1.00 0.55 ? 33 LYS B HG3  5  
ATOM 10322 H HD2  . LYS B 1 33 ? 5.618   -3.837  3.558   1.00 0.55 ? 33 LYS B HD2  5  
ATOM 10323 H HD3  . LYS B 1 33 ? 6.078   -4.742  4.999   1.00 0.55 ? 33 LYS B HD3  5  
ATOM 10324 H HE2  . LYS B 1 33 ? 7.148   -6.296  3.768   1.00 0.55 ? 33 LYS B HE2  5  
ATOM 10325 H HE3  . LYS B 1 33 ? 5.740   -6.517  2.728   1.00 0.55 ? 33 LYS B HE3  5  
ATOM 10326 H HZ1  . LYS B 1 33 ? 6.410   -4.460  1.556   1.00 0.55 ? 33 LYS B HZ1  5  
ATOM 10327 H HZ2  . LYS B 1 33 ? 7.835   -4.430  2.476   1.00 0.55 ? 33 LYS B HZ2  5  
ATOM 10328 H HZ3  . LYS B 1 33 ? 7.541   -5.720  1.410   1.00 0.55 ? 33 LYS B HZ3  5  
ATOM 10329 N N    . CYS B 1 34 ? 0.006   -3.982  6.233   1.00 0.46 ? 34 CYS B N    5  
ATOM 10330 C CA   . CYS B 1 34 ? -1.195  -3.101  6.258   1.00 0.46 ? 34 CYS B CA   5  
ATOM 10331 C C    . CYS B 1 34 ? -1.849  -3.161  7.641   1.00 0.46 ? 34 CYS B C    5  
ATOM 10332 O O    . CYS B 1 34 ? -1.248  -3.596  8.604   1.00 0.46 ? 34 CYS B O    5  
ATOM 10333 C CB   . CYS B 1 34 ? -2.194  -3.575  5.202   1.00 0.46 ? 34 CYS B CB   5  
ATOM 10334 S SG   . CYS B 1 34 ? -1.321  -3.886  3.649   1.00 0.46 ? 34 CYS B SG   5  
ATOM 10335 H H    . CYS B 1 34 ? -0.009  -4.843  6.697   1.00 0.46 ? 34 CYS B H    5  
ATOM 10336 H HA   . CYS B 1 34 ? -0.901  -2.083  6.045   1.00 0.46 ? 34 CYS B HA   5  
ATOM 10337 H HB2  . CYS B 1 34 ? -2.669  -4.485  5.537   1.00 0.46 ? 34 CYS B HB2  5  
ATOM 10338 H HB3  . CYS B 1 34 ? -2.944  -2.813  5.047   1.00 0.46 ? 34 CYS B HB3  5  
ATOM 10339 N N    . SER B 1 35 ? -3.075  -2.728  7.745   1.00 0.42 ? 35 SER B N    5  
ATOM 10340 C CA   . SER B 1 35 ? -3.768  -2.760  9.064   1.00 0.42 ? 35 SER B CA   5  
ATOM 10341 C C    . SER B 1 35 ? -4.818  -3.873  9.062   1.00 0.42 ? 35 SER B C    5  
ATOM 10342 O O    . SER B 1 35 ? -4.935  -4.630  10.006  1.00 0.42 ? 35 SER B O    5  
ATOM 10343 C CB   . SER B 1 35 ? -4.451  -1.415  9.314   1.00 0.42 ? 35 SER B CB   5  
ATOM 10344 O OG   . SER B 1 35 ? -4.676  -1.255  10.708  1.00 0.42 ? 35 SER B OG   5  
ATOM 10345 H H    . SER B 1 35 ? -3.541  -2.381  6.956   1.00 0.42 ? 35 SER B H    5  
ATOM 10346 H HA   . SER B 1 35 ? -3.045  -2.948  9.845   1.00 0.42 ? 35 SER B HA   5  
ATOM 10347 H HB2  . SER B 1 35 ? -3.819  -0.617  8.963   1.00 0.42 ? 35 SER B HB2  5  
ATOM 10348 H HB3  . SER B 1 35 ? -5.393  -1.387  8.780   1.00 0.42 ? 35 SER B HB3  5  
ATOM 10349 H HG   . SER B 1 35 ? -5.488  -1.715  10.932  1.00 0.42 ? 35 SER B HG   5  
ATOM 10350 N N    . ASN B 1 36 ? -5.582  -3.979  8.010   1.00 0.38 ? 36 ASN B N    5  
ATOM 10351 C CA   . ASN B 1 36 ? -6.624  -5.043  7.949   1.00 0.38 ? 36 ASN B CA   5  
ATOM 10352 C C    . ASN B 1 36 ? -6.518  -5.786  6.613   1.00 0.38 ? 36 ASN B C    5  
ATOM 10353 O O    . ASN B 1 36 ? -6.096  -5.222  5.624   1.00 0.38 ? 36 ASN B O    5  
ATOM 10354 C CB   . ASN B 1 36 ? -8.011  -4.408  8.069   1.00 0.38 ? 36 ASN B CB   5  
ATOM 10355 C CG   . ASN B 1 36 ? -7.936  -3.180  8.980   1.00 0.38 ? 36 ASN B CG   5  
ATOM 10356 O OD1  . ASN B 1 36 ? -7.725  -3.304  10.170  1.00 0.38 ? 36 ASN B OD1  5  
ATOM 10357 N ND2  . ASN B 1 36 ? -8.101  -1.992  8.466   1.00 0.38 ? 36 ASN B ND2  5  
ATOM 10358 H H    . ASN B 1 36 ? -5.471  -3.359  7.259   1.00 0.38 ? 36 ASN B H    5  
ATOM 10359 H HA   . ASN B 1 36 ? -6.475  -5.739  8.761   1.00 0.38 ? 36 ASN B HA   5  
ATOM 10360 H HB2  . ASN B 1 36 ? -8.357  -4.110  7.090   1.00 0.38 ? 36 ASN B HB2  5  
ATOM 10361 H HB3  . ASN B 1 36 ? -8.699  -5.125  8.492   1.00 0.38 ? 36 ASN B HB3  5  
ATOM 10362 H HD21 . ASN B 1 36 ? -8.270  -1.892  7.507   1.00 0.38 ? 36 ASN B HD21 5  
ATOM 10363 H HD22 . ASN B 1 36 ? -8.054  -1.199  9.041   1.00 0.38 ? 36 ASN B HD22 5  
ATOM 10364 N N    . PRO B 1 37 ? -6.909  -7.035  6.629   1.00 0.37 ? 37 PRO B N    5  
ATOM 10365 C CA   . PRO B 1 37 ? -6.874  -7.894  5.432   1.00 0.37 ? 37 PRO B CA   5  
ATOM 10366 C C    . PRO B 1 37 ? -8.058  -7.576  4.513   1.00 0.37 ? 37 PRO B C    5  
ATOM 10367 O O    . PRO B 1 37 ? -9.201  -7.612  4.923   1.00 0.37 ? 37 PRO B O    5  
ATOM 10368 C CB   . PRO B 1 37 ? -6.991  -9.310  6.003   1.00 0.37 ? 37 PRO B CB   5  
ATOM 10369 C CG   . PRO B 1 37 ? -7.645  -9.165  7.397   1.00 0.37 ? 37 PRO B CG   5  
ATOM 10370 C CD   . PRO B 1 37 ? -7.421  -7.707  7.841   1.00 0.37 ? 37 PRO B CD   5  
ATOM 10371 H HA   . PRO B 1 37 ? -5.939  -7.781  4.907   1.00 0.37 ? 37 PRO B HA   5  
ATOM 10372 H HB2  . PRO B 1 37 ? -7.610  -9.918  5.359   1.00 0.37 ? 37 PRO B HB2  5  
ATOM 10373 H HB3  . PRO B 1 37 ? -6.011  -9.751  6.104   1.00 0.37 ? 37 PRO B HB3  5  
ATOM 10374 H HG2  . PRO B 1 37 ? -8.704  -9.377  7.332   1.00 0.37 ? 37 PRO B HG2  5  
ATOM 10375 H HG3  . PRO B 1 37 ? -7.175  -9.836  8.100   1.00 0.37 ? 37 PRO B HG3  5  
ATOM 10376 H HD2  . PRO B 1 37 ? -8.353  -7.262  8.160   1.00 0.37 ? 37 PRO B HD2  5  
ATOM 10377 H HD3  . PRO B 1 37 ? -6.686  -7.661  8.631   1.00 0.37 ? 37 PRO B HD3  5  
ATOM 10378 N N    . ALA B 1 38 ? -7.792  -7.265  3.274   1.00 0.33 ? 38 ALA B N    5  
ATOM 10379 C CA   . ALA B 1 38 ? -8.901  -6.946  2.332   1.00 0.33 ? 38 ALA B CA   5  
ATOM 10380 C C    . ALA B 1 38 ? -8.541  -7.444  0.931   1.00 0.33 ? 38 ALA B C    5  
ATOM 10381 O O    . ALA B 1 38 ? -7.407  -7.781  0.654   1.00 0.33 ? 38 ALA B O    5  
ATOM 10382 C CB   . ALA B 1 38 ? -9.120  -5.433  2.294   1.00 0.33 ? 38 ALA B CB   5  
ATOM 10383 H H    . ALA B 1 38 ? -6.863  -7.242  2.962   1.00 0.33 ? 38 ALA B H    5  
ATOM 10384 H HA   . ALA B 1 38 ? -9.807  -7.433  2.664   1.00 0.33 ? 38 ALA B HA   5  
ATOM 10385 H HB1  . ALA B 1 38 ? -8.164  -4.931  2.247   1.00 0.33 ? 38 ALA B HB1  5  
ATOM 10386 H HB2  . ALA B 1 38 ? -9.705  -5.174  1.425   1.00 0.33 ? 38 ALA B HB2  5  
ATOM 10387 H HB3  . ALA B 1 38 ? -9.645  -5.122  3.186   1.00 0.33 ? 38 ALA B HB3  5  
ATOM 10388 N N    . VAL B 1 39 ? -9.497  -7.492  0.044   1.00 0.30 ? 39 VAL B N    5  
ATOM 10389 C CA   . VAL B 1 39 ? -9.209  -7.968  -1.338  1.00 0.30 ? 39 VAL B CA   5  
ATOM 10390 C C    . VAL B 1 39 ? -8.886  -6.769  -2.233  1.00 0.30 ? 39 VAL B C    5  
ATOM 10391 O O    . VAL B 1 39 ? -9.229  -5.644  -1.927  1.00 0.30 ? 39 VAL B O    5  
ATOM 10392 C CB   . VAL B 1 39 ? -10.430 -8.704  -1.891  1.00 0.30 ? 39 VAL B CB   5  
ATOM 10393 C CG1  . VAL B 1 39 ? -10.258 -8.928  -3.395  1.00 0.30 ? 39 VAL B CG1  5  
ATOM 10394 C CG2  . VAL B 1 39 ? -10.571 -10.056 -1.190  1.00 0.30 ? 39 VAL B CG2  5  
ATOM 10395 H H    . VAL B 1 39 ? -10.405 -7.216  0.287   1.00 0.30 ? 39 VAL B H    5  
ATOM 10396 H HA   . VAL B 1 39 ? -8.363  -8.639  -1.318  1.00 0.30 ? 39 VAL B HA   5  
ATOM 10397 H HB   . VAL B 1 39 ? -11.316 -8.111  -1.714  1.00 0.30 ? 39 VAL B HB   5  
ATOM 10398 H HG11 . VAL B 1 39 ? -9.360  -9.501  -3.572  1.00 0.30 ? 39 VAL B HG11 5  
ATOM 10399 H HG12 . VAL B 1 39 ? -11.112 -9.466  -3.779  1.00 0.30 ? 39 VAL B HG12 5  
ATOM 10400 H HG13 . VAL B 1 39 ? -10.179 -7.973  -3.894  1.00 0.30 ? 39 VAL B HG13 5  
ATOM 10401 H HG21 . VAL B 1 39 ? -10.041 -10.030 -0.249  1.00 0.30 ? 39 VAL B HG21 5  
ATOM 10402 H HG22 . VAL B 1 39 ? -11.615 -10.262 -1.008  1.00 0.30 ? 39 VAL B HG22 5  
ATOM 10403 H HG23 . VAL B 1 39 ? -10.155 -10.831 -1.817  1.00 0.30 ? 39 VAL B HG23 5  
ATOM 10404 N N    . VAL B 1 40 ? -8.230  -7.002  -3.336  1.00 0.33 ? 40 VAL B N    5  
ATOM 10405 C CA   . VAL B 1 40 ? -7.885  -5.878  -4.251  1.00 0.33 ? 40 VAL B CA   5  
ATOM 10406 C C    . VAL B 1 40 ? -8.211  -6.276  -5.691  1.00 0.33 ? 40 VAL B C    5  
ATOM 10407 O O    . VAL B 1 40 ? -7.587  -7.149  -6.259  1.00 0.33 ? 40 VAL B O    5  
ATOM 10408 C CB   . VAL B 1 40 ? -6.391  -5.569  -4.136  1.00 0.33 ? 40 VAL B CB   5  
ATOM 10409 C CG1  . VAL B 1 40 ? -5.979  -4.613  -5.257  1.00 0.33 ? 40 VAL B CG1  5  
ATOM 10410 C CG2  . VAL B 1 40 ? -6.110  -4.915  -2.781  1.00 0.33 ? 40 VAL B CG2  5  
ATOM 10411 H H    . VAL B 1 40 ? -7.963  -7.918  -3.563  1.00 0.33 ? 40 VAL B H    5  
ATOM 10412 H HA   . VAL B 1 40 ? -8.456  -5.004  -3.979  1.00 0.33 ? 40 VAL B HA   5  
ATOM 10413 H HB   . VAL B 1 40 ? -5.827  -6.486  -4.220  1.00 0.33 ? 40 VAL B HB   5  
ATOM 10414 H HG11 . VAL B 1 40 ? -6.858  -4.129  -5.658  1.00 0.33 ? 40 VAL B HG11 5  
ATOM 10415 H HG12 . VAL B 1 40 ? -5.306  -3.866  -4.864  1.00 0.33 ? 40 VAL B HG12 5  
ATOM 10416 H HG13 . VAL B 1 40 ? -5.485  -5.169  -6.039  1.00 0.33 ? 40 VAL B HG13 5  
ATOM 10417 H HG21 . VAL B 1 40 ? -6.984  -4.372  -2.454  1.00 0.33 ? 40 VAL B HG21 5  
ATOM 10418 H HG22 . VAL B 1 40 ? -5.870  -5.679  -2.056  1.00 0.33 ? 40 VAL B HG22 5  
ATOM 10419 H HG23 . VAL B 1 40 ? -5.277  -4.235  -2.875  1.00 0.33 ? 40 VAL B HG23 5  
ATOM 10420 N N    . PHE B 1 41 ? -9.185  -5.644  -6.286  1.00 0.37 ? 41 PHE B N    5  
ATOM 10421 C CA   . PHE B 1 41 ? -9.549  -5.988  -7.688  1.00 0.37 ? 41 PHE B CA   5  
ATOM 10422 C C    . PHE B 1 41 ? -8.784  -5.080  -8.653  1.00 0.37 ? 41 PHE B C    5  
ATOM 10423 O O    . PHE B 1 41 ? -9.125  -3.929  -8.840  1.00 0.37 ? 41 PHE B O    5  
ATOM 10424 C CB   . PHE B 1 41 ? -11.054 -5.792  -7.888  1.00 0.37 ? 41 PHE B CB   5  
ATOM 10425 C CG   . PHE B 1 41 ? -11.796 -6.976  -7.318  1.00 0.37 ? 41 PHE B CG   5  
ATOM 10426 C CD1  . PHE B 1 41 ? -11.659 -8.239  -7.907  1.00 0.37 ? 41 PHE B CD1  5  
ATOM 10427 C CD2  . PHE B 1 41 ? -12.622 -6.813  -6.199  1.00 0.37 ? 41 PHE B CD2  5  
ATOM 10428 C CE1  . PHE B 1 41 ? -12.347 -9.337  -7.379  1.00 0.37 ? 41 PHE B CE1  5  
ATOM 10429 C CE2  . PHE B 1 41 ? -13.310 -7.911  -5.670  1.00 0.37 ? 41 PHE B CE2  5  
ATOM 10430 C CZ   . PHE B 1 41 ? -13.173 -9.173  -6.260  1.00 0.37 ? 41 PHE B CZ   5  
ATOM 10431 H H    . PHE B 1 41 ? -9.678  -4.942  -5.809  1.00 0.37 ? 41 PHE B H    5  
ATOM 10432 H HA   . PHE B 1 41 ? -9.292  -7.018  -7.884  1.00 0.37 ? 41 PHE B HA   5  
ATOM 10433 H HB2  . PHE B 1 41 ? -11.370 -4.891  -7.382  1.00 0.37 ? 41 PHE B HB2  5  
ATOM 10434 H HB3  . PHE B 1 41 ? -11.270 -5.707  -8.943  1.00 0.37 ? 41 PHE B HB3  5  
ATOM 10435 H HD1  . PHE B 1 41 ? -11.022 -8.365  -8.770  1.00 0.37 ? 41 PHE B HD1  5  
ATOM 10436 H HD2  . PHE B 1 41 ? -12.728 -5.839  -5.744  1.00 0.37 ? 41 PHE B HD2  5  
ATOM 10437 H HE1  . PHE B 1 41 ? -12.241 -10.311 -7.833  1.00 0.37 ? 41 PHE B HE1  5  
ATOM 10438 H HE2  . PHE B 1 41 ? -13.947 -7.785  -4.807  1.00 0.37 ? 41 PHE B HE2  5  
ATOM 10439 H HZ   . PHE B 1 41 ? -13.704 -10.020 -5.852  1.00 0.37 ? 41 PHE B HZ   5  
ATOM 10440 N N    . VAL B 1 42 ? -7.751  -5.588  -9.267  1.00 0.46 ? 42 VAL B N    5  
ATOM 10441 C CA   . VAL B 1 42 ? -6.965  -4.753  -10.220 1.00 0.46 ? 42 VAL B CA   5  
ATOM 10442 C C    . VAL B 1 42 ? -7.551  -4.897  -11.626 1.00 0.46 ? 42 VAL B C    5  
ATOM 10443 O O    . VAL B 1 42 ? -7.614  -5.979  -12.175 1.00 0.46 ? 42 VAL B O    5  
ATOM 10444 C CB   . VAL B 1 42 ? -5.509  -5.219  -10.224 1.00 0.46 ? 42 VAL B CB   5  
ATOM 10445 C CG1  . VAL B 1 42 ? -4.649  -4.203  -10.980 1.00 0.46 ? 42 VAL B CG1  5  
ATOM 10446 C CG2  . VAL B 1 42 ? -5.007  -5.337  -8.784  1.00 0.46 ? 42 VAL B CG2  5  
ATOM 10447 H H    . VAL B 1 42 ? -7.493  -6.518  -9.102  1.00 0.46 ? 42 VAL B H    5  
ATOM 10448 H HA   . VAL B 1 42 ? -7.011  -3.718  -9.914  1.00 0.46 ? 42 VAL B HA   5  
ATOM 10449 H HB   . VAL B 1 42 ? -5.440  -6.181  -10.712 1.00 0.46 ? 42 VAL B HB   5  
ATOM 10450 H HG11 . VAL B 1 42 ? -5.108  -3.227  -10.918 1.00 0.46 ? 42 VAL B HG11 5  
ATOM 10451 H HG12 . VAL B 1 42 ? -3.665  -4.167  -10.540 1.00 0.46 ? 42 VAL B HG12 5  
ATOM 10452 H HG13 . VAL B 1 42 ? -4.570  -4.498  -12.016 1.00 0.46 ? 42 VAL B HG13 5  
ATOM 10453 H HG21 . VAL B 1 42 ? -5.763  -4.966  -8.107  1.00 0.46 ? 42 VAL B HG21 5  
ATOM 10454 H HG22 . VAL B 1 42 ? -4.800  -6.373  -8.557  1.00 0.46 ? 42 VAL B HG22 5  
ATOM 10455 H HG23 . VAL B 1 42 ? -4.104  -4.757  -8.667  1.00 0.46 ? 42 VAL B HG23 5  
ATOM 10456 N N    . THR B 1 43 ? -7.983  -3.813  -12.211 1.00 0.54 ? 43 THR B N    5  
ATOM 10457 C CA   . THR B 1 43 ? -8.566  -3.888  -13.580 1.00 0.54 ? 43 THR B CA   5  
ATOM 10458 C C    . THR B 1 43 ? -7.457  -3.702  -14.619 1.00 0.54 ? 43 THR B C    5  
ATOM 10459 O O    . THR B 1 43 ? -6.295  -3.580  -14.284 1.00 0.54 ? 43 THR B O    5  
ATOM 10460 C CB   . THR B 1 43 ? -9.612  -2.783  -13.749 1.00 0.54 ? 43 THR B CB   5  
ATOM 10461 O OG1  . THR B 1 43 ? -8.956  -1.545  -13.985 1.00 0.54 ? 43 THR B OG1  5  
ATOM 10462 C CG2  . THR B 1 43 ? -10.459 -2.681  -12.480 1.00 0.54 ? 43 THR B CG2  5  
ATOM 10463 H H    . THR B 1 43 ? -7.923  -2.950  -11.750 1.00 0.54 ? 43 THR B H    5  
ATOM 10464 H HA   . THR B 1 43 ? -9.034  -4.850  -13.721 1.00 0.54 ? 43 THR B HA   5  
ATOM 10465 H HB   . THR B 1 43 ? -10.252 -3.018  -14.586 1.00 0.54 ? 43 THR B HB   5  
ATOM 10466 H HG1  . THR B 1 43 ? -9.574  -0.838  -13.782 1.00 0.54 ? 43 THR B HG1  5  
ATOM 10467 H HG21 . THR B 1 43 ? -10.303 -3.560  -11.872 1.00 0.54 ? 43 THR B HG21 5  
ATOM 10468 H HG22 . THR B 1 43 ? -10.169 -1.803  -11.924 1.00 0.54 ? 43 THR B HG22 5  
ATOM 10469 H HG23 . THR B 1 43 ? -11.503 -2.609  -12.749 1.00 0.54 ? 43 THR B HG23 5  
ATOM 10470 N N    . ARG B 1 44 ? -7.806  -3.682  -15.876 1.00 0.69 ? 44 ARG B N    5  
ATOM 10471 C CA   . ARG B 1 44 ? -6.771  -3.505  -16.934 1.00 0.69 ? 44 ARG B CA   5  
ATOM 10472 C C    . ARG B 1 44 ? -6.277  -2.058  -16.927 1.00 0.69 ? 44 ARG B C    5  
ATOM 10473 O O    . ARG B 1 44 ? -5.285  -1.728  -17.547 1.00 0.69 ? 44 ARG B O    5  
ATOM 10474 C CB   . ARG B 1 44 ? -7.379  -3.831  -18.300 1.00 0.69 ? 44 ARG B CB   5  
ATOM 10475 C CG   . ARG B 1 44 ? -7.962  -5.244  -18.277 1.00 0.69 ? 44 ARG B CG   5  
ATOM 10476 C CD   . ARG B 1 44 ? -8.386  -5.646  -19.690 1.00 0.69 ? 44 ARG B CD   5  
ATOM 10477 N NE   . ARG B 1 44 ? -9.201  -4.553  -20.294 1.00 0.69 ? 44 ARG B NE   5  
ATOM 10478 C CZ   . ARG B 1 44 ? -8.618  -3.610  -20.983 1.00 0.69 ? 44 ARG B CZ   5  
ATOM 10479 N NH1  . ARG B 1 44 ? -7.672  -3.910  -21.830 1.00 0.69 ? 44 ARG B NH1  5  
ATOM 10480 N NH2  . ARG B 1 44 ? -8.983  -2.367  -20.825 1.00 0.69 ? 44 ARG B NH2  5  
ATOM 10481 H H    . ARG B 1 44 ? -8.748  -3.783  -16.124 1.00 0.69 ? 44 ARG B H    5  
ATOM 10482 H HA   . ARG B 1 44 ? -5.942  -4.170  -16.741 1.00 0.69 ? 44 ARG B HA   5  
ATOM 10483 H HB2  . ARG B 1 44 ? -8.162  -3.120  -18.523 1.00 0.69 ? 44 ARG B HB2  5  
ATOM 10484 H HB3  . ARG B 1 44 ? -6.613  -3.772  -19.059 1.00 0.69 ? 44 ARG B HB3  5  
ATOM 10485 H HG2  . ARG B 1 44 ? -7.216  -5.935  -17.913 1.00 0.69 ? 44 ARG B HG2  5  
ATOM 10486 H HG3  . ARG B 1 44 ? -8.824  -5.268  -17.625 1.00 0.69 ? 44 ARG B HG3  5  
ATOM 10487 H HD2  . ARG B 1 44 ? -7.508  -5.816  -20.295 1.00 0.69 ? 44 ARG B HD2  5  
ATOM 10488 H HD3  . ARG B 1 44 ? -8.974  -6.551  -19.648 1.00 0.69 ? 44 ARG B HD3  5  
ATOM 10489 H HE   . ARG B 1 44 ? -10.173 -4.543  -20.174 1.00 0.69 ? 44 ARG B HE   5  
ATOM 10490 H HH11 . ARG B 1 44 ? -7.392  -4.862  -21.951 1.00 0.69 ? 44 ARG B HH11 5  
ATOM 10491 H HH12 . ARG B 1 44 ? -7.225  -3.186  -22.358 1.00 0.69 ? 44 ARG B HH12 5  
ATOM 10492 H HH21 . ARG B 1 44 ? -9.709  -2.138  -20.177 1.00 0.69 ? 44 ARG B HH21 5  
ATOM 10493 H HH22 . ARG B 1 44 ? -8.537  -1.644  -21.353 1.00 0.69 ? 44 ARG B HH22 5  
ATOM 10494 N N    . LYS B 1 45 ? -6.959  -1.190  -16.231 1.00 0.66 ? 45 LYS B N    5  
ATOM 10495 C CA   . LYS B 1 45 ? -6.527  0.235   -16.186 1.00 0.66 ? 45 LYS B CA   5  
ATOM 10496 C C    . LYS B 1 45 ? -5.618  0.454   -14.976 1.00 0.66 ? 45 LYS B C    5  
ATOM 10497 O O    . LYS B 1 45 ? -5.399  1.569   -14.545 1.00 0.66 ? 45 LYS B O    5  
ATOM 10498 C CB   . LYS B 1 45 ? -7.757  1.138   -16.070 1.00 0.66 ? 45 LYS B CB   5  
ATOM 10499 C CG   . LYS B 1 45 ? -8.647  0.948   -17.300 1.00 0.66 ? 45 LYS B CG   5  
ATOM 10500 C CD   . LYS B 1 45 ? -7.876  1.357   -18.557 1.00 0.66 ? 45 LYS B CD   5  
ATOM 10501 C CE   . LYS B 1 45 ? -8.864  1.724   -19.667 1.00 0.66 ? 45 LYS B CE   5  
ATOM 10502 N NZ   . LYS B 1 45 ? -8.416  2.977   -20.337 1.00 0.66 ? 45 LYS B NZ   5  
ATOM 10503 H H    . LYS B 1 45 ? -7.757  -1.476  -15.738 1.00 0.66 ? 45 LYS B H    5  
ATOM 10504 H HA   . LYS B 1 45 ? -5.987  0.476   -17.090 1.00 0.66 ? 45 LYS B HA   5  
ATOM 10505 H HB2  . LYS B 1 45 ? -8.312  0.879   -15.181 1.00 0.66 ? 45 LYS B HB2  5  
ATOM 10506 H HB3  . LYS B 1 45 ? -7.442  2.169   -16.011 1.00 0.66 ? 45 LYS B HB3  5  
ATOM 10507 H HG2  . LYS B 1 45 ? -8.939  -0.089  -17.377 1.00 0.66 ? 45 LYS B HG2  5  
ATOM 10508 H HG3  . LYS B 1 45 ? -9.529  1.564   -17.206 1.00 0.66 ? 45 LYS B HG3  5  
ATOM 10509 H HD2  . LYS B 1 45 ? -7.251  2.211   -18.334 1.00 0.66 ? 45 LYS B HD2  5  
ATOM 10510 H HD3  . LYS B 1 45 ? -7.259  0.535   -18.885 1.00 0.66 ? 45 LYS B HD3  5  
ATOM 10511 H HE2  . LYS B 1 45 ? -8.905  0.923   -20.390 1.00 0.66 ? 45 LYS B HE2  5  
ATOM 10512 H HE3  . LYS B 1 45 ? -9.845  1.874   -19.240 1.00 0.66 ? 45 LYS B HE3  5  
ATOM 10513 H HZ1  . LYS B 1 45 ? -7.378  3.023   -20.329 1.00 0.66 ? 45 LYS B HZ1  5  
ATOM 10514 H HZ2  . LYS B 1 45 ? -8.754  2.985   -21.320 1.00 0.66 ? 45 LYS B HZ2  5  
ATOM 10515 H HZ3  . LYS B 1 45 ? -8.804  3.799   -19.830 1.00 0.66 ? 45 LYS B HZ3  5  
ATOM 10516 N N    . ASN B 1 46 ? -5.086  -0.602  -14.422 1.00 0.61 ? 46 ASN B N    5  
ATOM 10517 C CA   . ASN B 1 46 ? -4.192  -0.452  -13.239 1.00 0.61 ? 46 ASN B CA   5  
ATOM 10518 C C    . ASN B 1 46 ? -4.989  0.122   -12.067 1.00 0.61 ? 46 ASN B C    5  
ATOM 10519 O O    . ASN B 1 46 ? -4.446  0.767   -11.191 1.00 0.61 ? 46 ASN B O    5  
ATOM 10520 C CB   . ASN B 1 46 ? -3.042  0.495   -13.587 1.00 0.61 ? 46 ASN B CB   5  
ATOM 10521 C CG   . ASN B 1 46 ? -1.805  0.118   -12.767 1.00 0.61 ? 46 ASN B CG   5  
ATOM 10522 O OD1  . ASN B 1 46 ? -1.222  -0.928  -12.970 1.00 0.61 ? 46 ASN B OD1  5  
ATOM 10523 N ND2  . ASN B 1 46 ? -1.378  0.934   -11.842 1.00 0.61 ? 46 ASN B ND2  5  
ATOM 10524 H H    . ASN B 1 46 ? -5.275  -1.493  -14.785 1.00 0.61 ? 46 ASN B H    5  
ATOM 10525 H HA   . ASN B 1 46 ? -3.794  -1.419  -12.966 1.00 0.61 ? 46 ASN B HA   5  
ATOM 10526 H HB2  . ASN B 1 46 ? -2.814  0.414   -14.640 1.00 0.61 ? 46 ASN B HB2  5  
ATOM 10527 H HB3  . ASN B 1 46 ? -3.328  1.509   -13.357 1.00 0.61 ? 46 ASN B HB3  5  
ATOM 10528 H HD21 . ASN B 1 46 ? -1.849  1.779   -11.679 1.00 0.61 ? 46 ASN B HD21 5  
ATOM 10529 H HD22 . ASN B 1 46 ? -0.588  0.703   -11.312 1.00 0.61 ? 46 ASN B HD22 5  
ATOM 10530 N N    . ARG B 1 47 ? -6.274  -0.107  -12.042 1.00 0.52 ? 47 ARG B N    5  
ATOM 10531 C CA   . ARG B 1 47 ? -7.103  0.426   -10.925 1.00 0.52 ? 47 ARG B CA   5  
ATOM 10532 C C    . ARG B 1 47 ? -7.156  -0.602  -9.794  1.00 0.52 ? 47 ARG B C    5  
ATOM 10533 O O    . ARG B 1 47 ? -7.636  -1.705  -9.966  1.00 0.52 ? 47 ARG B O    5  
ATOM 10534 C CB   . ARG B 1 47 ? -8.522  0.702   -11.430 1.00 0.52 ? 47 ARG B CB   5  
ATOM 10535 C CG   . ARG B 1 47 ? -8.620  2.151   -11.912 1.00 0.52 ? 47 ARG B CG   5  
ATOM 10536 C CD   . ARG B 1 47 ? -8.877  3.070   -10.716 1.00 0.52 ? 47 ARG B CD   5  
ATOM 10537 N NE   . ARG B 1 47 ? -10.280 3.572   -10.768 1.00 0.52 ? 47 ARG B NE   5  
ATOM 10538 C CZ   . ARG B 1 47 ? -10.893 3.911   -9.667  1.00 0.52 ? 47 ARG B CZ   5  
ATOM 10539 N NH1  . ARG B 1 47 ? -10.963 3.069   -8.673  1.00 0.52 ? 47 ARG B NH1  5  
ATOM 10540 N NH2  . ARG B 1 47 ? -11.436 5.093   -9.560  1.00 0.52 ? 47 ARG B NH2  5  
ATOM 10541 H H    . ARG B 1 47 ? -6.692  -0.629  -12.758 1.00 0.52 ? 47 ARG B H    5  
ATOM 10542 H HA   . ARG B 1 47 ? -6.667  1.344   -10.559 1.00 0.52 ? 47 ARG B HA   5  
ATOM 10543 H HB2  . ARG B 1 47 ? -8.748  0.034   -12.249 1.00 0.52 ? 47 ARG B HB2  5  
ATOM 10544 H HB3  . ARG B 1 47 ? -9.226  0.543   -10.629 1.00 0.52 ? 47 ARG B HB3  5  
ATOM 10545 H HG2  . ARG B 1 47 ? -7.695  2.434   -12.392 1.00 0.52 ? 47 ARG B HG2  5  
ATOM 10546 H HG3  . ARG B 1 47 ? -9.434  2.242   -12.615 1.00 0.52 ? 47 ARG B HG3  5  
ATOM 10547 H HD2  . ARG B 1 47 ? -8.727  2.519   -9.800  1.00 0.52 ? 47 ARG B HD2  5  
ATOM 10548 H HD3  . ARG B 1 47 ? -8.194  3.906   -10.751 1.00 0.52 ? 47 ARG B HD3  5  
ATOM 10549 H HE   . ARG B 1 47 ? -10.741 3.647   -11.630 1.00 0.52 ? 47 ARG B HE   5  
ATOM 10550 H HH11 . ARG B 1 47 ? -10.547 2.163   -8.754  1.00 0.52 ? 47 ARG B HH11 5  
ATOM 10551 H HH12 . ARG B 1 47 ? -11.432 3.328   -7.830  1.00 0.52 ? 47 ARG B HH12 5  
ATOM 10552 H HH21 . ARG B 1 47 ? -11.382 5.739   -10.322 1.00 0.52 ? 47 ARG B HH21 5  
ATOM 10553 H HH22 . ARG B 1 47 ? -11.906 5.353   -8.717  1.00 0.52 ? 47 ARG B HH22 5  
ATOM 10554 N N    . GLN B 1 48 ? -6.663  -0.251  -8.638  1.00 0.45 ? 48 GLN B N    5  
ATOM 10555 C CA   . GLN B 1 48 ? -6.684  -1.210  -7.498  1.00 0.45 ? 48 GLN B CA   5  
ATOM 10556 C C    . GLN B 1 48 ? -7.866  -0.886  -6.581  1.00 0.45 ? 48 GLN B C    5  
ATOM 10557 O O    . GLN B 1 48 ? -7.785  -0.026  -5.727  1.00 0.45 ? 48 GLN B O    5  
ATOM 10558 C CB   . GLN B 1 48 ? -5.379  -1.091  -6.707  1.00 0.45 ? 48 GLN B CB   5  
ATOM 10559 C CG   . GLN B 1 48 ? -4.229  -0.766  -7.664  1.00 0.45 ? 48 GLN B CG   5  
ATOM 10560 C CD   . GLN B 1 48 ? -3.926  -1.989  -8.530  1.00 0.45 ? 48 GLN B CD   5  
ATOM 10561 O OE1  . GLN B 1 48 ? -4.810  -2.759  -8.847  1.00 0.45 ? 48 GLN B OE1  5  
ATOM 10562 N NE2  . GLN B 1 48 ? -2.701  -2.203  -8.931  1.00 0.45 ? 48 GLN B NE2  5  
ATOM 10563 H H    . GLN B 1 48 ? -6.279  0.643   -8.520  1.00 0.45 ? 48 GLN B H    5  
ATOM 10564 H HA   . GLN B 1 48 ? -6.787  -2.216  -7.875  1.00 0.45 ? 48 GLN B HA   5  
ATOM 10565 H HB2  . GLN B 1 48 ? -5.473  -0.302  -5.975  1.00 0.45 ? 48 GLN B HB2  5  
ATOM 10566 H HB3  . GLN B 1 48 ? -5.175  -2.026  -6.207  1.00 0.45 ? 48 GLN B HB3  5  
ATOM 10567 H HG2  . GLN B 1 48 ? -4.511  0.063   -8.296  1.00 0.45 ? 48 GLN B HG2  5  
ATOM 10568 H HG3  . GLN B 1 48 ? -3.351  -0.503  -7.094  1.00 0.45 ? 48 GLN B HG3  5  
ATOM 10569 H HE21 . GLN B 1 48 ? -1.988  -1.582  -8.676  1.00 0.45 ? 48 GLN B HE21 5  
ATOM 10570 H HE22 . GLN B 1 48 ? -2.497  -2.984  -9.487  1.00 0.45 ? 48 GLN B HE22 5  
ATOM 10571 N N    . VAL B 1 49 ? -8.965  -1.570  -6.751  1.00 0.37 ? 49 VAL B N    5  
ATOM 10572 C CA   . VAL B 1 49 ? -10.150 -1.301  -5.889  1.00 0.37 ? 49 VAL B CA   5  
ATOM 10573 C C    . VAL B 1 49 ? -10.094 -2.198  -4.651  1.00 0.37 ? 49 VAL B C    5  
ATOM 10574 O O    . VAL B 1 49 ? -9.330  -3.140  -4.590  1.00 0.37 ? 49 VAL B O    5  
ATOM 10575 C CB   . VAL B 1 49 ? -11.429 -1.595  -6.674  1.00 0.37 ? 49 VAL B CB   5  
ATOM 10576 C CG1  . VAL B 1 49 ? -12.643 -1.400  -5.764  1.00 0.37 ? 49 VAL B CG1  5  
ATOM 10577 C CG2  . VAL B 1 49 ? -11.527 -0.638  -7.865  1.00 0.37 ? 49 VAL B CG2  5  
ATOM 10578 H H    . VAL B 1 49 ? -9.010  -2.260  -7.445  1.00 0.37 ? 49 VAL B H    5  
ATOM 10579 H HA   . VAL B 1 49 ? -10.145 -0.265  -5.583  1.00 0.37 ? 49 VAL B HA   5  
ATOM 10580 H HB   . VAL B 1 49 ? -11.406 -2.615  -7.030  1.00 0.37 ? 49 VAL B HB   5  
ATOM 10581 H HG11 . VAL B 1 49 ? -12.514 -0.502  -5.179  1.00 0.37 ? 49 VAL B HG11 5  
ATOM 10582 H HG12 . VAL B 1 49 ? -13.535 -1.311  -6.367  1.00 0.37 ? 49 VAL B HG12 5  
ATOM 10583 H HG13 . VAL B 1 49 ? -12.738 -2.250  -5.104  1.00 0.37 ? 49 VAL B HG13 5  
ATOM 10584 H HG21 . VAL B 1 49 ? -10.978 0.266   -7.645  1.00 0.37 ? 49 VAL B HG21 5  
ATOM 10585 H HG22 . VAL B 1 49 ? -11.108 -1.110  -8.741  1.00 0.37 ? 49 VAL B HG22 5  
ATOM 10586 H HG23 . VAL B 1 49 ? -12.563 -0.394  -8.046  1.00 0.37 ? 49 VAL B HG23 5  
ATOM 10587 N N    . CYS B 1 50 ? -10.897 -1.912  -3.662  1.00 0.29 ? 50 CYS B N    5  
ATOM 10588 C CA   . CYS B 1 50 ? -10.887 -2.749  -2.429  1.00 0.29 ? 50 CYS B CA   5  
ATOM 10589 C C    . CYS B 1 50 ? -12.237 -3.453  -2.279  1.00 0.29 ? 50 CYS B C    5  
ATOM 10590 O O    . CYS B 1 50 ? -13.280 -2.873  -2.510  1.00 0.29 ? 50 CYS B O    5  
ATOM 10591 C CB   . CYS B 1 50 ? -10.639 -1.858  -1.210  1.00 0.29 ? 50 CYS B CB   5  
ATOM 10592 S SG   . CYS B 1 50 ? -9.142  -0.877  -1.477  1.00 0.29 ? 50 CYS B SG   5  
ATOM 10593 H H    . CYS B 1 50 ? -11.505 -1.147  -3.731  1.00 0.29 ? 50 CYS B H    5  
ATOM 10594 H HA   . CYS B 1 50 ? -10.102 -3.486  -2.501  1.00 0.29 ? 50 CYS B HA   5  
ATOM 10595 H HB2  . CYS B 1 50 ? -11.482 -1.198  -1.069  1.00 0.29 ? 50 CYS B HB2  5  
ATOM 10596 H HB3  . CYS B 1 50 ? -10.514 -2.475  -0.333  1.00 0.29 ? 50 CYS B HB3  5  
ATOM 10597 N N    . ALA B 1 51 ? -12.226 -4.699  -1.892  1.00 0.23 ? 51 ALA B N    5  
ATOM 10598 C CA   . ALA B 1 51 ? -13.508 -5.439  -1.726  1.00 0.23 ? 51 ALA B CA   5  
ATOM 10599 C C    . ALA B 1 51 ? -13.411 -6.358  -0.506  1.00 0.23 ? 51 ALA B C    5  
ATOM 10600 O O    . ALA B 1 51 ? -12.416 -7.021  -0.294  1.00 0.23 ? 51 ALA B O    5  
ATOM 10601 C CB   . ALA B 1 51 ? -13.779 -6.279  -2.976  1.00 0.23 ? 51 ALA B CB   5  
ATOM 10602 H H    . ALA B 1 51 ? -11.373 -5.148  -1.711  1.00 0.23 ? 51 ALA B H    5  
ATOM 10603 H HA   . ALA B 1 51 ? -14.315 -4.735  -1.583  1.00 0.23 ? 51 ALA B HA   5  
ATOM 10604 H HB1  . ALA B 1 51 ? -13.460 -5.734  -3.852  1.00 0.23 ? 51 ALA B HB1  5  
ATOM 10605 H HB2  . ALA B 1 51 ? -13.231 -7.208  -2.911  1.00 0.23 ? 51 ALA B HB2  5  
ATOM 10606 H HB3  . ALA B 1 51 ? -14.836 -6.488  -3.047  1.00 0.23 ? 51 ALA B HB3  5  
ATOM 10607 N N    . ASN B 1 52 ? -14.436 -6.401  0.299   1.00 0.26 ? 52 ASN B N    5  
ATOM 10608 C CA   . ASN B 1 52 ? -14.399 -7.277  1.504   1.00 0.26 ? 52 ASN B CA   5  
ATOM 10609 C C    . ASN B 1 52 ? -14.964 -8.657  1.149   1.00 0.26 ? 52 ASN B C    5  
ATOM 10610 O O    . ASN B 1 52 ? -15.876 -8.763  0.352   1.00 0.26 ? 52 ASN B O    5  
ATOM 10611 C CB   . ASN B 1 52 ? -15.242 -6.652  2.617   1.00 0.26 ? 52 ASN B CB   5  
ATOM 10612 C CG   . ASN B 1 52 ? -14.553 -6.874  3.965   1.00 0.26 ? 52 ASN B CG   5  
ATOM 10613 O OD1  . ASN B 1 52 ? -13.342 -6.845  4.054   1.00 0.26 ? 52 ASN B OD1  5  
ATOM 10614 N ND2  . ASN B 1 52 ? -15.279 -7.098  5.025   1.00 0.26 ? 52 ASN B ND2  5  
ATOM 10615 H H    . ASN B 1 52 ? -15.231 -5.859  0.112   1.00 0.26 ? 52 ASN B H    5  
ATOM 10616 H HA   . ASN B 1 52 ? -13.377 -7.381  1.839   1.00 0.26 ? 52 ASN B HA   5  
ATOM 10617 H HB2  . ASN B 1 52 ? -15.346 -5.591  2.436   1.00 0.26 ? 52 ASN B HB2  5  
ATOM 10618 H HB3  . ASN B 1 52 ? -16.217 -7.113  2.633   1.00 0.26 ? 52 ASN B HB3  5  
ATOM 10619 H HD21 . ASN B 1 52 ? -16.257 -7.122  4.954   1.00 0.26 ? 52 ASN B HD21 5  
ATOM 10620 H HD22 . ASN B 1 52 ? -14.849 -7.242  5.894   1.00 0.26 ? 52 ASN B HD22 5  
ATOM 10621 N N    . PRO B 1 53 ? -14.404 -9.674  1.753   1.00 0.30 ? 53 PRO B N    5  
ATOM 10622 C CA   . PRO B 1 53 ? -14.829 -11.065 1.523   1.00 0.30 ? 53 PRO B CA   5  
ATOM 10623 C C    . PRO B 1 53 ? -16.116 -11.366 2.298   1.00 0.30 ? 53 PRO B C    5  
ATOM 10624 O O    . PRO B 1 53 ? -16.595 -12.483 2.317   1.00 0.30 ? 53 PRO B O    5  
ATOM 10625 C CB   . PRO B 1 53 ? -13.659 -11.893 2.063   1.00 0.30 ? 53 PRO B CB   5  
ATOM 10626 C CG   . PRO B 1 53 ? -12.908 -10.983 3.065   1.00 0.30 ? 53 PRO B CG   5  
ATOM 10627 C CD   . PRO B 1 53 ? -13.296 -9.533  2.720   1.00 0.30 ? 53 PRO B CD   5  
ATOM 10628 H HA   . PRO B 1 53 ? -14.962 -11.257 0.471   1.00 0.30 ? 53 PRO B HA   5  
ATOM 10629 H HB2  . PRO B 1 53 ? -14.032 -12.775 2.565   1.00 0.30 ? 53 PRO B HB2  5  
ATOM 10630 H HB3  . PRO B 1 53 ? -12.998 -12.171 1.258   1.00 0.30 ? 53 PRO B HB3  5  
ATOM 10631 H HG2  . PRO B 1 53 ? -13.209 -11.220 4.076   1.00 0.30 ? 53 PRO B HG2  5  
ATOM 10632 H HG3  . PRO B 1 53 ? -11.843 -11.111 2.955   1.00 0.30 ? 53 PRO B HG3  5  
ATOM 10633 H HD2  . PRO B 1 53 ? -13.628 -9.010  3.606   1.00 0.30 ? 53 PRO B HD2  5  
ATOM 10634 H HD3  . PRO B 1 53 ? -12.466 -9.017  2.261   1.00 0.30 ? 53 PRO B HD3  5  
ATOM 10635 N N    . GLU B 1 54 ? -16.678 -10.377 2.938   1.00 0.43 ? 54 GLU B N    5  
ATOM 10636 C CA   . GLU B 1 54 ? -17.933 -10.606 3.709   1.00 0.43 ? 54 GLU B CA   5  
ATOM 10637 C C    . GLU B 1 54 ? -19.139 -10.237 2.844   1.00 0.43 ? 54 GLU B C    5  
ATOM 10638 O O    . GLU B 1 54 ? -20.261 -10.195 3.310   1.00 0.43 ? 54 GLU B O    5  
ATOM 10639 C CB   . GLU B 1 54 ? -17.922 -9.737  4.968   1.00 0.43 ? 54 GLU B CB   5  
ATOM 10640 C CG   . GLU B 1 54 ? -17.199 -10.477 6.094   1.00 0.43 ? 54 GLU B CG   5  
ATOM 10641 C CD   . GLU B 1 54 ? -17.275 -9.651  7.379   1.00 0.43 ? 54 GLU B CD   5  
ATOM 10642 O OE1  . GLU B 1 54 ? -17.796 -8.549  7.323   1.00 0.43 ? 54 GLU B OE1  5  
ATOM 10643 O OE2  . GLU B 1 54 ? -16.811 -10.134 8.399   1.00 0.43 ? 54 GLU B OE2  5  
ATOM 10644 H H    . GLU B 1 54 ? -16.277 -9.483  2.909   1.00 0.43 ? 54 GLU B H    5  
ATOM 10645 H HA   . GLU B 1 54 ? -17.996 -11.647 3.991   1.00 0.43 ? 54 GLU B HA   5  
ATOM 10646 H HB2  . GLU B 1 54 ? -17.412 -8.807  4.759   1.00 0.43 ? 54 GLU B HB2  5  
ATOM 10647 H HB3  . GLU B 1 54 ? -18.938 -9.529  5.271   1.00 0.43 ? 54 GLU B HB3  5  
ATOM 10648 H HG2  . GLU B 1 54 ? -17.667 -11.437 6.253   1.00 0.43 ? 54 GLU B HG2  5  
ATOM 10649 H HG3  . GLU B 1 54 ? -16.163 -10.621 5.823   1.00 0.43 ? 54 GLU B HG3  5  
ATOM 10650 N N    . LYS B 1 55 ? -18.920 -9.969  1.585   1.00 0.47 ? 55 LYS B N    5  
ATOM 10651 C CA   . LYS B 1 55 ? -20.055 -9.603  0.692   1.00 0.47 ? 55 LYS B CA   5  
ATOM 10652 C C    . LYS B 1 55 ? -20.579 -10.860 -0.008  1.00 0.47 ? 55 LYS B C    5  
ATOM 10653 O O    . LYS B 1 55 ? -20.151 -11.962 0.272   1.00 0.47 ? 55 LYS B O    5  
ATOM 10654 C CB   . LYS B 1 55 ? -19.576 -8.597  -0.356  1.00 0.47 ? 55 LYS B CB   5  
ATOM 10655 C CG   . LYS B 1 55 ? -19.974 -7.184  0.072   1.00 0.47 ? 55 LYS B CG   5  
ATOM 10656 C CD   . LYS B 1 55 ? -21.456 -6.955  -0.233  1.00 0.47 ? 55 LYS B CD   5  
ATOM 10657 C CE   . LYS B 1 55 ? -21.750 -5.454  -0.246  1.00 0.47 ? 55 LYS B CE   5  
ATOM 10658 N NZ   . LYS B 1 55 ? -22.490 -5.082  0.993   1.00 0.47 ? 55 LYS B NZ   5  
ATOM 10659 H H    . LYS B 1 55 ? -18.009 -10.009 1.227   1.00 0.47 ? 55 LYS B H    5  
ATOM 10660 H HA   . LYS B 1 55 ? -20.848 -9.161  1.278   1.00 0.47 ? 55 LYS B HA   5  
ATOM 10661 H HB2  . LYS B 1 55 ? -18.501 -8.657  -0.447  1.00 0.47 ? 55 LYS B HB2  5  
ATOM 10662 H HB3  . LYS B 1 55 ? -20.031 -8.825  -1.309  1.00 0.47 ? 55 LYS B HB3  5  
ATOM 10663 H HG2  . LYS B 1 55 ? -19.802 -7.066  1.132   1.00 0.47 ? 55 LYS B HG2  5  
ATOM 10664 H HG3  . LYS B 1 55 ? -19.382 -6.462  -0.472  1.00 0.47 ? 55 LYS B HG3  5  
ATOM 10665 H HD2  . LYS B 1 55 ? -21.694 -7.379  -1.199  1.00 0.47 ? 55 LYS B HD2  5  
ATOM 10666 H HD3  . LYS B 1 55 ? -22.057 -7.431  0.526   1.00 0.47 ? 55 LYS B HD3  5  
ATOM 10667 H HE2  . LYS B 1 55 ? -20.821 -4.906  -0.290  1.00 0.47 ? 55 LYS B HE2  5  
ATOM 10668 H HE3  . LYS B 1 55 ? -22.351 -5.213  -1.111  1.00 0.47 ? 55 LYS B HE3  5  
ATOM 10669 H HZ1  . LYS B 1 55 ? -22.259 -5.757  1.750   1.00 0.47 ? 55 LYS B HZ1  5  
ATOM 10670 H HZ2  . LYS B 1 55 ? -22.211 -4.125  1.288   1.00 0.47 ? 55 LYS B HZ2  5  
ATOM 10671 H HZ3  . LYS B 1 55 ? -23.513 -5.105  0.805   1.00 0.47 ? 55 LYS B HZ3  5  
ATOM 10672 N N    . LYS B 1 56 ? -21.500 -10.702 -0.919  1.00 0.58 ? 56 LYS B N    5  
ATOM 10673 C CA   . LYS B 1 56 ? -22.050 -11.888 -1.635  1.00 0.58 ? 56 LYS B CA   5  
ATOM 10674 C C    . LYS B 1 56 ? -21.362 -12.023 -2.997  1.00 0.58 ? 56 LYS B C    5  
ATOM 10675 O O    . LYS B 1 56 ? -20.957 -13.096 -3.394  1.00 0.58 ? 56 LYS B O    5  
ATOM 10676 C CB   . LYS B 1 56 ? -23.555 -11.707 -1.838  1.00 0.58 ? 56 LYS B CB   5  
ATOM 10677 C CG   . LYS B 1 56 ? -24.068 -12.755 -2.828  1.00 0.58 ? 56 LYS B CG   5  
ATOM 10678 C CD   . LYS B 1 56 ? -25.331 -13.411 -2.268  1.00 0.58 ? 56 LYS B CD   5  
ATOM 10679 C CE   . LYS B 1 56 ? -24.939 -14.543 -1.316  1.00 0.58 ? 56 LYS B CE   5  
ATOM 10680 N NZ   . LYS B 1 56 ? -25.763 -15.750 -1.612  1.00 0.58 ? 56 LYS B NZ   5  
ATOM 10681 H H    . LYS B 1 56 ? -21.832 -9.805  -1.131  1.00 0.58 ? 56 LYS B H    5  
ATOM 10682 H HA   . LYS B 1 56 ? -21.868 -12.777 -1.051  1.00 0.58 ? 56 LYS B HA   5  
ATOM 10683 H HB2  . LYS B 1 56 ? -24.062 -11.826 -0.891  1.00 0.58 ? 56 LYS B HB2  5  
ATOM 10684 H HB3  . LYS B 1 56 ? -23.750 -10.720 -2.230  1.00 0.58 ? 56 LYS B HB3  5  
ATOM 10685 H HG2  . LYS B 1 56 ? -24.297 -12.277 -3.770  1.00 0.58 ? 56 LYS B HG2  5  
ATOM 10686 H HG3  . LYS B 1 56 ? -23.311 -13.507 -2.981  1.00 0.58 ? 56 LYS B HG3  5  
ATOM 10687 H HD2  . LYS B 1 56 ? -25.913 -12.674 -1.733  1.00 0.58 ? 56 LYS B HD2  5  
ATOM 10688 H HD3  . LYS B 1 56 ? -25.919 -13.814 -3.080  1.00 0.58 ? 56 LYS B HD3  5  
ATOM 10689 H HE2  . LYS B 1 56 ? -23.893 -14.779 -1.450  1.00 0.58 ? 56 LYS B HE2  5  
ATOM 10690 H HE3  . LYS B 1 56 ? -25.110 -14.232 -0.296  1.00 0.58 ? 56 LYS B HE3  5  
ATOM 10691 H HZ1  . LYS B 1 56 ? -26.157 -15.674 -2.571  1.00 0.58 ? 56 LYS B HZ1  5  
ATOM 10692 H HZ2  . LYS B 1 56 ? -25.168 -16.599 -1.549  1.00 0.58 ? 56 LYS B HZ2  5  
ATOM 10693 H HZ3  . LYS B 1 56 ? -26.539 -15.815 -0.921  1.00 0.58 ? 56 LYS B HZ3  5  
ATOM 10694 N N    . TRP B 1 57 ? -21.230 -10.940 -3.714  1.00 0.41 ? 57 TRP B N    5  
ATOM 10695 C CA   . TRP B 1 57 ? -20.572 -11.007 -5.049  1.00 0.41 ? 57 TRP B CA   5  
ATOM 10696 C C    . TRP B 1 57 ? -19.052 -11.026 -4.867  1.00 0.41 ? 57 TRP B C    5  
ATOM 10697 O O    . TRP B 1 57 ? -18.337 -11.654 -5.623  1.00 0.41 ? 57 TRP B O    5  
ATOM 10698 C CB   . TRP B 1 57 ? -20.970 -9.780  -5.872  1.00 0.41 ? 57 TRP B CB   5  
ATOM 10699 C CG   . TRP B 1 57 ? -20.438 -8.548  -5.215  1.00 0.41 ? 57 TRP B CG   5  
ATOM 10700 C CD1  . TRP B 1 57 ? -21.102 -7.806  -4.300  1.00 0.41 ? 57 TRP B CD1  5  
ATOM 10701 C CD2  . TRP B 1 57 ? -19.145 -7.903  -5.404  1.00 0.41 ? 57 TRP B CD2  5  
ATOM 10702 N NE1  . TRP B 1 57 ? -20.301 -6.747  -3.915  1.00 0.41 ? 57 TRP B NE1  5  
ATOM 10703 C CE2  . TRP B 1 57 ? -19.084 -6.763  -4.568  1.00 0.41 ? 57 TRP B CE2  5  
ATOM 10704 C CE3  . TRP B 1 57 ? -18.031 -8.194  -6.211  1.00 0.41 ? 57 TRP B CE3  5  
ATOM 10705 C CZ2  . TRP B 1 57 ? -17.957 -5.940  -4.534  1.00 0.41 ? 57 TRP B CZ2  5  
ATOM 10706 C CZ3  . TRP B 1 57 ? -16.895 -7.368  -6.180  1.00 0.41 ? 57 TRP B CZ3  5  
ATOM 10707 C CH2  . TRP B 1 57 ? -16.858 -6.243  -5.343  1.00 0.41 ? 57 TRP B CH2  5  
ATOM 10708 H H    . TRP B 1 57 ? -21.566 -10.084 -3.374  1.00 0.41 ? 57 TRP B H    5  
ATOM 10709 H HA   . TRP B 1 57 ? -20.885 -11.903 -5.563  1.00 0.41 ? 57 TRP B HA   5  
ATOM 10710 H HB2  . TRP B 1 57 ? -20.558 -9.865  -6.867  1.00 0.41 ? 57 TRP B HB2  5  
ATOM 10711 H HB3  . TRP B 1 57 ? -22.046 -9.720  -5.931  1.00 0.41 ? 57 TRP B HB3  5  
ATOM 10712 H HD1  . TRP B 1 57 ? -22.098 -8.007  -3.931  1.00 0.41 ? 57 TRP B HD1  5  
ATOM 10713 H HE1  . TRP B 1 57 ? -20.547 -6.059  -3.262  1.00 0.41 ? 57 TRP B HE1  5  
ATOM 10714 H HE3  . TRP B 1 57 ? -18.048 -9.057  -6.859  1.00 0.41 ? 57 TRP B HE3  5  
ATOM 10715 H HZ2  . TRP B 1 57 ? -17.935 -5.075  -3.889  1.00 0.41 ? 57 TRP B HZ2  5  
ATOM 10716 H HZ3  . TRP B 1 57 ? -16.045 -7.601  -6.804  1.00 0.41 ? 57 TRP B HZ3  5  
ATOM 10717 H HH2  . TRP B 1 57 ? -15.983 -5.613  -5.324  1.00 0.41 ? 57 TRP B HH2  5  
ATOM 10718 N N    . VAL B 1 58 ? -18.553 -10.345 -3.873  1.00 0.32 ? 58 VAL B N    5  
ATOM 10719 C CA   . VAL B 1 58 ? -17.080 -10.327 -3.647  1.00 0.32 ? 58 VAL B CA   5  
ATOM 10720 C C    . VAL B 1 58 ? -16.541 -11.758 -3.683  1.00 0.32 ? 58 VAL B C    5  
ATOM 10721 O O    . VAL B 1 58 ? -15.698 -12.094 -4.491  1.00 0.32 ? 58 VAL B O    5  
ATOM 10722 C CB   . VAL B 1 58 ? -16.778 -9.701  -2.284  1.00 0.32 ? 58 VAL B CB   5  
ATOM 10723 C CG1  . VAL B 1 58 ? -15.286 -9.843  -1.976  1.00 0.32 ? 58 VAL B CG1  5  
ATOM 10724 C CG2  . VAL B 1 58 ? -17.153 -8.218  -2.310  1.00 0.32 ? 58 VAL B CG2  5  
ATOM 10725 H H    . VAL B 1 58 ? -19.146 -9.844  -3.275  1.00 0.32 ? 58 VAL B H    5  
ATOM 10726 H HA   . VAL B 1 58 ? -16.604 -9.743  -4.423  1.00 0.32 ? 58 VAL B HA   5  
ATOM 10727 H HB   . VAL B 1 58 ? -17.353 -10.208 -1.521  1.00 0.32 ? 58 VAL B HB   5  
ATOM 10728 H HG11 . VAL B 1 58 ? -14.745 -10.023 -2.893  1.00 0.32 ? 58 VAL B HG11 5  
ATOM 10729 H HG12 . VAL B 1 58 ? -14.926 -8.935  -1.518  1.00 0.32 ? 58 VAL B HG12 5  
ATOM 10730 H HG13 . VAL B 1 58 ? -15.135 -10.672 -1.300  1.00 0.32 ? 58 VAL B HG13 5  
ATOM 10731 H HG21 . VAL B 1 58 ? -16.620 -7.727  -3.111  1.00 0.32 ? 58 VAL B HG21 5  
ATOM 10732 H HG22 . VAL B 1 58 ? -18.216 -8.118  -2.471  1.00 0.32 ? 58 VAL B HG22 5  
ATOM 10733 H HG23 . VAL B 1 58 ? -16.887 -7.762  -1.369  1.00 0.32 ? 58 VAL B HG23 5  
ATOM 10734 N N    . ARG B 1 59 ? -17.024 -12.606 -2.816  1.00 0.34 ? 59 ARG B N    5  
ATOM 10735 C CA   . ARG B 1 59 ? -16.540 -14.014 -2.806  1.00 0.34 ? 59 ARG B CA   5  
ATOM 10736 C C    . ARG B 1 59 ? -16.864 -14.667 -4.150  1.00 0.34 ? 59 ARG B C    5  
ATOM 10737 O O    . ARG B 1 59 ? -16.216 -15.605 -4.569  1.00 0.34 ? 59 ARG B O    5  
ATOM 10738 C CB   . ARG B 1 59 ? -17.237 -14.786 -1.683  1.00 0.34 ? 59 ARG B CB   5  
ATOM 10739 C CG   . ARG B 1 59 ? -16.655 -16.197 -1.595  1.00 0.34 ? 59 ARG B CG   5  
ATOM 10740 C CD   . ARG B 1 59 ? -17.735 -17.166 -1.111  1.00 0.34 ? 59 ARG B CD   5  
ATOM 10741 N NE   . ARG B 1 59 ? -18.544 -17.629 -2.274  1.00 0.34 ? 59 ARG B NE   5  
ATOM 10742 C CZ   . ARG B 1 59 ? -18.468 -18.870 -2.671  1.00 0.34 ? 59 ARG B CZ   5  
ATOM 10743 N NH1  . ARG B 1 59 ? -18.847 -19.833 -1.876  1.00 0.34 ? 59 ARG B NH1  5  
ATOM 10744 N NH2  . ARG B 1 59 ? -18.011 -19.147 -3.861  1.00 0.34 ? 59 ARG B NH2  5  
ATOM 10745 H H    . ARG B 1 59 ? -17.705 -12.316 -2.174  1.00 0.34 ? 59 ARG B H    5  
ATOM 10746 H HA   . ARG B 1 59 ? -15.472 -14.029 -2.645  1.00 0.34 ? 59 ARG B HA   5  
ATOM 10747 H HB2  . ARG B 1 59 ? -17.083 -14.272 -0.744  1.00 0.34 ? 59 ARG B HB2  5  
ATOM 10748 H HB3  . ARG B 1 59 ? -18.295 -14.847 -1.890  1.00 0.34 ? 59 ARG B HB3  5  
ATOM 10749 H HG2  . ARG B 1 59 ? -16.306 -16.504 -2.571  1.00 0.34 ? 59 ARG B HG2  5  
ATOM 10750 H HG3  . ARG B 1 59 ? -15.830 -16.204 -0.898  1.00 0.34 ? 59 ARG B HG3  5  
ATOM 10751 H HD2  . ARG B 1 59 ? -17.270 -18.017 -0.635  1.00 0.34 ? 59 ARG B HD2  5  
ATOM 10752 H HD3  . ARG B 1 59 ? -18.377 -16.665 -0.402  1.00 0.34 ? 59 ARG B HD3  5  
ATOM 10753 H HE   . ARG B 1 59 ? -19.134 -17.001 -2.741  1.00 0.34 ? 59 ARG B HE   5  
ATOM 10754 H HH11 . ARG B 1 59 ? -19.198 -19.620 -0.964  1.00 0.34 ? 59 ARG B HH11 5  
ATOM 10755 H HH12 . ARG B 1 59 ? -18.788 -20.784 -2.180  1.00 0.34 ? 59 ARG B HH12 5  
ATOM 10756 H HH21 . ARG B 1 59 ? -17.720 -18.409 -4.470  1.00 0.34 ? 59 ARG B HH21 5  
ATOM 10757 H HH22 . ARG B 1 59 ? -17.952 -20.098 -4.164  1.00 0.34 ? 59 ARG B HH22 5  
ATOM 10758 N N    . GLU B 1 60 ? -17.862 -14.175 -4.830  1.00 0.37 ? 60 GLU B N    5  
ATOM 10759 C CA   . GLU B 1 60 ? -18.230 -14.761 -6.149  1.00 0.37 ? 60 GLU B CA   5  
ATOM 10760 C C    . GLU B 1 60 ? -17.136 -14.444 -7.169  1.00 0.37 ? 60 GLU B C    5  
ATOM 10761 O O    . GLU B 1 60 ? -16.907 -15.189 -8.102  1.00 0.37 ? 60 GLU B O    5  
ATOM 10762 C CB   . GLU B 1 60 ? -19.557 -14.157 -6.618  1.00 0.37 ? 60 GLU B CB   5  
ATOM 10763 C CG   . GLU B 1 60 ? -20.712 -15.058 -6.181  1.00 0.37 ? 60 GLU B CG   5  
ATOM 10764 C CD   . GLU B 1 60 ? -22.020 -14.265 -6.214  1.00 0.37 ? 60 GLU B CD   5  
ATOM 10765 O OE1  . GLU B 1 60 ? -22.158 -13.426 -7.089  1.00 0.37 ? 60 GLU B OE1  5  
ATOM 10766 O OE2  . GLU B 1 60 ? -22.860 -14.509 -5.364  1.00 0.37 ? 60 GLU B OE2  5  
ATOM 10767 H H    . GLU B 1 60 ? -18.371 -13.416 -4.473  1.00 0.37 ? 60 GLU B H    5  
ATOM 10768 H HA   . GLU B 1 60 ? -18.336 -15.831 -6.052  1.00 0.37 ? 60 GLU B HA   5  
ATOM 10769 H HB2  . GLU B 1 60 ? -19.678 -13.177 -6.181  1.00 0.37 ? 60 GLU B HB2  5  
ATOM 10770 H HB3  . GLU B 1 60 ? -19.554 -14.073 -7.694  1.00 0.37 ? 60 GLU B HB3  5  
ATOM 10771 H HG2  . GLU B 1 60 ? -20.785 -15.902 -6.853  1.00 0.37 ? 60 GLU B HG2  5  
ATOM 10772 H HG3  . GLU B 1 60 ? -20.534 -15.413 -5.178  1.00 0.37 ? 60 GLU B HG3  5  
ATOM 10773 N N    . TYR B 1 61 ? -16.455 -13.343 -6.998  1.00 0.36 ? 61 TYR B N    5  
ATOM 10774 C CA   . TYR B 1 61 ? -15.374 -12.976 -7.955  1.00 0.36 ? 61 TYR B CA   5  
ATOM 10775 C C    . TYR B 1 61 ? -14.098 -13.741 -7.600  1.00 0.36 ? 61 TYR B C    5  
ATOM 10776 O O    . TYR B 1 61 ? -13.453 -14.320 -8.451  1.00 0.36 ? 61 TYR B O    5  
ATOM 10777 C CB   . TYR B 1 61 ? -15.107 -11.471 -7.868  1.00 0.36 ? 61 TYR B CB   5  
ATOM 10778 C CG   . TYR B 1 61 ? -16.049 -10.727 -8.789  1.00 0.36 ? 61 TYR B CG   5  
ATOM 10779 C CD1  . TYR B 1 61 ? -17.228 -11.338 -9.238  1.00 0.36 ? 61 TYR B CD1  5  
ATOM 10780 C CD2  . TYR B 1 61 ? -15.743 -9.421  -9.192  1.00 0.36 ? 61 TYR B CD2  5  
ATOM 10781 C CE1  . TYR B 1 61 ? -18.096 -10.645 -10.089 1.00 0.36 ? 61 TYR B CE1  5  
ATOM 10782 C CE2  . TYR B 1 61 ? -16.612 -8.728  -10.043 1.00 0.36 ? 61 TYR B CE2  5  
ATOM 10783 C CZ   . TYR B 1 61 ? -17.789 -9.340  -10.492 1.00 0.36 ? 61 TYR B CZ   5  
ATOM 10784 O OH   . TYR B 1 61 ? -18.645 -8.658  -11.331 1.00 0.36 ? 61 TYR B OH   5  
ATOM 10785 H H    . TYR B 1 61 ? -16.656 -12.757 -6.238  1.00 0.36 ? 61 TYR B H    5  
ATOM 10786 H HA   . TYR B 1 61 ? -15.680 -13.232 -8.959  1.00 0.36 ? 61 TYR B HA   5  
ATOM 10787 H HB2  . TYR B 1 61 ? -15.261 -11.138 -6.853  1.00 0.36 ? 61 TYR B HB2  5  
ATOM 10788 H HB3  . TYR B 1 61 ? -14.088 -11.270 -8.161  1.00 0.36 ? 61 TYR B HB3  5  
ATOM 10789 H HD1  . TYR B 1 61 ? -17.465 -12.345 -8.928  1.00 0.36 ? 61 TYR B HD1  5  
ATOM 10790 H HD2  . TYR B 1 61 ? -14.836 -8.949  -8.846  1.00 0.36 ? 61 TYR B HD2  5  
ATOM 10791 H HE1  . TYR B 1 61 ? -19.004 -11.116 -10.436 1.00 0.36 ? 61 TYR B HE1  5  
ATOM 10792 H HE2  . TYR B 1 61 ? -16.374 -7.720  -10.353 1.00 0.36 ? 61 TYR B HE2  5  
ATOM 10793 H HH   . TYR B 1 61 ? -19.532 -8.996  -11.188 1.00 0.36 ? 61 TYR B HH   5  
ATOM 10794 N N    . ILE B 1 62 ? -13.729 -13.748 -6.348  1.00 0.38 ? 62 ILE B N    5  
ATOM 10795 C CA   . ILE B 1 62 ? -12.494 -14.476 -5.938  1.00 0.38 ? 62 ILE B CA   5  
ATOM 10796 C C    . ILE B 1 62 ? -12.635 -15.958 -6.292  1.00 0.38 ? 62 ILE B C    5  
ATOM 10797 O O    . ILE B 1 62 ? -11.686 -16.604 -6.691  1.00 0.38 ? 62 ILE B O    5  
ATOM 10798 C CB   . ILE B 1 62 ? -12.293 -14.329 -4.430  1.00 0.38 ? 62 ILE B CB   5  
ATOM 10799 C CG1  . ILE B 1 62 ? -12.034 -12.859 -4.092  1.00 0.38 ? 62 ILE B CG1  5  
ATOM 10800 C CG2  . ILE B 1 62 ? -11.094 -15.171 -3.990  1.00 0.38 ? 62 ILE B CG2  5  
ATOM 10801 C CD1  . ILE B 1 62 ? -13.218 -12.299 -3.302  1.00 0.38 ? 62 ILE B CD1  5  
ATOM 10802 H H    . ILE B 1 62 ? -14.264 -13.275 -5.677  1.00 0.38 ? 62 ILE B H    5  
ATOM 10803 H HA   . ILE B 1 62 ? -11.644 -14.061 -6.458  1.00 0.38 ? 62 ILE B HA   5  
ATOM 10804 H HB   . ILE B 1 62 ? -13.179 -14.668 -3.913  1.00 0.38 ? 62 ILE B HB   5  
ATOM 10805 H HG12 . ILE B 1 62 ? -11.134 -12.778 -3.500  1.00 0.38 ? 62 ILE B HG12 5  
ATOM 10806 H HG13 . ILE B 1 62 ? -11.915 -12.295 -5.006  1.00 0.38 ? 62 ILE B HG13 5  
ATOM 10807 H HG21 . ILE B 1 62 ? -10.866 -15.899 -4.753  1.00 0.38 ? 62 ILE B HG21 5  
ATOM 10808 H HG22 . ILE B 1 62 ? -10.238 -14.528 -3.839  1.00 0.38 ? 62 ILE B HG22 5  
ATOM 10809 H HG23 . ILE B 1 62 ? -11.330 -15.678 -3.066  1.00 0.38 ? 62 ILE B HG23 5  
ATOM 10810 H HD11 . ILE B 1 62 ? -13.889 -13.104 -3.041  1.00 0.38 ? 62 ILE B HD11 5  
ATOM 10811 H HD12 . ILE B 1 62 ? -12.858 -11.825 -2.400  1.00 0.38 ? 62 ILE B HD12 5  
ATOM 10812 H HD13 . ILE B 1 62 ? -13.743 -11.573 -3.904  1.00 0.38 ? 62 ILE B HD13 5  
ATOM 10813 N N    . ASN B 1 63 ? -13.812 -16.502 -6.149  1.00 0.49 ? 63 ASN B N    5  
ATOM 10814 C CA   . ASN B 1 63 ? -14.012 -17.942 -6.477  1.00 0.49 ? 63 ASN B CA   5  
ATOM 10815 C C    . ASN B 1 63 ? -14.181 -18.102 -7.989  1.00 0.49 ? 63 ASN B C    5  
ATOM 10816 O O    . ASN B 1 63 ? -13.814 -19.110 -8.562  1.00 0.49 ? 63 ASN B O    5  
ATOM 10817 C CB   . ASN B 1 63 ? -15.265 -18.458 -5.767  1.00 0.49 ? 63 ASN B CB   5  
ATOM 10818 C CG   . ASN B 1 63 ? -15.635 -19.835 -6.319  1.00 0.49 ? 63 ASN B CG   5  
ATOM 10819 O OD1  . ASN B 1 63 ? -14.896 -20.787 -6.158  1.00 0.49 ? 63 ASN B OD1  5  
ATOM 10820 N ND2  . ASN B 1 63 ? -16.758 -19.984 -6.968  1.00 0.49 ? 63 ASN B ND2  5  
ATOM 10821 H H    . ASN B 1 63 ? -14.565 -15.965 -5.826  1.00 0.49 ? 63 ASN B H    5  
ATOM 10822 H HA   . ASN B 1 63 ? -13.154 -18.509 -6.149  1.00 0.49 ? 63 ASN B HA   5  
ATOM 10823 H HB2  . ASN B 1 63 ? -15.071 -18.534 -4.706  1.00 0.49 ? 63 ASN B HB2  5  
ATOM 10824 H HB3  . ASN B 1 63 ? -16.082 -17.773 -5.935  1.00 0.49 ? 63 ASN B HB3  5  
ATOM 10825 H HD21 . ASN B 1 63 ? -17.354 -19.218 -7.097  1.00 0.49 ? 63 ASN B HD21 5  
ATOM 10826 H HD22 . ASN B 1 63 ? -17.004 -20.864 -7.326  1.00 0.49 ? 63 ASN B HD22 5  
ATOM 10827 N N    . SER B 1 64 ? -14.735 -17.116 -8.641  1.00 0.55 ? 64 SER B N    5  
ATOM 10828 C CA   . SER B 1 64 ? -14.927 -17.214 -10.116 1.00 0.55 ? 64 SER B CA   5  
ATOM 10829 C C    . SER B 1 64 ? -13.577 -17.051 -10.817 1.00 0.55 ? 64 SER B C    5  
ATOM 10830 O O    . SER B 1 64 ? -13.403 -17.450 -11.951 1.00 0.55 ? 64 SER B O    5  
ATOM 10831 C CB   . SER B 1 64 ? -15.878 -16.110 -10.579 1.00 0.55 ? 64 SER B CB   5  
ATOM 10832 O OG   . SER B 1 64 ? -15.306 -14.842 -10.283 1.00 0.55 ? 64 SER B OG   5  
ATOM 10833 H H    . SER B 1 64 ? -15.024 -16.313 -8.162  1.00 0.55 ? 64 SER B H    5  
ATOM 10834 H HA   . SER B 1 64 ? -15.347 -18.177 -10.362 1.00 0.55 ? 64 SER B HA   5  
ATOM 10835 H HB2  . SER B 1 64 ? -16.034 -16.189 -11.642 1.00 0.55 ? 64 SER B HB2  5  
ATOM 10836 H HB3  . SER B 1 64 ? -16.827 -16.217 -10.070 1.00 0.55 ? 64 SER B HB3  5  
ATOM 10837 H HG   . SER B 1 64 ? -15.876 -14.166 -10.655 1.00 0.55 ? 64 SER B HG   5  
ATOM 10838 N N    . LEU B 1 65 ? -12.619 -16.467 -10.151 1.00 0.53 ? 65 LEU B N    5  
ATOM 10839 C CA   . LEU B 1 65 ? -11.280 -16.281 -10.779 1.00 0.53 ? 65 LEU B CA   5  
ATOM 10840 C C    . LEU B 1 65 ? -10.401 -17.496 -10.479 1.00 0.53 ? 65 LEU B C    5  
ATOM 10841 O O    . LEU B 1 65 ? -9.772  -18.051 -11.358 1.00 0.53 ? 65 LEU B O    5  
ATOM 10842 C CB   . LEU B 1 65 ? -10.622 -15.022 -10.210 1.00 0.53 ? 65 LEU B CB   5  
ATOM 10843 C CG   . LEU B 1 65 ? -10.093 -14.159 -11.357 1.00 0.53 ? 65 LEU B CG   5  
ATOM 10844 C CD1  . LEU B 1 65 ? -10.937 -12.889 -11.471 1.00 0.53 ? 65 LEU B CD1  5  
ATOM 10845 C CD2  . LEU B 1 65 ? -8.637  -13.780 -11.078 1.00 0.53 ? 65 LEU B CD2  5  
ATOM 10846 H H    . LEU B 1 65 ? -12.779 -16.153 -9.236  1.00 0.53 ? 65 LEU B H    5  
ATOM 10847 H HA   . LEU B 1 65 ? -11.397 -16.175 -11.848 1.00 0.53 ? 65 LEU B HA   5  
ATOM 10848 H HB2  . LEU B 1 65 ? -11.349 -14.460 -9.642  1.00 0.53 ? 65 LEU B HB2  5  
ATOM 10849 H HB3  . LEU B 1 65 ? -9.802  -15.304 -9.567  1.00 0.53 ? 65 LEU B HB3  5  
ATOM 10850 H HG   . LEU B 1 65 ? -10.152 -14.715 -12.282 1.00 0.53 ? 65 LEU B HG   5  
ATOM 10851 H HD11 . LEU B 1 65 ? -10.961 -12.386 -10.516 1.00 0.53 ? 65 LEU B HD11 5  
ATOM 10852 H HD12 . LEU B 1 65 ? -10.501 -12.233 -12.212 1.00 0.53 ? 65 LEU B HD12 5  
ATOM 10853 H HD13 . LEU B 1 65 ? -11.941 -13.149 -11.769 1.00 0.53 ? 65 LEU B HD13 5  
ATOM 10854 H HD21 . LEU B 1 65 ? -8.481  -13.710 -10.012 1.00 0.53 ? 65 LEU B HD21 5  
ATOM 10855 H HD22 . LEU B 1 65 ? -7.984  -14.536 -11.489 1.00 0.53 ? 65 LEU B HD22 5  
ATOM 10856 H HD23 . LEU B 1 65 ? -8.418  -12.828 -11.537 1.00 0.53 ? 65 LEU B HD23 5  
ATOM 10857 N N    . GLU B 1 66 ? -10.353 -17.915 -9.244  1.00 0.61 ? 66 GLU B N    5  
ATOM 10858 C CA   . GLU B 1 66 ? -9.515  -19.094 -8.888  1.00 0.61 ? 66 GLU B CA   5  
ATOM 10859 C C    . GLU B 1 66 ? -10.339 -20.373 -9.048  1.00 0.61 ? 66 GLU B C    5  
ATOM 10860 O O    . GLU B 1 66 ? -10.415 -21.189 -8.152  1.00 0.61 ? 66 GLU B O    5  
ATOM 10861 C CB   . GLU B 1 66 ? -9.045  -18.967 -7.438  1.00 0.61 ? 66 GLU B CB   5  
ATOM 10862 C CG   . GLU B 1 66 ? -7.866  -17.994 -7.365  1.00 0.61 ? 66 GLU B CG   5  
ATOM 10863 C CD   . GLU B 1 66 ? -6.574  -18.730 -7.727  1.00 0.61 ? 66 GLU B CD   5  
ATOM 10864 O OE1  . GLU B 1 66 ? -6.541  -19.346 -8.780  1.00 0.61 ? 66 GLU B OE1  5  
ATOM 10865 O OE2  . GLU B 1 66 ? -5.640  -18.664 -6.946  1.00 0.61 ? 66 GLU B OE2  5  
ATOM 10866 H H    . GLU B 1 66 ? -10.869 -17.453 -8.550  1.00 0.61 ? 66 GLU B H    5  
ATOM 10867 H HA   . GLU B 1 66 ? -8.656  -19.135 -9.542  1.00 0.61 ? 66 GLU B HA   5  
ATOM 10868 H HB2  . GLU B 1 66 ? -9.857  -18.597 -6.828  1.00 0.61 ? 66 GLU B HB2  5  
ATOM 10869 H HB3  . GLU B 1 66 ? -8.733  -19.934 -7.074  1.00 0.61 ? 66 GLU B HB3  5  
ATOM 10870 H HG2  . GLU B 1 66 ? -8.026  -17.183 -8.060  1.00 0.61 ? 66 GLU B HG2  5  
ATOM 10871 H HG3  . GLU B 1 66 ? -7.786  -17.600 -6.363  1.00 0.61 ? 66 GLU B HG3  5  
ATOM 10872 N N    . MET B 1 67 ? -10.957 -20.553 -10.183 1.00 1.45 ? 67 MET B N    5  
ATOM 10873 C CA   . MET B 1 67 ? -11.776 -21.780 -10.399 1.00 1.45 ? 67 MET B CA   5  
ATOM 10874 C C    . MET B 1 67 ? -10.935 -23.017 -10.077 1.00 1.45 ? 67 MET B C    5  
ATOM 10875 O O    . MET B 1 67 ? -9.723  -22.963 -10.039 1.00 1.45 ? 67 MET B O    5  
ATOM 10876 C CB   . MET B 1 67 ? -12.232 -21.838 -11.858 1.00 1.45 ? 67 MET B CB   5  
ATOM 10877 C CG   . MET B 1 67 ? -13.756 -21.949 -11.914 1.00 1.45 ? 67 MET B CG   5  
ATOM 10878 S SD   . MET B 1 67 ? -14.306 -21.860 -13.636 1.00 1.45 ? 67 MET B SD   5  
ATOM 10879 C CE   . MET B 1 67 ? -16.076 -21.697 -13.302 1.00 1.45 ? 67 MET B CE   5  
ATOM 10880 H H    . MET B 1 67 ? -10.883 -19.882 -10.894 1.00 1.45 ? 67 MET B H    5  
ATOM 10881 H HA   . MET B 1 67 ? -12.641 -21.753 -9.753  1.00 1.45 ? 67 MET B HA   5  
ATOM 10882 H HB2  . MET B 1 67 ? -11.915 -20.941 -12.370 1.00 1.45 ? 67 MET B HB2  5  
ATOM 10883 H HB3  . MET B 1 67 ? -11.793 -22.701 -12.338 1.00 1.45 ? 67 MET B HB3  5  
ATOM 10884 H HG2  . MET B 1 67 ? -14.065 -22.891 -11.486 1.00 1.45 ? 67 MET B HG2  5  
ATOM 10885 H HG3  . MET B 1 67 ? -14.197 -21.138 -11.353 1.00 1.45 ? 67 MET B HG3  5  
ATOM 10886 H HE1  . MET B 1 67 ? -16.294 -22.091 -12.318 1.00 1.45 ? 67 MET B HE1  5  
ATOM 10887 H HE2  . MET B 1 67 ? -16.356 -20.653 -13.348 1.00 1.45 ? 67 MET B HE2  5  
ATOM 10888 H HE3  . MET B 1 67 ? -16.635 -22.249 -14.039 1.00 1.45 ? 67 MET B HE3  5  
ATOM 10889 N N    . SER B 1 68 ? -11.571 -24.133 -9.842  1.00 2.84 ? 68 SER B N    5  
ATOM 10890 C CA   . SER B 1 68 ? -10.807 -25.372 -9.523  1.00 2.84 ? 68 SER B CA   5  
ATOM 10891 C C    . SER B 1 68 ? -10.206 -25.945 -10.808 1.00 2.84 ? 68 SER B C    5  
ATOM 10892 O O    . SER B 1 68 ? -9.097  -26.451 -10.745 1.00 2.84 ? 68 SER B O    5  
ATOM 10893 C CB   . SER B 1 68 ? -11.747 -26.402 -8.896  1.00 2.84 ? 68 SER B CB   5  
ATOM 10894 O OG   . SER B 1 68 ? -10.982 -27.483 -8.382  1.00 2.84 ? 68 SER B OG   5  
ATOM 10895 O OXT  . SER B 1 68 ? -10.865 -25.871 -11.832 1.00 2.84 ? 68 SER B OXT  5  
ATOM 10896 H H    . SER B 1 68 ? -12.550 -24.156 -9.878  1.00 2.84 ? 68 SER B H    5  
ATOM 10897 H HA   . SER B 1 68 ? -10.015 -25.137 -8.828  1.00 2.84 ? 68 SER B HA   5  
ATOM 10898 H HB2  . SER B 1 68 ? -12.300 -25.945 -8.092  1.00 2.84 ? 68 SER B HB2  5  
ATOM 10899 H HB3  . SER B 1 68 ? -12.439 -26.761 -9.647  1.00 2.84 ? 68 SER B HB3  5  
ATOM 10900 H HG   . SER B 1 68 ? -11.567 -28.237 -8.273  1.00 2.84 ? 68 SER B HG   5  
ATOM 10901 N N    . SER A 1 1  ? -14.137 3.144   7.517   1.00 5.93 ? 1  SER A N    6  
ATOM 10902 C CA   . SER A 1 1  ? -13.191 3.895   6.645   1.00 5.93 ? 1  SER A CA   6  
ATOM 10903 C C    . SER A 1 1  ? -13.911 5.097   6.024   1.00 5.93 ? 1  SER A C    6  
ATOM 10904 O O    . SER A 1 1  ? -15.121 5.188   6.081   1.00 5.93 ? 1  SER A O    6  
ATOM 10905 C CB   . SER A 1 1  ? -12.682 2.977   5.533   1.00 5.93 ? 1  SER A CB   6  
ATOM 10906 O OG   . SER A 1 1  ? -11.402 2.473   5.889   1.00 5.93 ? 1  SER A OG   6  
ATOM 10907 H H1   . SER A 1 1  ? -15.054 3.635   7.537   1.00 5.93 ? 1  SER A H1   6  
ATOM 10908 H H2   . SER A 1 1  ? -14.268 2.184   7.141   1.00 5.93 ? 1  SER A H2   6  
ATOM 10909 H H3   . SER A 1 1  ? -13.751 3.090   8.481   1.00 5.93 ? 1  SER A H3   6  
ATOM 10910 H HA   . SER A 1 1  ? -12.355 4.242   7.235   1.00 5.93 ? 1  SER A HA   6  
ATOM 10911 H HB2  . SER A 1 1  ? -13.365 2.152   5.406   1.00 5.93 ? 1  SER A HB2  6  
ATOM 10912 H HB3  . SER A 1 1  ? -12.619 3.533   4.608   1.00 5.93 ? 1  SER A HB3  6  
ATOM 10913 H HG   . SER A 1 1  ? -11.465 1.517   5.953   1.00 5.93 ? 1  SER A HG   6  
ATOM 10914 N N    . PRO A 1 2  ? -13.138 5.984   5.450   1.00 3.89 ? 2  PRO A N    6  
ATOM 10915 C CA   . PRO A 1 2  ? -13.668 7.198   4.806   1.00 3.89 ? 2  PRO A CA   6  
ATOM 10916 C C    . PRO A 1 2  ? -14.245 6.863   3.426   1.00 3.89 ? 2  PRO A C    6  
ATOM 10917 O O    . PRO A 1 2  ? -14.564 5.727   3.136   1.00 3.89 ? 2  PRO A O    6  
ATOM 10918 C CB   . PRO A 1 2  ? -12.438 8.101   4.679   1.00 3.89 ? 2  PRO A CB   6  
ATOM 10919 C CG   . PRO A 1 2  ? -11.204 7.167   4.724   1.00 3.89 ? 2  PRO A CG   6  
ATOM 10920 C CD   . PRO A 1 2  ? -11.668 5.857   5.390   1.00 3.89 ? 2  PRO A CD   6  
ATOM 10921 H HA   . PRO A 1 2  ? -14.410 7.670   5.428   1.00 3.89 ? 2  PRO A HA   6  
ATOM 10922 H HB2  . PRO A 1 2  ? -12.468 8.637   3.739   1.00 3.89 ? 2  PRO A HB2  6  
ATOM 10923 H HB3  . PRO A 1 2  ? -12.399 8.795   5.502   1.00 3.89 ? 2  PRO A HB3  6  
ATOM 10924 H HG2  . PRO A 1 2  ? -10.853 6.971   3.720   1.00 3.89 ? 2  PRO A HG2  6  
ATOM 10925 H HG3  . PRO A 1 2  ? -10.420 7.617   5.312   1.00 3.89 ? 2  PRO A HG3  6  
ATOM 10926 H HD2  . PRO A 1 2  ? -11.382 5.006   4.787   1.00 3.89 ? 2  PRO A HD2  6  
ATOM 10927 H HD3  . PRO A 1 2  ? -11.260 5.774   6.386   1.00 3.89 ? 2  PRO A HD3  6  
ATOM 10928 N N    . TYR A 1 3  ? -14.381 7.843   2.576   1.00 2.56 ? 3  TYR A N    6  
ATOM 10929 C CA   . TYR A 1 3  ? -14.937 7.581   1.219   1.00 2.56 ? 3  TYR A CA   6  
ATOM 10930 C C    . TYR A 1 3  ? -13.802 7.197   0.268   1.00 2.56 ? 3  TYR A C    6  
ATOM 10931 O O    . TYR A 1 3  ? -13.220 8.036   -0.390  1.00 2.56 ? 3  TYR A O    6  
ATOM 10932 C CB   . TYR A 1 3  ? -15.633 8.840   0.700   1.00 2.56 ? 3  TYR A CB   6  
ATOM 10933 C CG   . TYR A 1 3  ? -16.905 9.070   1.478   1.00 2.56 ? 3  TYR A CG   6  
ATOM 10934 C CD1  . TYR A 1 3  ? -17.799 8.013   1.688   1.00 2.56 ? 3  TYR A CD1  6  
ATOM 10935 C CD2  . TYR A 1 3  ? -17.194 10.341  1.991   1.00 2.56 ? 3  TYR A CD2  6  
ATOM 10936 C CE1  . TYR A 1 3  ? -18.979 8.225   2.410   1.00 2.56 ? 3  TYR A CE1  6  
ATOM 10937 C CE2  . TYR A 1 3  ? -18.374 10.554  2.713   1.00 2.56 ? 3  TYR A CE2  6  
ATOM 10938 C CZ   . TYR A 1 3  ? -19.267 9.496   2.923   1.00 2.56 ? 3  TYR A CZ   6  
ATOM 10939 O OH   . TYR A 1 3  ? -20.430 9.706   3.634   1.00 2.56 ? 3  TYR A OH   6  
ATOM 10940 H H    . TYR A 1 3  ? -14.118 8.752   2.830   1.00 2.56 ? 3  TYR A H    6  
ATOM 10941 H HA   . TYR A 1 3  ? -15.650 6.772   1.273   1.00 2.56 ? 3  TYR A HA   6  
ATOM 10942 H HB2  . TYR A 1 3  ? -14.977 9.690   0.822   1.00 2.56 ? 3  TYR A HB2  6  
ATOM 10943 H HB3  . TYR A 1 3  ? -15.869 8.716   -0.347  1.00 2.56 ? 3  TYR A HB3  6  
ATOM 10944 H HD1  . TYR A 1 3  ? -17.577 7.032   1.293   1.00 2.56 ? 3  TYR A HD1  6  
ATOM 10945 H HD2  . TYR A 1 3  ? -16.505 11.157  1.830   1.00 2.56 ? 3  TYR A HD2  6  
ATOM 10946 H HE1  . TYR A 1 3  ? -19.668 7.409   2.571   1.00 2.56 ? 3  TYR A HE1  6  
ATOM 10947 H HE2  . TYR A 1 3  ? -18.596 11.534  3.108   1.00 2.56 ? 3  TYR A HE2  6  
ATOM 10948 H HH   . TYR A 1 3  ? -20.507 9.009   4.289   1.00 2.56 ? 3  TYR A HH   6  
ATOM 10949 N N    . SER A 1 4  ? -13.481 5.934   0.191   1.00 0.96 ? 4  SER A N    6  
ATOM 10950 C CA   . SER A 1 4  ? -12.383 5.499   -0.718  1.00 0.96 ? 4  SER A CA   6  
ATOM 10951 C C    . SER A 1 4  ? -12.307 3.970   -0.730  1.00 0.96 ? 4  SER A C    6  
ATOM 10952 O O    . SER A 1 4  ? -12.478 3.323   0.284   1.00 0.96 ? 4  SER A O    6  
ATOM 10953 C CB   . SER A 1 4  ? -11.055 6.071   -0.222  1.00 0.96 ? 4  SER A CB   6  
ATOM 10954 O OG   . SER A 1 4  ? -11.255 6.700   1.037   1.00 0.96 ? 4  SER A OG   6  
ATOM 10955 H H    . SER A 1 4  ? -13.963 5.272   0.730   1.00 0.96 ? 4  SER A H    6  
ATOM 10956 H HA   . SER A 1 4  ? -12.579 5.857   -1.717  1.00 0.96 ? 4  SER A HA   6  
ATOM 10957 H HB2  . SER A 1 4  ? -10.337 5.275   -0.110  1.00 0.96 ? 4  SER A HB2  6  
ATOM 10958 H HB3  . SER A 1 4  ? -10.684 6.790   -0.941  1.00 0.96 ? 4  SER A HB3  6  
ATOM 10959 H HG   . SER A 1 4  ? -11.109 7.642   0.924   1.00 0.96 ? 4  SER A HG   6  
ATOM 10960 N N    . SER A 1 5  ? -12.051 3.389   -1.870  1.00 0.48 ? 5  SER A N    6  
ATOM 10961 C CA   . SER A 1 5  ? -11.965 1.903   -1.946  1.00 0.48 ? 5  SER A CA   6  
ATOM 10962 C C    . SER A 1 5  ? -10.807 1.506   -2.864  1.00 0.48 ? 5  SER A C    6  
ATOM 10963 O O    . SER A 1 5  ? -10.963 0.709   -3.768  1.00 0.48 ? 5  SER A O    6  
ATOM 10964 C CB   . SER A 1 5  ? -13.273 1.344   -2.506  1.00 0.48 ? 5  SER A CB   6  
ATOM 10965 O OG   . SER A 1 5  ? -13.513 1.906   -3.791  1.00 0.48 ? 5  SER A OG   6  
ATOM 10966 H H    . SER A 1 5  ? -11.916 3.930   -2.676  1.00 0.48 ? 5  SER A H    6  
ATOM 10967 H HA   . SER A 1 5  ? -11.796 1.502   -0.958  1.00 0.48 ? 5  SER A HA   6  
ATOM 10968 H HB2  . SER A 1 5  ? -13.200 0.274   -2.596  1.00 0.48 ? 5  SER A HB2  6  
ATOM 10969 H HB3  . SER A 1 5  ? -14.085 1.593   -1.836  1.00 0.48 ? 5  SER A HB3  6  
ATOM 10970 H HG   . SER A 1 5  ? -13.688 1.187   -4.401  1.00 0.48 ? 5  SER A HG   6  
ATOM 10971 N N    . ASP A 1 6  ? -9.645  2.057   -2.639  1.00 0.37 ? 6  ASP A N    6  
ATOM 10972 C CA   . ASP A 1 6  ? -8.478  1.710   -3.500  1.00 0.37 ? 6  ASP A CA   6  
ATOM 10973 C C    . ASP A 1 6  ? -7.294  1.310   -2.616  1.00 0.37 ? 6  ASP A C    6  
ATOM 10974 O O    . ASP A 1 6  ? -7.241  1.637   -1.447  1.00 0.37 ? 6  ASP A O    6  
ATOM 10975 C CB   . ASP A 1 6  ? -8.093  2.924   -4.349  1.00 0.37 ? 6  ASP A CB   6  
ATOM 10976 C CG   . ASP A 1 6  ? -9.327  3.438   -5.093  1.00 0.37 ? 6  ASP A CG   6  
ATOM 10977 O OD1  . ASP A 1 6  ? -9.908  2.667   -5.839  1.00 0.37 ? 6  ASP A OD1  6  
ATOM 10978 O OD2  . ASP A 1 6  ? -9.669  4.594   -4.905  1.00 0.37 ? 6  ASP A OD2  6  
ATOM 10979 H H    . ASP A 1 6  ? -9.539  2.697   -1.906  1.00 0.37 ? 6  ASP A H    6  
ATOM 10980 H HA   . ASP A 1 6  ? -8.740  0.887   -4.147  1.00 0.37 ? 6  ASP A HA   6  
ATOM 10981 H HB2  . ASP A 1 6  ? -7.707  3.703   -3.708  1.00 0.37 ? 6  ASP A HB2  6  
ATOM 10982 H HB3  . ASP A 1 6  ? -7.338  2.637   -5.065  1.00 0.37 ? 6  ASP A HB3  6  
ATOM 10983 N N    . THR A 1 7  ? -6.344  0.604   -3.165  1.00 0.35 ? 7  THR A N    6  
ATOM 10984 C CA   . THR A 1 7  ? -5.165  0.184   -2.357  1.00 0.35 ? 7  THR A CA   6  
ATOM 10985 C C    . THR A 1 7  ? -4.254  1.390   -2.118  1.00 0.35 ? 7  THR A C    6  
ATOM 10986 O O    . THR A 1 7  ? -3.966  2.150   -3.020  1.00 0.35 ? 7  THR A O    6  
ATOM 10987 C CB   . THR A 1 7  ? -4.390  -0.899  -3.111  1.00 0.35 ? 7  THR A CB   6  
ATOM 10988 O OG1  . THR A 1 7  ? -3.946  -0.381  -4.357  1.00 0.35 ? 7  THR A OG1  6  
ATOM 10989 C CG2  . THR A 1 7  ? -5.298  -2.106  -3.352  1.00 0.35 ? 7  THR A CG2  6  
ATOM 10990 H H    . THR A 1 7  ? -6.406  0.350   -4.110  1.00 0.35 ? 7  THR A H    6  
ATOM 10991 H HA   . THR A 1 7  ? -5.500  -0.208  -1.408  1.00 0.35 ? 7  THR A HA   6  
ATOM 10992 H HB   . THR A 1 7  ? -3.539  -1.207  -2.524  1.00 0.35 ? 7  THR A HB   6  
ATOM 10993 H HG1  . THR A 1 7  ? -3.396  0.387   -4.180  1.00 0.35 ? 7  THR A HG1  6  
ATOM 10994 H HG21 . THR A 1 7  ? -6.329  -1.783  -3.367  1.00 0.35 ? 7  THR A HG21 6  
ATOM 10995 H HG22 . THR A 1 7  ? -5.050  -2.559  -4.301  1.00 0.35 ? 7  THR A HG22 6  
ATOM 10996 H HG23 . THR A 1 7  ? -5.158  -2.827  -2.561  1.00 0.35 ? 7  THR A HG23 6  
ATOM 10997 N N    . THR A 1 8  ? -3.798  1.570   -0.908  1.00 0.31 ? 8  THR A N    6  
ATOM 10998 C CA   . THR A 1 8  ? -2.906  2.727   -0.614  1.00 0.31 ? 8  THR A CA   6  
ATOM 10999 C C    . THR A 1 8  ? -1.446  2.310   -0.828  1.00 0.31 ? 8  THR A C    6  
ATOM 11000 O O    . THR A 1 8  ? -1.060  1.217   -0.463  1.00 0.31 ? 8  THR A O    6  
ATOM 11001 C CB   . THR A 1 8  ? -3.103  3.164   0.841   1.00 0.31 ? 8  THR A CB   6  
ATOM 11002 O OG1  . THR A 1 8  ? -4.422  3.665   1.008   1.00 0.31 ? 8  THR A OG1  6  
ATOM 11003 C CG2  . THR A 1 8  ? -2.092  4.257   1.193   1.00 0.31 ? 8  THR A CG2  6  
ATOM 11004 H H    . THR A 1 8  ? -4.042  0.945   -0.194  1.00 0.31 ? 8  THR A H    6  
ATOM 11005 H HA   . THR A 1 8  ? -3.153  3.545   -1.272  1.00 0.31 ? 8  THR A HA   6  
ATOM 11006 H HB   . THR A 1 8  ? -2.954  2.319   1.494   1.00 0.31 ? 8  THR A HB   6  
ATOM 11007 H HG1  . THR A 1 8  ? -4.413  4.601   0.797   1.00 0.31 ? 8  THR A HG1  6  
ATOM 11008 H HG21 . THR A 1 8  ? -1.146  4.039   0.720   1.00 0.31 ? 8  THR A HG21 6  
ATOM 11009 H HG22 . THR A 1 8  ? -2.457  5.211   0.845   1.00 0.31 ? 8  THR A HG22 6  
ATOM 11010 H HG23 . THR A 1 8  ? -1.958  4.292   2.264   1.00 0.31 ? 8  THR A HG23 6  
ATOM 11011 N N    . PRO A 1 9  ? -0.675  3.194   -1.411  1.00 0.34 ? 9  PRO A N    6  
ATOM 11012 C CA   . PRO A 1 9  ? 0.751   2.944   -1.683  1.00 0.34 ? 9  PRO A CA   6  
ATOM 11013 C C    . PRO A 1 9  ? 1.570   3.131   -0.404  1.00 0.34 ? 9  PRO A C    6  
ATOM 11014 O O    . PRO A 1 9  ? 2.231   4.133   -0.220  1.00 0.34 ? 9  PRO A O    6  
ATOM 11015 C CB   . PRO A 1 9  ? 1.109   4.010   -2.722  1.00 0.34 ? 9  PRO A CB   6  
ATOM 11016 C CG   . PRO A 1 9  ? 0.065   5.141   -2.566  1.00 0.34 ? 9  PRO A CG   6  
ATOM 11017 C CD   . PRO A 1 9  ? -1.151  4.521   -1.852  1.00 0.34 ? 9  PRO A CD   6  
ATOM 11018 H HA   . PRO A 1 9  ? 0.896   1.960   -2.095  1.00 0.34 ? 9  PRO A HA   6  
ATOM 11019 H HB2  . PRO A 1 9  ? 2.105   4.389   -2.534  1.00 0.34 ? 9  PRO A HB2  6  
ATOM 11020 H HB3  . PRO A 1 9  ? 1.051   3.595   -3.716  1.00 0.34 ? 9  PRO A HB3  6  
ATOM 11021 H HG2  . PRO A 1 9  ? 0.478   5.945   -1.972  1.00 0.34 ? 9  PRO A HG2  6  
ATOM 11022 H HG3  . PRO A 1 9  ? -0.230  5.509   -3.535  1.00 0.34 ? 9  PRO A HG3  6  
ATOM 11023 H HD2  . PRO A 1 9  ? -1.437  5.127   -1.001  1.00 0.34 ? 9  PRO A HD2  6  
ATOM 11024 H HD3  . PRO A 1 9  ? -1.978  4.413   -2.536  1.00 0.34 ? 9  PRO A HD3  6  
ATOM 11025 N N    . CYS A 1 10 ? 1.526   2.176   0.483   1.00 0.35 ? 10 CYS A N    6  
ATOM 11026 C CA   . CYS A 1 10 ? 2.295   2.305   1.752   1.00 0.35 ? 10 CYS A CA   6  
ATOM 11027 C C    . CYS A 1 10 ? 3.657   1.627   1.602   1.00 0.35 ? 10 CYS A C    6  
ATOM 11028 O O    . CYS A 1 10 ? 3.749   0.462   1.268   1.00 0.35 ? 10 CYS A O    6  
ATOM 11029 C CB   . CYS A 1 10 ? 1.515   1.640   2.887   1.00 0.35 ? 10 CYS A CB   6  
ATOM 11030 S SG   . CYS A 1 10 ? 0.013   2.593   3.221   1.00 0.35 ? 10 CYS A SG   6  
ATOM 11031 H H    . CYS A 1 10 ? 0.982   1.378   0.320   1.00 0.35 ? 10 CYS A H    6  
ATOM 11032 H HA   . CYS A 1 10 ? 2.438   3.352   1.980   1.00 0.35 ? 10 CYS A HA   6  
ATOM 11033 H HB2  . CYS A 1 10 ? 1.248   0.634   2.598   1.00 0.35 ? 10 CYS A HB2  6  
ATOM 11034 H HB3  . CYS A 1 10 ? 2.128   1.609   3.775   1.00 0.35 ? 10 CYS A HB3  6  
ATOM 11035 N N    . CYS A 1 11 ? 4.717   2.346   1.850   1.00 0.32 ? 11 CYS A N    6  
ATOM 11036 C CA   . CYS A 1 11 ? 6.073   1.742   1.727   1.00 0.32 ? 11 CYS A CA   6  
ATOM 11037 C C    . CYS A 1 11 ? 6.678   1.572   3.122   1.00 0.32 ? 11 CYS A C    6  
ATOM 11038 O O    . CYS A 1 11 ? 6.177   2.100   4.095   1.00 0.32 ? 11 CYS A O    6  
ATOM 11039 C CB   . CYS A 1 11 ? 6.968   2.659   0.892   1.00 0.32 ? 11 CYS A CB   6  
ATOM 11040 S SG   . CYS A 1 11 ? 6.801   2.234   -0.859  1.00 0.32 ? 11 CYS A SG   6  
ATOM 11041 H H    . CYS A 1 11 ? 4.620   3.283   2.121   1.00 0.32 ? 11 CYS A H    6  
ATOM 11042 H HA   . CYS A 1 11 ? 5.996   0.778   1.247   1.00 0.32 ? 11 CYS A HA   6  
ATOM 11043 H HB2  . CYS A 1 11 ? 6.672   3.686   1.043   1.00 0.32 ? 11 CYS A HB2  6  
ATOM 11044 H HB3  . CYS A 1 11 ? 7.996   2.533   1.196   1.00 0.32 ? 11 CYS A HB3  6  
ATOM 11045 N N    . PHE A 1 12 ? 7.750   0.838   3.228   1.00 0.28 ? 12 PHE A N    6  
ATOM 11046 C CA   . PHE A 1 12 ? 8.384   0.635   4.560   1.00 0.28 ? 12 PHE A CA   6  
ATOM 11047 C C    . PHE A 1 12 ? 9.890   0.433   4.383   1.00 0.28 ? 12 PHE A C    6  
ATOM 11048 O O    . PHE A 1 12 ? 10.686  0.909   5.168   1.00 0.28 ? 12 PHE A O    6  
ATOM 11049 C CB   . PHE A 1 12 ? 7.774   -0.600  5.227   1.00 0.28 ? 12 PHE A CB   6  
ATOM 11050 C CG   . PHE A 1 12 ? 6.298   -0.659  4.914   1.00 0.28 ? 12 PHE A CG   6  
ATOM 11051 C CD1  . PHE A 1 12 ? 5.387   0.055   5.703   1.00 0.28 ? 12 PHE A CD1  6  
ATOM 11052 C CD2  . PHE A 1 12 ? 5.840   -1.426  3.837   1.00 0.28 ? 12 PHE A CD2  6  
ATOM 11053 C CE1  . PHE A 1 12 ? 4.018   0.003   5.411   1.00 0.28 ? 12 PHE A CE1  6  
ATOM 11054 C CE2  . PHE A 1 12 ? 4.472   -1.478  3.545   1.00 0.28 ? 12 PHE A CE2  6  
ATOM 11055 C CZ   . PHE A 1 12 ? 3.561   -0.764  4.332   1.00 0.28 ? 12 PHE A CZ   6  
ATOM 11056 H H    . PHE A 1 12 ? 8.138   0.420   2.430   1.00 0.28 ? 12 PHE A H    6  
ATOM 11057 H HA   . PHE A 1 12 ? 8.207   1.501   5.179   1.00 0.28 ? 12 PHE A HA   6  
ATOM 11058 H HB2  . PHE A 1 12 ? 8.258   -1.490  4.851   1.00 0.28 ? 12 PHE A HB2  6  
ATOM 11059 H HB3  . PHE A 1 12 ? 7.913   -0.539  6.295   1.00 0.28 ? 12 PHE A HB3  6  
ATOM 11060 H HD1  . PHE A 1 12 ? 5.739   0.647   6.535   1.00 0.28 ? 12 PHE A HD1  6  
ATOM 11061 H HD2  . PHE A 1 12 ? 6.543   -1.977  3.230   1.00 0.28 ? 12 PHE A HD2  6  
ATOM 11062 H HE1  . PHE A 1 12 ? 3.315   0.554   6.018   1.00 0.28 ? 12 PHE A HE1  6  
ATOM 11063 H HE2  . PHE A 1 12 ? 4.119   -2.070  2.713   1.00 0.28 ? 12 PHE A HE2  6  
ATOM 11064 H HZ   . PHE A 1 12 ? 2.505   -0.805  4.107   1.00 0.28 ? 12 PHE A HZ   6  
ATOM 11065 N N    . ALA A 1 13 ? 10.289  -0.269  3.358   1.00 0.31 ? 13 ALA A N    6  
ATOM 11066 C CA   . ALA A 1 13 ? 11.744  -0.498  3.132   1.00 0.31 ? 13 ALA A CA   6  
ATOM 11067 C C    . ALA A 1 13 ? 12.305  0.626   2.257   1.00 0.31 ? 13 ALA A C    6  
ATOM 11068 O O    . ALA A 1 13 ? 11.584  1.491   1.804   1.00 0.31 ? 13 ALA A O    6  
ATOM 11069 C CB   . ALA A 1 13 ? 11.946  -1.841  2.427   1.00 0.31 ? 13 ALA A CB   6  
ATOM 11070 H H    . ALA A 1 13 ? 9.632   -0.644  2.735   1.00 0.31 ? 13 ALA A H    6  
ATOM 11071 H HA   . ALA A 1 13 ? 12.258  -0.507  4.081   1.00 0.31 ? 13 ALA A HA   6  
ATOM 11072 H HB1  . ALA A 1 13 ? 10.985  -2.269  2.186   1.00 0.31 ? 13 ALA A HB1  6  
ATOM 11073 H HB2  . ALA A 1 13 ? 12.511  -1.690  1.520   1.00 0.31 ? 13 ALA A HB2  6  
ATOM 11074 H HB3  . ALA A 1 13 ? 12.486  -2.512  3.080   1.00 0.31 ? 13 ALA A HB3  6  
ATOM 11075 N N    . TYR A 1 14 ? 13.588  0.620   2.017   1.00 0.29 ? 14 TYR A N    6  
ATOM 11076 C CA   . TYR A 1 14 ? 14.192  1.688   1.173   1.00 0.29 ? 14 TYR A CA   6  
ATOM 11077 C C    . TYR A 1 14 ? 15.275  1.081   0.279   1.00 0.29 ? 14 TYR A C    6  
ATOM 11078 O O    . TYR A 1 14 ? 16.218  0.478   0.753   1.00 0.29 ? 14 TYR A O    6  
ATOM 11079 C CB   . TYR A 1 14 ? 14.812  2.760   2.070   1.00 0.29 ? 14 TYR A CB   6  
ATOM 11080 C CG   . TYR A 1 14 ? 13.737  3.387   2.925   1.00 0.29 ? 14 TYR A CG   6  
ATOM 11081 C CD1  . TYR A 1 14 ? 12.542  3.820   2.338   1.00 0.29 ? 14 TYR A CD1  6  
ATOM 11082 C CD2  . TYR A 1 14 ? 13.935  3.536   4.302   1.00 0.29 ? 14 TYR A CD2  6  
ATOM 11083 C CE1  . TYR A 1 14 ? 11.544  4.402   3.130   1.00 0.29 ? 14 TYR A CE1  6  
ATOM 11084 C CE2  . TYR A 1 14 ? 12.939  4.119   5.093   1.00 0.29 ? 14 TYR A CE2  6  
ATOM 11085 C CZ   . TYR A 1 14 ? 11.742  4.551   4.507   1.00 0.29 ? 14 TYR A CZ   6  
ATOM 11086 O OH   . TYR A 1 14 ? 10.760  5.125   5.288   1.00 0.29 ? 14 TYR A OH   6  
ATOM 11087 H H    . TYR A 1 14 ? 14.153  -0.088  2.392   1.00 0.29 ? 14 TYR A H    6  
ATOM 11088 H HA   . TYR A 1 14 ? 13.426  2.135   0.555   1.00 0.29 ? 14 TYR A HA   6  
ATOM 11089 H HB2  . TYR A 1 14 ? 15.560  2.307   2.707   1.00 0.29 ? 14 TYR A HB2  6  
ATOM 11090 H HB3  . TYR A 1 14 ? 15.274  3.520   1.458   1.00 0.29 ? 14 TYR A HB3  6  
ATOM 11091 H HD1  . TYR A 1 14 ? 12.389  3.705   1.275   1.00 0.29 ? 14 TYR A HD1  6  
ATOM 11092 H HD2  . TYR A 1 14 ? 14.858  3.203   4.755   1.00 0.29 ? 14 TYR A HD2  6  
ATOM 11093 H HE1  . TYR A 1 14 ? 10.623  4.735   2.677   1.00 0.29 ? 14 TYR A HE1  6  
ATOM 11094 H HE2  . TYR A 1 14 ? 13.091  4.234   6.157   1.00 0.29 ? 14 TYR A HE2  6  
ATOM 11095 H HH   . TYR A 1 14 ? 10.412  5.885   4.816   1.00 0.29 ? 14 TYR A HH   6  
ATOM 11096 N N    . ILE A 1 15 ? 15.150  1.235   -1.010  1.00 0.32 ? 15 ILE A N    6  
ATOM 11097 C CA   . ILE A 1 15 ? 16.174  0.666   -1.931  1.00 0.32 ? 15 ILE A CA   6  
ATOM 11098 C C    . ILE A 1 15 ? 17.511  1.376   -1.706  1.00 0.32 ? 15 ILE A C    6  
ATOM 11099 O O    . ILE A 1 15 ? 17.569  2.583   -1.575  1.00 0.32 ? 15 ILE A O    6  
ATOM 11100 C CB   . ILE A 1 15 ? 15.727  0.868   -3.380  1.00 0.32 ? 15 ILE A CB   6  
ATOM 11101 C CG1  . ILE A 1 15 ? 16.619  0.041   -4.307  1.00 0.32 ? 15 ILE A CG1  6  
ATOM 11102 C CG2  . ILE A 1 15 ? 15.841  2.347   -3.749  1.00 0.32 ? 15 ILE A CG2  6  
ATOM 11103 C CD1  . ILE A 1 15 ? 15.793  -1.073  -4.953  1.00 0.32 ? 15 ILE A CD1  6  
ATOM 11104 H H    . ILE A 1 15 ? 14.383  1.725   -1.373  1.00 0.32 ? 15 ILE A H    6  
ATOM 11105 H HA   . ILE A 1 15 ? 16.290  -0.389  -1.733  1.00 0.32 ? 15 ILE A HA   6  
ATOM 11106 H HB   . ILE A 1 15 ? 14.699  0.548   -3.486  1.00 0.32 ? 15 ILE A HB   6  
ATOM 11107 H HG12 . ILE A 1 15 ? 17.027  0.680   -5.077  1.00 0.32 ? 15 ILE A HG12 6  
ATOM 11108 H HG13 . ILE A 1 15 ? 17.425  -0.396  -3.737  1.00 0.32 ? 15 ILE A HG13 6  
ATOM 11109 H HG21 . ILE A 1 15 ? 15.524  2.953   -2.913  1.00 0.32 ? 15 ILE A HG21 6  
ATOM 11110 H HG22 . ILE A 1 15 ? 16.867  2.579   -3.993  1.00 0.32 ? 15 ILE A HG22 6  
ATOM 11111 H HG23 . ILE A 1 15 ? 15.213  2.554   -4.603  1.00 0.32 ? 15 ILE A HG23 6  
ATOM 11112 H HD11 . ILE A 1 15 ? 14.948  -0.642  -5.468  1.00 0.32 ? 15 ILE A HD11 6  
ATOM 11113 H HD12 . ILE A 1 15 ? 16.407  -1.614  -5.657  1.00 0.32 ? 15 ILE A HD12 6  
ATOM 11114 H HD13 . ILE A 1 15 ? 15.441  -1.750  -4.188  1.00 0.32 ? 15 ILE A HD13 6  
ATOM 11115 N N    . ALA A 1 16 ? 18.585  0.637   -1.660  1.00 0.38 ? 16 ALA A N    6  
ATOM 11116 C CA   . ALA A 1 16 ? 19.916  1.271   -1.444  1.00 0.38 ? 16 ALA A CA   6  
ATOM 11117 C C    . ALA A 1 16 ? 20.455  1.792   -2.777  1.00 0.38 ? 16 ALA A C    6  
ATOM 11118 O O    . ALA A 1 16 ? 21.015  2.867   -2.852  1.00 0.38 ? 16 ALA A O    6  
ATOM 11119 C CB   . ALA A 1 16 ? 20.887  0.235   -0.872  1.00 0.38 ? 16 ALA A CB   6  
ATOM 11120 H H    . ALA A 1 16 ? 18.516  -0.335  -1.768  1.00 0.38 ? 16 ALA A H    6  
ATOM 11121 H HA   . ALA A 1 16 ? 19.816  2.091   -0.750  1.00 0.38 ? 16 ALA A HA   6  
ATOM 11122 H HB1  . ALA A 1 16 ? 20.343  -0.465  -0.255  1.00 0.38 ? 16 ALA A HB1  6  
ATOM 11123 H HB2  . ALA A 1 16 ? 21.367  -0.294  -1.682  1.00 0.38 ? 16 ALA A HB2  6  
ATOM 11124 H HB3  . ALA A 1 16 ? 21.635  0.735   -0.275  1.00 0.38 ? 16 ALA A HB3  6  
ATOM 11125 N N    . ARG A 1 17 ? 20.291  1.039   -3.830  1.00 0.42 ? 17 ARG A N    6  
ATOM 11126 C CA   . ARG A 1 17 ? 20.795  1.494   -5.156  1.00 0.42 ? 17 ARG A CA   6  
ATOM 11127 C C    . ARG A 1 17 ? 19.800  2.489   -5.763  1.00 0.42 ? 17 ARG A C    6  
ATOM 11128 O O    . ARG A 1 17 ? 18.608  2.363   -5.572  1.00 0.42 ? 17 ARG A O    6  
ATOM 11129 C CB   . ARG A 1 17 ? 20.944  0.289   -6.087  1.00 0.42 ? 17 ARG A CB   6  
ATOM 11130 C CG   . ARG A 1 17 ? 22.163  -0.534  -5.667  1.00 0.42 ? 17 ARG A CG   6  
ATOM 11131 C CD   . ARG A 1 17 ? 23.034  -0.820  -6.892  1.00 0.42 ? 17 ARG A CD   6  
ATOM 11132 N NE   . ARG A 1 17 ? 24.412  -1.173  -6.451  1.00 0.42 ? 17 ARG A NE   6  
ATOM 11133 C CZ   . ARG A 1 17 ? 25.436  -0.865  -7.200  1.00 0.42 ? 17 ARG A CZ   6  
ATOM 11134 N NH1  . ARG A 1 17 ? 25.279  -0.706  -8.486  1.00 0.42 ? 17 ARG A NH1  6  
ATOM 11135 N NH2  . ARG A 1 17 ? 26.615  -0.716  -6.663  1.00 0.42 ? 17 ARG A NH2  6  
ATOM 11136 H H    . ARG A 1 17 ? 19.836  0.175   -3.748  1.00 0.42 ? 17 ARG A H    6  
ATOM 11137 H HA   . ARG A 1 17 ? 21.754  1.973   -5.030  1.00 0.42 ? 17 ARG A HA   6  
ATOM 11138 H HB2  . ARG A 1 17 ? 20.056  -0.325  -6.026  1.00 0.42 ? 17 ARG A HB2  6  
ATOM 11139 H HB3  . ARG A 1 17 ? 21.076  0.633   -7.102  1.00 0.42 ? 17 ARG A HB3  6  
ATOM 11140 H HG2  . ARG A 1 17 ? 22.737  0.020   -4.938  1.00 0.42 ? 17 ARG A HG2  6  
ATOM 11141 H HG3  . ARG A 1 17 ? 21.837  -1.467  -5.234  1.00 0.42 ? 17 ARG A HG3  6  
ATOM 11142 H HD2  . ARG A 1 17 ? 22.611  -1.644  -7.449  1.00 0.42 ? 17 ARG A HD2  6  
ATOM 11143 H HD3  . ARG A 1 17 ? 23.070  0.057   -7.521  1.00 0.42 ? 17 ARG A HD3  6  
ATOM 11144 H HE   . ARG A 1 17 ? 24.550  -1.637  -5.599  1.00 0.42 ? 17 ARG A HE   6  
ATOM 11145 H HH11 . ARG A 1 17 ? 24.375  -0.820  -8.898  1.00 0.42 ? 17 ARG A HH11 6  
ATOM 11146 H HH12 . ARG A 1 17 ? 26.063  -0.469  -9.060  1.00 0.42 ? 17 ARG A HH12 6  
ATOM 11147 H HH21 . ARG A 1 17 ? 26.735  -0.838  -5.678  1.00 0.42 ? 17 ARG A HH21 6  
ATOM 11148 H HH22 . ARG A 1 17 ? 27.399  -0.480  -7.236  1.00 0.42 ? 17 ARG A HH22 6  
ATOM 11149 N N    . PRO A 1 18 ? 20.326  3.452   -6.479  1.00 0.41 ? 18 PRO A N    6  
ATOM 11150 C CA   . PRO A 1 18 ? 19.510  4.490   -7.131  1.00 0.41 ? 18 PRO A CA   6  
ATOM 11151 C C    . PRO A 1 18 ? 18.871  3.944   -8.412  1.00 0.41 ? 18 PRO A C    6  
ATOM 11152 O O    . PRO A 1 18 ? 19.151  2.841   -8.835  1.00 0.41 ? 18 PRO A O    6  
ATOM 11153 C CB   . PRO A 1 18 ? 20.524  5.592   -7.453  1.00 0.41 ? 18 PRO A CB   6  
ATOM 11154 C CG   . PRO A 1 18 ? 21.912  4.909   -7.494  1.00 0.41 ? 18 PRO A CG   6  
ATOM 11155 C CD   . PRO A 1 18 ? 21.779  3.593   -6.704  1.00 0.41 ? 18 PRO A CD   6  
ATOM 11156 H HA   . PRO A 1 18 ? 18.757  4.866   -6.458  1.00 0.41 ? 18 PRO A HA   6  
ATOM 11157 H HB2  . PRO A 1 18 ? 20.295  6.035   -8.414  1.00 0.41 ? 18 PRO A HB2  6  
ATOM 11158 H HB3  . PRO A 1 18 ? 20.511  6.346   -6.683  1.00 0.41 ? 18 PRO A HB3  6  
ATOM 11159 H HG2  . PRO A 1 18 ? 22.192  4.703   -8.518  1.00 0.41 ? 18 PRO A HG2  6  
ATOM 11160 H HG3  . PRO A 1 18 ? 22.650  5.542   -7.027  1.00 0.41 ? 18 PRO A HG3  6  
ATOM 11161 H HD2  . PRO A 1 18 ? 22.158  2.764   -7.286  1.00 0.41 ? 18 PRO A HD2  6  
ATOM 11162 H HD3  . PRO A 1 18 ? 22.296  3.664   -5.760  1.00 0.41 ? 18 PRO A HD3  6  
ATOM 11163 N N    . LEU A 1 19 ? 18.015  4.710   -9.030  1.00 0.45 ? 19 LEU A N    6  
ATOM 11164 C CA   . LEU A 1 19 ? 17.358  4.237   -10.281 1.00 0.45 ? 19 LEU A CA   6  
ATOM 11165 C C    . LEU A 1 19 ? 17.735  5.167   -11.438 1.00 0.45 ? 19 LEU A C    6  
ATOM 11166 O O    . LEU A 1 19 ? 18.200  6.268   -11.218 1.00 0.45 ? 19 LEU A O    6  
ATOM 11167 C CB   . LEU A 1 19 ? 15.839  4.246   -10.096 1.00 0.45 ? 19 LEU A CB   6  
ATOM 11168 C CG   . LEU A 1 19 ? 15.495  3.884   -8.651  1.00 0.45 ? 19 LEU A CG   6  
ATOM 11169 C CD1  . LEU A 1 19 ? 15.708  5.103   -7.752  1.00 0.45 ? 19 LEU A CD1  6  
ATOM 11170 C CD2  . LEU A 1 19 ? 14.031  3.446   -8.572  1.00 0.45 ? 19 LEU A CD2  6  
ATOM 11171 H H    . LEU A 1 19 ? 17.803  5.598   -8.672  1.00 0.45 ? 19 LEU A H    6  
ATOM 11172 H HA   . LEU A 1 19 ? 17.688  3.233   -10.504 1.00 0.45 ? 19 LEU A HA   6  
ATOM 11173 H HB2  . LEU A 1 19 ? 15.455  5.230   -10.322 1.00 0.45 ? 19 LEU A HB2  6  
ATOM 11174 H HB3  . LEU A 1 19 ? 15.391  3.524   -10.762 1.00 0.45 ? 19 LEU A HB3  6  
ATOM 11175 H HG   . LEU A 1 19 ? 16.132  3.077   -8.320  1.00 0.45 ? 19 LEU A HG   6  
ATOM 11176 H HD11 . LEU A 1 19 ? 15.656  6.003   -8.347  1.00 0.45 ? 19 LEU A HD11 6  
ATOM 11177 H HD12 . LEU A 1 19 ? 14.941  5.129   -6.992  1.00 0.45 ? 19 LEU A HD12 6  
ATOM 11178 H HD13 . LEU A 1 19 ? 16.678  5.038   -7.282  1.00 0.45 ? 19 LEU A HD13 6  
ATOM 11179 H HD21 . LEU A 1 19 ? 13.818  2.755   -9.373  1.00 0.45 ? 19 LEU A HD21 6  
ATOM 11180 H HD22 . LEU A 1 19 ? 13.850  2.966   -7.622  1.00 0.45 ? 19 LEU A HD22 6  
ATOM 11181 H HD23 . LEU A 1 19 ? 13.392  4.313   -8.664  1.00 0.45 ? 19 LEU A HD23 6  
ATOM 11182 N N    . PRO A 1 20 ? 17.520  4.695   -12.638 1.00 0.58 ? 20 PRO A N    6  
ATOM 11183 C CA   . PRO A 1 20 ? 17.825  5.461   -13.860 1.00 0.58 ? 20 PRO A CA   6  
ATOM 11184 C C    . PRO A 1 20 ? 16.733  6.503   -14.119 1.00 0.58 ? 20 PRO A C    6  
ATOM 11185 O O    . PRO A 1 20 ? 15.557  6.201   -14.099 1.00 0.58 ? 20 PRO A O    6  
ATOM 11186 C CB   . PRO A 1 20 ? 17.835  4.394   -14.958 1.00 0.58 ? 20 PRO A CB   6  
ATOM 11187 C CG   . PRO A 1 20 ? 16.995  3.209   -14.425 1.00 0.58 ? 20 PRO A CG   6  
ATOM 11188 C CD   . PRO A 1 20 ? 16.955  3.353   -12.891 1.00 0.58 ? 20 PRO A CD   6  
ATOM 11189 H HA   . PRO A 1 20 ? 18.793  5.928   -13.788 1.00 0.58 ? 20 PRO A HA   6  
ATOM 11190 H HB2  . PRO A 1 20 ? 17.392  4.790   -15.862 1.00 0.58 ? 20 PRO A HB2  6  
ATOM 11191 H HB3  . PRO A 1 20 ? 18.844  4.067   -15.150 1.00 0.58 ? 20 PRO A HB3  6  
ATOM 11192 H HG2  . PRO A 1 20 ? 15.994  3.254   -14.830 1.00 0.58 ? 20 PRO A HG2  6  
ATOM 11193 H HG3  . PRO A 1 20 ? 17.463  2.274   -14.690 1.00 0.58 ? 20 PRO A HG3  6  
ATOM 11194 H HD2  . PRO A 1 20 ? 15.936  3.295   -12.534 1.00 0.58 ? 20 PRO A HD2  6  
ATOM 11195 H HD3  . PRO A 1 20 ? 17.566  2.598   -12.423 1.00 0.58 ? 20 PRO A HD3  6  
ATOM 11196 N N    . ARG A 1 21 ? 17.114  7.728   -14.362 1.00 0.75 ? 21 ARG A N    6  
ATOM 11197 C CA   . ARG A 1 21 ? 16.097  8.787   -14.621 1.00 0.75 ? 21 ARG A CA   6  
ATOM 11198 C C    . ARG A 1 21 ? 15.362  8.483   -15.928 1.00 0.75 ? 21 ARG A C    6  
ATOM 11199 O O    . ARG A 1 21 ? 14.201  8.803   -16.087 1.00 0.75 ? 21 ARG A O    6  
ATOM 11200 C CB   . ARG A 1 21 ? 16.794  10.145  -14.731 1.00 0.75 ? 21 ARG A CB   6  
ATOM 11201 C CG   . ARG A 1 21 ? 15.743  11.251  -14.845 1.00 0.75 ? 21 ARG A CG   6  
ATOM 11202 C CD   . ARG A 1 21 ? 16.437  12.612  -14.888 1.00 0.75 ? 21 ARG A CD   6  
ATOM 11203 N NE   . ARG A 1 21 ? 15.544  13.646  -14.294 1.00 0.75 ? 21 ARG A NE   6  
ATOM 11204 C CZ   . ARG A 1 21 ? 15.333  14.767  -14.927 1.00 0.75 ? 21 ARG A CZ   6  
ATOM 11205 N NH1  . ARG A 1 21 ? 16.273  15.670  -14.984 1.00 0.75 ? 21 ARG A NH1  6  
ATOM 11206 N NH2  . ARG A 1 21 ? 14.182  14.986  -15.501 1.00 0.75 ? 21 ARG A NH2  6  
ATOM 11207 H H    . ARG A 1 21 ? 18.068  7.951   -14.374 1.00 0.75 ? 21 ARG A H    6  
ATOM 11208 H HA   . ARG A 1 21 ? 15.388  8.812   -13.807 1.00 0.75 ? 21 ARG A HA   6  
ATOM 11209 H HB2  . ARG A 1 21 ? 17.399  10.311  -13.852 1.00 0.75 ? 21 ARG A HB2  6  
ATOM 11210 H HB3  . ARG A 1 21 ? 17.422  10.157  -15.609 1.00 0.75 ? 21 ARG A HB3  6  
ATOM 11211 H HG2  . ARG A 1 21 ? 15.169  11.109  -15.750 1.00 0.75 ? 21 ARG A HG2  6  
ATOM 11212 H HG3  . ARG A 1 21 ? 15.084  11.212  -13.990 1.00 0.75 ? 21 ARG A HG3  6  
ATOM 11213 H HD2  . ARG A 1 21 ? 17.358  12.564  -14.324 1.00 0.75 ? 21 ARG A HD2  6  
ATOM 11214 H HD3  . ARG A 1 21 ? 16.657  12.872  -15.913 1.00 0.75 ? 21 ARG A HD3  6  
ATOM 11215 H HE   . ARG A 1 21 ? 15.114  13.483  -13.428 1.00 0.75 ? 21 ARG A HE   6  
ATOM 11216 H HH11 . ARG A 1 21 ? 17.155  15.503  -14.544 1.00 0.75 ? 21 ARG A HH11 6  
ATOM 11217 H HH12 . ARG A 1 21 ? 16.111  16.531  -15.469 1.00 0.75 ? 21 ARG A HH12 6  
ATOM 11218 H HH21 . ARG A 1 21 ? 13.462  14.294  -15.457 1.00 0.75 ? 21 ARG A HH21 6  
ATOM 11219 H HH22 . ARG A 1 21 ? 14.021  15.846  -15.986 1.00 0.75 ? 21 ARG A HH22 6  
ATOM 11220 N N    . ALA A 1 22 ? 16.030  7.870   -16.866 1.00 0.89 ? 22 ALA A N    6  
ATOM 11221 C CA   . ALA A 1 22 ? 15.370  7.549   -18.163 1.00 0.89 ? 22 ALA A CA   6  
ATOM 11222 C C    . ALA A 1 22 ? 14.216  6.573   -17.921 1.00 0.89 ? 22 ALA A C    6  
ATOM 11223 O O    . ALA A 1 22 ? 13.403  6.332   -18.793 1.00 0.89 ? 22 ALA A O    6  
ATOM 11224 C CB   . ALA A 1 22 ? 16.388  6.909   -19.108 1.00 0.89 ? 22 ALA A CB   6  
ATOM 11225 H H    . ALA A 1 22 ? 16.966  7.622   -16.718 1.00 0.89 ? 22 ALA A H    6  
ATOM 11226 H HA   . ALA A 1 22 ? 14.987  8.456   -18.606 1.00 0.89 ? 22 ALA A HA   6  
ATOM 11227 H HB1  . ALA A 1 22 ? 17.387  7.142   -18.771 1.00 0.89 ? 22 ALA A HB1  6  
ATOM 11228 H HB2  . ALA A 1 22 ? 16.251  5.838   -19.114 1.00 0.89 ? 22 ALA A HB2  6  
ATOM 11229 H HB3  . ALA A 1 22 ? 16.245  7.297   -20.106 1.00 0.89 ? 22 ALA A HB3  6  
ATOM 11230 N N    . HIS A 1 23 ? 14.136  6.008   -16.748 1.00 0.71 ? 23 HIS A N    6  
ATOM 11231 C CA   . HIS A 1 23 ? 13.034  5.048   -16.456 1.00 0.71 ? 23 HIS A CA   6  
ATOM 11232 C C    . HIS A 1 23 ? 12.075  5.664   -15.435 1.00 0.71 ? 23 HIS A C    6  
ATOM 11233 O O    . HIS A 1 23 ? 10.992  5.163   -15.206 1.00 0.71 ? 23 HIS A O    6  
ATOM 11234 C CB   . HIS A 1 23 ? 13.622  3.755   -15.888 1.00 0.71 ? 23 HIS A CB   6  
ATOM 11235 C CG   . HIS A 1 23 ? 14.388  3.037   -16.965 1.00 0.71 ? 23 HIS A CG   6  
ATOM 11236 N ND1  . HIS A 1 23 ? 14.207  1.689   -17.228 1.00 0.71 ? 23 HIS A ND1  6  
ATOM 11237 C CD2  . HIS A 1 23 ? 15.341  3.468   -17.855 1.00 0.71 ? 23 HIS A CD2  6  
ATOM 11238 C CE1  . HIS A 1 23 ? 15.033  1.357   -18.237 1.00 0.71 ? 23 HIS A CE1  6  
ATOM 11239 N NE2  . HIS A 1 23 ? 15.748  2.405   -18.657 1.00 0.71 ? 23 HIS A NE2  6  
ATOM 11240 H H    . HIS A 1 23 ? 14.801  6.215   -16.059 1.00 0.71 ? 23 HIS A H    6  
ATOM 11241 H HA   . HIS A 1 23 ? 12.496  4.830   -17.367 1.00 0.71 ? 23 HIS A HA   6  
ATOM 11242 H HB2  . HIS A 1 23 ? 14.286  3.990   -15.070 1.00 0.71 ? 23 HIS A HB2  6  
ATOM 11243 H HB3  . HIS A 1 23 ? 12.822  3.122   -15.534 1.00 0.71 ? 23 HIS A HB3  6  
ATOM 11244 H HD1  . HIS A 1 23 ? 13.590  1.086   -16.763 1.00 0.71 ? 23 HIS A HD1  6  
ATOM 11245 H HD2  . HIS A 1 23 ? 15.719  4.477   -17.921 1.00 0.71 ? 23 HIS A HD2  6  
ATOM 11246 H HE1  . HIS A 1 23 ? 15.109  0.365   -18.657 1.00 0.71 ? 23 HIS A HE1  6  
ATOM 11247 N N    . ILE A 1 24 ? 12.462  6.747   -14.818 1.00 0.56 ? 24 ILE A N    6  
ATOM 11248 C CA   . ILE A 1 24 ? 11.569  7.390   -13.812 1.00 0.56 ? 24 ILE A CA   6  
ATOM 11249 C C    . ILE A 1 24 ? 10.670  8.413   -14.510 1.00 0.56 ? 24 ILE A C    6  
ATOM 11250 O O    . ILE A 1 24 ? 11.128  9.232   -15.282 1.00 0.56 ? 24 ILE A O    6  
ATOM 11251 C CB   . ILE A 1 24 ? 12.417  8.096   -12.753 1.00 0.56 ? 24 ILE A CB   6  
ATOM 11252 C CG1  . ILE A 1 24 ? 13.301  7.069   -12.041 1.00 0.56 ? 24 ILE A CG1  6  
ATOM 11253 C CG2  . ILE A 1 24 ? 11.499  8.771   -11.731 1.00 0.56 ? 24 ILE A CG2  6  
ATOM 11254 C CD1  . ILE A 1 24 ? 14.017  7.738   -10.867 1.00 0.56 ? 24 ILE A CD1  6  
ATOM 11255 H H    . ILE A 1 24 ? 13.339  7.138   -15.015 1.00 0.56 ? 24 ILE A H    6  
ATOM 11256 H HA   . ILE A 1 24 ? 10.958  6.635   -13.340 1.00 0.56 ? 24 ILE A HA   6  
ATOM 11257 H HB   . ILE A 1 24 ? 13.038  8.841   -13.227 1.00 0.56 ? 24 ILE A HB   6  
ATOM 11258 H HG12 . ILE A 1 24 ? 12.687  6.259   -11.674 1.00 0.56 ? 24 ILE A HG12 6  
ATOM 11259 H HG13 . ILE A 1 24 ? 14.032  6.682   -12.733 1.00 0.56 ? 24 ILE A HG13 6  
ATOM 11260 H HG21 . ILE A 1 24 ? 10.479  8.466   -11.908 1.00 0.56 ? 24 ILE A HG21 6  
ATOM 11261 H HG22 . ILE A 1 24 ? 11.796  8.481   -10.734 1.00 0.56 ? 24 ILE A HG22 6  
ATOM 11262 H HG23 . ILE A 1 24 ? 11.578  9.844   -11.832 1.00 0.56 ? 24 ILE A HG23 6  
ATOM 11263 H HD11 . ILE A 1 24 ? 14.130  8.793   -11.068 1.00 0.56 ? 24 ILE A HD11 6  
ATOM 11264 H HD12 . ILE A 1 24 ? 13.437  7.603   -9.966  1.00 0.56 ? 24 ILE A HD12 6  
ATOM 11265 H HD13 . ILE A 1 24 ? 14.992  7.291   -10.738 1.00 0.56 ? 24 ILE A HD13 6  
ATOM 11266 N N    . LYS A 1 25 ? 9.392   8.370   -14.246 1.00 0.59 ? 25 LYS A N    6  
ATOM 11267 C CA   . LYS A 1 25 ? 8.465   9.340   -14.896 1.00 0.59 ? 25 LYS A CA   6  
ATOM 11268 C C    . LYS A 1 25 ? 7.847   10.249  -13.832 1.00 0.59 ? 25 LYS A C    6  
ATOM 11269 O O    . LYS A 1 25 ? 7.698   11.439  -14.030 1.00 0.59 ? 25 LYS A O    6  
ATOM 11270 C CB   . LYS A 1 25 ? 7.356   8.577   -15.623 1.00 0.59 ? 25 LYS A CB   6  
ATOM 11271 C CG   . LYS A 1 25 ? 6.661   7.630   -14.643 1.00 0.59 ? 25 LYS A CG   6  
ATOM 11272 C CD   . LYS A 1 25 ? 5.473   6.960   -15.337 1.00 0.59 ? 25 LYS A CD   6  
ATOM 11273 C CE   . LYS A 1 25 ? 4.366   7.991   -15.565 1.00 0.59 ? 25 LYS A CE   6  
ATOM 11274 N NZ   . LYS A 1 25 ? 3.399   7.467   -16.570 1.00 0.59 ? 25 LYS A NZ   6  
ATOM 11275 H H    . LYS A 1 25 ? 9.043   7.701   -13.621 1.00 0.59 ? 25 LYS A H    6  
ATOM 11276 H HA   . LYS A 1 25 ? 9.014   9.940   -15.607 1.00 0.59 ? 25 LYS A HA   6  
ATOM 11277 H HB2  . LYS A 1 25 ? 6.637   9.279   -16.018 1.00 0.59 ? 25 LYS A HB2  6  
ATOM 11278 H HB3  . LYS A 1 25 ? 7.783   8.004   -16.432 1.00 0.59 ? 25 LYS A HB3  6  
ATOM 11279 H HG2  . LYS A 1 25 ? 7.360   6.875   -14.315 1.00 0.59 ? 25 LYS A HG2  6  
ATOM 11280 H HG3  . LYS A 1 25 ? 6.308   8.189   -13.791 1.00 0.59 ? 25 LYS A HG3  6  
ATOM 11281 H HD2  . LYS A 1 25 ? 5.792   6.556   -16.287 1.00 0.59 ? 25 LYS A HD2  6  
ATOM 11282 H HD3  . LYS A 1 25 ? 5.096   6.162   -14.715 1.00 0.59 ? 25 LYS A HD3  6  
ATOM 11283 H HE2  . LYS A 1 25 ? 3.852   8.178   -14.634 1.00 0.59 ? 25 LYS A HE2  6  
ATOM 11284 H HE3  . LYS A 1 25 ? 4.801   8.910   -15.928 1.00 0.59 ? 25 LYS A HE3  6  
ATOM 11285 H HZ1  . LYS A 1 25 ? 3.915   6.961   -17.318 1.00 0.59 ? 25 LYS A HZ1  6  
ATOM 11286 H HZ2  . LYS A 1 25 ? 2.733   6.817   -16.104 1.00 0.59 ? 25 LYS A HZ2  6  
ATOM 11287 H HZ3  . LYS A 1 25 ? 2.873   8.259   -16.991 1.00 0.59 ? 25 LYS A HZ3  6  
ATOM 11288 N N    . GLU A 1 26 ? 7.484   9.701   -12.705 1.00 0.53 ? 26 GLU A N    6  
ATOM 11289 C CA   . GLU A 1 26 ? 6.875   10.538  -11.633 1.00 0.53 ? 26 GLU A CA   6  
ATOM 11290 C C    . GLU A 1 26 ? 6.858   9.755   -10.319 1.00 0.53 ? 26 GLU A C    6  
ATOM 11291 O O    . GLU A 1 26 ? 6.660   8.557   -10.301 1.00 0.53 ? 26 GLU A O    6  
ATOM 11292 C CB   . GLU A 1 26 ? 5.443   10.906  -12.026 1.00 0.53 ? 26 GLU A CB   6  
ATOM 11293 C CG   . GLU A 1 26 ? 4.551   9.668   -11.922 1.00 0.53 ? 26 GLU A CG   6  
ATOM 11294 C CD   . GLU A 1 26 ? 3.196   9.958   -12.571 1.00 0.53 ? 26 GLU A CD   6  
ATOM 11295 O OE1  . GLU A 1 26 ? 2.753   11.091  -12.488 1.00 0.53 ? 26 GLU A OE1  6  
ATOM 11296 O OE2  . GLU A 1 26 ? 2.626   9.042   -13.140 1.00 0.53 ? 26 GLU A OE2  6  
ATOM 11297 H H    . GLU A 1 26 ? 7.613   8.739   -12.563 1.00 0.53 ? 26 GLU A H    6  
ATOM 11298 H HA   . GLU A 1 26 ? 7.456   11.440  -11.506 1.00 0.53 ? 26 GLU A HA   6  
ATOM 11299 H HB2  . GLU A 1 26 ? 5.074   11.673  -11.361 1.00 0.53 ? 26 GLU A HB2  6  
ATOM 11300 H HB3  . GLU A 1 26 ? 5.430   11.272  -13.040 1.00 0.53 ? 26 GLU A HB3  6  
ATOM 11301 H HG2  . GLU A 1 26 ? 5.024   8.839   -12.430 1.00 0.53 ? 26 GLU A HG2  6  
ATOM 11302 H HG3  . GLU A 1 26 ? 4.403   9.415   -10.883 1.00 0.53 ? 26 GLU A HG3  6  
ATOM 11303 N N    . TYR A 1 27 ? 7.066   10.423  -9.217  1.00 0.39 ? 27 TYR A N    6  
ATOM 11304 C CA   . TYR A 1 27 ? 7.060   9.717   -7.905  1.00 0.39 ? 27 TYR A CA   6  
ATOM 11305 C C    . TYR A 1 27 ? 6.064   10.396  -6.963  1.00 0.39 ? 27 TYR A C    6  
ATOM 11306 O O    . TYR A 1 27 ? 5.321   11.274  -7.357  1.00 0.39 ? 27 TYR A O    6  
ATOM 11307 C CB   . TYR A 1 27 ? 8.464   9.767   -7.293  1.00 0.39 ? 27 TYR A CB   6  
ATOM 11308 C CG   . TYR A 1 27 ? 8.748   11.159  -6.781  1.00 0.39 ? 27 TYR A CG   6  
ATOM 11309 C CD1  . TYR A 1 27 ? 9.253   12.136  -7.647  1.00 0.39 ? 27 TYR A CD1  6  
ATOM 11310 C CD2  . TYR A 1 27 ? 8.507   11.472  -5.438  1.00 0.39 ? 27 TYR A CD2  6  
ATOM 11311 C CE1  . TYR A 1 27 ? 9.516   13.425  -7.171  1.00 0.39 ? 27 TYR A CE1  6  
ATOM 11312 C CE2  . TYR A 1 27 ? 8.770   12.763  -4.961  1.00 0.39 ? 27 TYR A CE2  6  
ATOM 11313 C CZ   . TYR A 1 27 ? 9.274   13.739  -5.828  1.00 0.39 ? 27 TYR A CZ   6  
ATOM 11314 O OH   . TYR A 1 27 ? 9.534   15.010  -5.359  1.00 0.39 ? 27 TYR A OH   6  
ATOM 11315 H H    . TYR A 1 27 ? 7.223   11.390  -9.251  1.00 0.39 ? 27 TYR A H    6  
ATOM 11316 H HA   . TYR A 1 27 ? 6.769   8.687   -8.053  1.00 0.39 ? 27 TYR A HA   6  
ATOM 11317 H HB2  . TYR A 1 27 ? 8.525   9.064   -6.476  1.00 0.39 ? 27 TYR A HB2  6  
ATOM 11318 H HB3  . TYR A 1 27 ? 9.193   9.507   -8.046  1.00 0.39 ? 27 TYR A HB3  6  
ATOM 11319 H HD1  . TYR A 1 27 ? 9.438   11.894  -8.684  1.00 0.39 ? 27 TYR A HD1  6  
ATOM 11320 H HD2  . TYR A 1 27 ? 8.117   10.719  -4.768  1.00 0.39 ? 27 TYR A HD2  6  
ATOM 11321 H HE1  . TYR A 1 27 ? 9.905   14.179  -7.840  1.00 0.39 ? 27 TYR A HE1  6  
ATOM 11322 H HE2  . TYR A 1 27 ? 8.583   13.004  -3.925  1.00 0.39 ? 27 TYR A HE2  6  
ATOM 11323 H HH   . TYR A 1 27 ? 8.816   15.582  -5.639  1.00 0.39 ? 27 TYR A HH   6  
ATOM 11324 N N    . PHE A 1 28 ? 6.043   9.999   -5.720  1.00 0.35 ? 28 PHE A N    6  
ATOM 11325 C CA   . PHE A 1 28 ? 5.097   10.623  -4.754  1.00 0.35 ? 28 PHE A CA   6  
ATOM 11326 C C    . PHE A 1 28 ? 5.334   10.038  -3.360  1.00 0.35 ? 28 PHE A C    6  
ATOM 11327 O O    . PHE A 1 28 ? 5.857   8.952   -3.214  1.00 0.35 ? 28 PHE A O    6  
ATOM 11328 C CB   . PHE A 1 28 ? 3.657   10.340  -5.189  1.00 0.35 ? 28 PHE A CB   6  
ATOM 11329 C CG   . PHE A 1 28 ? 3.537   8.902   -5.636  1.00 0.35 ? 28 PHE A CG   6  
ATOM 11330 C CD1  . PHE A 1 28 ? 3.645   7.867   -4.700  1.00 0.35 ? 28 PHE A CD1  6  
ATOM 11331 C CD2  . PHE A 1 28 ? 3.316   8.605   -6.986  1.00 0.35 ? 28 PHE A CD2  6  
ATOM 11332 C CE1  . PHE A 1 28 ? 3.533   6.534   -5.114  1.00 0.35 ? 28 PHE A CE1  6  
ATOM 11333 C CE2  . PHE A 1 28 ? 3.204   7.273   -7.400  1.00 0.35 ? 28 PHE A CE2  6  
ATOM 11334 C CZ   . PHE A 1 28 ? 3.312   6.237   -6.465  1.00 0.35 ? 28 PHE A CZ   6  
ATOM 11335 H H    . PHE A 1 28 ? 6.651   9.291   -5.422  1.00 0.35 ? 28 PHE A H    6  
ATOM 11336 H HA   . PHE A 1 28 ? 5.261   11.691  -4.727  1.00 0.35 ? 28 PHE A HA   6  
ATOM 11337 H HB2  . PHE A 1 28 ? 2.988   10.516  -4.358  1.00 0.35 ? 28 PHE A HB2  6  
ATOM 11338 H HB3  . PHE A 1 28 ? 3.394   10.993  -6.007  1.00 0.35 ? 28 PHE A HB3  6  
ATOM 11339 H HD1  . PHE A 1 28 ? 3.816   8.096   -3.658  1.00 0.35 ? 28 PHE A HD1  6  
ATOM 11340 H HD2  . PHE A 1 28 ? 3.233   9.404   -7.708  1.00 0.35 ? 28 PHE A HD2  6  
ATOM 11341 H HE1  . PHE A 1 28 ? 3.616   5.735   -4.393  1.00 0.35 ? 28 PHE A HE1  6  
ATOM 11342 H HE2  . PHE A 1 28 ? 3.033   7.044   -8.442  1.00 0.35 ? 28 PHE A HE2  6  
ATOM 11343 H HZ   . PHE A 1 28 ? 3.225   5.210   -6.784  1.00 0.35 ? 28 PHE A HZ   6  
ATOM 11344 N N    . TYR A 1 29 ? 4.953   10.750  -2.335  1.00 0.32 ? 29 TYR A N    6  
ATOM 11345 C CA   . TYR A 1 29 ? 5.160   10.234  -0.952  1.00 0.32 ? 29 TYR A CA   6  
ATOM 11346 C C    . TYR A 1 29 ? 3.936   9.423   -0.522  1.00 0.32 ? 29 TYR A C    6  
ATOM 11347 O O    . TYR A 1 29 ? 2.925   9.400   -1.196  1.00 0.32 ? 29 TYR A O    6  
ATOM 11348 C CB   . TYR A 1 29 ? 5.356   11.409  0.007   1.00 0.32 ? 29 TYR A CB   6  
ATOM 11349 C CG   . TYR A 1 29 ? 6.620   12.153  -0.357  1.00 0.32 ? 29 TYR A CG   6  
ATOM 11350 C CD1  . TYR A 1 29 ? 6.642   12.987  -1.482  1.00 0.32 ? 29 TYR A CD1  6  
ATOM 11351 C CD2  . TYR A 1 29 ? 7.769   12.009  0.430   1.00 0.32 ? 29 TYR A CD2  6  
ATOM 11352 C CE1  . TYR A 1 29 ? 7.812   13.678  -1.818  1.00 0.32 ? 29 TYR A CE1  6  
ATOM 11353 C CE2  . TYR A 1 29 ? 8.939   12.699  0.093   1.00 0.32 ? 29 TYR A CE2  6  
ATOM 11354 C CZ   . TYR A 1 29 ? 8.961   13.533  -1.031  1.00 0.32 ? 29 TYR A CZ   6  
ATOM 11355 O OH   . TYR A 1 29 ? 10.115  14.214  -1.362  1.00 0.32 ? 29 TYR A OH   6  
ATOM 11356 H H    . TYR A 1 29 ? 4.534   11.624  -2.474  1.00 0.32 ? 29 TYR A H    6  
ATOM 11357 H HA   . TYR A 1 29 ? 6.035   9.602   -0.931  1.00 0.32 ? 29 TYR A HA   6  
ATOM 11358 H HB2  . TYR A 1 29 ? 4.511   12.078  -0.066  1.00 0.32 ? 29 TYR A HB2  6  
ATOM 11359 H HB3  . TYR A 1 29 ? 5.437   11.039  1.018   1.00 0.32 ? 29 TYR A HB3  6  
ATOM 11360 H HD1  . TYR A 1 29 ? 5.756   13.098  -2.090  1.00 0.32 ? 29 TYR A HD1  6  
ATOM 11361 H HD2  . TYR A 1 29 ? 7.752   11.365  1.297   1.00 0.32 ? 29 TYR A HD2  6  
ATOM 11362 H HE1  . TYR A 1 29 ? 7.830   14.321  -2.685  1.00 0.32 ? 29 TYR A HE1  6  
ATOM 11363 H HE2  . TYR A 1 29 ? 9.825   12.588  0.701   1.00 0.32 ? 29 TYR A HE2  6  
ATOM 11364 H HH   . TYR A 1 29 ? 9.933   15.154  -1.300  1.00 0.32 ? 29 TYR A HH   6  
ATOM 11365 N N    . THR A 1 30 ? 4.018   8.757   0.598   1.00 0.37 ? 30 THR A N    6  
ATOM 11366 C CA   . THR A 1 30 ? 2.859   7.948   1.071   1.00 0.37 ? 30 THR A CA   6  
ATOM 11367 C C    . THR A 1 30 ? 2.876   7.881   2.599   1.00 0.37 ? 30 THR A C    6  
ATOM 11368 O O    . THR A 1 30 ? 3.920   7.765   3.214   1.00 0.37 ? 30 THR A O    6  
ATOM 11369 C CB   . THR A 1 30 ? 2.957   6.531   0.499   1.00 0.37 ? 30 THR A CB   6  
ATOM 11370 O OG1  . THR A 1 30 ? 4.156   5.921   0.954   1.00 0.37 ? 30 THR A OG1  6  
ATOM 11371 C CG2  . THR A 1 30 ? 2.962   6.593   -1.028  1.00 0.37 ? 30 THR A CG2  6  
ATOM 11372 H H    . THR A 1 30 ? 4.841   8.789   1.127   1.00 0.37 ? 30 THR A H    6  
ATOM 11373 H HA   . THR A 1 30 ? 1.940   8.408   0.741   1.00 0.37 ? 30 THR A HA   6  
ATOM 11374 H HB   . THR A 1 30 ? 2.109   5.952   0.829   1.00 0.37 ? 30 THR A HB   6  
ATOM 11375 H HG1  . THR A 1 30 ? 4.032   4.969   0.931   1.00 0.37 ? 30 THR A HG1  6  
ATOM 11376 H HG21 . THR A 1 30 ? 3.756   7.246   -1.361  1.00 0.37 ? 30 THR A HG21 6  
ATOM 11377 H HG22 . THR A 1 30 ? 3.119   5.603   -1.429  1.00 0.37 ? 30 THR A HG22 6  
ATOM 11378 H HG23 . THR A 1 30 ? 2.013   6.974   -1.376  1.00 0.37 ? 30 THR A HG23 6  
ATOM 11379 N N    . SER A 1 31 ? 1.729   7.948   3.216   1.00 0.47 ? 31 SER A N    6  
ATOM 11380 C CA   . SER A 1 31 ? 1.679   7.886   4.705   1.00 0.47 ? 31 SER A CA   6  
ATOM 11381 C C    . SER A 1 31 ? 0.221   7.910   5.168   1.00 0.47 ? 31 SER A C    6  
ATOM 11382 O O    . SER A 1 31 ? -0.689  7.681   4.397   1.00 0.47 ? 31 SER A O    6  
ATOM 11383 C CB   . SER A 1 31 ? 2.422   9.087   5.292   1.00 0.47 ? 31 SER A CB   6  
ATOM 11384 O OG   . SER A 1 31 ? 1.725   10.279  4.956   1.00 0.47 ? 31 SER A OG   6  
ATOM 11385 H H    . SER A 1 31 ? 0.900   8.040   2.702   1.00 0.47 ? 31 SER A H    6  
ATOM 11386 H HA   . SER A 1 31 ? 2.147   6.973   5.041   1.00 0.47 ? 31 SER A HA   6  
ATOM 11387 H HB2  . SER A 1 31 ? 2.469   8.993   6.363   1.00 0.47 ? 31 SER A HB2  6  
ATOM 11388 H HB3  . SER A 1 31 ? 3.426   9.118   4.889   1.00 0.47 ? 31 SER A HB3  6  
ATOM 11389 H HG   . SER A 1 31 ? 2.176   10.688  4.214   1.00 0.47 ? 31 SER A HG   6  
ATOM 11390 N N    . GLY A 1 32 ? -0.008  8.183   6.424   1.00 0.60 ? 32 GLY A N    6  
ATOM 11391 C CA   . GLY A 1 32 ? -1.407  8.217   6.936   1.00 0.60 ? 32 GLY A CA   6  
ATOM 11392 C C    . GLY A 1 32 ? -1.901  6.787   7.156   1.00 0.60 ? 32 GLY A C    6  
ATOM 11393 O O    . GLY A 1 32 ? -1.936  6.297   8.267   1.00 0.60 ? 32 GLY A O    6  
ATOM 11394 H H    . GLY A 1 32 ? 0.741   8.363   7.031   1.00 0.60 ? 32 GLY A H    6  
ATOM 11395 H HA2  . GLY A 1 32 ? -1.434  8.759   7.871   1.00 0.60 ? 32 GLY A HA2  6  
ATOM 11396 H HA3  . GLY A 1 32 ? -2.043  8.708   6.215   1.00 0.60 ? 32 GLY A HA3  6  
ATOM 11397 N N    . LYS A 1 33 ? -2.280  6.114   6.105   1.00 0.55 ? 33 LYS A N    6  
ATOM 11398 C CA   . LYS A 1 33 ? -2.768  4.714   6.252   1.00 0.55 ? 33 LYS A CA   6  
ATOM 11399 C C    . LYS A 1 33 ? -1.584  3.752   6.141   1.00 0.55 ? 33 LYS A C    6  
ATOM 11400 O O    . LYS A 1 33 ? -1.700  2.668   5.603   1.00 0.55 ? 33 LYS A O    6  
ATOM 11401 C CB   . LYS A 1 33 ? -3.779  4.408   5.145   1.00 0.55 ? 33 LYS A CB   6  
ATOM 11402 C CG   . LYS A 1 33 ? -5.150  4.959   5.539   1.00 0.55 ? 33 LYS A CG   6  
ATOM 11403 C CD   . LYS A 1 33 ? -6.241  4.147   4.843   1.00 0.55 ? 33 LYS A CD   6  
ATOM 11404 C CE   . LYS A 1 33 ? -7.326  5.090   4.320   1.00 0.55 ? 33 LYS A CE   6  
ATOM 11405 N NZ   . LYS A 1 33 ? -8.531  4.299   3.943   1.00 0.55 ? 33 LYS A NZ   6  
ATOM 11406 H H    . LYS A 1 33 ? -2.242  6.528   5.218   1.00 0.55 ? 33 LYS A H    6  
ATOM 11407 H HA   . LYS A 1 33 ? -3.242  4.595   7.215   1.00 0.55 ? 33 LYS A HA   6  
ATOM 11408 H HB2  . LYS A 1 33 ? -3.454  4.871   4.225   1.00 0.55 ? 33 LYS A HB2  6  
ATOM 11409 H HB3  . LYS A 1 33 ? -3.848  3.340   5.007   1.00 0.55 ? 33 LYS A HB3  6  
ATOM 11410 H HG2  . LYS A 1 33 ? -5.272  4.886   6.611   1.00 0.55 ? 33 LYS A HG2  6  
ATOM 11411 H HG3  . LYS A 1 33 ? -5.224  5.993   5.237   1.00 0.55 ? 33 LYS A HG3  6  
ATOM 11412 H HD2  . LYS A 1 33 ? -5.809  3.601   4.018   1.00 0.55 ? 33 LYS A HD2  6  
ATOM 11413 H HD3  . LYS A 1 33 ? -6.678  3.453   5.545   1.00 0.55 ? 33 LYS A HD3  6  
ATOM 11414 H HE2  . LYS A 1 33 ? -7.587  5.800   5.091   1.00 0.55 ? 33 LYS A HE2  6  
ATOM 11415 H HE3  . LYS A 1 33 ? -6.957  5.619   3.454   1.00 0.55 ? 33 LYS A HE3  6  
ATOM 11416 H HZ1  . LYS A 1 33 ? -8.525  3.394   4.455   1.00 0.55 ? 33 LYS A HZ1  6  
ATOM 11417 H HZ2  . LYS A 1 33 ? -9.388  4.833   4.192   1.00 0.55 ? 33 LYS A HZ2  6  
ATOM 11418 H HZ3  . LYS A 1 33 ? -8.523  4.121   2.919   1.00 0.55 ? 33 LYS A HZ3  6  
ATOM 11419 N N    . CYS A 1 34 ? -0.443  4.139   6.642   1.00 0.46 ? 34 CYS A N    6  
ATOM 11420 C CA   . CYS A 1 34 ? 0.748   3.249   6.561   1.00 0.46 ? 34 CYS A CA   6  
ATOM 11421 C C    . CYS A 1 34 ? 1.491   3.261   7.898   1.00 0.46 ? 34 CYS A C    6  
ATOM 11422 O O    . CYS A 1 34 ? 1.080   3.907   8.843   1.00 0.46 ? 34 CYS A O    6  
ATOM 11423 C CB   . CYS A 1 34 ? 1.681   3.751   5.458   1.00 0.46 ? 34 CYS A CB   6  
ATOM 11424 S SG   . CYS A 1 34 ? 0.695   4.305   4.045   1.00 0.46 ? 34 CYS A SG   6  
ATOM 11425 H H    . CYS A 1 34 ? -0.370  5.018   7.070   1.00 0.46 ? 34 CYS A H    6  
ATOM 11426 H HA   . CYS A 1 34 ? 0.431   2.242   6.334   1.00 0.46 ? 34 CYS A HA   6  
ATOM 11427 H HB2  . CYS A 1 34 ? 2.271   4.574   5.831   1.00 0.46 ? 34 CYS A HB2  6  
ATOM 11428 H HB3  . CYS A 1 34 ? 2.336   2.950   5.148   1.00 0.46 ? 34 CYS A HB3  6  
ATOM 11429 N N    . SER A 1 35 ? 2.582   2.552   7.987   1.00 0.42 ? 35 SER A N    6  
ATOM 11430 C CA   . SER A 1 35 ? 3.352   2.524   9.261   1.00 0.42 ? 35 SER A CA   6  
ATOM 11431 C C    . SER A 1 35 ? 4.283   3.737   9.321   1.00 0.42 ? 35 SER A C    6  
ATOM 11432 O O    . SER A 1 35 ? 4.503   4.311   10.369  1.00 0.42 ? 35 SER A O    6  
ATOM 11433 C CB   . SER A 1 35 ? 4.182   1.241   9.327   1.00 0.42 ? 35 SER A CB   6  
ATOM 11434 O OG   . SER A 1 35 ? 3.599   0.352   10.271  1.00 0.42 ? 35 SER A OG   6  
ATOM 11435 H H    . SER A 1 35 ? 2.897   2.039   7.213   1.00 0.42 ? 35 SER A H    6  
ATOM 11436 H HA   . SER A 1 35 ? 2.667   2.553   10.096  1.00 0.42 ? 35 SER A HA   6  
ATOM 11437 H HB2  . SER A 1 35 ? 4.196   0.769   8.359   1.00 0.42 ? 35 SER A HB2  6  
ATOM 11438 H HB3  . SER A 1 35 ? 5.194   1.483   9.623   1.00 0.42 ? 35 SER A HB3  6  
ATOM 11439 H HG   . SER A 1 35 ? 2.645   0.392   10.166  1.00 0.42 ? 35 SER A HG   6  
ATOM 11440 N N    . ASN A 1 36 ? 4.831   4.130   8.204   1.00 0.38 ? 36 ASN A N    6  
ATOM 11441 C CA   . ASN A 1 36 ? 5.747   5.306   8.197   1.00 0.38 ? 36 ASN A CA   6  
ATOM 11442 C C    . ASN A 1 36 ? 5.662   6.010   6.840   1.00 0.38 ? 36 ASN A C    6  
ATOM 11443 O O    . ASN A 1 36 ? 5.360   5.389   5.840   1.00 0.38 ? 36 ASN A O    6  
ATOM 11444 C CB   . ASN A 1 36 ? 7.186   4.840   8.439   1.00 0.38 ? 36 ASN A CB   6  
ATOM 11445 C CG   . ASN A 1 36 ? 7.184   3.583   9.310   1.00 0.38 ? 36 ASN A CG   6  
ATOM 11446 O OD1  . ASN A 1 36 ? 6.946   3.653   10.499  1.00 0.38 ? 36 ASN A OD1  6  
ATOM 11447 N ND2  . ASN A 1 36 ? 7.440   2.426   8.763   1.00 0.38 ? 36 ASN A ND2  6  
ATOM 11448 H H    . ASN A 1 36 ? 4.640   3.652   7.370   1.00 0.38 ? 36 ASN A H    6  
ATOM 11449 H HA   . ASN A 1 36 ? 5.455   5.994   8.978   1.00 0.38 ? 36 ASN A HA   6  
ATOM 11450 H HB2  . ASN A 1 36 ? 7.656   4.622   7.491   1.00 0.38 ? 36 ASN A HB2  6  
ATOM 11451 H HB3  . ASN A 1 36 ? 7.737   5.622   8.941   1.00 0.38 ? 36 ASN A HB3  6  
ATOM 11452 H HD21 . ASN A 1 36 ? 7.632   2.368   7.804   1.00 0.38 ? 36 ASN A HD21 6  
ATOM 11453 H HD22 . ASN A 1 36 ? 7.441   1.614   9.312   1.00 0.38 ? 36 ASN A HD22 6  
ATOM 11454 N N    . PRO A 1 37 ? 5.935   7.290   6.847   1.00 0.37 ? 37 PRO A N    6  
ATOM 11455 C CA   . PRO A 1 37 ? 5.902   8.116   5.628   1.00 0.37 ? 37 PRO A CA   6  
ATOM 11456 C C    . PRO A 1 37 ? 7.169   7.887   4.799   1.00 0.37 ? 37 PRO A C    6  
ATOM 11457 O O    . PRO A 1 37 ? 8.273   7.997   5.293   1.00 0.37 ? 37 PRO A O    6  
ATOM 11458 C CB   . PRO A 1 37 ? 5.853   9.548   6.166   1.00 0.37 ? 37 PRO A CB   6  
ATOM 11459 C CG   . PRO A 1 37 ? 6.424   9.494   7.604   1.00 0.37 ? 37 PRO A CG   6  
ATOM 11460 C CD   . PRO A 1 37 ? 6.301   8.031   8.072   1.00 0.37 ? 37 PRO A CD   6  
ATOM 11461 H HA   . PRO A 1 37 ? 5.020   7.907   5.046   1.00 0.37 ? 37 PRO A HA   6  
ATOM 11462 H HB2  . PRO A 1 37 ? 6.457   10.198  5.547   1.00 0.37 ? 37 PRO A HB2  6  
ATOM 11463 H HB3  . PRO A 1 37 ? 4.834   9.901   6.193   1.00 0.37 ? 37 PRO A HB3  6  
ATOM 11464 H HG2  . PRO A 1 37 ? 7.462   9.799   7.600   1.00 0.37 ? 37 PRO A HG2  6  
ATOM 11465 H HG3  . PRO A 1 37 ? 5.850   10.134  8.255   1.00 0.37 ? 37 PRO A HG3  6  
ATOM 11466 H HD2  . PRO A 1 37 ? 7.245   7.679   8.462   1.00 0.37 ? 37 PRO A HD2  6  
ATOM 11467 H HD3  . PRO A 1 37 ? 5.522   7.935   8.812   1.00 0.37 ? 37 PRO A HD3  6  
ATOM 11468 N N    . ALA A 1 38 ? 7.020   7.568   3.542   1.00 0.33 ? 38 ALA A N    6  
ATOM 11469 C CA   . ALA A 1 38 ? 8.218   7.332   2.688   1.00 0.33 ? 38 ALA A CA   6  
ATOM 11470 C C    . ALA A 1 38 ? 7.947   7.842   1.271   1.00 0.33 ? 38 ALA A C    6  
ATOM 11471 O O    . ALA A 1 38 ? 6.893   8.372   0.982   1.00 0.33 ? 38 ALA A O    6  
ATOM 11472 C CB   . ALA A 1 38 ? 8.522   5.833   2.640   1.00 0.33 ? 38 ALA A CB   6  
ATOM 11473 H H    . ALA A 1 38 ? 6.119   7.482   3.161   1.00 0.33 ? 38 ALA A H    6  
ATOM 11474 H HA   . ALA A 1 38 ? 9.065   7.858   3.104   1.00 0.33 ? 38 ALA A HA   6  
ATOM 11475 H HB1  . ALA A 1 38 ? 7.606   5.285   2.477   1.00 0.33 ? 38 ALA A HB1  6  
ATOM 11476 H HB2  . ALA A 1 38 ? 9.211   5.632   1.832   1.00 0.33 ? 38 ALA A HB2  6  
ATOM 11477 H HB3  . ALA A 1 38 ? 8.964   5.526   3.576   1.00 0.33 ? 38 ALA A HB3  6  
ATOM 11478 N N    . VAL A 1 39 ? 8.892   7.687   0.385   1.00 0.30 ? 39 VAL A N    6  
ATOM 11479 C CA   . VAL A 1 39 ? 8.688   8.163   -1.013  1.00 0.30 ? 39 VAL A CA   6  
ATOM 11480 C C    . VAL A 1 39 ? 8.419   6.963   -1.924  1.00 0.30 ? 39 VAL A C    6  
ATOM 11481 O O    . VAL A 1 39 ? 8.635   5.827   -1.553  1.00 0.30 ? 39 VAL A O    6  
ATOM 11482 C CB   . VAL A 1 39 ? 9.943   8.900   -1.488  1.00 0.30 ? 39 VAL A CB   6  
ATOM 11483 C CG1  . VAL A 1 39 ? 9.883   9.095   -3.004  1.00 0.30 ? 39 VAL A CG1  6  
ATOM 11484 C CG2  . VAL A 1 39 ? 10.021  10.266  -0.804  1.00 0.30 ? 39 VAL A CG2  6  
ATOM 11485 H H    . VAL A 1 39 ? 9.736   7.257   0.637   1.00 0.30 ? 39 VAL A H    6  
ATOM 11486 H HA   . VAL A 1 39 ? 7.843   8.834   -1.044  1.00 0.30 ? 39 VAL A HA   6  
ATOM 11487 H HB   . VAL A 1 39 ? 10.818  8.318   -1.236  1.00 0.30 ? 39 VAL A HB   6  
ATOM 11488 H HG11 . VAL A 1 39 ? 8.965   9.602   -3.266  1.00 0.30 ? 39 VAL A HG11 6  
ATOM 11489 H HG12 . VAL A 1 39 ? 10.724  9.691   -3.324  1.00 0.30 ? 39 VAL A HG12 6  
ATOM 11490 H HG13 . VAL A 1 39 ? 9.914   8.133   -3.493  1.00 0.30 ? 39 VAL A HG13 6  
ATOM 11491 H HG21 . VAL A 1 39 ? 9.475   10.232  0.128   1.00 0.30 ? 39 VAL A HG21 6  
ATOM 11492 H HG22 . VAL A 1 39 ? 11.053  10.512  -0.608  1.00 0.30 ? 39 VAL A HG22 6  
ATOM 11493 H HG23 . VAL A 1 39 ? 9.586   11.016  -1.449  1.00 0.30 ? 39 VAL A HG23 6  
ATOM 11494 N N    . VAL A 1 40 ? 7.951   7.209   -3.117  1.00 0.33 ? 40 VAL A N    6  
ATOM 11495 C CA   . VAL A 1 40 ? 7.668   6.086   -4.054  1.00 0.33 ? 40 VAL A CA   6  
ATOM 11496 C C    . VAL A 1 40 ? 7.981   6.529   -5.484  1.00 0.33 ? 40 VAL A C    6  
ATOM 11497 O O    . VAL A 1 40 ? 7.328   7.394   -6.033  1.00 0.33 ? 40 VAL A O    6  
ATOM 11498 C CB   . VAL A 1 40 ? 6.191   5.697   -3.950  1.00 0.33 ? 40 VAL A CB   6  
ATOM 11499 C CG1  . VAL A 1 40 ? 5.819   4.777   -5.114  1.00 0.33 ? 40 VAL A CG1  6  
ATOM 11500 C CG2  . VAL A 1 40 ? 5.950   4.966   -2.627  1.00 0.33 ? 40 VAL A CG2  6  
ATOM 11501 H H    . VAL A 1 40 ? 7.785   8.132   -3.398  1.00 0.33 ? 40 VAL A H    6  
ATOM 11502 H HA   . VAL A 1 40 ? 8.284   5.236   -3.797  1.00 0.33 ? 40 VAL A HA   6  
ATOM 11503 H HB   . VAL A 1 40 ? 5.582   6.588   -3.988  1.00 0.33 ? 40 VAL A HB   6  
ATOM 11504 H HG11 . VAL A 1 40 ? 6.545   3.980   -5.191  1.00 0.33 ? 40 VAL A HG11 6  
ATOM 11505 H HG12 . VAL A 1 40 ? 4.839   4.356   -4.942  1.00 0.33 ? 40 VAL A HG12 6  
ATOM 11506 H HG13 . VAL A 1 40 ? 5.810   5.345   -6.033  1.00 0.33 ? 40 VAL A HG13 6  
ATOM 11507 H HG21 . VAL A 1 40 ? 6.605   4.110   -2.565  1.00 0.33 ? 40 VAL A HG21 6  
ATOM 11508 H HG22 . VAL A 1 40 ? 6.154   5.635   -1.804  1.00 0.33 ? 40 VAL A HG22 6  
ATOM 11509 H HG23 . VAL A 1 40 ? 4.922   4.638   -2.580  1.00 0.33 ? 40 VAL A HG23 6  
ATOM 11510 N N    . PHE A 1 41 ? 8.978   5.947   -6.092  1.00 0.37 ? 41 PHE A N    6  
ATOM 11511 C CA   . PHE A 1 41 ? 9.333   6.341   -7.485  1.00 0.37 ? 41 PHE A CA   6  
ATOM 11512 C C    . PHE A 1 41 ? 8.552   5.476   -8.477  1.00 0.37 ? 41 PHE A C    6  
ATOM 11513 O O    . PHE A 1 41 ? 8.562   4.264   -8.403  1.00 0.37 ? 41 PHE A O    6  
ATOM 11514 C CB   . PHE A 1 41 ? 10.833  6.140   -7.705  1.00 0.37 ? 41 PHE A CB   6  
ATOM 11515 C CG   . PHE A 1 41 ? 11.592  7.278   -7.066  1.00 0.37 ? 41 PHE A CG   6  
ATOM 11516 C CD1  . PHE A 1 41 ? 11.661  8.520   -7.707  1.00 0.37 ? 41 PHE A CD1  6  
ATOM 11517 C CD2  . PHE A 1 41 ? 12.224  7.092   -5.831  1.00 0.37 ? 41 PHE A CD2  6  
ATOM 11518 C CE1  . PHE A 1 41 ? 12.364  9.576   -7.114  1.00 0.37 ? 41 PHE A CE1  6  
ATOM 11519 C CE2  . PHE A 1 41 ? 12.926  8.147   -5.237  1.00 0.37 ? 41 PHE A CE2  6  
ATOM 11520 C CZ   . PHE A 1 41 ? 12.997  9.390   -5.880  1.00 0.37 ? 41 PHE A CZ   6  
ATOM 11521 H H    . PHE A 1 41 ? 9.495   5.252   -5.633  1.00 0.37 ? 41 PHE A H    6  
ATOM 11522 H HA   . PHE A 1 41 ? 9.082   7.380   -7.640  1.00 0.37 ? 41 PHE A HA   6  
ATOM 11523 H HB2  . PHE A 1 41 ? 11.141  5.205   -7.258  1.00 0.37 ? 41 PHE A HB2  6  
ATOM 11524 H HB3  . PHE A 1 41 ? 11.043  6.120   -8.764  1.00 0.37 ? 41 PHE A HB3  6  
ATOM 11525 H HD1  . PHE A 1 41 ? 11.174  8.663   -8.660  1.00 0.37 ? 41 PHE A HD1  6  
ATOM 11526 H HD2  . PHE A 1 41 ? 12.170  6.133   -5.335  1.00 0.37 ? 41 PHE A HD2  6  
ATOM 11527 H HE1  . PHE A 1 41 ? 12.418  10.534  -7.609  1.00 0.37 ? 41 PHE A HE1  6  
ATOM 11528 H HE2  . PHE A 1 41 ? 13.414  8.004   -4.284  1.00 0.37 ? 41 PHE A HE2  6  
ATOM 11529 H HZ   . PHE A 1 41 ? 13.538  10.204  -5.422  1.00 0.37 ? 41 PHE A HZ   6  
ATOM 11530 N N    . VAL A 1 42 ? 7.875   6.092   -9.407  1.00 0.46 ? 42 VAL A N    6  
ATOM 11531 C CA   . VAL A 1 42 ? 7.095   5.310   -10.405 1.00 0.46 ? 42 VAL A CA   6  
ATOM 11532 C C    . VAL A 1 42 ? 7.735   5.465   -11.786 1.00 0.46 ? 42 VAL A C    6  
ATOM 11533 O O    . VAL A 1 42 ? 7.872   6.559   -12.298 1.00 0.46 ? 42 VAL A O    6  
ATOM 11534 C CB   . VAL A 1 42 ? 5.657   5.829   -10.448 1.00 0.46 ? 42 VAL A CB   6  
ATOM 11535 C CG1  . VAL A 1 42 ? 4.761   4.795   -11.134 1.00 0.46 ? 42 VAL A CG1  6  
ATOM 11536 C CG2  . VAL A 1 42 ? 5.158   6.066   -9.021  1.00 0.46 ? 42 VAL A CG2  6  
ATOM 11537 H H    . VAL A 1 42 ? 7.882   7.072   -9.449  1.00 0.46 ? 42 VAL A H    6  
ATOM 11538 H HA   . VAL A 1 42 ? 7.094   4.267   -10.124 1.00 0.46 ? 42 VAL A HA   6  
ATOM 11539 H HB   . VAL A 1 42 ? 5.625   6.755   -11.003 1.00 0.46 ? 42 VAL A HB   6  
ATOM 11540 H HG11 . VAL A 1 42 ? 5.320   3.885   -11.294 1.00 0.46 ? 42 VAL A HG11 6  
ATOM 11541 H HG12 . VAL A 1 42 ? 3.906   4.589   -10.508 1.00 0.46 ? 42 VAL A HG12 6  
ATOM 11542 H HG13 . VAL A 1 42 ? 4.426   5.185   -12.085 1.00 0.46 ? 42 VAL A HG13 6  
ATOM 11543 H HG21 . VAL A 1 42 ? 5.865   5.649   -8.319  1.00 0.46 ? 42 VAL A HG21 6  
ATOM 11544 H HG22 . VAL A 1 42 ? 5.060   7.128   -8.846  1.00 0.46 ? 42 VAL A HG22 6  
ATOM 11545 H HG23 . VAL A 1 42 ? 4.198   5.589   -8.892  1.00 0.46 ? 42 VAL A HG23 6  
ATOM 11546 N N    . THR A 1 43 ? 8.130   4.379   -12.393 1.00 0.54 ? 43 THR A N    6  
ATOM 11547 C CA   . THR A 1 43 ? 8.762   4.465   -13.739 1.00 0.54 ? 43 THR A CA   6  
ATOM 11548 C C    . THR A 1 43 ? 7.682   4.368   -14.817 1.00 0.54 ? 43 THR A C    6  
ATOM 11549 O O    . THR A 1 43 ? 6.502   4.429   -14.535 1.00 0.54 ? 43 THR A O    6  
ATOM 11550 C CB   . THR A 1 43 ? 9.758   3.314   -13.909 1.00 0.54 ? 43 THR A CB   6  
ATOM 11551 O OG1  . THR A 1 43 ? 9.175   2.112   -13.426 1.00 0.54 ? 43 THR A OG1  6  
ATOM 11552 C CG2  . THR A 1 43 ? 11.032  3.618   -13.121 1.00 0.54 ? 43 THR A CG2  6  
ATOM 11553 H H    . THR A 1 43 ? 8.011   3.506   -11.962 1.00 0.54 ? 43 THR A H    6  
ATOM 11554 H HA   . THR A 1 43 ? 9.282   5.407   -13.833 1.00 0.54 ? 43 THR A HA   6  
ATOM 11555 H HB   . THR A 1 43 ? 10.003  3.202   -14.953 1.00 0.54 ? 43 THR A HB   6  
ATOM 11556 H HG1  . THR A 1 43 ? 9.158   1.479   -14.149 1.00 0.54 ? 43 THR A HG1  6  
ATOM 11557 H HG21 . THR A 1 43 ? 10.981  4.622   -12.726 1.00 0.54 ? 43 THR A HG21 6  
ATOM 11558 H HG22 . THR A 1 43 ? 11.128  2.915   -12.307 1.00 0.54 ? 43 THR A HG22 6  
ATOM 11559 H HG23 . THR A 1 43 ? 11.888  3.532   -13.775 1.00 0.54 ? 43 THR A HG23 6  
ATOM 11560 N N    . ARG A 1 44 ? 8.076   4.220   -16.053 1.00 0.69 ? 44 ARG A N    6  
ATOM 11561 C CA   . ARG A 1 44 ? 7.071   4.119   -17.148 1.00 0.69 ? 44 ARG A CA   6  
ATOM 11562 C C    . ARG A 1 44 ? 6.375   2.758   -17.080 1.00 0.69 ? 44 ARG A C    6  
ATOM 11563 O O    . ARG A 1 44 ? 5.308   2.567   -17.628 1.00 0.69 ? 44 ARG A O    6  
ATOM 11564 C CB   . ARG A 1 44 ? 7.774   4.267   -18.499 1.00 0.69 ? 44 ARG A CB   6  
ATOM 11565 C CG   . ARG A 1 44 ? 8.367   5.673   -18.615 1.00 0.69 ? 44 ARG A CG   6  
ATOM 11566 C CD   . ARG A 1 44 ? 9.392   5.703   -19.751 1.00 0.69 ? 44 ARG A CD   6  
ATOM 11567 N NE   . ARG A 1 44 ? 10.301  4.529   -19.632 1.00 0.69 ? 44 ARG A NE   6  
ATOM 11568 C CZ   . ARG A 1 44 ? 10.594  3.821   -20.689 1.00 0.69 ? 44 ARG A CZ   6  
ATOM 11569 N NH1  . ARG A 1 44 ? 10.818  4.413   -21.829 1.00 0.69 ? 44 ARG A NH1  6  
ATOM 11570 N NH2  . ARG A 1 44 ? 10.664  2.520   -20.603 1.00 0.69 ? 44 ARG A NH2  6  
ATOM 11571 H H    . ARG A 1 44 ? 9.033   4.174   -16.260 1.00 0.69 ? 44 ARG A H    6  
ATOM 11572 H HA   . ARG A 1 44 ? 6.337   4.904   -17.037 1.00 0.69 ? 44 ARG A HA   6  
ATOM 11573 H HB2  . ARG A 1 44 ? 8.563   3.534   -18.576 1.00 0.69 ? 44 ARG A HB2  6  
ATOM 11574 H HB3  . ARG A 1 44 ? 7.060   4.114   -19.295 1.00 0.69 ? 44 ARG A HB3  6  
ATOM 11575 H HG2  . ARG A 1 44 ? 7.578   6.381   -18.822 1.00 0.69 ? 44 ARG A HG2  6  
ATOM 11576 H HG3  . ARG A 1 44 ? 8.854   5.935   -17.688 1.00 0.69 ? 44 ARG A HG3  6  
ATOM 11577 H HD2  . ARG A 1 44 ? 8.877   5.665   -20.700 1.00 0.69 ? 44 ARG A HD2  6  
ATOM 11578 H HD3  . ARG A 1 44 ? 9.970   6.613   -19.691 1.00 0.69 ? 44 ARG A HD3  6  
ATOM 11579 H HE   . ARG A 1 44 ? 10.678  4.287   -18.761 1.00 0.69 ? 44 ARG A HE   6  
ATOM 11580 H HH11 . ARG A 1 44 ? 10.764  5.409   -21.894 1.00 0.69 ? 44 ARG A HH11 6  
ATOM 11581 H HH12 . ARG A 1 44 ? 11.043  3.870   -22.639 1.00 0.69 ? 44 ARG A HH12 6  
ATOM 11582 H HH21 . ARG A 1 44 ? 10.493  2.066   -19.729 1.00 0.69 ? 44 ARG A HH21 6  
ATOM 11583 H HH22 . ARG A 1 44 ? 10.889  1.978   -21.413 1.00 0.69 ? 44 ARG A HH22 6  
ATOM 11584 N N    . LYS A 1 45 ? 6.973   1.810   -16.411 1.00 0.66 ? 45 LYS A N    6  
ATOM 11585 C CA   . LYS A 1 45 ? 6.345   0.463   -16.308 1.00 0.66 ? 45 LYS A CA   6  
ATOM 11586 C C    . LYS A 1 45 ? 5.447   0.411   -15.070 1.00 0.66 ? 45 LYS A C    6  
ATOM 11587 O O    . LYS A 1 45 ? 5.263   -0.628  -14.468 1.00 0.66 ? 45 LYS A O    6  
ATOM 11588 C CB   . LYS A 1 45 ? 7.438   -0.601  -16.190 1.00 0.66 ? 45 LYS A CB   6  
ATOM 11589 C CG   . LYS A 1 45 ? 8.485   -0.382  -17.282 1.00 0.66 ? 45 LYS A CG   6  
ATOM 11590 C CD   . LYS A 1 45 ? 9.681   -1.306  -17.038 1.00 0.66 ? 45 LYS A CD   6  
ATOM 11591 C CE   . LYS A 1 45 ? 10.782  -0.994  -18.053 1.00 0.66 ? 45 LYS A CE   6  
ATOM 11592 N NZ   . LYS A 1 45 ? 12.086  -1.503  -17.541 1.00 0.66 ? 45 LYS A NZ   6  
ATOM 11593 H H    . LYS A 1 45 ? 7.833   1.984   -15.975 1.00 0.66 ? 45 LYS A H    6  
ATOM 11594 H HA   . LYS A 1 45 ? 5.753   0.273   -17.191 1.00 0.66 ? 45 LYS A HA   6  
ATOM 11595 H HB2  . LYS A 1 45 ? 7.908   -0.529  -15.219 1.00 0.66 ? 45 LYS A HB2  6  
ATOM 11596 H HB3  . LYS A 1 45 ? 7.000   -1.582  -16.306 1.00 0.66 ? 45 LYS A HB3  6  
ATOM 11597 H HG2  . LYS A 1 45 ? 8.051   -0.601  -18.247 1.00 0.66 ? 45 LYS A HG2  6  
ATOM 11598 H HG3  . LYS A 1 45 ? 8.818   0.646   -17.261 1.00 0.66 ? 45 LYS A HG3  6  
ATOM 11599 H HD2  . LYS A 1 45 ? 10.056  -1.150  -16.038 1.00 0.66 ? 45 LYS A HD2  6  
ATOM 11600 H HD3  . LYS A 1 45 ? 9.370   -2.333  -17.151 1.00 0.66 ? 45 LYS A HD3  6  
ATOM 11601 H HE2  . LYS A 1 45 ? 10.552  -1.475  -18.993 1.00 0.66 ? 45 LYS A HE2  6  
ATOM 11602 H HE3  . LYS A 1 45 ? 10.845  0.073   -18.200 1.00 0.66 ? 45 LYS A HE3  6  
ATOM 11603 H HZ1  . LYS A 1 45 ? 12.042  -1.588  -16.505 1.00 0.66 ? 45 LYS A HZ1  6  
ATOM 11604 H HZ2  . LYS A 1 45 ? 12.283  -2.435  -17.958 1.00 0.66 ? 45 LYS A HZ2  6  
ATOM 11605 H HZ3  . LYS A 1 45 ? 12.844  -0.841  -17.803 1.00 0.66 ? 45 LYS A HZ3  6  
ATOM 11606 N N    . ASN A 1 46 ? 4.886   1.525   -14.686 1.00 0.61 ? 46 ASN A N    6  
ATOM 11607 C CA   . ASN A 1 46 ? 4.001   1.540   -13.489 1.00 0.61 ? 46 ASN A CA   6  
ATOM 11608 C C    . ASN A 1 46 ? 4.694   0.814   -12.333 1.00 0.61 ? 46 ASN A C    6  
ATOM 11609 O O    . ASN A 1 46 ? 4.055   0.309   -11.432 1.00 0.61 ? 46 ASN A O    6  
ATOM 11610 C CB   . ASN A 1 46 ? 2.684   0.833   -13.818 1.00 0.61 ? 46 ASN A CB   6  
ATOM 11611 C CG   . ASN A 1 46 ? 1.681   1.851   -14.364 1.00 0.61 ? 46 ASN A CG   6  
ATOM 11612 O OD1  . ASN A 1 46 ? 1.525   2.922   -13.813 1.00 0.61 ? 46 ASN A OD1  6  
ATOM 11613 N ND2  . ASN A 1 46 ? 0.990   1.560   -15.432 1.00 0.61 ? 46 ASN A ND2  6  
ATOM 11614 H H    . ASN A 1 46 ? 5.047   2.353   -15.187 1.00 0.61 ? 46 ASN A H    6  
ATOM 11615 H HA   . ASN A 1 46 ? 3.800   2.561   -13.202 1.00 0.61 ? 46 ASN A HA   6  
ATOM 11616 H HB2  . ASN A 1 46 ? 2.862   0.068   -14.560 1.00 0.61 ? 46 ASN A HB2  6  
ATOM 11617 H HB3  . ASN A 1 46 ? 2.284   0.381   -12.923 1.00 0.61 ? 46 ASN A HB3  6  
ATOM 11618 H HD21 . ASN A 1 46 ? 1.116   0.696   -15.877 1.00 0.61 ? 46 ASN A HD21 6  
ATOM 11619 H HD22 . ASN A 1 46 ? 0.346   2.205   -15.790 1.00 0.61 ? 46 ASN A HD22 6  
ATOM 11620 N N    . ARG A 1 47 ? 5.998   0.759   -12.353 1.00 0.52 ? 47 ARG A N    6  
ATOM 11621 C CA   . ARG A 1 47 ? 6.730   0.067   -11.255 1.00 0.52 ? 47 ARG A CA   6  
ATOM 11622 C C    . ARG A 1 47 ? 7.043   1.067   -10.141 1.00 0.52 ? 47 ARG A C    6  
ATOM 11623 O O    . ARG A 1 47 ? 7.660   2.089   -10.367 1.00 0.52 ? 47 ARG A O    6  
ATOM 11624 C CB   . ARG A 1 47 ? 8.037   -0.515  -11.801 1.00 0.52 ? 47 ARG A CB   6  
ATOM 11625 C CG   . ARG A 1 47 ? 7.886   -2.026  -11.983 1.00 0.52 ? 47 ARG A CG   6  
ATOM 11626 C CD   . ARG A 1 47 ? 8.514   -2.751  -10.791 1.00 0.52 ? 47 ARG A CD   6  
ATOM 11627 N NE   . ARG A 1 47 ? 9.491   -3.763  -11.282 1.00 0.52 ? 47 ARG A NE   6  
ATOM 11628 C CZ   . ARG A 1 47 ? 10.268  -4.384  -10.437 1.00 0.52 ? 47 ARG A CZ   6  
ATOM 11629 N NH1  . ARG A 1 47 ? 9.785   -4.822  -9.306  1.00 0.52 ? 47 ARG A NH1  6  
ATOM 11630 N NH2  . ARG A 1 47 ? 11.528  -4.567  -10.722 1.00 0.52 ? 47 ARG A NH2  6  
ATOM 11631 H H    . ARG A 1 47 ? 6.495   1.173   -13.089 1.00 0.52 ? 47 ARG A H    6  
ATOM 11632 H HA   . ARG A 1 47 ? 6.118   -0.732  -10.861 1.00 0.52 ? 47 ARG A HA   6  
ATOM 11633 H HB2  . ARG A 1 47 ? 8.264   -0.057  -12.752 1.00 0.52 ? 47 ARG A HB2  6  
ATOM 11634 H HB3  . ARG A 1 47 ? 8.838   -0.316  -11.104 1.00 0.52 ? 47 ARG A HB3  6  
ATOM 11635 H HG2  . ARG A 1 47 ? 6.838   -2.279  -12.047 1.00 0.52 ? 47 ARG A HG2  6  
ATOM 11636 H HG3  . ARG A 1 47 ? 8.386   -2.332  -12.890 1.00 0.52 ? 47 ARG A HG3  6  
ATOM 11637 H HD2  . ARG A 1 47 ? 9.024   -2.035  -10.162 1.00 0.52 ? 47 ARG A HD2  6  
ATOM 11638 H HD3  . ARG A 1 47 ? 7.740   -3.244  -10.220 1.00 0.52 ? 47 ARG A HD3  6  
ATOM 11639 H HE   . ARG A 1 47 ? 9.550   -3.963  -12.240 1.00 0.52 ? 47 ARG A HE   6  
ATOM 11640 H HH11 . ARG A 1 47 ? 8.818   -4.682  -9.088  1.00 0.52 ? 47 ARG A HH11 6  
ATOM 11641 H HH12 . ARG A 1 47 ? 10.380  -5.298  -8.660  1.00 0.52 ? 47 ARG A HH12 6  
ATOM 11642 H HH21 . ARG A 1 47 ? 11.898  -4.232  -11.588 1.00 0.52 ? 47 ARG A HH21 6  
ATOM 11643 H HH22 . ARG A 1 47 ? 12.124  -5.042  -10.075 1.00 0.52 ? 47 ARG A HH22 6  
ATOM 11644 N N    . GLN A 1 48 ? 6.622   0.784   -8.939  1.00 0.45 ? 48 GLN A N    6  
ATOM 11645 C CA   . GLN A 1 48 ? 6.895   1.721   -7.813  1.00 0.45 ? 48 GLN A CA   6  
ATOM 11646 C C    . GLN A 1 48 ? 8.125   1.244   -7.040  1.00 0.45 ? 48 GLN A C    6  
ATOM 11647 O O    . GLN A 1 48 ? 8.366   0.061   -6.905  1.00 0.45 ? 48 GLN A O    6  
ATOM 11648 C CB   . GLN A 1 48 ? 5.686   1.759   -6.876  1.00 0.45 ? 48 GLN A CB   6  
ATOM 11649 C CG   . GLN A 1 48 ? 4.533   2.497   -7.558  1.00 0.45 ? 48 GLN A CG   6  
ATOM 11650 C CD   . GLN A 1 48 ? 3.329   1.560   -7.683  1.00 0.45 ? 48 GLN A CD   6  
ATOM 11651 O OE1  . GLN A 1 48 ? 3.436   0.483   -8.234  1.00 0.45 ? 48 GLN A OE1  6  
ATOM 11652 N NE2  . GLN A 1 48 ? 2.179   1.929   -7.188  1.00 0.45 ? 48 GLN A NE2  6  
ATOM 11653 H H    . GLN A 1 48 ? 6.124   -0.045  -8.778  1.00 0.45 ? 48 GLN A H    6  
ATOM 11654 H HA   . GLN A 1 48 ? 7.078   2.710   -8.205  1.00 0.45 ? 48 GLN A HA   6  
ATOM 11655 H HB2  . GLN A 1 48 ? 5.380   0.748   -6.643  1.00 0.45 ? 48 GLN A HB2  6  
ATOM 11656 H HB3  . GLN A 1 48 ? 5.952   2.274   -5.966  1.00 0.45 ? 48 GLN A HB3  6  
ATOM 11657 H HG2  . GLN A 1 48 ? 4.261   3.361   -6.970  1.00 0.45 ? 48 GLN A HG2  6  
ATOM 11658 H HG3  . GLN A 1 48 ? 4.842   2.814   -8.544  1.00 0.45 ? 48 GLN A HG3  6  
ATOM 11659 H HE21 . GLN A 1 48 ? 2.092   2.798   -6.743  1.00 0.45 ? 48 GLN A HE21 6  
ATOM 11660 H HE22 . GLN A 1 48 ? 1.401   1.337   -7.262  1.00 0.45 ? 48 GLN A HE22 6  
ATOM 11661 N N    . VAL A 1 49 ? 8.906   2.156   -6.528  1.00 0.37 ? 49 VAL A N    6  
ATOM 11662 C CA   . VAL A 1 49 ? 10.120  1.755   -5.763  1.00 0.37 ? 49 VAL A CA   6  
ATOM 11663 C C    . VAL A 1 49 ? 10.229  2.608   -4.498  1.00 0.37 ? 49 VAL A C    6  
ATOM 11664 O O    . VAL A 1 49 ? 10.548  3.780   -4.552  1.00 0.37 ? 49 VAL A O    6  
ATOM 11665 C CB   . VAL A 1 49 ? 11.362  1.968   -6.630  1.00 0.37 ? 49 VAL A CB   6  
ATOM 11666 C CG1  . VAL A 1 49 ? 12.618  1.753   -5.784  1.00 0.37 ? 49 VAL A CG1  6  
ATOM 11667 C CG2  . VAL A 1 49 ? 11.352  0.966   -7.787  1.00 0.37 ? 49 VAL A CG2  6  
ATOM 11668 H H    . VAL A 1 49 ? 8.694   3.106   -6.648  1.00 0.37 ? 49 VAL A H    6  
ATOM 11669 H HA   . VAL A 1 49 ? 10.045  0.713   -5.489  1.00 0.37 ? 49 VAL A HA   6  
ATOM 11670 H HB   . VAL A 1 49 ? 11.360  2.974   -7.022  1.00 0.37 ? 49 VAL A HB   6  
ATOM 11671 H HG11 . VAL A 1 49 ? 12.419  1.011   -5.026  1.00 0.37 ? 49 VAL A HG11 6  
ATOM 11672 H HG12 . VAL A 1 49 ? 13.425  1.414   -6.416  1.00 0.37 ? 49 VAL A HG12 6  
ATOM 11673 H HG13 . VAL A 1 49 ? 12.897  2.684   -5.312  1.00 0.37 ? 49 VAL A HG13 6  
ATOM 11674 H HG21 . VAL A 1 49 ? 11.120  -0.019  -7.410  1.00 0.37 ? 49 VAL A HG21 6  
ATOM 11675 H HG22 . VAL A 1 49 ? 10.605  1.260   -8.510  1.00 0.37 ? 49 VAL A HG22 6  
ATOM 11676 H HG23 . VAL A 1 49 ? 12.323  0.952   -8.259  1.00 0.37 ? 49 VAL A HG23 6  
ATOM 11677 N N    . CYS A 1 50 ? 9.965   2.031   -3.358  1.00 0.29 ? 50 CYS A N    6  
ATOM 11678 C CA   . CYS A 1 50 ? 10.052  2.809   -2.090  1.00 0.29 ? 50 CYS A CA   6  
ATOM 11679 C C    . CYS A 1 50 ? 11.444  3.433   -1.968  1.00 0.29 ? 50 CYS A C    6  
ATOM 11680 O O    . CYS A 1 50 ? 12.443  2.805   -2.255  1.00 0.29 ? 50 CYS A O    6  
ATOM 11681 C CB   . CYS A 1 50 ? 9.803   1.879   -0.902  1.00 0.29 ? 50 CYS A CB   6  
ATOM 11682 S SG   . CYS A 1 50 ? 8.297   0.919   -1.193  1.00 0.29 ? 50 CYS A SG   6  
ATOM 11683 H H    . CYS A 1 50 ? 9.708   1.085   -3.335  1.00 0.29 ? 50 CYS A H    6  
ATOM 11684 H HA   . CYS A 1 50 ? 9.306   3.592   -2.097  1.00 0.29 ? 50 CYS A HA   6  
ATOM 11685 H HB2  . CYS A 1 50 ? 10.642  1.207   -0.789  1.00 0.29 ? 50 CYS A HB2  6  
ATOM 11686 H HB3  . CYS A 1 50 ? 9.688   2.465   -0.003  1.00 0.29 ? 50 CYS A HB3  6  
ATOM 11687 N N    . ALA A 1 51 ? 11.517  4.664   -1.541  1.00 0.23 ? 51 ALA A N    6  
ATOM 11688 C CA   . ALA A 1 51 ? 12.843  5.326   -1.399  1.00 0.23 ? 51 ALA A CA   6  
ATOM 11689 C C    . ALA A 1 51 ? 12.807  6.287   -0.208  1.00 0.23 ? 51 ALA A C    6  
ATOM 11690 O O    . ALA A 1 51 ? 11.829  6.969   0.022   1.00 0.23 ? 51 ALA A O    6  
ATOM 11691 C CB   . ALA A 1 51 ? 13.162  6.108   -2.675  1.00 0.23 ? 51 ALA A CB   6  
ATOM 11692 H H    . ALA A 1 51 ? 10.698  5.152   -1.314  1.00 0.23 ? 51 ALA A H    6  
ATOM 11693 H HA   . ALA A 1 51 ? 13.604  4.578   -1.235  1.00 0.23 ? 51 ALA A HA   6  
ATOM 11694 H HB1  . ALA A 1 51 ? 13.096  5.449   -3.527  1.00 0.23 ? 51 ALA A HB1  6  
ATOM 11695 H HB2  . ALA A 1 51 ? 12.455  6.916   -2.788  1.00 0.23 ? 51 ALA A HB2  6  
ATOM 11696 H HB3  . ALA A 1 51 ? 14.161  6.512   -2.609  1.00 0.23 ? 51 ALA A HB3  6  
ATOM 11697 N N    . ASN A 1 52 ? 13.867  6.344   0.552   1.00 0.26 ? 52 ASN A N    6  
ATOM 11698 C CA   . ASN A 1 52 ? 13.890  7.260   1.727   1.00 0.26 ? 52 ASN A CA   6  
ATOM 11699 C C    . ASN A 1 52 ? 14.486  8.609   1.309   1.00 0.26 ? 52 ASN A C    6  
ATOM 11700 O O    . ASN A 1 52 ? 15.361  8.663   0.468   1.00 0.26 ? 52 ASN A O    6  
ATOM 11701 C CB   . ASN A 1 52 ? 14.747  6.645   2.835   1.00 0.26 ? 52 ASN A CB   6  
ATOM 11702 C CG   . ASN A 1 52 ? 14.091  6.902   4.193   1.00 0.26 ? 52 ASN A CG   6  
ATOM 11703 O OD1  . ASN A 1 52 ? 12.883  6.851   4.316   1.00 0.26 ? 52 ASN A OD1  6  
ATOM 11704 N ND2  . ASN A 1 52 ? 14.840  7.178   5.225   1.00 0.26 ? 52 ASN A ND2  6  
ATOM 11705 H H    . ASN A 1 52 ? 14.646  5.786   0.351   1.00 0.26 ? 52 ASN A H    6  
ATOM 11706 H HA   . ASN A 1 52 ? 12.884  7.406   2.090   1.00 0.26 ? 52 ASN A HA   6  
ATOM 11707 H HB2  . ASN A 1 52 ? 14.835  5.581   2.673   1.00 0.26 ? 52 ASN A HB2  6  
ATOM 11708 H HB3  . ASN A 1 52 ? 15.730  7.094   2.823   1.00 0.26 ? 52 ASN A HB3  6  
ATOM 11709 H HD21 . ASN A 1 52 ? 15.814  7.220   5.126   1.00 0.26 ? 52 ASN A HD21 6  
ATOM 11710 H HD22 . ASN A 1 52 ? 14.428  7.345   6.099   1.00 0.26 ? 52 ASN A HD22 6  
ATOM 11711 N N    . PRO A 1 53 ? 13.989  9.660   1.913   1.00 0.30 ? 53 PRO A N    6  
ATOM 11712 C CA   . PRO A 1 53 ? 14.450  11.031  1.627   1.00 0.30 ? 53 PRO A CA   6  
ATOM 11713 C C    . PRO A 1 53 ? 15.783  11.303  2.331   1.00 0.30 ? 53 PRO A C    6  
ATOM 11714 O O    . PRO A 1 53 ? 16.298  12.403  2.300   1.00 0.30 ? 53 PRO A O    6  
ATOM 11715 C CB   . PRO A 1 53 ? 13.337  11.909  2.203   1.00 0.30 ? 53 PRO A CB   6  
ATOM 11716 C CG   . PRO A 1 53 ? 12.606  11.051  3.263   1.00 0.30 ? 53 PRO A CG   6  
ATOM 11717 C CD   . PRO A 1 53 ? 12.925  9.581   2.934   1.00 0.30 ? 53 PRO A CD   6  
ATOM 11718 H HA   . PRO A 1 53 ? 14.537  11.192  0.565   1.00 0.30 ? 53 PRO A HA   6  
ATOM 11719 H HB2  . PRO A 1 53 ? 13.764  12.791  2.663   1.00 0.30 ? 53 PRO A HB2  6  
ATOM 11720 H HB3  . PRO A 1 53 ? 12.646  12.193  1.425   1.00 0.30 ? 53 PRO A HB3  6  
ATOM 11721 H HG2  . PRO A 1 53 ? 12.967  11.299  4.252   1.00 0.30 ? 53 PRO A HG2  6  
ATOM 11722 H HG3  . PRO A 1 53 ? 11.542  11.215  3.202   1.00 0.30 ? 53 PRO A HG3  6  
ATOM 11723 H HD2  . PRO A 1 53 ? 13.280  9.066   3.817   1.00 0.30 ? 53 PRO A HD2  6  
ATOM 11724 H HD3  . PRO A 1 53 ? 12.056  9.086   2.529   1.00 0.30 ? 53 PRO A HD3  6  
ATOM 11725 N N    . GLU A 1 54 ? 16.343  10.310  2.966   1.00 0.43 ? 54 GLU A N    6  
ATOM 11726 C CA   . GLU A 1 54 ? 17.641  10.514  3.671   1.00 0.43 ? 54 GLU A CA   6  
ATOM 11727 C C    . GLU A 1 54 ? 18.761  9.837   2.879   1.00 0.43 ? 54 GLU A C    6  
ATOM 11728 O O    . GLU A 1 54 ? 19.641  9.214   3.439   1.00 0.43 ? 54 GLU A O    6  
ATOM 11729 C CB   . GLU A 1 54 ? 17.562  9.899   5.070   1.00 0.43 ? 54 GLU A CB   6  
ATOM 11730 C CG   . GLU A 1 54 ? 16.288  10.378  5.768   1.00 0.43 ? 54 GLU A CG   6  
ATOM 11731 C CD   . GLU A 1 54 ? 16.284  9.889   7.218   1.00 0.43 ? 54 GLU A CD   6  
ATOM 11732 O OE1  . GLU A 1 54 ? 17.324  9.442   7.674   1.00 0.43 ? 54 GLU A OE1  6  
ATOM 11733 O OE2  . GLU A 1 54 ? 15.242  9.969   7.846   1.00 0.43 ? 54 GLU A OE2  6  
ATOM 11734 H H    . GLU A 1 54 ? 15.910  9.431   2.980   1.00 0.43 ? 54 GLU A H    6  
ATOM 11735 H HA   . GLU A 1 54 ? 17.845  11.571  3.752   1.00 0.43 ? 54 GLU A HA   6  
ATOM 11736 H HB2  . GLU A 1 54 ? 17.547  8.822   4.990   1.00 0.43 ? 54 GLU A HB2  6  
ATOM 11737 H HB3  . GLU A 1 54 ? 18.422  10.206  5.646   1.00 0.43 ? 54 GLU A HB3  6  
ATOM 11738 H HG2  . GLU A 1 54 ? 16.252  11.458  5.751   1.00 0.43 ? 54 GLU A HG2  6  
ATOM 11739 H HG3  . GLU A 1 54 ? 15.425  9.982   5.254   1.00 0.43 ? 54 GLU A HG3  6  
ATOM 11740 N N    . LYS A 1 55 ? 18.737  9.956   1.579   1.00 0.47 ? 55 LYS A N    6  
ATOM 11741 C CA   . LYS A 1 55 ? 19.800  9.319   0.753   1.00 0.47 ? 55 LYS A CA   6  
ATOM 11742 C C    . LYS A 1 55 ? 20.620  10.404  0.053   1.00 0.47 ? 55 LYS A C    6  
ATOM 11743 O O    . LYS A 1 55 ? 20.437  11.583  0.286   1.00 0.47 ? 55 LYS A O    6  
ATOM 11744 C CB   . LYS A 1 55 ? 19.156  8.411   -0.296  1.00 0.47 ? 55 LYS A CB   6  
ATOM 11745 C CG   . LYS A 1 55 ? 19.046  6.989   0.256   1.00 0.47 ? 55 LYS A CG   6  
ATOM 11746 C CD   . LYS A 1 55 ? 20.392  6.278   0.107   1.00 0.47 ? 55 LYS A CD   6  
ATOM 11747 C CE   . LYS A 1 55 ? 20.308  4.887   0.737   1.00 0.47 ? 55 LYS A CE   6  
ATOM 11748 N NZ   . LYS A 1 55 ? 21.174  4.837   1.950   1.00 0.47 ? 55 LYS A NZ   6  
ATOM 11749 H H    . LYS A 1 55 ? 18.018  10.462  1.148   1.00 0.47 ? 55 LYS A H    6  
ATOM 11750 H HA   . LYS A 1 55 ? 20.448  8.732   1.387   1.00 0.47 ? 55 LYS A HA   6  
ATOM 11751 H HB2  . LYS A 1 55 ? 18.170  8.783   -0.535  1.00 0.47 ? 55 LYS A HB2  6  
ATOM 11752 H HB3  . LYS A 1 55 ? 19.764  8.403   -1.188  1.00 0.47 ? 55 LYS A HB3  6  
ATOM 11753 H HG2  . LYS A 1 55 ? 18.773  7.029   1.301   1.00 0.47 ? 55 LYS A HG2  6  
ATOM 11754 H HG3  . LYS A 1 55 ? 18.292  6.446   -0.293  1.00 0.47 ? 55 LYS A HG3  6  
ATOM 11755 H HD2  . LYS A 1 55 ? 20.636  6.185   -0.942  1.00 0.47 ? 55 LYS A HD2  6  
ATOM 11756 H HD3  . LYS A 1 55 ? 21.160  6.851   0.606   1.00 0.47 ? 55 LYS A HD3  6  
ATOM 11757 H HE2  . LYS A 1 55 ? 19.285  4.680   1.017   1.00 0.47 ? 55 LYS A HE2  6  
ATOM 11758 H HE3  . LYS A 1 55 ? 20.643  4.147   0.025   1.00 0.47 ? 55 LYS A HE3  6  
ATOM 11759 H HZ1  . LYS A 1 55 ? 21.867  5.611   1.913   1.00 0.47 ? 55 LYS A HZ1  6  
ATOM 11760 H HZ2  . LYS A 1 55 ? 20.586  4.942   2.800   1.00 0.47 ? 55 LYS A HZ2  6  
ATOM 11761 H HZ3  . LYS A 1 55 ? 21.672  3.924   1.982   1.00 0.47 ? 55 LYS A HZ3  6  
ATOM 11762 N N    . LYS A 1 56 ? 21.525  10.017  -0.805  1.00 0.58 ? 56 LYS A N    6  
ATOM 11763 C CA   . LYS A 1 56 ? 22.356  11.026  -1.519  1.00 0.58 ? 56 LYS A CA   6  
ATOM 11764 C C    . LYS A 1 56 ? 21.845  11.184  -2.953  1.00 0.58 ? 56 LYS A C    6  
ATOM 11765 O O    . LYS A 1 56 ? 22.239  12.085  -3.667  1.00 0.58 ? 56 LYS A O    6  
ATOM 11766 C CB   . LYS A 1 56 ? 23.813  10.562  -1.544  1.00 0.58 ? 56 LYS A CB   6  
ATOM 11767 C CG   . LYS A 1 56 ? 23.884  9.129   -2.076  1.00 0.58 ? 56 LYS A CG   6  
ATOM 11768 C CD   . LYS A 1 56 ? 25.347  8.710   -2.227  1.00 0.58 ? 56 LYS A CD   6  
ATOM 11769 C CE   . LYS A 1 56 ? 25.427  7.408   -3.025  1.00 0.58 ? 56 LYS A CE   6  
ATOM 11770 N NZ   . LYS A 1 56 ? 25.433  7.717   -4.482  1.00 0.58 ? 56 LYS A NZ   6  
ATOM 11771 H H    . LYS A 1 56 ? 21.657  9.061   -0.979  1.00 0.58 ? 56 LYS A H    6  
ATOM 11772 H HA   . LYS A 1 56 ? 22.289  11.975  -1.007  1.00 0.58 ? 56 LYS A HA   6  
ATOM 11773 H HB2  . LYS A 1 56 ? 24.388  11.213  -2.187  1.00 0.58 ? 56 LYS A HB2  6  
ATOM 11774 H HB3  . LYS A 1 56 ? 24.219  10.593  -0.544  1.00 0.58 ? 56 LYS A HB3  6  
ATOM 11775 H HG2  . LYS A 1 56 ? 23.388  8.464   -1.383  1.00 0.58 ? 56 LYS A HG2  6  
ATOM 11776 H HG3  . LYS A 1 56 ? 23.396  9.076   -3.037  1.00 0.58 ? 56 LYS A HG3  6  
ATOM 11777 H HD2  . LYS A 1 56 ? 25.891  9.486   -2.747  1.00 0.58 ? 56 LYS A HD2  6  
ATOM 11778 H HD3  . LYS A 1 56 ? 25.782  8.559   -1.250  1.00 0.58 ? 56 LYS A HD3  6  
ATOM 11779 H HE2  . LYS A 1 56 ? 26.334  6.881   -2.765  1.00 0.58 ? 56 LYS A HE2  6  
ATOM 11780 H HE3  . LYS A 1 56 ? 24.572  6.790   -2.791  1.00 0.58 ? 56 LYS A HE3  6  
ATOM 11781 H HZ1  . LYS A 1 56 ? 26.021  8.556   -4.657  1.00 0.58 ? 56 LYS A HZ1  6  
ATOM 11782 H HZ2  . LYS A 1 56 ? 25.821  6.909   -5.007  1.00 0.58 ? 56 LYS A HZ2  6  
ATOM 11783 H HZ3  . LYS A 1 56 ? 24.459  7.903   -4.801  1.00 0.58 ? 56 LYS A HZ3  6  
ATOM 11784 N N    . TRP A 1 57 ? 20.973  10.313  -3.381  1.00 0.41 ? 57 TRP A N    6  
ATOM 11785 C CA   . TRP A 1 57 ? 20.438  10.413  -4.768  1.00 0.41 ? 57 TRP A CA   6  
ATOM 11786 C C    . TRP A 1 57 ? 18.914  10.545  -4.719  1.00 0.41 ? 57 TRP A C    6  
ATOM 11787 O O    . TRP A 1 57 ? 18.304  11.121  -5.597  1.00 0.41 ? 57 TRP A O    6  
ATOM 11788 C CB   . TRP A 1 57 ? 20.818  9.155   -5.552  1.00 0.41 ? 57 TRP A CB   6  
ATOM 11789 C CG   . TRP A 1 57 ? 20.174  7.963   -4.923  1.00 0.41 ? 57 TRP A CG   6  
ATOM 11790 C CD1  . TRP A 1 57 ? 20.759  7.155   -4.009  1.00 0.41 ? 57 TRP A CD1  6  
ATOM 11791 C CD2  . TRP A 1 57 ? 18.836  7.431   -5.144  1.00 0.41 ? 57 TRP A CD2  6  
ATOM 11792 N NE1  . TRP A 1 57 ? 19.864  6.160   -3.655  1.00 0.41 ? 57 TRP A NE1  6  
ATOM 11793 C CE2  . TRP A 1 57 ? 18.666  6.287   -4.328  1.00 0.41 ? 57 TRP A CE2  6  
ATOM 11794 C CE3  . TRP A 1 57 ? 17.764  7.825   -5.965  1.00 0.41 ? 57 TRP A CE3  6  
ATOM 11795 C CZ2  . TRP A 1 57 ? 17.474  5.561   -4.327  1.00 0.41 ? 57 TRP A CZ2  6  
ATOM 11796 C CZ3  . TRP A 1 57 ? 16.565  7.097   -5.966  1.00 0.41 ? 57 TRP A CZ3  6  
ATOM 11797 C CH2  . TRP A 1 57 ? 16.420  5.967   -5.149  1.00 0.41 ? 57 TRP A CH2  6  
ATOM 11798 H H    . TRP A 1 57 ? 20.668  9.593   -2.789  1.00 0.41 ? 57 TRP A H    6  
ATOM 11799 H HA   . TRP A 1 57 ? 20.858  11.281  -5.254  1.00 0.41 ? 57 TRP A HA   6  
ATOM 11800 H HB2  . TRP A 1 57 ? 20.480  9.251   -6.573  1.00 0.41 ? 57 TRP A HB2  6  
ATOM 11801 H HB3  . TRP A 1 57 ? 21.891  9.034   -5.538  1.00 0.41 ? 57 TRP A HB3  6  
ATOM 11802 H HD1  . TRP A 1 57 ? 21.760  7.268   -3.620  1.00 0.41 ? 57 TRP A HD1  6  
ATOM 11803 H HE1  . TRP A 1 57 ? 20.041  5.445   -3.009  1.00 0.41 ? 57 TRP A HE1  6  
ATOM 11804 H HE3  . TRP A 1 57 ? 17.866  8.694   -6.599  1.00 0.41 ? 57 TRP A HE3  6  
ATOM 11805 H HZ2  . TRP A 1 57 ? 17.368  4.692   -3.696  1.00 0.41 ? 57 TRP A HZ2  6  
ATOM 11806 H HZ3  . TRP A 1 57 ? 15.748  7.409   -6.601  1.00 0.41 ? 57 TRP A HZ3  6  
ATOM 11807 H HH2  . TRP A 1 57 ? 15.494  5.411   -5.156  1.00 0.41 ? 57 TRP A HH2  6  
ATOM 11808 N N    . VAL A 1 58 ? 18.293  10.018  -3.700  1.00 0.32 ? 58 VAL A N    6  
ATOM 11809 C CA   . VAL A 1 58 ? 16.809  10.122  -3.601  1.00 0.32 ? 58 VAL A CA   6  
ATOM 11810 C C    . VAL A 1 58 ? 16.407  11.596  -3.677  1.00 0.32 ? 58 VAL A C    6  
ATOM 11811 O O    . VAL A 1 58 ? 15.699  12.012  -4.576  1.00 0.32 ? 58 VAL A O    6  
ATOM 11812 C CB   . VAL A 1 58 ? 16.342  9.530   -2.270  1.00 0.32 ? 58 VAL A CB   6  
ATOM 11813 C CG1  . VAL A 1 58 ? 14.824  9.677   -2.150  1.00 0.32 ? 58 VAL A CG1  6  
ATOM 11814 C CG2  . VAL A 1 58 ? 16.714  8.046   -2.214  1.00 0.32 ? 58 VAL A CG2  6  
ATOM 11815 H H    . VAL A 1 58 ? 18.801  9.558   -2.999  1.00 0.32 ? 58 VAL A H    6  
ATOM 11816 H HA   . VAL A 1 58 ? 16.354  9.581   -4.417  1.00 0.32 ? 58 VAL A HA   6  
ATOM 11817 H HB   . VAL A 1 58 ? 16.820  10.054  -1.455  1.00 0.32 ? 58 VAL A HB   6  
ATOM 11818 H HG11 . VAL A 1 58 ? 14.465  10.343  -2.920  1.00 0.32 ? 58 VAL A HG11 6  
ATOM 11819 H HG12 . VAL A 1 58 ? 14.359  8.708   -2.267  1.00 0.32 ? 58 VAL A HG12 6  
ATOM 11820 H HG13 . VAL A 1 58 ? 14.577  10.081  -1.180  1.00 0.32 ? 58 VAL A HG13 6  
ATOM 11821 H HG21 . VAL A 1 58 ? 17.774  7.935   -2.391  1.00 0.32 ? 58 VAL A HG21 6  
ATOM 11822 H HG22 . VAL A 1 58 ? 16.468  7.650   -1.240  1.00 0.32 ? 58 VAL A HG22 6  
ATOM 11823 H HG23 . VAL A 1 58 ? 16.164  7.509   -2.972  1.00 0.32 ? 58 VAL A HG23 6  
ATOM 11824 N N    . ARG A 1 59 ? 16.860  12.392  -2.747  1.00 0.34 ? 59 ARG A N    6  
ATOM 11825 C CA   . ARG A 1 59 ? 16.512  13.839  -2.776  1.00 0.34 ? 59 ARG A CA   6  
ATOM 11826 C C    . ARG A 1 59 ? 16.964  14.428  -4.112  1.00 0.34 ? 59 ARG A C    6  
ATOM 11827 O O    . ARG A 1 59 ? 16.393  15.377  -4.611  1.00 0.34 ? 59 ARG A O    6  
ATOM 11828 C CB   . ARG A 1 59 ? 17.222  14.561  -1.629  1.00 0.34 ? 59 ARG A CB   6  
ATOM 11829 C CG   . ARG A 1 59 ? 16.725  16.005  -1.549  1.00 0.34 ? 59 ARG A CG   6  
ATOM 11830 C CD   . ARG A 1 59 ? 17.921  16.958  -1.551  1.00 0.34 ? 59 ARG A CD   6  
ATOM 11831 N NE   . ARG A 1 59 ? 18.016  17.634  -2.876  1.00 0.34 ? 59 ARG A NE   6  
ATOM 11832 C CZ   . ARG A 1 59 ? 18.033  18.937  -2.943  1.00 0.34 ? 59 ARG A CZ   6  
ATOM 11833 N NH1  . ARG A 1 59 ? 17.029  19.628  -2.475  1.00 0.34 ? 59 ARG A NH1  6  
ATOM 11834 N NH2  . ARG A 1 59 ? 19.052  19.550  -3.480  1.00 0.34 ? 59 ARG A NH2  6  
ATOM 11835 H H    . ARG A 1 59 ? 17.435  12.039  -2.036  1.00 0.34 ? 59 ARG A H    6  
ATOM 11836 H HA   . ARG A 1 59 ? 15.443  13.956  -2.673  1.00 0.34 ? 59 ARG A HA   6  
ATOM 11837 H HB2  . ARG A 1 59 ? 17.010  14.054  -0.699  1.00 0.34 ? 59 ARG A HB2  6  
ATOM 11838 H HB3  . ARG A 1 59 ? 18.287  14.558  -1.807  1.00 0.34 ? 59 ARG A HB3  6  
ATOM 11839 H HG2  . ARG A 1 59 ? 16.095  16.216  -2.402  1.00 0.34 ? 59 ARG A HG2  6  
ATOM 11840 H HG3  . ARG A 1 59 ? 16.160  16.142  -0.640  1.00 0.34 ? 59 ARG A HG3  6  
ATOM 11841 H HD2  . ARG A 1 59 ? 17.792  17.701  -0.777  1.00 0.34 ? 59 ARG A HD2  6  
ATOM 11842 H HD3  . ARG A 1 59 ? 18.827  16.400  -1.366  1.00 0.34 ? 59 ARG A HD3  6  
ATOM 11843 H HE   . ARG A 1 59 ? 18.067  17.101  -3.696  1.00 0.34 ? 59 ARG A HE   6  
ATOM 11844 H HH11 . ARG A 1 59 ? 16.248  19.159  -2.064  1.00 0.34 ? 59 ARG A HH11 6  
ATOM 11845 H HH12 . ARG A 1 59 ? 17.042  20.626  -2.527  1.00 0.34 ? 59 ARG A HH12 6  
ATOM 11846 H HH21 . ARG A 1 59 ? 19.821  19.022  -3.840  1.00 0.34 ? 59 ARG A HH21 6  
ATOM 11847 H HH22 . ARG A 1 59 ? 19.0