data_1RUO
# 
_entry.id   1RUO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RUO         pdb_00001ruo 10.2210/pdb1ruo/pdb 
RCSB  PDR025       ?            ?                   
WWPDB D_1000176236 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RUO 
_pdbx_database_status.recvd_initial_deposition_date   1996-05-26 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Parkinson, G.N.' 1 
'Ebright, R.H.'   2 
'Berman, H.M.'    3 
# 
_citation.id                        primary 
_citation.title                     'Aromatic hydrogen bond in sequence-specific protein DNA recognition.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            3 
_citation.page_first                837 
_citation.page_last                 841 
_citation.year                      1996 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8836098 
_citation.pdbx_database_id_DOI      10.1038/nsb1096-837 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Parkinson, G.'    1 ? 
primary 'Gunasekera, A.'   2 ? 
primary 'Vojtechovsky, J.' 3 ? 
primary 'Zhang, X.'        4 ? 
primary 'Kunkel, T.A.'     5 ? 
primary 'Berman, H.'       6 ? 
primary 'Ebright, R.H.'    7 ? 
# 
_cell.entry_id           1RUO 
_cell.length_a           137.290 
_cell.length_b           153.100 
_cell.length_c           76.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RUO 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3')
;
4352.867  2  ? ?                   ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*TP*AP*GP*AP*TP*CP*AP*CP*AP*TP*TP*TP*TP*TP*CP*G )-3')
;
5152.358  2  ? ?                   ? ? 
3 polymer     man 'PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP))'                  23559.303 2  ? 'CHAIN A, B, E181F' ? ? 
4 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                               329.206   2  ? ?                   ? ? 
5 water       nat water                                                                18.015    35 ? ?                   ? ? 
# 
_entity_keywords.entity_id   3 
_entity_keywords.text        'MUTANT CHAIN A, B, E181F' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DA)(DA)(DA)(DA)(DT)(DG)(DT)(DG)(DA)(DT)' GCGAAAAATGTGAT C,E ? 
2 polydeoxyribonucleotide no no '(DC)(DT)(DA)(DG)(DA)(DT)(DC)(DA)(DC)(DA)(DT)(DT)(DT)(DT)(DT)(DC)(DG)' CTAGATCACATTTTTCG D,F ? 
3 'polypeptide(L)'        no no 
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVVYGTR
;
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVVYGTR
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DA  n 
1 6   DA  n 
1 7   DA  n 
1 8   DA  n 
1 9   DT  n 
1 10  DG  n 
1 11  DT  n 
1 12  DG  n 
1 13  DA  n 
1 14  DT  n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
3 1   VAL n 
3 2   LEU n 
3 3   GLY n 
3 4   LYS n 
3 5   PRO n 
3 6   GLN n 
3 7   THR n 
3 8   ASP n 
3 9   PRO n 
3 10  THR n 
3 11  LEU n 
3 12  GLU n 
3 13  TRP n 
3 14  PHE n 
3 15  LEU n 
3 16  SER n 
3 17  HIS n 
3 18  CYS n 
3 19  HIS n 
3 20  ILE n 
3 21  HIS n 
3 22  LYS n 
3 23  TYR n 
3 24  PRO n 
3 25  SER n 
3 26  LYS n 
3 27  SER n 
3 28  THR n 
3 29  LEU n 
3 30  ILE n 
3 31  HIS n 
3 32  GLN n 
3 33  GLY n 
3 34  GLU n 
3 35  LYS n 
3 36  ALA n 
3 37  GLU n 
3 38  THR n 
3 39  LEU n 
3 40  TYR n 
3 41  TYR n 
3 42  ILE n 
3 43  VAL n 
3 44  LYS n 
3 45  GLY n 
3 46  SER n 
3 47  VAL n 
3 48  ALA n 
3 49  VAL n 
3 50  LEU n 
3 51  ILE n 
3 52  LYS n 
3 53  ASP n 
3 54  GLU n 
3 55  GLU n 
3 56  GLY n 
3 57  LYS n 
3 58  GLU n 
3 59  MET n 
3 60  ILE n 
3 61  LEU n 
3 62  SER n 
3 63  TYR n 
3 64  LEU n 
3 65  ASN n 
3 66  GLN n 
3 67  GLY n 
3 68  ASP n 
3 69  PHE n 
3 70  ILE n 
3 71  GLY n 
3 72  GLU n 
3 73  LEU n 
3 74  GLY n 
3 75  LEU n 
3 76  PHE n 
3 77  GLU n 
3 78  GLU n 
3 79  GLY n 
3 80  GLN n 
3 81  GLU n 
3 82  ARG n 
3 83  SER n 
3 84  ALA n 
3 85  TRP n 
3 86  VAL n 
3 87  ARG n 
3 88  ALA n 
3 89  LYS n 
3 90  THR n 
3 91  ALA n 
3 92  CYS n 
3 93  GLU n 
3 94  VAL n 
3 95  ALA n 
3 96  GLU n 
3 97  ILE n 
3 98  SER n 
3 99  TYR n 
3 100 LYS n 
3 101 LYS n 
3 102 PHE n 
3 103 ARG n 
3 104 GLN n 
3 105 LEU n 
3 106 ILE n 
3 107 GLN n 
3 108 VAL n 
3 109 ASN n 
3 110 PRO n 
3 111 ASP n 
3 112 ILE n 
3 113 LEU n 
3 114 MET n 
3 115 ARG n 
3 116 LEU n 
3 117 SER n 
3 118 ALA n 
3 119 GLN n 
3 120 MET n 
3 121 ALA n 
3 122 ARG n 
3 123 ARG n 
3 124 LEU n 
3 125 GLN n 
3 126 VAL n 
3 127 THR n 
3 128 SER n 
3 129 GLU n 
3 130 LYS n 
3 131 VAL n 
3 132 GLY n 
3 133 ASN n 
3 134 LEU n 
3 135 ALA n 
3 136 PHE n 
3 137 LEU n 
3 138 ASP n 
3 139 VAL n 
3 140 THR n 
3 141 GLY n 
3 142 ARG n 
3 143 ILE n 
3 144 ALA n 
3 145 GLN n 
3 146 THR n 
3 147 LEU n 
3 148 LEU n 
3 149 ASN n 
3 150 LEU n 
3 151 ALA n 
3 152 LYS n 
3 153 GLN n 
3 154 PRO n 
3 155 ASP n 
3 156 ALA n 
3 157 MET n 
3 158 THR n 
3 159 HIS n 
3 160 PRO n 
3 161 ASP n 
3 162 GLY n 
3 163 MET n 
3 164 GLN n 
3 165 ILE n 
3 166 LYS n 
3 167 ILE n 
3 168 THR n 
3 169 ARG n 
3 170 GLN n 
3 171 GLU n 
3 172 ILE n 
3 173 GLY n 
3 174 GLN n 
3 175 ILE n 
3 176 VAL n 
3 177 GLY n 
3 178 CYS n 
3 179 SER n 
3 180 ARG n 
3 181 PHE n 
3 182 THR n 
3 183 VAL n 
3 184 GLY n 
3 185 ARG n 
3 186 ILE n 
3 187 LEU n 
3 188 LYS n 
3 189 MET n 
3 190 LEU n 
3 191 GLU n 
3 192 ASP n 
3 193 GLN n 
3 194 ASN n 
3 195 LEU n 
3 196 ILE n 
3 197 SER n 
3 198 ALA n 
3 199 HIS n 
3 200 GLY n 
3 201 LYS n 
3 202 THR n 
3 203 ILE n 
3 204 VAL n 
3 205 VAL n 
3 206 TYR n 
3 207 GLY n 
3 208 THR n 
3 209 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP CRP_ECOLI 3 P0ACJ8 ? ? ? 
2 PDB 1RUO      1 1RUO   ? ? ? 
3 PDB 1RUO      2 1RUO   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RUO A 1 ? 209 ? P0ACJ8 2  ? 210 ? 1  209 
2 1 1RUO B 1 ? 209 ? P0ACJ8 2  ? 210 ? 1  209 
3 2 1RUO C 1 ? 14  ? 1RUO   -5 ? 9   ? -5 9   
4 3 1RUO D 1 ? 17  ? 1RUO   10 ? 26  ? 10 26  
5 2 1RUO E 1 ? 14  ? 1RUO   27 ? 14  ? 27 14  
6 3 1RUO F 1 ? 17  ? 1RUO   13 ? -4  ? 13 -4  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RUO PHE A 181 ? UNP P0ACJ8 GLU 182 'engineered mutation' 181 1 
2 1RUO PHE B 181 ? UNP P0ACJ8 GLU 182 'engineered mutation' 181 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RUO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.50 
_exptl_crystal.density_percent_sol   58.95 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    'pH 6.50' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           258.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1993-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RUO 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   18147 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         83.700 
_reflns.pdbx_Rmerge_I_obs            0.1062 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.600 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1RUO 
_refine.ls_number_reflns_obs                     17328 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          4.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.000 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    78.900 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3171 
_refine_hist.pdbx_number_atoms_nucleic_acid   1262 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               4512 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        10.000 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO DNA-RNA-MULTI-ENDO.PARAM 'X-RAY DIFFRACTION' 
2 TOPHCSDX.PRO DNA-RNA-MULTI-ENDO.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RUO 
_struct.title                     
;CATABOLITE GENE ACTIVATOR PROTEIN (CAP) MUTANT/DNA COMPLEX + ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RUO 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;GENE-REGULATORY PROTEIN-DNA COMPLEX, COMPLEX (GENE-REGULATORY PROTEIN-DNA), TRANSCRIPTION REGULATION, DNA-BINDING, CAMP-BINDING, ACTIVATOR, TRANSCRIPTION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO E 9   ? CYS E 18  ? PRO A 9   CYS A 18  1 ? 10 
HELX_P HELX_P2  2  TYR E 99  ? VAL E 108 ? TYR A 99  VAL A 108 1 ? 10 
HELX_P HELX_P3  3  PRO E 110 ? PHE E 136 ? PRO A 110 PHE A 136 1 ? 27 
HELX_P HELX_P4  4  ASP E 138 ? ALA E 151 ? ASP A 138 ALA A 151 1 ? 14 
HELX_P HELX_P5  5  THR E 168 ? GLY E 177 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P6  6  SER E 179 ? GLN E 193 ? SER A 179 GLN A 193 1 ? 15 
HELX_P HELX_P7  7  GLU F 12  ? HIS F 17  ? GLU B 12  HIS B 17  1 ? 6  
HELX_P HELX_P8  8  TYR F 99  ? ASN F 109 ? TYR B 99  ASN B 109 1 ? 11 
HELX_P HELX_P9  9  PRO F 110 ? PHE F 136 ? PRO B 110 PHE B 136 1 ? 27 
HELX_P HELX_P10 10 ASP F 138 ? LEU F 150 ? ASP B 138 LEU B 150 1 ? 13 
HELX_P HELX_P11 11 THR F 168 ? GLY F 177 ? THR B 168 GLY B 177 1 ? 10 
HELX_P HELX_P12 12 SER F 179 ? GLN F 193 ? SER B 179 GLN B 193 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DC 2  N3 ? ? ? 1_555 D DG 17 N1 ? ? C DC -4 F DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog2  hydrog ? ? A DC 2  N4 ? ? ? 1_555 D DG 17 O6 ? ? C DC -4 F DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog3  hydrog ? ? A DC 2  O2 ? ? ? 1_555 D DG 17 N2 ? ? C DC -4 F DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 D DC 16 N3 ? ? C DG -3 F DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 D DC 16 O2 ? ? C DG -3 F DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 D DC 16 N4 ? ? C DG -3 F DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 D DT 15 N3 ? ? C DA -2 F DT -2 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? ? 
hydrog8  hydrog ? ? A DA 5  N1 ? ? ? 1_555 D DT 14 N3 ? ? C DA -1 F DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog9  hydrog ? ? A DA 5  N6 ? ? ? 1_555 D DT 14 O4 ? ? C DA -1 F DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog10 hydrog ? ? A DA 5  N1 ? ? ? 1_555 D DT 15 N3 ? ? C DA -1 F DT -2 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? ? 
hydrog11 hydrog ? ? A DA 6  N1 ? ? ? 1_555 D DT 13 N3 ? ? C DA 1  F DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog12 hydrog ? ? A DA 6  N6 ? ? ? 1_555 D DT 13 O4 ? ? C DA 1  F DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog13 hydrog ? ? A DA 7  N1 ? ? ? 1_555 D DT 12 N3 ? ? C DA 2  F DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog14 hydrog ? ? A DA 7  N6 ? ? ? 1_555 D DT 12 O4 ? ? C DA 2  F DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog15 hydrog ? ? A DA 8  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 3  F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog16 hydrog ? ? A DA 8  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 3  F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog17 hydrog ? ? A DT 9  N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 4  F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog18 hydrog ? ? A DT 9  O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 4  F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog19 hydrog ? ? A DG 10 N1 ? ? ? 1_555 D DC 9  N3 ? ? C DG 5  F DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog20 hydrog ? ? A DG 10 N2 ? ? ? 1_555 D DC 9  O2 ? ? C DG 5  F DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog21 hydrog ? ? A DG 10 O6 ? ? ? 1_555 D DC 9  N4 ? ? C DG 5  F DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog22 hydrog ? ? A DT 11 N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT 6  F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog23 hydrog ? ? A DT 11 O4 ? ? ? 1_555 D DA 8  N6 ? ? C DT 6  F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog24 hydrog ? ? A DG 12 N1 ? ? ? 1_555 D DC 7  N3 ? ? C DG 7  F DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog25 hydrog ? ? A DG 12 N2 ? ? ? 1_555 D DC 7  O2 ? ? C DG 7  F DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog26 hydrog ? ? A DG 12 O6 ? ? ? 1_555 D DC 7  N4 ? ? C DG 7  F DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog27 hydrog ? ? A DA 13 N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA 8  F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog28 hydrog ? ? A DA 13 N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA 8  F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog29 hydrog ? ? A DT 14 N3 ? ? ? 1_555 D DA 5  N1 ? ? C DT 9  F DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog30 hydrog ? ? A DT 14 O4 ? ? ? 1_555 D DA 5  N6 ? ? C DT 9  F DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog31 hydrog ? ? B DT 2  N3 ? ? ? 1_555 D DA 3  N1 ? ? D DT 11 F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog32 hydrog ? ? B DT 2  O4 ? ? ? 1_555 D DA 3  N6 ? ? D DT 11 F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog33 hydrog ? ? B DT 2  O2 ? ? ? 1_555 D DG 4  N1 ? ? D DT 11 F DG 10 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? ? 
hydrog34 hydrog ? ? B DA 3  N1 ? ? ? 1_555 D DT 2  N3 ? ? D DA 12 F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog35 hydrog ? ? B DA 3  N6 ? ? ? 1_555 D DT 2  O4 ? ? D DA 12 F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog36 hydrog ? ? B DG 4  N1 ? ? ? 1_555 D DC 1  N3 ? ? D DG 13 F DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog37 hydrog ? ? B DG 4  N2 ? ? ? 1_555 D DC 1  O2 ? ? D DG 13 F DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog38 hydrog ? ? B DG 4  O6 ? ? ? 1_555 D DC 1  N4 ? ? D DG 13 F DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog39 hydrog ? ? B DA 5  N1 ? ? ? 1_555 C DT 14 N3 ? ? D DA 14 E DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog40 hydrog ? ? B DA 5  N6 ? ? ? 1_555 C DT 14 O4 ? ? D DA 14 E DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog41 hydrog ? ? B DT 6  N3 ? ? ? 1_555 C DA 13 N1 ? ? D DT 15 E DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog42 hydrog ? ? B DT 6  O4 ? ? ? 1_555 C DA 13 N6 ? ? D DT 15 E DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog43 hydrog ? ? B DC 7  N3 ? ? ? 1_555 C DG 12 N1 ? ? D DC 16 E DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog44 hydrog ? ? B DC 7  N4 ? ? ? 1_555 C DG 12 O6 ? ? D DC 16 E DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog45 hydrog ? ? B DC 7  O2 ? ? ? 1_555 C DG 12 N2 ? ? D DC 16 E DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog46 hydrog ? ? B DA 8  N1 ? ? ? 1_555 C DT 11 N3 ? ? D DA 17 E DT 17 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? ? 
hydrog47 hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 10 N1 ? ? D DC 18 E DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog48 hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 10 O6 ? ? D DC 18 E DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog49 hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 10 N2 ? ? D DC 18 E DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog50 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 9  N3 ? ? D DA 19 E DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog51 hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 9  O4 ? ? D DA 19 E DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog52 hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DA 7  N6 ? ? D DT 20 E DA 21 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
hydrog53 hydrog ? ? B DT 11 N3 ? ? ? 1_555 C DA 8  N1 ? ? D DT 20 E DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog54 hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DA 8  N6 ? ? D DT 20 E DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog55 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 7  N1 ? ? D DT 21 E DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog56 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 7  N6 ? ? D DT 21 E DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog57 hydrog ? ? B DT 13 O4 ? ? ? 1_555 C DA 6  N6 ? ? D DT 22 E DA 22 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
hydrog58 hydrog ? ? B DT 13 N3 ? ? ? 1_555 C DA 7  N1 ? ? D DT 22 E DA 21 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
hydrog59 hydrog ? ? B DT 14 N3 ? ? ? 1_555 C DA 5  N1 ? ? D DT 23 E DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog60 hydrog ? ? B DT 14 O4 ? ? ? 1_555 C DA 5  N6 ? ? D DT 23 E DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog61 hydrog ? ? B DT 15 N3 ? ? ? 1_555 C DA 4  N1 ? ? D DT 24 E DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog62 hydrog ? ? B DT 15 O4 ? ? ? 1_555 C DA 4  N6 ? ? D DT 24 E DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog63 hydrog ? ? B DT 15 N3 ? ? ? 1_555 C DA 5  N1 ? ? D DT 24 E DA 23 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
hydrog64 hydrog ? ? B DC 16 N3 ? ? ? 1_555 C DG 3  N1 ? ? D DC 25 E DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog65 hydrog ? ? B DC 16 N4 ? ? ? 1_555 C DG 3  O6 ? ? D DC 25 E DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog66 hydrog ? ? B DC 16 O2 ? ? ? 1_555 C DG 3  N2 ? ? D DC 25 E DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog67 hydrog ? ? B DG 17 N1 ? ? ? 1_555 C DC 2  N3 ? ? D DG 26 E DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog68 hydrog ? ? B DG 17 N2 ? ? ? 1_555 C DC 2  O2 ? ? D DG 26 E DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog69 hydrog ? ? B DG 17 O6 ? ? ? 1_555 C DC 2  N4 ? ? D DG 26 E DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 3 ? 
G ? 4 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS E 19  ? ILE E 20  ? HIS A 19  ILE A 20  
A 2 ALA E 95  ? GLU E 96  ? ALA A 95  GLU A 96  
B 1 TYR E 40  ? TYR E 41  ? TYR A 40  TYR A 41  
B 2 PHE E 69  ? ILE E 70  ? PHE A 69  ILE A 70  
C 1 TRP E 85  ? ALA E 88  ? TRP A 85  ALA A 88  
C 2 SER E 46  ? LYS E 52  ? SER A 46  LYS A 52  
C 3 GLU E 58  ? ILE E 60  ? GLU A 58  ILE A 60  
D 1 TRP E 85  ? ALA E 88  ? TRP A 85  ALA A 88  
D 2 SER E 46  ? LYS E 52  ? SER A 46  LYS A 52  
D 3 LEU E 64  ? ASN E 65  ? LEU A 64  ASN A 65  
E 1 MET E 157 ? THR E 158 ? MET A 157 THR A 158 
E 2 MET E 163 ? LYS E 166 ? MET A 163 LYS A 166 
E 3 LYS E 201 ? VAL E 204 ? LYS A 201 VAL A 204 
F 1 HIS F 21  ? TYR F 23  ? HIS B 21  TYR B 23  
F 2 CYS F 92  ? SER F 98  ? CYS B 92  SER B 98  
F 3 THR F 38  ? LYS F 44  ? THR B 38  LYS B 44  
G 1 THR F 28  ? ILE F 30  ? THR B 28  ILE B 30  
G 2 VAL F 86  ? ALA F 88  ? VAL B 86  ALA B 88  
G 3 VAL F 47  ? LYS F 52  ? VAL B 47  LYS B 52  
G 4 GLU F 58  ? LEU F 64  ? GLU B 58  LEU B 64  
H 1 ILE F 165 ? LYS F 166 ? ILE B 165 LYS B 166 
H 2 LYS F 201 ? THR F 202 ? LYS B 201 THR B 202 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS E 19  ? N HIS A 19  O GLU E 96  ? O GLU A 96  
B 1 2 O TYR E 40  ? O TYR A 40  N ILE E 70  ? N ILE A 70  
C 1 2 O ARG E 87  ? O ARG A 87  N ALA E 48  ? N ALA A 48  
C 2 3 N ILE E 51  ? N ILE A 51  O MET E 59  ? O MET A 59  
D 1 2 O ARG E 87  ? O ARG A 87  N ALA E 48  ? N ALA A 48  
D 2 3 N VAL E 47  ? N VAL A 47  O LEU E 64  ? O LEU A 64  
E 1 2 N MET E 157 ? N MET A 157 O GLN E 164 ? O GLN A 164 
E 2 3 N ILE E 165 ? N ILE A 165 O THR E 202 ? O THR A 202 
F 1 2 N TYR F 23  ? N TYR B 23  O CYS F 92  ? O CYS B 92  
F 2 3 O ILE F 97  ? O ILE B 97  N LEU F 39  ? N LEU B 39  
G 1 2 N LEU F 29  ? N LEU B 29  O VAL F 86  ? O VAL B 86  
G 2 3 N ARG F 87  ? N ARG B 87  O ALA F 48  ? O ALA B 48  
G 3 4 O ILE F 51  ? O ILE B 51  N MET F 59  ? N MET B 59  
H 1 2 O ILE F 165 ? O ILE B 165 N THR F 202 ? N THR B 202 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B CMP 210 ? 12 'BINDING SITE FOR RESIDUE CMP B 210' 
AC2 Software A CMP 210 ? 12 'BINDING SITE FOR RESIDUE CMP A 210' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 LEU E 124 ? LEU A 124 . ? 1_555 ? 
2  AC1 12 SER E 128 ? SER A 128 . ? 1_555 ? 
3  AC1 12 VAL F 49  ? VAL B 49  . ? 1_555 ? 
4  AC1 12 LEU F 61  ? LEU B 61  . ? 1_555 ? 
5  AC1 12 SER F 62  ? SER B 62  . ? 1_555 ? 
6  AC1 12 GLY F 71  ? GLY B 71  . ? 1_555 ? 
7  AC1 12 GLU F 72  ? GLU B 72  . ? 1_555 ? 
8  AC1 12 LEU F 73  ? LEU B 73  . ? 1_555 ? 
9  AC1 12 ARG F 82  ? ARG B 82  . ? 1_555 ? 
10 AC1 12 SER F 83  ? SER B 83  . ? 1_555 ? 
11 AC1 12 ALA F 84  ? ALA B 84  . ? 1_555 ? 
12 AC1 12 THR F 127 ? THR B 127 . ? 1_555 ? 
13 AC2 12 VAL E 49  ? VAL A 49  . ? 1_555 ? 
14 AC2 12 SER E 62  ? SER A 62  . ? 1_555 ? 
15 AC2 12 ILE E 70  ? ILE A 70  . ? 1_555 ? 
16 AC2 12 GLY E 71  ? GLY A 71  . ? 1_555 ? 
17 AC2 12 GLU E 72  ? GLU A 72  . ? 1_555 ? 
18 AC2 12 LEU E 73  ? LEU A 73  . ? 1_555 ? 
19 AC2 12 ARG E 82  ? ARG A 82  . ? 1_555 ? 
20 AC2 12 SER E 83  ? SER A 83  . ? 1_555 ? 
21 AC2 12 ALA E 84  ? ALA A 84  . ? 1_555 ? 
22 AC2 12 THR E 127 ? THR A 127 . ? 1_555 ? 
23 AC2 12 LEU F 124 ? LEU B 124 . ? 1_555 ? 
24 AC2 12 SER F 128 ? SER B 128 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RUO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RUO 
_atom_sites.fract_transf_matrix[1][1]   0.007284 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006532 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013123 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? -3.897 61.994 -24.841 1.00 46.74 ? -5  DG  C "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? -5.016 62.932 -24.760 1.00 48.22 ? -5  DG  C "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? -4.695 64.310 -25.301 1.00 38.75 ? -5  DG  C "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? -4.459 65.240 -24.222 1.00 35.42 ? -5  DG  C "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? -3.413 64.316 -26.115 1.00 38.41 ? -5  DG  C "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? -3.497 65.336 -27.093 1.00 40.95 ? -5  DG  C "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? -2.354 64.634 -25.084 1.00 34.22 ? -5  DG  C "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? -3.091 65.629 -24.212 1.00 38.32 ? -5  DG  C "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? -2.631 65.588 -22.836 1.00 39.29 ? -5  DG  C N9    1 
ATOM   10   C C8    . DG  A 1 1   ? -2.125 64.484 -22.203 1.00 41.10 ? -5  DG  C C8    1 
ATOM   11   N N7    . DG  A 1 1   ? -1.781 64.713 -20.965 1.00 43.60 ? -5  DG  C N7    1 
ATOM   12   C C5    . DG  A 1 1   ? -2.077 66.050 -20.769 1.00 43.18 ? -5  DG  C C5    1 
ATOM   13   C C6    . DG  A 1 1   ? -1.912 66.851 -19.624 1.00 41.32 ? -5  DG  C C6    1 
ATOM   14   O O6    . DG  A 1 1   ? -1.447 66.550 -18.523 1.00 39.67 ? -5  DG  C O6    1 
ATOM   15   N N1    . DG  A 1 1   ? -2.347 68.137 -19.847 1.00 47.41 ? -5  DG  C N1    1 
ATOM   16   C C2    . DG  A 1 1   ? -2.827 68.622 -21.038 1.00 45.13 ? -5  DG  C C2    1 
ATOM   17   N N2    . DG  A 1 1   ? -3.124 69.931 -21.050 1.00 43.96 ? -5  DG  C N2    1 
ATOM   18   N N3    . DG  A 1 1   ? -2.993 67.888 -22.122 1.00 42.50 ? -5  DG  C N3    1 
ATOM   19   C C4    . DG  A 1 1   ? -2.612 66.608 -21.912 1.00 43.06 ? -5  DG  C C4    1 
ATOM   20   P P     . DC  A 1 2   ? -2.527 65.286 -28.360 1.00 44.57 ? -4  DC  C P     1 
ATOM   21   O OP1   . DC  A 1 2   ? -3.196 64.398 -29.376 1.00 46.78 ? -4  DC  C OP1   1 
ATOM   22   O OP2   . DC  A 1 2   ? -1.182 64.918 -27.831 1.00 48.03 ? -4  DC  C OP2   1 
ATOM   23   O "O5'" . DC  A 1 2   ? -2.416 66.806 -28.848 1.00 49.24 ? -4  DC  C "O5'" 1 
ATOM   24   C "C5'" . DC  A 1 2   ? -3.038 67.880 -28.078 1.00 48.49 ? -4  DC  C "C5'" 1 
ATOM   25   C "C4'" . DC  A 1 2   ? -2.238 69.160 -28.148 1.00 41.89 ? -4  DC  C "C4'" 1 
ATOM   26   O "O4'" . DC  A 1 2   ? -1.973 69.665 -26.823 1.00 40.32 ? -4  DC  C "O4'" 1 
ATOM   27   C "C3'" . DC  A 1 2   ? -0.894 69.063 -28.831 1.00 42.64 ? -4  DC  C "C3'" 1 
ATOM   28   O "O3'" . DC  A 1 2   ? -0.711 70.302 -29.433 1.00 49.24 ? -4  DC  C "O3'" 1 
ATOM   29   C "C2'" . DC  A 1 2   ? 0.092  68.944 -27.697 1.00 34.63 ? -4  DC  C "C2'" 1 
ATOM   30   C "C1'" . DC  A 1 2   ? -0.578 69.710 -26.573 1.00 38.33 ? -4  DC  C "C1'" 1 
ATOM   31   N N1    . DC  A 1 2   ? -0.310 69.049 -25.281 1.00 42.98 ? -4  DC  C N1    1 
ATOM   32   C C2    . DC  A 1 2   ? -0.280 69.739 -24.121 1.00 39.92 ? -4  DC  C C2    1 
ATOM   33   O O2    . DC  A 1 2   ? -0.533 70.955 -24.153 1.00 56.83 ? -4  DC  C O2    1 
ATOM   34   N N3    . DC  A 1 2   ? 0.022  69.083 -22.960 1.00 29.95 ? -4  DC  C N3    1 
ATOM   35   C C4    . DC  A 1 2   ? 0.261  67.779 -22.954 1.00 25.56 ? -4  DC  C C4    1 
ATOM   36   N N4    . DC  A 1 2   ? 0.546  67.306 -21.739 1.00 16.18 ? -4  DC  C N4    1 
ATOM   37   C C5    . DC  A 1 2   ? 0.191  67.035 -24.149 1.00 35.43 ? -4  DC  C C5    1 
ATOM   38   C C6    . DC  A 1 2   ? -0.082 67.705 -25.273 1.00 38.93 ? -4  DC  C C6    1 
ATOM   39   P P     . DG  A 1 3   ? -0.854 70.440 -31.001 1.00 58.95 ? -3  DG  C P     1 
ATOM   40   O OP1   . DG  A 1 3   ? -1.683 71.651 -31.315 1.00 52.22 ? -3  DG  C OP1   1 
ATOM   41   O OP2   . DG  A 1 3   ? -1.279 69.088 -31.504 1.00 58.31 ? -3  DG  C OP2   1 
ATOM   42   O "O5'" . DG  A 1 3   ? 0.661  70.718 -31.436 1.00 57.56 ? -3  DG  C "O5'" 1 
ATOM   43   C "C5'" . DG  A 1 3   ? 1.116  72.055 -31.686 1.00 53.83 ? -3  DG  C "C5'" 1 
ATOM   44   C "C4'" . DG  A 1 3   ? 2.085  72.513 -30.618 1.00 53.52 ? -3  DG  C "C4'" 1 
ATOM   45   O "O4'" . DG  A 1 3   ? 1.992  71.761 -29.374 1.00 52.36 ? -3  DG  C "O4'" 1 
ATOM   46   C "C3'" . DG  A 1 3   ? 3.557  72.431 -31.048 1.00 54.94 ? -3  DG  C "C3'" 1 
ATOM   47   O "O3'" . DG  A 1 3   ? 4.201  73.660 -30.636 1.00 53.25 ? -3  DG  C "O3'" 1 
ATOM   48   C "C2'" . DG  A 1 3   ? 4.089  71.267 -30.211 1.00 51.88 ? -3  DG  C "C2'" 1 
ATOM   49   C "C1'" . DG  A 1 3   ? 3.336  71.575 -28.924 1.00 50.33 ? -3  DG  C "C1'" 1 
ATOM   50   N N9    . DG  A 1 3   ? 3.350  70.545 -27.886 1.00 43.66 ? -3  DG  C N9    1 
ATOM   51   C C8    . DG  A 1 3   ? 2.957  69.252 -28.053 1.00 34.07 ? -3  DG  C C8    1 
ATOM   52   N N7    . DG  A 1 3   ? 3.067  68.536 -26.970 1.00 40.66 ? -3  DG  C N7    1 
ATOM   53   C C5    . DG  A 1 3   ? 3.575  69.400 -26.007 1.00 42.48 ? -3  DG  C C5    1 
ATOM   54   C C6    . DG  A 1 3   ? 3.912  69.166 -24.591 1.00 45.30 ? -3  DG  C C6    1 
ATOM   55   O O6    . DG  A 1 3   ? 3.816  68.115 -23.932 1.00 44.84 ? -3  DG  C O6    1 
ATOM   56   N N1    . DG  A 1 3   ? 4.401  70.325 -23.964 1.00 45.74 ? -3  DG  C N1    1 
ATOM   57   C C2    . DG  A 1 3   ? 4.549  71.559 -24.601 1.00 41.53 ? -3  DG  C C2    1 
ATOM   58   N N2    . DG  A 1 3   ? 5.049  72.576 -23.832 1.00 24.50 ? -3  DG  C N2    1 
ATOM   59   N N3    . DG  A 1 3   ? 4.233  71.782 -25.907 1.00 44.29 ? -3  DG  C N3    1 
ATOM   60   C C4    . DG  A 1 3   ? 3.755  70.658 -26.541 1.00 43.79 ? -3  DG  C C4    1 
ATOM   61   P P     . DA  A 1 4   ? 4.518  74.823 -31.703 1.00 47.67 ? -2  DA  C P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 3.244  75.457 -32.125 1.00 42.74 ? -2  DA  C OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 5.440  74.281 -32.734 1.00 45.78 ? -2  DA  C OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 5.371  75.846 -30.839 1.00 39.71 ? -2  DA  C "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 4.719  76.901 -30.163 1.00 35.80 ? -2  DA  C "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 5.318  77.103 -28.795 1.00 37.16 ? -2  DA  C "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 5.304  75.837 -28.122 1.00 33.71 ? -2  DA  C "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 6.773  77.566 -28.795 1.00 38.58 ? -2  DA  C "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 7.052  78.310 -27.584 1.00 39.51 ? -2  DA  C "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 7.515  76.245 -28.812 1.00 38.60 ? -2  DA  C "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 6.646  75.427 -27.870 1.00 42.93 ? -2  DA  C "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 6.697  73.978 -28.060 1.00 50.84 ? -2  DA  C N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 6.517  73.325 -29.254 1.00 51.55 ? -2  DA  C C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 6.587  72.013 -29.161 1.00 63.00 ? -2  DA  C N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 6.835  71.791 -27.814 1.00 60.39 ? -2  DA  C C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 7.037  70.585 -27.045 1.00 59.13 ? -2  DA  C C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 7.016  69.308 -27.466 1.00 68.20 ? -2  DA  C N6    1 
ATOM   78   N N1    . DA  A 1 4   ? 7.279  70.736 -25.758 1.00 60.24 ? -2  DA  C N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 7.324  71.967 -25.220 1.00 51.90 ? -2  DA  C C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 7.155  73.138 -25.801 1.00 55.05 ? -2  DA  C N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 6.912  72.988 -27.120 1.00 56.21 ? -2  DA  C C4    1 
ATOM   82   P P     . DA  A 1 5   ? 8.123  79.522 -27.605 1.00 43.51 ? -1  DA  C P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 7.359  80.756 -27.281 1.00 39.97 ? -1  DA  C OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 8.892  79.398 -28.921 1.00 38.66 ? -1  DA  C OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 9.117  79.271 -26.366 1.00 47.57 ? -1  DA  C "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 8.622  78.765 -25.062 1.00 43.91 ? -1  DA  C "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 9.666  77.913 -24.350 1.00 38.27 ? -1  DA  C "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 9.516  76.493 -24.582 1.00 37.17 ? -1  DA  C "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 11.134 78.225 -24.632 1.00 37.37 ? -1  DA  C "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 11.754 78.364 -23.355 1.00 40.58 ? -1  DA  C "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 11.634 77.019 -25.420 1.00 36.11 ? -1  DA  C "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 10.795 75.887 -24.853 1.00 37.93 ? -1  DA  C "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 10.566 74.711 -25.737 1.00 41.07 ? -1  DA  C N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 10.275 74.728 -27.095 1.00 32.43 ? -1  DA  C C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 10.097 73.534 -27.623 1.00 34.11 ? -1  DA  C N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 10.285 72.654 -26.556 1.00 34.13 ? -1  DA  C C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 10.207 71.244 -26.468 1.00 28.94 ? -1  DA  C C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 9.898  70.434 -27.499 1.00 14.95 ? -1  DA  C N6    1 
ATOM   99   N N1    . DA  A 1 5   ? 10.450 70.688 -25.267 1.00 36.95 ? -1  DA  C N1    1 
ATOM   100  C C2    . DA  A 1 5   ? 10.743 71.513 -24.212 1.00 31.44 ? -1  DA  C C2    1 
ATOM   101  N N3    . DA  A 1 5   ? 10.828 72.828 -24.164 1.00 24.22 ? -1  DA  C N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 10.582 73.360 -25.380 1.00 36.45 ? -1  DA  C C4    1 
ATOM   103  P P     . DA  A 1 6   ? 13.239 77.837 -23.129 1.00 46.58 ? 1   DA  C P     1 
ATOM   104  O OP1   . DA  A 1 6   ? 13.857 78.660 -22.043 1.00 42.56 ? 1   DA  C OP1   1 
ATOM   105  O OP2   . DA  A 1 6   ? 13.924 77.739 -24.469 1.00 44.14 ? 1   DA  C OP2   1 
ATOM   106  O "O5'" . DA  A 1 6   ? 13.011 76.335 -22.621 1.00 48.44 ? 1   DA  C "O5'" 1 
ATOM   107  C "C5'" . DA  A 1 6   ? 12.172 76.008 -21.455 1.00 34.62 ? 1   DA  C "C5'" 1 
ATOM   108  C "C4'" . DA  A 1 6   ? 12.589 74.665 -20.890 1.00 18.41 ? 1   DA  C "C4'" 1 
ATOM   109  O "O4'" . DA  A 1 6   ? 12.415 73.665 -21.917 1.00 6.46  ? 1   DA  C "O4'" 1 
ATOM   110  C "C3'" . DA  A 1 6   ? 14.083 74.680 -20.561 1.00 15.29 ? 1   DA  C "C3'" 1 
ATOM   111  O "O3'" . DA  A 1 6   ? 14.396 73.903 -19.397 1.00 11.91 ? 1   DA  C "O3'" 1 
ATOM   112  C "C2'" . DA  A 1 6   ? 14.714 74.161 -21.829 1.00 7.89  ? 1   DA  C "C2'" 1 
ATOM   113  C "C1'" . DA  A 1 6   ? 13.677 73.204 -22.320 1.00 12.03 ? 1   DA  C "C1'" 1 
ATOM   114  N N9    . DA  A 1 6   ? 13.665 73.006 -23.759 1.00 24.02 ? 1   DA  C N9    1 
ATOM   115  C C8    . DA  A 1 6   ? 13.742 73.908 -24.776 1.00 30.85 ? 1   DA  C C8    1 
ATOM   116  N N7    . DA  A 1 6   ? 13.707 73.365 -25.972 1.00 31.93 ? 1   DA  C N7    1 
ATOM   117  C C5    . DA  A 1 6   ? 13.596 72.005 -25.716 1.00 40.51 ? 1   DA  C C5    1 
ATOM   118  C C6    . DA  A 1 6   ? 13.512 70.856 -26.558 1.00 44.43 ? 1   DA  C C6    1 
ATOM   119  N N6    . DA  A 1 6   ? 13.510 70.887 -27.892 1.00 44.13 ? 1   DA  C N6    1 
ATOM   120  N N1    . DA  A 1 6   ? 13.429 69.648 -25.959 1.00 45.45 ? 1   DA  C N1    1 
ATOM   121  C C2    . DA  A 1 6   ? 13.426 69.590 -24.632 1.00 34.63 ? 1   DA  C C2    1 
ATOM   122  N N3    . DA  A 1 6   ? 13.490 70.568 -23.752 1.00 32.56 ? 1   DA  C N3    1 
ATOM   123  C C4    . DA  A 1 6   ? 13.572 71.771 -24.358 1.00 35.45 ? 1   DA  C C4    1 
ATOM   124  P P     . DA  A 1 7   ? 15.909 73.906 -18.815 1.00 21.92 ? 2   DA  C P     1 
ATOM   125  O OP1   . DA  A 1 7   ? 16.022 74.251 -17.366 1.00 20.25 ? 2   DA  C OP1   1 
ATOM   126  O OP2   . DA  A 1 7   ? 16.808 74.538 -19.799 1.00 23.56 ? 2   DA  C OP2   1 
ATOM   127  O "O5'" . DA  A 1 7   ? 16.422 72.390 -18.866 1.00 32.19 ? 2   DA  C "O5'" 1 
ATOM   128  C "C5'" . DA  A 1 7   ? 15.581 71.225 -18.525 1.00 24.68 ? 2   DA  C "C5'" 1 
ATOM   129  C "C4'" . DA  A 1 7   ? 15.949 70.054 -19.412 1.00 21.02 ? 2   DA  C "C4'" 1 
ATOM   130  O "O4'" . DA  A 1 7   ? 15.898 70.466 -20.819 1.00 19.45 ? 2   DA  C "O4'" 1 
ATOM   131  C "C3'" . DA  A 1 7   ? 17.370 69.505 -19.183 1.00 14.84 ? 2   DA  C "C3'" 1 
ATOM   132  O "O3'" . DA  A 1 7   ? 17.333 68.122 -18.855 1.00 15.60 ? 2   DA  C "O3'" 1 
ATOM   133  C "C2'" . DA  A 1 7   ? 18.039 69.657 -20.539 1.00 21.25 ? 2   DA  C "C2'" 1 
ATOM   134  C "C1'" . DA  A 1 7   ? 16.842 69.632 -21.472 1.00 24.64 ? 2   DA  C "C1'" 1 
ATOM   135  N N9    . DA  A 1 7   ? 17.107 70.090 -22.856 1.00 21.06 ? 2   DA  C N9    1 
ATOM   136  C C8    . DA  A 1 7   ? 17.761 71.223 -23.253 1.00 33.38 ? 2   DA  C C8    1 
ATOM   137  N N7    . DA  A 1 7   ? 17.882 71.338 -24.562 1.00 40.61 ? 2   DA  C N7    1 
ATOM   138  C C5    . DA  A 1 7   ? 17.253 70.206 -25.063 1.00 32.97 ? 2   DA  C C5    1 
ATOM   139  C C6    . DA  A 1 7   ? 17.068 69.707 -26.399 1.00 29.19 ? 2   DA  C C6    1 
ATOM   140  N N6    . DA  A 1 7   ? 17.506 70.299 -27.498 1.00 23.50 ? 2   DA  C N6    1 
ATOM   141  N N1    . DA  A 1 7   ? 16.410 68.555 -26.549 1.00 29.56 ? 2   DA  C N1    1 
ATOM   142  C C2    . DA  A 1 7   ? 15.993 67.931 -25.440 1.00 38.80 ? 2   DA  C C2    1 
ATOM   143  N N3    . DA  A 1 7   ? 16.127 68.275 -24.156 1.00 37.87 ? 2   DA  C N3    1 
ATOM   144  C C4    . DA  A 1 7   ? 16.770 69.432 -24.027 1.00 23.81 ? 2   DA  C C4    1 
ATOM   145  P P     . DA  A 1 8   ? 18.707 67.337 -18.500 1.00 32.05 ? 3   DA  C P     1 
ATOM   146  O OP1   . DA  A 1 8   ? 18.436 66.809 -17.136 1.00 24.03 ? 3   DA  C OP1   1 
ATOM   147  O OP2   . DA  A 1 8   ? 19.972 68.090 -18.768 1.00 21.14 ? 3   DA  C OP2   1 
ATOM   148  O "O5'" . DA  A 1 8   ? 18.766 66.136 -19.539 1.00 23.81 ? 3   DA  C "O5'" 1 
ATOM   149  C "C5'" . DA  A 1 8   ? 18.051 66.204 -20.807 1.00 25.56 ? 3   DA  C "C5'" 1 
ATOM   150  C "C4'" . DA  A 1 8   ? 18.250 64.934 -21.601 1.00 21.61 ? 3   DA  C "C4'" 1 
ATOM   151  O "O4'" . DA  A 1 8   ? 18.197 65.227 -23.017 1.00 22.53 ? 3   DA  C "O4'" 1 
ATOM   152  C "C3'" . DA  A 1 8   ? 19.642 64.360 -21.379 1.00 24.88 ? 3   DA  C "C3'" 1 
ATOM   153  O "O3'" . DA  A 1 8   ? 19.636 62.961 -21.581 1.00 21.29 ? 3   DA  C "O3'" 1 
ATOM   154  C "C2'" . DA  A 1 8   ? 20.487 65.049 -22.430 1.00 21.91 ? 3   DA  C "C2'" 1 
ATOM   155  C "C1'" . DA  A 1 8   ? 19.508 65.209 -23.570 1.00 24.88 ? 3   DA  C "C1'" 1 
ATOM   156  N N9    . DA  A 1 8   ? 19.704 66.460 -24.275 1.00 37.30 ? 3   DA  C N9    1 
ATOM   157  C C8    . DA  A 1 8   ? 19.787 67.729 -23.797 1.00 40.20 ? 3   DA  C C8    1 
ATOM   158  N N7    . DA  A 1 8   ? 19.954 68.627 -24.730 1.00 49.86 ? 3   DA  C N7    1 
ATOM   159  C C5    . DA  A 1 8   ? 19.990 67.892 -25.900 1.00 49.93 ? 3   DA  C C5    1 
ATOM   160  C C6    . DA  A 1 8   ? 20.147 68.263 -27.243 1.00 55.98 ? 3   DA  C C6    1 
ATOM   161  N N6    . DA  A 1 8   ? 20.295 69.525 -27.631 1.00 61.42 ? 3   DA  C N6    1 
ATOM   162  N N1    . DA  A 1 8   ? 20.137 67.286 -28.186 1.00 56.79 ? 3   DA  C N1    1 
ATOM   163  C C2    . DA  A 1 8   ? 19.982 66.023 -27.773 1.00 56.19 ? 3   DA  C C2    1 
ATOM   164  N N3    . DA  A 1 8   ? 19.817 65.556 -26.532 1.00 54.22 ? 3   DA  C N3    1 
ATOM   165  C C4    . DA  A 1 8   ? 19.827 66.556 -25.636 1.00 45.17 ? 3   DA  C C4    1 
ATOM   166  P P     . DT  A 1 9   ? 21.016 62.191 -21.694 1.00 19.26 ? 4   DT  C P     1 
ATOM   167  O OP1   . DT  A 1 9   ? 20.595 60.796 -21.440 1.00 31.00 ? 4   DT  C OP1   1 
ATOM   168  O OP2   . DT  A 1 9   ? 22.109 62.777 -20.882 1.00 32.94 ? 4   DT  C OP2   1 
ATOM   169  O "O5'" . DT  A 1 9   ? 21.502 62.479 -23.198 1.00 26.37 ? 4   DT  C "O5'" 1 
ATOM   170  C "C5'" . DT  A 1 9   ? 20.700 62.073 -24.354 1.00 20.37 ? 4   DT  C "C5'" 1 
ATOM   171  C "C4'" . DT  A 1 9   ? 21.550 62.079 -25.600 1.00 22.21 ? 4   DT  C "C4'" 1 
ATOM   172  O "O4'" . DT  A 1 9   ? 21.577 63.437 -26.093 1.00 15.79 ? 4   DT  C "O4'" 1 
ATOM   173  C "C3'" . DT  A 1 9   ? 23.014 61.707 -25.327 1.00 26.36 ? 4   DT  C "C3'" 1 
ATOM   174  O "O3'" . DT  A 1 9   ? 23.620 61.062 -26.454 1.00 25.48 ? 4   DT  C "O3'" 1 
ATOM   175  C "C2'" . DT  A 1 9   ? 23.678 63.067 -25.183 1.00 32.11 ? 4   DT  C "C2'" 1 
ATOM   176  C "C1'" . DT  A 1 9   ? 22.937 63.789 -26.298 1.00 29.12 ? 4   DT  C "C1'" 1 
ATOM   177  N N1    . DT  A 1 9   ? 23.091 65.269 -26.268 1.00 29.23 ? 4   DT  C N1    1 
ATOM   178  C C2    . DT  A 1 9   ? 23.279 65.930 -27.452 1.00 29.27 ? 4   DT  C C2    1 
ATOM   179  O O2    . DT  A 1 9   ? 23.292 65.392 -28.528 1.00 41.16 ? 4   DT  C O2    1 
ATOM   180  N N3    . DT  A 1 9   ? 23.449 67.259 -27.340 1.00 31.28 ? 4   DT  C N3    1 
ATOM   181  C C4    . DT  A 1 9   ? 23.448 68.004 -26.207 1.00 29.97 ? 4   DT  C C4    1 
ATOM   182  O O4    . DT  A 1 9   ? 23.633 69.198 -26.298 1.00 25.65 ? 4   DT  C O4    1 
ATOM   183  C C5    . DT  A 1 9   ? 23.216 67.259 -24.986 1.00 33.07 ? 4   DT  C C5    1 
ATOM   184  C C7    . DT  A 1 9   ? 23.156 67.983 -23.688 1.00 41.06 ? 4   DT  C C7    1 
ATOM   185  C C6    . DT  A 1 9   ? 23.054 65.946 -25.082 1.00 31.78 ? 4   DT  C C6    1 
ATOM   186  P P     . DG  A 1 10  ? 23.897 59.478 -26.448 1.00 24.50 ? 5   DG  C P     1 
ATOM   187  O OP1   . DG  A 1 10  ? 22.522 58.894 -26.597 1.00 18.67 ? 5   DG  C OP1   1 
ATOM   188  O OP2   . DG  A 1 10  ? 24.820 59.020 -25.359 1.00 26.92 ? 5   DG  C OP2   1 
ATOM   189  O "O5'" . DG  A 1 10  ? 24.643 59.275 -27.816 1.00 19.00 ? 5   DG  C "O5'" 1 
ATOM   190  C "C5'" . DG  A 1 10  ? 23.863 59.417 -29.017 1.00 21.94 ? 5   DG  C "C5'" 1 
ATOM   191  C "C4'" . DG  A 1 10  ? 24.588 60.266 -30.024 1.00 20.06 ? 5   DG  C "C4'" 1 
ATOM   192  O "O4'" . DG  A 1 10  ? 24.700 61.590 -29.488 1.00 21.51 ? 5   DG  C "O4'" 1 
ATOM   193  C "C3'" . DG  A 1 10  ? 26.021 59.778 -30.274 1.00 28.94 ? 5   DG  C "C3'" 1 
ATOM   194  O "O3'" . DG  A 1 10  ? 26.230 59.682 -31.685 1.00 27.54 ? 5   DG  C "O3'" 1 
ATOM   195  C "C2'" . DG  A 1 10  ? 26.907 60.834 -29.627 1.00 23.90 ? 5   DG  C "C2'" 1 
ATOM   196  C "C1'" . DG  A 1 10  ? 26.020 62.063 -29.753 1.00 35.22 ? 5   DG  C "C1'" 1 
ATOM   197  N N9    . DG  A 1 10  ? 26.312 63.174 -28.840 1.00 46.00 ? 5   DG  C N9    1 
ATOM   198  C C8    . DG  A 1 10  ? 26.556 63.082 -27.485 1.00 50.34 ? 5   DG  C C8    1 
ATOM   199  N N7    . DG  A 1 10  ? 26.786 64.238 -26.917 1.00 54.16 ? 5   DG  C N7    1 
ATOM   200  C C5    . DG  A 1 10  ? 26.688 65.159 -27.948 1.00 54.51 ? 5   DG  C C5    1 
ATOM   201  C C6    . DG  A 1 10  ? 26.850 66.568 -27.939 1.00 59.58 ? 5   DG  C C6    1 
ATOM   202  O O6    . DG  A 1 10  ? 27.090 67.301 -26.986 1.00 65.28 ? 5   DG  C O6    1 
ATOM   203  N N1    . DG  A 1 10  ? 26.697 67.122 -29.205 1.00 59.20 ? 5   DG  C N1    1 
ATOM   204  C C2    . DG  A 1 10  ? 26.399 66.404 -30.351 1.00 57.63 ? 5   DG  C C2    1 
ATOM   205  N N2    . DG  A 1 10  ? 26.266 67.094 -31.509 1.00 58.62 ? 5   DG  C N2    1 
ATOM   206  N N3    . DG  A 1 10  ? 26.237 65.088 -30.375 1.00 54.65 ? 5   DG  C N3    1 
ATOM   207  C C4    . DG  A 1 10  ? 26.401 64.530 -29.152 1.00 52.96 ? 5   DG  C C4    1 
ATOM   208  P P     . DT  A 1 11  ? 27.043 58.443 -32.287 1.00 23.13 ? 6   DT  C P     1 
ATOM   209  O OP1   . DT  A 1 11  ? 26.043 57.377 -32.421 1.00 33.61 ? 6   DT  C OP1   1 
ATOM   210  O OP2   . DT  A 1 11  ? 28.284 58.192 -31.483 1.00 28.46 ? 6   DT  C OP2   1 
ATOM   211  O "O5'" . DT  A 1 11  ? 27.443 58.949 -33.747 1.00 25.19 ? 6   DT  C "O5'" 1 
ATOM   212  C "C5'" . DT  A 1 11  ? 28.799 59.088 -34.117 1.00 26.31 ? 6   DT  C "C5'" 1 
ATOM   213  C "C4'" . DT  A 1 11  ? 29.146 60.537 -34.336 1.00 34.30 ? 6   DT  C "C4'" 1 
ATOM   214  O "O4'" . DT  A 1 11  ? 28.792 61.367 -33.196 1.00 38.93 ? 6   DT  C "O4'" 1 
ATOM   215  C "C3'" . DT  A 1 11  ? 30.655 60.666 -34.423 1.00 38.60 ? 6   DT  C "C3'" 1 
ATOM   216  O "O3'" . DT  A 1 11  ? 31.098 60.446 -35.765 1.00 43.77 ? 6   DT  C "O3'" 1 
ATOM   217  C "C2'" . DT  A 1 11  ? 30.960 62.071 -33.922 1.00 38.71 ? 6   DT  C "C2'" 1 
ATOM   218  C "C1'" . DT  A 1 11  ? 29.713 62.484 -33.146 1.00 41.08 ? 6   DT  C "C1'" 1 
ATOM   219  N N1    . DT  A 1 11  ? 29.915 62.947 -31.702 1.00 40.03 ? 6   DT  C N1    1 
ATOM   220  C C2    . DT  A 1 11  ? 30.365 64.237 -31.556 1.00 41.42 ? 6   DT  C C2    1 
ATOM   221  O O2    . DT  A 1 11  ? 30.627 64.964 -32.497 1.00 38.47 ? 6   DT  C O2    1 
ATOM   222  N N3    . DT  A 1 11  ? 30.507 64.656 -30.242 1.00 48.30 ? 6   DT  C N3    1 
ATOM   223  C C4    . DT  A 1 11  ? 30.262 63.929 -29.089 1.00 36.89 ? 6   DT  C C4    1 
ATOM   224  O O4    . DT  A 1 11  ? 30.445 64.487 -27.977 1.00 29.32 ? 6   DT  C O4    1 
ATOM   225  C C5    . DT  A 1 11  ? 29.821 62.609 -29.303 1.00 35.74 ? 6   DT  C C5    1 
ATOM   226  C C7    . DT  A 1 11  ? 29.558 61.787 -28.095 1.00 36.14 ? 6   DT  C C7    1 
ATOM   227  C C6    . DT  A 1 11  ? 29.665 62.168 -30.576 1.00 42.84 ? 6   DT  C C6    1 
ATOM   228  P P     . DG  A 1 12  ? 32.149 59.274 -36.049 1.00 41.04 ? 7   DG  C P     1 
ATOM   229  O OP1   . DG  A 1 12  ? 33.137 59.678 -37.071 1.00 35.30 ? 7   DG  C OP1   1 
ATOM   230  O OP2   . DG  A 1 12  ? 31.280 58.056 -36.239 1.00 38.29 ? 7   DG  C OP2   1 
ATOM   231  O "O5'" . DG  A 1 12  ? 32.981 59.190 -34.710 1.00 37.15 ? 7   DG  C "O5'" 1 
ATOM   232  C "C5'" . DG  A 1 12  ? 33.469 60.373 -34.138 1.00 36.13 ? 7   DG  C "C5'" 1 
ATOM   233  C "C4'" . DG  A 1 12  ? 34.809 60.689 -34.733 1.00 41.86 ? 7   DG  C "C4'" 1 
ATOM   234  O "O4'" . DG  A 1 12  ? 35.473 61.607 -33.835 1.00 43.93 ? 7   DG  C "O4'" 1 
ATOM   235  C "C3'" . DG  A 1 12  ? 35.722 59.472 -34.803 1.00 39.35 ? 7   DG  C "C3'" 1 
ATOM   236  O "O3'" . DG  A 1 12  ? 36.633 59.695 -35.904 1.00 47.81 ? 7   DG  C "O3'" 1 
ATOM   237  C "C2'" . DG  A 1 12  ? 36.333 59.435 -33.402 1.00 42.95 ? 7   DG  C "C2'" 1 
ATOM   238  C "C1'" . DG  A 1 12  ? 36.121 60.856 -32.812 1.00 41.35 ? 7   DG  C "C1'" 1 
ATOM   239  N N9    . DG  A 1 12  ? 35.267 60.957 -31.628 1.00 34.21 ? 7   DG  C N9    1 
ATOM   240  C C8    . DG  A 1 12  ? 34.353 60.030 -31.200 1.00 29.96 ? 7   DG  C C8    1 
ATOM   241  N N7    . DG  A 1 12  ? 33.704 60.402 -30.135 1.00 30.00 ? 7   DG  C N7    1 
ATOM   242  C C5    . DG  A 1 12  ? 34.225 61.645 -29.834 1.00 31.13 ? 7   DG  C C5    1 
ATOM   243  C C6    . DG  A 1 12  ? 33.933 62.531 -28.753 1.00 31.75 ? 7   DG  C C6    1 
ATOM   244  O O6    . DG  A 1 12  ? 33.079 62.413 -27.812 1.00 30.43 ? 7   DG  C O6    1 
ATOM   245  N N1    . DG  A 1 12  ? 34.741 63.660 -28.811 1.00 39.08 ? 7   DG  C N1    1 
ATOM   246  C C2    . DG  A 1 12  ? 35.694 63.921 -29.776 1.00 36.25 ? 7   DG  C C2    1 
ATOM   247  N N2    . DG  A 1 12  ? 36.389 65.108 -29.652 1.00 42.45 ? 7   DG  C N2    1 
ATOM   248  N N3    . DG  A 1 12  ? 35.961 63.107 -30.780 1.00 35.39 ? 7   DG  C N3    1 
ATOM   249  C C4    . DG  A 1 12  ? 35.202 61.997 -30.747 1.00 31.50 ? 7   DG  C C4    1 
ATOM   250  P P     . DA  A 1 13  ? 38.069 58.968 -35.969 1.00 46.81 ? 8   DA  C P     1 
ATOM   251  O OP1   . DA  A 1 13  ? 38.303 58.715 -37.413 1.00 45.06 ? 8   DA  C OP1   1 
ATOM   252  O OP2   . DA  A 1 13  ? 38.088 57.829 -35.011 1.00 50.51 ? 8   DA  C OP2   1 
ATOM   253  O "O5'" . DA  A 1 13  ? 39.096 60.093 -35.485 1.00 51.34 ? 8   DA  C "O5'" 1 
ATOM   254  C "C5'" . DA  A 1 13  ? 38.963 61.490 -35.957 1.00 53.32 ? 8   DA  C "C5'" 1 
ATOM   255  C "C4'" . DA  A 1 13  ? 40.043 62.393 -35.383 1.00 52.20 ? 8   DA  C "C4'" 1 
ATOM   256  O "O4'" . DA  A 1 13  ? 39.679 62.804 -34.050 1.00 53.64 ? 8   DA  C "O4'" 1 
ATOM   257  C "C3'" . DA  A 1 13  ? 41.439 61.787 -35.249 1.00 55.17 ? 8   DA  C "C3'" 1 
ATOM   258  O "O3'" . DA  A 1 13  ? 42.458 62.779 -35.469 1.00 56.55 ? 8   DA  C "O3'" 1 
ATOM   259  C "C2'" . DA  A 1 13  ? 41.493 61.272 -33.815 1.00 49.33 ? 8   DA  C "C2'" 1 
ATOM   260  C "C1'" . DA  A 1 13  ? 40.442 62.094 -33.075 1.00 50.15 ? 8   DA  C "C1'" 1 
ATOM   261  N N9    . DA  A 1 13  ? 39.510 61.276 -32.298 1.00 48.67 ? 8   DA  C N9    1 
ATOM   262  C C8    . DA  A 1 13  ? 39.071 59.992 -32.547 1.00 45.69 ? 8   DA  C C8    1 
ATOM   263  N N7    . DA  A 1 13  ? 38.233 59.528 -31.645 1.00 39.79 ? 8   DA  C N7    1 
ATOM   264  C C5    . DA  A 1 13  ? 38.102 60.568 -30.745 1.00 41.22 ? 8   DA  C C5    1 
ATOM   265  C C6    . DA  A 1 13  ? 37.376 60.678 -29.566 1.00 38.09 ? 8   DA  C C6    1 
ATOM   266  N N6    . DA  A 1 13  ? 36.589 59.698 -29.116 1.00 47.73 ? 8   DA  C N6    1 
ATOM   267  N N1    . DA  A 1 13  ? 37.479 61.840 -28.866 1.00 38.44 ? 8   DA  C N1    1 
ATOM   268  C C2    . DA  A 1 13  ? 38.316 62.839 -29.402 1.00 42.02 ? 8   DA  C C2    1 
ATOM   269  N N3    . DA  A 1 13  ? 39.032 62.837 -30.493 1.00 40.96 ? 8   DA  C N3    1 
ATOM   270  C C4    . DA  A 1 13  ? 38.885 61.662 -31.129 1.00 48.28 ? 8   DA  C C4    1 
ATOM   271  P P     . DT  A 1 14  ? 43.993 62.306 -35.674 1.00 63.31 ? 9   DT  C P     1 
ATOM   272  O OP1   . DT  A 1 14  ? 44.503 62.821 -36.981 1.00 61.01 ? 9   DT  C OP1   1 
ATOM   273  O OP2   . DT  A 1 14  ? 44.036 60.828 -35.401 1.00 58.13 ? 9   DT  C OP2   1 
ATOM   274  O "O5'" . DT  A 1 14  ? 44.805 63.080 -34.532 1.00 61.92 ? 9   DT  C "O5'" 1 
ATOM   275  C "C5'" . DT  A 1 14  ? 45.616 62.366 -33.556 1.00 57.42 ? 9   DT  C "C5'" 1 
ATOM   276  C "C4'" . DT  A 1 14  ? 45.411 62.968 -32.189 1.00 52.59 ? 9   DT  C "C4'" 1 
ATOM   277  O "O4'" . DT  A 1 14  ? 43.984 63.099 -31.996 1.00 51.68 ? 9   DT  C "O4'" 1 
ATOM   278  C "C3'" . DT  A 1 14  ? 45.885 62.151 -30.993 1.00 52.47 ? 9   DT  C "C3'" 1 
ATOM   279  O "O3'" . DT  A 1 14  ? 47.301 62.268 -30.621 1.00 49.28 ? 9   DT  C "O3'" 1 
ATOM   280  C "C2'" . DT  A 1 14  ? 45.030 62.746 -29.889 1.00 52.29 ? 9   DT  C "C2'" 1 
ATOM   281  C "C1'" . DT  A 1 14  ? 43.697 63.053 -30.605 1.00 51.28 ? 9   DT  C "C1'" 1 
ATOM   282  N N1    . DT  A 1 14  ? 42.703 61.986 -30.373 1.00 53.80 ? 9   DT  C N1    1 
ATOM   283  C C2    . DT  A 1 14  ? 41.643 62.217 -29.489 1.00 54.14 ? 9   DT  C C2    1 
ATOM   284  O O2    . DT  A 1 14  ? 41.446 63.273 -28.901 1.00 61.07 ? 9   DT  C O2    1 
ATOM   285  N N3    . DT  A 1 14  ? 40.807 61.154 -29.318 1.00 51.61 ? 9   DT  C N3    1 
ATOM   286  C C4    . DT  A 1 14  ? 40.883 59.917 -29.924 1.00 50.50 ? 9   DT  C C4    1 
ATOM   287  O O4    . DT  A 1 14  ? 40.018 59.047 -29.656 1.00 44.36 ? 9   DT  C O4    1 
ATOM   288  C C5    . DT  A 1 14  ? 42.006 59.748 -30.844 1.00 49.83 ? 9   DT  C C5    1 
ATOM   289  C C7    . DT  A 1 14  ? 42.174 58.444 -31.553 1.00 50.67 ? 9   DT  C C7    1 
ATOM   290  C C6    . DT  A 1 14  ? 42.842 60.775 -31.015 1.00 52.83 ? 9   DT  C C6    1 
ATOM   291  O "O5'" . DC  B 2 1   ? 46.074 67.969 -28.106 1.00 57.34 ? 10  DC  D "O5'" 1 
ATOM   292  C "C5'" . DC  B 2 1   ? 46.652 66.631 -27.935 1.00 54.56 ? 10  DC  D "C5'" 1 
ATOM   293  C "C4'" . DC  B 2 1   ? 45.951 65.906 -26.811 1.00 44.78 ? 10  DC  D "C4'" 1 
ATOM   294  O "O4'" . DC  B 2 1   ? 45.289 64.755 -27.336 1.00 44.97 ? 10  DC  D "O4'" 1 
ATOM   295  C "C3'" . DC  B 2 1   ? 46.778 65.322 -25.684 1.00 42.50 ? 10  DC  D "C3'" 1 
ATOM   296  O "O3'" . DC  B 2 1   ? 47.230 66.360 -24.800 1.00 47.05 ? 10  DC  D "O3'" 1 
ATOM   297  C "C2'" . DC  B 2 1   ? 45.707 64.484 -25.011 1.00 42.77 ? 10  DC  D "C2'" 1 
ATOM   298  C "C1'" . DC  B 2 1   ? 44.792 64.081 -26.191 1.00 46.41 ? 10  DC  D "C1'" 1 
ATOM   299  N N1    . DC  B 2 1   ? 44.741 62.631 -26.496 1.00 46.65 ? 10  DC  D N1    1 
ATOM   300  C C2    . DC  B 2 1   ? 43.504 61.961 -26.438 1.00 44.25 ? 10  DC  D C2    1 
ATOM   301  O O2    . DC  B 2 1   ? 42.488 62.594 -26.150 1.00 35.89 ? 10  DC  D O2    1 
ATOM   302  N N3    . DC  B 2 1   ? 43.448 60.642 -26.700 1.00 47.55 ? 10  DC  D N3    1 
ATOM   303  C C4    . DC  B 2 1   ? 44.554 59.987 -27.015 1.00 50.42 ? 10  DC  D C4    1 
ATOM   304  N N4    . DC  B 2 1   ? 44.445 58.677 -27.254 1.00 51.57 ? 10  DC  D N4    1 
ATOM   305  C C5    . DC  B 2 1   ? 45.829 60.640 -27.100 1.00 49.23 ? 10  DC  D C5    1 
ATOM   306  C C6    . DC  B 2 1   ? 45.873 61.946 -26.832 1.00 46.10 ? 10  DC  D C6    1 
ATOM   307  P P     . DT  B 2 2   ? 48.343 66.036 -23.660 1.00 53.26 ? 11  DT  D P     1 
ATOM   308  O OP1   . DT  B 2 2   ? 48.730 67.305 -22.934 1.00 53.27 ? 11  DT  D OP1   1 
ATOM   309  O OP2   . DT  B 2 2   ? 49.432 65.182 -24.251 1.00 46.95 ? 11  DT  D OP2   1 
ATOM   310  O "O5'" . DT  B 2 2   ? 47.535 65.101 -22.648 1.00 50.19 ? 11  DT  D "O5'" 1 
ATOM   311  C "C5'" . DT  B 2 2   ? 46.408 65.582 -21.860 1.00 47.77 ? 11  DT  D "C5'" 1 
ATOM   312  C "C4'" . DT  B 2 2   ? 46.361 64.807 -20.565 1.00 46.40 ? 11  DT  D "C4'" 1 
ATOM   313  O "O4'" . DT  B 2 2   ? 45.952 63.441 -20.864 1.00 49.10 ? 11  DT  D "O4'" 1 
ATOM   314  C "C3'" . DT  B 2 2   ? 47.757 64.693 -19.961 1.00 45.78 ? 11  DT  D "C3'" 1 
ATOM   315  O "O3'" . DT  B 2 2   ? 47.715 64.860 -18.536 1.00 44.60 ? 11  DT  D "O3'" 1 
ATOM   316  C "C2'" . DT  B 2 2   ? 48.273 63.334 -20.442 1.00 45.03 ? 11  DT  D "C2'" 1 
ATOM   317  C "C1'" . DT  B 2 2   ? 47.026 62.504 -20.697 1.00 41.25 ? 11  DT  D "C1'" 1 
ATOM   318  N N1    . DT  B 2 2   ? 47.045 61.609 -21.897 1.00 34.43 ? 11  DT  D N1    1 
ATOM   319  C C2    . DT  B 2 2   ? 46.052 60.660 -21.988 1.00 37.29 ? 11  DT  D C2    1 
ATOM   320  O O2    . DT  B 2 2   ? 45.189 60.501 -21.160 1.00 37.09 ? 11  DT  D O2    1 
ATOM   321  N N3    . DT  B 2 2   ? 46.100 59.881 -23.105 1.00 40.84 ? 11  DT  D N3    1 
ATOM   322  C C4    . DT  B 2 2   ? 47.009 59.933 -24.125 1.00 37.58 ? 11  DT  D C4    1 
ATOM   323  O O4    . DT  B 2 2   ? 46.889 59.142 -25.063 1.00 39.02 ? 11  DT  D O4    1 
ATOM   324  C C5    . DT  B 2 2   ? 48.038 60.926 -23.975 1.00 33.18 ? 11  DT  D C5    1 
ATOM   325  C C7    . DT  B 2 2   ? 49.099 61.050 -25.022 1.00 37.46 ? 11  DT  D C7    1 
ATOM   326  C C6    . DT  B 2 2   ? 48.004 61.712 -22.879 1.00 35.16 ? 11  DT  D C6    1 
ATOM   327  P P     . DA  B 2 3   ? 49.059 64.609 -17.651 1.00 54.06 ? 12  DA  D P     1 
ATOM   328  O OP1   . DA  B 2 3   ? 49.455 65.798 -16.827 1.00 54.69 ? 12  DA  D OP1   1 
ATOM   329  O OP2   . DA  B 2 3   ? 50.103 63.983 -18.537 1.00 56.08 ? 12  DA  D OP2   1 
ATOM   330  O "O5'" . DA  B 2 3   ? 48.523 63.513 -16.617 1.00 52.78 ? 12  DA  D "O5'" 1 
ATOM   331  C "C5'" . DA  B 2 3   ? 47.206 63.671 -16.026 1.00 47.92 ? 12  DA  D "C5'" 1 
ATOM   332  C "C4'" . DA  B 2 3   ? 46.691 62.357 -15.476 1.00 42.98 ? 12  DA  D "C4'" 1 
ATOM   333  O "O4'" . DA  B 2 3   ? 46.484 61.420 -16.557 1.00 45.02 ? 12  DA  D "O4'" 1 
ATOM   334  C "C3'" . DA  B 2 3   ? 47.571 61.646 -14.442 1.00 40.90 ? 12  DA  D "C3'" 1 
ATOM   335  O "O3'" . DA  B 2 3   ? 46.681 61.035 -13.481 1.00 35.74 ? 12  DA  D "O3'" 1 
ATOM   336  C "C2'" . DA  B 2 3   ? 48.356 60.659 -15.293 1.00 38.35 ? 12  DA  D "C2'" 1 
ATOM   337  C "C1'" . DA  B 2 3   ? 47.379 60.326 -16.442 1.00 42.78 ? 12  DA  D "C1'" 1 
ATOM   338  N N9    . DA  B 2 3   ? 47.956 60.105 -17.777 1.00 41.75 ? 12  DA  D N9    1 
ATOM   339  C C8    . DA  B 2 3   ? 48.802 60.937 -18.483 1.00 42.63 ? 12  DA  D C8    1 
ATOM   340  N N7    . DA  B 2 3   ? 49.143 60.467 -19.657 1.00 40.10 ? 12  DA  D N7    1 
ATOM   341  C C5    . DA  B 2 3   ? 48.479 59.247 -19.725 1.00 38.62 ? 12  DA  D C5    1 
ATOM   342  C C6    . DA  B 2 3   ? 48.432 58.283 -20.702 1.00 39.60 ? 12  DA  D C6    1 
ATOM   343  N N6    . DA  B 2 3   ? 49.103 58.405 -21.844 1.00 44.67 ? 12  DA  D N6    1 
ATOM   344  N N1    . DA  B 2 3   ? 47.668 57.184 -20.479 1.00 34.08 ? 12  DA  D N1    1 
ATOM   345  C C2    . DA  B 2 3   ? 47.007 57.091 -19.334 1.00 26.91 ? 12  DA  D C2    1 
ATOM   346  N N3    . DA  B 2 3   ? 46.974 57.936 -18.334 1.00 28.96 ? 12  DA  D N3    1 
ATOM   347  C C4    . DA  B 2 3   ? 47.744 59.011 -18.586 1.00 35.75 ? 12  DA  D C4    1 
ATOM   348  P P     . DG  B 2 4   ? 47.202 60.618 -12.009 1.00 37.36 ? 13  DG  D P     1 
ATOM   349  O OP1   . DG  B 2 4   ? 46.075 60.963 -11.115 1.00 37.60 ? 13  DG  D OP1   1 
ATOM   350  O OP2   . DG  B 2 4   ? 48.599 61.029 -11.616 1.00 34.50 ? 13  DG  D OP2   1 
ATOM   351  O "O5'" . DG  B 2 4   ? 47.298 59.044 -12.153 1.00 31.86 ? 13  DG  D "O5'" 1 
ATOM   352  C "C5'" . DG  B 2 4   ? 46.146 58.281 -12.531 1.00 33.21 ? 13  DG  D "C5'" 1 
ATOM   353  C "C4'" . DG  B 2 4   ? 46.537 56.903 -13.028 1.00 26.39 ? 13  DG  D "C4'" 1 
ATOM   354  O "O4'" . DG  B 2 4   ? 47.107 57.018 -14.347 1.00 22.05 ? 13  DG  D "O4'" 1 
ATOM   355  C "C3'" . DG  B 2 4   ? 47.552 56.155 -12.161 1.00 25.87 ? 13  DG  D "C3'" 1 
ATOM   356  O "O3'" . DG  B 2 4   ? 46.905 54.912 -11.715 1.00 26.23 ? 13  DG  D "O3'" 1 
ATOM   357  C "C2'" . DG  B 2 4   ? 48.779 56.048 -13.065 1.00 19.98 ? 13  DG  D "C2'" 1 
ATOM   358  C "C1'" . DG  B 2 4   ? 48.158 56.106 -14.459 1.00 23.24 ? 13  DG  D "C1'" 1 
ATOM   359  N N9    . DG  B 2 4   ? 49.036 56.526 -15.557 1.00 22.06 ? 13  DG  D N9    1 
ATOM   360  C C8    . DG  B 2 4   ? 49.860 57.620 -15.598 1.00 20.58 ? 13  DG  D C8    1 
ATOM   361  N N7    . DG  B 2 4   ? 50.537 57.708 -16.707 1.00 29.51 ? 13  DG  D N7    1 
ATOM   362  C C5    . DG  B 2 4   ? 50.130 56.606 -17.447 1.00 29.88 ? 13  DG  D C5    1 
ATOM   363  C C6    . DG  B 2 4   ? 50.545 56.149 -18.738 1.00 37.58 ? 13  DG  D C6    1 
ATOM   364  O O6    . DG  B 2 4   ? 51.372 56.653 -19.541 1.00 44.52 ? 13  DG  D O6    1 
ATOM   365  N N1    . DG  B 2 4   ? 49.901 54.979 -19.080 1.00 42.11 ? 13  DG  D N1    1 
ATOM   366  C C2    . DG  B 2 4   ? 48.983 54.313 -18.299 1.00 41.38 ? 13  DG  D C2    1 
ATOM   367  N N2    . DG  B 2 4   ? 48.469 53.170 -18.826 1.00 43.47 ? 13  DG  D N2    1 
ATOM   368  N N3    . DG  B 2 4   ? 48.592 54.725 -17.103 1.00 31.83 ? 13  DG  D N3    1 
ATOM   369  C C4    . DG  B 2 4   ? 49.201 55.868 -16.746 1.00 24.26 ? 13  DG  D C4    1 
ATOM   370  P P     . DA  B 2 5   ? 47.497 53.546 -11.271 1.00 28.30 ? 14  DA  D P     1 
ATOM   371  O OP1   . DA  B 2 5   ? 46.227 53.092 -10.676 1.00 27.19 ? 14  DA  D OP1   1 
ATOM   372  O OP2   . DA  B 2 5   ? 48.722 53.660 -10.394 1.00 12.56 ? 14  DA  D OP2   1 
ATOM   373  O "O5'" . DA  B 2 5   ? 47.983 52.717 -12.480 1.00 26.92 ? 14  DA  D "O5'" 1 
ATOM   374  C "C5'" . DA  B 2 5   ? 46.853 51.943 -13.070 1.00 35.59 ? 14  DA  D "C5'" 1 
ATOM   375  C "C4'" . DA  B 2 5   ? 47.346 50.788 -13.935 1.00 35.69 ? 14  DA  D "C4'" 1 
ATOM   376  O "O4'" . DA  B 2 5   ? 48.125 51.312 -15.038 1.00 37.21 ? 14  DA  D "O4'" 1 
ATOM   377  C "C3'" . DA  B 2 5   ? 48.247 49.760 -13.231 1.00 38.85 ? 14  DA  D "C3'" 1 
ATOM   378  O "O3'" . DA  B 2 5   ? 47.904 48.409 -13.589 1.00 40.11 ? 14  DA  D "O3'" 1 
ATOM   379  C "C2'" . DA  B 2 5   ? 49.650 50.126 -13.693 1.00 38.84 ? 14  DA  D "C2'" 1 
ATOM   380  C "C1'" . DA  B 2 5   ? 49.449 50.804 -15.022 1.00 35.70 ? 14  DA  D "C1'" 1 
ATOM   381  N N9    . DA  B 2 5   ? 50.355 51.920 -15.250 1.00 35.41 ? 14  DA  D N9    1 
ATOM   382  C C8    . DA  B 2 5   ? 50.784 52.909 -14.400 1.00 40.40 ? 14  DA  D C8    1 
ATOM   383  N N7    . DA  B 2 5   ? 51.617 53.771 -14.963 1.00 42.46 ? 14  DA  D N7    1 
ATOM   384  C C5    . DA  B 2 5   ? 51.735 53.314 -16.268 1.00 38.61 ? 14  DA  D C5    1 
ATOM   385  C C6    . DA  B 2 5   ? 52.447 53.787 -17.378 1.00 28.10 ? 14  DA  D C6    1 
ATOM   386  N N6    . DA  B 2 5   ? 53.221 54.846 -17.377 1.00 22.98 ? 14  DA  D N6    1 
ATOM   387  N N1    . DA  B 2 5   ? 52.332 53.108 -18.522 1.00 35.52 ? 14  DA  D N1    1 
ATOM   388  C C2    . DA  B 2 5   ? 51.555 52.020 -18.556 1.00 41.79 ? 14  DA  D C2    1 
ATOM   389  N N3    . DA  B 2 5   ? 50.838 51.474 -17.594 1.00 47.41 ? 14  DA  D N3    1 
ATOM   390  C C4    . DA  B 2 5   ? 50.965 52.174 -16.457 1.00 42.49 ? 14  DA  D C4    1 
ATOM   391  P P     . DT  B 2 6   ? 48.621 47.153 -12.852 1.00 43.53 ? 15  DT  D P     1 
ATOM   392  O OP1   . DT  B 2 6   ? 47.653 46.653 -11.851 1.00 46.48 ? 15  DT  D OP1   1 
ATOM   393  O OP2   . DT  B 2 6   ? 50.038 47.394 -12.420 1.00 38.03 ? 15  DT  D OP2   1 
ATOM   394  O "O5'" . DT  B 2 6   ? 48.683 46.092 -14.032 1.00 37.23 ? 15  DT  D "O5'" 1 
ATOM   395  C "C5'" . DT  B 2 6   ? 48.868 46.505 -15.394 1.00 38.50 ? 15  DT  D "C5'" 1 
ATOM   396  C "C4'" . DT  B 2 6   ? 50.239 46.093 -15.892 1.00 41.74 ? 15  DT  D "C4'" 1 
ATOM   397  O "O4'" . DT  B 2 6   ? 50.979 47.328 -16.157 1.00 39.27 ? 15  DT  D "O4'" 1 
ATOM   398  C "C3'" . DT  B 2 6   ? 51.090 45.249 -14.904 1.00 47.73 ? 15  DT  D "C3'" 1 
ATOM   399  O "O3'" . DT  B 2 6   ? 51.458 43.906 -15.393 1.00 45.57 ? 15  DT  D "O3'" 1 
ATOM   400  C "C2'" . DT  B 2 6   ? 52.349 46.080 -14.723 1.00 46.58 ? 15  DT  D "C2'" 1 
ATOM   401  C "C1'" . DT  B 2 6   ? 52.341 47.045 -15.926 1.00 45.47 ? 15  DT  D "C1'" 1 
ATOM   402  N N1    . DT  B 2 6   ? 53.091 48.316 -15.655 1.00 39.96 ? 15  DT  D N1    1 
ATOM   403  C C2    . DT  B 2 6   ? 53.875 48.837 -16.667 1.00 46.09 ? 15  DT  D C2    1 
ATOM   404  O O2    . DT  B 2 6   ? 53.969 48.323 -17.775 1.00 47.82 ? 15  DT  D O2    1 
ATOM   405  N N3    . DT  B 2 6   ? 54.561 49.997 -16.327 1.00 51.54 ? 15  DT  D N3    1 
ATOM   406  C C4    . DT  B 2 6   ? 54.532 50.654 -15.098 1.00 50.53 ? 15  DT  D C4    1 
ATOM   407  O O4    . DT  B 2 6   ? 55.211 51.692 -14.939 1.00 62.74 ? 15  DT  D O4    1 
ATOM   408  C C5    . DT  B 2 6   ? 53.686 50.047 -14.093 1.00 45.51 ? 15  DT  D C5    1 
ATOM   409  C C7    . DT  B 2 6   ? 53.586 50.656 -12.735 1.00 42.07 ? 15  DT  D C7    1 
ATOM   410  C C6    . DT  B 2 6   ? 53.017 48.938 -14.424 1.00 43.49 ? 15  DT  D C6    1 
ATOM   411  P P     . DC  B 2 7   ? 51.780 42.673 -14.328 1.00 45.93 ? 16  DC  D P     1 
ATOM   412  O OP1   . DC  B 2 7   ? 50.878 41.532 -14.655 1.00 38.31 ? 16  DC  D OP1   1 
ATOM   413  O OP2   . DC  B 2 7   ? 51.874 43.143 -12.926 1.00 50.00 ? 16  DC  D OP2   1 
ATOM   414  O "O5'" . DC  B 2 7   ? 53.269 42.223 -14.603 1.00 34.17 ? 16  DC  D "O5'" 1 
ATOM   415  C "C5'" . DC  B 2 7   ? 53.646 41.861 -15.881 1.00 33.86 ? 16  DC  D "C5'" 1 
ATOM   416  C "C4'" . DC  B 2 7   ? 55.027 42.377 -16.167 1.00 34.72 ? 16  DC  D "C4'" 1 
ATOM   417  O "O4'" . DC  B 2 7   ? 55.023 43.743 -16.619 1.00 39.29 ? 16  DC  D "O4'" 1 
ATOM   418  C "C3'" . DC  B 2 7   ? 55.987 42.464 -15.007 1.00 38.08 ? 16  DC  D "C3'" 1 
ATOM   419  O "O3'" . DC  B 2 7   ? 56.224 41.208 -14.356 1.00 40.62 ? 16  DC  D "O3'" 1 
ATOM   420  C "C2'" . DC  B 2 7   ? 57.153 43.046 -15.771 1.00 41.81 ? 16  DC  D "C2'" 1 
ATOM   421  C "C1'" . DC  B 2 7   ? 56.400 44.188 -16.492 1.00 42.40 ? 16  DC  D "C1'" 1 
ATOM   422  N N1    . DC  B 2 7   ? 56.484 45.318 -15.551 1.00 43.20 ? 16  DC  D N1    1 
ATOM   423  C C2    . DC  B 2 7   ? 57.319 46.381 -15.845 1.00 50.31 ? 16  DC  D C2    1 
ATOM   424  O O2    . DC  B 2 7   ? 57.920 46.379 -16.924 1.00 54.98 ? 16  DC  D O2    1 
ATOM   425  N N3    . DC  B 2 7   ? 57.455 47.400 -14.938 1.00 51.66 ? 16  DC  D N3    1 
ATOM   426  C C4    . DC  B 2 7   ? 56.773 47.370 -13.795 1.00 39.87 ? 16  DC  D C4    1 
ATOM   427  N N4    . DC  B 2 7   ? 56.923 48.329 -12.893 1.00 36.66 ? 16  DC  D N4    1 
ATOM   428  C C5    . DC  B 2 7   ? 55.874 46.315 -13.493 1.00 37.49 ? 16  DC  D C5    1 
ATOM   429  C C6    . DC  B 2 7   ? 55.765 45.319 -14.384 1.00 39.08 ? 16  DC  D C6    1 
ATOM   430  P P     . DA  B 2 8   ? 57.254 40.164 -14.980 1.00 47.51 ? 17  DA  D P     1 
ATOM   431  O OP1   . DA  B 2 8   ? 57.062 40.280 -16.447 1.00 47.68 ? 17  DA  D OP1   1 
ATOM   432  O OP2   . DA  B 2 8   ? 57.103 38.827 -14.313 1.00 43.16 ? 17  DA  D OP2   1 
ATOM   433  O "O5'" . DA  B 2 8   ? 58.662 40.806 -14.644 1.00 49.14 ? 17  DA  D "O5'" 1 
ATOM   434  C "C5'" . DA  B 2 8   ? 59.606 41.045 -15.685 1.00 52.59 ? 17  DA  D "C5'" 1 
ATOM   435  C "C4'" . DA  B 2 8   ? 60.984 40.552 -15.283 1.00 61.51 ? 17  DA  D "C4'" 1 
ATOM   436  O "O4'" . DA  B 2 8   ? 61.692 41.662 -14.678 1.00 62.82 ? 17  DA  D "O4'" 1 
ATOM   437  C "C3'" . DA  B 2 8   ? 61.082 39.363 -14.299 1.00 62.09 ? 17  DA  D "C3'" 1 
ATOM   438  O "O3'" . DA  B 2 8   ? 62.087 38.407 -14.701 1.00 59.46 ? 17  DA  D "O3'" 1 
ATOM   439  C "C2'" . DA  B 2 8   ? 61.511 39.995 -12.990 1.00 64.24 ? 17  DA  D "C2'" 1 
ATOM   440  C "C1'" . DA  B 2 8   ? 61.807 41.454 -13.292 1.00 63.18 ? 17  DA  D "C1'" 1 
ATOM   441  N N9    . DA  B 2 8   ? 60.734 42.166 -12.688 1.00 61.41 ? 17  DA  D N9    1 
ATOM   442  C C8    . DA  B 2 8   ? 59.501 41.644 -12.318 1.00 65.01 ? 17  DA  D C8    1 
ATOM   443  N N7    . DA  B 2 8   ? 58.688 42.515 -11.783 1.00 64.33 ? 17  DA  D N7    1 
ATOM   444  C C5    . DA  B 2 8   ? 59.425 43.685 -11.795 1.00 63.62 ? 17  DA  D C5    1 
ATOM   445  C C6    . DA  B 2 8   ? 59.148 45.036 -11.352 1.00 62.62 ? 17  DA  D C6    1 
ATOM   446  N N6    . DA  B 2 8   ? 58.042 45.529 -10.778 1.00 53.58 ? 17  DA  D N6    1 
ATOM   447  N N1    . DA  B 2 8   ? 60.112 45.920 -11.529 1.00 67.65 ? 17  DA  D N1    1 
ATOM   448  C C2    . DA  B 2 8   ? 61.279 45.547 -12.092 1.00 63.86 ? 17  DA  D C2    1 
ATOM   449  N N3    . DA  B 2 8   ? 61.658 44.374 -12.530 1.00 66.53 ? 17  DA  D N3    1 
ATOM   450  C C4    . DA  B 2 8   ? 60.680 43.478 -12.351 1.00 61.98 ? 17  DA  D C4    1 
ATOM   451  P P     . DC  B 2 9   ? 63.465 38.253 -13.852 1.00 56.58 ? 18  DC  D P     1 
ATOM   452  O OP1   . DC  B 2 9   ? 64.227 37.150 -14.508 1.00 59.51 ? 18  DC  D OP1   1 
ATOM   453  O OP2   . DC  B 2 9   ? 63.164 38.178 -12.399 1.00 55.71 ? 18  DC  D OP2   1 
ATOM   454  O "O5'" . DC  B 2 9   ? 64.301 39.579 -14.115 1.00 53.37 ? 18  DC  D "O5'" 1 
ATOM   455  C "C5'" . DC  B 2 9   ? 65.742 39.568 -13.974 1.00 57.63 ? 18  DC  D "C5'" 1 
ATOM   456  C "C4'" . DC  B 2 9   ? 66.165 40.444 -12.819 1.00 59.66 ? 18  DC  D "C4'" 1 
ATOM   457  O "O4'" . DC  B 2 9   ? 65.057 41.335 -12.538 1.00 66.05 ? 18  DC  D "O4'" 1 
ATOM   458  C "C3'" . DC  B 2 9   ? 66.455 39.729 -11.488 1.00 61.04 ? 18  DC  D "C3'" 1 
ATOM   459  O "O3'" . DC  B 2 9   ? 67.891 39.583 -11.254 1.00 58.62 ? 18  DC  D "O3'" 1 
ATOM   460  C "C2'" . DC  B 2 9   ? 65.795 40.631 -10.453 1.00 61.79 ? 18  DC  D "C2'" 1 
ATOM   461  C "C1'" . DC  B 2 9   ? 65.294 41.838 -11.248 1.00 65.59 ? 18  DC  D "C1'" 1 
ATOM   462  N N1    . DC  B 2 9   ? 64.029 42.319 -10.644 1.00 66.05 ? 18  DC  D N1    1 
ATOM   463  C C2    . DC  B 2 9   ? 63.851 43.756 -10.357 1.00 61.55 ? 18  DC  D C2    1 
ATOM   464  O O2    . DC  B 2 9   ? 64.719 44.632 -10.696 1.00 55.20 ? 18  DC  D O2    1 
ATOM   465  N N3    . DC  B 2 9   ? 62.724 44.137 -9.720  1.00 59.86 ? 18  DC  D N3    1 
ATOM   466  C C4    . DC  B 2 9   ? 61.789 43.228 -9.389  1.00 63.44 ? 18  DC  D C4    1 
ATOM   467  N N4    . DC  B 2 9   ? 60.679 43.632 -8.770  1.00 61.88 ? 18  DC  D N4    1 
ATOM   468  C C5    . DC  B 2 9   ? 61.922 41.844 -9.690  1.00 64.28 ? 18  DC  D C5    1 
ATOM   469  C C6    . DC  B 2 9   ? 63.040 41.434 -10.309 1.00 64.78 ? 18  DC  D C6    1 
ATOM   470  P P     . DA  B 2 10  ? 68.569 40.108 -9.868  1.00 52.64 ? 19  DA  D P     1 
ATOM   471  O OP1   . DA  B 2 10  ? 69.995 39.704 -9.804  1.00 46.31 ? 19  DA  D OP1   1 
ATOM   472  O OP2   . DA  B 2 10  ? 67.651 39.693 -8.742  1.00 47.17 ? 19  DA  D OP2   1 
ATOM   473  O "O5'" . DA  B 2 10  ? 68.570 41.700 -10.087 1.00 53.49 ? 19  DA  D "O5'" 1 
ATOM   474  C "C5'" . DA  B 2 10  ? 69.703 42.394 -10.728 1.00 49.72 ? 19  DA  D "C5'" 1 
ATOM   475  C "C4'" . DA  B 2 10  ? 69.967 43.733 -10.059 1.00 49.17 ? 19  DA  D "C4'" 1 
ATOM   476  O "O4'" . DA  B 2 10  ? 68.691 44.279 -9.644  1.00 54.94 ? 19  DA  D "O4'" 1 
ATOM   477  C "C3'" . DA  B 2 10  ? 70.808 43.707 -8.772  1.00 51.30 ? 19  DA  D "C3'" 1 
ATOM   478  O "O3'" . DA  B 2 10  ? 71.453 44.989 -8.557  1.00 49.58 ? 19  DA  D "O3'" 1 
ATOM   479  C "C2'" . DA  B 2 10  ? 69.757 43.436 -7.704  1.00 51.85 ? 19  DA  D "C2'" 1 
ATOM   480  C "C1'" . DA  B 2 10  ? 68.557 44.222 -8.210  1.00 51.44 ? 19  DA  D "C1'" 1 
ATOM   481  N N9    . DA  B 2 10  ? 67.232 43.659 -7.909  1.00 48.50 ? 19  DA  D N9    1 
ATOM   482  C C8    . DA  B 2 10  ? 66.801 42.350 -7.925  1.00 45.01 ? 19  DA  D C8    1 
ATOM   483  N N7    . DA  B 2 10  ? 65.530 42.208 -7.631  1.00 49.81 ? 19  DA  D N7    1 
ATOM   484  C C5    . DA  B 2 10  ? 65.098 43.511 -7.404  1.00 49.96 ? 19  DA  D C5    1 
ATOM   485  C C6    . DA  B 2 10  ? 63.852 44.057 -7.034  1.00 47.41 ? 19  DA  D C6    1 
ATOM   486  N N6    . DA  B 2 10  ? 62.757 43.348 -6.823  1.00 47.09 ? 19  DA  D N6    1 
ATOM   487  N N1    . DA  B 2 10  ? 63.771 45.384 -6.883  1.00 41.44 ? 19  DA  D N1    1 
ATOM   488  C C2    . DA  B 2 10  ? 64.858 46.117 -7.073  1.00 47.43 ? 19  DA  D C2    1 
ATOM   489  N N3    . DA  B 2 10  ? 66.076 45.736 -7.409  1.00 49.38 ? 19  DA  D N3    1 
ATOM   490  C C4    . DA  B 2 10  ? 66.135 44.405 -7.563  1.00 48.88 ? 19  DA  D C4    1 
ATOM   491  P P     . DT  B 2 11  ? 72.222 45.324 -7.154  1.00 55.30 ? 20  DT  D P     1 
ATOM   492  O OP1   . DT  B 2 11  ? 73.709 45.200 -7.430  1.00 51.64 ? 20  DT  D OP1   1 
ATOM   493  O OP2   . DT  B 2 11  ? 71.608 44.513 -6.033  1.00 50.76 ? 20  DT  D OP2   1 
ATOM   494  O "O5'" . DT  B 2 11  ? 71.883 46.878 -6.824  1.00 53.34 ? 20  DT  D "O5'" 1 
ATOM   495  C "C5'" . DT  B 2 11  ? 70.934 47.661 -7.638  1.00 47.73 ? 20  DT  D "C5'" 1 
ATOM   496  C "C4'" . DT  B 2 11  ? 69.960 48.445 -6.778  1.00 44.61 ? 20  DT  D "C4'" 1 
ATOM   497  O "O4'" . DT  B 2 11  ? 68.700 47.748 -6.586  1.00 48.96 ? 20  DT  D "O4'" 1 
ATOM   498  C "C3'" . DT  B 2 11  ? 70.488 48.781 -5.392  1.00 47.61 ? 20  DT  D "C3'" 1 
ATOM   499  O "O3'" . DT  B 2 11  ? 70.753 50.164 -5.325  1.00 53.89 ? 20  DT  D "O3'" 1 
ATOM   500  C "C2'" . DT  B 2 11  ? 69.362 48.452 -4.426  1.00 47.08 ? 20  DT  D "C2'" 1 
ATOM   501  C "C1'" . DT  B 2 11  ? 68.188 47.953 -5.258  1.00 48.86 ? 20  DT  D "C1'" 1 
ATOM   502  N N1    . DT  B 2 11  ? 67.635 46.634 -4.712  1.00 49.92 ? 20  DT  D N1    1 
ATOM   503  C C2    . DT  B 2 11  ? 66.629 46.681 -3.740  1.00 44.08 ? 20  DT  D C2    1 
ATOM   504  O O2    . DT  B 2 11  ? 66.143 47.728 -3.295  1.00 19.82 ? 20  DT  D O2    1 
ATOM   505  N N3    . DT  B 2 11  ? 66.209 45.431 -3.298  1.00 48.95 ? 20  DT  D N3    1 
ATOM   506  C C4    . DT  B 2 11  ? 66.667 44.178 -3.706  1.00 47.85 ? 20  DT  D C4    1 
ATOM   507  O O4    . DT  B 2 11  ? 66.189 43.147 -3.214  1.00 53.64 ? 20  DT  D O4    1 
ATOM   508  C C5    . DT  B 2 11  ? 67.691 44.197 -4.703  1.00 47.09 ? 20  DT  D C5    1 
ATOM   509  C C7    . DT  B 2 11  ? 68.222 42.878 -5.172  1.00 46.33 ? 20  DT  D C7    1 
ATOM   510  C C6    . DT  B 2 11  ? 68.126 45.399 -5.161  1.00 44.28 ? 20  DT  D C6    1 
ATOM   511  P P     . DT  B 2 12  ? 71.805 50.695 -4.249  1.00 63.76 ? 21  DT  D P     1 
ATOM   512  O OP1   . DT  B 2 12  ? 71.807 52.169 -4.257  1.00 61.01 ? 21  DT  D OP1   1 
ATOM   513  O OP2   . DT  B 2 12  ? 73.099 49.926 -4.386  1.00 62.03 ? 21  DT  D OP2   1 
ATOM   514  O "O5'" . DT  B 2 12  ? 71.183 50.284 -2.855  1.00 60.16 ? 21  DT  D "O5'" 1 
ATOM   515  C "C5'" . DT  B 2 12  ? 70.868 51.281 -1.905  1.00 57.43 ? 21  DT  D "C5'" 1 
ATOM   516  C "C4'" . DT  B 2 12  ? 69.371 51.394 -1.768  1.00 53.53 ? 21  DT  D "C4'" 1 
ATOM   517  O "O4'" . DT  B 2 12  ? 68.744 50.207 -2.326  1.00 49.57 ? 21  DT  D "O4'" 1 
ATOM   518  C "C3'" . DT  B 2 12  ? 68.954 51.468 -0.295  1.00 52.03 ? 21  DT  D "C3'" 1 
ATOM   519  O "O3'" . DT  B 2 12  ? 68.778 52.855 0.113   1.00 55.89 ? 21  DT  D "O3'" 1 
ATOM   520  C "C2'" . DT  B 2 12  ? 67.638 50.717 -0.265  1.00 54.62 ? 21  DT  D "C2'" 1 
ATOM   521  C "C1'" . DT  B 2 12  ? 67.629 49.829 -1.513  1.00 54.75 ? 21  DT  D "C1'" 1 
ATOM   522  N N1    . DT  B 2 12  ? 67.700 48.360 -1.192  1.00 55.25 ? 21  DT  D N1    1 
ATOM   523  C C2    . DT  B 2 12  ? 66.732 47.914 -0.316  1.00 53.37 ? 21  DT  D C2    1 
ATOM   524  O O2    . DT  B 2 12  ? 65.893 48.661 0.171   1.00 52.86 ? 21  DT  D O2    1 
ATOM   525  N N3    . DT  B 2 12  ? 66.779 46.546 -0.027  1.00 54.66 ? 21  DT  D N3    1 
ATOM   526  C C4    . DT  B 2 12  ? 67.690 45.614 -0.524  1.00 48.34 ? 21  DT  D C4    1 
ATOM   527  O O4    . DT  B 2 12  ? 67.621 44.443 -0.192  1.00 39.60 ? 21  DT  D O4    1 
ATOM   528  C C5    . DT  B 2 12  ? 68.680 46.151 -1.429  1.00 50.37 ? 21  DT  D C5    1 
ATOM   529  C C7    . DT  B 2 12  ? 69.691 45.211 -2.002  1.00 48.87 ? 21  DT  D C7    1 
ATOM   530  C C6    . DT  B 2 12  ? 68.644 47.480 -1.717  1.00 57.20 ? 21  DT  D C6    1 
ATOM   531  P P     . DT  B 2 13  ? 69.551 53.421 1.409   1.00 51.92 ? 22  DT  D P     1 
ATOM   532  O OP1   . DT  B 2 13  ? 70.417 54.517 0.986   1.00 49.38 ? 22  DT  D OP1   1 
ATOM   533  O OP2   . DT  B 2 13  ? 70.156 52.223 2.077   1.00 55.77 ? 22  DT  D OP2   1 
ATOM   534  O "O5'" . DT  B 2 13  ? 68.394 53.999 2.346   1.00 50.96 ? 22  DT  D "O5'" 1 
ATOM   535  C "C5'" . DT  B 2 13  ? 67.887 53.209 3.478   1.00 46.90 ? 22  DT  D "C5'" 1 
ATOM   536  C "C4'" . DT  B 2 13  ? 66.414 52.904 3.298   1.00 35.54 ? 22  DT  D "C4'" 1 
ATOM   537  O "O4'" . DT  B 2 13  ? 66.216 51.996 2.203   1.00 35.59 ? 22  DT  D "O4'" 1 
ATOM   538  C "C3'" . DT  B 2 13  ? 65.751 52.225 4.479   1.00 33.02 ? 22  DT  D "C3'" 1 
ATOM   539  O "O3'" . DT  B 2 13  ? 65.323 53.258 5.373   1.00 38.45 ? 22  DT  D "O3'" 1 
ATOM   540  C "C2'" . DT  B 2 13  ? 64.632 51.455 3.810   1.00 34.35 ? 22  DT  D "C2'" 1 
ATOM   541  C "C1'" . DT  B 2 13  ? 65.307 50.970 2.557   1.00 35.26 ? 22  DT  D "C1'" 1 
ATOM   542  N N1    . DT  B 2 13  ? 66.089 49.727 2.739   1.00 37.49 ? 22  DT  D N1    1 
ATOM   543  C C2    . DT  B 2 13  ? 65.412 48.524 2.866   1.00 39.65 ? 22  DT  D C2    1 
ATOM   544  O O2    . DT  B 2 13  ? 64.182 48.487 2.830   1.00 32.29 ? 22  DT  D O2    1 
ATOM   545  N N3    . DT  B 2 13  ? 66.243 47.365 3.034   1.00 45.44 ? 22  DT  D N3    1 
ATOM   546  C C4    . DT  B 2 13  ? 67.639 47.378 3.064   1.00 40.60 ? 22  DT  D C4    1 
ATOM   547  O O4    . DT  B 2 13  ? 68.267 46.260 3.206   1.00 40.48 ? 22  DT  D O4    1 
ATOM   548  C C5    . DT  B 2 13  ? 68.266 48.702 2.935   1.00 41.10 ? 22  DT  D C5    1 
ATOM   549  C C7    . DT  B 2 13  ? 69.755 48.817 2.973   1.00 36.61 ? 22  DT  D C7    1 
ATOM   550  C C6    . DT  B 2 13  ? 67.472 49.777 2.783   1.00 39.29 ? 22  DT  D C6    1 
ATOM   551  P P     . DT  B 2 14  ? 63.865 53.216 6.068   1.00 43.65 ? 23  DT  D P     1 
ATOM   552  O OP1   . DT  B 2 14  ? 62.825 53.548 5.051   1.00 43.07 ? 23  DT  D OP1   1 
ATOM   553  O OP2   . DT  B 2 14  ? 63.959 54.062 7.307   1.00 43.02 ? 23  DT  D OP2   1 
ATOM   554  O "O5'" . DT  B 2 14  ? 63.698 51.698 6.538   1.00 45.02 ? 23  DT  D "O5'" 1 
ATOM   555  C "C5'" . DT  B 2 14  ? 62.522 50.942 6.171   1.00 46.30 ? 23  DT  D "C5'" 1 
ATOM   556  C "C4'" . DT  B 2 14  ? 62.478 49.614 6.894   1.00 42.82 ? 23  DT  D "C4'" 1 
ATOM   557  O "O4'" . DT  B 2 14  ? 63.505 48.727 6.416   1.00 39.31 ? 23  DT  D "O4'" 1 
ATOM   558  C "C3'" . DT  B 2 14  ? 62.665 49.687 8.409   1.00 43.90 ? 23  DT  D "C3'" 1 
ATOM   559  O "O3'" . DT  B 2 14  ? 61.617 48.972 9.051   1.00 51.35 ? 23  DT  D "O3'" 1 
ATOM   560  C "C2'" . DT  B 2 14  ? 63.955 48.938 8.652   1.00 41.71 ? 23  DT  D "C2'" 1 
ATOM   561  C "C1'" . DT  B 2 14  ? 63.863 47.956 7.531   1.00 43.16 ? 23  DT  D "C1'" 1 
ATOM   562  N N1    . DT  B 2 14  ? 65.115 47.296 7.239   1.00 45.31 ? 23  DT  D N1    1 
ATOM   563  C C2    . DT  B 2 14  ? 65.122 45.939 7.354   1.00 52.18 ? 23  DT  D C2    1 
ATOM   564  O O2    . DT  B 2 14  ? 64.130 45.278 7.692   1.00 57.10 ? 23  DT  D O2    1 
ATOM   565  N N3    . DT  B 2 14  ? 66.334 45.370 7.061   1.00 53.76 ? 23  DT  D N3    1 
ATOM   566  C C4    . DT  B 2 14  ? 67.485 46.023 6.679   1.00 49.56 ? 23  DT  D C4    1 
ATOM   567  O O4    . DT  B 2 14  ? 68.502 45.400 6.439   1.00 46.04 ? 23  DT  D O4    1 
ATOM   568  C C5    . DT  B 2 14  ? 67.397 47.433 6.595   1.00 44.45 ? 23  DT  D C5    1 
ATOM   569  C C7    . DT  B 2 14  ? 68.614 48.200 6.196   1.00 53.50 ? 23  DT  D C7    1 
ATOM   570  C C6    . DT  B 2 14  ? 66.233 48.003 6.871   1.00 40.25 ? 23  DT  D C6    1 
ATOM   571  P P     . DT  B 2 15  ? 61.500 49.008 10.652  1.00 56.89 ? 24  DT  D P     1 
ATOM   572  O OP1   . DT  B 2 15  ? 60.081 49.359 11.002  1.00 54.33 ? 24  DT  D OP1   1 
ATOM   573  O OP2   . DT  B 2 15  ? 62.634 49.788 11.266  1.00 54.68 ? 24  DT  D OP2   1 
ATOM   574  O "O5'" . DT  B 2 15  ? 61.654 47.478 11.032  1.00 55.56 ? 24  DT  D "O5'" 1 
ATOM   575  C "C5'" . DT  B 2 15  ? 60.665 46.571 10.581  1.00 50.19 ? 24  DT  D "C5'" 1 
ATOM   576  C "C4'" . DT  B 2 15  ? 61.175 45.169 10.727  1.00 48.71 ? 24  DT  D "C4'" 1 
ATOM   577  O "O4'" . DT  B 2 15  ? 62.383 45.025 9.964   1.00 43.46 ? 24  DT  D "O4'" 1 
ATOM   578  C "C3'" . DT  B 2 15  ? 61.543 44.815 12.160  1.00 46.01 ? 24  DT  D "C3'" 1 
ATOM   579  O "O3'" . DT  B 2 15  ? 60.343 44.299 12.786  1.00 47.28 ? 24  DT  D "O3'" 1 
ATOM   580  C "C2'" . DT  B 2 15  ? 62.581 43.730 11.943  1.00 46.11 ? 24  DT  D "C2'" 1 
ATOM   581  C "C1'" . DT  B 2 15  ? 63.093 43.945 10.519  1.00 43.04 ? 24  DT  D "C1'" 1 
ATOM   582  N N1    . DT  B 2 15  ? 64.482 44.301 10.496  1.00 39.81 ? 24  DT  D N1    1 
ATOM   583  C C2    . DT  B 2 15  ? 65.364 43.452 9.894   1.00 40.10 ? 24  DT  D C2    1 
ATOM   584  O O2    . DT  B 2 15  ? 65.041 42.397 9.370   1.00 39.56 ? 24  DT  D O2    1 
ATOM   585  N N3    . DT  B 2 15  ? 66.646 43.873 9.923   1.00 37.28 ? 24  DT  D N3    1 
ATOM   586  C C4    . DT  B 2 15  ? 67.131 45.016 10.471  1.00 41.34 ? 24  DT  D C4    1 
ATOM   587  O O4    . DT  B 2 15  ? 68.304 45.272 10.438  1.00 49.25 ? 24  DT  D O4    1 
ATOM   588  C C5    . DT  B 2 15  ? 66.141 45.869 11.080  1.00 44.21 ? 24  DT  D C5    1 
ATOM   589  C C7    . DT  B 2 15  ? 66.580 47.165 11.694  1.00 55.22 ? 24  DT  D C7    1 
ATOM   590  C C6    . DT  B 2 15  ? 64.878 45.467 11.065  1.00 38.43 ? 24  DT  D C6    1 
ATOM   591  P P     . DC  B 2 16  ? 60.107 44.421 14.381  1.00 44.16 ? 25  DC  D P     1 
ATOM   592  O OP1   . DC  B 2 16  ? 58.665 44.724 14.617  1.00 42.15 ? 25  DC  D OP1   1 
ATOM   593  O OP2   . DC  B 2 16  ? 61.165 45.274 15.022  1.00 49.07 ? 25  DC  D OP2   1 
ATOM   594  O "O5'" . DC  B 2 16  ? 60.358 42.929 14.899  1.00 55.93 ? 25  DC  D "O5'" 1 
ATOM   595  C "C5'" . DC  B 2 16  ? 60.898 41.907 14.030  1.00 46.35 ? 25  DC  D "C5'" 1 
ATOM   596  C "C4'" . DC  B 2 16  ? 62.263 41.450 14.506  1.00 47.78 ? 25  DC  D "C4'" 1 
ATOM   597  O "O4'" . DC  B 2 16  ? 63.294 42.300 13.944  1.00 47.44 ? 25  DC  D "O4'" 1 
ATOM   598  C "C3'" . DC  B 2 16  ? 62.531 41.401 16.020  1.00 48.04 ? 25  DC  D "C3'" 1 
ATOM   599  O "O3'" . DC  B 2 16  ? 62.305 40.050 16.528  1.00 54.95 ? 25  DC  D "O3'" 1 
ATOM   600  C "C2'" . DC  B 2 16  ? 64.010 41.769 16.111  1.00 48.05 ? 25  DC  D "C2'" 1 
ATOM   601  C "C1'" . DC  B 2 16  ? 64.486 42.018 14.657  1.00 47.99 ? 25  DC  D "C1'" 1 
ATOM   602  N N1    . DC  B 2 16  ? 65.366 43.213 14.646  1.00 48.15 ? 25  DC  D N1    1 
ATOM   603  C C2    . DC  B 2 16  ? 66.763 43.040 14.600  1.00 39.03 ? 25  DC  D C2    1 
ATOM   604  O O2    . DC  B 2 16  ? 67.231 41.912 14.506  1.00 30.19 ? 25  DC  D O2    1 
ATOM   605  N N3    . DC  B 2 16  ? 67.564 44.117 14.661  1.00 33.18 ? 25  DC  D N3    1 
ATOM   606  C C4    . DC  B 2 16  ? 67.046 45.322 14.750  1.00 31.37 ? 25  DC  D C4    1 
ATOM   607  N N4    . DC  B 2 16  ? 67.912 46.307 14.823  1.00 44.03 ? 25  DC  D N4    1 
ATOM   608  C C5    . DC  B 2 16  ? 65.618 45.553 14.772  1.00 35.48 ? 25  DC  D C5    1 
ATOM   609  C C6    . DC  B 2 16  ? 64.826 44.482 14.717  1.00 40.50 ? 25  DC  D C6    1 
ATOM   610  P P     . DG  B 2 17  ? 62.776 39.632 18.030  1.00 53.25 ? 26  DG  D P     1 
ATOM   611  O OP1   . DG  B 2 17  ? 61.665 38.829 18.650  1.00 46.22 ? 26  DG  D OP1   1 
ATOM   612  O OP2   . DG  B 2 17  ? 63.292 40.877 18.725  1.00 54.14 ? 26  DG  D OP2   1 
ATOM   613  O "O5'" . DG  B 2 17  ? 64.021 38.667 17.814  1.00 45.54 ? 26  DG  D "O5'" 1 
ATOM   614  C "C5'" . DG  B 2 17  ? 63.992 37.649 16.779  1.00 50.79 ? 26  DG  D "C5'" 1 
ATOM   615  C "C4'" . DG  B 2 17  ? 65.349 36.995 16.647  1.00 50.06 ? 26  DG  D "C4'" 1 
ATOM   616  O "O4'" . DG  B 2 17  ? 66.325 38.011 16.271  1.00 53.35 ? 26  DG  D "O4'" 1 
ATOM   617  C "C3'" . DG  B 2 17  ? 65.858 36.411 17.963  1.00 49.69 ? 26  DG  D "C3'" 1 
ATOM   618  O "O3'" . DG  B 2 17  ? 66.728 35.313 17.683  1.00 46.06 ? 26  DG  D "O3'" 1 
ATOM   619  C "C2'" . DG  B 2 17  ? 66.619 37.588 18.572  1.00 54.29 ? 26  DG  D "C2'" 1 
ATOM   620  C "C1'" . DG  B 2 17  ? 67.281 38.205 17.335  1.00 56.20 ? 26  DG  D "C1'" 1 
ATOM   621  N N9    . DG  B 2 17  ? 67.638 39.636 17.358  1.00 50.30 ? 26  DG  D N9    1 
ATOM   622  C C8    . DG  B 2 17  ? 66.778 40.657 17.670  1.00 47.51 ? 26  DG  D C8    1 
ATOM   623  N N7    . DG  B 2 17  ? 67.330 41.833 17.576  1.00 48.59 ? 26  DG  D N7    1 
ATOM   624  C C5    . DG  B 2 17  ? 68.642 41.583 17.186  1.00 41.72 ? 26  DG  D C5    1 
ATOM   625  C C6    . DG  B 2 17  ? 69.636 42.475 16.928  1.00 39.89 ? 26  DG  D C6    1 
ATOM   626  O O6    . DG  B 2 17  ? 69.545 43.752 17.020  1.00 32.40 ? 26  DG  D O6    1 
ATOM   627  N N1    . DG  B 2 17  ? 70.830 41.811 16.533  1.00 32.48 ? 26  DG  D N1    1 
ATOM   628  C C2    . DG  B 2 17  ? 71.003 40.493 16.437  1.00 34.13 ? 26  DG  D C2    1 
ATOM   629  N N2    . DG  B 2 17  ? 72.227 40.104 16.072  1.00 21.00 ? 26  DG  D N2    1 
ATOM   630  N N3    . DG  B 2 17  ? 70.038 39.617 16.686  1.00 49.18 ? 26  DG  D N3    1 
ATOM   631  C C4    . DG  B 2 17  ? 68.870 40.237 17.054  1.00 48.42 ? 26  DG  D C4    1 
ATOM   632  O "O5'" . DG  C 1 1   ? 78.000 46.144 19.729  1.00 49.34 ? 27  DG  E "O5'" 1 
ATOM   633  C "C5'" . DG  C 1 1   ? 78.338 47.428 19.072  1.00 47.41 ? 27  DG  E "C5'" 1 
ATOM   634  C "C4'" . DG  C 1 1   ? 77.230 47.766 18.102  1.00 42.37 ? 27  DG  E "C4'" 1 
ATOM   635  O "O4'" . DG  C 1 1   ? 75.966 47.774 18.823  1.00 39.19 ? 27  DG  E "O4'" 1 
ATOM   636  C "C3'" . DG  C 1 1   ? 77.312 49.139 17.412  1.00 46.39 ? 27  DG  E "C3'" 1 
ATOM   637  O "O3'" . DG  C 1 1   ? 77.619 49.073 15.966  1.00 53.67 ? 27  DG  E "O3'" 1 
ATOM   638  C "C2'" . DG  C 1 1   ? 75.966 49.775 17.715  1.00 45.32 ? 27  DG  E "C2'" 1 
ATOM   639  C "C1'" . DG  C 1 1   ? 75.194 48.511 17.947  1.00 42.95 ? 27  DG  E "C1'" 1 
ATOM   640  N N9    . DG  C 1 1   ? 73.819 48.601 18.414  1.00 45.24 ? 27  DG  E N9    1 
ATOM   641  C C8    . DG  C 1 1   ? 73.027 49.719 18.302  1.00 55.05 ? 27  DG  E C8    1 
ATOM   642  N N7    . DG  C 1 1   ? 71.809 49.541 18.741  1.00 50.76 ? 27  DG  E N7    1 
ATOM   643  C C5    . DG  C 1 1   ? 71.790 48.232 19.179  1.00 41.81 ? 27  DG  E C5    1 
ATOM   644  C C6    . DG  C 1 1   ? 70.714 47.471 19.741  1.00 46.44 ? 27  DG  E C6    1 
ATOM   645  O O6    . DG  C 1 1   ? 69.543 47.833 19.998  1.00 46.23 ? 27  DG  E O6    1 
ATOM   646  N N1    . DG  C 1 1   ? 71.102 46.173 20.018  1.00 43.52 ? 27  DG  E N1    1 
ATOM   647  C C2    . DG  C 1 1   ? 72.381 45.660 19.825  1.00 43.39 ? 27  DG  E C2    1 
ATOM   648  N N2    . DG  C 1 1   ? 72.582 44.389 20.181  1.00 51.81 ? 27  DG  E N2    1 
ATOM   649  N N3    . DG  C 1 1   ? 73.399 46.360 19.313  1.00 42.49 ? 27  DG  E N3    1 
ATOM   650  C C4    . DG  C 1 1   ? 73.030 47.633 19.004  1.00 40.00 ? 27  DG  E C4    1 
ATOM   651  P P     . DC  C 1 2   ? 76.497 48.672 14.815  1.00 52.68 ? 26  DC  E P     1 
ATOM   652  O OP1   . DC  C 1 2   ? 77.089 49.067 13.504  1.00 49.97 ? 26  DC  E OP1   1 
ATOM   653  O OP2   . DC  C 1 2   ? 75.073 49.126 15.121  1.00 49.27 ? 26  DC  E OP2   1 
ATOM   654  O "O5'" . DC  C 1 2   ? 76.582 47.072 14.824  1.00 54.28 ? 26  DC  E "O5'" 1 
ATOM   655  C "C5'" . DC  C 1 2   ? 77.749 46.366 15.384  1.00 47.87 ? 26  DC  E "C5'" 1 
ATOM   656  C "C4'" . DC  C 1 2   ? 77.419 44.907 15.593  1.00 47.68 ? 26  DC  E "C4'" 1 
ATOM   657  O "O4'" . DC  C 1 2   ? 76.530 44.765 16.714  1.00 45.31 ? 26  DC  E "O4'" 1 
ATOM   658  C "C3'" . DC  C 1 2   ? 76.655 44.324 14.413  1.00 45.04 ? 26  DC  E "C3'" 1 
ATOM   659  O "O3'" . DC  C 1 2   ? 77.582 43.677 13.608  1.00 48.63 ? 26  DC  E "O3'" 1 
ATOM   660  C "C2'" . DC  C 1 2   ? 75.728 43.308 15.016  1.00 46.03 ? 26  DC  E "C2'" 1 
ATOM   661  C "C1'" . DC  C 1 2   ? 75.470 43.880 16.375  1.00 47.34 ? 26  DC  E "C1'" 1 
ATOM   662  N N1    . DC  C 1 2   ? 74.206 44.604 16.504  1.00 55.22 ? 26  DC  E N1    1 
ATOM   663  C C2    . DC  C 1 2   ? 73.073 43.845 16.762  1.00 59.50 ? 26  DC  E C2    1 
ATOM   664  O O2    . DC  C 1 2   ? 73.191 42.581 16.860  1.00 55.79 ? 26  DC  E O2    1 
ATOM   665  N N3    . DC  C 1 2   ? 71.868 44.467 16.913  1.00 56.87 ? 26  DC  E N3    1 
ATOM   666  C C4    . DC  C 1 2   ? 71.786 45.798 16.830  1.00 60.40 ? 26  DC  E C4    1 
ATOM   667  N N4    . DC  C 1 2   ? 70.567 46.340 16.969  1.00 66.64 ? 26  DC  E N4    1 
ATOM   668  C C5    . DC  C 1 2   ? 72.947 46.600 16.596  1.00 64.11 ? 26  DC  E C5    1 
ATOM   669  C C6    . DC  C 1 2   ? 74.123 45.963 16.418  1.00 63.58 ? 26  DC  E C6    1 
ATOM   670  P P     . DG  C 1 3   ? 78.375 44.522 12.529  1.00 52.89 ? 25  DG  E P     1 
ATOM   671  O OP1   . DG  C 1 3   ? 79.816 44.565 12.974  1.00 45.13 ? 25  DG  E OP1   1 
ATOM   672  O OP2   . DG  C 1 3   ? 77.582 45.791 12.412  1.00 50.49 ? 25  DG  E OP2   1 
ATOM   673  O "O5'" . DG  C 1 3   ? 78.152 43.696 11.165  1.00 55.65 ? 25  DG  E "O5'" 1 
ATOM   674  C "C5'" . DG  C 1 3   ? 78.198 42.226 11.118  1.00 48.28 ? 25  DG  E "C5'" 1 
ATOM   675  C "C4'" . DG  C 1 3   ? 76.825 41.606 10.909  1.00 48.01 ? 25  DG  E "C4'" 1 
ATOM   676  O "O4'" . DG  C 1 3   ? 76.118 41.608 12.173  1.00 46.19 ? 25  DG  E "O4'" 1 
ATOM   677  C "C3'" . DG  C 1 3   ? 75.806 42.234 9.952   1.00 48.43 ? 25  DG  E "C3'" 1 
ATOM   678  O "O3'" . DG  C 1 3   ? 75.948 41.973 8.524   1.00 53.04 ? 25  DG  E "O3'" 1 
ATOM   679  C "C2'" . DG  C 1 3   ? 74.535 41.547 10.416  1.00 48.02 ? 25  DG  E "C2'" 1 
ATOM   680  C "C1'" . DG  C 1 3   ? 74.706 41.515 11.929  1.00 48.82 ? 25  DG  E "C1'" 1 
ATOM   681  N N9    . DG  C 1 3   ? 74.031 42.711 12.436  1.00 49.16 ? 25  DG  E N9    1 
ATOM   682  C C8    . DG  C 1 3   ? 74.522 43.997 12.572  1.00 44.53 ? 25  DG  E C8    1 
ATOM   683  N N7    . DG  C 1 3   ? 73.633 44.839 13.025  1.00 45.13 ? 25  DG  E N7    1 
ATOM   684  C C5    . DG  C 1 3   ? 72.480 44.065 13.200  1.00 55.85 ? 25  DG  E C5    1 
ATOM   685  C C6    . DG  C 1 3   ? 71.119 44.417 13.655  1.00 53.60 ? 25  DG  E C6    1 
ATOM   686  O O6    . DG  C 1 3   ? 70.658 45.509 13.992  1.00 48.27 ? 25  DG  E O6    1 
ATOM   687  N N1    . DG  C 1 3   ? 70.285 43.309 13.676  1.00 59.02 ? 25  DG  E N1    1 
ATOM   688  C C2    . DG  C 1 3   ? 70.659 42.034 13.323  1.00 57.26 ? 25  DG  E C2    1 
ATOM   689  N N2    . DG  C 1 3   ? 69.710 41.106 13.427  1.00 63.48 ? 25  DG  E N2    1 
ATOM   690  N N3    . DG  C 1 3   ? 71.871 41.690 12.892  1.00 57.34 ? 25  DG  E N3    1 
ATOM   691  C C4    . DG  C 1 3   ? 72.722 42.748 12.855  1.00 54.80 ? 25  DG  E C4    1 
ATOM   692  P P     . DA  C 1 4   ? 76.709 40.649 7.967   1.00 53.95 ? 24  DA  E P     1 
ATOM   693  O OP1   . DA  C 1 4   ? 77.966 40.436 8.778   1.00 52.19 ? 24  DA  E OP1   1 
ATOM   694  O OP2   . DA  C 1 4   ? 76.825 40.843 6.472   1.00 57.68 ? 24  DA  E OP2   1 
ATOM   695  O "O5'" . DA  C 1 4   ? 75.660 39.452 8.158   1.00 50.62 ? 24  DA  E "O5'" 1 
ATOM   696  C "C5'" . DA  C 1 4   ? 75.251 38.605 7.025   1.00 51.21 ? 24  DA  E "C5'" 1 
ATOM   697  C "C4'" . DA  C 1 4   ? 74.052 37.752 7.395   1.00 48.97 ? 24  DA  E "C4'" 1 
ATOM   698  O "O4'" . DA  C 1 4   ? 73.224 38.529 8.288   1.00 47.77 ? 24  DA  E "O4'" 1 
ATOM   699  C "C3'" . DA  C 1 4   ? 73.117 37.359 6.250   1.00 46.51 ? 24  DA  E "C3'" 1 
ATOM   700  O "O3'" . DA  C 1 4   ? 72.368 36.192 6.662   1.00 43.04 ? 24  DA  E "O3'" 1 
ATOM   701  C "C2'" . DA  C 1 4   ? 72.240 38.606 6.141   1.00 42.12 ? 24  DA  E "C2'" 1 
ATOM   702  C "C1'" . DA  C 1 4   ? 72.041 38.951 7.621   1.00 42.10 ? 24  DA  E "C1'" 1 
ATOM   703  N N9    . DA  C 1 4   ? 71.849 40.369 7.930   1.00 45.80 ? 24  DA  E N9    1 
ATOM   704  C C8    . DA  C 1 4   ? 72.789 41.354 7.825   1.00 47.16 ? 24  DA  E C8    1 
ATOM   705  N N7    . DA  C 1 4   ? 72.350 42.534 8.169   1.00 44.07 ? 24  DA  E N7    1 
ATOM   706  C C5    . DA  C 1 4   ? 71.033 42.311 8.533   1.00 42.40 ? 24  DA  E C5    1 
ATOM   707  C C6    . DA  C 1 4   ? 70.033 43.180 8.956   1.00 43.71 ? 24  DA  E C6    1 
ATOM   708  N N6    . DA  C 1 4   ? 70.269 44.476 9.095   1.00 35.94 ? 24  DA  E N6    1 
ATOM   709  N N1    . DA  C 1 4   ? 68.789 42.665 9.218   1.00 47.55 ? 24  DA  E N1    1 
ATOM   710  C C2    . DA  C 1 4   ? 68.626 41.332 9.063   1.00 43.21 ? 24  DA  E C2    1 
ATOM   711  N N3    . DA  C 1 4   ? 69.505 40.424 8.639   1.00 40.48 ? 24  DA  E N3    1 
ATOM   712  C C4    . DA  C 1 4   ? 70.695 40.992 8.366   1.00 40.64 ? 24  DA  E C4    1 
ATOM   713  P P     . DA  C 1 5   ? 71.438 35.394 5.603   1.00 51.78 ? 23  DA  E P     1 
ATOM   714  O OP1   . DA  C 1 5   ? 71.970 33.997 5.581   1.00 52.07 ? 23  DA  E OP1   1 
ATOM   715  O OP2   . DA  C 1 5   ? 71.404 36.185 4.330   1.00 46.41 ? 23  DA  E OP2   1 
ATOM   716  O "O5'" . DA  C 1 5   ? 69.946 35.350 6.226   1.00 47.40 ? 23  DA  E "O5'" 1 
ATOM   717  C "C5'" . DA  C 1 5   ? 68.796 34.849 5.422   1.00 48.20 ? 23  DA  E "C5'" 1 
ATOM   718  C "C4'" . DA  C 1 5   ? 67.446 35.082 6.096   1.00 45.81 ? 23  DA  E "C4'" 1 
ATOM   719  O "O4'" . DA  C 1 5   ? 67.448 36.242 6.956   1.00 46.66 ? 23  DA  E "O4'" 1 
ATOM   720  C "C3'" . DA  C 1 5   ? 66.281 35.333 5.124   1.00 45.61 ? 23  DA  E "C3'" 1 
ATOM   721  O "O3'" . DA  C 1 5   ? 65.005 34.934 5.654   1.00 46.02 ? 23  DA  E "O3'" 1 
ATOM   722  C "C2'" . DA  C 1 5   ? 66.250 36.838 5.020   1.00 44.86 ? 23  DA  E "C2'" 1 
ATOM   723  C "C1'" . DA  C 1 5   ? 66.592 37.275 6.430   1.00 46.30 ? 23  DA  E "C1'" 1 
ATOM   724  N N9    . DA  C 1 5   ? 67.348 38.542 6.407   1.00 51.69 ? 23  DA  E N9    1 
ATOM   725  C C8    . DA  C 1 5   ? 68.689 38.677 6.092   1.00 53.08 ? 23  DA  E C8    1 
ATOM   726  N N7    . DA  C 1 5   ? 69.123 39.905 6.138   1.00 51.91 ? 23  DA  E N7    1 
ATOM   727  C C5    . DA  C 1 5   ? 68.002 40.637 6.516   1.00 47.75 ? 23  DA  E C5    1 
ATOM   728  C C6    . DA  C 1 5   ? 67.824 41.995 6.681   1.00 36.53 ? 23  DA  E C6    1 
ATOM   729  N N6    . DA  C 1 5   ? 68.829 42.838 6.540   1.00 32.32 ? 23  DA  E N6    1 
ATOM   730  N N1    . DA  C 1 5   ? 66.598 42.445 6.997   1.00 33.47 ? 23  DA  E N1    1 
ATOM   731  C C2    . DA  C 1 5   ? 65.615 41.541 7.133   1.00 43.42 ? 23  DA  E C2    1 
ATOM   732  N N3    . DA  C 1 5   ? 65.655 40.224 6.991   1.00 51.54 ? 23  DA  E N3    1 
ATOM   733  C C4    . DA  C 1 5   ? 66.899 39.823 6.672   1.00 50.28 ? 23  DA  E C4    1 
ATOM   734  P P     . DA  C 1 6   ? 63.656 35.248 4.817   1.00 46.92 ? 22  DA  E P     1 
ATOM   735  O OP1   . DA  C 1 6   ? 62.556 34.417 5.357   1.00 48.09 ? 22  DA  E OP1   1 
ATOM   736  O OP2   . DA  C 1 6   ? 63.970 35.184 3.334   1.00 42.48 ? 22  DA  E OP2   1 
ATOM   737  O "O5'" . DA  C 1 6   ? 63.330 36.764 5.194   1.00 45.44 ? 22  DA  E "O5'" 1 
ATOM   738  C "C5'" . DA  C 1 6   ? 62.929 37.137 6.537   1.00 41.57 ? 22  DA  E "C5'" 1 
ATOM   739  C "C4'" . DA  C 1 6   ? 62.174 38.452 6.527   1.00 33.97 ? 22  DA  E "C4'" 1 
ATOM   740  O "O4'" . DA  C 1 6   ? 63.092 39.537 6.264   1.00 21.84 ? 22  DA  E "O4'" 1 
ATOM   741  C "C3'" . DA  C 1 6   ? 61.055 38.547 5.494   1.00 28.96 ? 22  DA  E "C3'" 1 
ATOM   742  O "O3'" . DA  C 1 6   ? 59.847 39.004 6.125   1.00 34.45 ? 22  DA  E "O3'" 1 
ATOM   743  C "C2'" . DA  C 1 6   ? 61.605 39.487 4.432   1.00 28.95 ? 22  DA  E "C2'" 1 
ATOM   744  C "C1'" . DA  C 1 6   ? 62.699 40.282 5.138   1.00 31.08 ? 22  DA  E "C1'" 1 
ATOM   745  N N9    . DA  C 1 6   ? 63.929 40.588 4.403   1.00 34.74 ? 22  DA  E N9    1 
ATOM   746  C C8    . DA  C 1 6   ? 64.634 39.846 3.485   1.00 31.79 ? 22  DA  E C8    1 
ATOM   747  N N7    . DA  C 1 6   ? 65.750 40.428 3.068   1.00 34.06 ? 22  DA  E N7    1 
ATOM   748  C C5    . DA  C 1 6   ? 65.769 41.624 3.757   1.00 34.57 ? 22  DA  E C5    1 
ATOM   749  C C6    . DA  C 1 6   ? 66.651 42.736 3.714   1.00 41.01 ? 22  DA  E C6    1 
ATOM   750  N N6    . DA  C 1 6   ? 67.751 42.825 2.945   1.00 42.64 ? 22  DA  E N6    1 
ATOM   751  N N1    . DA  C 1 6   ? 66.346 43.807 4.496   1.00 46.51 ? 22  DA  E N1    1 
ATOM   752  C C2    . DA  C 1 6   ? 65.195 43.763 5.219   1.00 45.28 ? 22  DA  E C2    1 
ATOM   753  N N3    . DA  C 1 6   ? 64.285 42.804 5.315   1.00 37.23 ? 22  DA  E N3    1 
ATOM   754  C C4    . DA  C 1 6   ? 64.639 41.747 4.565   1.00 37.82 ? 22  DA  E C4    1 
ATOM   755  P P     . DA  C 1 7   ? 58.448 39.021 5.297   1.00 37.33 ? 21  DA  E P     1 
ATOM   756  O OP1   . DA  C 1 7   ? 57.301 38.343 6.006   1.00 29.13 ? 21  DA  E OP1   1 
ATOM   757  O OP2   . DA  C 1 7   ? 58.806 38.576 3.939   1.00 40.30 ? 21  DA  E OP2   1 
ATOM   758  O "O5'" . DA  C 1 7   ? 58.145 40.592 5.169   1.00 41.76 ? 21  DA  E "O5'" 1 
ATOM   759  C "C5'" . DA  C 1 7   ? 58.928 41.570 5.951   1.00 44.74 ? 21  DA  E "C5'" 1 
ATOM   760  C "C4'" . DA  C 1 7   ? 59.037 42.917 5.253   1.00 41.39 ? 21  DA  E "C4'" 1 
ATOM   761  O "O4'" . DA  C 1 7   ? 60.220 43.008 4.414   1.00 39.37 ? 21  DA  E "O4'" 1 
ATOM   762  C "C3'" . DA  C 1 7   ? 57.865 43.292 4.349   1.00 42.36 ? 21  DA  E "C3'" 1 
ATOM   763  O "O3'" . DA  C 1 7   ? 57.393 44.612 4.635   1.00 38.21 ? 21  DA  E "O3'" 1 
ATOM   764  C "C2'" . DA  C 1 7   ? 58.476 43.293 2.958   1.00 44.41 ? 21  DA  E "C2'" 1 
ATOM   765  C "C1'" . DA  C 1 7   ? 59.861 43.774 3.280   1.00 42.48 ? 21  DA  E "C1'" 1 
ATOM   766  N N9    . DA  C 1 7   ? 60.864 43.563 2.226   1.00 41.29 ? 21  DA  E N9    1 
ATOM   767  C C8    . DA  C 1 7   ? 60.847 42.740 1.130   1.00 36.72 ? 21  DA  E C8    1 
ATOM   768  N N7    . DA  C 1 7   ? 61.927 42.812 0.403   1.00 32.58 ? 21  DA  E N7    1 
ATOM   769  C C5    . DA  C 1 7   ? 62.706 43.740 1.064   1.00 40.53 ? 21  DA  E C5    1 
ATOM   770  C C6    . DA  C 1 7   ? 63.979 44.263 0.801   1.00 47.14 ? 21  DA  E C6    1 
ATOM   771  N N6    . DA  C 1 7   ? 64.741 43.894 -0.225  1.00 55.16 ? 21  DA  E N6    1 
ATOM   772  N N1    . DA  C 1 7   ? 64.462 45.188 1.638   1.00 50.62 ? 21  DA  E N1    1 
ATOM   773  C C2    . DA  C 1 7   ? 63.712 45.549 2.693   1.00 52.16 ? 21  DA  E C2    1 
ATOM   774  N N3    . DA  C 1 7   ? 62.517 45.131 3.053   1.00 50.70 ? 21  DA  E N3    1 
ATOM   775  C C4    . DA  C 1 7   ? 62.060 44.217 2.178   1.00 44.16 ? 21  DA  E C4    1 
ATOM   776  P P     . DA  C 1 8   ? 56.321 45.281 3.649   1.00 37.16 ? 20  DA  E P     1 
ATOM   777  O OP1   . DA  C 1 8   ? 55.321 46.037 4.479   1.00 36.97 ? 20  DA  E OP1   1 
ATOM   778  O OP2   . DA  C 1 8   ? 55.838 44.237 2.647   1.00 34.65 ? 20  DA  E OP2   1 
ATOM   779  O "O5'" . DA  C 1 8   ? 57.229 46.334 2.895   1.00 37.56 ? 20  DA  E "O5'" 1 
ATOM   780  C "C5'" . DA  C 1 8   ? 57.993 47.299 3.647   1.00 35.96 ? 20  DA  E "C5'" 1 
ATOM   781  C "C4'" . DA  C 1 8   ? 58.876 48.102 2.723   1.00 34.16 ? 20  DA  E "C4'" 1 
ATOM   782  O "O4'" . DA  C 1 8   ? 59.770 47.169 2.031   1.00 43.30 ? 20  DA  E "O4'" 1 
ATOM   783  C "C3'" . DA  C 1 8   ? 58.074 48.815 1.630   1.00 31.88 ? 20  DA  E "C3'" 1 
ATOM   784  O "O3'" . DA  C 1 8   ? 58.338 50.199 1.560   1.00 27.55 ? 20  DA  E "O3'" 1 
ATOM   785  C "C2'" . DA  C 1 8   ? 58.575 48.179 0.339   1.00 37.27 ? 20  DA  E "C2'" 1 
ATOM   786  C "C1'" . DA  C 1 8   ? 59.959 47.725 0.754   1.00 43.24 ? 20  DA  E "C1'" 1 
ATOM   787  N N9    . DA  C 1 8   ? 60.532 46.738 -0.175  1.00 45.68 ? 20  DA  E N9    1 
ATOM   788  C C8    . DA  C 1 8   ? 59.862 45.805 -0.919  1.00 51.54 ? 20  DA  E C8    1 
ATOM   789  N N7    . DA  C 1 8   ? 60.632 45.108 -1.720  1.00 48.03 ? 20  DA  E N7    1 
ATOM   790  C C5    . DA  C 1 8   ? 61.894 45.602 -1.478  1.00 42.37 ? 20  DA  E C5    1 
ATOM   791  C C6    . DA  C 1 8   ? 63.132 45.292 -2.030  1.00 46.05 ? 20  DA  E C6    1 
ATOM   792  N N6    . DA  C 1 8   ? 63.314 44.366 -2.985  1.00 48.10 ? 20  DA  E N6    1 
ATOM   793  N N1    . DA  C 1 8   ? 64.202 45.972 -1.574  1.00 47.73 ? 20  DA  E N1    1 
ATOM   794  C C2    . DA  C 1 8   ? 64.007 46.905 -0.624  1.00 50.64 ? 20  DA  E C2    1 
ATOM   795  N N3    . DA  C 1 8   ? 62.895 47.288 -0.036  1.00 44.08 ? 20  DA  E N3    1 
ATOM   796  C C4    . DA  C 1 8   ? 61.858 46.592 -0.513  1.00 44.52 ? 20  DA  E C4    1 
ATOM   797  P P     . DT  C 1 9   ? 57.562 51.082 0.468   1.00 35.85 ? 19  DT  E P     1 
ATOM   798  O OP1   . DT  C 1 9   ? 57.443 52.419 1.105   1.00 32.05 ? 19  DT  E OP1   1 
ATOM   799  O OP2   . DT  C 1 9   ? 56.337 50.444 -0.080  1.00 31.00 ? 19  DT  E OP2   1 
ATOM   800  O "O5'" . DT  C 1 9   ? 58.552 51.135 -0.779  1.00 29.19 ? 19  DT  E "O5'" 1 
ATOM   801  C "C5'" . DT  C 1 9   ? 59.976 51.054 -0.629  1.00 30.25 ? 19  DT  E "C5'" 1 
ATOM   802  C "C4'" . DT  C 1 9   ? 60.972 51.579 -1.707  1.00 36.14 ? 19  DT  E "C4'" 1 
ATOM   803  O "O4'" . DT  C 1 9   ? 62.072 50.712 -2.075  1.00 36.09 ? 19  DT  E "O4'" 1 
ATOM   804  C "C3'" . DT  C 1 9   ? 60.295 52.016 -3.023  1.00 36.95 ? 19  DT  E "C3'" 1 
ATOM   805  O "O3'" . DT  C 1 9   ? 59.946 53.431 -2.963  1.00 36.70 ? 19  DT  E "O3'" 1 
ATOM   806  C "C2'" . DT  C 1 9   ? 61.236 51.569 -4.126  1.00 37.12 ? 19  DT  E "C2'" 1 
ATOM   807  C "C1'" . DT  C 1 9   ? 62.102 50.509 -3.483  1.00 33.23 ? 19  DT  E "C1'" 1 
ATOM   808  N N1    . DT  C 1 9   ? 61.764 49.081 -3.772  1.00 31.40 ? 19  DT  E N1    1 
ATOM   809  C C2    . DT  C 1 9   ? 62.791 48.389 -4.341  1.00 32.07 ? 19  DT  E C2    1 
ATOM   810  O O2    . DT  C 1 9   ? 63.856 48.894 -4.604  1.00 42.62 ? 19  DT  E O2    1 
ATOM   811  N N3    . DT  C 1 9   ? 62.536 47.088 -4.602  1.00 34.32 ? 19  DT  E N3    1 
ATOM   812  C C4    . DT  C 1 9   ? 61.380 46.404 -4.370  1.00 28.63 ? 19  DT  E C4    1 
ATOM   813  O O4    . DT  C 1 9   ? 61.335 45.213 -4.674  1.00 34.30 ? 19  DT  E O4    1 
ATOM   814  C C5    . DT  C 1 9   ? 60.319 47.179 -3.784  1.00 20.79 ? 19  DT  E C5    1 
ATOM   815  C C7    . DT  C 1 9   ? 59.005 46.529 -3.510  1.00 12.78 ? 19  DT  E C7    1 
ATOM   816  C C6    . DT  C 1 9   ? 60.561 48.471 -3.512  1.00 26.03 ? 19  DT  E C6    1 
ATOM   817  P P     . DG  C 1 10  ? 60.567 54.558 -3.971  1.00 37.41 ? 18  DG  E P     1 
ATOM   818  O OP1   . DG  C 1 10  ? 61.476 55.456 -3.164  1.00 31.60 ? 18  DG  E OP1   1 
ATOM   819  O OP2   . DG  C 1 10  ? 59.344 55.140 -4.660  1.00 37.99 ? 18  DG  E OP2   1 
ATOM   820  O "O5'" . DG  C 1 10  ? 61.480 53.894 -5.078  1.00 32.46 ? 18  DG  E "O5'" 1 
ATOM   821  C "C5'" . DG  C 1 10  ? 62.852 54.275 -5.165  1.00 33.33 ? 18  DG  E "C5'" 1 
ATOM   822  C "C4'" . DG  C 1 10  ? 63.485 53.664 -6.388  1.00 40.19 ? 18  DG  E "C4'" 1 
ATOM   823  O "O4'" . DG  C 1 10  ? 63.218 52.237 -6.485  1.00 40.96 ? 18  DG  E "O4'" 1 
ATOM   824  C "C3'" . DG  C 1 10  ? 62.985 54.256 -7.700  1.00 42.74 ? 18  DG  E "C3'" 1 
ATOM   825  O "O3'" . DG  C 1 10  ? 64.112 54.229 -8.569  1.00 51.18 ? 18  DG  E "O3'" 1 
ATOM   826  C "C2'" . DG  C 1 10  ? 61.971 53.226 -8.182  1.00 45.18 ? 18  DG  E "C2'" 1 
ATOM   827  C "C1'" . DG  C 1 10  ? 62.757 51.975 -7.821  1.00 45.41 ? 18  DG  E "C1'" 1 
ATOM   828  N N9    . DG  C 1 10  ? 62.138 50.634 -7.865  1.00 43.45 ? 18  DG  E N9    1 
ATOM   829  C C8    . DG  C 1 10  ? 60.946 50.220 -7.323  1.00 41.57 ? 18  DG  E C8    1 
ATOM   830  N N7    . DG  C 1 10  ? 60.701 48.951 -7.525  1.00 41.39 ? 18  DG  E N7    1 
ATOM   831  C C5    . DG  C 1 10  ? 61.794 48.490 -8.252  1.00 46.38 ? 18  DG  E C5    1 
ATOM   832  C C6    . DG  C 1 10  ? 62.087 47.182 -8.766  1.00 52.37 ? 18  DG  E C6    1 
ATOM   833  O O6    . DG  C 1 10  ? 61.418 46.173 -8.666  1.00 59.06 ? 18  DG  E O6    1 
ATOM   834  N N1    . DG  C 1 10  ? 63.303 47.127 -9.455  1.00 51.67 ? 18  DG  E N1    1 
ATOM   835  C C2    . DG  C 1 10  ? 64.138 48.191 -9.638  1.00 49.43 ? 18  DG  E C2    1 
ATOM   836  N N2    . DG  C 1 10  ? 65.253 47.902 -10.346 1.00 49.25 ? 18  DG  E N2    1 
ATOM   837  N N3    . DG  C 1 10  ? 63.892 49.432 -9.167  1.00 49.09 ? 18  DG  E N3    1 
ATOM   838  C C4    . DG  C 1 10  ? 62.699 49.503 -8.478  1.00 45.27 ? 18  DG  E C4    1 
ATOM   839  P P     . DT  C 1 11  ? 64.382 55.441 -9.566  1.00 55.52 ? 17  DT  E P     1 
ATOM   840  O OP1   . DT  C 1 11  ? 65.414 56.303 -8.910  1.00 49.36 ? 17  DT  E OP1   1 
ATOM   841  O OP2   . DT  C 1 11  ? 63.002 55.988 -9.835  1.00 57.33 ? 17  DT  E OP2   1 
ATOM   842  O "O5'" . DT  C 1 11  ? 64.928 54.743 -10.909 1.00 53.13 ? 17  DT  E "O5'" 1 
ATOM   843  C "C5'" . DT  C 1 11  ? 64.184 54.874 -12.176 1.00 50.27 ? 17  DT  E "C5'" 1 
ATOM   844  C "C4'" . DT  C 1 11  ? 64.518 53.759 -13.148 1.00 46.40 ? 17  DT  E "C4'" 1 
ATOM   845  O "O4'" . DT  C 1 11  ? 64.405 52.502 -12.440 1.00 48.21 ? 17  DT  E "O4'" 1 
ATOM   846  C "C3'" . DT  C 1 11  ? 63.542 53.655 -14.332 1.00 47.65 ? 17  DT  E "C3'" 1 
ATOM   847  O "O3'" . DT  C 1 11  ? 63.951 54.404 -15.523 1.00 45.89 ? 17  DT  E "O3'" 1 
ATOM   848  C "C2'" . DT  C 1 11  ? 63.373 52.164 -14.578 1.00 42.81 ? 17  DT  E "C2'" 1 
ATOM   849  C "C1'" . DT  C 1 11  ? 63.824 51.496 -13.281 1.00 47.17 ? 17  DT  E "C1'" 1 
ATOM   850  N N1    . DT  C 1 11  ? 62.745 50.790 -12.519 1.00 42.08 ? 17  DT  E N1    1 
ATOM   851  C C2    . DT  C 1 11  ? 62.728 49.432 -12.602 1.00 34.20 ? 17  DT  E C2    1 
ATOM   852  O O2    . DT  C 1 11  ? 63.540 48.817 -13.247 1.00 43.30 ? 17  DT  E O2    1 
ATOM   853  N N3    . DT  C 1 11  ? 61.726 48.798 -11.903 1.00 36.93 ? 17  DT  E N3    1 
ATOM   854  C C4    . DT  C 1 11  ? 60.754 49.369 -11.146 1.00 33.66 ? 17  DT  E C4    1 
ATOM   855  O O4    . DT  C 1 11  ? 59.852 48.636 -10.580 1.00 28.93 ? 17  DT  E O4    1 
ATOM   856  C C5    . DT  C 1 11  ? 60.836 50.844 -11.079 1.00 40.54 ? 17  DT  E C5    1 
ATOM   857  C C7    . DT  C 1 11  ? 59.838 51.611 -10.271 1.00 44.45 ? 17  DT  E C7    1 
ATOM   858  C C6    . DT  C 1 11  ? 61.810 51.457 -11.765 1.00 37.03 ? 17  DT  E C6    1 
ATOM   859  P P     . DG  C 1 12  ? 65.430 54.235 -16.216 1.00 49.68 ? 16  DG  E P     1 
ATOM   860  O OP1   . DG  C 1 12  ? 66.586 54.365 -15.261 1.00 45.21 ? 16  DG  E OP1   1 
ATOM   861  O OP2   . DG  C 1 12  ? 65.341 55.152 -17.363 1.00 46.49 ? 16  DG  E OP2   1 
ATOM   862  O "O5'" . DG  C 1 12  ? 65.501 52.805 -16.945 1.00 45.39 ? 16  DG  E "O5'" 1 
ATOM   863  C "C5'" . DG  C 1 12  ? 64.311 51.995 -17.209 1.00 46.87 ? 16  DG  E "C5'" 1 
ATOM   864  C "C4'" . DG  C 1 12  ? 63.476 52.529 -18.365 1.00 46.24 ? 16  DG  E "C4'" 1 
ATOM   865  O "O4'" . DG  C 1 12  ? 62.108 52.139 -18.084 1.00 44.84 ? 16  DG  E "O4'" 1 
ATOM   866  C "C3'" . DG  C 1 12  ? 63.346 54.041 -18.599 1.00 42.72 ? 16  DG  E "C3'" 1 
ATOM   867  O "O3'" . DG  C 1 12  ? 62.540 54.189 -19.778 1.00 47.64 ? 16  DG  E "O3'" 1 
ATOM   868  C "C2'" . DG  C 1 12  ? 62.415 54.425 -17.467 1.00 42.05 ? 16  DG  E "C2'" 1 
ATOM   869  C "C1'" . DG  C 1 12  ? 61.392 53.307 -17.626 1.00 45.56 ? 16  DG  E "C1'" 1 
ATOM   870  N N9    . DG  C 1 12  ? 60.614 52.942 -16.449 1.00 51.20 ? 16  DG  E N9    1 
ATOM   871  C C8    . DG  C 1 12  ? 60.336 53.711 -15.343 1.00 48.60 ? 16  DG  E C8    1 
ATOM   872  N N7    . DG  C 1 12  ? 59.597 53.083 -14.465 1.00 57.04 ? 16  DG  E N7    1 
ATOM   873  C C5    . DG  C 1 12  ? 59.377 51.826 -15.033 1.00 55.89 ? 16  DG  E C5    1 
ATOM   874  C C6    . DG  C 1 12  ? 58.657 50.713 -14.551 1.00 56.52 ? 16  DG  E C6    1 
ATOM   875  O O6    . DG  C 1 12  ? 58.057 50.623 -13.480 1.00 56.97 ? 16  DG  E O6    1 
ATOM   876  N N1    . DG  C 1 12  ? 58.689 49.629 -15.458 1.00 54.81 ? 16  DG  E N1    1 
ATOM   877  C C2    . DG  C 1 12  ? 59.349 49.643 -16.665 1.00 51.75 ? 16  DG  E C2    1 
ATOM   878  N N2    . DG  C 1 12  ? 59.284 48.540 -17.412 1.00 44.33 ? 16  DG  E N2    1 
ATOM   879  N N3    . DG  C 1 12  ? 60.034 50.681 -17.114 1.00 53.07 ? 16  DG  E N3    1 
ATOM   880  C C4    . DG  C 1 12  ? 60.007 51.727 -16.254 1.00 53.75 ? 16  DG  E C4    1 
ATOM   881  P P     . DA  C 1 13  ? 62.955 55.172 -20.980 1.00 42.29 ? 15  DA  E P     1 
ATOM   882  O OP1   . DA  C 1 13  ? 64.187 55.939 -20.598 1.00 42.00 ? 15  DA  E OP1   1 
ATOM   883  O OP2   . DA  C 1 13  ? 61.673 55.901 -21.342 1.00 35.14 ? 15  DA  E OP2   1 
ATOM   884  O "O5'" . DA  C 1 13  ? 63.305 54.200 -22.209 1.00 44.03 ? 15  DA  E "O5'" 1 
ATOM   885  C "C5'" . DA  C 1 13  ? 63.480 52.749 -22.047 1.00 43.14 ? 15  DA  E "C5'" 1 
ATOM   886  C "C4'" . DA  C 1 13  ? 62.181 52.014 -22.333 1.00 42.50 ? 15  DA  E "C4'" 1 
ATOM   887  O "O4'" . DA  C 1 13  ? 61.396 51.972 -21.105 1.00 40.00 ? 15  DA  E "O4'" 1 
ATOM   888  C "C3'" . DA  C 1 13  ? 61.291 52.639 -23.417 1.00 42.40 ? 15  DA  E "C3'" 1 
ATOM   889  O "O3'" . DA  C 1 13  ? 61.062 51.705 -24.506 1.00 49.38 ? 15  DA  E "O3'" 1 
ATOM   890  C "C2'" . DA  C 1 13  ? 60.015 53.065 -22.680 1.00 39.23 ? 15  DA  E "C2'" 1 
ATOM   891  C "C1'" . DA  C 1 13  ? 60.047 52.347 -21.334 1.00 37.37 ? 15  DA  E "C1'" 1 
ATOM   892  N N9    . DA  C 1 13  ? 59.578 53.107 -20.162 1.00 39.28 ? 15  DA  E N9    1 
ATOM   893  C C8    . DA  C 1 13  ? 59.906 54.371 -19.701 1.00 40.89 ? 15  DA  E C8    1 
ATOM   894  N N7    . DA  C 1 13  ? 59.267 54.721 -18.595 1.00 45.53 ? 15  DA  E N7    1 
ATOM   895  C C5    . DA  C 1 13  ? 58.463 53.615 -18.310 1.00 47.16 ? 15  DA  E C5    1 
ATOM   896  C C6    . DA  C 1 13  ? 57.495 53.328 -17.268 1.00 40.28 ? 15  DA  E C6    1 
ATOM   897  N N6    . DA  C 1 13  ? 57.152 54.151 -16.248 1.00 31.13 ? 15  DA  E N6    1 
ATOM   898  N N1    . DA  C 1 13  ? 56.874 52.121 -17.328 1.00 47.39 ? 15  DA  E N1    1 
ATOM   899  C C2    . DA  C 1 13  ? 57.182 51.280 -18.329 1.00 46.97 ? 15  DA  E C2    1 
ATOM   900  N N3    . DA  C 1 13  ? 58.038 51.428 -19.334 1.00 43.84 ? 15  DA  E N3    1 
ATOM   901  C C4    . DA  C 1 13  ? 58.651 52.619 -19.271 1.00 44.80 ? 15  DA  E C4    1 
ATOM   902  P P     . DT  C 1 14  ? 60.284 52.194 -25.860 1.00 56.15 ? 14  DT  E P     1 
ATOM   903  O OP1   . DT  C 1 14  ? 60.599 51.256 -27.002 1.00 55.08 ? 14  DT  E OP1   1 
ATOM   904  O OP2   . DT  C 1 14  ? 60.517 53.690 -26.046 1.00 55.41 ? 14  DT  E OP2   1 
ATOM   905  O "O5'" . DT  C 1 14  ? 58.726 51.988 -25.513 1.00 55.05 ? 14  DT  E "O5'" 1 
ATOM   906  C "C5'" . DT  C 1 14  ? 58.028 50.744 -25.816 1.00 48.13 ? 14  DT  E "C5'" 1 
ATOM   907  C "C4'" . DT  C 1 14  ? 56.721 50.633 -25.049 1.00 42.43 ? 14  DT  E "C4'" 1 
ATOM   908  O "O4'" . DT  C 1 14  ? 56.890 50.727 -23.619 1.00 41.88 ? 14  DT  E "O4'" 1 
ATOM   909  C "C3'" . DT  C 1 14  ? 55.640 51.666 -25.328 1.00 37.54 ? 14  DT  E "C3'" 1 
ATOM   910  O "O3'" . DT  C 1 14  ? 54.896 51.421 -26.481 1.00 41.82 ? 14  DT  E "O3'" 1 
ATOM   911  C "C2'" . DT  C 1 14  ? 54.667 51.378 -24.204 1.00 34.27 ? 14  DT  E "C2'" 1 
ATOM   912  C "C1'" . DT  C 1 14  ? 55.581 50.972 -23.061 1.00 42.16 ? 14  DT  E "C1'" 1 
ATOM   913  N N1    . DT  C 1 14  ? 55.696 52.011 -21.996 1.00 45.45 ? 14  DT  E N1    1 
ATOM   914  C C2    . DT  C 1 14  ? 54.898 51.843 -20.893 1.00 42.74 ? 14  DT  E C2    1 
ATOM   915  O O2    . DT  C 1 14  ? 54.116 50.919 -20.779 1.00 47.90 ? 14  DT  E O2    1 
ATOM   916  N N3    . DT  C 1 14  ? 55.043 52.810 -19.923 1.00 51.16 ? 14  DT  E N3    1 
ATOM   917  C C4    . DT  C 1 14  ? 55.884 53.922 -19.952 1.00 49.03 ? 14  DT  E C4    1 
ATOM   918  O O4    . DT  C 1 14  ? 55.892 54.716 -19.002 1.00 48.52 ? 14  DT  E O4    1 
ATOM   919  C C5    . DT  C 1 14  ? 56.689 54.046 -21.146 1.00 46.65 ? 14  DT  E C5    1 
ATOM   920  C C7    . DT  C 1 14  ? 57.617 55.213 -21.278 1.00 45.14 ? 14  DT  E C7    1 
ATOM   921  C C6    . DT  C 1 14  ? 56.559 53.094 -22.095 1.00 50.40 ? 14  DT  E C6    1 
ATOM   922  O "O5'" . DC  D 2 1   ? 52.320 47.121 -21.497 1.00 36.51 ? 13  DC  F "O5'" 1 
ATOM   923  C "C5'" . DC  D 2 1   ? 52.025 47.435 -22.912 1.00 46.43 ? 13  DC  F "C5'" 1 
ATOM   924  C "C4'" . DC  D 2 1   ? 50.556 47.700 -23.187 1.00 44.85 ? 13  DC  F "C4'" 1 
ATOM   925  O "O4'" . DC  D 2 1   ? 50.189 48.909 -22.505 1.00 43.22 ? 13  DC  F "O4'" 1 
ATOM   926  C "C3'" . DC  D 2 1   ? 50.106 47.902 -24.643 1.00 42.88 ? 13  DC  F "C3'" 1 
ATOM   927  O "O3'" . DC  D 2 1   ? 48.793 47.278 -24.815 1.00 43.32 ? 13  DC  F "O3'" 1 
ATOM   928  C "C2'" . DC  D 2 1   ? 50.158 49.402 -24.825 1.00 40.50 ? 13  DC  F "C2'" 1 
ATOM   929  C "C1'" . DC  D 2 1   ? 49.764 49.885 -23.437 1.00 42.84 ? 13  DC  F "C1'" 1 
ATOM   930  N N1    . DC  D 2 1   ? 50.410 51.111 -23.049 1.00 40.89 ? 13  DC  F N1    1 
ATOM   931  C C2    . DC  D 2 1   ? 49.756 52.046 -22.143 1.00 40.12 ? 13  DC  F C2    1 
ATOM   932  O O2    . DC  D 2 1   ? 48.637 51.827 -21.689 1.00 52.33 ? 13  DC  F O2    1 
ATOM   933  N N3    . DC  D 2 1   ? 50.380 53.170 -21.786 1.00 45.86 ? 13  DC  F N3    1 
ATOM   934  C C4    . DC  D 2 1   ? 51.600 53.427 -22.258 1.00 50.12 ? 13  DC  F C4    1 
ATOM   935  N N4    . DC  D 2 1   ? 52.200 54.605 -21.853 1.00 39.33 ? 13  DC  F N4    1 
ATOM   936  C C5    . DC  D 2 1   ? 52.291 52.535 -23.153 1.00 47.03 ? 13  DC  F C5    1 
ATOM   937  C C6    . DC  D 2 1   ? 51.660 51.398 -23.516 1.00 45.07 ? 13  DC  F C6    1 
ATOM   938  P P     . DT  D 2 2   ? 47.440 48.135 -25.143 1.00 42.19 ? 12  DT  F P     1 
ATOM   939  O OP1   . DT  D 2 2   ? 46.321 47.058 -25.211 1.00 36.92 ? 12  DT  F OP1   1 
ATOM   940  O OP2   . DT  D 2 2   ? 47.646 49.053 -26.311 1.00 31.21 ? 12  DT  F OP2   1 
ATOM   941  O "O5'" . DT  D 2 2   ? 47.235 49.054 -23.856 1.00 36.95 ? 12  DT  F "O5'" 1 
ATOM   942  C "C5'" . DT  D 2 2   ? 46.675 48.526 -22.610 1.00 39.83 ? 12  DT  F "C5'" 1 
ATOM   943  C "C4'" . DT  D 2 2   ? 45.480 49.355 -22.204 1.00 34.87 ? 12  DT  F "C4'" 1 
ATOM   944  O "O4'" . DT  D 2 2   ? 45.989 50.648 -21.787 1.00 30.77 ? 12  DT  F "O4'" 1 
ATOM   945  C "C3'" . DT  D 2 2   ? 44.606 49.613 -23.437 1.00 35.22 ? 12  DT  F "C3'" 1 
ATOM   946  O "O3'" . DT  D 2 2   ? 43.191 49.807 -23.228 1.00 40.66 ? 12  DT  F "O3'" 1 
ATOM   947  C "C2'" . DT  D 2 2   ? 45.136 50.934 -23.937 1.00 34.20 ? 12  DT  F "C2'" 1 
ATOM   948  C "C1'" . DT  D 2 2   ? 45.412 51.626 -22.619 1.00 33.81 ? 12  DT  F "C1'" 1 
ATOM   949  N N1    . DT  D 2 2   ? 46.322 52.791 -22.768 1.00 40.96 ? 12  DT  F N1    1 
ATOM   950  C C2    . DT  D 2 2   ? 46.321 53.806 -21.822 1.00 42.54 ? 12  DT  F C2    1 
ATOM   951  O O2    . DT  D 2 2   ? 45.649 53.801 -20.806 1.00 34.85 ? 12  DT  F O2    1 
ATOM   952  N N3    . DT  D 2 2   ? 47.163 54.852 -22.130 1.00 46.27 ? 12  DT  F N3    1 
ATOM   953  C C4    . DT  D 2 2   ? 47.981 54.978 -23.242 1.00 42.38 ? 12  DT  F C4    1 
ATOM   954  O O4    . DT  D 2 2   ? 48.652 55.960 -23.398 1.00 46.68 ? 12  DT  F O4    1 
ATOM   955  C C5    . DT  D 2 2   ? 47.963 53.892 -24.154 1.00 44.94 ? 12  DT  F C5    1 
ATOM   956  C C7    . DT  D 2 2   ? 48.838 53.949 -25.367 1.00 43.25 ? 12  DT  F C7    1 
ATOM   957  C C6    . DT  D 2 2   ? 47.148 52.862 -23.880 1.00 45.50 ? 12  DT  F C6    1 
ATOM   958  P P     . DA  D 2 3   ? 42.436 49.227 -21.929 1.00 38.20 ? 11  DA  F P     1 
ATOM   959  O OP1   . DA  D 2 3   ? 43.319 48.369 -21.051 1.00 39.52 ? 11  DA  F OP1   1 
ATOM   960  O OP2   . DA  D 2 3   ? 41.167 48.675 -22.515 1.00 31.52 ? 11  DA  F OP2   1 
ATOM   961  O "O5'" . DA  D 2 3   ? 41.998 50.543 -21.134 1.00 35.60 ? 11  DA  F "O5'" 1 
ATOM   962  C "C5'" . DA  D 2 3   ? 41.945 50.580 -19.701 1.00 25.76 ? 11  DA  F "C5'" 1 
ATOM   963  C "C4'" . DA  D 2 3   ? 41.277 51.851 -19.230 1.00 16.38 ? 11  DA  F "C4'" 1 
ATOM   964  O "O4'" . DA  D 2 3   ? 42.034 52.957 -19.737 1.00 18.03 ? 11  DA  F "O4'" 1 
ATOM   965  C "C3'" . DA  D 2 3   ? 39.836 52.034 -19.696 1.00 9.05  ? 11  DA  F "C3'" 1 
ATOM   966  O "O3'" . DA  D 2 3   ? 39.062 52.456 -18.577 1.00 6.67  ? 11  DA  F "O3'" 1 
ATOM   967  C "C2'" . DA  D 2 3   ? 39.917 53.053 -20.816 1.00 13.41 ? 11  DA  F "C2'" 1 
ATOM   968  C "C1'" . DA  D 2 3   ? 41.211 53.824 -20.514 1.00 22.29 ? 11  DA  F "C1'" 1 
ATOM   969  N N9    . DA  D 2 3   ? 42.023 54.350 -21.655 1.00 31.18 ? 11  DA  F N9    1 
ATOM   970  C C8    . DA  D 2 3   ? 41.995 53.931 -22.975 1.00 37.68 ? 11  DA  F C8    1 
ATOM   971  N N7    . DA  D 2 3   ? 42.828 54.588 -23.766 1.00 36.52 ? 11  DA  F N7    1 
ATOM   972  C C5    . DA  D 2 3   ? 43.448 55.489 -22.921 1.00 27.67 ? 11  DA  F C5    1 
ATOM   973  C C6    . DA  D 2 3   ? 44.419 56.458 -23.164 1.00 22.92 ? 11  DA  F C6    1 
ATOM   974  N N6    . DA  D 2 3   ? 44.964 56.689 -24.354 1.00 26.63 ? 11  DA  F N6    1 
ATOM   975  N N1    . DA  D 2 3   ? 44.827 57.203 -22.131 1.00 32.39 ? 11  DA  F N1    1 
ATOM   976  C C2    . DA  D 2 3   ? 44.283 56.981 -20.925 1.00 35.60 ? 11  DA  F C2    1 
ATOM   977  N N3    . DA  D 2 3   ? 43.360 56.099 -20.567 1.00 30.74 ? 11  DA  F N3    1 
ATOM   978  C C4    . DA  D 2 3   ? 42.970 55.367 -21.623 1.00 27.93 ? 11  DA  F C4    1 
ATOM   979  P P     . DG  D 2 4   ? 37.469 52.524 -18.695 1.00 14.75 ? 10  DG  F P     1 
ATOM   980  O OP1   . DG  D 2 4   ? 36.841 52.334 -17.384 1.00 6.00  ? 10  DG  F OP1   1 
ATOM   981  O OP2   . DG  D 2 4   ? 36.964 51.806 -19.886 1.00 6.00  ? 10  DG  F OP2   1 
ATOM   982  O "O5'" . DG  D 2 4   ? 37.195 54.046 -19.063 1.00 20.83 ? 10  DG  F "O5'" 1 
ATOM   983  C "C5'" . DG  D 2 4   ? 37.554 55.069 -18.102 1.00 29.92 ? 10  DG  F "C5'" 1 
ATOM   984  C "C4'" . DG  D 2 4   ? 37.896 56.399 -18.753 1.00 25.07 ? 10  DG  F "C4'" 1 
ATOM   985  O "O4'" . DG  D 2 4   ? 38.621 56.295 -19.972 1.00 26.00 ? 10  DG  F "O4'" 1 
ATOM   986  C "C3'" . DG  D 2 4   ? 36.721 57.310 -19.080 1.00 24.68 ? 10  DG  F "C3'" 1 
ATOM   987  O "O3'" . DG  D 2 4   ? 36.759 58.358 -18.136 1.00 16.50 ? 10  DG  F "O3'" 1 
ATOM   988  C "C2'" . DG  D 2 4   ? 36.999 57.844 -20.491 1.00 22.84 ? 10  DG  F "C2'" 1 
ATOM   989  C "C1'" . DG  D 2 4   ? 38.475 57.550 -20.579 1.00 25.44 ? 10  DG  F "C1'" 1 
ATOM   990  N N9    . DG  D 2 4   ? 39.211 57.473 -21.832 1.00 39.91 ? 10  DG  F N9    1 
ATOM   991  C C8    . DG  D 2 4   ? 38.988 56.704 -22.960 1.00 36.48 ? 10  DG  F C8    1 
ATOM   992  N N7    . DG  D 2 4   ? 39.917 56.864 -23.877 1.00 37.99 ? 10  DG  F N7    1 
ATOM   993  C C5    . DG  D 2 4   ? 40.789 57.799 -23.319 1.00 46.11 ? 10  DG  F C5    1 
ATOM   994  C C6    . DG  D 2 4   ? 42.000 58.377 -23.824 1.00 49.82 ? 10  DG  F C6    1 
ATOM   995  O O6    . DG  D 2 4   ? 42.570 58.171 -24.922 1.00 50.02 ? 10  DG  F O6    1 
ATOM   996  N N1    . DG  D 2 4   ? 42.557 59.277 -22.901 1.00 50.24 ? 10  DG  F N1    1 
ATOM   997  C C2    . DG  D 2 4   ? 42.021 59.576 -21.654 1.00 49.73 ? 10  DG  F C2    1 
ATOM   998  N N2    . DG  D 2 4   ? 42.674 60.452 -20.861 1.00 54.01 ? 10  DG  F N2    1 
ATOM   999  N N3    . DG  D 2 4   ? 40.913 59.055 -21.197 1.00 45.11 ? 10  DG  F N3    1 
ATOM   1000 C C4    . DG  D 2 4   ? 40.352 58.187 -22.067 1.00 44.89 ? 10  DG  F C4    1 
ATOM   1001 P P     . DA  D 2 5   ? 35.761 59.544 -18.318 1.00 11.96 ? 9   DA  F P     1 
ATOM   1002 O OP1   . DA  D 2 5   ? 35.353 59.993 -16.975 1.00 9.23  ? 9   DA  F OP1   1 
ATOM   1003 O OP2   . DA  D 2 5   ? 34.727 59.014 -19.315 1.00 12.27 ? 9   DA  F OP2   1 
ATOM   1004 O "O5'" . DA  D 2 5   ? 36.632 60.588 -19.124 1.00 20.82 ? 9   DA  F "O5'" 1 
ATOM   1005 C "C5'" . DA  D 2 5   ? 37.961 60.923 -18.761 1.00 23.42 ? 9   DA  F "C5'" 1 
ATOM   1006 C "C4'" . DA  D 2 5   ? 38.384 62.095 -19.615 1.00 32.27 ? 9   DA  F "C4'" 1 
ATOM   1007 O "O4'" . DA  D 2 5   ? 38.668 61.600 -20.952 1.00 34.30 ? 9   DA  F "O4'" 1 
ATOM   1008 C "C3'" . DA  D 2 5   ? 37.235 63.107 -19.787 1.00 36.80 ? 9   DA  F "C3'" 1 
ATOM   1009 O "O3'" . DA  D 2 5   ? 37.714 64.479 -19.819 1.00 35.72 ? 9   DA  F "O3'" 1 
ATOM   1010 C "C2'" . DA  D 2 5   ? 36.603 62.670 -21.097 1.00 34.70 ? 9   DA  F "C2'" 1 
ATOM   1011 C "C1'" . DA  D 2 5   ? 37.840 62.268 -21.872 1.00 35.44 ? 9   DA  F "C1'" 1 
ATOM   1012 N N9    . DA  D 2 5   ? 37.608 61.384 -23.011 1.00 39.56 ? 9   DA  F N9    1 
ATOM   1013 C C8    . DA  D 2 5   ? 36.591 60.523 -23.258 1.00 43.68 ? 9   DA  F C8    1 
ATOM   1014 N N7    . DA  D 2 5   ? 36.702 59.896 -24.404 1.00 47.25 ? 9   DA  F N7    1 
ATOM   1015 C C5    . DA  D 2 5   ? 37.882 60.372 -24.940 1.00 40.26 ? 9   DA  F C5    1 
ATOM   1016 C C6    . DA  D 2 5   ? 38.570 60.099 -26.149 1.00 45.38 ? 9   DA  F C6    1 
ATOM   1017 N N6    . DA  D 2 5   ? 38.162 59.223 -27.084 1.00 43.79 ? 9   DA  F N6    1 
ATOM   1018 N N1    . DA  D 2 5   ? 39.712 60.767 -26.376 1.00 41.53 ? 9   DA  F N1    1 
ATOM   1019 C C2    . DA  D 2 5   ? 40.130 61.624 -25.464 1.00 37.55 ? 9   DA  F C2    1 
ATOM   1020 N N3    . DA  D 2 5   ? 39.589 61.958 -24.309 1.00 41.34 ? 9   DA  F N3    1 
ATOM   1021 C C4    . DA  D 2 5   ? 38.450 61.289 -24.103 1.00 39.05 ? 9   DA  F C4    1 
ATOM   1022 P P     . DT  D 2 6   ? 36.668 65.722 -19.672 1.00 32.48 ? 8   DT  F P     1 
ATOM   1023 O OP1   . DT  D 2 6   ? 36.593 66.068 -18.217 1.00 35.87 ? 8   DT  F OP1   1 
ATOM   1024 O OP2   . DT  D 2 6   ? 35.355 65.554 -20.441 1.00 27.48 ? 8   DT  F OP2   1 
ATOM   1025 O "O5'" . DT  D 2 6   ? 37.500 66.865 -20.391 1.00 32.71 ? 8   DT  F "O5'" 1 
ATOM   1026 C "C5'" . DT  D 2 6   ? 38.489 66.542 -21.381 1.00 33.44 ? 8   DT  F "C5'" 1 
ATOM   1027 C "C4'" . DT  D 2 6   ? 38.051 67.027 -22.747 1.00 32.60 ? 8   DT  F "C4'" 1 
ATOM   1028 O "O4'" . DT  D 2 6   ? 38.188 65.936 -23.720 1.00 35.31 ? 8   DT  F "O4'" 1 
ATOM   1029 C "C3'" . DT  D 2 6   ? 36.582 67.479 -22.810 1.00 40.79 ? 8   DT  F "C3'" 1 
ATOM   1030 O "O3'" . DT  D 2 6   ? 36.418 68.629 -23.669 1.00 44.96 ? 8   DT  F "O3'" 1 
ATOM   1031 C "C2'" . DT  D 2 6   ? 35.915 66.304 -23.474 1.00 39.79 ? 8   DT  F "C2'" 1 
ATOM   1032 C "C1'" . DT  D 2 6   ? 37.012 65.982 -24.488 1.00 37.16 ? 8   DT  F "C1'" 1 
ATOM   1033 N N1    . DT  D 2 6   ? 36.779 64.697 -25.242 1.00 35.45 ? 8   DT  F N1    1 
ATOM   1034 C C2    . DT  D 2 6   ? 37.419 64.360 -26.380 1.00 24.88 ? 8   DT  F C2    1 
ATOM   1035 O O2    . DT  D 2 6   ? 38.314 65.018 -26.893 1.00 30.46 ? 8   DT  F O2    1 
ATOM   1036 N N3    . DT  D 2 6   ? 36.968 63.200 -26.919 1.00 21.63 ? 8   DT  F N3    1 
ATOM   1037 C C4    . DT  D 2 6   ? 36.015 62.355 -26.505 1.00 20.11 ? 8   DT  F C4    1 
ATOM   1038 O O4    . DT  D 2 6   ? 35.743 61.353 -27.108 1.00 30.25 ? 8   DT  F O4    1 
ATOM   1039 C C5    . DT  D 2 6   ? 35.403 62.756 -25.248 1.00 17.76 ? 8   DT  F C5    1 
ATOM   1040 C C7    . DT  D 2 6   ? 34.327 61.940 -24.625 1.00 14.47 ? 8   DT  F C7    1 
ATOM   1041 C C6    . DT  D 2 6   ? 35.812 63.875 -24.700 1.00 25.68 ? 8   DT  F C6    1 
ATOM   1042 P P     . DC  D 2 7   ? 36.517 70.115 -23.041 1.00 51.71 ? 7   DC  F P     1 
ATOM   1043 O OP1   . DC  D 2 7   ? 37.824 70.291 -22.291 1.00 45.83 ? 7   DC  F OP1   1 
ATOM   1044 O OP2   . DC  D 2 7   ? 35.179 70.397 -22.371 1.00 47.35 ? 7   DC  F OP2   1 
ATOM   1045 O "O5'" . DC  D 2 7   ? 36.626 71.129 -24.256 1.00 45.76 ? 7   DC  F "O5'" 1 
ATOM   1046 C "C5'" . DC  D 2 7   ? 37.461 70.902 -25.404 1.00 41.23 ? 7   DC  F "C5'" 1 
ATOM   1047 C "C4'" . DC  D 2 7   ? 36.713 71.388 -26.622 1.00 36.44 ? 7   DC  F "C4'" 1 
ATOM   1048 O "O4'" . DC  D 2 7   ? 36.159 70.208 -27.215 1.00 31.43 ? 7   DC  F "O4'" 1 
ATOM   1049 C "C3'" . DC  D 2 7   ? 35.478 72.235 -26.254 1.00 37.89 ? 7   DC  F "C3'" 1 
ATOM   1050 O "O3'" . DC  D 2 7   ? 34.858 72.833 -27.395 1.00 37.30 ? 7   DC  F "O3'" 1 
ATOM   1051 C "C2'" . DC  D 2 7   ? 34.530 71.163 -25.790 1.00 35.60 ? 7   DC  F "C2'" 1 
ATOM   1052 C "C1'" . DC  D 2 7   ? 34.773 70.238 -26.953 1.00 33.34 ? 7   DC  F "C1'" 1 
ATOM   1053 N N1    . DC  D 2 7   ? 34.266 68.880 -26.816 1.00 39.73 ? 7   DC  F N1    1 
ATOM   1054 C C2    . DC  D 2 7   ? 34.725 67.827 -27.721 1.00 37.69 ? 7   DC  F C2    1 
ATOM   1055 O O2    . DC  D 2 7   ? 35.568 68.046 -28.582 1.00 46.33 ? 7   DC  F O2    1 
ATOM   1056 N N3    . DC  D 2 7   ? 34.207 66.594 -27.626 1.00 41.95 ? 7   DC  F N3    1 
ATOM   1057 C C4    . DC  D 2 7   ? 33.266 66.343 -26.728 1.00 45.69 ? 7   DC  F C4    1 
ATOM   1058 N N4    . DC  D 2 7   ? 32.768 65.080 -26.697 1.00 46.55 ? 7   DC  F N4    1 
ATOM   1059 C C5    . DC  D 2 7   ? 32.765 67.352 -25.815 1.00 36.98 ? 7   DC  F C5    1 
ATOM   1060 C C6    . DC  D 2 7   ? 33.300 68.586 -25.880 1.00 35.08 ? 7   DC  F C6    1 
ATOM   1061 P P     . DA  D 2 8   ? 33.528 73.697 -27.201 1.00 33.12 ? 6   DA  F P     1 
ATOM   1062 O OP1   . DA  D 2 8   ? 34.131 75.026 -27.079 1.00 34.60 ? 6   DA  F OP1   1 
ATOM   1063 O OP2   . DA  D 2 8   ? 32.658 73.163 -26.083 1.00 35.01 ? 6   DA  F OP2   1 
ATOM   1064 O "O5'" . DA  D 2 8   ? 32.704 73.508 -28.560 1.00 28.91 ? 6   DA  F "O5'" 1 
ATOM   1065 C "C5'" . DA  D 2 8   ? 33.335 73.574 -29.843 1.00 23.89 ? 6   DA  F "C5'" 1 
ATOM   1066 C "C4'" . DA  D 2 8   ? 32.279 73.697 -30.913 1.00 29.09 ? 6   DA  F "C4'" 1 
ATOM   1067 O "O4'" . DA  D 2 8   ? 31.941 72.371 -31.357 1.00 29.47 ? 6   DA  F "O4'" 1 
ATOM   1068 C "C3'" . DA  D 2 8   ? 30.971 74.321 -30.423 1.00 29.70 ? 6   DA  F "C3'" 1 
ATOM   1069 O "O3'" . DA  D 2 8   ? 30.908 75.738 -30.753 1.00 35.91 ? 6   DA  F "O3'" 1 
ATOM   1070 C "C2'" . DA  D 2 8   ? 29.900 73.442 -31.030 1.00 31.36 ? 6   DA  F "C2'" 1 
ATOM   1071 C "C1'" . DA  D 2 8   ? 30.572 72.116 -31.083 1.00 32.23 ? 6   DA  F "C1'" 1 
ATOM   1072 N N9    . DA  D 2 8   ? 30.519 71.409 -29.822 1.00 34.97 ? 6   DA  F N9    1 
ATOM   1073 C C8    . DA  D 2 8   ? 30.727 71.857 -28.545 1.00 37.88 ? 6   DA  F C8    1 
ATOM   1074 N N7    . DA  D 2 8   ? 30.646 70.908 -27.644 1.00 45.35 ? 6   DA  F N7    1 
ATOM   1075 C C5    . DA  D 2 8   ? 30.353 69.764 -28.390 1.00 46.49 ? 6   DA  F C5    1 
ATOM   1076 C C6    . DA  D 2 8   ? 30.183 68.359 -28.052 1.00 46.55 ? 6   DA  F C6    1 
ATOM   1077 N N6    . DA  D 2 8   ? 30.225 67.780 -26.841 1.00 45.30 ? 6   DA  F N6    1 
ATOM   1078 N N1    . DA  D 2 8   ? 29.957 67.524 -29.052 1.00 37.72 ? 6   DA  F N1    1 
ATOM   1079 C C2    . DA  D 2 8   ? 29.887 67.973 -30.282 1.00 31.28 ? 6   DA  F C2    1 
ATOM   1080 N N3    . DA  D 2 8   ? 30.028 69.204 -30.725 1.00 42.46 ? 6   DA  F N3    1 
ATOM   1081 C C4    . DA  D 2 8   ? 30.270 70.063 -29.720 1.00 40.27 ? 6   DA  F C4    1 
ATOM   1082 P P     . DC  D 2 9   ? 29.843 76.360 -31.835 1.00 44.18 ? 5   DC  F P     1 
ATOM   1083 O OP1   . DC  D 2 9   ? 30.662 76.753 -33.012 1.00 42.43 ? 5   DC  F OP1   1 
ATOM   1084 O OP2   . DC  D 2 9   ? 29.009 77.378 -31.138 1.00 39.93 ? 5   DC  F OP2   1 
ATOM   1085 O "O5'" . DC  D 2 9   ? 28.797 75.243 -32.326 1.00 46.36 ? 5   DC  F "O5'" 1 
ATOM   1086 C "C5'" . DC  D 2 9   ? 28.412 75.141 -33.737 1.00 47.61 ? 5   DC  F "C5'" 1 
ATOM   1087 C "C4'" . DC  D 2 9   ? 27.360 74.071 -33.935 1.00 46.70 ? 5   DC  F "C4'" 1 
ATOM   1088 O "O4'" . DC  D 2 9   ? 27.639 73.078 -32.927 1.00 44.77 ? 5   DC  F "O4'" 1 
ATOM   1089 C "C3'" . DC  D 2 9   ? 25.910 74.532 -33.673 1.00 45.44 ? 5   DC  F "C3'" 1 
ATOM   1090 O "O3'" . DC  D 2 9   ? 24.907 73.704 -34.369 1.00 48.29 ? 5   DC  F "O3'" 1 
ATOM   1091 C "C2'" . DC  D 2 9   ? 25.812 74.314 -32.179 1.00 42.44 ? 5   DC  F "C2'" 1 
ATOM   1092 C "C1'" . DC  D 2 9   ? 26.470 72.958 -32.184 1.00 48.42 ? 5   DC  F "C1'" 1 
ATOM   1093 N N1    . DC  D 2 9   ? 26.741 72.343 -30.862 1.00 61.33 ? 5   DC  F N1    1 
ATOM   1094 C C2    . DC  D 2 9   ? 26.636 70.878 -30.740 1.00 64.57 ? 5   DC  F C2    1 
ATOM   1095 O O2    . DC  D 2 9   ? 26.365 70.188 -31.745 1.00 70.01 ? 5   DC  F O2    1 
ATOM   1096 N N3    . DC  D 2 9   ? 26.816 70.285 -29.526 1.00 57.18 ? 5   DC  F N3    1 
ATOM   1097 C C4    . DC  D 2 9   ? 27.072 71.044 -28.458 1.00 61.17 ? 5   DC  F C4    1 
ATOM   1098 N N4    . DC  D 2 9   ? 27.245 70.399 -27.299 1.00 54.58 ? 5   DC  F N4    1 
ATOM   1099 C C5    . DC  D 2 9   ? 27.172 72.496 -28.533 1.00 58.17 ? 5   DC  F C5    1 
ATOM   1100 C C6    . DC  D 2 9   ? 27.019 73.094 -29.749 1.00 57.18 ? 5   DC  F C6    1 
ATOM   1101 P P     . DA  D 2 10  ? 24.265 74.168 -35.819 1.00 43.95 ? 4   DA  F P     1 
ATOM   1102 O OP1   . DA  D 2 10  ? 25.418 74.480 -36.737 1.00 41.81 ? 4   DA  F OP1   1 
ATOM   1103 O OP2   . DA  D 2 10  ? 23.155 75.161 -35.631 1.00 40.90 ? 4   DA  F OP2   1 
ATOM   1104 O "O5'" . DA  D 2 10  ? 23.504 72.885 -36.406 1.00 41.13 ? 4   DA  F "O5'" 1 
ATOM   1105 C "C5'" . DA  D 2 10  ? 24.147 71.955 -37.346 1.00 33.76 ? 4   DA  F "C5'" 1 
ATOM   1106 C "C4'" . DA  D 2 10  ? 23.557 70.571 -37.176 1.00 33.86 ? 4   DA  F "C4'" 1 
ATOM   1107 O "O4'" . DA  D 2 10  ? 23.909 70.153 -35.829 1.00 31.46 ? 4   DA  F "O4'" 1 
ATOM   1108 C "C3'" . DA  D 2 10  ? 22.016 70.542 -37.254 1.00 35.02 ? 4   DA  F "C3'" 1 
ATOM   1109 O "O3'" . DA  D 2 10  ? 21.498 69.530 -38.170 1.00 31.24 ? 4   DA  F "O3'" 1 
ATOM   1110 C "C2'" . DA  D 2 10  ? 21.570 70.313 -35.816 1.00 33.36 ? 4   DA  F "C2'" 1 
ATOM   1111 C "C1'" . DA  D 2 10  ? 22.769 69.668 -35.131 1.00 34.17 ? 4   DA  F "C1'" 1 
ATOM   1112 N N9    . DA  D 2 10  ? 22.871 70.073 -33.720 1.00 38.16 ? 4   DA  F N9    1 
ATOM   1113 C C8    . DA  D 2 10  ? 23.062 71.354 -33.259 1.00 38.62 ? 4   DA  F C8    1 
ATOM   1114 N N7    . DA  D 2 10  ? 23.091 71.448 -31.948 1.00 30.59 ? 4   DA  F N7    1 
ATOM   1115 C C5    . DA  D 2 10  ? 22.922 70.160 -31.520 1.00 26.04 ? 4   DA  F C5    1 
ATOM   1116 C C6    . DA  D 2 10  ? 22.870 69.645 -30.269 1.00 24.75 ? 4   DA  F C6    1 
ATOM   1117 N N6    . DA  D 2 10  ? 22.995 70.364 -29.158 1.00 12.36 ? 4   DA  F N6    1 
ATOM   1118 N N1    . DA  D 2 10  ? 22.683 68.332 -30.159 1.00 42.23 ? 4   DA  F N1    1 
ATOM   1119 C C2    . DA  D 2 10  ? 22.564 67.593 -31.271 1.00 36.57 ? 4   DA  F C2    1 
ATOM   1120 N N3    . DA  D 2 10  ? 22.602 67.974 -32.525 1.00 38.30 ? 4   DA  F N3    1 
ATOM   1121 C C4    . DA  D 2 10  ? 22.785 69.292 -32.588 1.00 36.39 ? 4   DA  F C4    1 
ATOM   1122 P P     . DT  D 2 11  ? 19.888 69.261 -38.277 1.00 33.89 ? 3   DT  F P     1 
ATOM   1123 O OP1   . DT  D 2 11  ? 19.580 68.626 -39.589 1.00 34.09 ? 3   DT  F OP1   1 
ATOM   1124 O OP2   . DT  D 2 11  ? 19.028 70.404 -37.794 1.00 29.09 ? 3   DT  F OP2   1 
ATOM   1125 O "O5'" . DT  D 2 11  ? 19.635 68.139 -37.186 1.00 42.90 ? 3   DT  F "O5'" 1 
ATOM   1126 C "C5'" . DT  D 2 11  ? 20.168 66.810 -37.328 1.00 44.43 ? 3   DT  F "C5'" 1 
ATOM   1127 C "C4'" . DT  D 2 11  ? 19.687 65.955 -36.177 1.00 48.55 ? 3   DT  F "C4'" 1 
ATOM   1128 O "O4'" . DT  D 2 11  ? 20.054 66.571 -34.917 1.00 45.62 ? 3   DT  F "O4'" 1 
ATOM   1129 C "C3'" . DT  D 2 11  ? 18.166 65.789 -36.121 1.00 48.92 ? 3   DT  F "C3'" 1 
ATOM   1130 O "O3'" . DT  D 2 11  ? 17.926 64.379 -35.977 1.00 46.79 ? 3   DT  F "O3'" 1 
ATOM   1131 C "C2'" . DT  D 2 11  ? 17.724 66.696 -34.955 1.00 47.55 ? 3   DT  F "C2'" 1 
ATOM   1132 C "C1'" . DT  D 2 11  ? 18.924 66.609 -34.042 1.00 46.90 ? 3   DT  F "C1'" 1 
ATOM   1133 N N1    . DT  D 2 11  ? 19.248 67.617 -33.022 1.00 39.05 ? 3   DT  F N1    1 
ATOM   1134 C C2    . DT  D 2 11  ? 19.256 67.248 -31.685 1.00 44.22 ? 3   DT  F C2    1 
ATOM   1135 O O2    . DT  D 2 11  ? 18.905 66.140 -31.272 1.00 40.02 ? 3   DT  F O2    1 
ATOM   1136 N N3    . DT  D 2 11  ? 19.687 68.236 -30.825 1.00 43.65 ? 3   DT  F N3    1 
ATOM   1137 C C4    . DT  D 2 11  ? 20.068 69.521 -31.155 1.00 37.23 ? 3   DT  F C4    1 
ATOM   1138 O O4    . DT  D 2 11  ? 20.466 70.308 -30.282 1.00 21.97 ? 3   DT  F O4    1 
ATOM   1139 C C5    . DT  D 2 11  ? 19.962 69.842 -32.556 1.00 38.05 ? 3   DT  F C5    1 
ATOM   1140 C C7    . DT  D 2 11  ? 20.300 71.224 -33.002 1.00 38.41 ? 3   DT  F C7    1 
ATOM   1141 C C6    . DT  D 2 11  ? 19.568 68.886 -33.405 1.00 36.36 ? 3   DT  F C6    1 
ATOM   1142 P P     . DT  D 2 12  ? 16.515 63.846 -35.418 1.00 52.41 ? 2   DT  F P     1 
ATOM   1143 O OP1   . DT  D 2 12  ? 16.721 62.385 -35.617 1.00 53.41 ? 2   DT  F OP1   1 
ATOM   1144 O OP2   . DT  D 2 12  ? 15.305 64.513 -36.022 1.00 41.66 ? 2   DT  F OP2   1 
ATOM   1145 O "O5'" . DT  D 2 12  ? 16.575 64.193 -33.860 1.00 43.65 ? 2   DT  F "O5'" 1 
ATOM   1146 C "C5'" . DT  D 2 12  ? 17.683 63.740 -33.069 1.00 35.55 ? 2   DT  F "C5'" 1 
ATOM   1147 C "C4'" . DT  D 2 12  ? 17.190 62.971 -31.868 1.00 31.54 ? 2   DT  F "C4'" 1 
ATOM   1148 O "O4'" . DT  D 2 12  ? 17.188 63.866 -30.750 1.00 34.53 ? 2   DT  F "O4'" 1 
ATOM   1149 C "C3'" . DT  D 2 12  ? 15.768 62.401 -31.897 1.00 30.42 ? 2   DT  F "C3'" 1 
ATOM   1150 O "O3'" . DT  D 2 12  ? 15.787 61.274 -31.006 1.00 22.21 ? 2   DT  F "O3'" 1 
ATOM   1151 C "C2'" . DT  D 2 12  ? 14.936 63.558 -31.340 1.00 35.28 ? 2   DT  F "C2'" 1 
ATOM   1152 C "C1'" . DT  D 2 12  ? 15.857 64.113 -30.248 1.00 36.47 ? 2   DT  F "C1'" 1 
ATOM   1153 N N1    . DT  D 2 12  ? 15.870 65.528 -29.985 1.00 39.07 ? 2   DT  F N1    1 
ATOM   1154 C C2    . DT  D 2 12  ? 15.901 66.097 -28.778 1.00 46.69 ? 2   DT  F C2    1 
ATOM   1155 O O2    . DT  D 2 12  ? 15.829 65.459 -27.749 1.00 59.05 ? 2   DT  F O2    1 
ATOM   1156 N N3    . DT  D 2 12  ? 16.032 67.466 -28.804 1.00 51.91 ? 2   DT  F N3    1 
ATOM   1157 C C4    . DT  D 2 12  ? 16.126 68.286 -29.899 1.00 48.90 ? 2   DT  F C4    1 
ATOM   1158 O O4    . DT  D 2 12  ? 16.250 69.495 -29.760 1.00 46.07 ? 2   DT  F O4    1 
ATOM   1159 C C5    . DT  D 2 12  ? 16.048 67.577 -31.183 1.00 48.13 ? 2   DT  F C5    1 
ATOM   1160 C C7    . DT  D 2 12  ? 16.134 68.330 -32.468 1.00 50.66 ? 2   DT  F C7    1 
ATOM   1161 C C6    . DT  D 2 12  ? 15.917 66.271 -31.142 1.00 43.95 ? 2   DT  F C6    1 
ATOM   1162 P P     . DT  D 2 13  ? 14.456 60.441 -30.722 1.00 32.30 ? 1   DT  F P     1 
ATOM   1163 O OP1   . DT  D 2 13  ? 14.828 59.049 -31.085 1.00 40.98 ? 1   DT  F OP1   1 
ATOM   1164 O OP2   . DT  D 2 13  ? 13.179 61.027 -31.282 1.00 22.59 ? 1   DT  F OP2   1 
ATOM   1165 O "O5'" . DT  D 2 13  ? 14.344 60.439 -29.125 1.00 35.25 ? 1   DT  F "O5'" 1 
ATOM   1166 C "C5'" . DT  D 2 13  ? 15.492 60.655 -28.238 1.00 27.92 ? 1   DT  F "C5'" 1 
ATOM   1167 C "C4'" . DT  D 2 13  ? 15.021 61.310 -26.950 1.00 30.56 ? 1   DT  F "C4'" 1 
ATOM   1168 O "O4'" . DT  D 2 13  ? 14.977 62.765 -27.120 1.00 30.57 ? 1   DT  F "O4'" 1 
ATOM   1169 C "C3'" . DT  D 2 13  ? 13.592 60.901 -26.508 1.00 25.15 ? 1   DT  F "C3'" 1 
ATOM   1170 O "O3'" . DT  D 2 13  ? 13.578 60.555 -25.104 1.00 12.72 ? 1   DT  F "O3'" 1 
ATOM   1171 C "C2'" . DT  D 2 13  ? 12.753 62.139 -26.814 1.00 24.36 ? 1   DT  F "C2'" 1 
ATOM   1172 C "C1'" . DT  D 2 13  ? 13.754 63.247 -26.538 1.00 28.72 ? 1   DT  F "C1'" 1 
ATOM   1173 N N1    . DT  D 2 13  ? 13.458 64.615 -27.085 1.00 30.60 ? 1   DT  F N1    1 
ATOM   1174 C C2    . DT  D 2 13  ? 13.589 65.732 -26.247 1.00 32.58 ? 1   DT  F C2    1 
ATOM   1175 O O2    . DT  D 2 13  ? 13.923 65.702 -25.078 1.00 35.01 ? 1   DT  F O2    1 
ATOM   1176 N N3    . DT  D 2 13  ? 13.315 66.919 -26.847 1.00 37.09 ? 1   DT  F N3    1 
ATOM   1177 C C4    . DT  D 2 13  ? 12.943 67.138 -28.148 1.00 36.10 ? 1   DT  F C4    1 
ATOM   1178 O O4    . DT  D 2 13  ? 12.747 68.269 -28.542 1.00 44.33 ? 1   DT  F O4    1 
ATOM   1179 C C5    . DT  D 2 13  ? 12.820 65.983 -28.961 1.00 31.86 ? 1   DT  F C5    1 
ATOM   1180 C C7    . DT  D 2 13  ? 12.413 66.178 -30.383 1.00 32.66 ? 1   DT  F C7    1 
ATOM   1181 C C6    . DT  D 2 13  ? 13.073 64.784 -28.405 1.00 34.42 ? 1   DT  F C6    1 
ATOM   1182 P P     . DT  D 2 14  ? 12.188 60.480 -24.279 1.00 15.05 ? -1  DT  F P     1 
ATOM   1183 O OP1   . DT  D 2 14  ? 12.251 59.415 -23.241 1.00 21.55 ? -1  DT  F OP1   1 
ATOM   1184 O OP2   . DT  D 2 14  ? 11.084 60.465 -25.239 1.00 6.00  ? -1  DT  F OP2   1 
ATOM   1185 O "O5'" . DT  D 2 14  ? 12.182 61.797 -23.385 1.00 14.54 ? -1  DT  F "O5'" 1 
ATOM   1186 C "C5'" . DT  D 2 14  ? 13.385 62.271 -22.710 1.00 11.85 ? -1  DT  F "C5'" 1 
ATOM   1187 C "C4'" . DT  D 2 14  ? 13.082 63.520 -21.916 1.00 13.82 ? -1  DT  F "C4'" 1 
ATOM   1188 O "O4'" . DT  D 2 14  ? 12.906 64.607 -22.857 1.00 19.41 ? -1  DT  F "O4'" 1 
ATOM   1189 C "C3'" . DT  D 2 14  ? 11.782 63.437 -21.115 1.00 15.05 ? -1  DT  F "C3'" 1 
ATOM   1190 O "O3'" . DT  D 2 14  ? 11.961 63.881 -19.761 1.00 17.07 ? -1  DT  F "O3'" 1 
ATOM   1191 C "C2'" . DT  D 2 14  ? 10.787 64.287 -21.891 1.00 6.89  ? -1  DT  F "C2'" 1 
ATOM   1192 C "C1'" . DT  D 2 14  ? 11.651 65.256 -22.664 1.00 21.01 ? -1  DT  F "C1'" 1 
ATOM   1193 N N1    . DT  D 2 14  ? 11.145 65.760 -24.011 1.00 24.63 ? -1  DT  F N1    1 
ATOM   1194 C C2    . DT  D 2 14  ? 11.137 67.134 -24.205 1.00 27.53 ? -1  DT  F C2    1 
ATOM   1195 O O2    . DT  D 2 14  ? 11.484 67.924 -23.371 1.00 38.98 ? -1  DT  F O2    1 
ATOM   1196 N N3    . DT  D 2 14  ? 10.705 67.547 -25.410 1.00 27.41 ? -1  DT  F N3    1 
ATOM   1197 C C4    . DT  D 2 14  ? 10.281 66.760 -26.438 1.00 35.65 ? -1  DT  F C4    1 
ATOM   1198 O O4    . DT  D 2 14  ? 9.927  67.286 -27.480 1.00 37.53 ? -1  DT  F O4    1 
ATOM   1199 C C5    . DT  D 2 14  ? 10.285 65.338 -26.187 1.00 29.35 ? -1  DT  F C5    1 
ATOM   1200 C C7    . DT  D 2 14  ? 9.819  64.413 -27.255 1.00 32.15 ? -1  DT  F C7    1 
ATOM   1201 C C6    . DT  D 2 14  ? 10.712 64.917 -25.001 1.00 19.91 ? -1  DT  F C6    1 
ATOM   1202 P P     . DT  D 2 15  ? 10.662 64.226 -18.861 1.00 31.69 ? -2  DT  F P     1 
ATOM   1203 O OP1   . DT  D 2 15  ? 10.837 63.852 -17.419 1.00 27.99 ? -2  DT  F OP1   1 
ATOM   1204 O OP2   . DT  D 2 15  ? 9.475  63.792 -19.594 1.00 28.90 ? -2  DT  F OP2   1 
ATOM   1205 O "O5'" . DT  D 2 15  ? 10.454 65.815 -18.969 1.00 34.82 ? -2  DT  F "O5'" 1 
ATOM   1206 C "C5'" . DT  D 2 15  ? 11.386 66.726 -18.388 1.00 31.12 ? -2  DT  F "C5'" 1 
ATOM   1207 C "C4'" . DT  D 2 15  ? 10.797 68.113 -18.334 1.00 30.21 ? -2  DT  F "C4'" 1 
ATOM   1208 O "O4'" . DT  D 2 15  ? 10.530 68.547 -19.655 1.00 27.25 ? -2  DT  F "O4'" 1 
ATOM   1209 C "C3'" . DT  D 2 15  ? 9.501  68.322 -17.565 1.00 29.47 ? -2  DT  F "C3'" 1 
ATOM   1210 O "O3'" . DT  D 2 15  ? 9.675  69.449 -16.722 1.00 30.82 ? -2  DT  F "O3'" 1 
ATOM   1211 C "C2'" . DT  D 2 15  ? 8.474  68.692 -18.610 1.00 21.09 ? -2  DT  F "C2'" 1 
ATOM   1212 C "C1'" . DT  D 2 15  ? 9.337  69.302 -19.699 1.00 28.82 ? -2  DT  F "C1'" 1 
ATOM   1213 N N1    . DT  D 2 15  ? 8.822  69.019 -20.972 1.00 28.79 ? -2  DT  F N1    1 
ATOM   1214 C C2    . DT  D 2 15  ? 8.830  69.799 -22.068 1.00 25.08 ? -2  DT  F C2    1 
ATOM   1215 O O2    . DT  D 2 15  ? 9.252  70.938 -22.082 1.00 14.14 ? -2  DT  F O2    1 
ATOM   1216 N N3    . DT  D 2 15  ? 8.301  69.169 -23.179 1.00 30.71 ? -2  DT  F N3    1 
ATOM   1217 C C4    . DT  D 2 15  ? 7.768  67.873 -23.259 1.00 36.08 ? -2  DT  F C4    1 
ATOM   1218 O O4    . DT  D 2 15  ? 7.361  67.511 -24.410 1.00 41.48 ? -2  DT  F O4    1 
ATOM   1219 C C5    . DT  D 2 15  ? 7.781  67.162 -22.046 1.00 37.09 ? -2  DT  F C5    1 
ATOM   1220 C C7    . DT  D 2 15  ? 7.218  65.782 -21.986 1.00 43.79 ? -2  DT  F C7    1 
ATOM   1221 C C6    . DT  D 2 15  ? 8.296  67.753 -21.001 1.00 33.35 ? -2  DT  F C6    1 
ATOM   1222 P P     . DC  D 2 16  ? 9.124  69.374 -15.246 1.00 32.20 ? -3  DC  F P     1 
ATOM   1223 O OP1   . DC  D 2 16  ? 10.272 69.694 -14.373 1.00 36.84 ? -3  DC  F OP1   1 
ATOM   1224 O OP2   . DC  D 2 16  ? 8.439  68.048 -15.117 1.00 41.15 ? -3  DC  F OP2   1 
ATOM   1225 O "O5'" . DC  D 2 16  ? 7.968  70.469 -15.199 1.00 36.60 ? -3  DC  F "O5'" 1 
ATOM   1226 C "C5'" . DC  D 2 16  ? 8.272  71.884 -15.260 1.00 43.50 ? -3  DC  F "C5'" 1 
ATOM   1227 C "C4'" . DC  D 2 16  ? 7.243  72.621 -16.092 1.00 42.93 ? -3  DC  F "C4'" 1 
ATOM   1228 O "O4'" . DC  D 2 16  ? 7.257  72.002 -17.411 1.00 40.03 ? -3  DC  F "O4'" 1 
ATOM   1229 C "C3'" . DC  D 2 16  ? 5.789  72.513 -15.599 1.00 46.41 ? -3  DC  F "C3'" 1 
ATOM   1230 O "O3'" . DC  D 2 16  ? 5.426  73.385 -14.418 1.00 42.57 ? -3  DC  F "O3'" 1 
ATOM   1231 C "C2'" . DC  D 2 16  ? 4.986  72.597 -16.892 1.00 44.46 ? -3  DC  F "C2'" 1 
ATOM   1232 C "C1'" . DC  D 2 16  ? 5.984  72.151 -18.008 1.00 41.83 ? -3  DC  F "C1'" 1 
ATOM   1233 N N1    . DC  D 2 16  ? 5.604  70.893 -18.735 1.00 48.80 ? -3  DC  F N1    1 
ATOM   1234 C C2    . DC  D 2 16  ? 5.304  70.994 -20.135 1.00 50.69 ? -3  DC  F C2    1 
ATOM   1235 O O2    . DC  D 2 16  ? 5.392  72.101 -20.713 1.00 51.79 ? -3  DC  F O2    1 
ATOM   1236 N N3    . DC  D 2 16  ? 4.914  69.879 -20.827 1.00 58.22 ? -3  DC  F N3    1 
ATOM   1237 C C4    . DC  D 2 16  ? 4.803  68.701 -20.196 1.00 53.61 ? -3  DC  F C4    1 
ATOM   1238 N N4    . DC  D 2 16  ? 4.427  67.614 -20.926 1.00 49.65 ? -3  DC  F N4    1 
ATOM   1239 C C5    . DC  D 2 16  ? 5.084  68.572 -18.773 1.00 45.16 ? -3  DC  F C5    1 
ATOM   1240 C C6    . DC  D 2 16  ? 5.498  69.679 -18.101 1.00 44.33 ? -3  DC  F C6    1 
ATOM   1241 P P     . DG  D 2 17  ? 5.037  74.995 -14.547 1.00 39.33 ? -4  DG  F P     1 
ATOM   1242 O OP1   . DG  D 2 17  ? 6.007  75.744 -13.668 1.00 35.08 ? -4  DG  F OP1   1 
ATOM   1243 O OP2   . DG  D 2 17  ? 3.604  75.180 -14.300 1.00 40.39 ? -4  DG  F OP2   1 
ATOM   1244 O "O5'" . DG  D 2 17  ? 5.206  75.347 -16.096 1.00 41.07 ? -4  DG  F "O5'" 1 
ATOM   1245 C "C5'" . DG  D 2 17  ? 5.027  76.680 -16.602 1.00 35.38 ? -4  DG  F "C5'" 1 
ATOM   1246 C "C4'" . DG  D 2 17  ? 3.663  76.856 -17.236 1.00 33.70 ? -4  DG  F "C4'" 1 
ATOM   1247 O "O4'" . DG  D 2 17  ? 3.508  76.048 -18.412 1.00 33.45 ? -4  DG  F "O4'" 1 
ATOM   1248 C "C3'" . DG  D 2 17  ? 2.449  76.510 -16.382 1.00 37.99 ? -4  DG  F "C3'" 1 
ATOM   1249 O "O3'" . DG  D 2 17  ? 2.029  77.568 -15.494 1.00 48.05 ? -4  DG  F "O3'" 1 
ATOM   1250 C "C2'" . DG  D 2 17  ? 1.359  76.385 -17.431 1.00 39.25 ? -4  DG  F "C2'" 1 
ATOM   1251 C "C1'" . DG  D 2 17  ? 2.107  75.738 -18.582 1.00 37.17 ? -4  DG  F "C1'" 1 
ATOM   1252 N N9    . DG  D 2 17  ? 1.948  74.284 -18.543 1.00 39.53 ? -4  DG  F N9    1 
ATOM   1253 C C8    . DG  D 2 17  ? 2.141  73.450 -17.454 1.00 38.35 ? -4  DG  F C8    1 
ATOM   1254 N N7    . DG  D 2 17  ? 1.939  72.202 -17.736 1.00 29.32 ? -4  DG  F N7    1 
ATOM   1255 C C5    . DG  D 2 17  ? 1.590  72.214 -19.075 1.00 35.52 ? -4  DG  F C5    1 
ATOM   1256 C C6    . DG  D 2 17  ? 1.184  71.156 -19.905 1.00 42.22 ? -4  DG  F C6    1 
ATOM   1257 O O6    . DG  D 2 17  ? 1.099  69.939 -19.661 1.00 57.28 ? -4  DG  F O6    1 
ATOM   1258 N N1    . DG  D 2 17  ? 0.846  71.601 -21.154 1.00 39.11 ? -4  DG  F N1    1 
ATOM   1259 C C2    . DG  D 2 17  ? 0.907  72.912 -21.570 1.00 26.08 ? -4  DG  F C2    1 
ATOM   1260 N N2    . DG  D 2 17  ? 0.584  73.165 -22.824 1.00 21.36 ? -4  DG  F N2    1 
ATOM   1261 N N3    . DG  D 2 17  ? 1.266  73.895 -20.813 1.00 27.06 ? -4  DG  F N3    1 
ATOM   1262 C C4    . DG  D 2 17  ? 1.587  73.481 -19.586 1.00 31.66 ? -4  DG  F C4    1 
ATOM   1263 N N     . PRO E 3 9   ? 2.485  52.992 17.298  1.00 29.82 ? 9   PRO A N     1 
ATOM   1264 C CA    . PRO E 3 9   ? 3.912  52.675 17.029  1.00 30.59 ? 9   PRO A CA    1 
ATOM   1265 C C     . PRO E 3 9   ? 4.653  53.984 16.717  1.00 32.48 ? 9   PRO A C     1 
ATOM   1266 O O     . PRO E 3 9   ? 4.049  54.977 16.295  1.00 19.36 ? 9   PRO A O     1 
ATOM   1267 C CB    . PRO E 3 9   ? 3.959  51.720 15.843  1.00 28.81 ? 9   PRO A CB    1 
ATOM   1268 C CG    . PRO E 3 9   ? 2.554  51.002 15.963  1.00 33.65 ? 9   PRO A CG    1 
ATOM   1269 C CD    . PRO E 3 9   ? 1.593  52.039 16.575  1.00 23.18 ? 9   PRO A CD    1 
ATOM   1270 N N     . THR E 3 10  ? 5.960  53.949 16.887  1.00 32.84 ? 10  THR A N     1 
ATOM   1271 C CA    . THR E 3 10  ? 6.855  55.098 16.746  1.00 38.17 ? 10  THR A CA    1 
ATOM   1272 C C     . THR E 3 10  ? 6.775  55.921 15.430  1.00 39.21 ? 10  THR A C     1 
ATOM   1273 O O     . THR E 3 10  ? 6.598  57.156 15.448  1.00 39.24 ? 10  THR A O     1 
ATOM   1274 C CB    . THR E 3 10  ? 8.300  54.591 16.949  1.00 39.48 ? 10  THR A CB    1 
ATOM   1275 O OG1   . THR E 3 10  ? 8.264  53.268 17.542  1.00 38.27 ? 10  THR A OG1   1 
ATOM   1276 C CG2   . THR E 3 10  ? 9.069  55.533 17.852  1.00 34.75 ? 10  THR A CG2   1 
ATOM   1277 N N     . LEU E 3 11  ? 6.857  55.210 14.302  1.00 43.48 ? 11  LEU A N     1 
ATOM   1278 C CA    . LEU E 3 11  ? 6.834  55.776 12.949  1.00 36.85 ? 11  LEU A CA    1 
ATOM   1279 C C     . LEU E 3 11  ? 5.513  56.484 12.648  1.00 37.85 ? 11  LEU A C     1 
ATOM   1280 O O     . LEU E 3 11  ? 5.368  57.117 11.605  1.00 32.32 ? 11  LEU A O     1 
ATOM   1281 C CB    . LEU E 3 11  ? 7.101  54.658 11.910  1.00 37.69 ? 11  LEU A CB    1 
ATOM   1282 C CG    . LEU E 3 11  ? 6.344  53.307 11.964  1.00 38.74 ? 11  LEU A CG    1 
ATOM   1283 C CD1   . LEU E 3 11  ? 5.934  52.889 10.546  1.00 39.37 ? 11  LEU A CD1   1 
ATOM   1284 C CD2   . LEU E 3 11  ? 7.225  52.227 12.615  1.00 33.65 ? 11  LEU A CD2   1 
ATOM   1285 N N     . GLU E 3 12  ? 4.545  56.343 13.555  1.00 42.84 ? 12  GLU A N     1 
ATOM   1286 C CA    . GLU E 3 12  ? 3.289  57.095 13.496  1.00 47.12 ? 12  GLU A CA    1 
ATOM   1287 C C     . GLU E 3 12  ? 3.197  58.072 14.693  1.00 47.78 ? 12  GLU A C     1 
ATOM   1288 O O     . GLU E 3 12  ? 2.569  59.138 14.589  1.00 50.94 ? 12  GLU A O     1 
ATOM   1289 C CB    . GLU E 3 12  ? 2.063  56.135 13.464  1.00 48.47 ? 12  GLU A CB    1 
ATOM   1290 C CG    . GLU E 3 12  ? 2.184  54.782 14.223  1.00 52.71 ? 12  GLU A CG    1 
ATOM   1291 C CD    . GLU E 3 12  ? 2.285  53.519 13.321  1.00 55.91 ? 12  GLU A CD    1 
ATOM   1292 O OE1   . GLU E 3 12  ? 3.421  53.026 13.078  1.00 57.62 ? 12  GLU A OE1   1 
ATOM   1293 O OE2   . GLU E 3 12  ? 1.219  52.987 12.900  1.00 52.94 ? 12  GLU A OE2   1 
ATOM   1294 N N     . TRP E 3 13  ? 3.907  57.741 15.776  1.00 43.81 ? 13  TRP A N     1 
ATOM   1295 C CA    . TRP E 3 13  ? 4.000  58.551 16.999  1.00 45.47 ? 13  TRP A CA    1 
ATOM   1296 C C     . TRP E 3 13  ? 4.801  59.821 16.739  1.00 47.95 ? 13  TRP A C     1 
ATOM   1297 O O     . TRP E 3 13  ? 4.287  60.953 16.838  1.00 40.82 ? 13  TRP A O     1 
ATOM   1298 C CB    . TRP E 3 13  ? 4.706  57.750 18.103  1.00 45.57 ? 13  TRP A CB    1 
ATOM   1299 C CG    . TRP E 3 13  ? 5.253  58.573 19.274  1.00 42.12 ? 13  TRP A CG    1 
ATOM   1300 C CD1   . TRP E 3 13  ? 4.516  59.211 20.217  1.00 37.34 ? 13  TRP A CD1   1 
ATOM   1301 C CD2   . TRP E 3 13  ? 6.646  58.743 19.663  1.00 41.03 ? 13  TRP A CD2   1 
ATOM   1302 N NE1   . TRP E 3 13  ? 5.343  59.746 21.177  1.00 45.80 ? 13  TRP A NE1   1 
ATOM   1303 C CE2   . TRP E 3 13  ? 6.649  59.480 20.866  1.00 40.74 ? 13  TRP A CE2   1 
ATOM   1304 C CE3   . TRP E 3 13  ? 7.873  58.342 19.115  1.00 39.79 ? 13  TRP A CE3   1 
ATOM   1305 C CZ2   . TRP E 3 13  ? 7.857  59.828 21.548  1.00 34.53 ? 13  TRP A CZ2   1 
ATOM   1306 C CZ3   . TRP E 3 13  ? 9.081  58.693 19.800  1.00 37.41 ? 13  TRP A CZ3   1 
ATOM   1307 C CH2   . TRP E 3 13  ? 9.049  59.425 21.000  1.00 24.04 ? 13  TRP A CH2   1 
ATOM   1308 N N     . PHE E 3 14  ? 6.099  59.610 16.494  1.00 47.52 ? 14  PHE A N     1 
ATOM   1309 C CA    . PHE E 3 14  ? 7.061  60.665 16.197  1.00 34.02 ? 14  PHE A CA    1 
ATOM   1310 C C     . PHE E 3 14  ? 6.459  61.383 15.003  1.00 34.08 ? 14  PHE A C     1 
ATOM   1311 O O     . PHE E 3 14  ? 6.361  62.607 15.030  1.00 28.52 ? 14  PHE A O     1 
ATOM   1312 C CB    . PHE E 3 14  ? 8.413  59.971 15.956  1.00 21.83 ? 14  PHE A CB    1 
ATOM   1313 C CG    . PHE E 3 14  ? 9.309  60.594 14.936  1.00 9.54  ? 14  PHE A CG    1 
ATOM   1314 C CD1   . PHE E 3 14  ? 10.597 60.941 15.298  1.00 12.06 ? 14  PHE A CD1   1 
ATOM   1315 C CD2   . PHE E 3 14  ? 8.961  60.626 13.583  1.00 6.00  ? 14  PHE A CD2   1 
ATOM   1316 C CE1   . PHE E 3 14  ? 11.531 61.290 14.333  1.00 18.33 ? 14  PHE A CE1   1 
ATOM   1317 C CE2   . PHE E 3 14  ? 9.865  60.970 12.612  1.00 6.00  ? 14  PHE A CE2   1 
ATOM   1318 C CZ    . PHE E 3 14  ? 11.162 61.301 12.978  1.00 11.67 ? 14  PHE A CZ    1 
ATOM   1319 N N     . LEU E 3 15  ? 5.868  60.611 14.079  1.00 35.44 ? 15  LEU A N     1 
ATOM   1320 C CA    . LEU E 3 15  ? 5.186  61.178 12.908  1.00 37.11 ? 15  LEU A CA    1 
ATOM   1321 C C     . LEU E 3 15  ? 4.142  62.174 13.332  1.00 37.01 ? 15  LEU A C     1 
ATOM   1322 O O     . LEU E 3 15  ? 3.963  63.183 12.655  1.00 42.38 ? 15  LEU A O     1 
ATOM   1323 C CB    . LEU E 3 15  ? 4.504  60.098 12.061  1.00 33.91 ? 15  LEU A CB    1 
ATOM   1324 C CG    . LEU E 3 15  ? 4.466  60.305 10.540  1.00 24.82 ? 15  LEU A CG    1 
ATOM   1325 C CD1   . LEU E 3 15  ? 3.336  61.246 10.152  1.00 20.68 ? 15  LEU A CD1   1 
ATOM   1326 C CD2   . LEU E 3 15  ? 5.829  60.850 10.090  1.00 18.13 ? 15  LEU A CD2   1 
ATOM   1327 N N     . SER E 3 16  ? 3.466  61.913 14.446  1.00 40.34 ? 16  SER A N     1 
ATOM   1328 C CA    . SER E 3 16  ? 2.534  62.899 14.989  1.00 47.24 ? 16  SER A CA    1 
ATOM   1329 C C     . SER E 3 16  ? 3.296  64.222 15.277  1.00 45.60 ? 16  SER A C     1 
ATOM   1330 O O     . SER E 3 16  ? 3.037  65.264 14.632  1.00 45.64 ? 16  SER A O     1 
ATOM   1331 C CB    . SER E 3 16  ? 1.893  62.377 16.292  1.00 51.82 ? 16  SER A CB    1 
ATOM   1332 O OG    . SER E 3 16  ? 1.352  61.058 16.171  1.00 56.10 ? 16  SER A OG    1 
ATOM   1333 N N     . HIS E 3 17  ? 4.322  64.113 16.129  1.00 41.68 ? 17  HIS A N     1 
ATOM   1334 C CA    . HIS E 3 17  ? 5.104  65.257 16.638  1.00 43.03 ? 17  HIS A CA    1 
ATOM   1335 C C     . HIS E 3 17  ? 5.747  66.178 15.601  1.00 41.24 ? 17  HIS A C     1 
ATOM   1336 O O     . HIS E 3 17  ? 6.035  67.336 15.912  1.00 42.26 ? 17  HIS A O     1 
ATOM   1337 C CB    . HIS E 3 17  ? 6.246  64.793 17.553  1.00 49.29 ? 17  HIS A CB    1 
ATOM   1338 C CG    . HIS E 3 17  ? 5.819  63.988 18.748  1.00 60.62 ? 17  HIS A CG    1 
ATOM   1339 N ND1   . HIS E 3 17  ? 6.648  63.792 19.835  1.00 61.16 ? 17  HIS A ND1   1 
ATOM   1340 C CD2   . HIS E 3 17  ? 4.686  63.288 19.010  1.00 63.11 ? 17  HIS A CD2   1 
ATOM   1341 C CE1   . HIS E 3 17  ? 6.049  63.004 20.712  1.00 61.17 ? 17  HIS A CE1   1 
ATOM   1342 N NE2   . HIS E 3 17  ? 4.856  62.684 20.235  1.00 62.27 ? 17  HIS A NE2   1 
ATOM   1343 N N     . CYS E 3 18  ? 6.075  65.630 14.433  1.00 42.46 ? 18  CYS A N     1 
ATOM   1344 C CA    . CYS E 3 18  ? 6.755  66.359 13.350  1.00 35.42 ? 18  CYS A CA    1 
ATOM   1345 C C     . CYS E 3 18  ? 5.901  67.379 12.605  1.00 39.18 ? 18  CYS A C     1 
ATOM   1346 O O     . CYS E 3 18  ? 4.753  67.638 12.995  1.00 39.77 ? 18  CYS A O     1 
ATOM   1347 C CB    . CYS E 3 18  ? 7.301  65.370 12.335  1.00 31.33 ? 18  CYS A CB    1 
ATOM   1348 S SG    . CYS E 3 18  ? 9.032  65.349 12.285  1.00 22.03 ? 18  CYS A SG    1 
ATOM   1349 N N     . HIS E 3 19  ? 6.467  67.966 11.540  1.00 42.05 ? 19  HIS A N     1 
ATOM   1350 C CA    . HIS E 3 19  ? 5.770  68.969 10.719  1.00 41.29 ? 19  HIS A CA    1 
ATOM   1351 C C     . HIS E 3 19  ? 5.972  68.925 9.176   1.00 43.10 ? 19  HIS A C     1 
ATOM   1352 O O     . HIS E 3 19  ? 6.921  69.507 8.602   1.00 37.62 ? 19  HIS A O     1 
ATOM   1353 C CB    . HIS E 3 19  ? 6.092  70.364 11.265  1.00 38.34 ? 19  HIS A CB    1 
ATOM   1354 C CG    . HIS E 3 19  ? 5.231  70.747 12.429  1.00 48.54 ? 19  HIS A CG    1 
ATOM   1355 N ND1   . HIS E 3 19  ? 5.654  70.636 13.739  1.00 54.85 ? 19  HIS A ND1   1 
ATOM   1356 C CD2   . HIS E 3 19  ? 3.945  71.179 12.484  1.00 50.90 ? 19  HIS A CD2   1 
ATOM   1357 C CE1   . HIS E 3 19  ? 4.667  70.983 14.549  1.00 58.23 ? 19  HIS A CE1   1 
ATOM   1358 N NE2   . HIS E 3 19  ? 3.618  71.316 13.814  1.00 54.02 ? 19  HIS A NE2   1 
ATOM   1359 N N     . ILE E 3 20  ? 4.991  68.262 8.553   1.00 37.94 ? 20  ILE A N     1 
ATOM   1360 C CA    . ILE E 3 20  ? 4.842  67.998 7.120   1.00 36.71 ? 20  ILE A CA    1 
ATOM   1361 C C     . ILE E 3 20  ? 4.895  69.201 6.145   1.00 39.91 ? 20  ILE A C     1 
ATOM   1362 O O     . ILE E 3 20  ? 4.101  70.144 6.244   1.00 42.59 ? 20  ILE A O     1 
ATOM   1363 C CB    . ILE E 3 20  ? 3.509  67.237 6.925   1.00 36.38 ? 20  ILE A CB    1 
ATOM   1364 C CG1   . ILE E 3 20  ? 3.349  66.826 5.468   1.00 35.54 ? 20  ILE A CG1   1 
ATOM   1365 C CG2   . ILE E 3 20  ? 2.312  68.116 7.402   1.00 24.96 ? 20  ILE A CG2   1 
ATOM   1366 C CD1   . ILE E 3 20  ? 2.035  66.065 5.201   1.00 42.79 ? 20  ILE A CD1   1 
ATOM   1367 N N     . HIS E 3 21  ? 5.819  69.158 5.190   1.00 44.26 ? 21  HIS A N     1 
ATOM   1368 C CA    . HIS E 3 21  ? 5.959  70.222 4.180   1.00 45.79 ? 21  HIS A CA    1 
ATOM   1369 C C     . HIS E 3 21  ? 6.096  69.592 2.823   1.00 39.68 ? 21  HIS A C     1 
ATOM   1370 O O     . HIS E 3 21  ? 6.780  68.584 2.686   1.00 41.34 ? 21  HIS A O     1 
ATOM   1371 C CB    . HIS E 3 21  ? 7.227  71.057 4.367   1.00 51.61 ? 21  HIS A CB    1 
ATOM   1372 C CG    . HIS E 3 21  ? 7.252  71.884 5.608   1.00 52.20 ? 21  HIS A CG    1 
ATOM   1373 N ND1   . HIS E 3 21  ? 8.412  72.450 6.087   1.00 48.70 ? 21  HIS A ND1   1 
ATOM   1374 C CD2   . HIS E 3 21  ? 6.268  72.253 6.459   1.00 50.11 ? 21  HIS A CD2   1 
ATOM   1375 C CE1   . HIS E 3 21  ? 8.142  73.134 7.183   1.00 52.48 ? 21  HIS A CE1   1 
ATOM   1376 N NE2   . HIS E 3 21  ? 6.848  73.030 7.430   1.00 52.19 ? 21  HIS A NE2   1 
ATOM   1377 N N     . LYS E 3 22  ? 5.545  70.231 1.804   1.00 38.30 ? 22  LYS A N     1 
ATOM   1378 C CA    . LYS E 3 22  ? 5.745  69.739 0.451   1.00 39.40 ? 22  LYS A CA    1 
ATOM   1379 C C     . LYS E 3 22  ? 6.896  70.542 -0.133  1.00 37.44 ? 22  LYS A C     1 
ATOM   1380 O O     . LYS E 3 22  ? 7.144  71.686 0.296   1.00 40.65 ? 22  LYS A O     1 
ATOM   1381 C CB    . LYS E 3 22  ? 4.484  69.928 -0.394  1.00 40.65 ? 22  LYS A CB    1 
ATOM   1382 C CG    . LYS E 3 22  ? 4.096  68.686 -1.205  1.00 41.89 ? 22  LYS A CG    1 
ATOM   1383 C CD    . LYS E 3 22  ? 4.739  68.607 -2.597  1.00 39.71 ? 22  LYS A CD    1 
ATOM   1384 C CE    . LYS E 3 22  ? 3.678  68.866 -3.682  1.00 35.86 ? 22  LYS A CE    1 
ATOM   1385 N NZ    . LYS E 3 22  ? 4.071  68.426 -5.056  1.00 32.74 ? 22  LYS A NZ    1 
ATOM   1386 N N     . TYR E 3 23  ? 7.656  69.890 -1.011  1.00 34.72 ? 23  TYR A N     1 
ATOM   1387 C CA    . TYR E 3 23  ? 8.773  70.502 -1.718  1.00 34.23 ? 23  TYR A CA    1 
ATOM   1388 C C     . TYR E 3 23  ? 8.599  69.981 -3.144  1.00 31.28 ? 23  TYR A C     1 
ATOM   1389 O O     . TYR E 3 23  ? 8.245  68.799 -3.332  1.00 28.17 ? 23  TYR A O     1 
ATOM   1390 C CB    . TYR E 3 23  ? 10.122 70.035 -1.145  1.00 27.28 ? 23  TYR A CB    1 
ATOM   1391 C CG    . TYR E 3 23  ? 10.595 70.674 0.168   1.00 31.81 ? 23  TYR A CG    1 
ATOM   1392 C CD1   . TYR E 3 23  ? 9.719  70.896 1.247   1.00 29.53 ? 23  TYR A CD1   1 
ATOM   1393 C CD2   . TYR E 3 23  ? 11.954 70.926 0.381   1.00 28.81 ? 23  TYR A CD2   1 
ATOM   1394 C CE1   . TYR E 3 23  ? 10.184 71.336 2.494   1.00 24.46 ? 23  TYR A CE1   1 
ATOM   1395 C CE2   . TYR E 3 23  ? 12.432 71.356 1.624   1.00 26.65 ? 23  TYR A CE2   1 
ATOM   1396 C CZ    . TYR E 3 23  ? 11.543 71.556 2.680   1.00 24.22 ? 23  TYR A CZ    1 
ATOM   1397 O OH    . TYR E 3 23  ? 12.034 71.940 3.922   1.00 26.15 ? 23  TYR A OH    1 
ATOM   1398 N N     . PRO E 3 24  ? 8.713  70.877 -4.158  1.00 29.47 ? 24  PRO A N     1 
ATOM   1399 C CA    . PRO E 3 24  ? 8.311  70.580 -5.539  1.00 30.18 ? 24  PRO A CA    1 
ATOM   1400 C C     . PRO E 3 24  ? 9.319  69.697 -6.245  1.00 27.96 ? 24  PRO A C     1 
ATOM   1401 O O     . PRO E 3 24  ? 10.338 69.304 -5.665  1.00 8.07  ? 24  PRO A O     1 
ATOM   1402 C CB    . PRO E 3 24  ? 8.207  71.954 -6.174  1.00 30.36 ? 24  PRO A CB    1 
ATOM   1403 C CG    . PRO E 3 24  ? 9.373  72.671 -5.520  1.00 31.18 ? 24  PRO A CG    1 
ATOM   1404 C CD    . PRO E 3 24  ? 9.128  72.311 -4.059  1.00 28.09 ? 24  PRO A CD    1 
ATOM   1405 N N     . SER E 3 25  ? 9.090  69.471 -7.531  1.00 23.86 ? 25  SER A N     1 
ATOM   1406 C CA    . SER E 3 25  ? 9.983  68.622 -8.278  1.00 27.22 ? 25  SER A CA    1 
ATOM   1407 C C     . SER E 3 25  ? 11.281 69.337 -8.655  1.00 22.66 ? 25  SER A C     1 
ATOM   1408 O O     . SER E 3 25  ? 11.393 69.889 -9.754  1.00 22.66 ? 25  SER A O     1 
ATOM   1409 C CB    . SER E 3 25  ? 9.257  68.086 -9.520  1.00 33.58 ? 25  SER A CB    1 
ATOM   1410 O OG    . SER E 3 25  ? 8.140  67.289 -9.144  1.00 40.36 ? 25  SER A OG    1 
ATOM   1411 N N     . LYS E 3 26  ? 12.169 69.431 -7.661  1.00 16.99 ? 26  LYS A N     1 
ATOM   1412 C CA    . LYS E 3 26  ? 13.538 69.986 -7.722  1.00 13.95 ? 26  LYS A CA    1 
ATOM   1413 C C     . LYS E 3 26  ? 13.981 70.876 -6.556  1.00 16.36 ? 26  LYS A C     1 
ATOM   1414 O O     . LYS E 3 26  ? 15.159 71.288 -6.537  1.00 17.32 ? 26  LYS A O     1 
ATOM   1415 C CB    . LYS E 3 26  ? 13.805 70.757 -9.031  1.00 14.45 ? 26  LYS A CB    1 
ATOM   1416 C CG    . LYS E 3 26  ? 14.470 69.899 -10.110 1.00 14.26 ? 26  LYS A CG    1 
ATOM   1417 C CD    . LYS E 3 26  ? 14.003 70.271 -11.499 1.00 20.36 ? 26  LYS A CD    1 
ATOM   1418 C CE    . LYS E 3 26  ? 13.594 69.053 -12.350 1.00 25.43 ? 26  LYS A CE    1 
ATOM   1419 N NZ    . LYS E 3 26  ? 12.146 69.084 -12.748 1.00 26.91 ? 26  LYS A NZ    1 
ATOM   1420 N N     . SER E 3 27  ? 13.100 71.145 -5.579  1.00 11.56 ? 27  SER A N     1 
ATOM   1421 C CA    . SER E 3 27  ? 13.650 72.091 -4.569  1.00 18.65 ? 27  SER A CA    1 
ATOM   1422 C C     . SER E 3 27  ? 14.904 71.538 -3.863  1.00 26.12 ? 27  SER A C     1 
ATOM   1423 O O     . SER E 3 27  ? 14.969 70.324 -3.556  1.00 32.05 ? 27  SER A O     1 
ATOM   1424 C CB    . SER E 3 27  ? 12.532 72.247 -3.551  1.00 13.70 ? 27  SER A CB    1 
ATOM   1425 O OG    . SER E 3 27  ? 11.596 71.205 -3.687  1.00 6.00  ? 27  SER A OG    1 
ATOM   1426 N N     . THR E 3 28  ? 15.923 72.393 -3.686  1.00 26.86 ? 28  THR A N     1 
ATOM   1427 C CA    . THR E 3 28  ? 17.187 71.979 -3.072  1.00 23.86 ? 28  THR A CA    1 
ATOM   1428 C C     . THR E 3 28  ? 16.955 71.889 -1.553  1.00 20.68 ? 28  THR A C     1 
ATOM   1429 O O     . THR E 3 28  ? 17.298 72.808 -0.796  1.00 22.70 ? 28  THR A O     1 
ATOM   1430 C CB    . THR E 3 28  ? 18.378 72.991 -3.442  1.00 17.86 ? 28  THR A CB    1 
ATOM   1431 O OG1   . THR E 3 28  ? 18.668 72.974 -4.854  1.00 12.46 ? 28  THR A OG1   1 
ATOM   1432 C CG2   . THR E 3 28  ? 19.622 72.569 -2.790  1.00 17.27 ? 28  THR A CG2   1 
ATOM   1433 N N     . LEU E 3 29  ? 16.299 70.785 -1.176  1.00 21.39 ? 29  LEU A N     1 
ATOM   1434 C CA    . LEU E 3 29  ? 15.896 70.346 0.178   1.00 15.87 ? 29  LEU A CA    1 
ATOM   1435 C C     . LEU E 3 29  ? 16.807 70.677 1.400   1.00 16.04 ? 29  LEU A C     1 
ATOM   1436 O O     . LEU E 3 29  ? 16.285 71.064 2.445   1.00 13.09 ? 29  LEU A O     1 
ATOM   1437 C CB    . LEU E 3 29  ? 15.684 68.829 0.121   1.00 17.04 ? 29  LEU A CB    1 
ATOM   1438 C CG    . LEU E 3 29  ? 14.409 68.041 0.397   1.00 18.81 ? 29  LEU A CG    1 
ATOM   1439 C CD1   . LEU E 3 29  ? 13.986 68.323 1.807   1.00 22.08 ? 29  LEU A CD1   1 
ATOM   1440 C CD2   . LEU E 3 29  ? 13.340 68.365 -0.612  1.00 14.41 ? 29  LEU A CD2   1 
ATOM   1441 N N     . ILE E 3 30  ? 18.121 70.425 1.302   1.00 10.44 ? 30  ILE A N     1 
ATOM   1442 C CA    . ILE E 3 30  ? 19.131 70.747 2.345   1.00 10.06 ? 30  ILE A CA    1 
ATOM   1443 C C     . ILE E 3 30  ? 20.399 71.159 1.565   1.00 15.57 ? 30  ILE A C     1 
ATOM   1444 O O     . ILE E 3 30  ? 20.446 71.010 0.329   1.00 25.13 ? 30  ILE A O     1 
ATOM   1445 C CB    . ILE E 3 30  ? 19.456 69.504 3.278   1.00 11.41 ? 30  ILE A CB    1 
ATOM   1446 C CG1   . ILE E 3 30  ? 18.233 69.112 4.103   1.00 6.00  ? 30  ILE A CG1   1 
ATOM   1447 C CG2   . ILE E 3 30  ? 20.500 69.846 4.292   1.00 6.00  ? 30  ILE A CG2   1 
ATOM   1448 C CD1   . ILE E 3 30  ? 18.469 67.922 4.971   1.00 10.55 ? 30  ILE A CD1   1 
ATOM   1449 N N     . HIS E 3 31  ? 21.408 71.714 2.232   1.00 14.37 ? 31  HIS A N     1 
ATOM   1450 C CA    . HIS E 3 31  ? 22.561 72.288 1.525   1.00 14.08 ? 31  HIS A CA    1 
ATOM   1451 C C     . HIS E 3 31  ? 23.824 72.007 2.301   1.00 8.67  ? 31  HIS A C     1 
ATOM   1452 O O     . HIS E 3 31  ? 23.844 72.206 3.508   1.00 8.93  ? 31  HIS A O     1 
ATOM   1453 C CB    . HIS E 3 31  ? 22.402 73.828 1.387   1.00 22.56 ? 31  HIS A CB    1 
ATOM   1454 C CG    . HIS E 3 31  ? 21.365 74.281 0.381   1.00 17.58 ? 31  HIS A CG    1 
ATOM   1455 N ND1   . HIS E 3 31  ? 20.025 74.420 0.688   1.00 6.00  ? 31  HIS A ND1   1 
ATOM   1456 C CD2   . HIS E 3 31  ? 21.489 74.650 -0.922  1.00 19.29 ? 31  HIS A CD2   1 
ATOM   1457 C CE1   . HIS E 3 31  ? 19.369 74.839 -0.378  1.00 12.26 ? 31  HIS A CE1   1 
ATOM   1458 N NE2   . HIS E 3 31  ? 20.233 74.990 -1.369  1.00 18.01 ? 31  HIS A NE2   1 
ATOM   1459 H HD1   . HIS E 3 31  ? 19.541 74.110 1.495   1.00 0.00  ? 31  HIS A HD1   1 
ATOM   1460 N N     . GLN E 3 32  ? 24.875 71.566 1.618   1.00 10.83 ? 32  GLN A N     1 
ATOM   1461 C CA    . GLN E 3 32  ? 26.163 71.317 2.270   1.00 13.87 ? 32  GLN A CA    1 
ATOM   1462 C C     . GLN E 3 32  ? 26.679 72.646 2.848   1.00 16.49 ? 32  GLN A C     1 
ATOM   1463 O O     . GLN E 3 32  ? 26.019 73.671 2.686   1.00 17.73 ? 32  GLN A O     1 
ATOM   1464 C CB    . GLN E 3 32  ? 27.176 70.770 1.264   1.00 15.96 ? 32  GLN A CB    1 
ATOM   1465 C CG    . GLN E 3 32  ? 28.547 70.443 1.870   1.00 23.40 ? 32  GLN A CG    1 
ATOM   1466 C CD    . GLN E 3 32  ? 29.659 70.270 0.863   1.00 28.99 ? 32  GLN A CD    1 
ATOM   1467 O OE1   . GLN E 3 32  ? 29.892 71.137 0.022   1.00 44.69 ? 32  GLN A OE1   1 
ATOM   1468 N NE2   . GLN E 3 32  ? 30.383 69.170 0.965   1.00 35.52 ? 32  GLN A NE2   1 
ATOM   1469 N N     . GLY E 3 33  ? 27.809 72.611 3.563   1.00 22.01 ? 33  GLY A N     1 
ATOM   1470 C CA    . GLY E 3 33  ? 28.433 73.794 4.146   1.00 20.06 ? 33  GLY A CA    1 
ATOM   1471 C C     . GLY E 3 33  ? 27.811 74.291 5.459   1.00 22.11 ? 33  GLY A C     1 
ATOM   1472 O O     . GLY E 3 33  ? 28.535 74.620 6.409   1.00 21.09 ? 33  GLY A O     1 
ATOM   1473 N N     . GLU E 3 34  ? 26.478 74.213 5.507   1.00 18.03 ? 34  GLU A N     1 
ATOM   1474 C CA    . GLU E 3 34  ? 25.565 74.815 6.485   1.00 17.53 ? 34  GLU A CA    1 
ATOM   1475 C C     . GLU E 3 34  ? 25.582 74.260 7.900   1.00 20.98 ? 34  GLU A C     1 
ATOM   1476 O O     . GLU E 3 34  ? 26.575 73.665 8.287   1.00 15.82 ? 34  GLU A O     1 
ATOM   1477 C CB    . GLU E 3 34  ? 24.154 74.721 5.927   1.00 17.36 ? 34  GLU A CB    1 
ATOM   1478 C CG    . GLU E 3 34  ? 23.341 75.969 5.978   1.00 20.05 ? 34  GLU A CG    1 
ATOM   1479 C CD    . GLU E 3 34  ? 21.915 75.621 6.296   1.00 35.27 ? 34  GLU A CD    1 
ATOM   1480 O OE1   . GLU E 3 34  ? 21.009 76.292 5.757   1.00 39.16 ? 34  GLU A OE1   1 
ATOM   1481 O OE2   . GLU E 3 34  ? 21.700 74.658 7.084   1.00 32.68 ? 34  GLU A OE2   1 
ATOM   1482 N N     . LYS E 3 35  ? 24.477 74.419 8.654   1.00 21.99 ? 35  LYS A N     1 
ATOM   1483 C CA    . LYS E 3 35  ? 24.439 74.056 10.089  1.00 20.65 ? 35  LYS A CA    1 
ATOM   1484 C C     . LYS E 3 35  ? 23.327 73.120 10.564  1.00 22.51 ? 35  LYS A C     1 
ATOM   1485 O O     . LYS E 3 35  ? 22.120 73.411 10.457  1.00 10.45 ? 35  LYS A O     1 
ATOM   1486 C CB    . LYS E 3 35  ? 24.379 75.317 10.958  1.00 24.74 ? 35  LYS A CB    1 
ATOM   1487 C CG    . LYS E 3 35  ? 25.702 75.731 11.604  1.00 31.72 ? 35  LYS A CG    1 
ATOM   1488 C CD    . LYS E 3 35  ? 26.682 76.365 10.622  1.00 27.89 ? 35  LYS A CD    1 
ATOM   1489 C CE    . LYS E 3 35  ? 27.853 76.970 11.377  1.00 37.41 ? 35  LYS A CE    1 
ATOM   1490 N NZ    . LYS E 3 35  ? 28.424 76.058 12.433  1.00 34.51 ? 35  LYS A NZ    1 
ATOM   1491 N N     . ALA E 3 36  ? 23.784 72.026 11.158  1.00 18.40 ? 36  ALA A N     1 
ATOM   1492 C CA    . ALA E 3 36  ? 22.974 70.931 11.655  1.00 15.71 ? 36  ALA A CA    1 
ATOM   1493 C C     . ALA E 3 36  ? 21.803 71.339 12.542  1.00 20.83 ? 36  ALA A C     1 
ATOM   1494 O O     . ALA E 3 36  ? 21.922 71.269 13.776  1.00 18.22 ? 36  ALA A O     1 
ATOM   1495 C CB    . ALA E 3 36  ? 23.879 69.994 12.407  1.00 20.36 ? 36  ALA A CB    1 
ATOM   1496 N N     . GLU E 3 37  ? 20.677 71.734 11.937  1.00 17.34 ? 37  GLU A N     1 
ATOM   1497 C CA    . GLU E 3 37  ? 19.488 72.087 12.713  1.00 20.61 ? 37  GLU A CA    1 
ATOM   1498 C C     . GLU E 3 37  ? 18.364 71.023 12.882  1.00 17.93 ? 37  GLU A C     1 
ATOM   1499 O O     . GLU E 3 37  ? 18.177 70.458 13.978  1.00 14.27 ? 37  GLU A O     1 
ATOM   1500 C CB    . GLU E 3 37  ? 18.832 73.389 12.161  1.00 30.65 ? 37  GLU A CB    1 
ATOM   1501 C CG    . GLU E 3 37  ? 19.430 74.078 10.920  1.00 30.46 ? 37  GLU A CG    1 
ATOM   1502 C CD    . GLU E 3 37  ? 19.087 73.413 9.568   1.00 40.93 ? 37  GLU A CD    1 
ATOM   1503 O OE1   . GLU E 3 37  ? 20.025 72.876 8.931   1.00 44.14 ? 37  GLU A OE1   1 
ATOM   1504 O OE2   . GLU E 3 37  ? 17.908 73.471 9.108   1.00 35.91 ? 37  GLU A OE2   1 
ATOM   1505 N N     . THR E 3 38  ? 17.547 70.833 11.848  1.00 17.09 ? 38  THR A N     1 
ATOM   1506 C CA    . THR E 3 38  ? 16.419 69.900 11.902  1.00 20.70 ? 38  THR A CA    1 
ATOM   1507 C C     . THR E 3 38  ? 16.786 68.475 11.390  1.00 30.22 ? 38  THR A C     1 
ATOM   1508 O O     . THR E 3 38  ? 17.768 68.288 10.653  1.00 31.70 ? 38  THR A O     1 
ATOM   1509 C CB    . THR E 3 38  ? 15.266 70.479 11.075  1.00 18.93 ? 38  THR A CB    1 
ATOM   1510 O OG1   . THR E 3 38  ? 14.934 71.764 11.584  1.00 22.18 ? 38  THR A OG1   1 
ATOM   1511 C CG2   . THR E 3 38  ? 14.050 69.638 11.153  1.00 18.76 ? 38  THR A CG2   1 
ATOM   1512 N N     . LEU E 3 39  ? 16.025 67.480 11.841  1.00 28.90 ? 39  LEU A N     1 
ATOM   1513 C CA    . LEU E 3 39  ? 16.199 66.081 11.455  1.00 28.77 ? 39  LEU A CA    1 
ATOM   1514 C C     . LEU E 3 39  ? 14.888 65.748 10.719  1.00 32.54 ? 39  LEU A C     1 
ATOM   1515 O O     . LEU E 3 39  ? 13.782 65.868 11.295  1.00 23.61 ? 39  LEU A O     1 
ATOM   1516 C CB    . LEU E 3 39  ? 16.368 65.256 12.719  1.00 27.71 ? 39  LEU A CB    1 
ATOM   1517 C CG    . LEU E 3 39  ? 16.743 63.795 12.778  1.00 27.94 ? 39  LEU A CG    1 
ATOM   1518 C CD1   . LEU E 3 39  ? 15.687 63.110 13.625  1.00 17.36 ? 39  LEU A CD1   1 
ATOM   1519 C CD2   . LEU E 3 39  ? 16.846 63.180 11.399  1.00 35.94 ? 39  LEU A CD2   1 
ATOM   1520 N N     . TYR E 3 40  ? 15.041 65.380 9.439   1.00 37.59 ? 40  TYR A N     1 
ATOM   1521 C CA    . TYR E 3 40  ? 13.951 65.263 8.438   1.00 34.85 ? 40  TYR A CA    1 
ATOM   1522 C C     . TYR E 3 40  ? 13.539 63.817 8.156   1.00 30.79 ? 40  TYR A C     1 
ATOM   1523 O O     . TYR E 3 40  ? 14.347 62.901 8.311   1.00 29.39 ? 40  TYR A O     1 
ATOM   1524 C CB    . TYR E 3 40  ? 14.374 65.898 7.077   1.00 38.62 ? 40  TYR A CB    1 
ATOM   1525 C CG    . TYR E 3 40  ? 14.973 67.312 7.093   1.00 36.20 ? 40  TYR A CG    1 
ATOM   1526 C CD1   . TYR E 3 40  ? 15.977 67.674 8.009   1.00 30.74 ? 40  TYR A CD1   1 
ATOM   1527 C CD2   . TYR E 3 40  ? 14.505 68.287 6.224   1.00 34.25 ? 40  TYR A CD2   1 
ATOM   1528 C CE1   . TYR E 3 40  ? 16.479 68.957 8.071   1.00 32.41 ? 40  TYR A CE1   1 
ATOM   1529 C CE2   . TYR E 3 40  ? 15.014 69.597 6.273   1.00 39.33 ? 40  TYR A CE2   1 
ATOM   1530 C CZ    . TYR E 3 40  ? 15.998 69.933 7.212   1.00 40.36 ? 40  TYR A CZ    1 
ATOM   1531 O OH    . TYR E 3 40  ? 16.441 71.251 7.355   1.00 34.56 ? 40  TYR A OH    1 
ATOM   1532 N N     . TYR E 3 41  ? 12.345 63.644 7.598   1.00 19.75 ? 41  TYR A N     1 
ATOM   1533 C CA    . TYR E 3 41  ? 11.804 62.333 7.328   1.00 16.55 ? 41  TYR A CA    1 
ATOM   1534 C C     . TYR E 3 41  ? 10.871 62.432 6.120   1.00 19.61 ? 41  TYR A C     1 
ATOM   1535 O O     . TYR E 3 41  ? 9.849  63.155 6.131   1.00 20.14 ? 41  TYR A O     1 
ATOM   1536 C CB    . TYR E 3 41  ? 11.070 61.818 8.596   1.00 22.39 ? 41  TYR A CB    1 
ATOM   1537 C CG    . TYR E 3 41  ? 10.517 60.377 8.591   1.00 23.66 ? 41  TYR A CG    1 
ATOM   1538 C CD1   . TYR E 3 41  ? 9.573  59.973 7.656   1.00 28.33 ? 41  TYR A CD1   1 
ATOM   1539 C CD2   . TYR E 3 41  ? 10.854 59.455 9.597   1.00 25.97 ? 41  TYR A CD2   1 
ATOM   1540 C CE1   . TYR E 3 41  ? 8.972  58.716 7.725   1.00 23.91 ? 41  TYR A CE1   1 
ATOM   1541 C CE2   . TYR E 3 41  ? 10.253 58.185 9.660   1.00 13.04 ? 41  TYR A CE2   1 
ATOM   1542 C CZ    . TYR E 3 41  ? 9.311  57.849 8.713   1.00 14.74 ? 41  TYR A CZ    1 
ATOM   1543 O OH    . TYR E 3 41  ? 8.634  56.673 8.736   1.00 24.31 ? 41  TYR A OH    1 
ATOM   1544 N N     . ILE E 3 42  ? 11.243 61.673 5.089   1.00 14.39 ? 42  ILE A N     1 
ATOM   1545 C CA    . ILE E 3 42  ? 10.557 61.580 3.806   1.00 12.87 ? 42  ILE A CA    1 
ATOM   1546 C C     . ILE E 3 42  ? 9.152  60.981 3.971   1.00 17.29 ? 42  ILE A C     1 
ATOM   1547 O O     . ILE E 3 42  ? 8.991  59.763 3.838   1.00 17.54 ? 42  ILE A O     1 
ATOM   1548 C CB    . ILE E 3 42  ? 11.333 60.646 2.802   1.00 15.98 ? 42  ILE A CB    1 
ATOM   1549 C CG1   . ILE E 3 42  ? 12.855 60.825 2.934   1.00 14.81 ? 42  ILE A CG1   1 
ATOM   1550 C CG2   . ILE E 3 42  ? 10.883 60.956 1.348   1.00 16.82 ? 42  ILE A CG2   1 
ATOM   1551 C CD1   . ILE E 3 42  ? 13.439 61.940 2.122   1.00 10.11 ? 42  ILE A CD1   1 
ATOM   1552 N N     . VAL E 3 43  ? 8.138  61.798 4.233   1.00 15.74 ? 43  VAL A N     1 
ATOM   1553 C CA    . VAL E 3 43  ? 6.793  61.260 4.397   1.00 13.16 ? 43  VAL A CA    1 
ATOM   1554 C C     . VAL E 3 43  ? 6.188  60.790 3.107   1.00 17.68 ? 43  VAL A C     1 
ATOM   1555 O O     . VAL E 3 43  ? 5.268  59.968 3.118   1.00 21.75 ? 43  VAL A O     1 
ATOM   1556 C CB    . VAL E 3 43  ? 5.861  62.283 5.054   1.00 15.28 ? 43  VAL A CB    1 
ATOM   1557 C CG1   . VAL E 3 43  ? 4.354  61.969 4.805   1.00 8.19  ? 43  VAL A CG1   1 
ATOM   1558 C CG2   . VAL E 3 43  ? 6.131  62.245 6.513   1.00 16.29 ? 43  VAL A CG2   1 
ATOM   1559 N N     . LYS E 3 44  ? 6.697  61.292 1.988   1.00 23.44 ? 44  LYS A N     1 
ATOM   1560 C CA    . LYS E 3 44  ? 6.266  60.816 0.656   1.00 21.85 ? 44  LYS A CA    1 
ATOM   1561 C C     . LYS E 3 44  ? 7.431  61.182 -0.261  1.00 19.72 ? 44  LYS A C     1 
ATOM   1562 O O     . LYS E 3 44  ? 8.204  62.073 0.078   1.00 29.14 ? 44  LYS A O     1 
ATOM   1563 C CB    . LYS E 3 44  ? 4.942  61.515 0.250   1.00 18.84 ? 44  LYS A CB    1 
ATOM   1564 C CG    . LYS E 3 44  ? 4.307  61.098 -1.057  1.00 21.62 ? 44  LYS A CG    1 
ATOM   1565 C CD    . LYS E 3 44  ? 4.857  61.983 -2.184  1.00 28.31 ? 44  LYS A CD    1 
ATOM   1566 C CE    . LYS E 3 44  ? 4.250  61.658 -3.539  1.00 29.35 ? 44  LYS A CE    1 
ATOM   1567 N NZ    . LYS E 3 44  ? 2.779  61.913 -3.566  1.00 27.58 ? 44  LYS A NZ    1 
ATOM   1568 N N     . GLY E 3 45  ? 7.672  60.386 -1.294  1.00 11.31 ? 45  GLY A N     1 
ATOM   1569 C CA    . GLY E 3 45  ? 8.721  60.701 -2.248  1.00 9.53  ? 45  GLY A CA    1 
ATOM   1570 C C     . GLY E 3 45  ? 10.091 60.046 -2.092  1.00 10.31 ? 45  GLY A C     1 
ATOM   1571 O O     . GLY E 3 45  ? 10.213 58.947 -1.552  1.00 19.85 ? 45  GLY A O     1 
ATOM   1572 N N     . SER E 3 46  ? 11.098 60.709 -2.649  1.00 6.00  ? 46  SER A N     1 
ATOM   1573 C CA    . SER E 3 46  ? 12.467 60.237 -2.710  1.00 6.00  ? 46  SER A CA    1 
ATOM   1574 C C     . SER E 3 46  ? 13.364 61.489 -2.685  1.00 6.00  ? 46  SER A C     1 
ATOM   1575 O O     . SER E 3 46  ? 12.857 62.608 -2.633  1.00 6.00  ? 46  SER A O     1 
ATOM   1576 C CB    . SER E 3 46  ? 12.723 59.433 -4.012  1.00 14.30 ? 46  SER A CB    1 
ATOM   1577 O OG    . SER E 3 46  ? 11.600 58.671 -4.463  1.00 25.71 ? 46  SER A OG    1 
ATOM   1578 N N     . VAL E 3 47  ? 14.678 61.319 -2.827  1.00 6.00  ? 47  VAL A N     1 
ATOM   1579 C CA    . VAL E 3 47  ? 15.614 62.420 -2.629  1.00 6.01  ? 47  VAL A CA    1 
ATOM   1580 C C     . VAL E 3 47  ? 16.962 62.097 -3.322  1.00 6.09  ? 47  VAL A C     1 
ATOM   1581 O O     . VAL E 3 47  ? 17.128 60.985 -3.817  1.00 6.00  ? 47  VAL A O     1 
ATOM   1582 C CB    . VAL E 3 47  ? 15.716 62.639 -1.079  1.00 6.00  ? 47  VAL A CB    1 
ATOM   1583 C CG1   . VAL E 3 47  ? 17.091 62.924 -0.650  1.00 12.11 ? 47  VAL A CG1   1 
ATOM   1584 C CG2   . VAL E 3 47  ? 14.807 63.752 -0.675  1.00 6.00  ? 47  VAL A CG2   1 
ATOM   1585 N N     . ALA E 3 48  ? 17.876 63.066 -3.437  1.00 6.00  ? 48  ALA A N     1 
ATOM   1586 C CA    . ALA E 3 48  ? 19.139 62.815 -4.097  1.00 6.00  ? 48  ALA A CA    1 
ATOM   1587 C C     . ALA E 3 48  ? 20.314 63.447 -3.387  1.00 6.00  ? 48  ALA A C     1 
ATOM   1588 O O     . ALA E 3 48  ? 20.758 64.527 -3.701  1.00 6.00  ? 48  ALA A O     1 
ATOM   1589 C CB    . ALA E 3 48  ? 19.067 63.296 -5.535  1.00 6.00  ? 48  ALA A CB    1 
ATOM   1590 N N     . VAL E 3 49  ? 20.827 62.760 -2.392  1.00 7.21  ? 49  VAL A N     1 
ATOM   1591 C CA    . VAL E 3 49  ? 22.043 63.210 -1.741  1.00 8.87  ? 49  VAL A CA    1 
ATOM   1592 C C     . VAL E 3 49  ? 23.080 63.336 -2.854  1.00 6.46  ? 49  VAL A C     1 
ATOM   1593 O O     . VAL E 3 49  ? 23.422 62.339 -3.494  1.00 17.53 ? 49  VAL A O     1 
ATOM   1594 C CB    . VAL E 3 49  ? 22.581 62.169 -0.682  1.00 6.00  ? 49  VAL A CB    1 
ATOM   1595 C CG1   . VAL E 3 49  ? 23.896 62.659 -0.103  1.00 7.93  ? 49  VAL A CG1   1 
ATOM   1596 C CG2   . VAL E 3 49  ? 21.597 61.968 0.416   1.00 6.00  ? 49  VAL A CG2   1 
ATOM   1597 N N     . LEU E 3 50  ? 23.516 64.547 -3.142  1.00 6.00  ? 50  LEU A N     1 
ATOM   1598 C CA    . LEU E 3 50  ? 24.636 64.722 -4.054  1.00 6.00  ? 50  LEU A CA    1 
ATOM   1599 C C     . LEU E 3 50  ? 25.680 65.718 -3.494  1.00 6.53  ? 50  LEU A C     1 
ATOM   1600 O O     . LEU E 3 50  ? 25.335 66.728 -2.882  1.00 15.71 ? 50  LEU A O     1 
ATOM   1601 C CB    . LEU E 3 50  ? 24.101 65.171 -5.406  1.00 9.91  ? 50  LEU A CB    1 
ATOM   1602 C CG    . LEU E 3 50  ? 23.143 66.363 -5.571  1.00 10.12 ? 50  LEU A CG    1 
ATOM   1603 C CD1   . LEU E 3 50  ? 23.933 67.616 -5.616  1.00 6.00  ? 50  LEU A CD1   1 
ATOM   1604 C CD2   . LEU E 3 50  ? 22.380 66.247 -6.868  1.00 6.00  ? 50  LEU A CD2   1 
ATOM   1605 N N     . ILE E 3 51  ? 26.947 65.351 -3.545  1.00 6.00  ? 51  ILE A N     1 
ATOM   1606 C CA    . ILE E 3 51  ? 27.999 66.248 -3.110  1.00 6.07  ? 51  ILE A CA    1 
ATOM   1607 C C     . ILE E 3 51  ? 28.463 66.957 -4.380  1.00 15.07 ? 51  ILE A C     1 
ATOM   1608 O O     . ILE E 3 51  ? 27.964 66.648 -5.489  1.00 11.58 ? 51  ILE A O     1 
ATOM   1609 C CB    . ILE E 3 51  ? 29.240 65.491 -2.444  1.00 12.75 ? 51  ILE A CB    1 
ATOM   1610 C CG1   . ILE E 3 51  ? 29.558 64.195 -3.202  1.00 7.83  ? 51  ILE A CG1   1 
ATOM   1611 C CG2   . ILE E 3 51  ? 28.957 65.221 -0.970  1.00 9.64  ? 51  ILE A CG2   1 
ATOM   1612 C CD1   . ILE E 3 51  ? 30.892 63.568 -2.858  1.00 6.00  ? 51  ILE A CD1   1 
ATOM   1613 N N     . LYS E 3 52  ? 29.478 67.815 -4.248  1.00 18.05 ? 52  LYS A N     1 
ATOM   1614 C CA    . LYS E 3 52  ? 29.922 68.644 -5.362  1.00 21.74 ? 52  LYS A CA    1 
ATOM   1615 C C     . LYS E 3 52  ? 31.440 68.609 -5.582  1.00 22.24 ? 52  LYS A C     1 
ATOM   1616 O O     . LYS E 3 52  ? 32.249 68.616 -4.633  1.00 21.58 ? 52  LYS A O     1 
ATOM   1617 C CB    . LYS E 3 52  ? 29.458 70.109 -5.123  1.00 27.80 ? 52  LYS A CB    1 
ATOM   1618 C CG    . LYS E 3 52  ? 28.678 70.844 -6.265  1.00 31.04 ? 52  LYS A CG    1 
ATOM   1619 C CD    . LYS E 3 52  ? 27.182 70.458 -6.409  1.00 24.67 ? 52  LYS A CD    1 
ATOM   1620 C CE    . LYS E 3 52  ? 26.250 71.504 -5.844  1.00 28.30 ? 52  LYS A CE    1 
ATOM   1621 N NZ    . LYS E 3 52  ? 26.510 72.883 -6.363  1.00 28.93 ? 52  LYS A NZ    1 
ATOM   1622 N N     . ASP E 3 53  ? 31.789 68.588 -6.862  1.00 27.42 ? 53  ASP A N     1 
ATOM   1623 C CA    . ASP E 3 53  ? 33.156 68.641 -7.372  1.00 35.95 ? 53  ASP A CA    1 
ATOM   1624 C C     . ASP E 3 53  ? 33.735 70.027 -7.149  1.00 36.40 ? 53  ASP A C     1 
ATOM   1625 O O     . ASP E 3 53  ? 33.011 71.021 -7.260  1.00 38.17 ? 53  ASP A O     1 
ATOM   1626 C CB    . ASP E 3 53  ? 33.123 68.292 -8.868  1.00 41.23 ? 53  ASP A CB    1 
ATOM   1627 C CG    . ASP E 3 53  ? 34.055 69.133 -9.704  1.00 42.58 ? 53  ASP A CG    1 
ATOM   1628 O OD1   . ASP E 3 53  ? 35.287 68.919 -9.557  1.00 40.27 ? 53  ASP A OD1   1 
ATOM   1629 O OD2   . ASP E 3 53  ? 33.541 69.973 -10.500 1.00 25.14 ? 53  ASP A OD2   1 
ATOM   1630 N N     . GLU E 3 54  ? 35.065 70.071 -7.067  1.00 37.75 ? 54  GLU A N     1 
ATOM   1631 C CA    . GLU E 3 54  ? 35.866 71.278 -6.740  1.00 38.03 ? 54  GLU A CA    1 
ATOM   1632 C C     . GLU E 3 54  ? 35.148 72.579 -7.036  1.00 27.69 ? 54  GLU A C     1 
ATOM   1633 O O     . GLU E 3 54  ? 34.946 73.375 -6.127  1.00 21.73 ? 54  GLU A O     1 
ATOM   1634 C CB    . GLU E 3 54  ? 37.218 71.205 -7.463  1.00 46.94 ? 54  GLU A CB    1 
ATOM   1635 C CG    . GLU E 3 54  ? 38.178 70.088 -6.895  1.00 47.64 ? 54  GLU A CG    1 
ATOM   1636 C CD    . GLU E 3 54  ? 37.586 68.669 -6.930  1.00 49.81 ? 54  GLU A CD    1 
ATOM   1637 O OE1   . GLU E 3 54  ? 37.817 67.963 -7.937  1.00 48.93 ? 54  GLU A OE1   1 
ATOM   1638 O OE2   . GLU E 3 54  ? 36.883 68.271 -5.962  1.00 44.29 ? 54  GLU A OE2   1 
ATOM   1639 N N     . GLU E 3 55  ? 34.730 72.772 -8.280  1.00 22.00 ? 55  GLU A N     1 
ATOM   1640 C CA    . GLU E 3 55  ? 33.641 73.703 -8.521  1.00 22.57 ? 55  GLU A CA    1 
ATOM   1641 C C     . GLU E 3 55  ? 32.919 73.197 -9.711  1.00 18.91 ? 55  GLU A C     1 
ATOM   1642 O O     . GLU E 3 55  ? 33.522 72.991 -10.762 1.00 18.69 ? 55  GLU A O     1 
ATOM   1643 C CB    . GLU E 3 55  ? 34.096 75.143 -8.769  1.00 32.90 ? 55  GLU A CB    1 
ATOM   1644 C CG    . GLU E 3 55  ? 32.911 76.141 -9.052  1.00 42.20 ? 55  GLU A CG    1 
ATOM   1645 C CD    . GLU E 3 55  ? 31.707 76.133 -8.043  1.00 45.20 ? 55  GLU A CD    1 
ATOM   1646 O OE1   . GLU E 3 55  ? 31.240 77.249 -7.656  1.00 44.25 ? 55  GLU A OE1   1 
ATOM   1647 O OE2   . GLU E 3 55  ? 31.171 75.041 -7.710  1.00 48.46 ? 55  GLU A OE2   1 
ATOM   1648 N N     . GLY E 3 56  ? 31.653 72.875 -9.509  1.00 20.75 ? 56  GLY A N     1 
ATOM   1649 C CA    . GLY E 3 56  ? 30.907 72.237 -10.572 1.00 34.02 ? 56  GLY A CA    1 
ATOM   1650 C C     . GLY E 3 56  ? 30.303 70.841 -10.300 1.00 32.67 ? 56  GLY A C     1 
ATOM   1651 O O     . GLY E 3 56  ? 29.496 70.707 -9.384  1.00 39.13 ? 56  GLY A O     1 
ATOM   1652 N N     . LYS E 3 57  ? 30.734 69.801 -11.023 1.00 25.88 ? 57  LYS A N     1 
ATOM   1653 C CA    . LYS E 3 57  ? 29.944 68.581 -11.100 1.00 25.97 ? 57  LYS A CA    1 
ATOM   1654 C C     . LYS E 3 57  ? 29.569 67.754 -9.861  1.00 21.08 ? 57  LYS A C     1 
ATOM   1655 O O     . LYS E 3 57  ? 30.382 67.425 -9.002  1.00 20.75 ? 57  LYS A O     1 
ATOM   1656 C CB    . LYS E 3 57  ? 30.565 67.643 -12.141 1.00 31.19 ? 57  LYS A CB    1 
ATOM   1657 C CG    . LYS E 3 57  ? 29.566 66.518 -12.609 1.00 32.03 ? 57  LYS A CG    1 
ATOM   1658 C CD    . LYS E 3 57  ? 29.824 65.974 -14.037 1.00 23.88 ? 57  LYS A CD    1 
ATOM   1659 C CE    . LYS E 3 57  ? 29.555 64.457 -14.165 1.00 30.71 ? 57  LYS A CE    1 
ATOM   1660 N NZ    . LYS E 3 57  ? 30.515 63.609 -13.362 1.00 21.59 ? 57  LYS A NZ    1 
ATOM   1661 N N     . GLU E 3 58  ? 28.327 67.320 -9.875  1.00 6.86  ? 58  GLU A N     1 
ATOM   1662 C CA    . GLU E 3 58  ? 27.766 66.582 -8.789  1.00 12.26 ? 58  GLU A CA    1 
ATOM   1663 C C     . GLU E 3 58  ? 28.045 65.094 -8.952  1.00 18.33 ? 58  GLU A C     1 
ATOM   1664 O O     . GLU E 3 58  ? 28.263 64.603 -10.071 1.00 20.27 ? 58  GLU A O     1 
ATOM   1665 C CB    . GLU E 3 58  ? 26.268 66.826 -8.769  1.00 19.28 ? 58  GLU A CB    1 
ATOM   1666 C CG    . GLU E 3 58  ? 25.935 68.222 -9.270  1.00 17.53 ? 58  GLU A CG    1 
ATOM   1667 C CD    . GLU E 3 58  ? 24.636 68.268 -10.012 1.00 31.15 ? 58  GLU A CD    1 
ATOM   1668 O OE1   . GLU E 3 58  ? 23.619 68.571 -9.361  1.00 37.35 ? 58  GLU A OE1   1 
ATOM   1669 O OE2   . GLU E 3 58  ? 24.630 68.017 -11.242 1.00 34.54 ? 58  GLU A OE2   1 
ATOM   1670 N N     . MET E 3 59  ? 28.026 64.385 -7.823  1.00 17.80 ? 59  MET A N     1 
ATOM   1671 C CA    . MET E 3 59  ? 28.102 62.933 -7.783  1.00 9.61  ? 59  MET A CA    1 
ATOM   1672 C C     . MET E 3 59  ? 27.078 62.475 -6.789  1.00 12.37 ? 59  MET A C     1 
ATOM   1673 O O     . MET E 3 59  ? 27.197 62.764 -5.610  1.00 8.92  ? 59  MET A O     1 
ATOM   1674 C CB    . MET E 3 59  ? 29.456 62.420 -7.309  1.00 18.14 ? 59  MET A CB    1 
ATOM   1675 C CG    . MET E 3 59  ? 29.396 60.915 -6.983  1.00 25.62 ? 59  MET A CG    1 
ATOM   1676 S SD    . MET E 3 59  ? 30.948 60.124 -7.204  1.00 27.97 ? 59  MET A SD    1 
ATOM   1677 C CE    . MET E 3 59  ? 30.725 59.547 -8.821  1.00 21.39 ? 59  MET A CE    1 
ATOM   1678 N N     . ILE E 3 60  ? 26.062 61.770 -7.268  1.00 15.69 ? 60  ILE A N     1 
ATOM   1679 C CA    . ILE E 3 60  ? 25.051 61.210 -6.399  1.00 10.80 ? 60  ILE A CA    1 
ATOM   1680 C C     . ILE E 3 60  ? 25.734 60.166 -5.537  1.00 13.88 ? 60  ILE A C     1 
ATOM   1681 O O     . ILE E 3 60  ? 26.579 59.420 -6.037  1.00 6.00  ? 60  ILE A O     1 
ATOM   1682 C CB    . ILE E 3 60  ? 23.971 60.565 -7.206  1.00 6.00  ? 60  ILE A CB    1 
ATOM   1683 C CG1   . ILE E 3 60  ? 23.163 61.673 -7.923  1.00 6.00  ? 60  ILE A CG1   1 
ATOM   1684 C CG2   . ILE E 3 60  ? 23.188 59.633 -6.307  1.00 6.00  ? 60  ILE A CG2   1 
ATOM   1685 C CD1   . ILE E 3 60  ? 21.925 61.229 -8.651  1.00 6.00  ? 60  ILE A CD1   1 
ATOM   1686 N N     . LEU E 3 61  ? 25.476 60.252 -4.230  1.00 13.49 ? 61  LEU A N     1 
ATOM   1687 C CA    . LEU E 3 61  ? 26.002 59.310 -3.229  1.00 14.10 ? 61  LEU A CA    1 
ATOM   1688 C C     . LEU E 3 61  ? 24.911 58.376 -2.772  1.00 14.22 ? 61  LEU A C     1 
ATOM   1689 O O     . LEU E 3 61  ? 25.161 57.468 -1.982  1.00 10.19 ? 61  LEU A O     1 
ATOM   1690 C CB    . LEU E 3 61  ? 26.494 60.007 -1.967  1.00 6.00  ? 61  LEU A CB    1 
ATOM   1691 C CG    . LEU E 3 61  ? 27.882 60.596 -1.913  1.00 6.00  ? 61  LEU A CG    1 
ATOM   1692 C CD1   . LEU E 3 61  ? 28.056 60.996 -0.502  1.00 6.00  ? 61  LEU A CD1   1 
ATOM   1693 C CD2   . LEU E 3 61  ? 28.958 59.655 -2.326  1.00 6.00  ? 61  LEU A CD2   1 
ATOM   1694 N N     . SER E 3 62  ? 23.684 58.698 -3.153  1.00 10.04 ? 62  SER A N     1 
ATOM   1695 C CA    . SER E 3 62  ? 22.532 57.977 -2.695  1.00 9.04  ? 62  SER A CA    1 
ATOM   1696 C C     . SER E 3 62  ? 21.272 58.604 -3.229  1.00 8.95  ? 62  SER A C     1 
ATOM   1697 O O     . SER E 3 62  ? 21.309 59.580 -3.923  1.00 24.86 ? 62  SER A O     1 
ATOM   1698 C CB    . SER E 3 62  ? 22.469 57.999 -1.184  1.00 8.69  ? 62  SER A CB    1 
ATOM   1699 O OG    . SER E 3 62  ? 21.576 57.006 -0.730  1.00 29.32 ? 62  SER A OG    1 
ATOM   1700 N N     . TYR E 3 63  ? 20.181 57.920 -3.013  1.00 6.00  ? 63  TYR A N     1 
ATOM   1701 C CA    . TYR E 3 63  ? 18.856 58.412 -3.204  1.00 6.00  ? 63  TYR A CA    1 
ATOM   1702 C C     . TYR E 3 63  ? 18.314 57.917 -1.830  1.00 10.05 ? 63  TYR A C     1 
ATOM   1703 O O     . TYR E 3 63  ? 18.937 57.085 -1.160  1.00 11.38 ? 63  TYR A O     1 
ATOM   1704 C CB    . TYR E 3 63  ? 18.159 57.664 -4.339  1.00 10.54 ? 63  TYR A CB    1 
ATOM   1705 C CG    . TYR E 3 63  ? 18.501 58.015 -5.779  1.00 15.16 ? 63  TYR A CG    1 
ATOM   1706 C CD1   . TYR E 3 63  ? 17.575 57.752 -6.794  1.00 23.81 ? 63  TYR A CD1   1 
ATOM   1707 C CD2   . TYR E 3 63  ? 19.730 58.538 -6.153  1.00 13.88 ? 63  TYR A CD2   1 
ATOM   1708 C CE1   . TYR E 3 63  ? 17.862 57.992 -8.153  1.00 23.04 ? 63  TYR A CE1   1 
ATOM   1709 C CE2   . TYR E 3 63  ? 20.030 58.792 -7.531  1.00 16.25 ? 63  TYR A CE2   1 
ATOM   1710 C CZ    . TYR E 3 63  ? 19.083 58.511 -8.514  1.00 20.42 ? 63  TYR A CZ    1 
ATOM   1711 O OH    . TYR E 3 63  ? 19.318 58.751 -9.855  1.00 20.37 ? 63  TYR A OH    1 
ATOM   1712 N N     . LEU E 3 64  ? 17.204 58.444 -1.368  1.00 11.44 ? 64  LEU A N     1 
ATOM   1713 C CA    . LEU E 3 64  ? 16.621 57.975 -0.125  1.00 12.86 ? 64  LEU A CA    1 
ATOM   1714 C C     . LEU E 3 64  ? 15.169 58.180 -0.449  1.00 20.43 ? 64  LEU A C     1 
ATOM   1715 O O     . LEU E 3 64  ? 14.808 59.247 -0.959  1.00 26.60 ? 64  LEU A O     1 
ATOM   1716 C CB    . LEU E 3 64  ? 17.015 58.854 1.072   1.00 6.00  ? 64  LEU A CB    1 
ATOM   1717 C CG    . LEU E 3 64  ? 18.459 58.863 1.534   1.00 6.00  ? 64  LEU A CG    1 
ATOM   1718 C CD1   . LEU E 3 64  ? 19.125 59.874 0.766   1.00 6.00  ? 64  LEU A CD1   1 
ATOM   1719 C CD2   . LEU E 3 64  ? 18.623 59.231 2.979   1.00 6.00  ? 64  LEU A CD2   1 
ATOM   1720 N N     . ASN E 3 65  ? 14.342 57.168 -0.224  1.00 21.11 ? 65  ASN A N     1 
ATOM   1721 C CA    . ASN E 3 65  ? 12.944 57.284 -0.613  1.00 18.94 ? 65  ASN A CA    1 
ATOM   1722 C C     . ASN E 3 65  ? 12.014 57.387 0.556   1.00 16.89 ? 65  ASN A C     1 
ATOM   1723 O O     . ASN E 3 65  ? 12.424 57.753 1.665   1.00 21.94 ? 65  ASN A O     1 
ATOM   1724 C CB    . ASN E 3 65  ? 12.542 56.095 -1.491  1.00 13.74 ? 65  ASN A CB    1 
ATOM   1725 C CG    . ASN E 3 65  ? 13.478 55.908 -2.650  1.00 11.12 ? 65  ASN A CG    1 
ATOM   1726 O OD1   . ASN E 3 65  ? 14.622 55.498 -2.450  1.00 24.56 ? 65  ASN A OD1   1 
ATOM   1727 N ND2   . ASN E 3 65  ? 13.047 56.279 -3.851  1.00 17.04 ? 65  ASN A ND2   1 
ATOM   1728 N N     . GLN E 3 66  ? 10.741 57.177 0.254   1.00 12.79 ? 66  GLN A N     1 
ATOM   1729 C CA    . GLN E 3 66  ? 9.672  57.110 1.231   1.00 17.36 ? 66  GLN A CA    1 
ATOM   1730 C C     . GLN E 3 66  ? 10.153 56.396 2.490   1.00 17.87 ? 66  GLN A C     1 
ATOM   1731 O O     . GLN E 3 66  ? 10.634 55.266 2.424   1.00 13.87 ? 66  GLN A O     1 
ATOM   1732 C CB    . GLN E 3 66  ? 8.496  56.354 0.612   1.00 20.08 ? 66  GLN A CB    1 
ATOM   1733 C CG    . GLN E 3 66  ? 7.218  56.479 1.372   1.00 24.69 ? 66  GLN A CG    1 
ATOM   1734 C CD    . GLN E 3 66  ? 6.069  55.734 0.712   1.00 34.87 ? 66  GLN A CD    1 
ATOM   1735 O OE1   . GLN E 3 66  ? 5.965  55.664 -0.521  1.00 39.72 ? 66  GLN A OE1   1 
ATOM   1736 N NE2   . GLN E 3 66  ? 5.188  55.180 1.533   1.00 30.00 ? 66  GLN A NE2   1 
ATOM   1737 N N     . GLY E 3 67  ? 10.153 57.125 3.597   1.00 25.13 ? 67  GLY A N     1 
ATOM   1738 C CA    . GLY E 3 67  ? 10.499 56.550 4.885   1.00 26.21 ? 67  GLY A CA    1 
ATOM   1739 C C     . GLY E 3 67  ? 11.959 56.504 5.308   1.00 29.46 ? 67  GLY A C     1 
ATOM   1740 O O     . GLY E 3 67  ? 12.237 55.935 6.380   1.00 36.67 ? 67  GLY A O     1 
ATOM   1741 N N     . ASP E 3 68  ? 12.894 57.017 4.500   1.00 24.52 ? 68  ASP A N     1 
ATOM   1742 C CA    . ASP E 3 68  ? 14.316 57.062 4.926   1.00 31.06 ? 68  ASP A CA    1 
ATOM   1743 C C     . ASP E 3 68  ? 14.493 58.305 5.851   1.00 34.07 ? 68  ASP A C     1 
ATOM   1744 O O     . ASP E 3 68  ? 13.531 59.053 6.070   1.00 41.24 ? 68  ASP A O     1 
ATOM   1745 C CB    . ASP E 3 68  ? 15.288 57.208 3.718   1.00 35.42 ? 68  ASP A CB    1 
ATOM   1746 C CG    . ASP E 3 68  ? 15.239 56.039 2.731   1.00 29.16 ? 68  ASP A CG    1 
ATOM   1747 O OD1   . ASP E 3 68  ? 14.144 55.685 2.229   1.00 35.46 ? 68  ASP A OD1   1 
ATOM   1748 O OD2   . ASP E 3 68  ? 16.317 55.523 2.396   1.00 18.75 ? 68  ASP A OD2   1 
ATOM   1749 N N     . PHE E 3 69  ? 15.707 58.564 6.339   1.00 29.27 ? 69  PHE A N     1 
ATOM   1750 C CA    . PHE E 3 69  ? 15.964 59.705 7.225   1.00 23.32 ? 69  PHE A CA    1 
ATOM   1751 C C     . PHE E 3 69  ? 16.958 60.666 6.646   1.00 21.90 ? 69  PHE A C     1 
ATOM   1752 O O     . PHE E 3 69  ? 17.955 60.213 6.057   1.00 26.66 ? 69  PHE A O     1 
ATOM   1753 C CB    . PHE E 3 69  ? 16.503 59.222 8.548   1.00 19.00 ? 69  PHE A CB    1 
ATOM   1754 C CG    . PHE E 3 69  ? 15.510 59.217 9.599   1.00 17.24 ? 69  PHE A CG    1 
ATOM   1755 C CD1   . PHE E 3 69  ? 15.179 60.396 10.236  1.00 17.58 ? 69  PHE A CD1   1 
ATOM   1756 C CD2   . PHE E 3 69  ? 14.848 58.045 9.929   1.00 25.57 ? 69  PHE A CD2   1 
ATOM   1757 C CE1   . PHE E 3 69  ? 14.194 60.426 11.196  1.00 25.65 ? 69  PHE A CE1   1 
ATOM   1758 C CE2   . PHE E 3 69  ? 13.847 58.031 10.894  1.00 33.79 ? 69  PHE A CE2   1 
ATOM   1759 C CZ    . PHE E 3 69  ? 13.512 59.228 11.536  1.00 37.61 ? 69  PHE A CZ    1 
ATOM   1760 N N     . ILE E 3 70  ? 16.736 61.972 6.839   1.00 18.05 ? 70  ILE A N     1 
ATOM   1761 C CA    . ILE E 3 70  ? 17.683 62.972 6.321   1.00 15.71 ? 70  ILE A CA    1 
ATOM   1762 C C     . ILE E 3 70  ? 18.281 63.826 7.430   1.00 15.74 ? 70  ILE A C     1 
ATOM   1763 O O     . ILE E 3 70  ? 17.616 64.162 8.421   1.00 9.70  ? 70  ILE A O     1 
ATOM   1764 C CB    . ILE E 3 70  ? 17.067 63.964 5.310   1.00 18.02 ? 70  ILE A CB    1 
ATOM   1765 C CG1   . ILE E 3 70  ? 16.170 63.285 4.276   1.00 25.95 ? 70  ILE A CG1   1 
ATOM   1766 C CG2   . ILE E 3 70  ? 18.181 64.573 4.508   1.00 26.25 ? 70  ILE A CG2   1 
ATOM   1767 C CD1   . ILE E 3 70  ? 15.674 64.309 3.192   1.00 18.54 ? 70  ILE A CD1   1 
ATOM   1768 N N     . GLY E 3 71  ? 19.555 64.161 7.250   1.00 14.70 ? 71  GLY A N     1 
ATOM   1769 C CA    . GLY E 3 71  ? 20.281 64.951 8.219   1.00 10.00 ? 71  GLY A CA    1 
ATOM   1770 C C     . GLY E 3 71  ? 20.064 64.366 9.586   1.00 11.03 ? 71  GLY A C     1 
ATOM   1771 O O     . GLY E 3 71  ? 19.155 64.786 10.295  1.00 10.50 ? 71  GLY A O     1 
ATOM   1772 N N     . GLU E 3 72  ? 20.745 63.257 9.853   1.00 15.72 ? 72  GLU A N     1 
ATOM   1773 C CA    . GLU E 3 72  ? 20.813 62.715 11.214  1.00 16.08 ? 72  GLU A CA    1 
ATOM   1774 C C     . GLU E 3 72  ? 22.228 62.937 11.699  1.00 14.07 ? 72  GLU A C     1 
ATOM   1775 O O     . GLU E 3 72  ? 22.412 63.414 12.811  1.00 15.63 ? 72  GLU A O     1 
ATOM   1776 C CB    . GLU E 3 72  ? 20.471 61.211 11.292  1.00 12.12 ? 72  GLU A CB    1 
ATOM   1777 C CG    . GLU E 3 72  ? 21.235 60.275 10.382  1.00 7.87  ? 72  GLU A CG    1 
ATOM   1778 C CD    . GLU E 3 72  ? 20.657 60.239 9.007   1.00 17.05 ? 72  GLU A CD    1 
ATOM   1779 O OE1   . GLU E 3 72  ? 19.415 60.314 8.894   1.00 28.43 ? 72  GLU A OE1   1 
ATOM   1780 O OE2   . GLU E 3 72  ? 21.443 60.161 8.039   1.00 17.19 ? 72  GLU A OE2   1 
ATOM   1781 N N     . LEU E 3 73  ? 23.180 62.844 10.767  1.00 11.97 ? 73  LEU A N     1 
ATOM   1782 C CA    . LEU E 3 73  ? 24.601 62.963 11.044  1.00 7.01  ? 73  LEU A CA    1 
ATOM   1783 C C     . LEU E 3 73  ? 24.962 64.245 11.770  1.00 11.34 ? 73  LEU A C     1 
ATOM   1784 O O     . LEU E 3 73  ? 26.141 64.449 12.117  1.00 15.76 ? 73  LEU A O     1 
ATOM   1785 C CB    . LEU E 3 73  ? 25.402 62.879 9.744   1.00 6.00  ? 73  LEU A CB    1 
ATOM   1786 C CG    . LEU E 3 73  ? 25.417 61.592 8.903   1.00 8.70  ? 73  LEU A CG    1 
ATOM   1787 C CD1   . LEU E 3 73  ? 24.629 61.801 7.595   1.00 6.00  ? 73  LEU A CD1   1 
ATOM   1788 C CD2   . LEU E 3 73  ? 26.861 61.228 8.573   1.00 8.59  ? 73  LEU A CD2   1 
ATOM   1789 N N     . GLY E 3 74  ? 23.975 65.146 11.898  1.00 9.11  ? 74  GLY A N     1 
ATOM   1790 C CA    . GLY E 3 74  ? 24.124 66.316 12.741  1.00 10.73 ? 74  GLY A CA    1 
ATOM   1791 C C     . GLY E 3 74  ? 24.042 65.879 14.204  1.00 11.89 ? 74  GLY A C     1 
ATOM   1792 O O     . GLY E 3 74  ? 25.016 65.997 14.955  1.00 18.27 ? 74  GLY A O     1 
ATOM   1793 N N     . LEU E 3 75  ? 22.921 65.270 14.560  1.00 6.00  ? 75  LEU A N     1 
ATOM   1794 C CA    . LEU E 3 75  ? 22.577 64.802 15.908  1.00 10.59 ? 75  LEU A CA    1 
ATOM   1795 C C     . LEU E 3 75  ? 23.510 64.559 17.131  1.00 14.16 ? 75  LEU A C     1 
ATOM   1796 O O     . LEU E 3 75  ? 23.116 64.927 18.230  1.00 21.02 ? 75  LEU A O     1 
ATOM   1797 C CB    . LEU E 3 75  ? 21.753 63.547 15.720  1.00 18.47 ? 75  LEU A CB    1 
ATOM   1798 C CG    . LEU E 3 75  ? 20.476 63.292 16.508  1.00 26.57 ? 75  LEU A CG    1 
ATOM   1799 C CD1   . LEU E 3 75  ? 19.761 64.631 16.787  1.00 33.50 ? 75  LEU A CD1   1 
ATOM   1800 C CD2   . LEU E 3 75  ? 19.598 62.299 15.695  1.00 6.90  ? 75  LEU A CD2   1 
ATOM   1801 N N     . PHE E 3 76  ? 24.698 63.958 16.998  1.00 19.92 ? 76  PHE A N     1 
ATOM   1802 C CA    . PHE E 3 76  ? 25.447 63.491 18.210  1.00 25.41 ? 76  PHE A CA    1 
ATOM   1803 C C     . PHE E 3 76  ? 26.719 64.247 18.751  1.00 31.48 ? 76  PHE A C     1 
ATOM   1804 O O     . PHE E 3 76  ? 27.461 63.753 19.655  1.00 22.29 ? 76  PHE A O     1 
ATOM   1805 C CB    . PHE E 3 76  ? 25.836 62.015 18.026  1.00 26.28 ? 76  PHE A CB    1 
ATOM   1806 C CG    . PHE E 3 76  ? 24.817 61.189 17.299  1.00 24.80 ? 76  PHE A CG    1 
ATOM   1807 C CD1   . PHE E 3 76  ? 23.887 60.434 18.006  1.00 31.85 ? 76  PHE A CD1   1 
ATOM   1808 C CD2   . PHE E 3 76  ? 24.800 61.152 15.905  1.00 19.74 ? 76  PHE A CD2   1 
ATOM   1809 C CE1   . PHE E 3 76  ? 22.932 59.634 17.340  1.00 31.30 ? 76  PHE A CE1   1 
ATOM   1810 C CE2   . PHE E 3 76  ? 23.867 60.368 15.221  1.00 31.30 ? 76  PHE A CE2   1 
ATOM   1811 C CZ    . PHE E 3 76  ? 22.922 59.601 15.939  1.00 33.16 ? 76  PHE A CZ    1 
ATOM   1812 N N     . GLU E 3 77  ? 26.992 65.413 18.174  1.00 31.91 ? 77  GLU A N     1 
ATOM   1813 C CA    . GLU E 3 77  ? 28.029 66.331 18.651  1.00 34.30 ? 77  GLU A CA    1 
ATOM   1814 C C     . GLU E 3 77  ? 27.323 67.667 18.382  1.00 32.69 ? 77  GLU A C     1 
ATOM   1815 O O     . GLU E 3 77  ? 26.094 67.679 18.396  1.00 28.05 ? 77  GLU A O     1 
ATOM   1816 C CB    . GLU E 3 77  ? 29.333 66.167 17.840  1.00 32.78 ? 77  GLU A CB    1 
ATOM   1817 C CG    . GLU E 3 77  ? 30.181 64.933 18.222  1.00 29.68 ? 77  GLU A CG    1 
ATOM   1818 C CD    . GLU E 3 77  ? 31.653 65.025 17.769  1.00 35.80 ? 77  GLU A CD    1 
ATOM   1819 O OE1   . GLU E 3 77  ? 32.188 64.055 17.178  1.00 34.71 ? 77  GLU A OE1   1 
ATOM   1820 O OE2   . GLU E 3 77  ? 32.299 66.065 18.033  1.00 38.26 ? 77  GLU A OE2   1 
ATOM   1821 N N     . GLU E 3 78  ? 28.029 68.778 18.163  1.00 33.75 ? 78  GLU A N     1 
ATOM   1822 C CA    . GLU E 3 78  ? 27.339 70.047 17.898  1.00 39.28 ? 78  GLU A CA    1 
ATOM   1823 C C     . GLU E 3 78  ? 28.135 71.013 17.019  1.00 41.38 ? 78  GLU A C     1 
ATOM   1824 O O     . GLU E 3 78  ? 29.367 70.954 16.969  1.00 45.04 ? 78  GLU A O     1 
ATOM   1825 C CB    . GLU E 3 78  ? 26.971 70.739 19.221  1.00 44.80 ? 78  GLU A CB    1 
ATOM   1826 C CG    . GLU E 3 78  ? 25.488 70.602 19.630  1.00 48.64 ? 78  GLU A CG    1 
ATOM   1827 C CD    . GLU E 3 78  ? 25.291 69.874 20.971  1.00 56.18 ? 78  GLU A CD    1 
ATOM   1828 O OE1   . GLU E 3 78  ? 24.789 70.519 21.934  1.00 59.42 ? 78  GLU A OE1   1 
ATOM   1829 O OE2   . GLU E 3 78  ? 25.620 68.659 21.057  1.00 48.92 ? 78  GLU A OE2   1 
ATOM   1830 N N     . GLY E 3 79  ? 27.417 71.907 16.337  1.00 38.58 ? 79  GLY A N     1 
ATOM   1831 C CA    . GLY E 3 79  ? 28.056 72.818 15.402  1.00 41.52 ? 79  GLY A CA    1 
ATOM   1832 C C     . GLY E 3 79  ? 28.502 72.166 14.094  1.00 41.79 ? 79  GLY A C     1 
ATOM   1833 O O     . GLY E 3 79  ? 29.282 72.754 13.330  1.00 36.96 ? 79  GLY A O     1 
ATOM   1834 N N     . GLN E 3 80  ? 27.942 70.993 13.792  1.00 46.51 ? 80  GLN A N     1 
ATOM   1835 C CA    . GLN E 3 80  ? 28.315 70.246 12.594  1.00 47.30 ? 80  GLN A CA    1 
ATOM   1836 C C     . GLN E 3 80  ? 27.794 70.804 11.269  1.00 45.86 ? 80  GLN A C     1 
ATOM   1837 O O     . GLN E 3 80  ? 26.582 70.805 10.985  1.00 40.88 ? 80  GLN A O     1 
ATOM   1838 C CB    . GLN E 3 80  ? 27.876 68.792 12.725  1.00 52.38 ? 80  GLN A CB    1 
ATOM   1839 C CG    . GLN E 3 80  ? 28.806 67.861 11.961  1.00 58.07 ? 80  GLN A CG    1 
ATOM   1840 C CD    . GLN E 3 80  ? 30.272 68.128 12.289  1.00 57.37 ? 80  GLN A CD    1 
ATOM   1841 O OE1   . GLN E 3 80  ? 30.604 68.501 13.417  1.00 60.22 ? 80  GLN A OE1   1 
ATOM   1842 N NE2   . GLN E 3 80  ? 31.148 67.967 11.302  1.00 55.44 ? 80  GLN A NE2   1 
ATOM   1843 N N     . GLU E 3 81  ? 28.740 71.248 10.453  1.00 40.42 ? 81  GLU A N     1 
ATOM   1844 C CA    . GLU E 3 81  ? 28.439 71.853 9.163   1.00 37.02 ? 81  GLU A CA    1 
ATOM   1845 C C     . GLU E 3 81  ? 27.832 70.807 8.191   1.00 29.57 ? 81  GLU A C     1 
ATOM   1846 O O     . GLU E 3 81  ? 28.480 69.808 7.890   1.00 35.04 ? 81  GLU A O     1 
ATOM   1847 C CB    . GLU E 3 81  ? 29.729 72.483 8.564   1.00 40.52 ? 81  GLU A CB    1 
ATOM   1848 C CG    . GLU E 3 81  ? 30.850 72.907 9.568   1.00 27.52 ? 81  GLU A CG    1 
ATOM   1849 C CD    . GLU E 3 81  ? 32.018 71.893 9.632   1.00 36.76 ? 81  GLU A CD    1 
ATOM   1850 O OE1   . GLU E 3 81  ? 33.110 72.235 10.156  1.00 36.40 ? 81  GLU A OE1   1 
ATOM   1851 O OE2   . GLU E 3 81  ? 31.857 70.748 9.141   1.00 40.50 ? 81  GLU A OE2   1 
ATOM   1852 N N     . ARG E 3 82  ? 26.593 71.025 7.740   1.00 14.55 ? 82  ARG A N     1 
ATOM   1853 C CA    . ARG E 3 82  ? 25.840 70.081 6.903   1.00 8.15  ? 82  ARG A CA    1 
ATOM   1854 C C     . ARG E 3 82  ? 26.653 69.419 5.844   1.00 6.00  ? 82  ARG A C     1 
ATOM   1855 O O     . ARG E 3 82  ? 27.377 70.054 5.120   1.00 6.00  ? 82  ARG A O     1 
ATOM   1856 C CB    . ARG E 3 82  ? 24.659 70.776 6.251   1.00 11.88 ? 82  ARG A CB    1 
ATOM   1857 C CG    . ARG E 3 82  ? 23.327 70.063 6.377   1.00 12.75 ? 82  ARG A CG    1 
ATOM   1858 C CD    . ARG E 3 82  ? 22.639 70.142 7.762   1.00 15.00 ? 82  ARG A CD    1 
ATOM   1859 N NE    . ARG E 3 82  ? 21.384 69.382 7.735   1.00 17.03 ? 82  ARG A NE    1 
ATOM   1860 C CZ    . ARG E 3 82  ? 20.448 69.406 8.680   1.00 21.83 ? 82  ARG A CZ    1 
ATOM   1861 N NH1   . ARG E 3 82  ? 20.598 70.145 9.761   1.00 33.75 ? 82  ARG A NH1   1 
ATOM   1862 N NH2   . ARG E 3 82  ? 19.326 68.727 8.529   1.00 11.66 ? 82  ARG A NH2   1 
ATOM   1863 N N     . SER E 3 83  ? 26.411 68.132 5.687   1.00 16.51 ? 83  SER A N     1 
ATOM   1864 C CA    . SER E 3 83  ? 27.310 67.191 4.970   1.00 20.34 ? 83  SER A CA    1 
ATOM   1865 C C     . SER E 3 83  ? 27.333 67.046 3.417   1.00 13.57 ? 83  SER A C     1 
ATOM   1866 O O     . SER E 3 83  ? 28.424 66.843 2.818   1.00 6.00  ? 83  SER A O     1 
ATOM   1867 C CB    . SER E 3 83  ? 27.103 65.811 5.632   1.00 23.64 ? 83  SER A CB    1 
ATOM   1868 O OG    . SER E 3 83  ? 27.148 65.896 7.080   1.00 23.93 ? 83  SER A OG    1 
ATOM   1869 N N     . ALA E 3 84  ? 26.151 67.134 2.794   1.00 6.00  ? 84  ALA A N     1 
ATOM   1870 C CA    . ALA E 3 84  ? 26.003 67.155 1.343   1.00 6.00  ? 84  ALA A CA    1 
ATOM   1871 C C     . ALA E 3 84  ? 24.674 67.754 1.025   1.00 7.45  ? 84  ALA A C     1 
ATOM   1872 O O     . ALA E 3 84  ? 23.752 67.695 1.842   1.00 6.00  ? 84  ALA A O     1 
ATOM   1873 C CB    . ALA E 3 84  ? 26.041 65.801 0.806   1.00 11.35 ? 84  ALA A CB    1 
ATOM   1874 N N     . TRP E 3 85  ? 24.560 68.358 -0.148  1.00 11.30 ? 85  TRP A N     1 
ATOM   1875 C CA    . TRP E 3 85  ? 23.261 68.883 -0.559  1.00 14.74 ? 85  TRP A CA    1 
ATOM   1876 C C     . TRP E 3 85  ? 22.319 67.670 -0.637  1.00 20.28 ? 85  TRP A C     1 
ATOM   1877 O O     . TRP E 3 85  ? 22.756 66.558 -0.957  1.00 30.40 ? 85  TRP A O     1 
ATOM   1878 C CB    . TRP E 3 85  ? 23.294 69.482 -1.954  1.00 6.29  ? 85  TRP A CB    1 
ATOM   1879 C CG    . TRP E 3 85  ? 23.984 70.726 -2.139  1.00 17.29 ? 85  TRP A CG    1 
ATOM   1880 C CD1   . TRP E 3 85  ? 23.416 71.909 -2.490  1.00 23.53 ? 85  TRP A CD1   1 
ATOM   1881 C CD2   . TRP E 3 85  ? 25.394 70.939 -2.158  1.00 21.87 ? 85  TRP A CD2   1 
ATOM   1882 N NE1   . TRP E 3 85  ? 24.378 72.848 -2.749  1.00 23.36 ? 85  TRP A NE1   1 
ATOM   1883 C CE2   . TRP E 3 85  ? 25.607 72.282 -2.549  1.00 24.34 ? 85  TRP A CE2   1 
ATOM   1884 C CE3   . TRP E 3 85  ? 26.500 70.127 -1.898  1.00 28.00 ? 85  TRP A CE3   1 
ATOM   1885 C CZ2   . TRP E 3 85  ? 26.882 72.834 -2.685  1.00 32.04 ? 85  TRP A CZ2   1 
ATOM   1886 C CZ3   . TRP E 3 85  ? 27.772 70.671 -2.034  1.00 32.37 ? 85  TRP A CZ3   1 
ATOM   1887 C CH2   . TRP E 3 85  ? 27.952 72.018 -2.424  1.00 36.35 ? 85  TRP A CH2   1 
ATOM   1888 H HE1   . TRP E 3 85  ? 24.247 73.751 -3.103  1.00 0.00  ? 85  TRP A HE1   1 
ATOM   1889 N N     . VAL E 3 86  ? 21.035 67.903 -0.413  1.00 17.60 ? 86  VAL A N     1 
ATOM   1890 C CA    . VAL E 3 86  ? 20.007 66.905 -0.615  1.00 11.71 ? 86  VAL A CA    1 
ATOM   1891 C C     . VAL E 3 86  ? 18.944 67.662 -1.394  1.00 13.02 ? 86  VAL A C     1 
ATOM   1892 O O     . VAL E 3 86  ? 18.381 68.622 -0.879  1.00 12.94 ? 86  VAL A O     1 
ATOM   1893 C CB    . VAL E 3 86  ? 19.431 66.454 0.700   1.00 7.11  ? 86  VAL A CB    1 
ATOM   1894 C CG1   . VAL E 3 86  ? 18.200 65.674 0.468   1.00 6.00  ? 86  VAL A CG1   1 
ATOM   1895 C CG2   . VAL E 3 86  ? 20.402 65.635 1.401   1.00 6.00  ? 86  VAL A CG2   1 
ATOM   1896 N N     . ARG E 3 87  ? 18.735 67.291 -2.651  1.00 10.24 ? 87  ARG A N     1 
ATOM   1897 C CA    . ARG E 3 87  ? 17.733 67.931 -3.535  1.00 10.81 ? 87  ARG A CA    1 
ATOM   1898 C C     . ARG E 3 87  ? 16.597 66.949 -3.843  1.00 13.99 ? 87  ARG A C     1 
ATOM   1899 O O     . ARG E 3 87  ? 16.853 65.784 -4.202  1.00 23.37 ? 87  ARG A O     1 
ATOM   1900 C CB    . ARG E 3 87  ? 18.407 68.372 -4.846  1.00 6.47  ? 87  ARG A CB    1 
ATOM   1901 C CG    . ARG E 3 87  ? 17.777 67.838 -6.141  1.00 6.00  ? 87  ARG A CG    1 
ATOM   1902 C CD    . ARG E 3 87  ? 17.859 68.818 -7.314  1.00 6.00  ? 87  ARG A CD    1 
ATOM   1903 N NE    . ARG E 3 87  ? 18.910 68.457 -8.245  1.00 15.90 ? 87  ARG A NE    1 
ATOM   1904 C CZ    . ARG E 3 87  ? 20.205 68.699 -8.050  1.00 27.71 ? 87  ARG A CZ    1 
ATOM   1905 N NH1   . ARG E 3 87  ? 20.637 69.341 -6.949  1.00 16.32 ? 87  ARG A NH1   1 
ATOM   1906 N NH2   . ARG E 3 87  ? 21.087 68.205 -8.915  1.00 11.16 ? 87  ARG A NH2   1 
ATOM   1907 N N     . ALA E 3 88  ? 15.353 67.388 -3.735  1.00 15.60 ? 88  ALA A N     1 
ATOM   1908 C CA    . ALA E 3 88  ? 14.239 66.461 -3.992  1.00 15.33 ? 88  ALA A CA    1 
ATOM   1909 C C     . ALA E 3 88  ? 14.357 65.924 -5.389  1.00 12.63 ? 88  ALA A C     1 
ATOM   1910 O O     . ALA E 3 88  ? 14.914 66.578 -6.265  1.00 12.18 ? 88  ALA A O     1 
ATOM   1911 C CB    . ALA E 3 88  ? 12.925 67.158 -3.850  1.00 19.09 ? 88  ALA A CB    1 
ATOM   1912 N N     . LYS E 3 89  ? 13.866 64.718 -5.594  1.00 15.59 ? 89  LYS A N     1 
ATOM   1913 C CA    . LYS E 3 89  ? 14.002 64.109 -6.908  1.00 13.41 ? 89  LYS A CA    1 
ATOM   1914 C C     . LYS E 3 89  ? 12.655 64.193 -7.542  1.00 11.23 ? 89  LYS A C     1 
ATOM   1915 O O     . LYS E 3 89  ? 12.520 64.070 -8.744  1.00 12.11 ? 89  LYS A O     1 
ATOM   1916 C CB    . LYS E 3 89  ? 14.450 62.680 -6.759  1.00 22.01 ? 89  LYS A CB    1 
ATOM   1917 C CG    . LYS E 3 89  ? 15.148 62.131 -7.962  1.00 32.04 ? 89  LYS A CG    1 
ATOM   1918 C CD    . LYS E 3 89  ? 15.419 60.626 -7.765  1.00 41.34 ? 89  LYS A CD    1 
ATOM   1919 C CE    . LYS E 3 89  ? 14.122 59.777 -7.707  1.00 40.68 ? 89  LYS A CE    1 
ATOM   1920 N NZ    . LYS E 3 89  ? 14.353 58.321 -7.362  1.00 43.50 ? 89  LYS A NZ    1 
ATOM   1921 N N     . THR E 3 90  ? 11.653 64.385 -6.700  1.00 13.33 ? 90  THR A N     1 
ATOM   1922 C CA    . THR E 3 90  ? 10.293 64.678 -7.107  1.00 15.51 ? 90  THR A CA    1 
ATOM   1923 C C     . THR E 3 90  ? 9.520  65.125 -5.888  1.00 23.83 ? 90  THR A C     1 
ATOM   1924 O O     . THR E 3 90  ? 10.011 64.994 -4.756  1.00 26.16 ? 90  THR A O     1 
ATOM   1925 C CB    . THR E 3 90  ? 9.577  63.487 -7.651  1.00 22.25 ? 90  THR A CB    1 
ATOM   1926 O OG1   . THR E 3 90  ? 10.227 62.296 -7.210  1.00 33.71 ? 90  THR A OG1   1 
ATOM   1927 C CG2   . THR E 3 90  ? 9.523  63.581 -9.155  1.00 39.73 ? 90  THR A CG2   1 
ATOM   1928 N N     . ALA E 3 91  ? 8.294  65.581 -6.124  1.00 26.06 ? 91  ALA A N     1 
ATOM   1929 C CA    . ALA E 3 91  ? 7.434  66.128 -5.085  1.00 22.47 ? 91  ALA A CA    1 
ATOM   1930 C C     . ALA E 3 91  ? 7.447  65.215 -3.888  1.00 19.83 ? 91  ALA A C     1 
ATOM   1931 O O     . ALA E 3 91  ? 6.635  64.295 -3.816  1.00 29.49 ? 91  ALA A O     1 
ATOM   1932 C CB    . ALA E 3 91  ? 6.017  66.269 -5.621  1.00 17.72 ? 91  ALA A CB    1 
ATOM   1933 N N     . CYS E 3 92  ? 8.426  65.404 -3.014  1.00 15.39 ? 92  CYS A N     1 
ATOM   1934 C CA    . CYS E 3 92  ? 8.550  64.563 -1.849  1.00 15.41 ? 92  CYS A CA    1 
ATOM   1935 C C     . CYS E 3 92  ? 8.095  65.364 -0.662  1.00 18.99 ? 92  CYS A C     1 
ATOM   1936 O O     . CYS E 3 92  ? 8.466  66.525 -0.539  1.00 34.86 ? 92  CYS A O     1 
ATOM   1937 C CB    . CYS E 3 92  ? 9.977  64.158 -1.662  1.00 6.98  ? 92  CYS A CB    1 
ATOM   1938 S SG    . CYS E 3 92  ? 10.929 65.429 -0.886  1.00 26.42 ? 92  CYS A SG    1 
ATOM   1939 N N     . GLU E 3 93  ? 7.405  64.720 0.274   1.00 21.96 ? 93  GLU A N     1 
ATOM   1940 C CA    . GLU E 3 93  ? 6.742  65.410 1.382   1.00 20.89 ? 93  GLU A CA    1 
ATOM   1941 C C     . GLU E 3 93  ? 7.461  65.359 2.738   1.00 22.68 ? 93  GLU A C     1 
ATOM   1942 O O     . GLU E 3 93  ? 7.034  64.639 3.659   1.00 25.13 ? 93  GLU A O     1 
ATOM   1943 C CB    . GLU E 3 93  ? 5.339  64.840 1.535   1.00 19.27 ? 93  GLU A CB    1 
ATOM   1944 C CG    . GLU E 3 93  ? 4.259  65.874 1.606   1.00 23.34 ? 93  GLU A CG    1 
ATOM   1945 C CD    . GLU E 3 93  ? 2.869  65.260 1.626   1.00 31.39 ? 93  GLU A CD    1 
ATOM   1946 O OE1   . GLU E 3 93  ? 2.614  64.426 2.530   1.00 25.53 ? 93  GLU A OE1   1 
ATOM   1947 O OE2   . GLU E 3 93  ? 2.036  65.614 0.740   1.00 34.06 ? 93  GLU A OE2   1 
ATOM   1948 N N     . VAL E 3 94  ? 8.479  66.197 2.896   1.00 14.15 ? 94  VAL A N     1 
ATOM   1949 C CA    . VAL E 3 94  ? 9.294  66.170 4.099   1.00 16.65 ? 94  VAL A CA    1 
ATOM   1950 C C     . VAL E 3 94  ? 8.598  66.564 5.404   1.00 24.81 ? 94  VAL A C     1 
ATOM   1951 O O     . VAL E 3 94  ? 8.124  67.697 5.545   1.00 23.22 ? 94  VAL A O     1 
ATOM   1952 C CB    . VAL E 3 94  ? 10.484 67.061 3.933   1.00 16.73 ? 94  VAL A CB    1 
ATOM   1953 C CG1   . VAL E 3 94  ? 11.547 66.669 4.944   1.00 23.67 ? 94  VAL A CG1   1 
ATOM   1954 C CG2   . VAL E 3 94  ? 11.013 66.937 2.522   1.00 24.26 ? 94  VAL A CG2   1 
ATOM   1955 N N     . ALA E 3 95  ? 8.535  65.619 6.350   1.00 27.72 ? 95  ALA A N     1 
ATOM   1956 C CA    . ALA E 3 95  ? 7.981  65.869 7.689   1.00 27.89 ? 95  ALA A CA    1 
ATOM   1957 C C     . ALA E 3 95  ? 9.084  66.090 8.723   1.00 29.41 ? 95  ALA A C     1 
ATOM   1958 O O     . ALA E 3 95  ? 9.507  65.129 9.381   1.00 27.52 ? 95  ALA A O     1 
ATOM   1959 C CB    . ALA E 3 95  ? 7.129  64.715 8.135   1.00 14.67 ? 95  ALA A CB    1 
ATOM   1960 N N     . GLU E 3 96  ? 9.477  67.354 8.916   1.00 28.29 ? 96  GLU A N     1 
ATOM   1961 C CA    . GLU E 3 96  ? 10.563 67.754 9.827   1.00 24.58 ? 96  GLU A CA    1 
ATOM   1962 C C     . GLU E 3 96  ? 10.266 67.708 11.360  1.00 23.05 ? 96  GLU A C     1 
ATOM   1963 O O     . GLU E 3 96  ? 9.182  68.143 11.754  1.00 32.93 ? 96  GLU A O     1 
ATOM   1964 C CB    . GLU E 3 96  ? 10.983 69.190 9.462   1.00 30.58 ? 96  GLU A CB    1 
ATOM   1965 C CG    . GLU E 3 96  ? 11.493 69.455 8.011   1.00 29.71 ? 96  GLU A CG    1 
ATOM   1966 C CD    . GLU E 3 96  ? 11.797 70.964 7.740   1.00 35.91 ? 96  GLU A CD    1 
ATOM   1967 O OE1   . GLU E 3 96  ? 12.964 71.411 7.883   1.00 32.11 ? 96  GLU A OE1   1 
ATOM   1968 O OE2   . GLU E 3 96  ? 10.862 71.716 7.384   1.00 30.94 ? 96  GLU A OE2   1 
ATOM   1969 N N     . ILE E 3 97  ? 11.147 67.147 12.214  1.00 13.88 ? 97  ILE A N     1 
ATOM   1970 C CA    . ILE E 3 97  ? 11.081 67.468 13.675  1.00 17.91 ? 97  ILE A CA    1 
ATOM   1971 C C     . ILE E 3 97  ? 12.256 68.385 14.122  1.00 19.97 ? 97  ILE A C     1 
ATOM   1972 O O     . ILE E 3 97  ? 12.527 69.379 13.456  1.00 22.13 ? 97  ILE A O     1 
ATOM   1973 C CB    . ILE E 3 97  ? 11.096 66.234 14.657  1.00 26.34 ? 97  ILE A CB    1 
ATOM   1974 C CG1   . ILE E 3 97  ? 11.662 65.004 13.972  1.00 34.02 ? 97  ILE A CG1   1 
ATOM   1975 C CG2   . ILE E 3 97  ? 9.706  66.043 15.271  1.00 24.95 ? 97  ILE A CG2   1 
ATOM   1976 C CD1   . ILE E 3 97  ? 12.785 64.402 14.785  1.00 27.23 ? 97  ILE A CD1   1 
ATOM   1977 N N     . SER E 3 98  ? 12.974 68.076 15.207  1.00 17.60 ? 98  SER A N     1 
ATOM   1978 C CA    . SER E 3 98  ? 14.018 68.988 15.713  1.00 15.90 ? 98  SER A CA    1 
ATOM   1979 C C     . SER E 3 98  ? 15.090 68.234 16.465  1.00 14.53 ? 98  SER A C     1 
ATOM   1980 O O     . SER E 3 98  ? 14.771 67.281 17.164  1.00 8.18  ? 98  SER A O     1 
ATOM   1981 C CB    . SER E 3 98  ? 13.375 70.045 16.645  1.00 23.41 ? 98  SER A CB    1 
ATOM   1982 O OG    . SER E 3 98  ? 14.284 70.610 17.595  1.00 10.48 ? 98  SER A OG    1 
ATOM   1983 N N     . TYR E 3 99  ? 16.347 68.673 16.362  1.00 15.33 ? 99  TYR A N     1 
ATOM   1984 C CA    . TYR E 3 99  ? 17.427 67.985 17.055  1.00 19.25 ? 99  TYR A CA    1 
ATOM   1985 C C     . TYR E 3 99  ? 17.186 68.045 18.538  1.00 30.67 ? 99  TYR A C     1 
ATOM   1986 O O     . TYR E 3 99  ? 17.048 66.997 19.203  1.00 37.03 ? 99  TYR A O     1 
ATOM   1987 C CB    . TYR E 3 99  ? 18.764 68.620 16.738  1.00 21.61 ? 99  TYR A CB    1 
ATOM   1988 C CG    . TYR E 3 99  ? 19.404 68.058 15.491  1.00 30.33 ? 99  TYR A CG    1 
ATOM   1989 C CD1   . TYR E 3 99  ? 18.652 67.344 14.549  1.00 26.30 ? 99  TYR A CD1   1 
ATOM   1990 C CD2   . TYR E 3 99  ? 20.764 68.267 15.235  1.00 31.09 ? 99  TYR A CD2   1 
ATOM   1991 C CE1   . TYR E 3 99  ? 19.235 66.854 13.387  1.00 31.51 ? 99  TYR A CE1   1 
ATOM   1992 C CE2   . TYR E 3 99  ? 21.353 67.782 14.074  1.00 30.00 ? 99  TYR A CE2   1 
ATOM   1993 C CZ    . TYR E 3 99  ? 20.584 67.077 13.159  1.00 32.58 ? 99  TYR A CZ    1 
ATOM   1994 O OH    . TYR E 3 99  ? 21.176 66.549 12.039  1.00 41.06 ? 99  TYR A OH    1 
ATOM   1995 N N     . LYS E 3 100 ? 17.094 69.282 19.036  1.00 36.07 ? 100 LYS A N     1 
ATOM   1996 C CA    . LYS E 3 100 ? 16.758 69.551 20.426  1.00 37.52 ? 100 LYS A CA    1 
ATOM   1997 C C     . LYS E 3 100 ? 15.484 68.740 20.728  1.00 36.90 ? 100 LYS A C     1 
ATOM   1998 O O     . LYS E 3 100 ? 15.516 67.825 21.563  1.00 43.36 ? 100 LYS A O     1 
ATOM   1999 C CB    . LYS E 3 100 ? 16.538 71.065 20.638  1.00 36.85 ? 100 LYS A CB    1 
ATOM   2000 C CG    . LYS E 3 100 ? 16.229 71.877 19.366  1.00 43.73 ? 100 LYS A CG    1 
ATOM   2001 C CD    . LYS E 3 100 ? 15.842 73.356 19.639  1.00 52.35 ? 100 LYS A CD    1 
ATOM   2002 C CE    . LYS E 3 100 ? 15.199 74.065 18.402  1.00 47.29 ? 100 LYS A CE    1 
ATOM   2003 N NZ    . LYS E 3 100 ? 13.812 73.597 17.986  1.00 35.44 ? 100 LYS A NZ    1 
ATOM   2004 N N     . LYS E 3 101 ? 14.427 68.932 19.943  1.00 32.95 ? 101 LYS A N     1 
ATOM   2005 C CA    . LYS E 3 101 ? 13.220 68.118 20.131  1.00 36.33 ? 101 LYS A CA    1 
ATOM   2006 C C     . LYS E 3 101 ? 13.323 66.763 19.418  1.00 34.92 ? 101 LYS A C     1 
ATOM   2007 O O     . LYS E 3 101 ? 12.452 66.404 18.594  1.00 32.00 ? 101 LYS A O     1 
ATOM   2008 C CB    . LYS E 3 101 ? 11.960 68.860 19.633  1.00 36.85 ? 101 LYS A CB    1 
ATOM   2009 C CG    . LYS E 3 101 ? 10.626 68.292 20.200  1.00 34.30 ? 101 LYS A CG    1 
ATOM   2010 C CD    . LYS E 3 101 ? 9.663  67.800 19.107  1.00 29.90 ? 101 LYS A CD    1 
ATOM   2011 C CE    . LYS E 3 101 ? 8.360  67.302 19.723  1.00 33.18 ? 101 LYS A CE    1 
ATOM   2012 N NZ    . LYS E 3 101 ? 7.522  68.344 20.437  1.00 32.81 ? 101 LYS A NZ    1 
ATOM   2013 N N     . PHE E 3 102 ? 14.467 66.108 19.599  1.00 36.12 ? 102 PHE A N     1 
ATOM   2014 C CA    . PHE E 3 102 ? 14.617 64.701 19.228  1.00 40.48 ? 102 PHE A CA    1 
ATOM   2015 C C     . PHE E 3 102 ? 15.141 63.992 20.465  1.00 40.97 ? 102 PHE A C     1 
ATOM   2016 O O     . PHE E 3 102 ? 14.575 62.981 20.864  1.00 40.68 ? 102 PHE A O     1 
ATOM   2017 C CB    . PHE E 3 102 ? 15.618 64.467 18.083  1.00 40.97 ? 102 PHE A CB    1 
ATOM   2018 C CG    . PHE E 3 102 ? 15.495 63.086 17.437  1.00 38.05 ? 102 PHE A CG    1 
ATOM   2019 C CD1   . PHE E 3 102 ? 14.225 62.525 17.169  1.00 34.38 ? 102 PHE A CD1   1 
ATOM   2020 C CD2   . PHE E 3 102 ? 16.639 62.373 17.056  1.00 31.95 ? 102 PHE A CD2   1 
ATOM   2021 C CE1   . PHE E 3 102 ? 14.099 61.282 16.527  1.00 25.95 ? 102 PHE A CE1   1 
ATOM   2022 C CE2   . PHE E 3 102 ? 16.535 61.127 16.415  1.00 29.34 ? 102 PHE A CE2   1 
ATOM   2023 C CZ    . PHE E 3 102 ? 15.260 60.580 16.148  1.00 31.21 ? 102 PHE A CZ    1 
ATOM   2024 N N     . ARG E 3 103 ? 16.177 64.556 21.099  1.00 40.32 ? 103 ARG A N     1 
ATOM   2025 C CA    . ARG E 3 103 ? 16.780 63.967 22.303  1.00 39.90 ? 103 ARG A CA    1 
ATOM   2026 C C     . ARG E 3 103 ? 15.748 63.669 23.393  1.00 46.73 ? 103 ARG A C     1 
ATOM   2027 O O     . ARG E 3 103 ? 15.743 62.580 24.003  1.00 46.32 ? 103 ARG A O     1 
ATOM   2028 C CB    . ARG E 3 103 ? 17.850 64.890 22.884  1.00 35.06 ? 103 ARG A CB    1 
ATOM   2029 C CG    . ARG E 3 103 ? 19.151 64.837 22.159  1.00 25.77 ? 103 ARG A CG    1 
ATOM   2030 C CD    . ARG E 3 103 ? 18.998 65.487 20.811  1.00 23.83 ? 103 ARG A CD    1 
ATOM   2031 N NE    . ARG E 3 103 ? 20.302 65.877 20.317  1.00 24.77 ? 103 ARG A NE    1 
ATOM   2032 C CZ    . ARG E 3 103 ? 20.983 66.922 20.769  1.00 25.83 ? 103 ARG A CZ    1 
ATOM   2033 N NH1   . ARG E 3 103 ? 20.461 67.697 21.722  1.00 24.08 ? 103 ARG A NH1   1 
ATOM   2034 N NH2   . ARG E 3 103 ? 22.207 67.158 20.306  1.00 28.78 ? 103 ARG A NH2   1 
ATOM   2035 N N     . GLN E 3 104 ? 14.868 64.640 23.626  1.00 50.12 ? 104 GLN A N     1 
ATOM   2036 C CA    . GLN E 3 104 ? 13.779 64.462 24.577  1.00 46.55 ? 104 GLN A CA    1 
ATOM   2037 C C     . GLN E 3 104 ? 12.961 63.257 24.088  1.00 40.04 ? 104 GLN A C     1 
ATOM   2038 O O     . GLN E 3 104 ? 12.920 62.229 24.754  1.00 46.38 ? 104 GLN A O     1 
ATOM   2039 C CB    . GLN E 3 104 ? 12.950 65.746 24.629  1.00 48.42 ? 104 GLN A CB    1 
ATOM   2040 C CG    . GLN E 3 104 ? 13.757 66.946 25.147  1.00 51.03 ? 104 GLN A CG    1 
ATOM   2041 C CD    . GLN E 3 104 ? 13.206 68.286 24.660  1.00 54.81 ? 104 GLN A CD    1 
ATOM   2042 O OE1   . GLN E 3 104 ? 12.030 68.385 24.311  1.00 52.94 ? 104 GLN A OE1   1 
ATOM   2043 N NE2   . GLN E 3 104 ? 14.061 69.312 24.604  1.00 51.54 ? 104 GLN A NE2   1 
ATOM   2044 N N     . LEU E 3 105 ? 12.507 63.327 22.844  1.00 37.47 ? 105 LEU A N     1 
ATOM   2045 C CA    . LEU E 3 105 ? 11.779 62.248 22.190  1.00 35.47 ? 105 LEU A CA    1 
ATOM   2046 C C     . LEU E 3 105 ? 12.488 60.923 22.446  1.00 37.68 ? 105 LEU A C     1 
ATOM   2047 O O     . LEU E 3 105 ? 11.865 59.917 22.831  1.00 48.65 ? 105 LEU A O     1 
ATOM   2048 C CB    . LEU E 3 105 ? 11.732 62.489 20.677  1.00 24.12 ? 105 LEU A CB    1 
ATOM   2049 C CG    . LEU E 3 105 ? 10.381 62.508 19.982  1.00 32.47 ? 105 LEU A CG    1 
ATOM   2050 C CD1   . LEU E 3 105 ? 9.867  63.950 20.004  1.00 25.71 ? 105 LEU A CD1   1 
ATOM   2051 C CD2   . LEU E 3 105 ? 10.509 61.956 18.532  1.00 27.29 ? 105 LEU A CD2   1 
ATOM   2052 N N     . ILE E 3 106 ? 13.812 60.979 22.360  1.00 35.78 ? 106 ILE A N     1 
ATOM   2053 C CA    . ILE E 3 106 ? 14.665 59.803 22.376  1.00 36.59 ? 106 ILE A CA    1 
ATOM   2054 C C     . ILE E 3 106 ? 14.790 59.082 23.729  1.00 41.42 ? 106 ILE A C     1 
ATOM   2055 O O     . ILE E 3 106 ? 15.242 57.923 23.787  1.00 41.43 ? 106 ILE A O     1 
ATOM   2056 C CB    . ILE E 3 106 ? 16.058 60.223 21.778  1.00 22.20 ? 106 ILE A CB    1 
ATOM   2057 C CG1   . ILE E 3 106 ? 16.234 59.522 20.435  1.00 17.09 ? 106 ILE A CG1   1 
ATOM   2058 C CG2   . ILE E 3 106 ? 17.209 59.954 22.740  1.00 29.17 ? 106 ILE A CG2   1 
ATOM   2059 C CD1   . ILE E 3 106 ? 17.517 59.906 19.722  1.00 26.06 ? 106 ILE A CD1   1 
ATOM   2060 N N     . GLN E 3 107 ? 14.384 59.730 24.820  1.00 36.90 ? 107 GLN A N     1 
ATOM   2061 C CA    . GLN E 3 107 ? 14.456 59.072 26.118  1.00 36.93 ? 107 GLN A CA    1 
ATOM   2062 C C     . GLN E 3 107 ? 13.090 58.595 26.666  1.00 32.66 ? 107 GLN A C     1 
ATOM   2063 O O     . GLN E 3 107 ? 13.026 57.858 27.651  1.00 29.86 ? 107 GLN A O     1 
ATOM   2064 C CB    . GLN E 3 107 ? 15.174 60.005 27.097  1.00 42.18 ? 107 GLN A CB    1 
ATOM   2065 C CG    . GLN E 3 107 ? 16.551 60.535 26.590  1.00 49.36 ? 107 GLN A CG    1 
ATOM   2066 C CD    . GLN E 3 107 ? 17.657 59.465 26.444  1.00 50.58 ? 107 GLN A CD    1 
ATOM   2067 O OE1   . GLN E 3 107 ? 18.675 59.498 27.159  1.00 44.40 ? 107 GLN A OE1   1 
ATOM   2068 N NE2   . GLN E 3 107 ? 17.469 58.529 25.516  1.00 50.23 ? 107 GLN A NE2   1 
ATOM   2069 N N     . VAL E 3 108 ? 12.001 59.002 26.032  1.00 28.77 ? 108 VAL A N     1 
ATOM   2070 C CA    . VAL E 3 108 ? 10.699 58.395 26.338  1.00 32.13 ? 108 VAL A CA    1 
ATOM   2071 C C     . VAL E 3 108 ? 10.537 57.274 25.318  1.00 30.77 ? 108 VAL A C     1 
ATOM   2072 O O     . VAL E 3 108 ? 9.467  56.701 25.201  1.00 29.01 ? 108 VAL A O     1 
ATOM   2073 C CB    . VAL E 3 108 ? 9.486  59.374 26.160  1.00 35.36 ? 108 VAL A CB    1 
ATOM   2074 C CG1   . VAL E 3 108 ? 8.185  58.711 26.684  1.00 36.33 ? 108 VAL A CG1   1 
ATOM   2075 C CG2   . VAL E 3 108 ? 9.747  60.679 26.907  1.00 37.94 ? 108 VAL A CG2   1 
ATOM   2076 N N     . ASN E 3 109 ? 11.559 57.072 24.486  1.00 35.68 ? 109 ASN A N     1 
ATOM   2077 C CA    . ASN E 3 109 ? 11.571 55.986 23.517  1.00 41.82 ? 109 ASN A CA    1 
ATOM   2078 C C     . ASN E 3 109 ? 12.923 55.785 22.872  1.00 44.69 ? 109 ASN A C     1 
ATOM   2079 O O     . ASN E 3 109 ? 13.335 56.597 22.029  1.00 49.56 ? 109 ASN A O     1 
ATOM   2080 C CB    . ASN E 3 109 ? 10.581 56.199 22.369  1.00 44.13 ? 109 ASN A CB    1 
ATOM   2081 C CG    . ASN E 3 109 ? 10.747 55.124 21.270  1.00 50.51 ? 109 ASN A CG    1 
ATOM   2082 O OD1   . ASN E 3 109 ? 10.529 53.927 21.515  1.00 52.70 ? 109 ASN A OD1   1 
ATOM   2083 N ND2   . ASN E 3 109 ? 11.266 55.525 20.114  1.00 39.48 ? 109 ASN A ND2   1 
ATOM   2084 N N     . PRO E 3 110 ? 13.577 54.641 23.158  1.00 41.72 ? 110 PRO A N     1 
ATOM   2085 C CA    . PRO E 3 110 ? 14.771 54.220 22.411  1.00 37.34 ? 110 PRO A CA    1 
ATOM   2086 C C     . PRO E 3 110 ? 14.528 53.577 21.034  1.00 32.07 ? 110 PRO A C     1 
ATOM   2087 O O     . PRO E 3 110 ? 15.444 53.536 20.224  1.00 32.86 ? 110 PRO A O     1 
ATOM   2088 C CB    . PRO E 3 110 ? 15.482 53.287 23.389  1.00 35.70 ? 110 PRO A CB    1 
ATOM   2089 C CG    . PRO E 3 110 ? 14.312 52.616 24.088  1.00 39.82 ? 110 PRO A CG    1 
ATOM   2090 C CD    . PRO E 3 110 ? 13.374 53.777 24.365  1.00 40.40 ? 110 PRO A CD    1 
ATOM   2091 N N     . ASP E 3 111 ? 13.309 53.128 20.741  1.00 26.38 ? 111 ASP A N     1 
ATOM   2092 C CA    . ASP E 3 111 ? 13.036 52.470 19.459  1.00 26.72 ? 111 ASP A CA    1 
ATOM   2093 C C     . ASP E 3 111 ? 13.494 53.277 18.236  1.00 31.12 ? 111 ASP A C     1 
ATOM   2094 O O     . ASP E 3 111 ? 14.060 52.698 17.292  1.00 21.09 ? 111 ASP A O     1 
ATOM   2095 C CB    . ASP E 3 111 ? 11.542 52.168 19.329  1.00 31.64 ? 111 ASP A CB    1 
ATOM   2096 C CG    . ASP E 3 111 ? 11.245 50.703 19.000  1.00 36.74 ? 111 ASP A CG    1 
ATOM   2097 O OD1   . ASP E 3 111 ? 12.020 49.794 19.414  1.00 42.43 ? 111 ASP A OD1   1 
ATOM   2098 O OD2   . ASP E 3 111 ? 10.190 50.459 18.360  1.00 30.71 ? 111 ASP A OD2   1 
ATOM   2099 N N     . ILE E 3 112 ? 13.297 54.606 18.252  1.00 34.87 ? 112 ILE A N     1 
ATOM   2100 C CA    . ILE E 3 112 ? 13.753 55.417 17.110  1.00 36.24 ? 112 ILE A CA    1 
ATOM   2101 C C     . ILE E 3 112 ? 15.160 55.945 17.245  1.00 35.64 ? 112 ILE A C     1 
ATOM   2102 O O     . ILE E 3 112 ? 15.632 56.675 16.368  1.00 45.89 ? 112 ILE A O     1 
ATOM   2103 C CB    . ILE E 3 112 ? 12.879 56.661 16.790  1.00 37.91 ? 112 ILE A CB    1 
ATOM   2104 C CG1   . ILE E 3 112 ? 12.582 57.435 18.075  1.00 47.15 ? 112 ILE A CG1   1 
ATOM   2105 C CG2   . ILE E 3 112 ? 11.692 56.236 15.978  1.00 35.86 ? 112 ILE A CG2   1 
ATOM   2106 C CD1   . ILE E 3 112 ? 12.096 58.850 17.858  1.00 43.76 ? 112 ILE A CD1   1 
ATOM   2107 N N     . LEU E 3 113 ? 15.812 55.665 18.364  1.00 27.94 ? 113 LEU A N     1 
ATOM   2108 C CA    . LEU E 3 113 ? 17.244 55.908 18.387  1.00 22.94 ? 113 LEU A CA    1 
ATOM   2109 C C     . LEU E 3 113 ? 17.721 54.836 17.445  1.00 32.23 ? 113 LEU A C     1 
ATOM   2110 O O     . LEU E 3 113 ? 18.569 55.079 16.586  1.00 31.27 ? 113 LEU A O     1 
ATOM   2111 C CB    . LEU E 3 113 ? 17.876 55.619 19.726  1.00 13.02 ? 113 LEU A CB    1 
ATOM   2112 C CG    . LEU E 3 113 ? 19.374 55.862 19.579  1.00 10.27 ? 113 LEU A CG    1 
ATOM   2113 C CD1   . LEU E 3 113 ? 19.644 57.375 19.391  1.00 16.72 ? 113 LEU A CD1   1 
ATOM   2114 C CD2   . LEU E 3 113 ? 20.067 55.416 20.803  1.00 9.97  ? 113 LEU A CD2   1 
ATOM   2115 N N     . MET E 3 114 ? 17.083 53.664 17.596  1.00 35.06 ? 114 MET A N     1 
ATOM   2116 C CA    . MET E 3 114 ? 17.406 52.444 16.881  1.00 28.05 ? 114 MET A CA    1 
ATOM   2117 C C     . MET E 3 114 ? 17.220 52.634 15.397  1.00 27.53 ? 114 MET A C     1 
ATOM   2118 O O     . MET E 3 114 ? 18.218 52.719 14.690  1.00 24.45 ? 114 MET A O     1 
ATOM   2119 C CB    . MET E 3 114 ? 16.528 51.294 17.369  1.00 26.71 ? 114 MET A CB    1 
ATOM   2120 C CG    . MET E 3 114 ? 16.712 50.869 18.833  1.00 29.72 ? 114 MET A CG    1 
ATOM   2121 S SD    . MET E 3 114 ? 18.117 49.743 19.184  1.00 37.71 ? 114 MET A SD    1 
ATOM   2122 C CE    . MET E 3 114 ? 18.158 48.679 17.642  1.00 19.21 ? 114 MET A CE    1 
ATOM   2123 N N     . ARG E 3 115 ? 15.982 52.816 14.930  1.00 21.56 ? 115 ARG A N     1 
ATOM   2124 C CA    . ARG E 3 115 ? 15.746 52.882 13.483  1.00 18.56 ? 115 ARG A CA    1 
ATOM   2125 C C     . ARG E 3 115 ? 16.640 53.863 12.747  1.00 21.13 ? 115 ARG A C     1 
ATOM   2126 O O     . ARG E 3 115 ? 17.298 53.482 11.774  1.00 19.70 ? 115 ARG A O     1 
ATOM   2127 C CB    . ARG E 3 115 ? 14.280 53.190 13.183  1.00 17.00 ? 115 ARG A CB    1 
ATOM   2128 C CG    . ARG E 3 115 ? 13.594 51.998 12.501  1.00 20.32 ? 115 ARG A CG    1 
ATOM   2129 C CD    . ARG E 3 115 ? 12.097 51.926 12.757  1.00 17.92 ? 115 ARG A CD    1 
ATOM   2130 N NE    . ARG E 3 115 ? 11.787 51.846 14.185  1.00 26.55 ? 115 ARG A NE    1 
ATOM   2131 C CZ    . ARG E 3 115 ? 10.646 51.386 14.710  1.00 34.41 ? 115 ARG A CZ    1 
ATOM   2132 N NH1   . ARG E 3 115 ? 9.646  50.919 13.956  1.00 34.29 ? 115 ARG A NH1   1 
ATOM   2133 N NH2   . ARG E 3 115 ? 10.461 51.481 16.015  1.00 34.71 ? 115 ARG A NH2   1 
ATOM   2134 N N     . LEU E 3 116 ? 16.803 55.063 13.286  1.00 23.68 ? 116 LEU A N     1 
ATOM   2135 C CA    . LEU E 3 116 ? 17.714 56.046 12.678  1.00 21.33 ? 116 LEU A CA    1 
ATOM   2136 C C     . LEU E 3 116 ? 19.101 55.363 12.529  1.00 24.05 ? 116 LEU A C     1 
ATOM   2137 O O     . LEU E 3 116 ? 19.672 55.316 11.429  1.00 25.42 ? 116 LEU A O     1 
ATOM   2138 C CB    . LEU E 3 116 ? 17.784 57.271 13.598  1.00 20.53 ? 116 LEU A CB    1 
ATOM   2139 C CG    . LEU E 3 116 ? 18.573 58.565 13.404  1.00 21.24 ? 116 LEU A CG    1 
ATOM   2140 C CD1   . LEU E 3 116 ? 17.725 59.634 12.753  1.00 34.80 ? 116 LEU A CD1   1 
ATOM   2141 C CD2   . LEU E 3 116 ? 19.000 59.053 14.772  1.00 23.78 ? 116 LEU A CD2   1 
ATOM   2142 N N     . SER E 3 117 ? 19.531 54.691 13.604  1.00 19.80 ? 117 SER A N     1 
ATOM   2143 C CA    . SER E 3 117 ? 20.835 54.031 13.696  1.00 13.36 ? 117 SER A CA    1 
ATOM   2144 C C     . SER E 3 117 ? 20.946 52.803 12.771  1.00 11.69 ? 117 SER A C     1 
ATOM   2145 O O     . SER E 3 117 ? 22.040 52.364 12.422  1.00 7.78  ? 117 SER A O     1 
ATOM   2146 C CB    . SER E 3 117 ? 21.090 53.615 15.155  1.00 18.62 ? 117 SER A CB    1 
ATOM   2147 O OG    . SER E 3 117 ? 20.984 54.714 16.063  1.00 15.74 ? 117 SER A OG    1 
ATOM   2148 N N     . ALA E 3 118 ? 19.807 52.271 12.354  1.00 9.55  ? 118 ALA A N     1 
ATOM   2149 C CA    . ALA E 3 118 ? 19.747 51.083 11.522  1.00 6.00  ? 118 ALA A CA    1 
ATOM   2150 C C     . ALA E 3 118 ? 19.995 51.527 10.083  1.00 11.77 ? 118 ALA A C     1 
ATOM   2151 O O     . ALA E 3 118 ? 20.868 50.964 9.382   1.00 7.14  ? 118 ALA A O     1 
ATOM   2152 C CB    . ALA E 3 118 ? 18.408 50.458 11.663  1.00 6.00  ? 118 ALA A CB    1 
ATOM   2153 N N     . GLN E 3 119 ? 19.278 52.590 9.697   1.00 11.87 ? 119 GLN A N     1 
ATOM   2154 C CA    . GLN E 3 119 ? 19.493 53.318 8.446   1.00 6.00  ? 119 GLN A CA    1 
ATOM   2155 C C     . GLN E 3 119 ? 20.960 53.751 8.408   1.00 6.00  ? 119 GLN A C     1 
ATOM   2156 O O     . GLN E 3 119 ? 21.665 53.514 7.430   1.00 6.00  ? 119 GLN A O     1 
ATOM   2157 C CB    . GLN E 3 119 ? 18.593 54.557 8.406   1.00 6.00  ? 119 GLN A CB    1 
ATOM   2158 C CG    . GLN E 3 119 ? 17.288 54.407 7.601   1.00 6.00  ? 119 GLN A CG    1 
ATOM   2159 C CD    . GLN E 3 119 ? 16.121 55.153 8.216   1.00 11.84 ? 119 GLN A CD    1 
ATOM   2160 O OE1   . GLN E 3 119 ? 16.297 55.849 9.219   1.00 15.78 ? 119 GLN A OE1   1 
ATOM   2161 N NE2   . GLN E 3 119 ? 14.921 55.006 7.638   1.00 6.00  ? 119 GLN A NE2   1 
ATOM   2162 N N     . MET E 3 120 ? 21.465 54.306 9.500   1.00 6.00  ? 120 MET A N     1 
ATOM   2163 C CA    . MET E 3 120 ? 22.853 54.767 9.482   1.00 11.43 ? 120 MET A CA    1 
ATOM   2164 C C     . MET E 3 120 ? 23.784 53.663 9.108   1.00 17.21 ? 120 MET A C     1 
ATOM   2165 O O     . MET E 3 120 ? 24.660 53.836 8.259   1.00 25.01 ? 120 MET A O     1 
ATOM   2166 C CB    . MET E 3 120 ? 23.277 55.336 10.826  1.00 6.00  ? 120 MET A CB    1 
ATOM   2167 C CG    . MET E 3 120 ? 23.515 56.844 10.720  1.00 9.13  ? 120 MET A CG    1 
ATOM   2168 S SD    . MET E 3 120 ? 23.497 57.714 12.215  1.00 12.64 ? 120 MET A SD    1 
ATOM   2169 C CE    . MET E 3 120 ? 21.790 57.520 12.608  1.00 6.00  ? 120 MET A CE    1 
ATOM   2170 N N     . ALA E 3 121 ? 23.503 52.483 9.642   1.00 29.18 ? 121 ALA A N     1 
ATOM   2171 C CA    . ALA E 3 121 ? 24.325 51.319 9.377   1.00 22.79 ? 121 ALA A CA    1 
ATOM   2172 C C     . ALA E 3 121 ? 24.157 50.880 7.935   1.00 26.54 ? 121 ALA A C     1 
ATOM   2173 O O     . ALA E 3 121 ? 25.166 50.694 7.240   1.00 22.14 ? 121 ALA A O     1 
ATOM   2174 C CB    . ALA E 3 121 ? 23.940 50.221 10.295  1.00 20.01 ? 121 ALA A CB    1 
ATOM   2175 N N     . ARG E 3 122 ? 22.908 50.774 7.454   1.00 23.04 ? 122 ARG A N     1 
ATOM   2176 C CA    . ARG E 3 122 ? 22.671 50.282 6.088   1.00 23.00 ? 122 ARG A CA    1 
ATOM   2177 C C     . ARG E 3 122 ? 23.443 51.169 5.141   1.00 21.86 ? 122 ARG A C     1 
ATOM   2178 O O     . ARG E 3 122 ? 24.077 50.662 4.201   1.00 30.71 ? 122 ARG A O     1 
ATOM   2179 C CB    . ARG E 3 122 ? 21.198 50.333 5.644   1.00 17.33 ? 122 ARG A CB    1 
ATOM   2180 C CG    . ARG E 3 122 ? 20.151 49.848 6.619   1.00 41.14 ? 122 ARG A CG    1 
ATOM   2181 C CD    . ARG E 3 122 ? 20.213 48.340 6.898   1.00 53.66 ? 122 ARG A CD    1 
ATOM   2182 N NE    . ARG E 3 122 ? 19.026 47.923 7.655   1.00 51.96 ? 122 ARG A NE    1 
ATOM   2183 C CZ    . ARG E 3 122 ? 19.038 47.542 8.931   1.00 44.03 ? 122 ARG A CZ    1 
ATOM   2184 N NH1   . ARG E 3 122 ? 17.886 47.211 9.514   1.00 34.51 ? 122 ARG A NH1   1 
ATOM   2185 N NH2   . ARG E 3 122 ? 20.195 47.424 9.590   1.00 33.09 ? 122 ARG A NH2   1 
ATOM   2186 N N     . ARG E 3 123 ? 23.454 52.478 5.417   1.00 16.99 ? 123 ARG A N     1 
ATOM   2187 C CA    . ARG E 3 123 ? 24.070 53.416 4.477   1.00 13.90 ? 123 ARG A CA    1 
ATOM   2188 C C     . ARG E 3 123 ? 25.574 53.340 4.464   1.00 6.00  ? 123 ARG A C     1 
ATOM   2189 O O     . ARG E 3 123 ? 26.150 53.339 3.402   1.00 12.83 ? 123 ARG A O     1 
ATOM   2190 C CB    . ARG E 3 123 ? 23.591 54.846 4.748   1.00 6.00  ? 123 ARG A CB    1 
ATOM   2191 C CG    . ARG E 3 123 ? 22.137 55.031 4.333   1.00 16.60 ? 123 ARG A CG    1 
ATOM   2192 C CD    . ARG E 3 123 ? 21.532 56.230 5.005   1.00 14.65 ? 123 ARG A CD    1 
ATOM   2193 N NE    . ARG E 3 123 ? 20.074 56.296 4.993   1.00 6.00  ? 123 ARG A NE    1 
ATOM   2194 C CZ    . ARG E 3 123 ? 19.414 57.311 5.543   1.00 11.34 ? 123 ARG A CZ    1 
ATOM   2195 N NH1   . ARG E 3 123 ? 20.074 58.308 6.122   1.00 11.44 ? 123 ARG A NH1   1 
ATOM   2196 N NH2   . ARG E 3 123 ? 18.100 57.352 5.516   1.00 14.99 ? 123 ARG A NH2   1 
ATOM   2197 N N     . LEU E 3 124 ? 26.215 53.163 5.607   1.00 6.00  ? 124 LEU A N     1 
ATOM   2198 C CA    . LEU E 3 124 ? 27.665 52.999 5.617   1.00 6.00  ? 124 LEU A CA    1 
ATOM   2199 C C     . LEU E 3 124 ? 28.050 51.685 4.880   1.00 8.47  ? 124 LEU A C     1 
ATOM   2200 O O     . LEU E 3 124 ? 29.139 51.594 4.317   1.00 6.00  ? 124 LEU A O     1 
ATOM   2201 C CB    . LEU E 3 124 ? 28.125 52.975 7.050   1.00 6.00  ? 124 LEU A CB    1 
ATOM   2202 C CG    . LEU E 3 124 ? 29.493 53.469 7.419   1.00 6.00  ? 124 LEU A CG    1 
ATOM   2203 C CD1   . LEU E 3 124 ? 29.540 53.337 8.910   1.00 6.09  ? 124 LEU A CD1   1 
ATOM   2204 C CD2   . LEU E 3 124 ? 30.610 52.694 6.810   1.00 6.00  ? 124 LEU A CD2   1 
ATOM   2205 N N     . GLN E 3 125 ? 27.148 50.684 4.878   1.00 15.47 ? 125 GLN A N     1 
ATOM   2206 C CA    . GLN E 3 125 ? 27.370 49.408 4.159   1.00 18.42 ? 125 GLN A CA    1 
ATOM   2207 C C     . GLN E 3 125 ? 27.441 49.722 2.656   1.00 16.37 ? 125 GLN A C     1 
ATOM   2208 O O     . GLN E 3 125 ? 28.517 49.579 2.037   1.00 18.66 ? 125 GLN A O     1 
ATOM   2209 C CB    . GLN E 3 125 ? 26.231 48.373 4.400   1.00 33.90 ? 125 GLN A CB    1 
ATOM   2210 C CG    . GLN E 3 125 ? 26.046 47.794 5.866   1.00 47.33 ? 125 GLN A CG    1 
ATOM   2211 C CD    . GLN E 3 125 ? 24.958 46.683 5.990   1.00 41.38 ? 125 GLN A CD    1 
ATOM   2212 O OE1   . GLN E 3 125 ? 25.125 45.600 5.459   1.00 45.63 ? 125 GLN A OE1   1 
ATOM   2213 N NE2   . GLN E 3 125 ? 23.870 46.960 6.710   1.00 43.15 ? 125 GLN A NE2   1 
ATOM   2214 N N     . VAL E 3 126 ? 26.373 50.288 2.089   1.00 6.00  ? 126 VAL A N     1 
ATOM   2215 C CA    . VAL E 3 126 ? 26.408 50.630 0.660   1.00 6.00  ? 126 VAL A CA    1 
ATOM   2216 C C     . VAL E 3 126 ? 27.361 51.770 0.265   1.00 6.85  ? 126 VAL A C     1 
ATOM   2217 O O     . VAL E 3 126 ? 27.916 51.775 -0.842  1.00 10.84 ? 126 VAL A O     1 
ATOM   2218 C CB    . VAL E 3 126 ? 24.959 50.877 0.101   1.00 6.00  ? 126 VAL A CB    1 
ATOM   2219 C CG1   . VAL E 3 126 ? 24.009 51.220 1.228   1.00 7.00  ? 126 VAL A CG1   1 
ATOM   2220 C CG2   . VAL E 3 126 ? 24.985 51.892 -0.987  1.00 6.00  ? 126 VAL A CG2   1 
ATOM   2221 N N     . THR E 3 127 ? 27.706 52.624 1.215   1.00 8.33  ? 127 THR A N     1 
ATOM   2222 C CA    . THR E 3 127 ? 28.683 53.646 0.934   1.00 7.03  ? 127 THR A CA    1 
ATOM   2223 C C     . THR E 3 127 ? 30.031 53.020 0.836   1.00 6.00  ? 127 THR A C     1 
ATOM   2224 O O     . THR E 3 127 ? 30.795 53.439 0.007   1.00 6.00  ? 127 THR A O     1 
ATOM   2225 C CB    . THR E 3 127 ? 28.775 54.711 2.011   1.00 8.10  ? 127 THR A CB    1 
ATOM   2226 O OG1   . THR E 3 127 ? 27.487 55.248 2.303   1.00 6.00  ? 127 THR A OG1   1 
ATOM   2227 C CG2   . THR E 3 127 ? 29.636 55.808 1.508   1.00 11.47 ? 127 THR A CG2   1 
ATOM   2228 N N     . SER E 3 128 ? 30.316 52.034 1.694   1.00 6.20  ? 128 SER A N     1 
ATOM   2229 C CA    . SER E 3 128 ? 31.598 51.309 1.693   1.00 6.00  ? 128 SER A CA    1 
ATOM   2230 C C     . SER E 3 128 ? 31.780 50.634 0.374   1.00 7.57  ? 128 SER A C     1 
ATOM   2231 O O     . SER E 3 128 ? 32.878 50.599 -0.175  1.00 6.00  ? 128 SER A O     1 
ATOM   2232 C CB    . SER E 3 128 ? 31.622 50.258 2.758   1.00 6.00  ? 128 SER A CB    1 
ATOM   2233 O OG    . SER E 3 128 ? 31.676 50.859 4.029   1.00 12.06 ? 128 SER A OG    1 
ATOM   2234 N N     . GLU E 3 129 ? 30.673 50.126 -0.149  1.00 6.00  ? 129 GLU A N     1 
ATOM   2235 C CA    . GLU E 3 129 ? 30.663 49.528 -1.458  1.00 10.75 ? 129 GLU A CA    1 
ATOM   2236 C C     . GLU E 3 129 ? 31.151 50.516 -2.523  1.00 17.60 ? 129 GLU A C     1 
ATOM   2237 O O     . GLU E 3 129 ? 32.133 50.207 -3.233  1.00 9.94  ? 129 GLU A O     1 
ATOM   2238 C CB    . GLU E 3 129 ? 29.257 49.064 -1.790  1.00 28.29 ? 129 GLU A CB    1 
ATOM   2239 C CG    . GLU E 3 129 ? 28.910 47.664 -1.298  1.00 34.45 ? 129 GLU A CG    1 
ATOM   2240 C CD    . GLU E 3 129 ? 28.370 46.834 -2.417  1.00 39.21 ? 129 GLU A CD    1 
ATOM   2241 O OE1   . GLU E 3 129 ? 27.233 47.139 -2.862  1.00 44.17 ? 129 GLU A OE1   1 
ATOM   2242 O OE2   . GLU E 3 129 ? 29.107 45.926 -2.887  1.00 44.31 ? 129 GLU A OE2   1 
ATOM   2243 N N     . LYS E 3 130 ? 30.498 51.688 -2.628  1.00 11.53 ? 130 LYS A N     1 
ATOM   2244 C CA    . LYS E 3 130 ? 30.955 52.718 -3.561  1.00 10.41 ? 130 LYS A CA    1 
ATOM   2245 C C     . LYS E 3 130 ? 32.460 52.862 -3.506  1.00 9.92  ? 130 LYS A C     1 
ATOM   2246 O O     . LYS E 3 130 ? 33.124 52.621 -4.500  1.00 16.60 ? 130 LYS A O     1 
ATOM   2247 C CB    . LYS E 3 130 ? 30.333 54.056 -3.248  1.00 15.52 ? 130 LYS A CB    1 
ATOM   2248 C CG    . LYS E 3 130 ? 29.023 54.322 -3.950  1.00 21.07 ? 130 LYS A CG    1 
ATOM   2249 C CD    . LYS E 3 130 ? 29.187 54.652 -5.420  1.00 16.11 ? 130 LYS A CD    1 
ATOM   2250 C CE    . LYS E 3 130 ? 27.829 54.940 -6.010  1.00 20.60 ? 130 LYS A CE    1 
ATOM   2251 N NZ    . LYS E 3 130 ? 26.861 53.827 -5.646  1.00 21.33 ? 130 LYS A NZ    1 
ATOM   2252 N N     . VAL E 3 131 ? 33.020 53.105 -2.331  1.00 6.00  ? 131 VAL A N     1 
ATOM   2253 C CA    . VAL E 3 131 ? 34.484 53.194 -2.208  1.00 6.67  ? 131 VAL A CA    1 
ATOM   2254 C C     . VAL E 3 131 ? 35.201 51.964 -2.797  1.00 7.15  ? 131 VAL A C     1 
ATOM   2255 O O     . VAL E 3 131 ? 36.349 52.060 -3.225  1.00 10.01 ? 131 VAL A O     1 
ATOM   2256 C CB    . VAL E 3 131 ? 34.921 53.317 -0.728  1.00 6.01  ? 131 VAL A CB    1 
ATOM   2257 C CG1   . VAL E 3 131 ? 36.325 53.748 -0.641  1.00 6.00  ? 131 VAL A CG1   1 
ATOM   2258 C CG2   . VAL E 3 131 ? 34.060 54.323 -0.011  1.00 22.77 ? 131 VAL A CG2   1 
ATOM   2259 N N     . GLY E 3 132 ? 34.540 50.807 -2.756  1.00 7.96  ? 132 GLY A N     1 
ATOM   2260 C CA    . GLY E 3 132 ? 35.088 49.597 -3.342  1.00 6.00  ? 132 GLY A CA    1 
ATOM   2261 C C     . GLY E 3 132 ? 34.981 49.530 -4.860  1.00 9.89  ? 132 GLY A C     1 
ATOM   2262 O O     . GLY E 3 132 ? 36.003 49.289 -5.504  1.00 6.00  ? 132 GLY A O     1 
ATOM   2263 N N     . ASN E 3 133 ? 33.765 49.695 -5.422  1.00 10.89 ? 133 ASN A N     1 
ATOM   2264 C CA    . ASN E 3 133 ? 33.539 49.757 -6.888  1.00 14.24 ? 133 ASN A CA    1 
ATOM   2265 C C     . ASN E 3 133 ? 34.296 50.850 -7.645  1.00 16.80 ? 133 ASN A C     1 
ATOM   2266 O O     . ASN E 3 133 ? 34.410 50.738 -8.853  1.00 32.24 ? 133 ASN A O     1 
ATOM   2267 C CB    . ASN E 3 133 ? 32.074 49.995 -7.279  1.00 11.24 ? 133 ASN A CB    1 
ATOM   2268 C CG    . ASN E 3 133 ? 31.191 48.878 -6.935  1.00 6.00  ? 133 ASN A CG    1 
ATOM   2269 O OD1   . ASN E 3 133 ? 31.632 47.881 -6.394  1.00 17.52 ? 133 ASN A OD1   1 
ATOM   2270 N ND2   . ASN E 3 133 ? 29.917 49.052 -7.161  1.00 6.00  ? 133 ASN A ND2   1 
ATOM   2271 N N     . LEU E 3 134 ? 34.684 51.951 -7.001  1.00 10.84 ? 134 LEU A N     1 
ATOM   2272 C CA    . LEU E 3 134 ? 35.380 53.011 -7.715  1.00 6.00  ? 134 LEU A CA    1 
ATOM   2273 C C     . LEU E 3 134 ? 36.846 52.641 -7.843  1.00 9.00  ? 134 LEU A C     1 
ATOM   2274 O O     . LEU E 3 134 ? 37.525 53.021 -8.795  1.00 12.34 ? 134 LEU A O     1 
ATOM   2275 C CB    . LEU E 3 134 ? 35.223 54.348 -6.982  1.00 6.00  ? 134 LEU A CB    1 
ATOM   2276 C CG    . LEU E 3 134 ? 33.738 54.677 -6.758  1.00 10.31 ? 134 LEU A CG    1 
ATOM   2277 C CD1   . LEU E 3 134 ? 33.684 55.532 -5.561  1.00 21.11 ? 134 LEU A CD1   1 
ATOM   2278 C CD2   . LEU E 3 134 ? 33.067 55.340 -7.954  1.00 6.00  ? 134 LEU A CD2   1 
ATOM   2279 N N     . ALA E 3 135 ? 37.357 51.897 -6.890  1.00 6.00  ? 135 ALA A N     1 
ATOM   2280 C CA    . ALA E 3 135 ? 38.727 51.515 -6.987  1.00 6.00  ? 135 ALA A CA    1 
ATOM   2281 C C     . ALA E 3 135 ? 38.952 50.077 -7.497  1.00 9.86  ? 135 ALA A C     1 
ATOM   2282 O O     . ALA E 3 135 ? 40.066 49.748 -7.861  1.00 15.70 ? 135 ALA A O     1 
ATOM   2283 C CB    . ALA E 3 135 ? 39.362 51.729 -5.648  1.00 6.00  ? 135 ALA A CB    1 
ATOM   2284 N N     . PHE E 3 136 ? 37.907 49.237 -7.562  1.00 12.39 ? 136 PHE A N     1 
ATOM   2285 C CA    . PHE E 3 136 ? 38.010 47.807 -7.967  1.00 12.28 ? 136 PHE A CA    1 
ATOM   2286 C C     . PHE E 3 136 ? 37.356 47.477 -9.272  1.00 18.19 ? 136 PHE A C     1 
ATOM   2287 O O     . PHE E 3 136 ? 37.176 46.290 -9.589  1.00 24.78 ? 136 PHE A O     1 
ATOM   2288 C CB    . PHE E 3 136 ? 37.333 46.849 -6.981  1.00 7.88  ? 136 PHE A CB    1 
ATOM   2289 C CG    . PHE E 3 136 ? 38.077 46.643 -5.749  1.00 6.00  ? 136 PHE A CG    1 
ATOM   2290 C CD1   . PHE E 3 136 ? 39.445 46.831 -5.721  1.00 6.00  ? 136 PHE A CD1   1 
ATOM   2291 C CD2   . PHE E 3 136 ? 37.401 46.378 -4.584  1.00 6.00  ? 136 PHE A CD2   1 
ATOM   2292 C CE1   . PHE E 3 136 ? 40.125 46.773 -4.548  1.00 6.00  ? 136 PHE A CE1   1 
ATOM   2293 C CE2   . PHE E 3 136 ? 38.072 46.319 -3.393  1.00 7.47  ? 136 PHE A CE2   1 
ATOM   2294 C CZ    . PHE E 3 136 ? 39.435 46.518 -3.364  1.00 10.63 ? 136 PHE A CZ    1 
ATOM   2295 N N     . LEU E 3 137 ? 36.938 48.480 -10.013 1.00 16.09 ? 137 LEU A N     1 
ATOM   2296 C CA    . LEU E 3 137 ? 36.128 48.178 -11.160 1.00 11.41 ? 137 LEU A CA    1 
ATOM   2297 C C     . LEU E 3 137 ? 36.242 49.264 -12.261 1.00 11.00 ? 137 LEU A C     1 
ATOM   2298 O O     . LEU E 3 137 ? 36.387 50.445 -11.992 1.00 10.17 ? 137 LEU A O     1 
ATOM   2299 C CB    . LEU E 3 137 ? 34.700 48.008 -10.638 1.00 8.66  ? 137 LEU A CB    1 
ATOM   2300 C CG    . LEU E 3 137 ? 33.909 46.758 -10.995 1.00 6.88  ? 137 LEU A CG    1 
ATOM   2301 C CD1   . LEU E 3 137 ? 34.657 45.537 -10.486 1.00 6.00  ? 137 LEU A CD1   1 
ATOM   2302 C CD2   . LEU E 3 137 ? 32.515 46.849 -10.406 1.00 6.00  ? 137 LEU A CD2   1 
ATOM   2303 N N     . ASP E 3 138 ? 36.274 48.814 -13.497 1.00 7.07  ? 138 ASP A N     1 
ATOM   2304 C CA    . ASP E 3 138 ? 36.396 49.658 -14.652 1.00 6.00  ? 138 ASP A CA    1 
ATOM   2305 C C     . ASP E 3 138 ? 35.025 50.258 -14.852 1.00 6.00  ? 138 ASP A C     1 
ATOM   2306 O O     . ASP E 3 138 ? 34.049 49.722 -14.324 1.00 6.00  ? 138 ASP A O     1 
ATOM   2307 C CB    . ASP E 3 138 ? 36.798 48.796 -15.840 1.00 7.15  ? 138 ASP A CB    1 
ATOM   2308 C CG    . ASP E 3 138 ? 35.664 47.925 -16.323 1.00 6.00  ? 138 ASP A CG    1 
ATOM   2309 O OD1   . ASP E 3 138 ? 34.911 48.417 -17.169 1.00 14.11 ? 138 ASP A OD1   1 
ATOM   2310 O OD2   . ASP E 3 138 ? 35.476 46.786 -15.832 1.00 13.23 ? 138 ASP A OD2   1 
ATOM   2311 N N     . VAL E 3 139 ? 34.924 51.258 -15.731 1.00 6.00  ? 139 VAL A N     1 
ATOM   2312 C CA    . VAL E 3 139 ? 33.677 52.030 -15.915 1.00 9.43  ? 139 VAL A CA    1 
ATOM   2313 C C     . VAL E 3 139 ? 32.469 51.207 -16.370 1.00 11.43 ? 139 VAL A C     1 
ATOM   2314 O O     . VAL E 3 139 ? 31.428 51.194 -15.703 1.00 12.83 ? 139 VAL A O     1 
ATOM   2315 C CB    . VAL E 3 139 ? 33.899 53.265 -16.902 1.00 16.36 ? 139 VAL A CB    1 
ATOM   2316 C CG1   . VAL E 3 139 ? 34.510 52.793 -18.254 1.00 6.00  ? 139 VAL A CG1   1 
ATOM   2317 C CG2   . VAL E 3 139 ? 32.555 54.013 -17.112 1.00 17.85 ? 139 VAL A CG2   1 
ATOM   2318 N N     . THR E 3 140 ? 32.626 50.437 -17.435 1.00 12.80 ? 140 THR A N     1 
ATOM   2319 C CA    . THR E 3 140 ? 31.542 49.596 -17.915 1.00 16.28 ? 140 THR A CA    1 
ATOM   2320 C C     . THR E 3 140 ? 31.051 48.802 -16.714 1.00 15.60 ? 140 THR A C     1 
ATOM   2321 O O     . THR E 3 140 ? 29.848 48.628 -16.531 1.00 14.69 ? 140 THR A O     1 
ATOM   2322 C CB    . THR E 3 140 ? 32.026 48.608 -19.031 1.00 18.09 ? 140 THR A CB    1 
ATOM   2323 O OG1   . THR E 3 140 ? 32.661 49.330 -20.104 1.00 8.35  ? 140 THR A OG1   1 
ATOM   2324 C CG2   . THR E 3 140 ? 30.839 47.840 -19.598 1.00 21.17 ? 140 THR A CG2   1 
ATOM   2325 N N     . GLY E 3 141 ? 31.997 48.462 -15.835 1.00 15.65 ? 141 GLY A N     1 
ATOM   2326 C CA    . GLY E 3 141 ? 31.708 47.673 -14.651 1.00 13.50 ? 141 GLY A CA    1 
ATOM   2327 C C     . GLY E 3 141 ? 30.782 48.407 -13.725 1.00 16.23 ? 141 GLY A C     1 
ATOM   2328 O O     . GLY E 3 141 ? 29.739 47.861 -13.356 1.00 15.55 ? 141 GLY A O     1 
ATOM   2329 N N     . ARG E 3 142 ? 31.096 49.668 -13.427 1.00 11.05 ? 142 ARG A N     1 
ATOM   2330 C CA    . ARG E 3 142 ? 30.280 50.423 -12.504 1.00 6.00  ? 142 ARG A CA    1 
ATOM   2331 C C     . ARG E 3 142 ? 28.974 50.669 -13.120 1.00 6.00  ? 142 ARG A C     1 
ATOM   2332 O O     . ARG E 3 142 ? 27.990 50.770 -12.391 1.00 12.04 ? 142 ARG A O     1 
ATOM   2333 C CB    . ARG E 3 142 ? 30.880 51.745 -12.175 1.00 6.79  ? 142 ARG A CB    1 
ATOM   2334 C CG    . ARG E 3 142 ? 32.336 51.685 -11.742 1.00 19.10 ? 142 ARG A CG    1 
ATOM   2335 C CD    . ARG E 3 142 ? 32.785 53.044 -11.175 1.00 15.87 ? 142 ARG A CD    1 
ATOM   2336 N NE    . ARG E 3 142 ? 34.196 53.331 -11.398 1.00 15.63 ? 142 ARG A NE    1 
ATOM   2337 C CZ    . ARG E 3 142 ? 34.626 54.214 -12.290 1.00 15.35 ? 142 ARG A CZ    1 
ATOM   2338 N NH1   . ARG E 3 142 ? 33.731 54.866 -13.016 1.00 6.89  ? 142 ARG A NH1   1 
ATOM   2339 N NH2   . ARG E 3 142 ? 35.935 54.436 -12.451 1.00 8.71  ? 142 ARG A NH2   1 
ATOM   2340 N N     . ILE E 3 143 ? 28.953 50.773 -14.457 1.00 6.00  ? 143 ILE A N     1 
ATOM   2341 C CA    . ILE E 3 143 ? 27.703 51.012 -15.220 1.00 7.73  ? 143 ILE A CA    1 
ATOM   2342 C C     . ILE E 3 143 ? 26.770 49.791 -15.148 1.00 9.65  ? 143 ILE A C     1 
ATOM   2343 O O     . ILE E 3 143 ? 25.544 49.918 -15.030 1.00 6.00  ? 143 ILE A O     1 
ATOM   2344 C CB    . ILE E 3 143 ? 27.948 51.336 -16.769 1.00 7.82  ? 143 ILE A CB    1 
ATOM   2345 C CG1   . ILE E 3 143 ? 28.830 52.591 -16.955 1.00 13.46 ? 143 ILE A CG1   1 
ATOM   2346 C CG2   . ILE E 3 143 ? 26.582 51.493 -17.464 1.00 6.00  ? 143 ILE A CG2   1 
ATOM   2347 C CD1   . ILE E 3 143 ? 28.448 53.535 -18.102 1.00 6.00  ? 143 ILE A CD1   1 
ATOM   2348 N N     . ALA E 3 144 ? 27.364 48.606 -15.227 1.00 13.92 ? 144 ALA A N     1 
ATOM   2349 C CA    . ALA E 3 144 ? 26.631 47.346 -15.152 1.00 17.02 ? 144 ALA A CA    1 
ATOM   2350 C C     . ALA E 3 144 ? 26.000 47.185 -13.776 1.00 15.78 ? 144 ALA A C     1 
ATOM   2351 O O     . ALA E 3 144 ? 24.772 46.965 -13.670 1.00 14.89 ? 144 ALA A O     1 
ATOM   2352 C CB    . ALA E 3 144 ? 27.576 46.183 -15.438 1.00 21.89 ? 144 ALA A CB    1 
ATOM   2353 N N     . GLN E 3 145 ? 26.814 47.385 -12.730 1.00 13.13 ? 145 GLN A N     1 
ATOM   2354 C CA    . GLN E 3 145 ? 26.331 47.247 -11.357 1.00 16.61 ? 145 GLN A CA    1 
ATOM   2355 C C     . GLN E 3 145 ? 25.245 48.251 -11.061 1.00 17.48 ? 145 GLN A C     1 
ATOM   2356 O O     . GLN E 3 145 ? 24.175 47.884 -10.569 1.00 19.83 ? 145 GLN A O     1 
ATOM   2357 C CB    . GLN E 3 145 ? 27.450 47.424 -10.337 1.00 15.77 ? 145 GLN A CB    1 
ATOM   2358 C CG    . GLN E 3 145 ? 27.469 46.293 -9.293  1.00 18.05 ? 145 GLN A CG    1 
ATOM   2359 C CD    . GLN E 3 145 ? 28.576 45.275 -9.566  1.00 26.43 ? 145 GLN A CD    1 
ATOM   2360 O OE1   . GLN E 3 145 ? 29.682 45.640 -9.975  1.00 22.20 ? 145 GLN A OE1   1 
ATOM   2361 N NE2   . GLN E 3 145 ? 28.293 44.002 -9.314  1.00 18.66 ? 145 GLN A NE2   1 
ATOM   2362 N N     . THR E 3 146 ? 25.496 49.515 -11.380 1.00 18.75 ? 146 THR A N     1 
ATOM   2363 C CA    . THR E 3 146 ? 24.480 50.555 -11.188 1.00 15.35 ? 146 THR A CA    1 
ATOM   2364 C C     . THR E 3 146 ? 23.092 50.222 -11.774 1.00 12.66 ? 146 THR A C     1 
ATOM   2365 O O     . THR E 3 146 ? 22.116 50.234 -11.023 1.00 10.39 ? 146 THR A O     1 
ATOM   2366 C CB    . THR E 3 146 ? 24.961 51.868 -11.778 1.00 7.37  ? 146 THR A CB    1 
ATOM   2367 O OG1   . THR E 3 146 ? 26.027 52.372 -10.969 1.00 6.00  ? 146 THR A OG1   1 
ATOM   2368 C CG2   . THR E 3 146 ? 23.833 52.861 -11.857 1.00 13.43 ? 146 THR A CG2   1 
ATOM   2369 N N     . LEU E 3 147 ? 23.002 49.934 -13.078 1.00 9.63  ? 147 LEU A N     1 
ATOM   2370 C CA    . LEU E 3 147 ? 21.724 49.595 -13.695 1.00 6.00  ? 147 LEU A CA    1 
ATOM   2371 C C     . LEU E 3 147 ? 21.116 48.428 -12.906 1.00 6.98  ? 147 LEU A C     1 
ATOM   2372 O O     . LEU E 3 147 ? 19.886 48.359 -12.690 1.00 6.19  ? 147 LEU A O     1 
ATOM   2373 C CB    . LEU E 3 147 ? 21.949 49.206 -15.148 1.00 6.00  ? 147 LEU A CB    1 
ATOM   2374 C CG    . LEU E 3 147 ? 22.244 50.358 -16.105 1.00 7.91  ? 147 LEU A CG    1 
ATOM   2375 C CD1   . LEU E 3 147 ? 23.256 49.903 -17.106 1.00 21.40 ? 147 LEU A CD1   1 
ATOM   2376 C CD2   . LEU E 3 147 ? 20.974 50.804 -16.822 1.00 8.06  ? 147 LEU A CD2   1 
ATOM   2377 N N     . LEU E 3 148 ? 21.988 47.545 -12.417 1.00 11.09 ? 148 LEU A N     1 
ATOM   2378 C CA    . LEU E 3 148 ? 21.544 46.458 -11.582 1.00 12.14 ? 148 LEU A CA    1 
ATOM   2379 C C     . LEU E 3 148 ? 20.867 47.019 -10.327 1.00 17.11 ? 148 LEU A C     1 
ATOM   2380 O O     . LEU E 3 148 ? 19.683 46.768 -10.144 1.00 18.43 ? 148 LEU A O     1 
ATOM   2381 C CB    . LEU E 3 148 ? 22.728 45.592 -11.229 1.00 7.07  ? 148 LEU A CB    1 
ATOM   2382 C CG    . LEU E 3 148 ? 22.515 44.465 -10.233 1.00 16.32 ? 148 LEU A CG    1 
ATOM   2383 C CD1   . LEU E 3 148 ? 21.329 43.593 -10.626 1.00 14.74 ? 148 LEU A CD1   1 
ATOM   2384 C CD2   . LEU E 3 148 ? 23.808 43.657 -10.183 1.00 21.37 ? 148 LEU A CD2   1 
ATOM   2385 N N     . ASN E 3 149 ? 21.559 47.865 -9.539  1.00 22.06 ? 149 ASN A N     1 
ATOM   2386 C CA    . ASN E 3 149 ? 20.979 48.536 -8.329  1.00 15.17 ? 149 ASN A CA    1 
ATOM   2387 C C     . ASN E 3 149 ? 19.727 49.395 -8.553  1.00 14.07 ? 149 ASN A C     1 
ATOM   2388 O O     . ASN E 3 149 ? 18.725 49.253 -7.842  1.00 16.64 ? 149 ASN A O     1 
ATOM   2389 C CB    . ASN E 3 149 ? 22.012 49.427 -7.642  1.00 9.00  ? 149 ASN A CB    1 
ATOM   2390 C CG    . ASN E 3 149 ? 23.029 48.632 -6.869  1.00 23.37 ? 149 ASN A CG    1 
ATOM   2391 O OD1   . ASN E 3 149 ? 22.717 48.012 -5.838  1.00 35.79 ? 149 ASN A OD1   1 
ATOM   2392 N ND2   . ASN E 3 149 ? 24.258 48.618 -7.362  1.00 28.49 ? 149 ASN A ND2   1 
ATOM   2393 N N     . LEU E 3 150 ? 19.752 50.283 -9.537  1.00 15.02 ? 150 LEU A N     1 
ATOM   2394 C CA    . LEU E 3 150 ? 18.571 51.111 -9.796  1.00 19.13 ? 150 LEU A CA    1 
ATOM   2395 C C     . LEU E 3 150 ? 17.378 50.229 -10.175 1.00 15.28 ? 150 LEU A C     1 
ATOM   2396 O O     . LEU E 3 150 ? 16.256 50.500 -9.746  1.00 18.28 ? 150 LEU A O     1 
ATOM   2397 C CB    . LEU E 3 150 ? 18.826 52.145 -10.930 1.00 18.56 ? 150 LEU A CB    1 
ATOM   2398 C CG    . LEU E 3 150 ? 19.685 53.392 -10.700 1.00 11.46 ? 150 LEU A CG    1 
ATOM   2399 C CD1   . LEU E 3 150 ? 21.016 53.015 -10.143 1.00 7.57  ? 150 LEU A CD1   1 
ATOM   2400 C CD2   . LEU E 3 150 ? 19.893 54.099 -12.025 1.00 18.28 ? 150 LEU A CD2   1 
ATOM   2401 N N     . ALA E 3 151 ? 17.608 49.141 -10.914 1.00 9.38  ? 151 ALA A N     1 
ATOM   2402 C CA    . ALA E 3 151 ? 16.474 48.316 -11.324 1.00 11.44 ? 151 ALA A CA    1 
ATOM   2403 C C     . ALA E 3 151 ? 15.895 47.608 -10.119 1.00 16.37 ? 151 ALA A C     1 
ATOM   2404 O O     . ALA E 3 151 ? 14.802 47.057 -10.200 1.00 25.74 ? 151 ALA A O     1 
ATOM   2405 C CB    . ALA E 3 151 ? 16.912 47.308 -12.367 1.00 7.22  ? 151 ALA A CB    1 
ATOM   2406 N N     . LYS E 3 152 ? 16.596 47.736 -8.989  1.00 22.17 ? 152 LYS A N     1 
ATOM   2407 C CA    . LYS E 3 152 ? 16.306 47.055 -7.720  1.00 23.36 ? 152 LYS A CA    1 
ATOM   2408 C C     . LYS E 3 152 ? 15.815 48.019 -6.645  1.00 17.95 ? 152 LYS A C     1 
ATOM   2409 O O     . LYS E 3 152 ? 15.872 47.703 -5.462  1.00 21.56 ? 152 LYS A O     1 
ATOM   2410 C CB    . LYS E 3 152 ? 17.592 46.353 -7.246  1.00 18.96 ? 152 LYS A CB    1 
ATOM   2411 C CG    . LYS E 3 152 ? 17.472 45.146 -6.315  1.00 11.46 ? 152 LYS A CG    1 
ATOM   2412 C CD    . LYS E 3 152 ? 18.827 44.334 -6.290  1.00 6.00  ? 152 LYS A CD    1 
ATOM   2413 C CE    . LYS E 3 152 ? 20.024 45.180 -5.792  1.00 12.61 ? 152 LYS A CE    1 
ATOM   2414 N NZ    . LYS E 3 152 ? 21.402 44.693 -6.179  1.00 9.44  ? 152 LYS A NZ    1 
ATOM   2415 N N     . GLN E 3 153 ? 15.361 49.192 -7.051  1.00 18.60 ? 153 GLN A N     1 
ATOM   2416 C CA    . GLN E 3 153 ? 14.875 50.212 -6.122  1.00 19.10 ? 153 GLN A CA    1 
ATOM   2417 C C     . GLN E 3 153 ? 13.458 50.499 -6.601  1.00 15.34 ? 153 GLN A C     1 
ATOM   2418 O O     . GLN E 3 153 ? 13.072 50.057 -7.690  1.00 15.96 ? 153 GLN A O     1 
ATOM   2419 C CB    . GLN E 3 153 ? 15.773 51.506 -6.174  1.00 25.35 ? 153 GLN A CB    1 
ATOM   2420 C CG    . GLN E 3 153 ? 14.981 52.906 -6.213  1.00 37.00 ? 153 GLN A CG    1 
ATOM   2421 C CD    . GLN E 3 153 ? 15.613 54.189 -5.528  1.00 31.34 ? 153 GLN A CD    1 
ATOM   2422 O OE1   . GLN E 3 153 ? 15.011 55.274 -5.607  1.00 33.13 ? 153 GLN A OE1   1 
ATOM   2423 N NE2   . GLN E 3 153 ? 16.773 54.067 -4.889  1.00 23.47 ? 153 GLN A NE2   1 
ATOM   2424 N N     . PRO E 3 154 ? 12.646 51.188 -5.775  1.00 10.71 ? 154 PRO A N     1 
ATOM   2425 C CA    . PRO E 3 154 ? 11.229 51.414 -6.038  1.00 9.44  ? 154 PRO A CA    1 
ATOM   2426 C C     . PRO E 3 154 ? 10.712 52.118 -7.287  1.00 16.71 ? 154 PRO A C     1 
ATOM   2427 O O     . PRO E 3 154 ? 9.621  51.808 -7.758  1.00 10.57 ? 154 PRO A O     1 
ATOM   2428 C CB    . PRO E 3 154 ? 10.772 52.085 -4.778  1.00 8.88  ? 154 PRO A CB    1 
ATOM   2429 C CG    . PRO E 3 154 ? 11.496 51.298 -3.758  1.00 14.84 ? 154 PRO A CG    1 
ATOM   2430 C CD    . PRO E 3 154 ? 12.888 51.254 -4.303  1.00 11.86 ? 154 PRO A CD    1 
ATOM   2431 N N     . ASP E 3 155 ? 11.430 53.087 -7.829  1.00 29.57 ? 155 ASP A N     1 
ATOM   2432 C CA    . ASP E 3 155 ? 10.848 53.760 -8.984  1.00 33.96 ? 155 ASP A CA    1 
ATOM   2433 C C     . ASP E 3 155 ? 10.903 52.845 -10.208 1.00 37.22 ? 155 ASP A C     1 
ATOM   2434 O O     . ASP E 3 155 ? 10.175 53.082 -11.174 1.00 38.00 ? 155 ASP A O     1 
ATOM   2435 C CB    . ASP E 3 155 ? 11.559 55.096 -9.256  1.00 26.76 ? 155 ASP A CB    1 
ATOM   2436 C CG    . ASP E 3 155 ? 13.052 54.946 -9.465  1.00 28.46 ? 155 ASP A CG    1 
ATOM   2437 O OD1   . ASP E 3 155 ? 13.814 55.090 -8.477  1.00 32.18 ? 155 ASP A OD1   1 
ATOM   2438 O OD2   . ASP E 3 155 ? 13.461 54.730 -10.621 1.00 20.66 ? 155 ASP A OD2   1 
ATOM   2439 N N     . ALA E 3 156 ? 11.709 51.776 -10.122 1.00 33.92 ? 156 ALA A N     1 
ATOM   2440 C CA    . ALA E 3 156 ? 11.882 50.790 -11.201 1.00 33.16 ? 156 ALA A CA    1 
ATOM   2441 C C     . ALA E 3 156 ? 10.533 50.204 -11.534 1.00 33.39 ? 156 ALA A C     1 
ATOM   2442 O O     . ALA E 3 156 ? 9.794  49.858 -10.617 1.00 31.40 ? 156 ALA A O     1 
ATOM   2443 C CB    . ALA E 3 156 ? 12.842 49.653 -10.749 1.00 35.76 ? 156 ALA A CB    1 
ATOM   2444 N N     . MET E 3 157 ? 10.177 50.117 -12.817 1.00 34.26 ? 157 MET A N     1 
ATOM   2445 C CA    . MET E 3 157 ? 8.884  49.529 -13.174 1.00 33.32 ? 157 MET A CA    1 
ATOM   2446 C C     . MET E 3 157 ? 9.088  48.237 -13.931 1.00 31.36 ? 157 MET A C     1 
ATOM   2447 O O     . MET E 3 157 ? 9.685  48.213 -15.006 1.00 34.68 ? 157 MET A O     1 
ATOM   2448 C CB    . MET E 3 157 ? 8.029  50.473 -14.032 1.00 39.72 ? 157 MET A CB    1 
ATOM   2449 C CG    . MET E 3 157 ? 8.156  51.955 -13.712 1.00 45.58 ? 157 MET A CG    1 
ATOM   2450 S SD    . MET E 3 157 ? 9.669  52.591 -14.491 1.00 60.68 ? 157 MET A SD    1 
ATOM   2451 C CE    . MET E 3 157 ? 9.789  54.260 -13.773 1.00 58.53 ? 157 MET A CE    1 
ATOM   2452 N N     . THR E 3 158 ? 8.692  47.159 -13.268 1.00 29.52 ? 158 THR A N     1 
ATOM   2453 C CA    . THR E 3 158 ? 8.652  45.804 -13.795 1.00 27.13 ? 158 THR A CA    1 
ATOM   2454 C C     . THR E 3 158 ? 8.164  45.789 -15.248 1.00 19.40 ? 158 THR A C     1 
ATOM   2455 O O     . THR E 3 158 ? 7.177  46.432 -15.616 1.00 20.17 ? 158 THR A O     1 
ATOM   2456 C CB    . THR E 3 158 ? 7.705  44.934 -12.898 1.00 31.91 ? 158 THR A CB    1 
ATOM   2457 O OG1   . THR E 3 158 ? 6.740  45.782 -12.244 1.00 22.70 ? 158 THR A OG1   1 
ATOM   2458 C CG2   . THR E 3 158 ? 8.489  44.205 -11.799 1.00 29.03 ? 158 THR A CG2   1 
ATOM   2459 N N     . HIS E 3 159 ? 8.882  45.065 -16.077 1.00 22.45 ? 159 HIS A N     1 
ATOM   2460 C CA    . HIS E 3 159 ? 8.618  45.031 -17.502 1.00 32.50 ? 159 HIS A CA    1 
ATOM   2461 C C     . HIS E 3 159 ? 8.619  43.558 -17.898 1.00 39.50 ? 159 HIS A C     1 
ATOM   2462 O O     . HIS E 3 159 ? 9.312  42.771 -17.257 1.00 47.92 ? 159 HIS A O     1 
ATOM   2463 C CB    . HIS E 3 159 ? 9.733  45.794 -18.203 1.00 42.49 ? 159 HIS A CB    1 
ATOM   2464 C CG    . HIS E 3 159 ? 9.548  45.930 -19.678 1.00 50.95 ? 159 HIS A CG    1 
ATOM   2465 N ND1   . HIS E 3 159 ? 10.298 45.217 -20.587 1.00 51.39 ? 159 HIS A ND1   1 
ATOM   2466 C CD2   . HIS E 3 159 ? 8.708  46.709 -20.405 1.00 57.69 ? 159 HIS A CD2   1 
ATOM   2467 C CE1   . HIS E 3 159 ? 9.927  45.551 -21.812 1.00 58.09 ? 159 HIS A CE1   1 
ATOM   2468 N NE2   . HIS E 3 159 ? 8.964  46.454 -21.731 1.00 55.02 ? 159 HIS A NE2   1 
ATOM   2469 H HD1   . HIS E 3 159 ? 11.069 44.634 -20.316 1.00 0.00  ? 159 HIS A HD1   1 
ATOM   2470 N N     . PRO E 3 160 ? 7.841  43.156 -18.941 1.00 38.59 ? 160 PRO A N     1 
ATOM   2471 C CA    . PRO E 3 160 ? 7.823  41.827 -19.565 1.00 37.65 ? 160 PRO A CA    1 
ATOM   2472 C C     . PRO E 3 160 ? 9.123  41.053 -19.529 1.00 39.86 ? 160 PRO A C     1 
ATOM   2473 O O     . PRO E 3 160 ? 9.135  39.818 -19.497 1.00 53.25 ? 160 PRO A O     1 
ATOM   2474 C CB    . PRO E 3 160 ? 7.345  42.135 -20.966 1.00 40.41 ? 160 PRO A CB    1 
ATOM   2475 C CG    . PRO E 3 160 ? 6.200  43.035 -20.672 1.00 45.01 ? 160 PRO A CG    1 
ATOM   2476 C CD    . PRO E 3 160 ? 6.750  43.971 -19.558 1.00 46.21 ? 160 PRO A CD    1 
ATOM   2477 N N     . ASP E 3 161 ? 10.214 41.789 -19.584 1.00 35.42 ? 161 ASP A N     1 
ATOM   2478 C CA    . ASP E 3 161 ? 11.526 41.230 -19.393 1.00 35.30 ? 161 ASP A CA    1 
ATOM   2479 C C     . ASP E 3 161 ? 12.187 42.358 -18.635 1.00 39.25 ? 161 ASP A C     1 
ATOM   2480 O O     . ASP E 3 161 ? 11.903 43.558 -18.896 1.00 41.11 ? 161 ASP A O     1 
ATOM   2481 C CB    . ASP E 3 161 ? 12.206 40.992 -20.734 1.00 35.26 ? 161 ASP A CB    1 
ATOM   2482 C CG    . ASP E 3 161 ? 12.214 42.229 -21.609 1.00 34.23 ? 161 ASP A CG    1 
ATOM   2483 O OD1   . ASP E 3 161 ? 11.237 42.457 -22.360 1.00 34.13 ? 161 ASP A OD1   1 
ATOM   2484 O OD2   . ASP E 3 161 ? 13.194 42.985 -21.518 1.00 35.90 ? 161 ASP A OD2   1 
ATOM   2485 N N     . GLY E 3 162 ? 13.025 41.979 -17.680 1.00 42.57 ? 162 GLY A N     1 
ATOM   2486 C CA    . GLY E 3 162 ? 13.697 42.949 -16.838 1.00 39.43 ? 162 GLY A CA    1 
ATOM   2487 C C     . GLY E 3 162 ? 12.843 44.014 -16.173 1.00 36.32 ? 162 GLY A C     1 
ATOM   2488 O O     . GLY E 3 162 ? 11.606 43.962 -16.137 1.00 32.57 ? 162 GLY A O     1 
ATOM   2489 N N     . MET E 3 163 ? 13.546 44.976 -15.606 1.00 32.35 ? 163 MET A N     1 
ATOM   2490 C CA    . MET E 3 163 ? 12.948 46.122 -14.948 1.00 32.21 ? 163 MET A CA    1 
ATOM   2491 C C     . MET E 3 163 ? 13.360 47.357 -15.771 1.00 32.35 ? 163 MET A C     1 
ATOM   2492 O O     . MET E 3 163 ? 14.516 47.462 -16.206 1.00 35.98 ? 163 MET A O     1 
ATOM   2493 C CB    . MET E 3 163 ? 13.490 46.229 -13.519 1.00 21.24 ? 163 MET A CB    1 
ATOM   2494 C CG    . MET E 3 163 ? 13.056 45.106 -12.636 1.00 16.44 ? 163 MET A CG    1 
ATOM   2495 S SD    . MET E 3 163 ? 11.363 45.302 -12.065 1.00 31.17 ? 163 MET A SD    1 
ATOM   2496 C CE    . MET E 3 163 ? 11.678 45.543 -10.107 1.00 6.00  ? 163 MET A CE    1 
ATOM   2497 N N     . GLN E 3 164 ? 12.419 48.248 -16.065 1.00 30.56 ? 164 GLN A N     1 
ATOM   2498 C CA    . GLN E 3 164 ? 12.801 49.465 -16.749 1.00 26.65 ? 164 GLN A CA    1 
ATOM   2499 C C     . GLN E 3 164 ? 12.889 50.512 -15.668 1.00 23.62 ? 164 GLN A C     1 
ATOM   2500 O O     . GLN E 3 164 ? 12.259 50.354 -14.603 1.00 6.00  ? 164 GLN A O     1 
ATOM   2501 C CB    . GLN E 3 164 ? 11.777 49.847 -17.820 1.00 22.41 ? 164 GLN A CB    1 
ATOM   2502 C CG    . GLN E 3 164 ? 10.596 50.637 -17.340 1.00 33.64 ? 164 GLN A CG    1 
ATOM   2503 C CD    . GLN E 3 164 ? 10.324 51.831 -18.230 1.00 33.91 ? 164 GLN A CD    1 
ATOM   2504 O OE1   . GLN E 3 164 ? 11.030 52.841 -18.143 1.00 45.84 ? 164 GLN A OE1   1 
ATOM   2505 N NE2   . GLN E 3 164 ? 9.311  51.725 -19.104 1.00 24.42 ? 164 GLN A NE2   1 
ATOM   2506 N N     . ILE E 3 165 ? 13.647 51.573 -15.964 1.00 23.19 ? 165 ILE A N     1 
ATOM   2507 C CA    . ILE E 3 165 ? 14.028 52.598 -14.997 1.00 21.31 ? 165 ILE A CA    1 
ATOM   2508 C C     . ILE E 3 165 ? 14.273 53.983 -15.643 1.00 23.55 ? 165 ILE A C     1 
ATOM   2509 O O     . ILE E 3 165 ? 15.403 54.302 -16.022 1.00 25.54 ? 165 ILE A O     1 
ATOM   2510 C CB    . ILE E 3 165 ? 15.349 52.168 -14.247 1.00 23.97 ? 165 ILE A CB    1 
ATOM   2511 C CG1   . ILE E 3 165 ? 16.471 51.844 -15.235 1.00 11.27 ? 165 ILE A CG1   1 
ATOM   2512 C CG2   . ILE E 3 165 ? 15.144 50.905 -13.491 1.00 23.49 ? 165 ILE A CG2   1 
ATOM   2513 C CD1   . ILE E 3 165 ? 17.755 52.549 -14.899 1.00 6.90  ? 165 ILE A CD1   1 
ATOM   2514 N N     . LYS E 3 166 ? 13.245 54.818 -15.748 1.00 26.56 ? 166 LYS A N     1 
ATOM   2515 C CA    . LYS E 3 166 ? 13.384 56.155 -16.357 1.00 25.36 ? 166 LYS A CA    1 
ATOM   2516 C C     . LYS E 3 166 ? 14.518 56.934 -15.692 1.00 21.06 ? 166 LYS A C     1 
ATOM   2517 O O     . LYS E 3 166 ? 14.415 57.270 -14.518 1.00 26.55 ? 166 LYS A O     1 
ATOM   2518 C CB    . LYS E 3 166 ? 12.070 56.954 -16.217 1.00 25.93 ? 166 LYS A CB    1 
ATOM   2519 C CG    . LYS E 3 166 ? 11.431 57.492 -17.544 1.00 34.23 ? 166 LYS A CG    1 
ATOM   2520 C CD    . LYS E 3 166 ? 10.149 58.367 -17.311 1.00 34.14 ? 166 LYS A CD    1 
ATOM   2521 C CE    . LYS E 3 166 ? 10.479 59.679 -16.517 1.00 41.75 ? 166 LYS A CE    1 
ATOM   2522 N NZ    . LYS E 3 166 ? 9.354  60.386 -15.767 1.00 26.16 ? 166 LYS A NZ    1 
ATOM   2523 N N     . ILE E 3 167 ? 15.623 57.132 -16.406 1.00 18.60 ? 167 ILE A N     1 
ATOM   2524 C CA    . ILE E 3 167 ? 16.756 57.914 -15.907 1.00 13.05 ? 167 ILE A CA    1 
ATOM   2525 C C     . ILE E 3 167 ? 17.485 58.430 -17.177 1.00 15.31 ? 167 ILE A C     1 
ATOM   2526 O O     . ILE E 3 167 ? 16.884 58.375 -18.258 1.00 18.26 ? 167 ILE A O     1 
ATOM   2527 C CB    . ILE E 3 167 ? 17.714 57.058 -14.980 1.00 6.00  ? 167 ILE A CB    1 
ATOM   2528 C CG1   . ILE E 3 167 ? 18.529 58.017 -14.107 1.00 6.00  ? 167 ILE A CG1   1 
ATOM   2529 C CG2   . ILE E 3 167 ? 18.607 56.139 -15.797 1.00 6.00  ? 167 ILE A CG2   1 
ATOM   2530 C CD1   . ILE E 3 167 ? 19.620 57.423 -13.229 1.00 6.00  ? 167 ILE A CD1   1 
ATOM   2531 N N     . THR E 3 168 ? 18.721 58.943 -17.077 1.00 7.86  ? 168 THR A N     1 
ATOM   2532 C CA    . THR E 3 168 ? 19.371 59.517 -18.235 1.00 6.00  ? 168 THR A CA    1 
ATOM   2533 C C     . THR E 3 168 ? 20.893 59.399 -18.176 1.00 9.31  ? 168 THR A C     1 
ATOM   2534 O O     . THR E 3 168 ? 21.443 59.448 -17.095 1.00 15.56 ? 168 THR A O     1 
ATOM   2535 C CB    . THR E 3 168 ? 18.977 60.986 -18.338 1.00 11.06 ? 168 THR A CB    1 
ATOM   2536 O OG1   . THR E 3 168 ? 18.853 61.330 -19.721 1.00 18.68 ? 168 THR A OG1   1 
ATOM   2537 C CG2   . THR E 3 168 ? 20.047 61.894 -17.659 1.00 14.70 ? 168 THR A CG2   1 
ATOM   2538 N N     . ARG E 3 169 ? 21.561 59.349 -19.339 1.00 9.69  ? 169 ARG A N     1 
ATOM   2539 C CA    . ARG E 3 169 ? 23.033 59.197 -19.479 1.00 6.00  ? 169 ARG A CA    1 
ATOM   2540 C C     . ARG E 3 169 ? 23.836 60.139 -18.594 1.00 11.94 ? 169 ARG A C     1 
ATOM   2541 O O     . ARG E 3 169 ? 24.868 59.748 -18.043 1.00 16.02 ? 169 ARG A O     1 
ATOM   2542 C CB    . ARG E 3 169 ? 23.516 59.476 -20.909 1.00 10.17 ? 169 ARG A CB    1 
ATOM   2543 C CG    . ARG E 3 169 ? 23.143 58.500 -22.018 1.00 12.86 ? 169 ARG A CG    1 
ATOM   2544 C CD    . ARG E 3 169 ? 21.650 58.354 -22.213 1.00 6.00  ? 169 ARG A CD    1 
ATOM   2545 N NE    . ARG E 3 169 ? 21.362 57.609 -23.416 1.00 6.00  ? 169 ARG A NE    1 
ATOM   2546 C CZ    . ARG E 3 169 ? 20.148 57.222 -23.777 1.00 11.00 ? 169 ARG A CZ    1 
ATOM   2547 N NH1   . ARG E 3 169 ? 19.071 57.489 -23.033 1.00 6.00  ? 169 ARG A NH1   1 
ATOM   2548 N NH2   . ARG E 3 169 ? 20.006 56.590 -24.929 1.00 27.21 ? 169 ARG A NH2   1 
ATOM   2549 N N     . GLN E 3 170 ? 23.402 61.398 -18.525 1.00 17.19 ? 170 GLN A N     1 
ATOM   2550 C CA    . GLN E 3 170 ? 24.081 62.417 -17.701 1.00 21.39 ? 170 GLN A CA    1 
ATOM   2551 C C     . GLN E 3 170 ? 24.096 61.891 -16.249 1.00 19.24 ? 170 GLN A C     1 
ATOM   2552 O O     . GLN E 3 170 ? 25.154 61.850 -15.638 1.00 10.44 ? 170 GLN A O     1 
ATOM   2553 C CB    . GLN E 3 170 ? 23.347 63.806 -17.793 1.00 22.63 ? 170 GLN A CB    1 
ATOM   2554 C CG    . GLN E 3 170 ? 24.195 65.048 -18.288 1.00 9.70  ? 170 GLN A CG    1 
ATOM   2555 C CD    . GLN E 3 170 ? 23.331 66.296 -18.780 1.00 16.96 ? 170 GLN A CD    1 
ATOM   2556 O OE1   . GLN E 3 170 ? 23.663 66.966 -19.777 1.00 6.23  ? 170 GLN A OE1   1 
ATOM   2557 N NE2   . GLN E 3 170 ? 22.239 66.587 -18.076 1.00 10.73 ? 170 GLN A NE2   1 
ATOM   2558 N N     . GLU E 3 171 ? 22.969 61.340 -15.770 1.00 16.38 ? 171 GLU A N     1 
ATOM   2559 C CA    . GLU E 3 171 ? 22.898 60.849 -14.387 1.00 6.34  ? 171 GLU A CA    1 
ATOM   2560 C C     . GLU E 3 171 ? 23.697 59.581 -14.106 1.00 11.88 ? 171 GLU A C     1 
ATOM   2561 O O     . GLU E 3 171 ? 24.306 59.524 -13.043 1.00 12.36 ? 171 GLU A O     1 
ATOM   2562 C CB    . GLU E 3 171 ? 21.440 60.654 -13.934 1.00 6.00  ? 171 GLU A CB    1 
ATOM   2563 C CG    . GLU E 3 171 ? 21.220 61.115 -12.455 1.00 13.00 ? 171 GLU A CG    1 
ATOM   2564 C CD    . GLU E 3 171 ? 19.752 61.463 -12.026 1.00 23.09 ? 171 GLU A CD    1 
ATOM   2565 O OE1   . GLU E 3 171 ? 19.565 61.899 -10.853 1.00 19.58 ? 171 GLU A OE1   1 
ATOM   2566 O OE2   . GLU E 3 171 ? 18.797 61.322 -12.837 1.00 20.62 ? 171 GLU A OE2   1 
ATOM   2567 N N     . ILE E 3 172 ? 23.755 58.592 -15.020 1.00 9.37  ? 172 ILE A N     1 
ATOM   2568 C CA    . ILE E 3 172 ? 24.613 57.434 -14.739 1.00 10.18 ? 172 ILE A CA    1 
ATOM   2569 C C     . ILE E 3 172 ? 26.022 57.985 -14.728 1.00 6.03  ? 172 ILE A C     1 
ATOM   2570 O O     . ILE E 3 172 ? 26.737 57.710 -13.788 1.00 10.60 ? 172 ILE A O     1 
ATOM   2571 C CB    . ILE E 3 172 ? 24.588 56.203 -15.803 1.00 8.91  ? 172 ILE A CB    1 
ATOM   2572 C CG1   . ILE E 3 172 ? 23.564 55.106 -15.477 1.00 6.00  ? 172 ILE A CG1   1 
ATOM   2573 C CG2   . ILE E 3 172 ? 25.826 55.382 -15.624 1.00 6.00  ? 172 ILE A CG2   1 
ATOM   2574 C CD1   . ILE E 3 172 ? 22.131 55.559 -15.317 1.00 16.26 ? 172 ILE A CD1   1 
ATOM   2575 N N     . GLY E 3 173 ? 26.399 58.807 -15.694 1.00 6.00  ? 173 GLY A N     1 
ATOM   2576 C CA    . GLY E 3 173 ? 27.751 59.312 -15.682 1.00 6.00  ? 173 GLY A CA    1 
ATOM   2577 C C     . GLY E 3 173 ? 28.060 59.905 -14.325 1.00 9.18  ? 173 GLY A C     1 
ATOM   2578 O O     . GLY E 3 173 ? 29.147 59.720 -13.788 1.00 6.00  ? 173 GLY A O     1 
ATOM   2579 N N     . GLN E 3 174 ? 27.043 60.537 -13.740 1.00 10.64 ? 174 GLN A N     1 
ATOM   2580 C CA    . GLN E 3 174 ? 27.126 61.208 -12.449 1.00 13.44 ? 174 GLN A CA    1 
ATOM   2581 C C     . GLN E 3 174 ? 27.440 60.198 -11.373 1.00 19.29 ? 174 GLN A C     1 
ATOM   2582 O O     . GLN E 3 174 ? 28.547 60.171 -10.836 1.00 26.30 ? 174 GLN A O     1 
ATOM   2583 C CB    . GLN E 3 174 ? 25.793 61.861 -12.135 1.00 14.92 ? 174 GLN A CB    1 
ATOM   2584 C CG    . GLN E 3 174 ? 25.870 63.213 -11.525 1.00 22.54 ? 174 GLN A CG    1 
ATOM   2585 C CD    . GLN E 3 174 ? 24.788 64.116 -12.074 1.00 24.16 ? 174 GLN A CD    1 
ATOM   2586 O OE1   . GLN E 3 174 ? 25.079 65.117 -12.720 1.00 28.60 ? 174 GLN A OE1   1 
ATOM   2587 N NE2   . GLN E 3 174 ? 23.529 63.761 -11.834 1.00 23.06 ? 174 GLN A NE2   1 
ATOM   2588 N N     . ILE E 3 175 ? 26.465 59.310 -11.149 1.00 21.18 ? 175 ILE A N     1 
ATOM   2589 C CA    . ILE E 3 175 ? 26.471 58.286 -10.101 1.00 12.16 ? 175 ILE A CA    1 
ATOM   2590 C C     . ILE E 3 175 ? 27.733 57.470 -10.166 1.00 11.48 ? 175 ILE A C     1 
ATOM   2591 O O     . ILE E 3 175 ? 28.330 57.190 -9.134  1.00 9.57  ? 175 ILE A O     1 
ATOM   2592 C CB    . ILE E 3 175 ? 25.245 57.377 -10.243 1.00 7.09  ? 175 ILE A CB    1 
ATOM   2593 C CG1   . ILE E 3 175 ? 23.999 58.234 -10.258 1.00 6.00  ? 175 ILE A CG1   1 
ATOM   2594 C CG2   . ILE E 3 175 ? 25.081 56.484 -9.041  1.00 13.35 ? 175 ILE A CG2   1 
ATOM   2595 C CD1   . ILE E 3 175 ? 22.825 57.543 -10.804 1.00 8.14  ? 175 ILE A CD1   1 
ATOM   2596 N N     . VAL E 3 176 ? 28.117 57.096 -11.386 1.00 22.92 ? 176 VAL A N     1 
ATOM   2597 C CA    . VAL E 3 176 ? 29.360 56.350 -11.701 1.00 20.27 ? 176 VAL A CA    1 
ATOM   2598 C C     . VAL E 3 176 ? 30.612 57.239 -11.467 1.00 19.39 ? 176 VAL A C     1 
ATOM   2599 O O     . VAL E 3 176 ? 31.524 56.865 -10.732 1.00 17.05 ? 176 VAL A O     1 
ATOM   2600 C CB    . VAL E 3 176 ? 29.358 55.873 -13.226 1.00 18.51 ? 176 VAL A CB    1 
ATOM   2601 C CG1   . VAL E 3 176 ? 30.722 55.407 -13.633 1.00 8.33  ? 176 VAL A CG1   1 
ATOM   2602 C CG2   . VAL E 3 176 ? 28.324 54.793 -13.449 1.00 6.00  ? 176 VAL A CG2   1 
ATOM   2603 N N     . GLY E 3 177 ? 30.611 58.420 -12.088 1.00 12.36 ? 177 GLY A N     1 
ATOM   2604 C CA    . GLY E 3 177 ? 31.774 59.290 -12.114 1.00 11.45 ? 177 GLY A CA    1 
ATOM   2605 C C     . GLY E 3 177 ? 32.529 59.204 -13.436 1.00 14.21 ? 177 GLY A C     1 
ATOM   2606 O O     . GLY E 3 177 ? 33.744 59.005 -13.453 1.00 16.42 ? 177 GLY A O     1 
ATOM   2607 N N     . CYS E 3 178 ? 31.820 59.319 -14.555 1.00 15.30 ? 178 CYS A N     1 
ATOM   2608 C CA    . CYS E 3 178 ? 32.468 59.314 -15.866 1.00 15.97 ? 178 CYS A CA    1 
ATOM   2609 C C     . CYS E 3 178 ? 31.685 60.180 -16.882 1.00 19.55 ? 178 CYS A C     1 
ATOM   2610 O O     . CYS E 3 178 ? 30.449 60.236 -16.816 1.00 13.75 ? 178 CYS A O     1 
ATOM   2611 C CB    . CYS E 3 178 ? 32.567 57.882 -16.379 1.00 15.02 ? 178 CYS A CB    1 
ATOM   2612 S SG    . CYS E 3 178 ? 31.025 57.189 -16.813 1.00 16.62 ? 178 CYS A SG    1 
ATOM   2613 N N     . SER E 3 179 ? 32.417 60.841 -17.799 1.00 17.01 ? 179 SER A N     1 
ATOM   2614 C CA    . SER E 3 179 ? 31.861 61.727 -18.846 1.00 11.55 ? 179 SER A CA    1 
ATOM   2615 C C     . SER E 3 179 ? 30.564 61.200 -19.417 1.00 6.00  ? 179 SER A C     1 
ATOM   2616 O O     . SER E 3 179 ? 30.492 60.027 -19.729 1.00 24.74 ? 179 SER A O     1 
ATOM   2617 C CB    . SER E 3 179 ? 32.884 61.878 -19.991 1.00 12.53 ? 179 SER A CB    1 
ATOM   2618 O OG    . SER E 3 179 ? 32.256 62.198 -21.222 1.00 13.07 ? 179 SER A OG    1 
ATOM   2619 N N     . ARG E 3 180 ? 29.577 62.048 -19.667 1.00 6.63  ? 180 ARG A N     1 
ATOM   2620 C CA    . ARG E 3 180 ? 28.322 61.527 -20.209 1.00 6.00  ? 180 ARG A CA    1 
ATOM   2621 C C     . ARG E 3 180 ? 28.509 60.967 -21.609 1.00 6.00  ? 180 ARG A C     1 
ATOM   2622 O O     . ARG E 3 180 ? 27.645 60.245 -22.117 1.00 15.62 ? 180 ARG A O     1 
ATOM   2623 C CB    . ARG E 3 180 ? 27.237 62.597 -20.222 1.00 6.79  ? 180 ARG A CB    1 
ATOM   2624 C CG    . ARG E 3 180 ? 27.621 63.836 -20.958 1.00 16.15 ? 180 ARG A CG    1 
ATOM   2625 C CD    . ARG E 3 180 ? 26.433 64.490 -21.640 1.00 28.60 ? 180 ARG A CD    1 
ATOM   2626 N NE    . ARG E 3 180 ? 26.945 65.619 -22.402 1.00 25.37 ? 180 ARG A NE    1 
ATOM   2627 C CZ    . ARG E 3 180 ? 26.850 65.763 -23.719 1.00 21.77 ? 180 ARG A CZ    1 
ATOM   2628 N NH1   . ARG E 3 180 ? 26.209 64.871 -24.479 1.00 8.63  ? 180 ARG A NH1   1 
ATOM   2629 N NH2   . ARG E 3 180 ? 27.573 66.721 -24.283 1.00 10.02 ? 180 ARG A NH2   1 
ATOM   2630 N N     . PHE E 3 181 ? 29.663 61.235 -22.213 1.00 6.00  ? 181 PHE A N     1 
ATOM   2631 C CA    . PHE E 3 181 ? 29.963 60.625 -23.503 1.00 13.51 ? 181 PHE A CA    1 
ATOM   2632 C C     . PHE E 3 181 ? 30.167 59.130 -23.334 1.00 13.57 ? 181 PHE A C     1 
ATOM   2633 O O     . PHE E 3 181 ? 29.631 58.362 -24.108 1.00 19.68 ? 181 PHE A O     1 
ATOM   2634 C CB    . PHE E 3 181 ? 31.222 61.243 -24.125 1.00 12.32 ? 181 PHE A CB    1 
ATOM   2635 C CG    . PHE E 3 181 ? 31.046 62.640 -24.495 1.00 16.55 ? 181 PHE A CG    1 
ATOM   2636 C CD1   . PHE E 3 181 ? 29.898 63.032 -25.193 1.00 19.90 ? 181 PHE A CD1   1 
ATOM   2637 C CD2   . PHE E 3 181 ? 31.907 63.604 -24.005 1.00 25.24 ? 181 PHE A CD2   1 
ATOM   2638 C CE1   . PHE E 3 181 ? 29.594 64.361 -25.386 1.00 21.87 ? 181 PHE A CE1   1 
ATOM   2639 C CE2   . PHE E 3 181 ? 31.614 64.958 -24.191 1.00 22.93 ? 181 PHE A CE2   1 
ATOM   2640 C CZ    . PHE E 3 181 ? 30.452 65.336 -24.881 1.00 17.81 ? 181 PHE A CZ    1 
ATOM   2641 N N     . THR E 3 182 ? 30.928 58.747 -22.307 1.00 11.24 ? 182 THR A N     1 
ATOM   2642 C CA    . THR E 3 182 ? 31.271 57.382 -21.994 1.00 6.93  ? 182 THR A CA    1 
ATOM   2643 C C     . THR E 3 182 ? 30.020 56.602 -21.490 1.00 18.10 ? 182 THR A C     1 
ATOM   2644 O O     . THR E 3 182 ? 29.870 55.398 -21.810 1.00 31.54 ? 182 THR A O     1 
ATOM   2645 C CB    . THR E 3 182 ? 32.437 57.379 -20.942 1.00 13.17 ? 182 THR A CB    1 
ATOM   2646 O OG1   . THR E 3 182 ? 33.587 58.042 -21.496 1.00 9.71  ? 182 THR A OG1   1 
ATOM   2647 C CG2   . THR E 3 182 ? 32.826 55.946 -20.533 1.00 14.45 ? 182 THR A CG2   1 
ATOM   2648 N N     . VAL E 3 183 ? 29.081 57.237 -20.774 1.00 16.23 ? 183 VAL A N     1 
ATOM   2649 C CA    . VAL E 3 183 ? 27.827 56.514 -20.474 1.00 18.60 ? 183 VAL A CA    1 
ATOM   2650 C C     . VAL E 3 183 ? 27.095 56.261 -21.811 1.00 18.11 ? 183 VAL A C     1 
ATOM   2651 O O     . VAL E 3 183 ? 26.394 55.252 -22.005 1.00 14.54 ? 183 VAL A O     1 
ATOM   2652 C CB    . VAL E 3 183 ? 26.925 57.328 -19.505 1.00 15.54 ? 183 VAL A CB    1 
ATOM   2653 C CG1   . VAL E 3 183 ? 25.575 56.620 -19.220 1.00 6.00  ? 183 VAL A CG1   1 
ATOM   2654 C CG2   . VAL E 3 183 ? 27.660 57.473 -18.242 1.00 20.49 ? 183 VAL A CG2   1 
ATOM   2655 N N     . GLY E 3 184 ? 27.384 57.146 -22.757 1.00 24.32 ? 184 GLY A N     1 
ATOM   2656 C CA    . GLY E 3 184 ? 26.805 57.103 -24.090 1.00 20.85 ? 184 GLY A CA    1 
ATOM   2657 C C     . GLY E 3 184 ? 27.000 55.839 -24.871 1.00 10.05 ? 184 GLY A C     1 
ATOM   2658 O O     . GLY E 3 184 ? 25.992 55.259 -25.269 1.00 13.56 ? 184 GLY A O     1 
ATOM   2659 N N     . ARG E 3 185 ? 28.248 55.432 -25.119 1.00 10.40 ? 185 ARG A N     1 
ATOM   2660 C CA    . ARG E 3 185 ? 28.514 54.205 -25.887 1.00 19.95 ? 185 ARG A CA    1 
ATOM   2661 C C     . ARG E 3 185 ? 28.357 52.917 -25.123 1.00 21.70 ? 185 ARG A C     1 
ATOM   2662 O O     . ARG E 3 185 ? 27.901 51.957 -25.714 1.00 36.31 ? 185 ARG A O     1 
ATOM   2663 C CB    . ARG E 3 185 ? 29.912 54.172 -26.497 1.00 21.10 ? 185 ARG A CB    1 
ATOM   2664 C CG    . ARG E 3 185 ? 30.964 54.979 -25.774 1.00 28.54 ? 185 ARG A CG    1 
ATOM   2665 C CD    . ARG E 3 185 ? 31.271 56.245 -26.572 1.00 29.88 ? 185 ARG A CD    1 
ATOM   2666 N NE    . ARG E 3 185 ? 32.048 57.213 -25.811 1.00 34.58 ? 185 ARG A NE    1 
ATOM   2667 C CZ    . ARG E 3 185 ? 32.630 58.284 -26.342 1.00 36.27 ? 185 ARG A CZ    1 
ATOM   2668 N NH1   . ARG E 3 185 ? 32.506 58.524 -27.644 1.00 34.96 ? 185 ARG A NH1   1 
ATOM   2669 N NH2   . ARG E 3 185 ? 33.410 59.058 -25.586 1.00 24.84 ? 185 ARG A NH2   1 
ATOM   2670 N N     . ILE E 3 186 ? 28.720 52.859 -23.836 1.00 24.29 ? 186 ILE A N     1 
ATOM   2671 C CA    . ILE E 3 186 ? 28.583 51.605 -23.059 1.00 15.00 ? 186 ILE A CA    1 
ATOM   2672 C C     . ILE E 3 186 ? 27.123 51.103 -23.183 1.00 15.80 ? 186 ILE A C     1 
ATOM   2673 O O     . ILE E 3 186 ? 26.869 49.981 -23.617 1.00 13.02 ? 186 ILE A O     1 
ATOM   2674 C CB    . ILE E 3 186 ? 28.996 51.853 -21.548 1.00 13.22 ? 186 ILE A CB    1 
ATOM   2675 C CG1   . ILE E 3 186 ? 30.514 51.842 -21.441 1.00 6.00  ? 186 ILE A CG1   1 
ATOM   2676 C CG2   . ILE E 3 186 ? 28.457 50.747 -20.615 1.00 9.64  ? 186 ILE A CG2   1 
ATOM   2677 C CD1   . ILE E 3 186 ? 31.032 52.378 -20.143 1.00 15.38 ? 186 ILE A CD1   1 
ATOM   2678 N N     . LEU E 3 187 ? 26.184 52.001 -22.936 1.00 6.00  ? 187 LEU A N     1 
ATOM   2679 C CA    . LEU E 3 187 ? 24.778 51.736 -23.087 1.00 6.00  ? 187 LEU A CA    1 
ATOM   2680 C C     . LEU E 3 187 ? 24.417 51.251 -24.488 1.00 7.46  ? 187 LEU A C     1 
ATOM   2681 O O     . LEU E 3 187 ? 23.363 50.655 -24.675 1.00 7.64  ? 187 LEU A O     1 
ATOM   2682 C CB    . LEU E 3 187 ? 23.983 53.018 -22.752 1.00 6.00  ? 187 LEU A CB    1 
ATOM   2683 C CG    . LEU E 3 187 ? 23.320 53.080 -21.376 1.00 6.00  ? 187 LEU A CG    1 
ATOM   2684 C CD1   . LEU E 3 187 ? 24.252 52.453 -20.347 1.00 6.00  ? 187 LEU A CD1   1 
ATOM   2685 C CD2   . LEU E 3 187 ? 23.010 54.475 -21.016 1.00 6.00  ? 187 LEU A CD2   1 
ATOM   2686 N N     . LYS E 3 188 ? 25.219 51.596 -25.489 1.00 13.40 ? 188 LYS A N     1 
ATOM   2687 C CA    . LYS E 3 188 ? 24.936 51.175 -26.861 1.00 21.66 ? 188 LYS A CA    1 
ATOM   2688 C C     . LYS E 3 188 ? 25.618 49.845 -27.203 1.00 28.15 ? 188 LYS A C     1 
ATOM   2689 O O     . LYS E 3 188 ? 25.171 49.124 -28.098 1.00 17.24 ? 188 LYS A O     1 
ATOM   2690 C CB    . LYS E 3 188 ? 25.379 52.255 -27.835 1.00 28.30 ? 188 LYS A CB    1 
ATOM   2691 C CG    . LYS E 3 188 ? 24.255 53.250 -28.198 1.00 36.11 ? 188 LYS A CG    1 
ATOM   2692 C CD    . LYS E 3 188 ? 24.755 54.426 -29.042 1.00 35.58 ? 188 LYS A CD    1 
ATOM   2693 C CE    . LYS E 3 188 ? 25.428 55.465 -28.160 1.00 28.14 ? 188 LYS A CE    1 
ATOM   2694 N NZ    . LYS E 3 188 ? 26.183 56.484 -28.928 1.00 34.30 ? 188 LYS A NZ    1 
ATOM   2695 N N     . MET E 3 189 ? 26.685 49.531 -26.457 1.00 33.81 ? 189 MET A N     1 
ATOM   2696 C CA    . MET E 3 189 ? 27.362 48.244 -26.491 1.00 34.32 ? 189 MET A CA    1 
ATOM   2697 C C     . MET E 3 189 ? 26.438 47.151 -25.920 1.00 31.97 ? 189 MET A C     1 
ATOM   2698 O O     . MET E 3 189 ? 26.003 46.234 -26.651 1.00 32.16 ? 189 MET A O     1 
ATOM   2699 C CB    . MET E 3 189 ? 28.635 48.288 -25.657 1.00 34.74 ? 189 MET A CB    1 
ATOM   2700 C CG    . MET E 3 189 ? 29.893 48.363 -26.483 1.00 43.11 ? 189 MET A CG    1 
ATOM   2701 S SD    . MET E 3 189 ? 31.309 47.664 -25.583 1.00 47.07 ? 189 MET A SD    1 
ATOM   2702 C CE    . MET E 3 189 ? 32.008 49.164 -24.904 1.00 37.40 ? 189 MET A CE    1 
ATOM   2703 N N     . LEU E 3 190 ? 26.097 47.277 -24.635 1.00 19.30 ? 190 LEU A N     1 
ATOM   2704 C CA    . LEU E 3 190 ? 25.242 46.305 -23.967 1.00 9.87  ? 190 LEU A CA    1 
ATOM   2705 C C     . LEU E 3 190 ? 23.883 46.242 -24.681 1.00 8.77  ? 190 LEU A C     1 
ATOM   2706 O O     . LEU E 3 190 ? 23.202 45.220 -24.683 1.00 6.00  ? 190 LEU A O     1 
ATOM   2707 C CB    . LEU E 3 190 ? 25.116 46.691 -22.492 1.00 6.00  ? 190 LEU A CB    1 
ATOM   2708 C CG    . LEU E 3 190 ? 26.394 47.065 -21.709 1.00 6.85  ? 190 LEU A CG    1 
ATOM   2709 C CD1   . LEU E 3 190 ? 26.096 47.104 -20.248 1.00 6.00  ? 190 LEU A CD1   1 
ATOM   2710 C CD2   . LEU E 3 190 ? 27.482 46.051 -21.930 1.00 6.00  ? 190 LEU A CD2   1 
ATOM   2711 N N     . GLU E 3 191 ? 23.542 47.337 -25.352 1.00 25.81 ? 191 GLU A N     1 
ATOM   2712 C CA    . GLU E 3 191 ? 22.373 47.461 -26.264 1.00 27.67 ? 191 GLU A CA    1 
ATOM   2713 C C     . GLU E 3 191 ? 22.504 46.323 -27.299 1.00 26.57 ? 191 GLU A C     1 
ATOM   2714 O O     . GLU E 3 191 ? 21.688 45.397 -27.360 1.00 21.57 ? 191 GLU A O     1 
ATOM   2715 C CB    . GLU E 3 191 ? 22.421 48.855 -26.969 1.00 16.64 ? 191 GLU A CB    1 
ATOM   2716 C CG    . GLU E 3 191 ? 21.413 49.181 -28.090 1.00 14.07 ? 191 GLU A CG    1 
ATOM   2717 C CD    . GLU E 3 191 ? 20.098 49.781 -27.585 1.00 15.13 ? 191 GLU A CD    1 
ATOM   2718 O OE1   . GLU E 3 191 ? 19.220 50.040 -28.420 1.00 13.65 ? 191 GLU A OE1   1 
ATOM   2719 O OE2   . GLU E 3 191 ? 19.927 49.988 -26.364 1.00 19.65 ? 191 GLU A OE2   1 
ATOM   2720 N N     . ASP E 3 192 ? 23.612 46.351 -28.023 1.00 26.24 ? 192 ASP A N     1 
ATOM   2721 C CA    . ASP E 3 192 ? 23.856 45.385 -29.046 1.00 26.54 ? 192 ASP A CA    1 
ATOM   2722 C C     . ASP E 3 192 ? 23.934 43.979 -28.485 1.00 30.37 ? 192 ASP A C     1 
ATOM   2723 O O     . ASP E 3 192 ? 23.232 43.094 -28.985 1.00 42.27 ? 192 ASP A O     1 
ATOM   2724 C CB    . ASP E 3 192 ? 25.113 45.805 -29.786 1.00 28.91 ? 192 ASP A CB    1 
ATOM   2725 C CG    . ASP E 3 192 ? 24.920 47.148 -30.507 1.00 43.05 ? 192 ASP A CG    1 
ATOM   2726 O OD1   . ASP E 3 192 ? 23.745 47.510 -30.846 1.00 35.03 ? 192 ASP A OD1   1 
ATOM   2727 O OD2   . ASP E 3 192 ? 25.941 47.853 -30.713 1.00 52.86 ? 192 ASP A OD2   1 
ATOM   2728 N N     . GLN E 3 193 ? 24.668 43.777 -27.387 1.00 21.49 ? 193 GLN A N     1 
ATOM   2729 C CA    . GLN E 3 193 ? 24.686 42.468 -26.721 1.00 9.12  ? 193 GLN A CA    1 
ATOM   2730 C C     . GLN E 3 193 ? 23.382 42.148 -25.992 1.00 8.29  ? 193 GLN A C     1 
ATOM   2731 O O     . GLN E 3 193 ? 23.424 41.462 -24.997 1.00 18.49 ? 193 GLN A O     1 
ATOM   2732 C CB    . GLN E 3 193 ? 25.802 42.377 -25.682 1.00 6.00  ? 193 GLN A CB    1 
ATOM   2733 C CG    . GLN E 3 193 ? 27.147 42.554 -26.223 1.00 6.00  ? 193 GLN A CG    1 
ATOM   2734 C CD    . GLN E 3 193 ? 28.167 42.859 -25.154 1.00 12.11 ? 193 GLN A CD    1 
ATOM   2735 O OE1   . GLN E 3 193 ? 27.839 43.127 -23.983 1.00 6.60  ? 193 GLN A OE1   1 
ATOM   2736 N NE2   . GLN E 3 193 ? 29.433 42.881 -25.567 1.00 12.45 ? 193 GLN A NE2   1 
ATOM   2737 N N     . ASN E 3 194 ? 22.243 42.692 -26.394 1.00 6.59  ? 194 ASN A N     1 
ATOM   2738 C CA    . ASN E 3 194 ? 20.967 42.346 -25.777 1.00 8.51  ? 194 ASN A CA    1 
ATOM   2739 C C     . ASN E 3 194 ? 20.797 42.387 -24.267 1.00 7.03  ? 194 ASN A C     1 
ATOM   2740 O O     . ASN E 3 194 ? 19.710 42.045 -23.766 1.00 6.00  ? 194 ASN A O     1 
ATOM   2741 C CB    . ASN E 3 194 ? 20.556 40.974 -26.231 1.00 7.96  ? 194 ASN A CB    1 
ATOM   2742 C CG    . ASN E 3 194 ? 20.662 40.821 -27.709 1.00 21.38 ? 194 ASN A CG    1 
ATOM   2743 O OD1   . ASN E 3 194 ? 19.825 41.333 -28.451 1.00 22.67 ? 194 ASN A OD1   1 
ATOM   2744 N ND2   . ASN E 3 194 ? 21.694 40.105 -28.160 1.00 21.95 ? 194 ASN A ND2   1 
ATOM   2745 N N     . LEU E 3 195 ? 21.805 42.866 -23.543 1.00 10.48 ? 195 LEU A N     1 
ATOM   2746 C CA    . LEU E 3 195 ? 21.708 42.931 -22.082 1.00 16.18 ? 195 LEU A CA    1 
ATOM   2747 C C     . LEU E 3 195 ? 20.818 44.114 -21.673 1.00 15.62 ? 195 LEU A C     1 
ATOM   2748 O O     . LEU E 3 195 ? 20.354 44.171 -20.535 1.00 9.18  ? 195 LEU A O     1 
ATOM   2749 C CB    . LEU E 3 195 ? 23.109 43.090 -21.428 1.00 12.75 ? 195 LEU A CB    1 
ATOM   2750 C CG    . LEU E 3 195 ? 24.227 42.009 -21.462 1.00 9.49  ? 195 LEU A CG    1 
ATOM   2751 C CD1   . LEU E 3 195 ? 25.587 42.585 -21.117 1.00 6.00  ? 195 LEU A CD1   1 
ATOM   2752 C CD2   . LEU E 3 195 ? 23.910 40.939 -20.486 1.00 12.71 ? 195 LEU A CD2   1 
ATOM   2753 N N     . ILE E 3 196 ? 20.591 45.061 -22.593 1.00 20.93 ? 196 ILE A N     1 
ATOM   2754 C CA    . ILE E 3 196 ? 19.839 46.298 -22.280 1.00 25.52 ? 196 ILE A CA    1 
ATOM   2755 C C     . ILE E 3 196 ? 19.290 47.069 -23.505 1.00 24.48 ? 196 ILE A C     1 
ATOM   2756 O O     . ILE E 3 196 ? 19.834 46.971 -24.599 1.00 24.35 ? 196 ILE A O     1 
ATOM   2757 C CB    . ILE E 3 196 ? 20.759 47.237 -21.388 1.00 16.96 ? 196 ILE A CB    1 
ATOM   2758 C CG1   . ILE E 3 196 ? 20.371 48.717 -21.478 1.00 12.72 ? 196 ILE A CG1   1 
ATOM   2759 C CG2   . ILE E 3 196 ? 22.141 47.055 -21.792 1.00 21.61 ? 196 ILE A CG2   1 
ATOM   2760 C CD1   . ILE E 3 196 ? 21.413 49.641 -22.136 1.00 13.83 ? 196 ILE A CD1   1 
ATOM   2761 N N     . SER E 3 197 ? 18.196 47.801 -23.308 1.00 24.75 ? 197 SER A N     1 
ATOM   2762 C CA    . SER E 3 197 ? 17.651 48.700 -24.334 1.00 32.87 ? 197 SER A CA    1 
ATOM   2763 C C     . SER E 3 197 ? 17.648 50.167 -23.804 1.00 35.20 ? 197 SER A C     1 
ATOM   2764 O O     . SER E 3 197 ? 17.967 50.398 -22.634 1.00 44.02 ? 197 SER A O     1 
ATOM   2765 C CB    . SER E 3 197 ? 16.219 48.277 -24.688 1.00 39.09 ? 197 SER A CB    1 
ATOM   2766 O OG    . SER E 3 197 ? 15.325 48.491 -23.596 1.00 40.90 ? 197 SER A OG    1 
ATOM   2767 N N     . ALA E 3 198 ? 17.267 51.141 -24.636 1.00 32.16 ? 198 ALA A N     1 
ATOM   2768 C CA    . ALA E 3 198 ? 17.179 52.553 -24.220 1.00 27.50 ? 198 ALA A CA    1 
ATOM   2769 C C     . ALA E 3 198 ? 16.122 53.357 -25.012 1.00 25.02 ? 198 ALA A C     1 
ATOM   2770 O O     . ALA E 3 198 ? 15.525 52.849 -25.964 1.00 19.54 ? 198 ALA A O     1 
ATOM   2771 C CB    . ALA E 3 198 ? 18.546 53.217 -24.370 1.00 27.65 ? 198 ALA A CB    1 
ATOM   2772 N N     . HIS E 3 199 ? 15.907 54.608 -24.602 1.00 28.06 ? 199 HIS A N     1 
ATOM   2773 C CA    . HIS E 3 199 ? 14.950 55.559 -25.203 1.00 29.40 ? 199 HIS A CA    1 
ATOM   2774 C C     . HIS E 3 199 ? 14.672 56.467 -24.000 1.00 28.74 ? 199 HIS A C     1 
ATOM   2775 O O     . HIS E 3 199 ? 13.495 56.649 -23.644 1.00 30.27 ? 199 HIS A O     1 
ATOM   2776 C CB    . HIS E 3 199 ? 13.645 54.814 -25.640 1.00 38.70 ? 199 HIS A CB    1 
ATOM   2777 C CG    . HIS E 3 199 ? 12.594 55.675 -26.292 1.00 45.07 ? 199 HIS A CG    1 
ATOM   2778 N ND1   . HIS E 3 199 ? 11.456 56.090 -25.624 1.00 52.08 ? 199 HIS A ND1   1 
ATOM   2779 C CD2   . HIS E 3 199 ? 12.475 56.146 -27.557 1.00 46.81 ? 199 HIS A CD2   1 
ATOM   2780 C CE1   . HIS E 3 199 ? 10.684 56.779 -26.451 1.00 51.95 ? 199 HIS A CE1   1 
ATOM   2781 N NE2   . HIS E 3 199 ? 11.281 56.828 -27.629 1.00 50.02 ? 199 HIS A NE2   1 
ATOM   2782 H HD1   . HIS E 3 199 ? 11.291 55.925 -24.665 1.00 0.00  ? 199 HIS A HD1   1 
ATOM   2783 N N     . GLY E 3 200 ? 15.715 57.018 -23.356 1.00 13.23 ? 200 GLY A N     1 
ATOM   2784 C CA    . GLY E 3 200 ? 15.490 57.636 -22.041 1.00 19.29 ? 200 GLY A CA    1 
ATOM   2785 C C     . GLY E 3 200 ? 15.062 56.577 -20.986 1.00 18.35 ? 200 GLY A C     1 
ATOM   2786 O O     . GLY E 3 200 ? 15.602 56.480 -19.875 1.00 15.83 ? 200 GLY A O     1 
ATOM   2787 N N     . LYS E 3 201 ? 14.039 55.801 -21.325 1.00 14.52 ? 201 LYS A N     1 
ATOM   2788 C CA    . LYS E 3 201 ? 13.610 54.656 -20.552 1.00 12.82 ? 201 LYS A CA    1 
ATOM   2789 C C     . LYS E 3 201 ? 14.533 53.541 -21.002 1.00 6.55  ? 201 LYS A C     1 
ATOM   2790 O O     . LYS E 3 201 ? 14.482 53.164 -22.153 1.00 17.02 ? 201 LYS A O     1 
ATOM   2791 C CB    . LYS E 3 201 ? 12.136 54.349 -20.888 1.00 9.52  ? 201 LYS A CB    1 
ATOM   2792 C CG    . LYS E 3 201 ? 11.798 52.901 -21.286 1.00 23.12 ? 201 LYS A CG    1 
ATOM   2793 C CD    . LYS E 3 201 ? 11.142 52.844 -22.684 1.00 29.88 ? 201 LYS A CD    1 
ATOM   2794 C CE    . LYS E 3 201 ? 10.976 51.423 -23.269 1.00 16.06 ? 201 LYS A CE    1 
ATOM   2795 N NZ    . LYS E 3 201 ? 9.934  50.597 -22.586 1.00 14.03 ? 201 LYS A NZ    1 
ATOM   2796 N N     . THR E 3 202 ? 15.523 53.191 -20.200 1.00 9.60  ? 202 THR A N     1 
ATOM   2797 C CA    . THR E 3 202 ? 16.328 51.995 -20.477 1.00 13.40 ? 202 THR A CA    1 
ATOM   2798 C C     . THR E 3 202 ? 15.707 50.819 -19.736 1.00 13.48 ? 202 THR A C     1 
ATOM   2799 O O     . THR E 3 202 ? 15.410 50.909 -18.538 1.00 6.00  ? 202 THR A O     1 
ATOM   2800 C CB    . THR E 3 202 ? 17.817 52.135 -20.021 1.00 14.20 ? 202 THR A CB    1 
ATOM   2801 O OG1   . THR E 3 202 ? 18.587 52.692 -21.096 1.00 17.50 ? 202 THR A OG1   1 
ATOM   2802 C CG2   . THR E 3 202 ? 18.417 50.766 -19.654 1.00 7.99  ? 202 THR A CG2   1 
ATOM   2803 N N     . ILE E 3 203 ? 15.459 49.750 -20.492 1.00 21.32 ? 203 ILE A N     1 
ATOM   2804 C CA    . ILE E 3 203 ? 14.888 48.518 -19.965 1.00 20.97 ? 203 ILE A CA    1 
ATOM   2805 C C     . ILE E 3 203 ? 16.063 47.579 -19.714 1.00 23.74 ? 203 ILE A C     1 
ATOM   2806 O O     . ILE E 3 203 ? 16.861 47.309 -20.625 1.00 24.27 ? 203 ILE A O     1 
ATOM   2807 C CB    . ILE E 3 203 ? 13.940 47.871 -20.964 1.00 10.92 ? 203 ILE A CB    1 
ATOM   2808 C CG1   . ILE E 3 203 ? 12.959 48.921 -21.495 1.00 17.25 ? 203 ILE A CG1   1 
ATOM   2809 C CG2   . ILE E 3 203 ? 13.212 46.722 -20.299 1.00 9.28  ? 203 ILE A CG2   1 
ATOM   2810 C CD1   . ILE E 3 203 ? 11.908 48.370 -22.461 1.00 22.27 ? 203 ILE A CD1   1 
ATOM   2811 N N     . VAL E 3 204 ? 16.264 47.223 -18.450 1.00 27.06 ? 204 VAL A N     1 
ATOM   2812 C CA    . VAL E 3 204 ? 17.326 46.293 -18.106 1.00 26.66 ? 204 VAL A CA    1 
ATOM   2813 C C     . VAL E 3 204 ? 16.772 44.869 -18.209 1.00 23.68 ? 204 VAL A C     1 
ATOM   2814 O O     . VAL E 3 204 ? 16.039 44.402 -17.342 1.00 14.67 ? 204 VAL A O     1 
ATOM   2815 C CB    . VAL E 3 204 ? 17.872 46.555 -16.689 1.00 19.53 ? 204 VAL A CB    1 
ATOM   2816 C CG1   . VAL E 3 204 ? 18.789 45.461 -16.287 1.00 21.27 ? 204 VAL A CG1   1 
ATOM   2817 C CG2   . VAL E 3 204 ? 18.668 47.818 -16.669 1.00 17.95 ? 204 VAL A CG2   1 
ATOM   2818 N N     . VAL E 3 205 ? 16.957 44.312 -19.399 1.00 26.37 ? 205 VAL A N     1 
ATOM   2819 C CA    . VAL E 3 205 ? 16.675 42.930 -19.734 1.00 22.22 ? 205 VAL A CA    1 
ATOM   2820 C C     . VAL E 3 205 ? 17.705 42.245 -18.851 1.00 32.34 ? 205 VAL A C     1 
ATOM   2821 O O     . VAL E 3 205 ? 18.886 42.251 -19.164 1.00 38.61 ? 205 VAL A O     1 
ATOM   2822 C CB    . VAL E 3 205 ? 17.003 42.662 -21.215 1.00 13.06 ? 205 VAL A CB    1 
ATOM   2823 C CG1   . VAL E 3 205 ? 17.022 41.224 -21.481 1.00 27.95 ? 205 VAL A CG1   1 
ATOM   2824 C CG2   . VAL E 3 205 ? 15.989 43.306 -22.103 1.00 6.72  ? 205 VAL A CG2   1 
ATOM   2825 N N     . TYR E 3 206 ? 17.272 41.846 -17.668 1.00 44.25 ? 206 TYR A N     1 
ATOM   2826 C CA    . TYR E 3 206 ? 18.094 41.128 -16.688 1.00 50.75 ? 206 TYR A CA    1 
ATOM   2827 C C     . TYR E 3 206 ? 17.042 40.364 -15.850 1.00 50.27 ? 206 TYR A C     1 
ATOM   2828 O O     . TYR E 3 206 ? 17.218 40.227 -14.623 1.00 55.14 ? 206 TYR A O     1 
ATOM   2829 C CB    . TYR E 3 206 ? 18.885 42.118 -15.785 1.00 58.12 ? 206 TYR A CB    1 
ATOM   2830 C CG    . TYR E 3 206 ? 20.408 42.277 -16.001 1.00 63.43 ? 206 TYR A CG    1 
ATOM   2831 C CD1   . TYR E 3 206 ? 21.331 41.738 -15.074 1.00 62.41 ? 206 TYR A CD1   1 
ATOM   2832 C CD2   . TYR E 3 206 ? 20.924 43.076 -17.051 1.00 63.55 ? 206 TYR A CD2   1 
ATOM   2833 C CE1   . TYR E 3 206 ? 22.727 42.009 -15.183 1.00 62.11 ? 206 TYR A CE1   1 
ATOM   2834 C CE2   . TYR E 3 206 ? 22.319 43.352 -17.168 1.00 62.35 ? 206 TYR A CE2   1 
ATOM   2835 C CZ    . TYR E 3 206 ? 23.209 42.819 -16.232 1.00 60.90 ? 206 TYR A CZ    1 
ATOM   2836 O OH    . TYR E 3 206 ? 24.560 43.101 -16.333 1.00 51.61 ? 206 TYR A OH    1 
ATOM   2837 N N     . PRO F 3 9   ? 32.410 55.310 32.922  1.00 28.18 ? 9   PRO B N     1 
ATOM   2838 C CA    . PRO F 3 9   ? 31.093 55.915 32.682  1.00 31.72 ? 9   PRO B CA    1 
ATOM   2839 C C     . PRO F 3 9   ? 30.125 54.768 32.504  1.00 27.24 ? 9   PRO B C     1 
ATOM   2840 O O     . PRO F 3 9   ? 30.367 53.649 33.015  1.00 20.24 ? 9   PRO B O     1 
ATOM   2841 C CB    . PRO F 3 9   ? 31.209 56.752 31.408  1.00 21.78 ? 9   PRO B CB    1 
ATOM   2842 C CG    . PRO F 3 9   ? 32.700 57.232 31.457  1.00 23.81 ? 9   PRO B CG    1 
ATOM   2843 C CD    . PRO F 3 9   ? 33.436 56.074 32.156  1.00 30.18 ? 9   PRO B CD    1 
ATOM   2844 H H     . PRO F 3 9   ? 32.546 55.089 33.921  1.00 0.00  ? 9   PRO B H     1 
ATOM   2845 H H3    . PRO F 3 9   ? 32.275 54.360 32.474  1.00 0.00  ? 9   PRO B H3    1 
ATOM   2846 N N     . THR F 3 10  ? 29.067 55.050 31.745  1.00 25.83 ? 10  THR B N     1 
ATOM   2847 C CA    . THR F 3 10  ? 28.187 54.021 31.249  1.00 22.76 ? 10  THR B CA    1 
ATOM   2848 C C     . THR F 3 10  ? 29.186 53.010 30.680  1.00 21.65 ? 10  THR B C     1 
ATOM   2849 O O     . THR F 3 10  ? 29.236 51.882 31.141  1.00 21.69 ? 10  THR B O     1 
ATOM   2850 C CB    . THR F 3 10  ? 27.244 54.534 30.092  1.00 23.93 ? 10  THR B CB    1 
ATOM   2851 O OG1   . THR F 3 10  ? 27.991 55.370 29.192  1.00 24.85 ? 10  THR B OG1   1 
ATOM   2852 C CG2   . THR F 3 10  ? 26.052 55.292 30.650  1.00 17.68 ? 10  THR B CG2   1 
ATOM   2853 N N     . LEU F 3 11  ? 30.092 53.447 29.809  1.00 21.90 ? 11  LEU B N     1 
ATOM   2854 C CA    . LEU F 3 11  ? 31.065 52.493 29.305  1.00 19.14 ? 11  LEU B CA    1 
ATOM   2855 C C     . LEU F 3 11  ? 32.117 52.106 30.325  1.00 18.80 ? 11  LEU B C     1 
ATOM   2856 O O     . LEU F 3 11  ? 33.109 52.773 30.541  1.00 17.61 ? 11  LEU B O     1 
ATOM   2857 C CB    . LEU F 3 11  ? 31.719 52.983 27.997  1.00 27.60 ? 11  LEU B CB    1 
ATOM   2858 C CG    . LEU F 3 11  ? 32.341 54.330 27.608  1.00 25.56 ? 11  LEU B CG    1 
ATOM   2859 C CD1   . LEU F 3 11  ? 33.804 54.496 28.102  1.00 26.37 ? 11  LEU B CD1   1 
ATOM   2860 C CD2   . LEU F 3 11  ? 32.295 54.359 26.078  1.00 19.10 ? 11  LEU B CD2   1 
ATOM   2861 N N     . GLU F 3 12  ? 31.703 51.114 31.092  1.00 27.83 ? 12  GLU B N     1 
ATOM   2862 C CA    . GLU F 3 12  ? 32.474 50.311 32.046  1.00 29.42 ? 12  GLU B CA    1 
ATOM   2863 C C     . GLU F 3 12  ? 31.401 49.344 32.598  1.00 27.49 ? 12  GLU B C     1 
ATOM   2864 O O     . GLU F 3 12  ? 31.687 48.227 33.028  1.00 11.95 ? 12  GLU B O     1 
ATOM   2865 C CB    . GLU F 3 12  ? 33.103 51.164 33.162  1.00 29.28 ? 12  GLU B CB    1 
ATOM   2866 C CG    . GLU F 3 12  ? 34.675 51.032 33.226  1.00 30.81 ? 12  GLU B CG    1 
ATOM   2867 C CD    . GLU F 3 12  ? 35.255 49.559 33.326  1.00 29.77 ? 12  GLU B CD    1 
ATOM   2868 O OE1   . GLU F 3 12  ? 34.651 48.660 33.995  1.00 21.27 ? 12  GLU B OE1   1 
ATOM   2869 O OE2   . GLU F 3 12  ? 36.359 49.327 32.754  1.00 20.09 ? 12  GLU B OE2   1 
ATOM   2870 N N     . TRP F 3 13  ? 30.156 49.802 32.509  1.00 27.96 ? 13  TRP B N     1 
ATOM   2871 C CA    . TRP F 3 13  ? 28.972 48.998 32.706  1.00 24.45 ? 13  TRP B CA    1 
ATOM   2872 C C     . TRP F 3 13  ? 28.917 48.037 31.521  1.00 29.43 ? 13  TRP B C     1 
ATOM   2873 O O     . TRP F 3 13  ? 29.051 46.838 31.729  1.00 38.28 ? 13  TRP B O     1 
ATOM   2874 C CB    . TRP F 3 13  ? 27.747 49.904 32.736  1.00 20.67 ? 13  TRP B CB    1 
ATOM   2875 C CG    . TRP F 3 13  ? 26.451 49.229 32.659  1.00 21.65 ? 13  TRP B CG    1 
ATOM   2876 C CD1   . TRP F 3 13  ? 25.913 48.361 33.580  1.00 28.00 ? 13  TRP B CD1   1 
ATOM   2877 C CD2   . TRP F 3 13  ? 25.498 49.343 31.602  1.00 17.06 ? 13  TRP B CD2   1 
ATOM   2878 N NE1   . TRP F 3 13  ? 24.670 47.929 33.147  1.00 29.58 ? 13  TRP B NE1   1 
ATOM   2879 C CE2   . TRP F 3 13  ? 24.398 48.513 31.934  1.00 25.24 ? 13  TRP B CE2   1 
ATOM   2880 C CE3   . TRP F 3 13  ? 25.464 50.062 30.403  1.00 17.86 ? 13  TRP B CE3   1 
ATOM   2881 C CZ2   . TRP F 3 13  ? 23.277 48.381 31.100  1.00 20.79 ? 13  TRP B CZ2   1 
ATOM   2882 C CZ3   . TRP F 3 13  ? 24.349 49.936 29.576  1.00 20.50 ? 13  TRP B CZ3   1 
ATOM   2883 C CH2   . TRP F 3 13  ? 23.272 49.098 29.930  1.00 19.02 ? 13  TRP B CH2   1 
ATOM   2884 H HE1   . TRP F 3 13  ? 24.027 47.377 33.645  1.00 0.00  ? 13  TRP B HE1   1 
ATOM   2885 N N     . PHE F 3 14  ? 28.803 48.532 30.284  1.00 29.61 ? 14  PHE B N     1 
ATOM   2886 C CA    . PHE F 3 14  ? 28.768 47.612 29.130  1.00 31.73 ? 14  PHE B CA    1 
ATOM   2887 C C     . PHE F 3 14  ? 30.091 46.820 29.075  1.00 25.83 ? 14  PHE B C     1 
ATOM   2888 O O     . PHE F 3 14  ? 30.081 45.609 28.897  1.00 26.31 ? 14  PHE B O     1 
ATOM   2889 C CB    . PHE F 3 14  ? 28.515 48.384 27.788  1.00 27.57 ? 14  PHE B CB    1 
ATOM   2890 C CG    . PHE F 3 14  ? 29.667 48.315 26.792  1.00 25.89 ? 14  PHE B CG    1 
ATOM   2891 C CD1   . PHE F 3 14  ? 29.974 47.134 26.125  1.00 21.24 ? 14  PHE B CD1   1 
ATOM   2892 C CD2   . PHE F 3 14  ? 30.493 49.426 26.585  1.00 30.12 ? 14  PHE B CD2   1 
ATOM   2893 C CE1   . PHE F 3 14  ? 31.082 47.060 25.285  1.00 30.57 ? 14  PHE B CE1   1 
ATOM   2894 C CE2   . PHE F 3 14  ? 31.608 49.363 25.739  1.00 17.00 ? 14  PHE B CE2   1 
ATOM   2895 C CZ    . PHE F 3 14  ? 31.903 48.190 25.097  1.00 19.99 ? 14  PHE B CZ    1 
ATOM   2896 N N     . LEU F 3 15  ? 31.213 47.490 29.316  1.00 23.32 ? 15  LEU B N     1 
ATOM   2897 C CA    . LEU F 3 15  ? 32.511 46.834 29.221  1.00 25.40 ? 15  LEU B CA    1 
ATOM   2898 C C     . LEU F 3 15  ? 32.747 45.667 30.157  1.00 28.11 ? 15  LEU B C     1 
ATOM   2899 O O     . LEU F 3 15  ? 33.624 44.829 29.882  1.00 26.43 ? 15  LEU B O     1 
ATOM   2900 C CB    . LEU F 3 15  ? 33.628 47.846 29.425  1.00 21.68 ? 15  LEU B CB    1 
ATOM   2901 C CG    . LEU F 3 15  ? 34.211 48.356 28.103  1.00 21.33 ? 15  LEU B CG    1 
ATOM   2902 C CD1   . LEU F 3 15  ? 34.498 49.860 28.199  1.00 25.65 ? 15  LEU B CD1   1 
ATOM   2903 C CD2   . LEU F 3 15  ? 35.470 47.564 27.769  1.00 19.33 ? 15  LEU B CD2   1 
ATOM   2904 N N     . SER F 3 16  ? 31.992 45.617 31.259  1.00 32.20 ? 16  SER B N     1 
ATOM   2905 C CA    . SER F 3 16  ? 32.162 44.535 32.217  1.00 33.73 ? 16  SER B CA    1 
ATOM   2906 C C     . SER F 3 16  ? 31.471 43.247 31.743  1.00 37.86 ? 16  SER B C     1 
ATOM   2907 O O     . SER F 3 16  ? 31.894 42.138 32.111  1.00 43.28 ? 16  SER B O     1 
ATOM   2908 C CB    . SER F 3 16  ? 31.673 44.963 33.640  1.00 28.83 ? 16  SER B CB    1 
ATOM   2909 O OG    . SER F 3 16  ? 30.271 45.105 33.805  1.00 19.30 ? 16  SER B OG    1 
ATOM   2910 N N     . HIS F 3 17  ? 30.498 43.371 30.835  1.00 35.57 ? 17  HIS B N     1 
ATOM   2911 C CA    . HIS F 3 17  ? 29.824 42.182 30.280  1.00 30.35 ? 17  HIS B CA    1 
ATOM   2912 C C     . HIS F 3 17  ? 30.585 41.687 29.036  1.00 26.56 ? 17  HIS B C     1 
ATOM   2913 O O     . HIS F 3 17  ? 29.971 41.096 28.129  1.00 28.14 ? 17  HIS B O     1 
ATOM   2914 C CB    . HIS F 3 17  ? 28.372 42.516 29.887  1.00 32.30 ? 17  HIS B CB    1 
ATOM   2915 C CG    . HIS F 3 17  ? 27.573 43.164 30.979  1.00 36.82 ? 17  HIS B CG    1 
ATOM   2916 N ND1   . HIS F 3 17  ? 26.366 42.667 31.427  1.00 41.32 ? 17  HIS B ND1   1 
ATOM   2917 C CD2   . HIS F 3 17  ? 27.812 44.278 31.714  1.00 40.31 ? 17  HIS B CD2   1 
ATOM   2918 C CE1   . HIS F 3 17  ? 25.897 43.444 32.387  1.00 38.58 ? 17  HIS B CE1   1 
ATOM   2919 N NE2   . HIS F 3 17  ? 26.756 44.431 32.581  1.00 34.09 ? 17  HIS B NE2   1 
ATOM   2920 H HD1   . HIS F 3 17  ? 25.961 41.807 31.143  1.00 0.00  ? 17  HIS B HD1   1 
ATOM   2921 N N     . CYS F 3 18  ? 31.919 41.824 29.052  1.00 15.20 ? 18  CYS B N     1 
ATOM   2922 C CA    . CYS F 3 18  ? 32.734 41.627 27.854  1.00 17.06 ? 18  CYS B CA    1 
ATOM   2923 C C     . CYS F 3 18  ? 34.027 40.874 28.091  1.00 16.60 ? 18  CYS B C     1 
ATOM   2924 O O     . CYS F 3 18  ? 34.917 41.353 28.795  1.00 27.34 ? 18  CYS B O     1 
ATOM   2925 C CB    . CYS F 3 18  ? 33.073 42.998 27.209  1.00 26.43 ? 18  CYS B CB    1 
ATOM   2926 S SG    . CYS F 3 18  ? 31.665 43.996 26.495  1.00 32.44 ? 18  CYS B SG    1 
ATOM   2927 N N     . HIS F 3 19  ? 34.185 39.735 27.428  1.00 7.09  ? 19  HIS B N     1 
ATOM   2928 C CA    . HIS F 3 19  ? 35.399 38.951 27.629  1.00 9.32  ? 19  HIS B CA    1 
ATOM   2929 C C     . HIS F 3 19  ? 36.607 39.711 27.009  1.00 7.79  ? 19  HIS B C     1 
ATOM   2930 O O     . HIS F 3 19  ? 36.695 39.904 25.790  1.00 19.65 ? 19  HIS B O     1 
ATOM   2931 C CB    . HIS F 3 19  ? 35.250 37.547 26.987  1.00 6.33  ? 19  HIS B CB    1 
ATOM   2932 C CG    . HIS F 3 19  ? 34.120 36.729 27.529  1.00 6.00  ? 19  HIS B CG    1 
ATOM   2933 N ND1   . HIS F 3 19  ? 32.880 36.659 26.916  1.00 24.28 ? 19  HIS B ND1   1 
ATOM   2934 C CD2   . HIS F 3 19  ? 34.030 35.958 28.635  1.00 11.09 ? 19  HIS B CD2   1 
ATOM   2935 C CE1   . HIS F 3 19  ? 32.073 35.882 27.626  1.00 10.42 ? 19  HIS B CE1   1 
ATOM   2936 N NE2   . HIS F 3 19  ? 32.749 35.446 28.674  1.00 14.94 ? 19  HIS B NE2   1 
ATOM   2937 H HD1   . HIS F 3 19  ? 32.577 37.104 26.086  1.00 0.00  ? 19  HIS B HD1   1 
ATOM   2938 N N     . ILE F 3 20  ? 37.543 40.130 27.829  1.00 6.00  ? 20  ILE B N     1 
ATOM   2939 C CA    . ILE F 3 20  ? 38.693 40.880 27.330  1.00 9.55  ? 20  ILE B CA    1 
ATOM   2940 C C     . ILE F 3 20  ? 39.845 40.102 26.622  1.00 11.61 ? 20  ILE B C     1 
ATOM   2941 O O     . ILE F 3 20  ? 40.697 39.505 27.298  1.00 19.12 ? 20  ILE B O     1 
ATOM   2942 C CB    . ILE F 3 20  ? 39.283 41.666 28.478  1.00 9.73  ? 20  ILE B CB    1 
ATOM   2943 C CG1   . ILE F 3 20  ? 38.137 42.273 29.318  1.00 13.05 ? 20  ILE B CG1   1 
ATOM   2944 C CG2   . ILE F 3 20  ? 40.296 42.667 27.920  1.00 18.02 ? 20  ILE B CG2   1 
ATOM   2945 C CD1   . ILE F 3 20  ? 37.336 43.384 28.657  1.00 17.78 ? 20  ILE B CD1   1 
ATOM   2946 N N     . HIS F 3 21  ? 39.919 40.158 25.291  1.00 11.11 ? 21  HIS B N     1 
ATOM   2947 C CA    . HIS F 3 21  ? 40.975 39.433 24.548  1.00 10.86 ? 21  HIS B CA    1 
ATOM   2948 C C     . HIS F 3 21  ? 42.085 40.273 23.974  1.00 12.55 ? 21  HIS B C     1 
ATOM   2949 O O     . HIS F 3 21  ? 41.861 41.354 23.451  1.00 19.19 ? 21  HIS B O     1 
ATOM   2950 C CB    . HIS F 3 21  ? 40.407 38.622 23.356  1.00 23.33 ? 21  HIS B CB    1 
ATOM   2951 C CG    . HIS F 3 21  ? 39.469 37.514 23.747  1.00 28.22 ? 21  HIS B CG    1 
ATOM   2952 N ND1   . HIS F 3 21  ? 38.156 37.465 23.327  1.00 27.17 ? 21  HIS B ND1   1 
ATOM   2953 C CD2   . HIS F 3 21  ? 39.640 36.448 24.570  1.00 29.70 ? 21  HIS B CD2   1 
ATOM   2954 C CE1   . HIS F 3 21  ? 37.558 36.424 23.881  1.00 27.64 ? 21  HIS B CE1   1 
ATOM   2955 N NE2   . HIS F 3 21  ? 38.436 35.789 24.639  1.00 28.83 ? 21  HIS B NE2   1 
ATOM   2956 H HD1   . HIS F 3 21  ? 37.708 38.146 22.768  1.00 0.00  ? 21  HIS B HD1   1 
ATOM   2957 N N     . LYS F 3 22  ? 43.281 39.716 23.994  1.00 20.73 ? 22  LYS B N     1 
ATOM   2958 C CA    . LYS F 3 22  ? 44.463 40.314 23.360  1.00 24.26 ? 22  LYS B CA    1 
ATOM   2959 C C     . LYS F 3 22  ? 44.628 39.639 21.972  1.00 23.96 ? 22  LYS B C     1 
ATOM   2960 O O     . LYS F 3 22  ? 44.320 38.452 21.835  1.00 25.20 ? 22  LYS B O     1 
ATOM   2961 C CB    . LYS F 3 22  ? 45.719 40.034 24.213  1.00 34.23 ? 22  LYS B CB    1 
ATOM   2962 C CG    . LYS F 3 22  ? 45.665 40.524 25.688  1.00 41.75 ? 22  LYS B CG    1 
ATOM   2963 C CD    . LYS F 3 22  ? 46.601 39.710 26.651  1.00 47.12 ? 22  LYS B CD    1 
ATOM   2964 C CE    . LYS F 3 22  ? 48.094 39.631 26.230  1.00 48.56 ? 22  LYS B CE    1 
ATOM   2965 N NZ    . LYS F 3 22  ? 48.959 38.913 27.229  1.00 35.17 ? 22  LYS B NZ    1 
ATOM   2966 N N     . TYR F 3 23  ? 45.039 40.375 20.942  1.00 15.55 ? 23  TYR B N     1 
ATOM   2967 C CA    . TYR F 3 23  ? 45.349 39.748 19.664  1.00 8.50  ? 23  TYR B CA    1 
ATOM   2968 C C     . TYR F 3 23  ? 46.768 40.065 19.326  1.00 15.03 ? 23  TYR B C     1 
ATOM   2969 O O     . TYR F 3 23  ? 47.326 41.086 19.775  1.00 19.81 ? 23  TYR B O     1 
ATOM   2970 C CB    . TYR F 3 23  ? 44.469 40.265 18.554  1.00 9.18  ? 23  TYR B CB    1 
ATOM   2971 C CG    . TYR F 3 23  ? 43.084 39.748 18.617  1.00 6.00  ? 23  TYR B CG    1 
ATOM   2972 C CD1   . TYR F 3 23  ? 42.653 38.705 17.780  1.00 8.67  ? 23  TYR B CD1   1 
ATOM   2973 C CD2   . TYR F 3 23  ? 42.197 40.270 19.516  1.00 6.00  ? 23  TYR B CD2   1 
ATOM   2974 C CE1   . TYR F 3 23  ? 41.334 38.211 17.866  1.00 6.00  ? 23  TYR B CE1   1 
ATOM   2975 C CE2   . TYR F 3 23  ? 40.905 39.780 19.604  1.00 12.80 ? 23  TYR B CE2   1 
ATOM   2976 C CZ    . TYR F 3 23  ? 40.496 38.764 18.787  1.00 6.00  ? 23  TYR B CZ    1 
ATOM   2977 O OH    . TYR F 3 23  ? 39.235 38.339 18.948  1.00 13.55 ? 23  TYR B OH    1 
ATOM   2978 N N     . PRO F 3 24  ? 47.405 39.192 18.552  1.00 12.53 ? 24  PRO B N     1 
ATOM   2979 C CA    . PRO F 3 24  ? 48.781 39.499 18.139  1.00 8.77  ? 24  PRO B CA    1 
ATOM   2980 C C     . PRO F 3 24  ? 48.826 40.528 16.980  1.00 6.00  ? 24  PRO B C     1 
ATOM   2981 O O     . PRO F 3 24  ? 47.798 40.950 16.475  1.00 6.00  ? 24  PRO B O     1 
ATOM   2982 C CB    . PRO F 3 24  ? 49.324 38.130 17.765  1.00 8.39  ? 24  PRO B CB    1 
ATOM   2983 C CG    . PRO F 3 24  ? 48.078 37.423 17.165  1.00 7.50  ? 24  PRO B CG    1 
ATOM   2984 C CD    . PRO F 3 24  ? 47.000 37.809 18.157  1.00 6.00  ? 24  PRO B CD    1 
ATOM   2985 N N     . SER F 3 25  ? 50.016 40.912 16.553  1.00 11.59 ? 25  SER B N     1 
ATOM   2986 C CA    . SER F 3 25  ? 50.129 41.791 15.404  1.00 12.72 ? 25  SER B CA    1 
ATOM   2987 C C     . SER F 3 25  ? 49.713 40.987 14.170  1.00 18.27 ? 25  SER B C     1 
ATOM   2988 O O     . SER F 3 25  ? 49.929 39.776 14.088  1.00 23.16 ? 25  SER B O     1 
ATOM   2989 C CB    . SER F 3 25  ? 51.566 42.255 15.225  1.00 22.58 ? 25  SER B CB    1 
ATOM   2990 O OG    . SER F 3 25  ? 52.427 41.172 14.868  1.00 39.09 ? 25  SER B OG    1 
ATOM   2991 N N     . LYS F 3 26  ? 49.034 41.657 13.254  1.00 20.77 ? 26  LYS B N     1 
ATOM   2992 C CA    . LYS F 3 26  ? 48.625 41.083 11.975  1.00 22.37 ? 26  LYS B CA    1 
ATOM   2993 C C     . LYS F 3 26  ? 47.572 39.944 11.998  1.00 19.89 ? 26  LYS B C     1 
ATOM   2994 O O     . LYS F 3 26  ? 47.200 39.432 10.922  1.00 26.44 ? 26  LYS B O     1 
ATOM   2995 C CB    . LYS F 3 26  ? 49.893 40.653 11.231  1.00 19.26 ? 26  LYS B CB    1 
ATOM   2996 C CG    . LYS F 3 26  ? 50.921 41.788 11.102  1.00 17.58 ? 26  LYS B CG    1 
ATOM   2997 C CD    . LYS F 3 26  ? 52.378 41.316 11.351  1.00 34.55 ? 26  LYS B CD    1 
ATOM   2998 C CE    . LYS F 3 26  ? 53.026 40.629 10.129  1.00 35.58 ? 26  LYS B CE    1 
ATOM   2999 N NZ    . LYS F 3 26  ? 54.472 40.188 10.318  1.00 48.30 ? 26  LYS B NZ    1 
ATOM   3000 N N     . SER F 3 27  ? 47.041 39.602 13.183  1.00 8.35  ? 27  SER B N     1 
ATOM   3001 C CA    . SER F 3 27  ? 45.932 38.654 13.307  1.00 6.00  ? 27  SER B CA    1 
ATOM   3002 C C     . SER F 3 27  ? 44.751 39.180 12.520  1.00 6.13  ? 27  SER B C     1 
ATOM   3003 O O     . SER F 3 27  ? 44.651 40.376 12.306  1.00 23.61 ? 27  SER B O     1 
ATOM   3004 C CB    . SER F 3 27  ? 45.444 38.473 14.768  1.00 6.00  ? 27  SER B CB    1 
ATOM   3005 O OG    . SER F 3 27  ? 46.215 39.134 15.779  1.00 6.00  ? 27  SER B OG    1 
ATOM   3006 N N     . THR F 3 28  ? 43.852 38.316 12.073  1.00 6.00  ? 28  THR B N     1 
ATOM   3007 C CA    . THR F 3 28  ? 42.614 38.795 11.489  1.00 6.00  ? 28  THR B CA    1 
ATOM   3008 C C     . THR F 3 28  ? 41.618 38.753 12.666  1.00 11.27 ? 28  THR B C     1 
ATOM   3009 O O     . THR F 3 28  ? 41.765 37.947 13.565  1.00 23.86 ? 28  THR B O     1 
ATOM   3010 C CB    . THR F 3 28  ? 42.186 37.865 10.406  1.00 6.00  ? 28  THR B CB    1 
ATOM   3011 O OG1   . THR F 3 28  ? 43.237 37.728 9.432   1.00 6.00  ? 28  THR B OG1   1 
ATOM   3012 C CG2   . THR F 3 28  ? 40.998 38.361 9.769   1.00 6.00  ? 28  THR B CG2   1 
ATOM   3013 N N     . LEU F 3 29  ? 40.674 39.668 12.731  1.00 14.56 ? 29  LEU B N     1 
ATOM   3014 C CA    . LEU F 3 29  ? 39.662 39.632 13.782  1.00 14.06 ? 29  LEU B CA    1 
ATOM   3015 C C     . LEU F 3 29  ? 38.343 39.230 13.131  1.00 16.72 ? 29  LEU B C     1 
ATOM   3016 O O     . LEU F 3 29  ? 37.494 38.553 13.721  1.00 24.87 ? 29  LEU B O     1 
ATOM   3017 C CB    . LEU F 3 29  ? 39.455 41.016 14.426  1.00 19.18 ? 29  LEU B CB    1 
ATOM   3018 C CG    . LEU F 3 29  ? 40.494 42.047 14.911  1.00 24.00 ? 29  LEU B CG    1 
ATOM   3019 C CD1   . LEU F 3 29  ? 40.202 42.266 16.357  1.00 17.84 ? 29  LEU B CD1   1 
ATOM   3020 C CD2   . LEU F 3 29  ? 41.951 41.632 14.695  1.00 31.72 ? 29  LEU B CD2   1 
ATOM   3021 N N     . ILE F 3 30  ? 38.149 39.726 11.920  1.00 16.44 ? 30  ILE B N     1 
ATOM   3022 C CA    . ILE F 3 30  ? 36.931 39.508 11.165  1.00 13.75 ? 30  ILE B CA    1 
ATOM   3023 C C     . ILE F 3 30  ? 37.355 39.251 9.721   1.00 11.98 ? 30  ILE B C     1 
ATOM   3024 O O     . ILE F 3 30  ? 38.401 39.740 9.326   1.00 8.87  ? 30  ILE B O     1 
ATOM   3025 C CB    . ILE F 3 30  ? 36.063 40.765 11.234  1.00 10.41 ? 30  ILE B CB    1 
ATOM   3026 C CG1   . ILE F 3 30  ? 35.724 41.050 12.701  1.00 6.90  ? 30  ILE B CG1   1 
ATOM   3027 C CG2   . ILE F 3 30  ? 34.827 40.586 10.401  1.00 6.00  ? 30  ILE B CG2   1 
ATOM   3028 C CD1   . ILE F 3 30  ? 34.962 42.322 12.918  1.00 6.12  ? 30  ILE B CD1   1 
ATOM   3029 N N     . HIS F 3 31  ? 36.649 38.375 9.003   1.00 6.72  ? 31  HIS B N     1 
ATOM   3030 C CA    . HIS F 3 31  ? 36.821 38.232 7.558   1.00 10.10 ? 31  HIS B CA    1 
ATOM   3031 C C     . HIS F 3 31  ? 35.521 38.824 7.016   1.00 12.27 ? 31  HIS B C     1 
ATOM   3032 O O     . HIS F 3 31  ? 34.515 38.781 7.731   1.00 15.84 ? 31  HIS B O     1 
ATOM   3033 C CB    . HIS F 3 31  ? 36.855 36.770 7.115   1.00 20.61 ? 31  HIS B CB    1 
ATOM   3034 C CG    . HIS F 3 31  ? 38.175 36.081 7.280   1.00 31.74 ? 31  HIS B CG    1 
ATOM   3035 N ND1   . HIS F 3 31  ? 38.925 36.148 8.436   1.00 42.45 ? 31  HIS B ND1   1 
ATOM   3036 C CD2   . HIS F 3 31  ? 38.831 35.221 6.465   1.00 38.38 ? 31  HIS B CD2   1 
ATOM   3037 C CE1   . HIS F 3 31  ? 39.982 35.353 8.329   1.00 40.85 ? 31  HIS B CE1   1 
ATOM   3038 N NE2   . HIS F 3 31  ? 39.946 34.781 7.142   1.00 37.09 ? 31  HIS B NE2   1 
ATOM   3039 H HD1   . HIS F 3 31  ? 38.701 36.701 9.216   1.00 0.00  ? 31  HIS B HD1   1 
ATOM   3040 N N     . GLN F 3 32  ? 35.509 39.339 5.777   1.00 17.29 ? 32  GLN B N     1 
ATOM   3041 C CA    . GLN F 3 32  ? 34.220 39.625 5.089   1.00 17.70 ? 32  GLN B CA    1 
ATOM   3042 C C     . GLN F 3 32  ? 33.583 38.233 5.048   1.00 16.08 ? 32  GLN B C     1 
ATOM   3043 O O     . GLN F 3 32  ? 34.316 37.264 4.837   1.00 19.87 ? 32  GLN B O     1 
ATOM   3044 C CB    . GLN F 3 32  ? 34.376 40.045 3.605   1.00 24.76 ? 32  GLN B CB    1 
ATOM   3045 C CG    . GLN F 3 32  ? 35.301 41.237 3.242   1.00 34.45 ? 32  GLN B CG    1 
ATOM   3046 C CD    . GLN F 3 32  ? 34.930 41.905 1.891   1.00 34.64 ? 32  GLN B CD    1 
ATOM   3047 O OE1   . GLN F 3 32  ? 33.769 42.270 1.684   1.00 34.16 ? 32  GLN B OE1   1 
ATOM   3048 N NE2   . GLN F 3 32  ? 35.911 42.065 0.976   1.00 21.59 ? 32  GLN B NE2   1 
ATOM   3049 N N     . GLY F 3 33  ? 32.266 38.114 5.216   1.00 18.25 ? 33  GLY B N     1 
ATOM   3050 C CA    . GLY F 3 33  ? 31.619 36.800 5.141   1.00 10.71 ? 33  GLY B CA    1 
ATOM   3051 C C     . GLY F 3 33  ? 31.096 36.268 6.472   1.00 10.77 ? 33  GLY B C     1 
ATOM   3052 O O     . GLY F 3 33  ? 29.898 36.300 6.711   1.00 8.23  ? 33  GLY B O     1 
ATOM   3053 N N     . GLU F 3 34  ? 31.998 35.776 7.318   1.00 7.95  ? 34  GLU B N     1 
ATOM   3054 C CA    . GLU F 3 34  ? 31.720 35.292 8.673   1.00 8.07  ? 34  GLU B CA    1 
ATOM   3055 C C     . GLU F 3 34  ? 30.406 35.813 9.279   1.00 14.38 ? 34  GLU B C     1 
ATOM   3056 O O     . GLU F 3 34  ? 29.998 36.952 9.077   1.00 19.61 ? 34  GLU B O     1 
ATOM   3057 C CB    . GLU F 3 34  ? 32.943 35.643 9.564   1.00 7.57  ? 34  GLU B CB    1 
ATOM   3058 C CG    . GLU F 3 34  ? 32.694 35.976 11.071  1.00 29.30 ? 34  GLU B CG    1 
ATOM   3059 C CD    . GLU F 3 34  ? 33.778 36.901 11.744  1.00 33.92 ? 34  GLU B CD    1 
ATOM   3060 O OE1   . GLU F 3 34  ? 33.409 37.737 12.615  1.00 34.92 ? 34  GLU B OE1   1 
ATOM   3061 O OE2   . GLU F 3 34  ? 34.991 36.790 11.426  1.00 34.42 ? 34  GLU B OE2   1 
ATOM   3062 N N     . LYS F 3 35  ? 29.658 34.883 9.833   1.00 17.04 ? 35  LYS B N     1 
ATOM   3063 C CA    . LYS F 3 35  ? 28.447 35.152 10.590  1.00 16.72 ? 35  LYS B CA    1 
ATOM   3064 C C     . LYS F 3 35  ? 28.637 36.380 11.479  1.00 14.37 ? 35  LYS B C     1 
ATOM   3065 O O     . LYS F 3 35  ? 29.600 36.466 12.253  1.00 8.22  ? 35  LYS B O     1 
ATOM   3066 C CB    . LYS F 3 35  ? 28.121 33.918 11.464  1.00 23.77 ? 35  LYS B CB    1 
ATOM   3067 C CG    . LYS F 3 35  ? 29.356 32.961 11.816  1.00 33.10 ? 35  LYS B CG    1 
ATOM   3068 C CD    . LYS F 3 35  ? 30.505 33.636 12.670  1.00 35.14 ? 35  LYS B CD    1 
ATOM   3069 C CE    . LYS F 3 35  ? 31.747 32.731 12.957  1.00 31.27 ? 35  LYS B CE    1 
ATOM   3070 N NZ    . LYS F 3 35  ? 32.916 32.873 12.014  1.00 32.17 ? 35  LYS B NZ    1 
ATOM   3071 N N     . ALA F 3 36  ? 27.748 37.342 11.371  1.00 6.00  ? 36  ALA B N     1 
ATOM   3072 C CA    . ALA F 3 36  ? 27.898 38.479 12.231  1.00 10.87 ? 36  ALA B CA    1 
ATOM   3073 C C     . ALA F 3 36  ? 27.059 38.310 13.471  1.00 12.11 ? 36  ALA B C     1 
ATOM   3074 O O     . ALA F 3 36  ? 25.843 38.421 13.425  1.00 11.99 ? 36  ALA B O     1 
ATOM   3075 C CB    . ALA F 3 36  ? 27.504 39.743 11.497  1.00 19.42 ? 36  ALA B CB    1 
ATOM   3076 N N     . GLU F 3 37  ? 27.696 38.000 14.584  1.00 17.91 ? 37  GLU B N     1 
ATOM   3077 C CA    . GLU F 3 37  ? 26.954 37.987 15.823  1.00 23.37 ? 37  GLU B CA    1 
ATOM   3078 C C     . GLU F 3 37  ? 27.701 38.587 17.010  1.00 23.78 ? 37  GLU B C     1 
ATOM   3079 O O     . GLU F 3 37  ? 27.086 38.851 18.056  1.00 25.34 ? 37  GLU B O     1 
ATOM   3080 C CB    . GLU F 3 37  ? 26.484 36.561 16.138  1.00 34.22 ? 37  GLU B CB    1 
ATOM   3081 C CG    . GLU F 3 37  ? 25.235 36.104 15.326  1.00 42.19 ? 37  GLU B CG    1 
ATOM   3082 C CD    . GLU F 3 37  ? 23.924 36.869 15.676  1.00 54.38 ? 37  GLU B CD    1 
ATOM   3083 O OE1   . GLU F 3 37  ? 23.815 38.092 15.365  1.00 50.36 ? 37  GLU B OE1   1 
ATOM   3084 O OE2   . GLU F 3 37  ? 22.982 36.227 16.225  1.00 45.35 ? 37  GLU B OE2   1 
ATOM   3085 N N     . THR F 3 38  ? 28.983 38.893 16.855  1.00 10.85 ? 38  THR B N     1 
ATOM   3086 C CA    . THR F 3 38  ? 29.672 39.569 17.932  1.00 14.93 ? 38  THR B CA    1 
ATOM   3087 C C     . THR F 3 38  ? 30.102 40.971 17.570  1.00 16.50 ? 38  THR B C     1 
ATOM   3088 O O     . THR F 3 38  ? 30.627 41.253 16.491  1.00 12.91 ? 38  THR B O     1 
ATOM   3089 C CB    . THR F 3 38  ? 30.912 38.813 18.395  1.00 30.60 ? 38  THR B CB    1 
ATOM   3090 O OG1   . THR F 3 38  ? 31.850 38.756 17.322  1.00 41.45 ? 38  THR B OG1   1 
ATOM   3091 C CG2   . THR F 3 38  ? 30.547 37.381 18.815  1.00 36.85 ? 38  THR B CG2   1 
ATOM   3092 N N     . LEU F 3 39  ? 29.754 41.849 18.492  1.00 18.97 ? 39  LEU B N     1 
ATOM   3093 C CA    . LEU F 3 39  ? 30.025 43.267 18.485  1.00 16.22 ? 39  LEU B CA    1 
ATOM   3094 C C     . LEU F 3 39  ? 31.279 43.402 19.352  1.00 13.79 ? 39  LEU B C     1 
ATOM   3095 O O     . LEU F 3 39  ? 31.245 43.059 20.534  1.00 20.11 ? 39  LEU B O     1 
ATOM   3096 C CB    . LEU F 3 39  ? 28.800 43.955 19.109  1.00 16.71 ? 39  LEU B CB    1 
ATOM   3097 C CG    . LEU F 3 39  ? 28.693 45.414 19.523  1.00 15.91 ? 39  LEU B CG    1 
ATOM   3098 C CD1   . LEU F 3 39  ? 29.488 45.591 20.776  1.00 15.47 ? 39  LEU B CD1   1 
ATOM   3099 C CD2   . LEU F 3 39  ? 29.178 46.323 18.410  1.00 14.73 ? 39  LEU B CD2   1 
ATOM   3100 N N     . TYR F 3 40  ? 32.387 43.835 18.765  1.00 12.54 ? 40  TYR B N     1 
ATOM   3101 C CA    . TYR F 3 40  ? 33.668 43.952 19.482  1.00 16.71 ? 40  TYR B CA    1 
ATOM   3102 C C     . TYR F 3 40  ? 33.828 45.348 20.090  1.00 12.52 ? 40  TYR B C     1 
ATOM   3103 O O     . TYR F 3 40  ? 32.948 46.187 19.926  1.00 14.58 ? 40  TYR B O     1 
ATOM   3104 C CB    . TYR F 3 40  ? 34.829 43.700 18.522  1.00 16.74 ? 40  TYR B CB    1 
ATOM   3105 C CG    . TYR F 3 40  ? 34.851 42.327 17.893  1.00 15.55 ? 40  TYR B CG    1 
ATOM   3106 C CD1   . TYR F 3 40  ? 33.723 41.799 17.261  1.00 14.04 ? 40  TYR B CD1   1 
ATOM   3107 C CD2   . TYR F 3 40  ? 36.017 41.574 17.872  1.00 22.63 ? 40  TYR B CD2   1 
ATOM   3108 C CE1   . TYR F 3 40  ? 33.754 40.572 16.620  1.00 10.72 ? 40  TYR B CE1   1 
ATOM   3109 C CE2   . TYR F 3 40  ? 36.057 40.313 17.225  1.00 21.65 ? 40  TYR B CE2   1 
ATOM   3110 C CZ    . TYR F 3 40  ? 34.918 39.825 16.595  1.00 16.50 ? 40  TYR B CZ    1 
ATOM   3111 O OH    . TYR F 3 40  ? 34.972 38.626 15.889  1.00 23.55 ? 40  TYR B OH    1 
ATOM   3112 N N     . TYR F 3 41  ? 34.943 45.607 20.765  1.00 13.66 ? 41  TYR B N     1 
ATOM   3113 C CA    . TYR F 3 41  ? 35.242 46.956 21.268  1.00 21.71 ? 41  TYR B CA    1 
ATOM   3114 C C     . TYR F 3 41  ? 36.720 47.038 21.581  1.00 16.71 ? 41  TYR B C     1 
ATOM   3115 O O     . TYR F 3 41  ? 37.224 46.314 22.436  1.00 13.53 ? 41  TYR B O     1 
ATOM   3116 C CB    . TYR F 3 41  ? 34.426 47.260 22.533  1.00 30.24 ? 41  TYR B CB    1 
ATOM   3117 C CG    . TYR F 3 41  ? 34.511 48.699 23.032  1.00 37.42 ? 41  TYR B CG    1 
ATOM   3118 C CD1   . TYR F 3 41  ? 35.586 49.130 23.826  1.00 40.00 ? 41  TYR B CD1   1 
ATOM   3119 C CD2   . TYR F 3 41  ? 33.514 49.638 22.719  1.00 36.50 ? 41  TYR B CD2   1 
ATOM   3120 C CE1   . TYR F 3 41  ? 35.666 50.469 24.286  1.00 43.55 ? 41  TYR B CE1   1 
ATOM   3121 C CE2   . TYR F 3 41  ? 33.582 50.970 23.177  1.00 35.50 ? 41  TYR B CE2   1 
ATOM   3122 C CZ    . TYR F 3 41  ? 34.662 51.375 23.953  1.00 39.52 ? 41  TYR B CZ    1 
ATOM   3123 O OH    . TYR F 3 41  ? 34.775 52.681 24.370  1.00 40.79 ? 41  TYR B OH    1 
ATOM   3124 N N     . ILE F 3 42  ? 37.423 47.905 20.869  1.00 16.13 ? 42  ILE B N     1 
ATOM   3125 C CA    . ILE F 3 42  ? 38.863 48.027 21.046  1.00 20.93 ? 42  ILE B CA    1 
ATOM   3126 C C     . ILE F 3 42  ? 39.128 48.766 22.350  1.00 29.16 ? 42  ILE B C     1 
ATOM   3127 O O     . ILE F 3 42  ? 38.675 49.896 22.570  1.00 39.64 ? 42  ILE B O     1 
ATOM   3128 C CB    . ILE F 3 42  ? 39.541 48.819 19.896  1.00 19.00 ? 42  ILE B CB    1 
ATOM   3129 C CG1   . ILE F 3 42  ? 39.085 48.281 18.551  1.00 25.02 ? 42  ILE B CG1   1 
ATOM   3130 C CG2   . ILE F 3 42  ? 41.049 48.651 19.958  1.00 16.65 ? 42  ILE B CG2   1 
ATOM   3131 C CD1   . ILE F 3 42  ? 39.788 48.885 17.390  1.00 18.86 ? 42  ILE B CD1   1 
ATOM   3132 N N     . VAL F 3 43  ? 39.773 48.061 23.258  1.00 30.26 ? 43  VAL B N     1 
ATOM   3133 C CA    . VAL F 3 43  ? 40.179 48.591 24.548  1.00 23.57 ? 43  VAL B CA    1 
ATOM   3134 C C     . VAL F 3 43  ? 41.555 49.266 24.409  1.00 17.98 ? 43  VAL B C     1 
ATOM   3135 O O     . VAL F 3 43  ? 41.772 50.318 24.976  1.00 12.07 ? 43  VAL B O     1 
ATOM   3136 C CB    . VAL F 3 43  ? 40.227 47.425 25.587  1.00 25.57 ? 43  VAL B CB    1 
ATOM   3137 C CG1   . VAL F 3 43  ? 40.902 47.898 26.904  1.00 17.79 ? 43  VAL B CG1   1 
ATOM   3138 C CG2   . VAL F 3 43  ? 38.782 46.871 25.801  1.00 9.45  ? 43  VAL B CG2   1 
ATOM   3139 N N     . LYS F 3 44  ? 42.455 48.679 23.624  1.00 9.65  ? 44  LYS B N     1 
ATOM   3140 C CA    . LYS F 3 44  ? 43.801 49.213 23.415  1.00 10.43 ? 44  LYS B CA    1 
ATOM   3141 C C     . LYS F 3 44  ? 44.162 48.776 21.998  1.00 14.68 ? 44  LYS B C     1 
ATOM   3142 O O     . LYS F 3 44  ? 43.465 47.942 21.435  1.00 13.45 ? 44  LYS B O     1 
ATOM   3143 C CB    . LYS F 3 44  ? 44.747 48.600 24.438  1.00 16.08 ? 44  LYS B CB    1 
ATOM   3144 C CG    . LYS F 3 44  ? 46.169 49.119 24.403  1.00 31.30 ? 44  LYS B CG    1 
ATOM   3145 C CD    . LYS F 3 44  ? 46.953 48.627 25.630  1.00 33.17 ? 44  LYS B CD    1 
ATOM   3146 C CE    . LYS F 3 44  ? 48.472 48.647 25.391  1.00 39.19 ? 44  LYS B CE    1 
ATOM   3147 N NZ    . LYS F 3 44  ? 49.077 50.007 25.218  1.00 38.62 ? 44  LYS B NZ    1 
ATOM   3148 N N     . GLY F 3 45  ? 45.207 49.334 21.402  1.00 18.87 ? 45  GLY B N     1 
ATOM   3149 C CA    . GLY F 3 45  ? 45.566 48.915 20.053  1.00 17.20 ? 45  GLY B CA    1 
ATOM   3150 C C     . GLY F 3 45  ? 44.839 49.646 18.927  1.00 18.22 ? 45  GLY B C     1 
ATOM   3151 O O     . GLY F 3 45  ? 43.882 50.389 19.180  1.00 31.60 ? 45  GLY B O     1 
ATOM   3152 N N     . SER F 3 46  ? 45.325 49.480 17.698  1.00 16.28 ? 46  SER B N     1 
ATOM   3153 C CA    . SER F 3 46  ? 44.759 50.130 16.531  1.00 11.12 ? 46  SER B CA    1 
ATOM   3154 C C     . SER F 3 46  ? 44.410 49.021 15.561  1.00 18.14 ? 46  SER B C     1 
ATOM   3155 O O     . SER F 3 46  ? 44.967 47.914 15.627  1.00 33.36 ? 46  SER B O     1 
ATOM   3156 C CB    . SER F 3 46  ? 45.785 51.052 15.886  1.00 20.59 ? 46  SER B CB    1 
ATOM   3157 O OG    . SER F 3 46  ? 46.886 51.314 16.746  1.00 32.65 ? 46  SER B OG    1 
ATOM   3158 N N     . VAL F 3 47  ? 43.681 49.350 14.516  1.00 17.10 ? 47  VAL B N     1 
ATOM   3159 C CA    . VAL F 3 47  ? 43.141 48.313 13.685  1.00 6.00  ? 47  VAL B CA    1 
ATOM   3160 C C     . VAL F 3 47  ? 42.859 48.853 12.255  1.00 7.50  ? 47  VAL B C     1 
ATOM   3161 O O     . VAL F 3 47  ? 42.327 49.943 12.132  1.00 10.04 ? 47  VAL B O     1 
ATOM   3162 C CB    . VAL F 3 47  ? 41.903 47.870 14.495  1.00 7.03  ? 47  VAL B CB    1 
ATOM   3163 C CG1   . VAL F 3 47  ? 40.656 48.183 13.763  1.00 6.00  ? 47  VAL B CG1   1 
ATOM   3164 C CG2   . VAL F 3 47  ? 42.065 46.424 14.928  1.00 7.47  ? 47  VAL B CG2   1 
ATOM   3165 N N     . ALA F 3 48  ? 43.279 48.166 11.190  1.00 6.08  ? 48  ALA B N     1 
ATOM   3166 C CA    . ALA F 3 48  ? 42.900 48.559 9.808   1.00 6.00  ? 48  ALA B CA    1 
ATOM   3167 C C     . ALA F 3 48  ? 41.692 47.740 9.308   1.00 6.00  ? 48  ALA B C     1 
ATOM   3168 O O     . ALA F 3 48  ? 41.631 46.550 9.514   1.00 6.00  ? 48  ALA B O     1 
ATOM   3169 C CB    . ALA F 3 48  ? 44.091 48.376 8.854   1.00 6.00  ? 48  ALA B CB    1 
ATOM   3170 N N     . VAL F 3 49  ? 40.728 48.392 8.682   1.00 6.00  ? 49  VAL B N     1 
ATOM   3171 C CA    . VAL F 3 49  ? 39.473 47.768 8.206   1.00 6.00  ? 49  VAL B CA    1 
ATOM   3172 C C     . VAL F 3 49  ? 39.518 47.745 6.677   1.00 12.69 ? 49  VAL B C     1 
ATOM   3173 O O     . VAL F 3 49  ? 39.328 48.816 6.077   1.00 12.15 ? 49  VAL B O     1 
ATOM   3174 C CB    . VAL F 3 49  ? 38.212 48.608 8.605   1.00 6.00  ? 49  VAL B CB    1 
ATOM   3175 C CG1   . VAL F 3 49  ? 36.989 48.073 7.945   1.00 6.00  ? 49  VAL B CG1   1 
ATOM   3176 C CG2   . VAL F 3 49  ? 38.004 48.574 10.069  1.00 6.00  ? 49  VAL B CG2   1 
ATOM   3177 N N     . LEU F 3 50  ? 39.737 46.578 6.047   1.00 9.32  ? 50  LEU B N     1 
ATOM   3178 C CA    . LEU F 3 50  ? 39.904 46.504 4.577   1.00 6.00  ? 50  LEU B CA    1 
ATOM   3179 C C     . LEU F 3 50  ? 38.735 45.923 3.832   1.00 6.00  ? 50  LEU B C     1 
ATOM   3180 O O     . LEU F 3 50  ? 37.750 45.507 4.442   1.00 6.00  ? 50  LEU B O     1 
ATOM   3181 C CB    . LEU F 3 50  ? 41.101 45.663 4.192   1.00 6.00  ? 50  LEU B CB    1 
ATOM   3182 C CG    . LEU F 3 50  ? 42.471 46.216 4.394   1.00 6.00  ? 50  LEU B CG    1 
ATOM   3183 C CD1   . LEU F 3 50  ? 43.041 45.609 5.650   1.00 12.30 ? 50  LEU B CD1   1 
ATOM   3184 C CD2   . LEU F 3 50  ? 43.333 45.884 3.217   1.00 6.00  ? 50  LEU B CD2   1 
ATOM   3185 N N     . ILE F 3 51  ? 38.840 45.963 2.504   1.00 6.00  ? 51  ILE B N     1 
ATOM   3186 C CA    . ILE F 3 51  ? 38.026 45.136 1.618   1.00 6.65  ? 51  ILE B CA    1 
ATOM   3187 C C     . ILE F 3 51  ? 38.939 44.694 0.479   1.00 14.43 ? 51  ILE B C     1 
ATOM   3188 O O     . ILE F 3 51  ? 39.959 45.346 0.185   1.00 9.09  ? 51  ILE B O     1 
ATOM   3189 C CB    . ILE F 3 51  ? 36.842 45.859 1.026   1.00 6.00  ? 51  ILE B CB    1 
ATOM   3190 C CG1   . ILE F 3 51  ? 37.277 47.213 0.487   1.00 7.06  ? 51  ILE B CG1   1 
ATOM   3191 C CG2   . ILE F 3 51  ? 35.776 45.950 2.043   1.00 6.00  ? 51  ILE B CG2   1 
ATOM   3192 C CD1   . ILE F 3 51  ? 36.187 47.988 -0.202  1.00 6.00  ? 51  ILE B CD1   1 
ATOM   3193 N N     . LYS F 3 52  ? 38.591 43.555 -0.112  1.00 26.62 ? 52  LYS B N     1 
ATOM   3194 C CA    . LYS F 3 52  ? 39.426 42.874 -1.112  1.00 30.75 ? 52  LYS B CA    1 
ATOM   3195 C C     . LYS F 3 52  ? 38.540 42.355 -2.262  1.00 27.20 ? 52  LYS B C     1 
ATOM   3196 O O     . LYS F 3 52  ? 37.348 42.093 -2.050  1.00 26.94 ? 52  LYS B O     1 
ATOM   3197 C CB    . LYS F 3 52  ? 40.177 41.679 -0.465  1.00 27.67 ? 52  LYS B CB    1 
ATOM   3198 C CG    . LYS F 3 52  ? 41.181 42.016 0.679   1.00 27.06 ? 52  LYS B CG    1 
ATOM   3199 C CD    . LYS F 3 52  ? 41.583 40.818 1.606   1.00 20.31 ? 52  LYS B CD    1 
ATOM   3200 C CE    . LYS F 3 52  ? 42.291 39.692 0.877   1.00 31.84 ? 52  LYS B CE    1 
ATOM   3201 N NZ    . LYS F 3 52  ? 41.423 38.938 -0.115  1.00 34.05 ? 52  LYS B NZ    1 
ATOM   3202 N N     . ASP F 3 53  ? 39.142 42.214 -3.450  1.00 29.38 ? 53  ASP B N     1 
ATOM   3203 C CA    . ASP F 3 53  ? 38.501 41.754 -4.704  1.00 24.03 ? 53  ASP B CA    1 
ATOM   3204 C C     . ASP F 3 53  ? 38.882 40.300 -4.971  1.00 20.96 ? 53  ASP B C     1 
ATOM   3205 O O     . ASP F 3 53  ? 40.046 39.941 -4.833  1.00 23.12 ? 53  ASP B O     1 
ATOM   3206 C CB    . ASP F 3 53  ? 38.987 42.622 -5.897  1.00 31.16 ? 53  ASP B CB    1 
ATOM   3207 C CG    . ASP F 3 53  ? 38.145 42.441 -7.168  1.00 21.99 ? 53  ASP B CG    1 
ATOM   3208 O OD1   . ASP F 3 53  ? 36.922 42.699 -7.127  1.00 29.95 ? 53  ASP B OD1   1 
ATOM   3209 O OD2   . ASP F 3 53  ? 38.705 42.084 -8.221  1.00 18.83 ? 53  ASP B OD2   1 
ATOM   3210 N N     . GLU F 3 54  ? 37.922 39.503 -5.433  1.00 18.50 ? 54  GLU B N     1 
ATOM   3211 C CA    . GLU F 3 54  ? 38.135 38.085 -5.786  1.00 17.07 ? 54  GLU B CA    1 
ATOM   3212 C C     . GLU F 3 54  ? 39.427 37.874 -6.516  1.00 21.49 ? 54  GLU B C     1 
ATOM   3213 O O     . GLU F 3 54  ? 40.088 36.873 -6.289  1.00 27.40 ? 54  GLU B O     1 
ATOM   3214 C CB    . GLU F 3 54  ? 37.011 37.554 -6.664  1.00 16.85 ? 54  GLU B CB    1 
ATOM   3215 C CG    . GLU F 3 54  ? 35.564 37.898 -6.185  1.00 24.93 ? 54  GLU B CG    1 
ATOM   3216 C CD    . GLU F 3 54  ? 35.088 39.322 -6.558  1.00 25.47 ? 54  GLU B CD    1 
ATOM   3217 O OE1   . GLU F 3 54  ? 35.903 40.143 -7.018  1.00 15.89 ? 54  GLU B OE1   1 
ATOM   3218 O OE2   . GLU F 3 54  ? 33.889 39.627 -6.382  1.00 28.37 ? 54  GLU B OE2   1 
ATOM   3219 N N     . GLU F 3 55  ? 39.787 38.815 -7.395  1.00 28.86 ? 55  GLU B N     1 
ATOM   3220 C CA    . GLU F 3 55  ? 41.084 38.757 -8.100  1.00 38.98 ? 55  GLU B CA    1 
ATOM   3221 C C     . GLU F 3 55  ? 42.226 38.992 -7.089  1.00 40.26 ? 55  GLU B C     1 
ATOM   3222 O O     . GLU F 3 55  ? 43.249 38.321 -7.151  1.00 46.88 ? 55  GLU B O     1 
ATOM   3223 C CB    . GLU F 3 55  ? 41.185 39.808 -9.246  1.00 30.78 ? 55  GLU B CB    1 
ATOM   3224 C CG    . GLU F 3 55  ? 40.119 39.701 -10.374 1.00 35.97 ? 55  GLU B CG    1 
ATOM   3225 C CD    . GLU F 3 55  ? 40.534 38.923 -11.664 1.00 33.46 ? 55  GLU B CD    1 
ATOM   3226 O OE1   . GLU F 3 55  ? 39.660 38.187 -12.183 1.00 38.06 ? 55  GLU B OE1   1 
ATOM   3227 O OE2   . GLU F 3 55  ? 41.661 39.088 -12.203 1.00 21.65 ? 55  GLU B OE2   1 
ATOM   3228 N N     . GLY F 3 56  ? 42.079 39.964 -6.197  1.00 38.86 ? 56  GLY B N     1 
ATOM   3229 C CA    . GLY F 3 56  ? 43.053 40.092 -5.143  1.00 32.76 ? 56  GLY B CA    1 
ATOM   3230 C C     . GLY F 3 56  ? 43.368 41.431 -4.533  1.00 32.79 ? 56  GLY B C     1 
ATOM   3231 O O     . GLY F 3 56  ? 43.661 41.473 -3.339  1.00 23.74 ? 56  GLY B O     1 
ATOM   3232 N N     . LYS F 3 57  ? 43.397 42.504 -5.329  1.00 35.45 ? 57  LYS B N     1 
ATOM   3233 C CA    . LYS F 3 57  ? 43.816 43.811 -4.811  1.00 36.79 ? 57  LYS B CA    1 
ATOM   3234 C C     . LYS F 3 57  ? 42.866 44.215 -3.675  1.00 39.76 ? 57  LYS B C     1 
ATOM   3235 O O     . LYS F 3 57  ? 41.676 43.860 -3.690  1.00 45.12 ? 57  LYS B O     1 
ATOM   3236 C CB    . LYS F 3 57  ? 43.805 44.880 -5.926  1.00 36.07 ? 57  LYS B CB    1 
ATOM   3237 C CG    . LYS F 3 57  ? 44.566 46.196 -5.570  1.00 44.72 ? 57  LYS B CG    1 
ATOM   3238 C CD    . LYS F 3 57  ? 44.360 47.351 -6.580  1.00 42.59 ? 57  LYS B CD    1 
ATOM   3239 C CE    . LYS F 3 57  ? 44.810 48.714 -6.004  1.00 38.67 ? 57  LYS B CE    1 
ATOM   3240 N NZ    . LYS F 3 57  ? 44.522 49.851 -6.934  1.00 34.99 ? 57  LYS B NZ    1 
ATOM   3241 N N     . GLU F 3 58  ? 43.407 44.898 -2.671  1.00 38.93 ? 58  GLU B N     1 
ATOM   3242 C CA    . GLU F 3 58  ? 42.634 45.293 -1.498  1.00 40.72 ? 58  GLU B CA    1 
ATOM   3243 C C     . GLU F 3 58  ? 42.600 46.809 -1.356  1.00 35.44 ? 58  GLU B C     1 
ATOM   3244 O O     . GLU F 3 58  ? 43.268 47.549 -2.104  1.00 29.26 ? 58  GLU B O     1 
ATOM   3245 C CB    . GLU F 3 58  ? 43.247 44.714 -0.216  1.00 42.19 ? 58  GLU B CB    1 
ATOM   3246 C CG    . GLU F 3 58  ? 44.178 43.524 -0.414  1.00 40.10 ? 58  GLU B CG    1 
ATOM   3247 C CD    . GLU F 3 58  ? 44.787 43.058 0.881   1.00 38.28 ? 58  GLU B CD    1 
ATOM   3248 O OE1   . GLU F 3 58  ? 44.507 41.911 1.290   1.00 31.80 ? 58  GLU B OE1   1 
ATOM   3249 O OE2   . GLU F 3 58  ? 45.546 43.841 1.485   1.00 38.38 ? 58  GLU B OE2   1 
ATOM   3250 N N     . MET F 3 59  ? 41.883 47.252 -0.334  1.00 28.42 ? 59  MET B N     1 
ATOM   3251 C CA    . MET F 3 59  ? 41.825 48.662 -0.006  1.00 22.78 ? 59  MET B CA    1 
ATOM   3252 C C     . MET F 3 59  ? 41.712 48.735 1.491   1.00 15.88 ? 59  MET B C     1 
ATOM   3253 O O     . MET F 3 59  ? 41.241 47.764 2.117   1.00 14.67 ? 59  MET B O     1 
ATOM   3254 C CB    . MET F 3 59  ? 40.603 49.324 -0.666  1.00 26.82 ? 59  MET B CB    1 
ATOM   3255 C CG    . MET F 3 59  ? 40.426 50.803 -0.346  1.00 21.75 ? 59  MET B CG    1 
ATOM   3256 S SD    . MET F 3 59  ? 39.961 51.898 -1.709  1.00 18.13 ? 59  MET B SD    1 
ATOM   3257 C CE    . MET F 3 59  ? 41.580 52.337 -2.361  1.00 6.00  ? 59  MET B CE    1 
ATOM   3258 N N     . ILE F 3 60  ? 42.322 49.788 2.033   1.00 6.00  ? 60  ILE B N     1 
ATOM   3259 C CA    . ILE F 3 60  ? 42.209 50.217 3.424   1.00 6.00  ? 60  ILE B CA    1 
ATOM   3260 C C     . ILE F 3 60  ? 41.004 51.102 3.359   1.00 6.00  ? 60  ILE B C     1 
ATOM   3261 O O     . ILE F 3 60  ? 41.039 52.051 2.611   1.00 6.00  ? 60  ILE B O     1 
ATOM   3262 C CB    . ILE F 3 60  ? 43.309 51.150 3.839   1.00 6.00  ? 60  ILE B CB    1 
ATOM   3263 C CG1   . ILE F 3 60  ? 44.677 50.541 3.534   1.00 6.00  ? 60  ILE B CG1   1 
ATOM   3264 C CG2   . ILE F 3 60  ? 43.049 51.552 5.268   1.00 6.00  ? 60  ILE B CG2   1 
ATOM   3265 C CD1   . ILE F 3 60  ? 45.493 50.302 4.709   1.00 6.00  ? 60  ILE B CD1   1 
ATOM   3266 N N     . LEU F 3 61  ? 39.971 50.873 4.150   1.00 9.00  ? 61  LEU B N     1 
ATOM   3267 C CA    . LEU F 3 61  ? 38.757 51.740 4.109   1.00 6.00  ? 61  LEU B CA    1 
ATOM   3268 C C     . LEU F 3 61  ? 38.479 52.426 5.465   1.00 9.29  ? 61  LEU B C     1 
ATOM   3269 O O     . LEU F 3 61  ? 37.339 52.661 5.795   1.00 8.16  ? 61  LEU B O     1 
ATOM   3270 C CB    . LEU F 3 61  ? 37.587 50.861 3.696   1.00 6.00  ? 61  LEU B CB    1 
ATOM   3271 C CG    . LEU F 3 61  ? 36.191 51.232 3.289   1.00 6.00  ? 61  LEU B CG    1 
ATOM   3272 C CD1   . LEU F 3 61  ? 35.660 49.997 2.615   1.00 6.45  ? 61  LEU B CD1   1 
ATOM   3273 C CD2   . LEU F 3 61  ? 35.279 51.568 4.437   1.00 10.78 ? 61  LEU B CD2   1 
ATOM   3274 N N     . SER F 3 62  ? 39.527 52.570 6.289   1.00 6.10  ? 62  SER B N     1 
ATOM   3275 C CA    . SER F 3 62  ? 39.548 53.203 7.605   1.00 6.00  ? 62  SER B CA    1 
ATOM   3276 C C     . SER F 3 62  ? 40.543 52.573 8.568   1.00 6.00  ? 62  SER B C     1 
ATOM   3277 O O     . SER F 3 62  ? 41.030 51.470 8.367   1.00 13.12 ? 62  SER B O     1 
ATOM   3278 C CB    . SER F 3 62  ? 38.216 53.173 8.321   1.00 6.00  ? 62  SER B CB    1 
ATOM   3279 O OG    . SER F 3 62  ? 38.204 54.208 9.310   1.00 9.72  ? 62  SER B OG    1 
ATOM   3280 N N     . TYR F 3 63  ? 40.928 53.351 9.561   1.00 6.00  ? 63  TYR B N     1 
ATOM   3281 C CA    . TYR F 3 63  ? 41.695 52.859 10.672  1.00 6.00  ? 63  TYR B CA    1 
ATOM   3282 C C     . TYR F 3 63  ? 40.716 53.062 11.818  1.00 6.00  ? 63  TYR B C     1 
ATOM   3283 O O     . TYR F 3 63  ? 39.688 53.739 11.655  1.00 9.56  ? 63  TYR B O     1 
ATOM   3284 C CB    . TYR F 3 63  ? 42.902 53.712 10.905  1.00 6.00  ? 63  TYR B CB    1 
ATOM   3285 C CG    . TYR F 3 63  ? 44.054 53.421 10.023  1.00 6.00  ? 63  TYR B CG    1 
ATOM   3286 C CD1   . TYR F 3 63  ? 44.375 52.129 9.676   1.00 8.65  ? 63  TYR B CD1   1 
ATOM   3287 C CD2   . TYR F 3 63  ? 44.899 54.432 9.617   1.00 8.41  ? 63  TYR B CD2   1 
ATOM   3288 C CE1   . TYR F 3 63  ? 45.515 51.831 8.952   1.00 6.00  ? 63  TYR B CE1   1 
ATOM   3289 C CE2   . TYR F 3 63  ? 46.054 54.148 8.885   1.00 15.66 ? 63  TYR B CE2   1 
ATOM   3290 C CZ    . TYR F 3 63  ? 46.352 52.832 8.561   1.00 9.86  ? 63  TYR B CZ    1 
ATOM   3291 O OH    . TYR F 3 63  ? 47.511 52.535 7.890   1.00 6.98  ? 63  TYR B OH    1 
ATOM   3292 N N     . LEU F 3 64  ? 40.970 52.414 12.936  1.00 6.00  ? 64  LEU B N     1 
ATOM   3293 C CA    . LEU F 3 64  ? 40.148 52.591 14.107  1.00 6.00  ? 64  LEU B CA    1 
ATOM   3294 C C     . LEU F 3 64  ? 41.115 52.463 15.268  1.00 7.31  ? 64  LEU B C     1 
ATOM   3295 O O     . LEU F 3 64  ? 42.277 52.043 15.075  1.00 9.67  ? 64  LEU B O     1 
ATOM   3296 C CB    . LEU F 3 64  ? 39.041 51.541 14.185  1.00 6.00  ? 64  LEU B CB    1 
ATOM   3297 C CG    . LEU F 3 64  ? 37.605 51.937 13.886  1.00 6.00  ? 64  LEU B CG    1 
ATOM   3298 C CD1   . LEU F 3 64  ? 37.497 53.276 13.270  1.00 7.97  ? 64  LEU B CD1   1 
ATOM   3299 C CD2   . LEU F 3 64  ? 37.066 50.973 12.947  1.00 6.00  ? 64  LEU B CD2   1 
ATOM   3300 N N     . ASN F 3 65  ? 40.662 52.839 16.460  1.00 6.00  ? 65  ASN B N     1 
ATOM   3301 C CA    . ASN F 3 65  ? 41.569 53.029 17.570  1.00 14.89 ? 65  ASN B CA    1 
ATOM   3302 C C     . ASN F 3 65  ? 40.764 52.914 18.856  1.00 18.13 ? 65  ASN B C     1 
ATOM   3303 O O     . ASN F 3 65  ? 39.532 52.665 18.791  1.00 11.50 ? 65  ASN B O     1 
ATOM   3304 C CB    . ASN F 3 65  ? 42.245 54.418 17.428  1.00 24.77 ? 65  ASN B CB    1 
ATOM   3305 C CG    . ASN F 3 65  ? 43.650 54.330 16.837  1.00 26.00 ? 65  ASN B CG    1 
ATOM   3306 O OD1   . ASN F 3 65  ? 44.536 53.788 17.476  1.00 39.09 ? 65  ASN B OD1   1 
ATOM   3307 N ND2   . ASN F 3 65  ? 43.855 54.854 15.623  1.00 12.81 ? 65  ASN B ND2   1 
ATOM   3308 N N     . GLN F 3 66  ? 41.466 53.026 20.003  1.00 15.43 ? 66  GLN B N     1 
ATOM   3309 C CA    . GLN F 3 66  ? 40.890 52.836 21.356  1.00 17.94 ? 66  GLN B CA    1 
ATOM   3310 C C     . GLN F 3 66  ? 39.453 53.310 21.424  1.00 16.46 ? 66  GLN B C     1 
ATOM   3311 O O     . GLN F 3 66  ? 39.114 54.280 20.802  1.00 22.56 ? 66  GLN B O     1 
ATOM   3312 C CB    . GLN F 3 66  ? 41.677 53.613 22.421  1.00 16.05 ? 66  GLN B CB    1 
ATOM   3313 C CG    . GLN F 3 66  ? 42.981 52.994 22.933  1.00 17.16 ? 66  GLN B CG    1 
ATOM   3314 C CD    . GLN F 3 66  ? 43.756 53.914 23.895  1.00 20.64 ? 66  GLN B CD    1 
ATOM   3315 O OE1   . GLN F 3 66  ? 44.991 53.912 23.904  1.00 19.59 ? 66  GLN B OE1   1 
ATOM   3316 N NE2   . GLN F 3 66  ? 43.037 54.709 24.689  1.00 14.82 ? 66  GLN B NE2   1 
ATOM   3317 N N     . GLY F 3 67  ? 38.612 52.638 22.177  1.00 9.32  ? 67  GLY B N     1 
ATOM   3318 C CA    . GLY F 3 67  ? 37.270 53.117 22.306  1.00 6.00  ? 67  GLY B CA    1 
ATOM   3319 C C     . GLY F 3 67  ? 36.544 53.176 20.988  1.00 11.13 ? 67  GLY B C     1 
ATOM   3320 O O     . GLY F 3 67  ? 35.476 53.802 20.932  1.00 15.68 ? 67  GLY B O     1 
ATOM   3321 N N     . ASP F 3 68  ? 37.078 52.585 19.917  1.00 6.24  ? 68  ASP B N     1 
ATOM   3322 C CA    . ASP F 3 68  ? 36.234 52.500 18.725  1.00 11.21 ? 68  ASP B CA    1 
ATOM   3323 C C     . ASP F 3 68  ? 35.534 51.166 18.819  1.00 6.00  ? 68  ASP B C     1 
ATOM   3324 O O     . ASP F 3 68  ? 36.185 50.173 19.105  1.00 14.24 ? 68  ASP B O     1 
ATOM   3325 C CB    . ASP F 3 68  ? 37.055 52.575 17.414  1.00 13.34 ? 68  ASP B CB    1 
ATOM   3326 C CG    . ASP F 3 68  ? 37.291 54.039 16.934  1.00 21.32 ? 68  ASP B CG    1 
ATOM   3327 O OD1   . ASP F 3 68  ? 36.311 54.829 16.885  1.00 27.02 ? 68  ASP B OD1   1 
ATOM   3328 O OD2   . ASP F 3 68  ? 38.451 54.416 16.624  1.00 6.00  ? 68  ASP B OD2   1 
ATOM   3329 N N     . PHE F 3 69  ? 34.213 51.127 18.681  1.00 6.00  ? 69  PHE B N     1 
ATOM   3330 C CA    . PHE F 3 69  ? 33.523 49.821 18.589  1.00 6.00  ? 69  PHE B CA    1 
ATOM   3331 C C     . PHE F 3 69  ? 33.863 49.123 17.220  1.00 8.46  ? 69  PHE B C     1 
ATOM   3332 O O     . PHE F 3 69  ? 34.251 49.807 16.263  1.00 17.39 ? 69  PHE B O     1 
ATOM   3333 C CB    . PHE F 3 69  ? 32.006 50.010 18.677  1.00 9.73  ? 69  PHE B CB    1 
ATOM   3334 C CG    . PHE F 3 69  ? 31.454 50.227 20.087  1.00 25.99 ? 69  PHE B CG    1 
ATOM   3335 C CD1   . PHE F 3 69  ? 30.944 49.166 20.826  1.00 21.92 ? 69  PHE B CD1   1 
ATOM   3336 C CD2   . PHE F 3 69  ? 31.339 51.518 20.634  1.00 33.16 ? 69  PHE B CD2   1 
ATOM   3337 C CE1   . PHE F 3 69  ? 30.325 49.387 22.085  1.00 23.37 ? 69  PHE B CE1   1 
ATOM   3338 C CE2   . PHE F 3 69  ? 30.719 51.738 21.897  1.00 28.38 ? 69  PHE B CE2   1 
ATOM   3339 C CZ    . PHE F 3 69  ? 30.218 50.672 22.612  1.00 24.36 ? 69  PHE B CZ    1 
ATOM   3340 N N     . ILE F 3 70  ? 33.760 47.785 17.125  1.00 11.66 ? 70  ILE B N     1 
ATOM   3341 C CA    . ILE F 3 70  ? 33.889 47.063 15.834  1.00 7.42  ? 70  ILE B CA    1 
ATOM   3342 C C     . ILE F 3 70  ? 32.624 46.213 15.620  1.00 6.25  ? 70  ILE B C     1 
ATOM   3343 O O     . ILE F 3 70  ? 31.688 46.281 16.409  1.00 8.02  ? 70  ILE B O     1 
ATOM   3344 C CB    . ILE F 3 70  ? 35.131 46.120 15.750  1.00 6.00  ? 70  ILE B CB    1 
ATOM   3345 C CG1   . ILE F 3 70  ? 36.388 46.787 16.300  1.00 6.00  ? 70  ILE B CG1   1 
ATOM   3346 C CG2   . ILE F 3 70  ? 35.470 45.868 14.279  1.00 6.00  ? 70  ILE B CG2   1 
ATOM   3347 C CD1   . ILE F 3 70  ? 37.682 46.032 16.054  1.00 6.00  ? 70  ILE B CD1   1 
ATOM   3348 N N     . GLY F 3 71  ? 32.517 45.537 14.487  1.00 6.00  ? 71  GLY B N     1 
ATOM   3349 C CA    . GLY F 3 71  ? 31.332 44.744 14.212  1.00 6.00  ? 71  GLY B CA    1 
ATOM   3350 C C     . GLY F 3 71  ? 29.961 45.335 14.490  1.00 6.00  ? 71  GLY B C     1 
ATOM   3351 O O     . GLY F 3 71  ? 29.019 44.601 14.658  1.00 6.00  ? 71  GLY B O     1 
ATOM   3352 N N     . GLU F 3 72  ? 29.848 46.661 14.497  1.00 16.00 ? 72  GLU B N     1 
ATOM   3353 C CA    . GLU F 3 72  ? 28.584 47.400 14.759  1.00 11.20 ? 72  GLU B CA    1 
ATOM   3354 C C     . GLU F 3 72  ? 27.461 47.184 13.743  1.00 12.46 ? 72  GLU B C     1 
ATOM   3355 O O     . GLU F 3 72  ? 26.275 47.349 14.071  1.00 20.74 ? 72  GLU B O     1 
ATOM   3356 C CB    . GLU F 3 72  ? 28.851 48.912 14.826  1.00 6.00  ? 72  GLU B CB    1 
ATOM   3357 C CG    . GLU F 3 72  ? 30.306 49.401 14.438  1.00 13.29 ? 72  GLU B CG    1 
ATOM   3358 C CD    . GLU F 3 72  ? 30.470 49.902 12.996  1.00 14.18 ? 72  GLU B CD    1 
ATOM   3359 O OE1   . GLU F 3 72  ? 31.613 50.087 12.528  1.00 9.43  ? 72  GLU B OE1   1 
ATOM   3360 O OE2   . GLU F 3 72  ? 29.464 50.140 12.318  1.00 12.45 ? 72  GLU B OE2   1 
ATOM   3361 N N     . LEU F 3 73  ? 27.837 46.810 12.523  1.00 7.09  ? 73  LEU B N     1 
ATOM   3362 C CA    . LEU F 3 73  ? 26.911 46.795 11.398  1.00 6.69  ? 73  LEU B CA    1 
ATOM   3363 C C     . LEU F 3 73  ? 25.911 45.697 11.342  1.00 7.06  ? 73  LEU B C     1 
ATOM   3364 O O     . LEU F 3 73  ? 24.901 45.839 10.665  1.00 21.62 ? 73  LEU B O     1 
ATOM   3365 C CB    . LEU F 3 73  ? 27.691 46.815 10.078  1.00 9.59  ? 73  LEU B CB    1 
ATOM   3366 C CG    . LEU F 3 73  ? 27.685 48.115 9.250   1.00 15.67 ? 73  LEU B CG    1 
ATOM   3367 C CD1   . LEU F 3 73  ? 27.672 49.324 10.152  1.00 10.57 ? 73  LEU B CD1   1 
ATOM   3368 C CD2   . LEU F 3 73  ? 28.937 48.172 8.363   1.00 22.24 ? 73  LEU B CD2   1 
ATOM   3369 N N     . GLY F 3 74  ? 26.182 44.591 12.021  1.00 14.62 ? 74  GLY B N     1 
ATOM   3370 C CA    . GLY F 3 74  ? 25.241 43.475 12.023  1.00 6.00  ? 74  GLY B CA    1 
ATOM   3371 C C     . GLY F 3 74  ? 23.995 43.797 12.803  1.00 6.66  ? 74  GLY B C     1 
ATOM   3372 O O     . GLY F 3 74  ? 22.963 44.048 12.224  1.00 14.20 ? 74  GLY B O     1 
ATOM   3373 N N     . LEU F 3 75  ? 24.181 43.973 14.105  1.00 10.53 ? 75  LEU B N     1 
ATOM   3374 C CA    . LEU F 3 75  ? 23.183 44.316 15.113  1.00 8.05  ? 75  LEU B CA    1 
ATOM   3375 C C     . LEU F 3 75  ? 21.808 44.912 14.765  1.00 14.33 ? 75  LEU B C     1 
ATOM   3376 O O     . LEU F 3 75  ? 20.819 44.590 15.426  1.00 26.71 ? 75  LEU B O     1 
ATOM   3377 C CB    . LEU F 3 75  ? 23.890 45.201 16.120  1.00 6.00  ? 75  LEU B CB    1 
ATOM   3378 C CG    . LEU F 3 75  ? 23.201 45.777 17.362  1.00 15.53 ? 75  LEU B CG    1 
ATOM   3379 C CD1   . LEU F 3 75  ? 22.518 44.728 18.179  1.00 10.40 ? 75  LEU B CD1   1 
ATOM   3380 C CD2   . LEU F 3 75  ? 24.265 46.441 18.202  1.00 14.03 ? 75  LEU B CD2   1 
ATOM   3381 N N     . PHE F 3 76  ? 21.701 45.778 13.770  1.00 21.56 ? 76  PHE B N     1 
ATOM   3382 C CA    . PHE F 3 76  ? 20.383 46.336 13.431  1.00 17.56 ? 76  PHE B CA    1 
ATOM   3383 C C     . PHE F 3 76  ? 19.580 45.432 12.584  1.00 18.61 ? 76  PHE B C     1 
ATOM   3384 O O     . PHE F 3 76  ? 18.375 45.573 12.533  1.00 24.18 ? 76  PHE B O     1 
ATOM   3385 C CB    . PHE F 3 76  ? 20.534 47.657 12.727  1.00 22.46 ? 76  PHE B CB    1 
ATOM   3386 C CG    . PHE F 3 76  ? 21.372 48.589 13.482  1.00 16.97 ? 76  PHE B CG    1 
ATOM   3387 C CD1   . PHE F 3 76  ? 20.919 49.080 14.710  1.00 12.83 ? 76  PHE B CD1   1 
ATOM   3388 C CD2   . PHE F 3 76  ? 22.684 48.798 13.095  1.00 10.84 ? 76  PHE B CD2   1 
ATOM   3389 C CE1   . PHE F 3 76  ? 21.767 49.746 15.549  1.00 22.82 ? 76  PHE B CE1   1 
ATOM   3390 C CE2   . PHE F 3 76  ? 23.554 49.460 13.913  1.00 20.20 ? 76  PHE B CE2   1 
ATOM   3391 C CZ    . PHE F 3 76  ? 23.104 49.941 15.160  1.00 27.43 ? 76  PHE B CZ    1 
ATOM   3392 N N     . GLU F 3 77  ? 20.235 44.504 11.913  1.00 22.12 ? 77  GLU B N     1 
ATOM   3393 C CA    . GLU F 3 77  ? 19.531 43.515 11.117  1.00 25.88 ? 77  GLU B CA    1 
ATOM   3394 C C     . GLU F 3 77  ? 20.022 42.082 11.405  1.00 31.20 ? 77  GLU B C     1 
ATOM   3395 O O     . GLU F 3 77  ? 21.216 41.851 11.694  1.00 38.87 ? 77  GLU B O     1 
ATOM   3396 C CB    . GLU F 3 77  ? 19.705 43.855 9.653   1.00 31.91 ? 77  GLU B CB    1 
ATOM   3397 C CG    . GLU F 3 77  ? 18.509 43.456 8.832   1.00 46.18 ? 77  GLU B CG    1 
ATOM   3398 C CD    . GLU F 3 77  ? 18.433 44.203 7.525   1.00 52.28 ? 77  GLU B CD    1 
ATOM   3399 O OE1   . GLU F 3 77  ? 19.122 43.765 6.568   1.00 54.27 ? 77  GLU B OE1   1 
ATOM   3400 O OE2   . GLU F 3 77  ? 17.686 45.223 7.460   1.00 53.04 ? 77  GLU B OE2   1 
ATOM   3401 N N     . GLU F 3 78  ? 19.126 41.101 11.355  1.00 32.78 ? 78  GLU B N     1 
ATOM   3402 C CA    . GLU F 3 78  ? 19.581 39.776 11.745  1.00 29.73 ? 78  GLU B CA    1 
ATOM   3403 C C     . GLU F 3 78  ? 20.181 38.833 10.716  1.00 31.46 ? 78  GLU B C     1 
ATOM   3404 O O     . GLU F 3 78  ? 19.634 38.597 9.611   1.00 24.56 ? 78  GLU B O     1 
ATOM   3405 C CB    . GLU F 3 78  ? 18.481 39.055 12.515  1.00 33.71 ? 78  GLU B CB    1 
ATOM   3406 C CG    . GLU F 3 78  ? 18.645 39.220 14.043  1.00 42.25 ? 78  GLU B CG    1 
ATOM   3407 C CD    . GLU F 3 78  ? 20.045 38.822 14.578  1.00 47.13 ? 78  GLU B CD    1 
ATOM   3408 O OE1   . GLU F 3 78  ? 20.133 37.854 15.370  1.00 48.39 ? 78  GLU B OE1   1 
ATOM   3409 O OE2   . GLU F 3 78  ? 21.061 39.496 14.258  1.00 56.85 ? 78  GLU B OE2   1 
ATOM   3410 N N     . GLY F 3 79  ? 21.378 38.384 11.096  1.00 24.22 ? 79  GLY B N     1 
ATOM   3411 C CA    . GLY F 3 79  ? 22.158 37.448 10.315  1.00 24.45 ? 79  GLY B CA    1 
ATOM   3412 C C     . GLY F 3 79  ? 22.654 37.970 8.986   1.00 29.22 ? 79  GLY B C     1 
ATOM   3413 O O     . GLY F 3 79  ? 22.069 37.703 7.932   1.00 29.65 ? 79  GLY B O     1 
ATOM   3414 N N     . GLN F 3 80  ? 23.757 38.700 9.018   1.00 31.50 ? 80  GLN B N     1 
ATOM   3415 C CA    . GLN F 3 80  ? 24.311 39.280 7.797   1.00 29.89 ? 80  GLN B CA    1 
ATOM   3416 C C     . GLN F 3 80  ? 25.789 39.034 7.858   1.00 29.02 ? 80  GLN B C     1 
ATOM   3417 O O     . GLN F 3 80  ? 26.330 38.802 8.933   1.00 41.39 ? 80  GLN B O     1 
ATOM   3418 C CB    . GLN F 3 80  ? 24.040 40.794 7.719   1.00 34.67 ? 80  GLN B CB    1 
ATOM   3419 C CG    . GLN F 3 80  ? 22.619 41.190 7.283   1.00 37.24 ? 80  GLN B CG    1 
ATOM   3420 C CD    . GLN F 3 80  ? 22.588 42.565 6.629   1.00 47.02 ? 80  GLN B CD    1 
ATOM   3421 O OE1   . GLN F 3 80  ? 21.825 43.428 7.031   1.00 47.30 ? 80  GLN B OE1   1 
ATOM   3422 N NE2   . GLN F 3 80  ? 23.420 42.767 5.609   1.00 44.59 ? 80  GLN B NE2   1 
ATOM   3423 N N     . GLU F 3 81  ? 26.451 39.063 6.721   1.00 25.23 ? 81  GLU B N     1 
ATOM   3424 C CA    . GLU F 3 81  ? 27.856 38.745 6.708   1.00 21.25 ? 81  GLU B CA    1 
ATOM   3425 C C     . GLU F 3 81  ? 28.676 39.983 7.055   1.00 25.07 ? 81  GLU B C     1 
ATOM   3426 O O     . GLU F 3 81  ? 28.289 41.105 6.715   1.00 26.66 ? 81  GLU B O     1 
ATOM   3427 C CB    . GLU F 3 81  ? 28.236 38.181 5.323   1.00 27.20 ? 81  GLU B CB    1 
ATOM   3428 C CG    . GLU F 3 81  ? 27.939 39.078 4.078   1.00 37.29 ? 81  GLU B CG    1 
ATOM   3429 C CD    . GLU F 3 81  ? 28.019 38.319 2.740   1.00 27.17 ? 81  GLU B CD    1 
ATOM   3430 O OE1   . GLU F 3 81  ? 27.309 38.717 1.780   1.00 20.67 ? 81  GLU B OE1   1 
ATOM   3431 O OE2   . GLU F 3 81  ? 28.783 37.325 2.668   1.00 28.12 ? 81  GLU B OE2   1 
ATOM   3432 N N     . ARG F 3 82  ? 29.771 39.776 7.788   1.00 19.72 ? 82  ARG B N     1 
ATOM   3433 C CA    . ARG F 3 82  ? 30.729 40.819 8.092   1.00 21.15 ? 82  ARG B CA    1 
ATOM   3434 C C     . ARG F 3 82  ? 31.070 41.471 6.773   1.00 27.05 ? 82  ARG B C     1 
ATOM   3435 O O     . ARG F 3 82  ? 31.318 40.769 5.771   1.00 30.72 ? 82  ARG B O     1 
ATOM   3436 C CB    . ARG F 3 82  ? 31.993 40.241 8.727   1.00 11.90 ? 82  ARG B CB    1 
ATOM   3437 C CG    . ARG F 3 82  ? 31.790 39.854 10.176  1.00 18.67 ? 82  ARG B CG    1 
ATOM   3438 C CD    . ARG F 3 82  ? 31.395 41.030 11.017  1.00 15.32 ? 82  ARG B CD    1 
ATOM   3439 N NE    . ARG F 3 82  ? 30.585 40.667 12.180  1.00 25.52 ? 82  ARG B NE    1 
ATOM   3440 C CZ    . ARG F 3 82  ? 31.057 40.317 13.381  1.00 27.38 ? 82  ARG B CZ    1 
ATOM   3441 N NH1   . ARG F 3 82  ? 32.368 40.265 13.627  1.00 19.41 ? 82  ARG B NH1   1 
ATOM   3442 N NH2   . ARG F 3 82  ? 30.201 40.037 14.355  1.00 20.79 ? 82  ARG B NH2   1 
ATOM   3443 N N     . SER F 3 83  ? 31.050 42.811 6.794   1.00 26.41 ? 83  SER B N     1 
ATOM   3444 C CA    . SER F 3 83  ? 31.135 43.673 5.618   1.00 13.88 ? 83  SER B CA    1 
ATOM   3445 C C     . SER F 3 83  ? 32.537 43.991 5.162   1.00 7.05  ? 83  SER B C     1 
ATOM   3446 O O     . SER F 3 83  ? 32.724 44.412 4.056   1.00 6.00  ? 83  SER B O     1 
ATOM   3447 C CB    . SER F 3 83  ? 30.378 44.971 5.909   1.00 6.00  ? 83  SER B CB    1 
ATOM   3448 O OG    . SER F 3 83  ? 30.917 45.612 7.058   1.00 6.00  ? 83  SER B OG    1 
ATOM   3449 N N     . ALA F 3 84  ? 33.533 43.810 6.002   1.00 6.01  ? 84  ALA B N     1 
ATOM   3450 C CA    . ALA F 3 84  ? 34.885 44.151 5.584   1.00 6.00  ? 84  ALA B CA    1 
ATOM   3451 C C     . ALA F 3 84  ? 35.805 43.273 6.376   1.00 6.00  ? 84  ALA B C     1 
ATOM   3452 O O     . ALA F 3 84  ? 35.354 42.448 7.104   1.00 6.00  ? 84  ALA B O     1 
ATOM   3453 C CB    . ALA F 3 84  ? 35.160 45.586 5.882   1.00 6.00  ? 84  ALA B CB    1 
ATOM   3454 N N     . TRP F 3 85  ? 37.088 43.343 6.134   1.00 6.00  ? 85  TRP B N     1 
ATOM   3455 C CA    . TRP F 3 85  ? 38.014 42.631 6.978   1.00 13.33 ? 85  TRP B CA    1 
ATOM   3456 C C     . TRP F 3 85  ? 38.363 43.675 8.044   1.00 19.62 ? 85  TRP B C     1 
ATOM   3457 O O     . TRP F 3 85  ? 37.887 44.820 7.956   1.00 33.09 ? 85  TRP B O     1 
ATOM   3458 C CB    . TRP F 3 85  ? 39.283 42.259 6.204   1.00 27.05 ? 85  TRP B CB    1 
ATOM   3459 C CG    . TRP F 3 85  ? 39.356 40.870 5.596   1.00 33.32 ? 85  TRP B CG    1 
ATOM   3460 C CD1   . TRP F 3 85  ? 39.893 39.739 6.172   1.00 39.96 ? 85  TRP B CD1   1 
ATOM   3461 C CD2   . TRP F 3 85  ? 39.059 40.516 4.246   1.00 39.18 ? 85  TRP B CD2   1 
ATOM   3462 N NE1   . TRP F 3 85  ? 39.969 38.720 5.249   1.00 37.45 ? 85  TRP B NE1   1 
ATOM   3463 C CE2   . TRP F 3 85  ? 39.462 39.177 4.058   1.00 44.46 ? 85  TRP B CE2   1 
ATOM   3464 C CE3   . TRP F 3 85  ? 38.501 41.205 3.161   1.00 43.95 ? 85  TRP B CE3   1 
ATOM   3465 C CZ2   . TRP F 3 85  ? 39.326 38.525 2.829   1.00 52.62 ? 85  TRP B CZ2   1 
ATOM   3466 C CZ3   . TRP F 3 85  ? 38.364 40.552 1.938   1.00 37.92 ? 85  TRP B CZ3   1 
ATOM   3467 C CH2   . TRP F 3 85  ? 38.772 39.237 1.783   1.00 45.22 ? 85  TRP B CH2   1 
ATOM   3468 H HE1   . TRP F 3 85  ? 40.470 37.890 5.340   1.00 0.00  ? 85  TRP B HE1   1 
ATOM   3469 N N     . VAL F 3 86  ? 39.178 43.277 9.031   1.00 18.47 ? 86  VAL B N     1 
ATOM   3470 C CA    . VAL F 3 86  ? 39.803 44.149 10.043  1.00 12.64 ? 86  VAL B CA    1 
ATOM   3471 C C     . VAL F 3 86  ? 40.989 43.308 10.569  1.00 18.96 ? 86  VAL B C     1 
ATOM   3472 O O     . VAL F 3 86  ? 40.813 42.163 10.991  1.00 25.61 ? 86  VAL B O     1 
ATOM   3473 C CB    . VAL F 3 86  ? 38.898 44.480 11.298  1.00 6.00  ? 86  VAL B CB    1 
ATOM   3474 C CG1   . VAL F 3 86  ? 39.655 45.392 12.180  1.00 6.00  ? 86  VAL B CG1   1 
ATOM   3475 C CG2   . VAL F 3 86  ? 37.585 45.134 10.943  1.00 6.00  ? 86  VAL B CG2   1 
ATOM   3476 N N     . ARG F 3 87  ? 42.196 43.842 10.498  1.00 17.06 ? 87  ARG B N     1 
ATOM   3477 C CA    . ARG F 3 87  ? 43.395 43.164 11.008  1.00 13.06 ? 87  ARG B CA    1 
ATOM   3478 C C     . ARG F 3 87  ? 44.131 44.102 11.969  1.00 14.77 ? 87  ARG B C     1 
ATOM   3479 O O     . ARG F 3 87  ? 44.470 45.240 11.616  1.00 15.58 ? 87  ARG B O     1 
ATOM   3480 C CB    . ARG F 3 87  ? 44.360 42.832 9.888   1.00 12.40 ? 87  ARG B CB    1 
ATOM   3481 C CG    . ARG F 3 87  ? 43.729 42.428 8.610   1.00 23.81 ? 87  ARG B CG    1 
ATOM   3482 C CD    . ARG F 3 87  ? 44.845 42.268 7.598   1.00 33.53 ? 87  ARG B CD    1 
ATOM   3483 N NE    . ARG F 3 87  ? 44.404 41.663 6.342   1.00 47.24 ? 87  ARG B NE    1 
ATOM   3484 C CZ    . ARG F 3 87  ? 43.719 40.525 6.227   1.00 46.09 ? 87  ARG B CZ    1 
ATOM   3485 N NH1   . ARG F 3 87  ? 43.362 39.828 7.307   1.00 40.31 ? 87  ARG B NH1   1 
ATOM   3486 N NH2   . ARG F 3 87  ? 43.430 40.063 5.007   1.00 48.40 ? 87  ARG B NH2   1 
ATOM   3487 N N     . ALA F 3 88  ? 44.439 43.611 13.152  1.00 16.41 ? 88  ALA B N     1 
ATOM   3488 C CA    . ALA F 3 88  ? 45.141 44.416 14.130  1.00 17.23 ? 88  ALA B CA    1 
ATOM   3489 C C     . ALA F 3 88  ? 46.359 45.038 13.481  1.00 12.94 ? 88  ALA B C     1 
ATOM   3490 O O     . ALA F 3 88  ? 47.158 44.340 12.829  1.00 9.58  ? 88  ALA B O     1 
ATOM   3491 C CB    . ALA F 3 88  ? 45.558 43.558 15.271  1.00 15.67 ? 88  ALA B CB    1 
ATOM   3492 N N     . LYS F 3 89  ? 46.443 46.357 13.570  1.00 6.01  ? 89  LYS B N     1 
ATOM   3493 C CA    . LYS F 3 89  ? 47.588 47.052 13.014  1.00 11.31 ? 89  LYS B CA    1 
ATOM   3494 C C     . LYS F 3 89  ? 48.695 46.781 13.981  1.00 6.81  ? 89  LYS B C     1 
ATOM   3495 O O     . LYS F 3 89  ? 49.863 46.676 13.607  1.00 10.55 ? 89  LYS B O     1 
ATOM   3496 C CB    . LYS F 3 89  ? 47.331 48.544 12.928  1.00 21.03 ? 89  LYS B CB    1 
ATOM   3497 C CG    . LYS F 3 89  ? 46.711 49.014 11.619  1.00 38.39 ? 89  LYS B CG    1 
ATOM   3498 C CD    . LYS F 3 89  ? 47.773 49.638 10.688  1.00 44.27 ? 89  LYS B CD    1 
ATOM   3499 C CE    . LYS F 3 89  ? 48.181 51.046 11.127  1.00 38.36 ? 89  LYS B CE    1 
ATOM   3500 N NZ    . LYS F 3 89  ? 49.088 51.713 10.140  1.00 45.47 ? 89  LYS B NZ    1 
ATOM   3501 N N     . THR F 3 90  ? 48.301 46.613 15.229  1.00 6.00  ? 90  THR B N     1 
ATOM   3502 C CA    . THR F 3 90  ? 49.217 46.261 16.300  1.00 7.98  ? 90  THR B CA    1 
ATOM   3503 C C     . THR F 3 90  ? 48.438 45.630 17.441  1.00 8.38  ? 90  THR B C     1 
ATOM   3504 O O     . THR F 3 90  ? 47.199 45.606 17.411  1.00 6.00  ? 90  THR B O     1 
ATOM   3505 C CB    . THR F 3 90  ? 49.946 47.480 16.847  1.00 15.08 ? 90  THR B CB    1 
ATOM   3506 O OG1   . THR F 3 90  ? 49.021 48.582 16.917  1.00 12.04 ? 90  THR B OG1   1 
ATOM   3507 C CG2   . THR F 3 90  ? 51.205 47.795 15.992  1.00 11.73 ? 90  THR B CG2   1 
ATOM   3508 N N     . ALA F 3 91  ? 49.167 45.174 18.462  1.00 8.55  ? 91  ALA B N     1 
ATOM   3509 C CA    . ALA F 3 91  ? 48.578 44.483 19.606  1.00 9.03  ? 91  ALA B CA    1 
ATOM   3510 C C     . ALA F 3 91  ? 47.395 45.242 20.179  1.00 10.80 ? 91  ALA B C     1 
ATOM   3511 O O     . ALA F 3 91  ? 47.509 46.419 20.552  1.00 22.78 ? 91  ALA B O     1 
ATOM   3512 C CB    . ALA F 3 91  ? 49.591 44.320 20.628  1.00 6.00  ? 91  ALA B CB    1 
ATOM   3513 N N     . CYS F 3 92  ? 46.259 44.576 20.234  1.00 8.08  ? 92  CYS B N     1 
ATOM   3514 C CA    . CYS F 3 92  ? 45.041 45.194 20.708  1.00 10.97 ? 92  CYS B CA    1 
ATOM   3515 C C     . CYS F 3 92  ? 44.449 44.400 21.866  1.00 17.90 ? 92  CYS B C     1 
ATOM   3516 O O     . CYS F 3 92  ? 44.607 43.176 21.956  1.00 13.21 ? 92  CYS B O     1 
ATOM   3517 C CB    . CYS F 3 92  ? 43.995 45.259 19.587  1.00 6.00  ? 92  CYS B CB    1 
ATOM   3518 S SG    . CYS F 3 92  ? 44.660 45.839 18.042  1.00 6.00  ? 92  CYS B SG    1 
ATOM   3519 N N     . GLU F 3 93  ? 43.772 45.118 22.748  1.00 20.81 ? 93  GLU B N     1 
ATOM   3520 C CA    . GLU F 3 93  ? 42.960 44.516 23.777  1.00 21.36 ? 93  GLU B CA    1 
ATOM   3521 C C     . GLU F 3 93  ? 41.568 44.832 23.230  1.00 25.37 ? 93  GLU B C     1 
ATOM   3522 O O     . GLU F 3 93  ? 41.260 46.010 23.119  1.00 26.81 ? 93  GLU B O     1 
ATOM   3523 C CB    . GLU F 3 93  ? 43.170 45.243 25.088  1.00 27.39 ? 93  GLU B CB    1 
ATOM   3524 C CG    . GLU F 3 93  ? 43.783 44.445 26.237  1.00 32.65 ? 93  GLU B CG    1 
ATOM   3525 C CD    . GLU F 3 93  ? 44.060 45.346 27.454  1.00 46.78 ? 93  GLU B CD    1 
ATOM   3526 O OE1   . GLU F 3 93  ? 45.228 45.827 27.574  1.00 42.45 ? 93  GLU B OE1   1 
ATOM   3527 O OE2   . GLU F 3 93  ? 43.100 45.608 28.253  1.00 39.58 ? 93  GLU B OE2   1 
ATOM   3528 N N     . VAL F 3 94  ? 40.800 43.831 22.782  1.00 22.28 ? 94  VAL B N     1 
ATOM   3529 C CA    . VAL F 3 94  ? 39.427 44.006 22.280  1.00 15.32 ? 94  VAL B CA    1 
ATOM   3530 C C     . VAL F 3 94  ? 38.484 43.248 23.207  1.00 14.81 ? 94  VAL B C     1 
ATOM   3531 O O     . VAL F 3 94  ? 38.851 42.189 23.703  1.00 29.05 ? 94  VAL B O     1 
ATOM   3532 C CB    . VAL F 3 94  ? 39.294 43.444 20.828  1.00 23.47 ? 94  VAL B CB    1 
ATOM   3533 C CG1   . VAL F 3 94  ? 37.837 42.996 20.517  1.00 8.92  ? 94  VAL B CG1   1 
ATOM   3534 C CG2   . VAL F 3 94  ? 39.702 44.527 19.849  1.00 29.66 ? 94  VAL B CG2   1 
ATOM   3535 N N     . ALA F 3 95  ? 37.287 43.780 23.439  1.00 16.39 ? 95  ALA B N     1 
ATOM   3536 C CA    . ALA F 3 95  ? 36.271 43.199 24.340  1.00 17.05 ? 95  ALA B CA    1 
ATOM   3537 C C     . ALA F 3 95  ? 35.227 42.617 23.433  1.00 13.72 ? 95  ALA B C     1 
ATOM   3538 O O     . ALA F 3 95  ? 35.291 42.876 22.229  1.00 22.27 ? 95  ALA B O     1 
ATOM   3539 C CB    . ALA F 3 95  ? 35.615 44.305 25.232  1.00 8.04  ? 95  ALA B CB    1 
ATOM   3540 N N     . GLU F 3 96  ? 34.269 41.856 23.970  1.00 11.39 ? 96  GLU B N     1 
ATOM   3541 C CA    . GLU F 3 96  ? 33.160 41.418 23.140  1.00 6.00  ? 96  GLU B CA    1 
ATOM   3542 C C     . GLU F 3 96  ? 31.890 40.893 23.750  1.00 7.63  ? 96  GLU B C     1 
ATOM   3543 O O     . GLU F 3 96  ? 31.863 40.348 24.864  1.00 20.25 ? 96  GLU B O     1 
ATOM   3544 C CB    . GLU F 3 96  ? 33.635 40.424 22.116  1.00 7.65  ? 96  GLU B CB    1 
ATOM   3545 C CG    . GLU F 3 96  ? 34.280 39.179 22.578  1.00 22.69 ? 96  GLU B CG    1 
ATOM   3546 C CD    . GLU F 3 96  ? 34.903 38.464 21.384  1.00 32.71 ? 96  GLU B CD    1 
ATOM   3547 O OE1   . GLU F 3 96  ? 36.143 38.585 21.204  1.00 38.11 ? 96  GLU B OE1   1 
ATOM   3548 O OE2   . GLU F 3 96  ? 34.145 37.836 20.599  1.00 34.32 ? 96  GLU B OE2   1 
ATOM   3549 N N     . ILE F 3 97  ? 30.814 41.136 23.019  1.00 6.00  ? 97  ILE B N     1 
ATOM   3550 C CA    . ILE F 3 97  ? 29.461 40.834 23.456  1.00 6.84  ? 97  ILE B CA    1 
ATOM   3551 C C     . ILE F 3 97  ? 28.752 40.265 22.254  1.00 9.86  ? 97  ILE B C     1 
ATOM   3552 O O     . ILE F 3 97  ? 29.159 40.480 21.094  1.00 14.75 ? 97  ILE B O     1 
ATOM   3553 C CB    . ILE F 3 97  ? 28.688 42.122 23.930  1.00 10.64 ? 97  ILE B CB    1 
ATOM   3554 C CG1   . ILE F 3 97  ? 29.488 42.797 25.041  1.00 11.35 ? 97  ILE B CG1   1 
ATOM   3555 C CG2   . ILE F 3 97  ? 27.252 41.767 24.397  1.00 6.00  ? 97  ILE B CG2   1 
ATOM   3556 C CD1   . ILE F 3 97  ? 28.679 43.392 26.153  1.00 17.60 ? 97  ILE B CD1   1 
ATOM   3557 N N     . SER F 3 98  ? 27.735 39.469 22.520  1.00 8.31  ? 98  SER B N     1 
ATOM   3558 C CA    . SER F 3 98  ? 26.995 38.893 21.417  1.00 8.95  ? 98  SER B CA    1 
ATOM   3559 C C     . SER F 3 98  ? 26.069 39.982 21.041  1.00 6.00  ? 98  SER B C     1 
ATOM   3560 O O     . SER F 3 98  ? 25.792 40.843 21.860  1.00 9.27  ? 98  SER B O     1 
ATOM   3561 C CB    . SER F 3 98  ? 26.208 37.662 21.877  1.00 6.00  ? 98  SER B CB    1 
ATOM   3562 O OG    . SER F 3 98  ? 25.432 37.948 23.018  1.00 22.05 ? 98  SER B OG    1 
ATOM   3563 N N     . TYR F 3 99  ? 25.506 39.936 19.859  1.00 13.95 ? 99  TYR B N     1 
ATOM   3564 C CA    . TYR F 3 99  ? 24.503 40.948 19.600  1.00 21.93 ? 99  TYR B CA    1 
ATOM   3565 C C     . TYR F 3 99  ? 23.356 40.612 20.547  1.00 20.09 ? 99  TYR B C     1 
ATOM   3566 O O     . TYR F 3 99  ? 22.977 41.439 21.356  1.00 21.38 ? 99  TYR B O     1 
ATOM   3567 C CB    . TYR F 3 99  ? 24.039 40.950 18.117  1.00 16.44 ? 99  TYR B CB    1 
ATOM   3568 C CG    . TYR F 3 99  ? 25.102 41.396 17.124  1.00 6.00  ? 99  TYR B CG    1 
ATOM   3569 C CD1   . TYR F 3 99  ? 26.375 41.707 17.543  1.00 6.00  ? 99  TYR B CD1   1 
ATOM   3570 C CD2   . TYR F 3 99  ? 24.852 41.412 15.762  1.00 12.54 ? 99  TYR B CD2   1 
ATOM   3571 C CE1   . TYR F 3 99  ? 27.382 42.013 16.661  1.00 6.00  ? 99  TYR B CE1   1 
ATOM   3572 C CE2   . TYR F 3 99  ? 25.874 41.716 14.843  1.00 10.16 ? 99  TYR B CE2   1 
ATOM   3573 C CZ    . TYR F 3 99  ? 27.142 42.006 15.317  1.00 11.37 ? 99  TYR B CZ    1 
ATOM   3574 O OH    . TYR F 3 99  ? 28.204 42.190 14.468  1.00 17.50 ? 99  TYR B OH    1 
ATOM   3575 N N     . LYS F 3 100 ? 22.965 39.342 20.576  1.00 26.13 ? 100 LYS B N     1 
ATOM   3576 C CA    . LYS F 3 100 ? 21.808 38.878 21.347  1.00 25.06 ? 100 LYS B CA    1 
ATOM   3577 C C     . LYS F 3 100 ? 21.800 39.437 22.755  1.00 21.87 ? 100 LYS B C     1 
ATOM   3578 O O     . LYS F 3 100 ? 20.746 39.752 23.289  1.00 21.84 ? 100 LYS B O     1 
ATOM   3579 C CB    . LYS F 3 100 ? 21.788 37.344 21.399  1.00 33.36 ? 100 LYS B CB    1 
ATOM   3580 C CG    . LYS F 3 100 ? 21.612 36.621 20.043  1.00 27.87 ? 100 LYS B CG    1 
ATOM   3581 C CD    . LYS F 3 100 ? 22.887 36.616 19.211  1.00 28.33 ? 100 LYS B CD    1 
ATOM   3582 C CE    . LYS F 3 100 ? 24.013 35.778 19.849  1.00 24.04 ? 100 LYS B CE    1 
ATOM   3583 N NZ    . LYS F 3 100 ? 25.335 35.929 19.147  1.00 18.19 ? 100 LYS B NZ    1 
ATOM   3584 N N     . LYS F 3 101 ? 22.993 39.581 23.325  1.00 22.40 ? 101 LYS B N     1 
ATOM   3585 C CA    . LYS F 3 101 ? 23.186 40.236 24.617  1.00 26.65 ? 101 LYS B CA    1 
ATOM   3586 C C     . LYS F 3 101 ? 23.223 41.784 24.499  1.00 25.65 ? 101 LYS B C     1 
ATOM   3587 O O     . LYS F 3 101 ? 22.475 42.456 25.188  1.00 27.07 ? 101 LYS B O     1 
ATOM   3588 C CB    . LYS F 3 101 ? 24.490 39.751 25.252  1.00 33.30 ? 101 LYS B CB    1 
ATOM   3589 C CG    . LYS F 3 101 ? 24.469 39.615 26.774  1.00 36.43 ? 101 LYS B CG    1 
ATOM   3590 C CD    . LYS F 3 101 ? 25.361 40.630 27.468  1.00 36.64 ? 101 LYS B CD    1 
ATOM   3591 C CE    . LYS F 3 101 ? 25.292 40.466 28.986  1.00 39.66 ? 101 LYS B CE    1 
ATOM   3592 N NZ    . LYS F 3 101 ? 23.889 40.400 29.560  1.00 38.91 ? 101 LYS B NZ    1 
ATOM   3593 N N     . PHE F 3 102 ? 24.088 42.343 23.647  1.00 25.72 ? 102 PHE B N     1 
ATOM   3594 C CA    . PHE F 3 102 ? 24.248 43.819 23.473  1.00 28.72 ? 102 PHE B CA    1 
ATOM   3595 C C     . PHE F 3 102 ? 22.950 44.630 23.506  1.00 26.78 ? 102 PHE B C     1 
ATOM   3596 O O     . PHE F 3 102 ? 22.731 45.502 24.373  1.00 22.12 ? 102 PHE B O     1 
ATOM   3597 C CB    . PHE F 3 102 ? 24.943 44.111 22.144  1.00 24.79 ? 102 PHE B CB    1 
ATOM   3598 C CG    . PHE F 3 102 ? 25.369 45.516 21.980  1.00 18.38 ? 102 PHE B CG    1 
ATOM   3599 C CD1   . PHE F 3 102 ? 26.576 45.936 22.486  1.00 19.78 ? 102 PHE B CD1   1 
ATOM   3600 C CD2   . PHE F 3 102 ? 24.558 46.424 21.331  1.00 27.61 ? 102 PHE B CD2   1 
ATOM   3601 C CE1   . PHE F 3 102 ? 26.989 47.268 22.355  1.00 28.54 ? 102 PHE B CE1   1 
ATOM   3602 C CE2   . PHE F 3 102 ? 24.950 47.756 21.187  1.00 31.25 ? 102 PHE B CE2   1 
ATOM   3603 C CZ    . PHE F 3 102 ? 26.180 48.181 21.706  1.00 32.58 ? 102 PHE B CZ    1 
ATOM   3604 N N     . ARG F 3 103 ? 22.059 44.261 22.601  1.00 18.71 ? 103 ARG B N     1 
ATOM   3605 C CA    . ARG F 3 103 ? 20.748 44.871 22.472  1.00 19.79 ? 103 ARG B CA    1 
ATOM   3606 C C     . ARG F 3 103 ? 20.006 44.941 23.813  1.00 23.92 ? 103 ARG B C     1 
ATOM   3607 O O     . ARG F 3 103 ? 18.982 45.614 23.914  1.00 29.87 ? 103 ARG B O     1 
ATOM   3608 C CB    . ARG F 3 103 ? 19.916 44.081 21.443  1.00 19.72 ? 103 ARG B CB    1 
ATOM   3609 C CG    . ARG F 3 103 ? 20.764 43.085 20.587  1.00 20.71 ? 103 ARG B CG    1 
ATOM   3610 C CD    . ARG F 3 103 ? 20.020 42.326 19.483  1.00 32.38 ? 103 ARG B CD    1 
ATOM   3611 N NE    . ARG F 3 103 ? 20.745 41.127 19.033  1.00 28.57 ? 103 ARG B NE    1 
ATOM   3612 C CZ    . ARG F 3 103 ? 20.718 40.634 17.794  1.00 28.08 ? 103 ARG B CZ    1 
ATOM   3613 N NH1   . ARG F 3 103 ? 20.020 41.232 16.841  1.00 18.60 ? 103 ARG B NH1   1 
ATOM   3614 N NH2   . ARG F 3 103 ? 21.300 39.475 17.536  1.00 33.69 ? 103 ARG B NH2   1 
ATOM   3615 N N     . GLN F 3 104 ? 20.520 44.244 24.829  1.00 31.59 ? 104 GLN B N     1 
ATOM   3616 C CA    . GLN F 3 104 ? 19.960 44.212 26.187  1.00 31.99 ? 104 GLN B CA    1 
ATOM   3617 C C     . GLN F 3 104 ? 20.551 45.345 26.987  1.00 30.43 ? 104 GLN B C     1 
ATOM   3618 O O     . GLN F 3 104 ? 19.827 46.105 27.660  1.00 29.21 ? 104 GLN B O     1 
ATOM   3619 C CB    . GLN F 3 104 ? 20.286 42.873 26.886  1.00 44.97 ? 104 GLN B CB    1 
ATOM   3620 C CG    . GLN F 3 104 ? 19.548 42.601 28.224  1.00 55.90 ? 104 GLN B CG    1 
ATOM   3621 C CD    . GLN F 3 104 ? 19.852 41.229 28.817  1.00 52.83 ? 104 GLN B CD    1 
ATOM   3622 O OE1   . GLN F 3 104 ? 20.686 41.102 29.718  1.00 49.39 ? 104 GLN B OE1   1 
ATOM   3623 N NE2   . GLN F 3 104 ? 19.166 40.198 28.317  1.00 56.27 ? 104 GLN B NE2   1 
ATOM   3624 N N     . LEU F 3 105 ? 21.867 45.475 26.907  1.00 19.60 ? 105 LEU B N     1 
ATOM   3625 C CA    . LEU F 3 105 ? 22.509 46.590 27.546  1.00 15.94 ? 105 LEU B CA    1 
ATOM   3626 C C     . LEU F 3 105 ? 21.719 47.778 27.037  1.00 20.70 ? 105 LEU B C     1 
ATOM   3627 O O     . LEU F 3 105 ? 21.257 48.587 27.827  1.00 22.80 ? 105 LEU B O     1 
ATOM   3628 C CB    . LEU F 3 105 ? 23.945 46.716 27.092  1.00 16.11 ? 105 LEU B CB    1 
ATOM   3629 C CG    . LEU F 3 105 ? 25.032 45.890 27.745  1.00 19.62 ? 105 LEU B CG    1 
ATOM   3630 C CD1   . LEU F 3 105 ? 24.443 44.628 28.215  1.00 20.03 ? 105 LEU B CD1   1 
ATOM   3631 C CD2   . LEU F 3 105 ? 26.167 45.640 26.761  1.00 8.89  ? 105 LEU B CD2   1 
ATOM   3632 N N     . ILE F 3 106 ? 21.383 47.747 25.741  1.00 26.71 ? 106 ILE B N     1 
ATOM   3633 C CA    . ILE F 3 106 ? 20.647 48.848 25.116  1.00 27.41 ? 106 ILE B CA    1 
ATOM   3634 C C     . ILE F 3 106 ? 19.305 49.107 25.771  1.00 23.01 ? 106 ILE B C     1 
ATOM   3635 O O     . ILE F 3 106 ? 19.070 50.198 26.262  1.00 31.35 ? 106 ILE B O     1 
ATOM   3636 C CB    . ILE F 3 106 ? 20.445 48.613 23.583  1.00 24.11 ? 106 ILE B CB    1 
ATOM   3637 C CG1   . ILE F 3 106 ? 21.702 49.061 22.818  1.00 21.33 ? 106 ILE B CG1   1 
ATOM   3638 C CG2   . ILE F 3 106 ? 19.269 49.426 23.057  1.00 25.43 ? 106 ILE B CG2   1 
ATOM   3639 C CD1   . ILE F 3 106 ? 21.687 48.646 21.341  1.00 15.44 ? 106 ILE B CD1   1 
ATOM   3640 N N     . GLN F 3 107 ? 18.431 48.128 25.835  1.00 22.38 ? 107 GLN B N     1 
ATOM   3641 C CA    . GLN F 3 107 ? 17.163 48.410 26.470  1.00 25.94 ? 107 GLN B CA    1 
ATOM   3642 C C     . GLN F 3 107 ? 17.276 48.352 28.003  1.00 28.44 ? 107 GLN B C     1 
ATOM   3643 O O     . GLN F 3 107 ? 16.254 48.294 28.686  1.00 38.08 ? 107 GLN B O     1 
ATOM   3644 C CB    . GLN F 3 107 ? 16.096 47.441 25.963  1.00 21.06 ? 107 GLN B CB    1 
ATOM   3645 C CG    . GLN F 3 107 ? 16.006 47.428 24.450  1.00 29.69 ? 107 GLN B CG    1 
ATOM   3646 C CD    . GLN F 3 107 ? 14.579 47.480 23.945  1.00 37.99 ? 107 GLN B CD    1 
ATOM   3647 O OE1   . GLN F 3 107 ? 14.120 48.518 23.445  1.00 34.33 ? 107 GLN B OE1   1 
ATOM   3648 N NE2   . GLN F 3 107 ? 13.863 46.356 24.056  1.00 37.50 ? 107 GLN B NE2   1 
ATOM   3649 N N     . VAL F 3 108 ? 18.490 48.300 28.553  1.00 29.14 ? 108 VAL B N     1 
ATOM   3650 C CA    . VAL F 3 108 ? 18.649 48.516 29.999  1.00 31.36 ? 108 VAL B CA    1 
ATOM   3651 C C     . VAL F 3 108 ? 19.313 49.908 30.336  1.00 36.22 ? 108 VAL B C     1 
ATOM   3652 O O     . VAL F 3 108 ? 19.125 50.415 31.450  1.00 35.98 ? 108 VAL B O     1 
ATOM   3653 C CB    . VAL F 3 108 ? 19.395 47.281 30.638  1.00 32.29 ? 108 VAL B CB    1 
ATOM   3654 C CG1   . VAL F 3 108 ? 20.013 47.606 31.965  1.00 27.74 ? 108 VAL B CG1   1 
ATOM   3655 C CG2   . VAL F 3 108 ? 18.370 46.194 30.905  1.00 28.64 ? 108 VAL B CG2   1 
ATOM   3656 N N     . ASN F 3 109 ? 20.017 50.537 29.369  1.00 37.25 ? 109 ASN B N     1 
ATOM   3657 C CA    . ASN F 3 109 ? 20.418 51.992 29.400  1.00 38.88 ? 109 ASN B CA    1 
ATOM   3658 C C     . ASN F 3 109 ? 20.860 52.585 28.036  1.00 35.04 ? 109 ASN B C     1 
ATOM   3659 O O     . ASN F 3 109 ? 22.012 52.393 27.607  1.00 33.49 ? 109 ASN B O     1 
ATOM   3660 C CB    . ASN F 3 109 ? 21.572 52.308 30.376  1.00 35.98 ? 109 ASN B CB    1 
ATOM   3661 C CG    . ASN F 3 109 ? 22.099 53.736 30.193  1.00 27.23 ? 109 ASN B CG    1 
ATOM   3662 O OD1   . ASN F 3 109 ? 23.284 53.956 29.982  1.00 20.40 ? 109 ASN B OD1   1 
ATOM   3663 N ND2   . ASN F 3 109 ? 21.190 54.696 30.182  1.00 23.63 ? 109 ASN B ND2   1 
ATOM   3664 N N     . PRO F 3 110 ? 19.987 53.403 27.404  1.00 30.35 ? 110 PRO B N     1 
ATOM   3665 C CA    . PRO F 3 110 ? 20.138 53.779 25.989  1.00 28.82 ? 110 PRO B CA    1 
ATOM   3666 C C     . PRO F 3 110 ? 21.268 54.723 25.604  1.00 27.05 ? 110 PRO B C     1 
ATOM   3667 O O     . PRO F 3 110 ? 21.391 55.081 24.435  1.00 27.76 ? 110 PRO B O     1 
ATOM   3668 C CB    . PRO F 3 110 ? 18.759 54.334 25.619  1.00 26.08 ? 110 PRO B CB    1 
ATOM   3669 C CG    . PRO F 3 110 ? 17.816 53.497 26.500  1.00 21.80 ? 110 PRO B CG    1 
ATOM   3670 C CD    . PRO F 3 110 ? 18.576 53.613 27.833  1.00 28.49 ? 110 PRO B CD    1 
ATOM   3671 N N     . ASP F 3 111 ? 22.158 55.047 26.534  1.00 28.95 ? 111 ASP B N     1 
ATOM   3672 C CA    . ASP F 3 111 ? 23.229 55.980 26.203  1.00 29.82 ? 111 ASP B CA    1 
ATOM   3673 C C     . ASP F 3 111 ? 24.239 55.289 25.319  1.00 29.79 ? 111 ASP B C     1 
ATOM   3674 O O     . ASP F 3 111 ? 24.806 55.945 24.445  1.00 36.31 ? 111 ASP B O     1 
ATOM   3675 C CB    . ASP F 3 111 ? 23.940 56.523 27.466  1.00 34.90 ? 111 ASP B CB    1 
ATOM   3676 C CG    . ASP F 3 111 ? 25.049 57.554 27.140  1.00 37.35 ? 111 ASP B CG    1 
ATOM   3677 O OD1   . ASP F 3 111 ? 24.768 58.518 26.392  1.00 35.65 ? 111 ASP B OD1   1 
ATOM   3678 O OD2   . ASP F 3 111 ? 26.205 57.401 27.632  1.00 35.98 ? 111 ASP B OD2   1 
ATOM   3679 N N     . ILE F 3 112 ? 24.495 53.991 25.530  1.00 24.43 ? 112 ILE B N     1 
ATOM   3680 C CA    . ILE F 3 112 ? 25.503 53.314 24.690  1.00 18.06 ? 112 ILE B CA    1 
ATOM   3681 C C     . ILE F 3 112 ? 25.045 53.275 23.244  1.00 13.79 ? 112 ILE B C     1 
ATOM   3682 O O     . ILE F 3 112 ? 25.878 53.433 22.356  1.00 15.10 ? 112 ILE B O     1 
ATOM   3683 C CB    . ILE F 3 112 ? 25.862 51.805 25.076  1.00 19.64 ? 112 ILE B CB    1 
ATOM   3684 C CG1   . ILE F 3 112 ? 24.842 51.205 26.028  1.00 13.77 ? 112 ILE B CG1   1 
ATOM   3685 C CG2   . ILE F 3 112 ? 27.257 51.749 25.657  1.00 15.81 ? 112 ILE B CG2   1 
ATOM   3686 C CD1   . ILE F 3 112 ? 25.188 49.836 26.385  1.00 30.65 ? 112 ILE B CD1   1 
ATOM   3687 N N     . LEU F 3 113 ? 23.745 53.157 22.975  1.00 7.42  ? 113 LEU B N     1 
ATOM   3688 C CA    . LEU F 3 113 ? 23.372 53.187 21.559  1.00 15.01 ? 113 LEU B CA    1 
ATOM   3689 C C     . LEU F 3 113 ? 23.571 54.612 20.998  1.00 21.18 ? 113 LEU B C     1 
ATOM   3690 O O     . LEU F 3 113 ? 23.577 54.842 19.778  1.00 28.36 ? 113 LEU B O     1 
ATOM   3691 C CB    . LEU F 3 113 ? 21.939 52.713 21.342  1.00 6.00  ? 113 LEU B CB    1 
ATOM   3692 C CG    . LEU F 3 113 ? 21.683 52.579 19.839  1.00 6.00  ? 113 LEU B CG    1 
ATOM   3693 C CD1   . LEU F 3 113 ? 22.707 51.676 19.187  1.00 6.00  ? 113 LEU B CD1   1 
ATOM   3694 C CD2   . LEU F 3 113 ? 20.296 52.032 19.623  1.00 11.32 ? 113 LEU B CD2   1 
ATOM   3695 N N     . MET F 3 114 ? 23.770 55.571 21.896  1.00 21.38 ? 114 MET B N     1 
ATOM   3696 C CA    . MET F 3 114 ? 24.164 56.873 21.452  1.00 15.01 ? 114 MET B CA    1 
ATOM   3697 C C     . MET F 3 114 ? 25.623 56.714 21.122  1.00 8.79  ? 114 MET B C     1 
ATOM   3698 O O     . MET F 3 114 ? 25.923 56.623 19.951  1.00 16.65 ? 114 MET B O     1 
ATOM   3699 C CB    . MET F 3 114 ? 23.882 57.887 22.541  1.00 19.79 ? 114 MET B CB    1 
ATOM   3700 C CG    . MET F 3 114 ? 22.395 58.163 22.600  1.00 16.20 ? 114 MET B CG    1 
ATOM   3701 S SD    . MET F 3 114 ? 21.883 58.522 20.892  1.00 24.12 ? 114 MET B SD    1 
ATOM   3702 C CE    . MET F 3 114 ? 22.290 60.275 20.805  1.00 21.90 ? 114 MET B CE    1 
ATOM   3703 N N     . ARG F 3 115 ? 26.471 56.441 22.107  1.00 9.59  ? 115 ARG B N     1 
ATOM   3704 C CA    . ARG F 3 115 ? 27.919 56.217 21.892  1.00 23.52 ? 115 ARG B CA    1 
ATOM   3705 C C     . ARG F 3 115 ? 28.257 55.557 20.554  1.00 26.10 ? 115 ARG B C     1 
ATOM   3706 O O     . ARG F 3 115 ? 29.144 55.993 19.826  1.00 28.91 ? 115 ARG B O     1 
ATOM   3707 C CB    . ARG F 3 115 ? 28.529 55.294 22.959  1.00 21.85 ? 115 ARG B CB    1 
ATOM   3708 C CG    . ARG F 3 115 ? 28.390 55.715 24.371  1.00 23.76 ? 115 ARG B CG    1 
ATOM   3709 C CD    . ARG F 3 115 ? 29.219 56.940 24.630  1.00 34.98 ? 115 ARG B CD    1 
ATOM   3710 N NE    . ARG F 3 115 ? 28.985 57.416 25.986  1.00 33.95 ? 115 ARG B NE    1 
ATOM   3711 C CZ    . ARG F 3 115 ? 29.930 57.551 26.908  1.00 36.73 ? 115 ARG B CZ    1 
ATOM   3712 N NH1   . ARG F 3 115 ? 31.202 57.261 26.632  1.00 31.36 ? 115 ARG B NH1   1 
ATOM   3713 N NH2   . ARG F 3 115 ? 29.582 57.928 28.129  1.00 40.42 ? 115 ARG B NH2   1 
ATOM   3714 N N     . LEU F 3 116 ? 27.558 54.467 20.273  1.00 28.51 ? 116 LEU B N     1 
ATOM   3715 C CA    . LEU F 3 116 ? 27.773 53.654 19.082  1.00 24.96 ? 116 LEU B CA    1 
ATOM   3716 C C     . LEU F 3 116 ? 27.386 54.409 17.807  1.00 20.69 ? 116 LEU B C     1 
ATOM   3717 O O     . LEU F 3 116 ? 28.210 54.553 16.916  1.00 15.52 ? 116 LEU B O     1 
ATOM   3718 C CB    . LEU F 3 116 ? 26.960 52.365 19.227  1.00 13.61 ? 116 LEU B CB    1 
ATOM   3719 C CG    . LEU F 3 116 ? 27.173 51.099 18.417  1.00 12.32 ? 116 LEU B CG    1 
ATOM   3720 C CD1   . LEU F 3 116 ? 25.918 50.907 17.614  1.00 6.00  ? 116 LEU B CD1   1 
ATOM   3721 C CD2   . LEU F 3 116 ? 28.460 51.160 17.585  1.00 6.00  ? 116 LEU B CD2   1 
ATOM   3722 N N     . SER F 3 117 ? 26.165 54.933 17.735  1.00 17.87 ? 117 SER B N     1 
ATOM   3723 C CA    . SER F 3 117 ? 25.699 55.584 16.524  1.00 13.09 ? 117 SER B CA    1 
ATOM   3724 C C     . SER F 3 117 ? 26.530 56.766 16.091  1.00 17.59 ? 117 SER B C     1 
ATOM   3725 O O     . SER F 3 117 ? 26.886 56.870 14.915  1.00 17.92 ? 117 SER B O     1 
ATOM   3726 C CB    . SER F 3 117 ? 24.264 55.995 16.699  1.00 12.95 ? 117 SER B CB    1 
ATOM   3727 O OG    . SER F 3 117 ? 23.476 54.865 16.444  1.00 17.32 ? 117 SER B OG    1 
ATOM   3728 N N     . ALA F 3 118 ? 26.957 57.583 17.052  1.00 19.15 ? 118 ALA B N     1 
ATOM   3729 C CA    . ALA F 3 118 ? 27.812 58.738 16.761  1.00 15.97 ? 118 ALA B CA    1 
ATOM   3730 C C     . ALA F 3 118 ? 29.086 58.213 16.166  1.00 10.25 ? 118 ALA B C     1 
ATOM   3731 O O     . ALA F 3 118 ? 29.726 58.909 15.399  1.00 10.31 ? 118 ALA B O     1 
ATOM   3732 C CB    . ALA F 3 118 ? 28.134 59.549 18.030  1.00 17.17 ? 118 ALA B CB    1 
ATOM   3733 N N     . GLN F 3 119 ? 29.441 56.980 16.488  1.00 7.79  ? 119 GLN B N     1 
ATOM   3734 C CA    . GLN F 3 119 ? 30.620 56.436 15.884  1.00 8.65  ? 119 GLN B CA    1 
ATOM   3735 C C     . GLN F 3 119 ? 30.301 56.350 14.409  1.00 9.24  ? 119 GLN B C     1 
ATOM   3736 O O     . GLN F 3 119 ? 30.929 57.029 13.607  1.00 10.47 ? 119 GLN B O     1 
ATOM   3737 C CB    . GLN F 3 119 ? 30.958 55.039 16.403  1.00 14.30 ? 119 GLN B CB    1 
ATOM   3738 C CG    . GLN F 3 119 ? 30.743 54.844 17.860  1.00 11.30 ? 119 GLN B CG    1 
ATOM   3739 C CD    . GLN F 3 119 ? 31.976 54.919 18.695  1.00 14.65 ? 119 GLN B CD    1 
ATOM   3740 O OE1   . GLN F 3 119 ? 33.088 55.062 18.177  1.00 13.50 ? 119 GLN B OE1   1 
ATOM   3741 N NE2   . GLN F 3 119 ? 31.801 54.786 20.015  1.00 6.00  ? 119 GLN B NE2   1 
ATOM   3742 N N     . MET F 3 120 ? 29.269 55.613 14.021  1.00 7.89  ? 120 MET B N     1 
ATOM   3743 C CA    . MET F 3 120 ? 29.150 55.381 12.580  1.00 8.73  ? 120 MET B CA    1 
ATOM   3744 C C     . MET F 3 120 ? 28.646 56.607 11.805  1.00 9.22  ? 120 MET B C     1 
ATOM   3745 O O     . MET F 3 120 ? 28.655 56.622 10.580  1.00 8.39  ? 120 MET B O     1 
ATOM   3746 C CB    . MET F 3 120 ? 28.301 54.108 12.309  1.00 6.33  ? 120 MET B CB    1 
ATOM   3747 C CG    . MET F 3 120 ? 26.892 54.147 12.788  1.00 15.94 ? 120 MET B CG    1 
ATOM   3748 S SD    . MET F 3 120 ? 26.296 52.784 13.833  1.00 15.56 ? 120 MET B SD    1 
ATOM   3749 C CE    . MET F 3 120 ? 24.865 52.463 12.917  1.00 6.00  ? 120 MET B CE    1 
ATOM   3750 N N     . ALA F 3 121 ? 28.302 57.666 12.537  1.00 17.49 ? 121 ALA B N     1 
ATOM   3751 C CA    . ALA F 3 121 ? 27.933 58.979 11.961  1.00 19.66 ? 121 ALA B CA    1 
ATOM   3752 C C     . ALA F 3 121 ? 29.180 59.704 11.470  1.00 10.85 ? 121 ALA B C     1 
ATOM   3753 O O     . ALA F 3 121 ? 29.244 60.058 10.297  1.00 6.00  ? 121 ALA B O     1 
ATOM   3754 C CB    . ALA F 3 121 ? 27.215 59.858 13.000  1.00 24.82 ? 121 ALA B CB    1 
ATOM   3755 N N     . ARG F 3 122 ? 30.173 59.911 12.340  1.00 6.00  ? 122 ARG B N     1 
ATOM   3756 C CA    . ARG F 3 122 ? 31.415 60.468 11.870  1.00 6.00  ? 122 ARG B CA    1 
ATOM   3757 C C     . ARG F 3 122 ? 31.869 59.589 10.693  1.00 18.28 ? 122 ARG B C     1 
ATOM   3758 O O     . ARG F 3 122 ? 32.190 60.112 9.618   1.00 25.05 ? 122 ARG B O     1 
ATOM   3759 C CB    . ARG F 3 122 ? 32.484 60.465 12.958  1.00 8.21  ? 122 ARG B CB    1 
ATOM   3760 C CG    . ARG F 3 122 ? 33.385 61.744 12.949  1.00 24.89 ? 122 ARG B CG    1 
ATOM   3761 C CD    . ARG F 3 122 ? 32.810 62.903 13.780  1.00 26.35 ? 122 ARG B CD    1 
ATOM   3762 N NE    . ARG F 3 122 ? 31.372 63.069 13.544  1.00 26.71 ? 122 ARG B NE    1 
ATOM   3763 C CZ    . ARG F 3 122 ? 30.416 62.785 14.434  1.00 36.66 ? 122 ARG B CZ    1 
ATOM   3764 N NH1   . ARG F 3 122 ? 30.732 62.348 15.641  1.00 38.14 ? 122 ARG B NH1   1 
ATOM   3765 N NH2   . ARG F 3 122 ? 29.132 62.801 14.079  1.00 41.55 ? 122 ARG B NH2   1 
ATOM   3766 N N     . ARG F 3 123 ? 31.754 58.266 10.859  1.00 13.97 ? 123 ARG B N     1 
ATOM   3767 C CA    . ARG F 3 123 ? 32.089 57.282 9.829   1.00 8.79  ? 123 ARG B CA    1 
ATOM   3768 C C     . ARG F 3 123 ? 31.318 57.439 8.516   1.00 6.13  ? 123 ARG B C     1 
ATOM   3769 O O     . ARG F 3 123 ? 31.926 57.324 7.450   1.00 12.93 ? 123 ARG B O     1 
ATOM   3770 C CB    . ARG F 3 123 ? 31.864 55.850 10.358  1.00 16.39 ? 123 ARG B CB    1 
ATOM   3771 C CG    . ARG F 3 123 ? 32.974 55.267 11.227  1.00 6.00  ? 123 ARG B CG    1 
ATOM   3772 C CD    . ARG F 3 123 ? 32.429 54.294 12.213  1.00 6.00  ? 123 ARG B CD    1 
ATOM   3773 N NE    . ARG F 3 123 ? 33.531 53.627 12.898  1.00 18.30 ? 123 ARG B NE    1 
ATOM   3774 C CZ    . ARG F 3 123 ? 33.401 52.581 13.713  1.00 10.97 ? 123 ARG B CZ    1 
ATOM   3775 N NH1   . ARG F 3 123 ? 32.203 52.087 13.962  1.00 6.00  ? 123 ARG B NH1   1 
ATOM   3776 N NH2   . ARG F 3 123 ? 34.473 52.027 14.263  1.00 6.00  ? 123 ARG B NH2   1 
ATOM   3777 N N     . LEU F 3 124 ? 30.011 57.693 8.542   1.00 6.00  ? 124 LEU B N     1 
ATOM   3778 C CA    . LEU F 3 124 ? 29.287 57.848 7.277   1.00 7.88  ? 124 LEU B CA    1 
ATOM   3779 C C     . LEU F 3 124 ? 29.801 59.111 6.580   1.00 16.61 ? 124 LEU B C     1 
ATOM   3780 O O     . LEU F 3 124 ? 29.961 59.125 5.344   1.00 23.47 ? 124 LEU B O     1 
ATOM   3781 C CB    . LEU F 3 124 ? 27.774 57.936 7.511   1.00 6.00  ? 124 LEU B CB    1 
ATOM   3782 C CG    . LEU F 3 124 ? 26.765 57.507 6.419   1.00 6.00  ? 124 LEU B CG    1 
ATOM   3783 C CD1   . LEU F 3 124 ? 25.917 58.717 5.928   1.00 8.32  ? 124 LEU B CD1   1 
ATOM   3784 C CD2   . LEU F 3 124 ? 27.510 56.890 5.263   1.00 6.00  ? 124 LEU B CD2   1 
ATOM   3785 N N     . GLN F 3 125 ? 30.202 60.107 7.387   1.00 26.77 ? 125 GLN B N     1 
ATOM   3786 C CA    . GLN F 3 125 ? 30.769 61.372 6.902   1.00 18.74 ? 125 GLN B CA    1 
ATOM   3787 C C     . GLN F 3 125 ? 32.113 61.132 6.255   1.00 14.89 ? 125 GLN B C     1 
ATOM   3788 O O     . GLN F 3 125 ? 32.231 61.317 5.058   1.00 25.01 ? 125 GLN B O     1 
ATOM   3789 C CB    . GLN F 3 125 ? 30.940 62.381 8.042   1.00 28.22 ? 125 GLN B CB    1 
ATOM   3790 C CG    . GLN F 3 125 ? 30.994 63.823 7.543   1.00 43.53 ? 125 GLN B CG    1 
ATOM   3791 C CD    . GLN F 3 125 ? 32.274 64.563 7.902   1.00 47.94 ? 125 GLN B CD    1 
ATOM   3792 O OE1   . GLN F 3 125 ? 32.285 65.389 8.822   1.00 47.15 ? 125 GLN B OE1   1 
ATOM   3793 N NE2   . GLN F 3 125 ? 33.340 64.324 7.140   1.00 46.00 ? 125 GLN B NE2   1 
ATOM   3794 N N     . VAL F 3 126 ? 33.097 60.651 7.013   1.00 7.07  ? 126 VAL B N     1 
ATOM   3795 C CA    . VAL F 3 126 ? 34.453 60.411 6.491   1.00 10.00 ? 126 VAL B CA    1 
ATOM   3796 C C     . VAL F 3 126 ? 34.480 59.563 5.205   1.00 20.92 ? 126 VAL B C     1 
ATOM   3797 O O     . VAL F 3 126 ? 35.416 59.674 4.382   1.00 16.19 ? 126 VAL B O     1 
ATOM   3798 C CB    . VAL F 3 126 ? 35.392 59.654 7.510   1.00 9.11  ? 126 VAL B CB    1 
ATOM   3799 C CG1   . VAL F 3 126 ? 36.831 59.685 6.975   1.00 9.24  ? 126 VAL B CG1   1 
ATOM   3800 C CG2   . VAL F 3 126 ? 35.342 60.273 8.908   1.00 6.00  ? 126 VAL B CG2   1 
ATOM   3801 N N     . THR F 3 127 ? 33.502 58.652 5.097   1.00 32.88 ? 127 THR B N     1 
ATOM   3802 C CA    . THR F 3 127 ? 33.426 57.702 3.989   1.00 24.84 ? 127 THR B CA    1 
ATOM   3803 C C     . THR F 3 127 ? 32.926 58.431 2.756   1.00 22.70 ? 127 THR B C     1 
ATOM   3804 O O     . THR F 3 127 ? 33.566 58.335 1.706   1.00 23.73 ? 127 THR B O     1 
ATOM   3805 C CB    . THR F 3 127 ? 32.503 56.481 4.361   1.00 19.29 ? 127 THR B CB    1 
ATOM   3806 O OG1   . THR F 3 127 ? 33.010 55.835 5.532   1.00 7.96  ? 127 THR B OG1   1 
ATOM   3807 C CG2   . THR F 3 127 ? 32.537 55.420 3.278   1.00 27.50 ? 127 THR B CG2   1 
ATOM   3808 N N     . SER F 3 128 ? 31.876 59.247 2.912   1.00 20.67 ? 128 SER B N     1 
ATOM   3809 C CA    . SER F 3 128 ? 31.317 60.057 1.800   1.00 18.21 ? 128 SER B CA    1 
ATOM   3810 C C     . SER F 3 128 ? 32.279 61.121 1.180   1.00 14.40 ? 128 SER B C     1 
ATOM   3811 O O     . SER F 3 128 ? 32.165 61.466 0.007   1.00 11.25 ? 128 SER B O     1 
ATOM   3812 C CB    . SER F 3 128 ? 30.028 60.710 2.279   1.00 9.23  ? 128 SER B CB    1 
ATOM   3813 O OG    . SER F 3 128 ? 29.075 59.696 2.472   1.00 6.00  ? 128 SER B OG    1 
ATOM   3814 N N     . GLU F 3 129 ? 33.207 61.621 1.974   1.00 6.00  ? 129 GLU B N     1 
ATOM   3815 C CA    . GLU F 3 129 ? 34.347 62.344 1.474   1.00 6.00  ? 129 GLU B CA    1 
ATOM   3816 C C     . GLU F 3 129 ? 35.127 61.341 0.601   1.00 8.50  ? 129 GLU B C     1 
ATOM   3817 O O     . GLU F 3 129 ? 35.239 61.549 -0.588  1.00 15.93 ? 129 GLU B O     1 
ATOM   3818 C CB    . GLU F 3 129 ? 35.180 62.814 2.659   1.00 7.26  ? 129 GLU B CB    1 
ATOM   3819 C CG    . GLU F 3 129 ? 36.431 63.631 2.348   1.00 21.44 ? 129 GLU B CG    1 
ATOM   3820 C CD    . GLU F 3 129 ? 37.003 64.394 3.587   1.00 32.05 ? 129 GLU B CD    1 
ATOM   3821 O OE1   . GLU F 3 129 ? 36.607 64.082 4.754   1.00 26.71 ? 129 GLU B OE1   1 
ATOM   3822 O OE2   . GLU F 3 129 ? 37.856 65.311 3.380   1.00 27.76 ? 129 GLU B OE2   1 
ATOM   3823 N N     . LYS F 3 130 ? 35.550 60.199 1.156   1.00 15.07 ? 130 LYS B N     1 
ATOM   3824 C CA    . LYS F 3 130 ? 36.345 59.195 0.417   1.00 12.32 ? 130 LYS B CA    1 
ATOM   3825 C C     . LYS F 3 130 ? 35.771 58.838 -0.976  1.00 14.58 ? 130 LYS B C     1 
ATOM   3826 O O     . LYS F 3 130 ? 36.560 58.729 -1.921  1.00 9.22  ? 130 LYS B O     1 
ATOM   3827 C CB    . LYS F 3 130 ? 36.515 57.899 1.257   1.00 8.30  ? 130 LYS B CB    1 
ATOM   3828 C CG    . LYS F 3 130 ? 37.818 57.077 0.911   1.00 6.00  ? 130 LYS B CG    1 
ATOM   3829 C CD    . LYS F 3 130 ? 37.860 55.660 1.540   1.00 11.31 ? 130 LYS B CD    1 
ATOM   3830 C CE    . LYS F 3 130 ? 38.866 54.651 0.878   1.00 11.88 ? 130 LYS B CE    1 
ATOM   3831 N NZ    . LYS F 3 130 ? 40.289 54.949 1.186   1.00 14.93 ? 130 LYS B NZ    1 
ATOM   3832 N N     . VAL F 3 131 ? 34.444 58.642 -1.116  1.00 6.00  ? 131 VAL B N     1 
ATOM   3833 C CA    . VAL F 3 131 ? 33.855 58.485 -2.447  1.00 6.00  ? 131 VAL B CA    1 
ATOM   3834 C C     . VAL F 3 131 ? 34.166 59.721 -3.244  1.00 7.11  ? 131 VAL B C     1 
ATOM   3835 O O     . VAL F 3 131 ? 34.683 59.640 -4.361  1.00 9.74  ? 131 VAL B O     1 
ATOM   3836 C CB    . VAL F 3 131 ? 32.309 58.381 -2.502  1.00 9.02  ? 131 VAL B CB    1 
ATOM   3837 C CG1   . VAL F 3 131 ? 31.880 58.404 -3.970  1.00 6.00  ? 131 VAL B CG1   1 
ATOM   3838 C CG2   . VAL F 3 131 ? 31.811 57.075 -1.899  1.00 6.00  ? 131 VAL B CG2   1 
ATOM   3839 N N     . GLY F 3 132 ? 33.813 60.868 -2.661  1.00 13.98 ? 132 GLY B N     1 
ATOM   3840 C CA    . GLY F 3 132 ? 33.994 62.174 -3.287  1.00 6.00  ? 132 GLY B CA    1 
ATOM   3841 C C     . GLY F 3 132 ? 35.377 62.370 -3.832  1.00 6.00  ? 132 GLY B C     1 
ATOM   3842 O O     . GLY F 3 132 ? 35.492 62.745 -5.004  1.00 11.32 ? 132 GLY B O     1 
ATOM   3843 N N     . ASN F 3 133 ? 36.435 62.096 -3.076  1.00 6.00  ? 133 ASN B N     1 
ATOM   3844 C CA    . ASN F 3 133 ? 37.735 62.351 -3.669  1.00 6.00  ? 133 ASN B CA    1 
ATOM   3845 C C     . ASN F 3 133 ? 38.349 61.148 -4.416  1.00 14.23 ? 133 ASN B C     1 
ATOM   3846 O O     . ASN F 3 133 ? 39.575 61.047 -4.596  1.00 16.08 ? 133 ASN B O     1 
ATOM   3847 C CB    . ASN F 3 133 ? 38.730 62.945 -2.629  1.00 6.00  ? 133 ASN B CB    1 
ATOM   3848 C CG    . ASN F 3 133 ? 38.875 62.116 -1.375  1.00 8.98  ? 133 ASN B CG    1 
ATOM   3849 O OD1   . ASN F 3 133 ? 37.901 61.586 -0.854  1.00 9.26  ? 133 ASN B OD1   1 
ATOM   3850 N ND2   . ASN F 3 133 ? 40.089 62.005 -0.877  1.00 6.00  ? 133 ASN B ND2   1 
ATOM   3851 N N     . LEU F 3 134 ? 37.478 60.278 -4.933  1.00 15.66 ? 134 LEU B N     1 
ATOM   3852 C CA    . LEU F 3 134 ? 37.894 59.207 -5.852  1.00 12.49 ? 134 LEU B CA    1 
ATOM   3853 C C     . LEU F 3 134 ? 37.270 59.544 -7.219  1.00 12.58 ? 134 LEU B C     1 
ATOM   3854 O O     . LEU F 3 134 ? 37.772 59.173 -8.286  1.00 21.80 ? 134 LEU B O     1 
ATOM   3855 C CB    . LEU F 3 134 ? 37.402 57.822 -5.367  1.00 7.30  ? 134 LEU B CB    1 
ATOM   3856 C CG    . LEU F 3 134 ? 38.083 57.126 -4.171  1.00 9.00  ? 134 LEU B CG    1 
ATOM   3857 C CD1   . LEU F 3 134 ? 37.092 56.082 -3.676  1.00 19.93 ? 134 LEU B CD1   1 
ATOM   3858 C CD2   . LEU F 3 134 ? 39.402 56.489 -4.509  1.00 6.00  ? 134 LEU B CD2   1 
ATOM   3859 N N     . ALA F 3 135 ? 36.143 60.214 -7.183  1.00 6.00  ? 135 ALA B N     1 
ATOM   3860 C CA    . ALA F 3 135 ? 35.511 60.626 -8.406  1.00 18.23 ? 135 ALA B CA    1 
ATOM   3861 C C     . ALA F 3 135 ? 36.064 61.970 -8.856  1.00 16.48 ? 135 ALA B C     1 
ATOM   3862 O O     . ALA F 3 135 ? 35.808 62.405 -9.986  1.00 23.12 ? 135 ALA B O     1 
ATOM   3863 C CB    . ALA F 3 135 ? 33.985 60.718 -8.203  1.00 22.84 ? 135 ALA B CB    1 
ATOM   3864 N N     . PHE F 3 136 ? 36.731 62.667 -7.939  1.00 16.21 ? 136 PHE B N     1 
ATOM   3865 C CA    . PHE F 3 136 ? 37.240 63.986 -8.245  1.00 8.18  ? 136 PHE B CA    1 
ATOM   3866 C C     . PHE F 3 136 ? 38.788 63.998 -8.234  1.00 6.00  ? 136 PHE B C     1 
ATOM   3867 O O     . PHE F 3 136 ? 39.403 63.701 -9.240  1.00 11.96 ? 136 PHE B O     1 
ATOM   3868 C CB    . PHE F 3 136 ? 36.636 64.994 -7.250  1.00 6.00  ? 136 PHE B CB    1 
ATOM   3869 C CG    . PHE F 3 136 ? 35.097 65.039 -7.232  1.00 11.32 ? 136 PHE B CG    1 
ATOM   3870 C CD1   . PHE F 3 136 ? 34.335 64.893 -8.402  1.00 13.71 ? 136 PHE B CD1   1 
ATOM   3871 C CD2   . PHE F 3 136 ? 34.407 65.311 -6.040  1.00 9.07  ? 136 PHE B CD2   1 
ATOM   3872 C CE1   . PHE F 3 136 ? 32.913 65.029 -8.371  1.00 7.32  ? 136 PHE B CE1   1 
ATOM   3873 C CE2   . PHE F 3 136 ? 32.995 65.440 -6.007  1.00 6.00  ? 136 PHE B CE2   1 
ATOM   3874 C CZ    . PHE F 3 136 ? 32.262 65.301 -7.164  1.00 6.00  ? 136 PHE B CZ    1 
ATOM   3875 N N     . LEU F 3 137 ? 39.420 64.146 -7.083  1.00 6.00  ? 137 LEU B N     1 
ATOM   3876 C CA    . LEU F 3 137 ? 40.856 64.398 -7.039  1.00 9.74  ? 137 LEU B CA    1 
ATOM   3877 C C     . LEU F 3 137 ? 41.771 63.289 -7.572  1.00 14.73 ? 137 LEU B C     1 
ATOM   3878 O O     . LEU F 3 137 ? 41.680 62.153 -7.128  1.00 26.43 ? 137 LEU B O     1 
ATOM   3879 C CB    . LEU F 3 137 ? 41.274 64.767 -5.601  1.00 10.16 ? 137 LEU B CB    1 
ATOM   3880 C CG    . LEU F 3 137 ? 40.700 66.087 -5.064  1.00 14.71 ? 137 LEU B CG    1 
ATOM   3881 C CD1   . LEU F 3 137 ? 39.282 65.865 -4.668  1.00 15.41 ? 137 LEU B CD1   1 
ATOM   3882 C CD2   . LEU F 3 137 ? 41.469 66.578 -3.848  1.00 26.83 ? 137 LEU B CD2   1 
ATOM   3883 N N     . ASP F 3 138 ? 42.627 63.620 -8.543  1.00 15.56 ? 138 ASP B N     1 
ATOM   3884 C CA    . ASP F 3 138 ? 43.587 62.668 -9.074  1.00 21.39 ? 138 ASP B CA    1 
ATOM   3885 C C     . ASP F 3 138 ? 44.607 62.240 -8.003  1.00 20.44 ? 138 ASP B C     1 
ATOM   3886 O O     . ASP F 3 138 ? 44.698 62.849 -6.953  1.00 16.31 ? 138 ASP B O     1 
ATOM   3887 C CB    . ASP F 3 138 ? 44.317 63.232 -10.369 1.00 26.27 ? 138 ASP B CB    1 
ATOM   3888 C CG    . ASP F 3 138 ? 45.062 64.608 -10.191 1.00 25.59 ? 138 ASP B CG    1 
ATOM   3889 O OD1   . ASP F 3 138 ? 44.839 65.342 -9.208  1.00 30.42 ? 138 ASP B OD1   1 
ATOM   3890 O OD2   . ASP F 3 138 ? 45.869 64.962 -11.101 1.00 16.81 ? 138 ASP B OD2   1 
ATOM   3891 N N     . VAL F 3 139 ? 45.346 61.174 -8.286  1.00 15.84 ? 139 VAL B N     1 
ATOM   3892 C CA    . VAL F 3 139 ? 46.303 60.600 -7.366  1.00 15.27 ? 139 VAL B CA    1 
ATOM   3893 C C     . VAL F 3 139 ? 47.000 61.630 -6.502  1.00 17.56 ? 139 VAL B C     1 
ATOM   3894 O O     . VAL F 3 139 ? 46.710 61.714 -5.322  1.00 13.69 ? 139 VAL B O     1 
ATOM   3895 C CB    . VAL F 3 139 ? 47.316 59.797 -8.141  1.00 13.64 ? 139 VAL B CB    1 
ATOM   3896 C CG1   . VAL F 3 139 ? 48.358 59.230 -7.219  1.00 6.00  ? 139 VAL B CG1   1 
ATOM   3897 C CG2   . VAL F 3 139 ? 46.571 58.692 -8.879  1.00 16.15 ? 139 VAL B CG2   1 
ATOM   3898 N N     . THR F 3 140 ? 47.810 62.480 -7.119  1.00 22.46 ? 140 THR B N     1 
ATOM   3899 C CA    . THR F 3 140 ? 48.502 63.611 -6.455  1.00 20.42 ? 140 THR B CA    1 
ATOM   3900 C C     . THR F 3 140 ? 47.603 64.347 -5.426  1.00 13.09 ? 140 THR B C     1 
ATOM   3901 O O     . THR F 3 140 ? 47.947 64.505 -4.266  1.00 13.54 ? 140 THR B O     1 
ATOM   3902 C CB    . THR F 3 140 ? 48.945 64.579 -7.530  1.00 23.62 ? 140 THR B CB    1 
ATOM   3903 O OG1   . THR F 3 140 ? 47.806 64.878 -8.374  1.00 37.39 ? 140 THR B OG1   1 
ATOM   3904 C CG2   . THR F 3 140 ? 50.036 63.937 -8.400  1.00 12.06 ? 140 THR B CG2   1 
ATOM   3905 N N     . GLY F 3 141 ? 46.400 64.656 -5.839  1.00 6.00  ? 141 GLY B N     1 
ATOM   3906 C CA    . GLY F 3 141 ? 45.449 65.198 -4.915  1.00 6.00  ? 141 GLY B CA    1 
ATOM   3907 C C     . GLY F 3 141 ? 45.139 64.204 -3.829  1.00 10.79 ? 141 GLY B C     1 
ATOM   3908 O O     . GLY F 3 141 ? 45.387 64.508 -2.676  1.00 17.50 ? 141 GLY B O     1 
ATOM   3909 N N     . ARG F 3 142 ? 44.657 63.009 -4.185  1.00 17.79 ? 142 ARG B N     1 
ATOM   3910 C CA    . ARG F 3 142 ? 44.209 62.010 -3.210  1.00 16.29 ? 142 ARG B CA    1 
ATOM   3911 C C     . ARG F 3 142 ? 45.302 61.771 -2.214  1.00 23.23 ? 142 ARG B C     1 
ATOM   3912 O O     . ARG F 3 142 ? 45.036 61.763 -1.009  1.00 22.22 ? 142 ARG B O     1 
ATOM   3913 C CB    . ARG F 3 142 ? 43.882 60.679 -3.869  1.00 13.99 ? 142 ARG B CB    1 
ATOM   3914 C CG    . ARG F 3 142 ? 42.733 60.714 -4.801  1.00 9.36  ? 142 ARG B CG    1 
ATOM   3915 C CD    . ARG F 3 142 ? 42.299 59.307 -5.177  1.00 22.22 ? 142 ARG B CD    1 
ATOM   3916 N NE    . ARG F 3 142 ? 43.143 58.609 -6.171  1.00 34.51 ? 142 ARG B NE    1 
ATOM   3917 C CZ    . ARG F 3 142 ? 42.925 57.355 -6.613  1.00 36.28 ? 142 ARG B CZ    1 
ATOM   3918 N NH1   . ARG F 3 142 ? 41.899 56.653 -6.161  1.00 35.06 ? 142 ARG B NH1   1 
ATOM   3919 N NH2   . ARG F 3 142 ? 43.739 56.770 -7.488  1.00 29.36 ? 142 ARG B NH2   1 
ATOM   3920 N N     . ILE F 3 143 ? 46.533 61.684 -2.729  1.00 22.17 ? 143 ILE B N     1 
ATOM   3921 C CA    . ILE F 3 143 ? 47.744 61.420 -1.953  1.00 25.30 ? 143 ILE B CA    1 
ATOM   3922 C C     . ILE F 3 143 ? 47.960 62.567 -0.982  1.00 29.07 ? 143 ILE B C     1 
ATOM   3923 O O     . ILE F 3 143 ? 48.281 62.357 0.194   1.00 30.49 ? 143 ILE B O     1 
ATOM   3924 C CB    . ILE F 3 143 ? 49.028 61.324 -2.862  1.00 18.61 ? 143 ILE B CB    1 
ATOM   3925 C CG1   . ILE F 3 143 ? 48.884 60.162 -3.841  1.00 14.72 ? 143 ILE B CG1   1 
ATOM   3926 C CG2   . ILE F 3 143 ? 50.305 61.128 -1.990  1.00 6.00  ? 143 ILE B CG2   1 
ATOM   3927 C CD1   . ILE F 3 143 ? 50.215 59.654 -4.411  1.00 13.15 ? 143 ILE B CD1   1 
ATOM   3928 N N     . ALA F 3 144 ? 47.789 63.781 -1.487  1.00 29.88 ? 144 ALA B N     1 
ATOM   3929 C CA    . ALA F 3 144 ? 48.053 64.958 -0.691  1.00 22.52 ? 144 ALA B CA    1 
ATOM   3930 C C     . ALA F 3 144 ? 47.215 65.058 0.570   1.00 15.52 ? 144 ALA B C     1 
ATOM   3931 O O     . ALA F 3 144 ? 47.768 64.999 1.664   1.00 21.45 ? 144 ALA B O     1 
ATOM   3932 C CB    . ALA F 3 144 ? 47.862 66.152 -1.519  1.00 29.58 ? 144 ALA B CB    1 
ATOM   3933 N N     . GLN F 3 145 ? 45.898 65.122 0.467   1.00 12.02 ? 145 GLN B N     1 
ATOM   3934 C CA    . GLN F 3 145 ? 45.138 65.266 1.692   1.00 14.17 ? 145 GLN B CA    1 
ATOM   3935 C C     . GLN F 3 145 ? 45.269 64.034 2.588   1.00 17.59 ? 145 GLN B C     1 
ATOM   3936 O O     . GLN F 3 145 ? 44.892 64.088 3.761   1.00 21.92 ? 145 GLN B O     1 
ATOM   3937 C CB    . GLN F 3 145 ? 43.651 65.523 1.419   1.00 13.38 ? 145 GLN B CB    1 
ATOM   3938 C CG    . GLN F 3 145 ? 42.938 66.112 2.679   1.00 17.69 ? 145 GLN B CG    1 
ATOM   3939 C CD    . GLN F 3 145 ? 41.429 66.305 2.539   1.00 16.41 ? 145 GLN B CD    1 
ATOM   3940 O OE1   . GLN F 3 145 ? 40.856 66.144 1.454   1.00 19.64 ? 145 GLN B OE1   1 
ATOM   3941 N NE2   . GLN F 3 145 ? 40.771 66.620 3.657   1.00 18.00 ? 145 GLN B NE2   1 
ATOM   3942 N N     . THR F 3 146 ? 45.811 62.938 2.060   1.00 26.82 ? 146 THR B N     1 
ATOM   3943 C CA    . THR F 3 146 ? 46.017 61.726 2.856   1.00 29.65 ? 146 THR B CA    1 
ATOM   3944 C C     . THR F 3 146 ? 47.110 61.973 3.899   1.00 24.84 ? 146 THR B C     1 
ATOM   3945 O O     . THR F 3 146 ? 46.816 61.981 5.106   1.00 30.31 ? 146 THR B O     1 
ATOM   3946 C CB    . THR F 3 146 ? 46.402 60.481 1.944   1.00 35.25 ? 146 THR B CB    1 
ATOM   3947 O OG1   . THR F 3 146 ? 45.256 60.072 1.186   1.00 43.30 ? 146 THR B OG1   1 
ATOM   3948 C CG2   . THR F 3 146 ? 46.859 59.284 2.779   1.00 36.58 ? 146 THR B CG2   1 
ATOM   3949 N N     . LEU F 3 147 ? 48.333 62.262 3.456   1.00 23.34 ? 147 LEU B N     1 
ATOM   3950 C CA    . LEU F 3 147 ? 49.445 62.490 4.380   1.00 23.26 ? 147 LEU B CA    1 
ATOM   3951 C C     . LEU F 3 147 ? 49.002 63.493 5.435   1.00 27.42 ? 147 LEU B C     1 
ATOM   3952 O O     . LEU F 3 147 ? 49.311 63.331 6.635   1.00 16.17 ? 147 LEU B O     1 
ATOM   3953 C CB    . LEU F 3 147 ? 50.661 63.009 3.624   1.00 21.47 ? 147 LEU B CB    1 
ATOM   3954 C CG    . LEU F 3 147 ? 51.432 61.934 2.847   1.00 21.25 ? 147 LEU B CG    1 
ATOM   3955 C CD1   . LEU F 3 147 ? 51.503 62.305 1.375   1.00 21.00 ? 147 LEU B CD1   1 
ATOM   3956 C CD2   . LEU F 3 147 ? 52.844 61.812 3.418   1.00 19.43 ? 147 LEU B CD2   1 
ATOM   3957 N N     . LEU F 3 148 ? 48.134 64.408 4.977   1.00 32.21 ? 148 LEU B N     1 
ATOM   3958 C CA    . LEU F 3 148 ? 47.486 65.420 5.813   1.00 31.62 ? 148 LEU B CA    1 
ATOM   3959 C C     . LEU F 3 148 ? 46.701 64.722 6.910   1.00 32.41 ? 148 LEU B C     1 
ATOM   3960 O O     . LEU F 3 148 ? 47.074 64.840 8.079   1.00 42.76 ? 148 LEU B O     1 
ATOM   3961 C CB    . LEU F 3 148 ? 46.525 66.317 4.996   1.00 31.67 ? 148 LEU B CB    1 
ATOM   3962 C CG    . LEU F 3 148 ? 46.583 67.825 5.294   1.00 28.44 ? 148 LEU B CG    1 
ATOM   3963 C CD1   . LEU F 3 148 ? 47.762 68.397 4.530   1.00 33.06 ? 148 LEU B CD1   1 
ATOM   3964 C CD2   . LEU F 3 148 ? 45.326 68.546 4.876   1.00 24.53 ? 148 LEU B CD2   1 
ATOM   3965 N N     . ASN F 3 149 ? 45.676 63.945 6.563   1.00 21.94 ? 149 ASN B N     1 
ATOM   3966 C CA    . ASN F 3 149 ? 44.916 63.269 7.605   1.00 19.29 ? 149 ASN B CA    1 
ATOM   3967 C C     . ASN F 3 149 ? 45.806 62.347 8.405   1.00 29.21 ? 149 ASN B C     1 
ATOM   3968 O O     . ASN F 3 149 ? 45.500 62.049 9.553   1.00 32.38 ? 149 ASN B O     1 
ATOM   3969 C CB    . ASN F 3 149 ? 43.801 62.428 7.054   1.00 21.53 ? 149 ASN B CB    1 
ATOM   3970 C CG    . ASN F 3 149 ? 42.690 63.244 6.496   1.00 46.46 ? 149 ASN B CG    1 
ATOM   3971 O OD1   . ASN F 3 149 ? 42.007 63.979 7.213   1.00 56.99 ? 149 ASN B OD1   1 
ATOM   3972 N ND2   . ASN F 3 149 ? 42.482 63.124 5.195   1.00 59.00 ? 149 ASN B ND2   1 
ATOM   3973 N N     . LEU F 3 150 ? 46.936 61.930 7.842   1.00 34.19 ? 150 LEU B N     1 
ATOM   3974 C CA    . LEU F 3 150 ? 47.810 61.006 8.565   1.00 36.11 ? 150 LEU B CA    1 
ATOM   3975 C C     . LEU F 3 150 ? 48.699 61.696 9.624   1.00 36.12 ? 150 LEU B C     1 
ATOM   3976 O O     . LEU F 3 150 ? 49.731 61.164 10.053  1.00 30.03 ? 150 LEU B O     1 
ATOM   3977 C CB    . LEU F 3 150 ? 48.666 60.189 7.558   1.00 31.69 ? 150 LEU B CB    1 
ATOM   3978 C CG    . LEU F 3 150 ? 48.178 58.747 7.323   1.00 20.89 ? 150 LEU B CG    1 
ATOM   3979 C CD1   . LEU F 3 150 ? 46.726 58.811 6.888   1.00 26.70 ? 150 LEU B CD1   1 
ATOM   3980 C CD2   . LEU F 3 150 ? 49.017 58.027 6.271   1.00 23.21 ? 150 LEU B CD2   1 
ATOM   3981 N N     . ALA F 3 151 ? 48.260 62.867 10.071  1.00 38.09 ? 151 ALA B N     1 
ATOM   3982 C CA    . ALA F 3 151 ? 48.898 63.574 11.174  1.00 37.85 ? 151 ALA B CA    1 
ATOM   3983 C C     . ALA F 3 151 ? 47.814 64.089 12.147  1.00 38.66 ? 151 ALA B C     1 
ATOM   3984 O O     . ALA F 3 151 ? 48.120 64.584 13.231  1.00 43.69 ? 151 ALA B O     1 
ATOM   3985 C CB    . ALA F 3 151 ? 49.746 64.726 10.623  1.00 27.99 ? 151 ALA B CB    1 
ATOM   3986 N N     . LYS F 3 152 ? 46.544 63.914 11.778  1.00 41.27 ? 152 LYS B N     1 
ATOM   3987 C CA    . LYS F 3 152 ? 45.412 64.274 12.634  1.00 38.47 ? 152 LYS B CA    1 
ATOM   3988 C C     . LYS F 3 152 ? 44.911 62.970 13.242  1.00 44.70 ? 152 LYS B C     1 
ATOM   3989 O O     . LYS F 3 152 ? 43.700 62.718 13.324  1.00 47.58 ? 152 LYS B O     1 
ATOM   3990 C CB    . LYS F 3 152 ? 44.297 64.940 11.808  1.00 34.56 ? 152 LYS B CB    1 
ATOM   3991 C CG    . LYS F 3 152 ? 44.398 66.470 11.723  1.00 36.50 ? 152 LYS B CG    1 
ATOM   3992 C CD    . LYS F 3 152 ? 44.016 67.162 13.058  1.00 28.70 ? 152 LYS B CD    1 
ATOM   3993 C CE    . LYS F 3 152 ? 44.214 68.710 13.051  1.00 32.34 ? 152 LYS B CE    1 
ATOM   3994 N NZ    . LYS F 3 152 ? 45.640 69.229 13.270  1.00 27.59 ? 152 LYS B NZ    1 
ATOM   3995 N N     . GLN F 3 153 ? 45.854 62.162 13.710  1.00 43.83 ? 153 GLN B N     1 
ATOM   3996 C CA    . GLN F 3 153 ? 45.545 60.815 14.161  1.00 44.68 ? 153 GLN B CA    1 
ATOM   3997 C C     . GLN F 3 153 ? 46.920 60.180 14.430  1.00 47.39 ? 153 GLN B C     1 
ATOM   3998 O O     . GLN F 3 153 ? 47.883 60.422 13.681  1.00 43.52 ? 153 GLN B O     1 
ATOM   3999 C CB    . GLN F 3 153 ? 44.804 60.060 13.037  1.00 47.73 ? 153 GLN B CB    1 
ATOM   4000 C CG    . GLN F 3 153 ? 44.177 58.726 13.405  1.00 44.47 ? 153 GLN B CG    1 
ATOM   4001 C CD    . GLN F 3 153 ? 44.039 57.803 12.211  1.00 37.96 ? 153 GLN B CD    1 
ATOM   4002 O OE1   . GLN F 3 153 ? 42.944 57.560 11.719  1.00 29.60 ? 153 GLN B OE1   1 
ATOM   4003 N NE2   . GLN F 3 153 ? 45.158 57.262 11.760  1.00 35.40 ? 153 GLN B NE2   1 
ATOM   4004 N N     . PRO F 3 154 ? 47.035 59.391 15.524  1.00 46.11 ? 154 PRO B N     1 
ATOM   4005 C CA    . PRO F 3 154 ? 48.311 59.188 16.236  1.00 42.51 ? 154 PRO B CA    1 
ATOM   4006 C C     . PRO F 3 154 ? 49.481 58.350 15.614  1.00 39.13 ? 154 PRO B C     1 
ATOM   4007 O O     . PRO F 3 154 ? 49.334 57.180 15.223  1.00 33.33 ? 154 PRO B O     1 
ATOM   4008 C CB    . PRO F 3 154 ? 47.855 58.641 17.602  1.00 33.86 ? 154 PRO B CB    1 
ATOM   4009 C CG    . PRO F 3 154 ? 46.445 59.165 17.755  1.00 38.08 ? 154 PRO B CG    1 
ATOM   4010 C CD    . PRO F 3 154 ? 45.899 58.923 16.385  1.00 38.65 ? 154 PRO B CD    1 
ATOM   4011 N N     . ASP F 3 155 ? 50.638 59.002 15.580  1.00 34.12 ? 155 ASP B N     1 
ATOM   4012 C CA    . ASP F 3 155 ? 51.936 58.447 15.184  1.00 37.43 ? 155 ASP B CA    1 
ATOM   4013 C C     . ASP F 3 155 ? 52.807 59.563 14.612  1.00 39.26 ? 155 ASP B C     1 
ATOM   4014 O O     . ASP F 3 155 ? 53.970 59.350 14.239  1.00 32.76 ? 155 ASP B O     1 
ATOM   4015 C CB    . ASP F 3 155 ? 51.822 57.354 14.121  1.00 35.88 ? 155 ASP B CB    1 
ATOM   4016 C CG    . ASP F 3 155 ? 53.133 56.665 13.896  1.00 40.84 ? 155 ASP B CG    1 
ATOM   4017 O OD1   . ASP F 3 155 ? 53.718 56.837 12.785  1.00 42.09 ? 155 ASP B OD1   1 
ATOM   4018 O OD2   . ASP F 3 155 ? 53.604 56.016 14.870  1.00 31.66 ? 155 ASP B OD2   1 
ATOM   4019 N N     . ALA F 3 156 ? 52.239 60.763 14.576  1.00 43.64 ? 156 ALA B N     1 
ATOM   4020 C CA    . ALA F 3 156 ? 52.870 61.913 13.949  1.00 47.40 ? 156 ALA B CA    1 
ATOM   4021 C C     . ALA F 3 156 ? 53.984 62.637 14.757  1.00 48.92 ? 156 ALA B C     1 
ATOM   4022 O O     . ALA F 3 156 ? 53.758 63.710 15.337  1.00 50.82 ? 156 ALA B O     1 
ATOM   4023 C CB    . ALA F 3 156 ? 51.758 62.888 13.565  1.00 50.61 ? 156 ALA B CB    1 
ATOM   4024 N N     . MET F 3 157 ? 55.188 62.068 14.790  1.00 52.18 ? 157 MET B N     1 
ATOM   4025 C CA    . MET F 3 157 ? 56.307 62.701 15.515  1.00 53.71 ? 157 MET B CA    1 
ATOM   4026 C C     . MET F 3 157 ? 56.479 64.139 15.002  1.00 51.85 ? 157 MET B C     1 
ATOM   4027 O O     . MET F 3 157 ? 56.729 64.389 13.802  1.00 50.10 ? 157 MET B O     1 
ATOM   4028 C CB    . MET F 3 157 ? 57.622 61.879 15.315  1.00 56.55 ? 157 MET B CB    1 
ATOM   4029 C CG    . MET F 3 157 ? 58.962 62.445 15.913  1.00 52.89 ? 157 MET B CG    1 
ATOM   4030 S SD    . MET F 3 157 ? 60.543 61.449 15.625  1.00 45.77 ? 157 MET B SD    1 
ATOM   4031 C CE    . MET F 3 157 ? 60.493 60.359 17.078  1.00 42.19 ? 157 MET B CE    1 
ATOM   4032 N N     . THR F 3 158 ? 56.209 65.086 15.887  1.00 47.67 ? 158 THR B N     1 
ATOM   4033 C CA    . THR F 3 158 ? 56.437 66.479 15.566  1.00 49.09 ? 158 THR B CA    1 
ATOM   4034 C C     . THR F 3 158 ? 57.973 66.601 15.433  1.00 47.19 ? 158 THR B C     1 
ATOM   4035 O O     . THR F 3 158 ? 58.695 66.723 16.423  1.00 46.62 ? 158 THR B O     1 
ATOM   4036 C CB    . THR F 3 158 ? 55.857 67.408 16.697  1.00 46.69 ? 158 THR B CB    1 
ATOM   4037 O OG1   . THR F 3 158 ? 54.875 66.690 17.482  1.00 37.48 ? 158 THR B OG1   1 
ATOM   4038 C CG2   . THR F 3 158 ? 55.179 68.642 16.070  1.00 36.28 ? 158 THR B CG2   1 
ATOM   4039 N N     . HIS F 3 159 ? 58.458 66.276 14.236  1.00 48.80 ? 159 HIS B N     1 
ATOM   4040 C CA    . HIS F 3 159 ? 59.863 66.377 13.866  1.00 52.69 ? 159 HIS B CA    1 
ATOM   4041 C C     . HIS F 3 159 ? 60.235 67.867 13.945  1.00 44.07 ? 159 HIS B C     1 
ATOM   4042 O O     . HIS F 3 159 ? 59.703 68.678 13.213  1.00 42.55 ? 159 HIS B O     1 
ATOM   4043 C CB    . HIS F 3 159 ? 60.061 65.825 12.421  1.00 57.66 ? 159 HIS B CB    1 
ATOM   4044 C CG    . HIS F 3 159 ? 60.248 66.890 11.379  1.00 62.89 ? 159 HIS B CG    1 
ATOM   4045 N ND1   . HIS F 3 159 ? 59.183 67.546 10.799  1.00 67.71 ? 159 HIS B ND1   1 
ATOM   4046 C CD2   . HIS F 3 159 ? 61.358 67.555 10.969  1.00 65.80 ? 159 HIS B CD2   1 
ATOM   4047 C CE1   . HIS F 3 159 ? 59.622 68.586 10.109  1.00 69.78 ? 159 HIS B CE1   1 
ATOM   4048 N NE2   . HIS F 3 159 ? 60.939 68.612 10.194  1.00 69.48 ? 159 HIS B NE2   1 
ATOM   4049 H HD1   . HIS F 3 159 ? 58.275 67.185 10.809  1.00 0.00  ? 159 HIS B HD1   1 
ATOM   4050 N N     . PRO F 3 160 ? 61.170 68.249 14.816  1.00 43.05 ? 160 PRO B N     1 
ATOM   4051 C CA    . PRO F 3 160 ? 60.784 68.910 16.076  1.00 38.35 ? 160 PRO B CA    1 
ATOM   4052 C C     . PRO F 3 160 ? 59.500 69.688 15.843  1.00 36.92 ? 160 PRO B C     1 
ATOM   4053 O O     . PRO F 3 160 ? 58.433 69.373 16.370  1.00 24.56 ? 160 PRO B O     1 
ATOM   4054 C CB    . PRO F 3 160 ? 61.977 69.800 16.384  1.00 40.53 ? 160 PRO B CB    1 
ATOM   4055 C CG    . PRO F 3 160 ? 63.173 69.031 15.748  1.00 43.53 ? 160 PRO B CG    1 
ATOM   4056 C CD    . PRO F 3 160 ? 62.579 68.585 14.430  1.00 42.04 ? 160 PRO B CD    1 
ATOM   4057 N N     . ASP F 3 161 ? 59.583 70.645 14.944  1.00 40.89 ? 161 ASP B N     1 
ATOM   4058 C CA    . ASP F 3 161 ? 58.379 71.333 14.537  1.00 50.40 ? 161 ASP B CA    1 
ATOM   4059 C C     . ASP F 3 161 ? 58.012 70.735 13.149  1.00 54.85 ? 161 ASP B C     1 
ATOM   4060 O O     . ASP F 3 161 ? 58.804 70.837 12.184  1.00 54.22 ? 161 ASP B O     1 
ATOM   4061 C CB    . ASP F 3 161 ? 58.641 72.867 14.498  1.00 55.66 ? 161 ASP B CB    1 
ATOM   4062 C CG    . ASP F 3 161 ? 58.687 73.521 15.916  1.00 52.74 ? 161 ASP B CG    1 
ATOM   4063 O OD1   . ASP F 3 161 ? 57.626 73.980 16.411  1.00 53.62 ? 161 ASP B OD1   1 
ATOM   4064 O OD2   . ASP F 3 161 ? 59.782 73.595 16.527  1.00 45.92 ? 161 ASP B OD2   1 
ATOM   4065 N N     . GLY F 3 162 ? 56.966 69.892 13.150  1.00 56.39 ? 162 GLY B N     1 
ATOM   4066 C CA    . GLY F 3 162 ? 56.438 69.295 11.922  1.00 57.94 ? 162 GLY B CA    1 
ATOM   4067 C C     . GLY F 3 162 ? 56.305 67.771 11.927  1.00 59.35 ? 162 GLY B C     1 
ATOM   4068 O O     . GLY F 3 162 ? 57.233 67.083 12.342  1.00 58.99 ? 162 GLY B O     1 
ATOM   4069 N N     . MET F 3 163 ? 55.237 67.217 11.357  1.00 54.21 ? 163 MET B N     1 
ATOM   4070 C CA    . MET F 3 163 ? 55.019 65.779 11.485  1.00 46.38 ? 163 MET B CA    1 
ATOM   4071 C C     . MET F 3 163 ? 56.002 64.862 10.788  1.00 42.05 ? 163 MET B C     1 
ATOM   4072 O O     . MET F 3 163 ? 56.725 65.278 9.885   1.00 34.87 ? 163 MET B O     1 
ATOM   4073 C CB    . MET F 3 163 ? 53.602 65.430 11.046  1.00 44.11 ? 163 MET B CB    1 
ATOM   4074 C CG    . MET F 3 163 ? 52.568 65.955 12.038  1.00 44.44 ? 163 MET B CG    1 
ATOM   4075 S SD    . MET F 3 163 ? 53.196 65.876 13.761  1.00 47.59 ? 163 MET B SD    1 
ATOM   4076 C CE    . MET F 3 163 ? 51.659 66.259 14.722  1.00 32.12 ? 163 MET B CE    1 
ATOM   4077 N N     . GLN F 3 164 ? 56.083 63.643 11.320  1.00 42.76 ? 164 GLN B N     1 
ATOM   4078 C CA    . GLN F 3 164 ? 56.919 62.543 10.822  1.00 40.08 ? 164 GLN B CA    1 
ATOM   4079 C C     . GLN F 3 164 ? 56.232 61.197 11.102  1.00 34.79 ? 164 GLN B C     1 
ATOM   4080 O O     . GLN F 3 164 ? 56.511 60.502 12.092  1.00 24.25 ? 164 GLN B O     1 
ATOM   4081 C CB    . GLN F 3 164 ? 58.293 62.521 11.499  1.00 38.00 ? 164 GLN B CB    1 
ATOM   4082 C CG    . GLN F 3 164 ? 59.099 61.255 11.151  1.00 17.81 ? 164 GLN B CG    1 
ATOM   4083 C CD    . GLN F 3 164 ? 59.703 60.609 12.359  1.00 18.28 ? 164 GLN B CD    1 
ATOM   4084 O OE1   . GLN F 3 164 ? 60.913 60.438 12.451  1.00 22.53 ? 164 GLN B OE1   1 
ATOM   4085 N NE2   . GLN F 3 164 ? 58.870 60.228 13.290  1.00 15.81 ? 164 GLN B NE2   1 
ATOM   4086 N N     . ILE F 3 165 ? 55.287 60.852 10.256  1.00 36.24 ? 165 ILE B N     1 
ATOM   4087 C CA    . ILE F 3 165 ? 54.621 59.581 10.422  1.00 34.06 ? 165 ILE B CA    1 
ATOM   4088 C C     . ILE F 3 165 ? 55.488 58.555 9.687   1.00 34.57 ? 165 ILE B C     1 
ATOM   4089 O O     . ILE F 3 165 ? 56.458 58.920 9.000   1.00 34.79 ? 165 ILE B O     1 
ATOM   4090 C CB    . ILE F 3 165 ? 53.173 59.627 9.826   1.00 23.15 ? 165 ILE B CB    1 
ATOM   4091 C CG1   . ILE F 3 165 ? 53.094 60.618 8.659   1.00 13.75 ? 165 ILE B CG1   1 
ATOM   4092 C CG2   . ILE F 3 165 ? 52.205 60.037 10.885  1.00 9.97  ? 165 ILE B CG2   1 
ATOM   4093 C CD1   . ILE F 3 165 ? 52.156 60.149 7.574   1.00 9.93  ? 165 ILE B CD1   1 
ATOM   4094 N N     . LYS F 3 166 ? 55.222 57.278 9.914   1.00 33.90 ? 166 LYS B N     1 
ATOM   4095 C CA    . LYS F 3 166 ? 55.816 56.245 9.082   1.00 32.72 ? 166 LYS B CA    1 
ATOM   4096 C C     . LYS F 3 166 ? 54.582 55.546 8.521   1.00 34.39 ? 166 LYS B C     1 
ATOM   4097 O O     . LYS F 3 166 ? 53.572 55.432 9.232   1.00 34.23 ? 166 LYS B O     1 
ATOM   4098 C CB    . LYS F 3 166 ? 56.674 55.265 9.914   1.00 31.22 ? 166 LYS B CB    1 
ATOM   4099 C CG    . LYS F 3 166 ? 58.197 55.454 9.731   1.00 30.63 ? 166 LYS B CG    1 
ATOM   4100 C CD    . LYS F 3 166 ? 59.074 54.676 10.745  1.00 31.75 ? 166 LYS B CD    1 
ATOM   4101 C CE    . LYS F 3 166 ? 60.561 55.202 10.835  1.00 29.67 ? 166 LYS B CE    1 
ATOM   4102 N NZ    . LYS F 3 166 ? 61.350 55.186 9.542   1.00 17.81 ? 166 LYS B NZ    1 
ATOM   4103 N N     . ILE F 3 167 ? 54.606 55.291 7.212   1.00 32.77 ? 167 ILE B N     1 
ATOM   4104 C CA    . ILE F 3 167 ? 53.604 54.499 6.475   1.00 29.19 ? 167 ILE B CA    1 
ATOM   4105 C C     . ILE F 3 167 ? 54.351 54.274 5.141   1.00 26.75 ? 167 ILE B C     1 
ATOM   4106 O O     . ILE F 3 167 ? 54.980 55.200 4.641   1.00 32.32 ? 167 ILE B O     1 
ATOM   4107 C CB    . ILE F 3 167 ? 52.240 55.291 6.277   1.00 21.10 ? 167 ILE B CB    1 
ATOM   4108 C CG1   . ILE F 3 167 ? 51.070 54.495 6.862   1.00 29.25 ? 167 ILE B CG1   1 
ATOM   4109 C CG2   . ILE F 3 167 ? 51.876 55.429 4.818   1.00 22.32 ? 167 ILE B CG2   1 
ATOM   4110 C CD1   . ILE F 3 167 ? 50.942 54.493 8.378   1.00 35.93 ? 167 ILE B CD1   1 
ATOM   4111 N N     . THR F 3 168 ? 54.407 53.031 4.659   1.00 25.64 ? 168 THR B N     1 
ATOM   4112 C CA    . THR F 3 168 ? 55.179 52.684 3.456   1.00 30.22 ? 168 THR B CA    1 
ATOM   4113 C C     . THR F 3 168 ? 54.418 53.140 2.197   1.00 31.64 ? 168 THR B C     1 
ATOM   4114 O O     . THR F 3 168 ? 53.192 53.256 2.233   1.00 41.95 ? 168 THR B O     1 
ATOM   4115 C CB    . THR F 3 168 ? 55.448 51.133 3.390   1.00 27.25 ? 168 THR B CB    1 
ATOM   4116 O OG1   . THR F 3 168 ? 54.200 50.429 3.278   1.00 27.59 ? 168 THR B OG1   1 
ATOM   4117 C CG2   . THR F 3 168 ? 56.172 50.650 4.657   1.00 23.33 ? 168 THR B CG2   1 
ATOM   4118 N N     . ARG F 3 169 ? 55.120 53.384 1.093   1.00 28.28 ? 169 ARG B N     1 
ATOM   4119 C CA    . ARG F 3 169 ? 54.466 53.846 -0.141  1.00 31.33 ? 169 ARG B CA    1 
ATOM   4120 C C     . ARG F 3 169 ? 53.384 52.856 -0.596  1.00 27.05 ? 169 ARG B C     1 
ATOM   4121 O O     . ARG F 3 169 ? 52.289 53.236 -1.027  1.00 19.34 ? 169 ARG B O     1 
ATOM   4122 C CB    . ARG F 3 169 ? 55.502 54.034 -1.266  1.00 37.11 ? 169 ARG B CB    1 
ATOM   4123 C CG    . ARG F 3 169 ? 56.417 55.264 -1.123  1.00 36.78 ? 169 ARG B CG    1 
ATOM   4124 C CD    . ARG F 3 169 ? 57.852 54.945 -1.598  1.00 36.74 ? 169 ARG B CD    1 
ATOM   4125 N NE    . ARG F 3 169 ? 58.811 56.045 -1.470  1.00 27.46 ? 169 ARG B NE    1 
ATOM   4126 C CZ    . ARG F 3 169 ? 59.191 56.601 -0.316  1.00 31.98 ? 169 ARG B CZ    1 
ATOM   4127 N NH1   . ARG F 3 169 ? 58.697 56.191 0.855   1.00 23.32 ? 169 ARG B NH1   1 
ATOM   4128 N NH2   . ARG F 3 169 ? 60.129 57.537 -0.328  1.00 36.79 ? 169 ARG B NH2   1 
ATOM   4129 N N     . GLN F 3 170 ? 53.695 51.582 -0.423  1.00 24.60 ? 170 GLN B N     1 
ATOM   4130 C CA    . GLN F 3 170 ? 52.799 50.502 -0.750  1.00 15.50 ? 170 GLN B CA    1 
ATOM   4131 C C     . GLN F 3 170 ? 51.504 50.697 0.023   1.00 18.62 ? 170 GLN B C     1 
ATOM   4132 O O     . GLN F 3 170 ? 50.419 50.544 -0.546  1.00 19.39 ? 170 GLN B O     1 
ATOM   4133 C CB    . GLN F 3 170 ? 53.474 49.218 -0.365  1.00 17.29 ? 170 GLN B CB    1 
ATOM   4134 C CG    . GLN F 3 170 ? 53.273 48.089 -1.307  1.00 26.90 ? 170 GLN B CG    1 
ATOM   4135 C CD    . GLN F 3 170 ? 54.147 46.928 -0.932  1.00 30.71 ? 170 GLN B CD    1 
ATOM   4136 O OE1   . GLN F 3 170 ? 55.118 46.632 -1.611  1.00 35.69 ? 170 GLN B OE1   1 
ATOM   4137 N NE2   . GLN F 3 170 ? 53.829 46.283 0.177   1.00 29.65 ? 170 GLN B NE2   1 
ATOM   4138 N N     . GLU F 3 171 ? 51.627 51.100 1.294   1.00 15.76 ? 171 GLU B N     1 
ATOM   4139 C CA    . GLU F 3 171 ? 50.466 51.369 2.169   1.00 14.38 ? 171 GLU B CA    1 
ATOM   4140 C C     . GLU F 3 171 ? 49.643 52.571 1.729   1.00 13.39 ? 171 GLU B C     1 
ATOM   4141 O O     . GLU F 3 171 ? 48.437 52.487 1.583   1.00 9.77  ? 171 GLU B O     1 
ATOM   4142 C CB    . GLU F 3 171 ? 50.927 51.606 3.603   1.00 17.94 ? 171 GLU B CB    1 
ATOM   4143 C CG    . GLU F 3 171 ? 50.575 50.493 4.581   1.00 24.26 ? 171 GLU B CG    1 
ATOM   4144 C CD    . GLU F 3 171 ? 49.165 50.608 5.075   1.00 23.40 ? 171 GLU B CD    1 
ATOM   4145 O OE1   . GLU F 3 171 ? 48.262 50.808 4.244   1.00 24.45 ? 171 GLU B OE1   1 
ATOM   4146 O OE2   . GLU F 3 171 ? 48.956 50.539 6.292   1.00 15.97 ? 171 GLU B OE2   1 
ATOM   4147 N N     . ILE F 3 172 ? 50.309 53.704 1.553   1.00 16.89 ? 172 ILE B N     1 
ATOM   4148 C CA    . ILE F 3 172 ? 49.682 54.923 1.084   1.00 12.82 ? 172 ILE B CA    1 
ATOM   4149 C C     . ILE F 3 172 ? 48.880 54.509 -0.116  1.00 22.75 ? 172 ILE B C     1 
ATOM   4150 O O     . ILE F 3 172 ? 47.688 54.784 -0.175  1.00 20.28 ? 172 ILE B O     1 
ATOM   4151 C CB    . ILE F 3 172 ? 50.660 55.903 0.570   1.00 6.00  ? 172 ILE B CB    1 
ATOM   4152 C CG1   . ILE F 3 172 ? 51.821 56.043 1.503   1.00 6.00  ? 172 ILE B CG1   1 
ATOM   4153 C CG2   . ILE F 3 172 ? 49.995 57.188 0.438   1.00 9.04  ? 172 ILE B CG2   1 
ATOM   4154 C CD1   . ILE F 3 172 ? 52.977 56.623 0.809   1.00 7.22  ? 172 ILE B CD1   1 
ATOM   4155 N N     . GLY F 3 173 ? 49.554 53.797 -1.028  1.00 26.79 ? 173 GLY B N     1 
ATOM   4156 C CA    . GLY F 3 173 ? 48.954 53.249 -2.242  1.00 27.41 ? 173 GLY B CA    1 
ATOM   4157 C C     . GLY F 3 173 ? 47.688 52.432 -2.020  1.00 24.87 ? 173 GLY B C     1 
ATOM   4158 O O     . GLY F 3 173 ? 46.723 52.488 -2.810  1.00 22.30 ? 173 GLY B O     1 
ATOM   4159 N N     . GLN F 3 174 ? 47.661 51.729 -0.897  1.00 22.95 ? 174 GLN B N     1 
ATOM   4160 C CA    . GLN F 3 174 ? 46.512 50.935 -0.488  1.00 17.55 ? 174 GLN B CA    1 
ATOM   4161 C C     . GLN F 3 174 ? 45.428 51.798 0.220   1.00 16.71 ? 174 GLN B C     1 
ATOM   4162 O O     . GLN F 3 174 ? 44.359 51.275 0.537   1.00 28.54 ? 174 GLN B O     1 
ATOM   4163 C CB    . GLN F 3 174 ? 47.018 49.816 0.436   1.00 21.74 ? 174 GLN B CB    1 
ATOM   4164 C CG    . GLN F 3 174 ? 46.647 48.394 0.079   1.00 21.23 ? 174 GLN B CG    1 
ATOM   4165 C CD    . GLN F 3 174 ? 47.427 47.382 0.934   1.00 23.45 ? 174 GLN B CD    1 
ATOM   4166 O OE1   . GLN F 3 174 ? 48.227 46.588 0.408   1.00 17.88 ? 174 GLN B OE1   1 
ATOM   4167 N NE2   . GLN F 3 174 ? 47.205 47.415 2.262   1.00 11.60 ? 174 GLN B NE2   1 
ATOM   4168 N N     . ILE F 3 175 ? 45.730 53.055 0.573   1.00 18.61 ? 175 ILE B N     1 
ATOM   4169 C CA    . ILE F 3 175 ? 44.713 54.005 1.108   1.00 11.72 ? 175 ILE B CA    1 
ATOM   4170 C C     . ILE F 3 175 ? 44.033 54.751 -0.038  1.00 6.07  ? 175 ILE B C     1 
ATOM   4171 O O     . ILE F 3 175 ? 42.850 55.038 -0.014  1.00 6.00  ? 175 ILE B O     1 
ATOM   4172 C CB    . ILE F 3 175 ? 45.299 55.108 1.989   1.00 6.00  ? 175 ILE B CB    1 
ATOM   4173 C CG1   . ILE F 3 175 ? 46.327 54.531 2.976   1.00 6.00  ? 175 ILE B CG1   1 
ATOM   4174 C CG2   . ILE F 3 175 ? 44.149 55.829 2.660   1.00 9.18  ? 175 ILE B CG2   1 
ATOM   4175 C CD1   . ILE F 3 175 ? 46.118 54.905 4.471   1.00 6.00  ? 175 ILE B CD1   1 
ATOM   4176 N N     . VAL F 3 176 ? 44.853 55.083 -1.021  1.00 9.83  ? 176 VAL B N     1 
ATOM   4177 C CA    . VAL F 3 176 ? 44.504 55.909 -2.158  1.00 9.57  ? 176 VAL B CA    1 
ATOM   4178 C C     . VAL F 3 176 ? 43.851 55.169 -3.280  1.00 11.27 ? 176 VAL B C     1 
ATOM   4179 O O     . VAL F 3 176 ? 43.015 55.736 -3.959  1.00 6.51  ? 176 VAL B O     1 
ATOM   4180 C CB    . VAL F 3 176 ? 45.787 56.624 -2.670  1.00 19.35 ? 176 VAL B CB    1 
ATOM   4181 C CG1   . VAL F 3 176 ? 45.938 56.518 -4.197  1.00 14.08 ? 176 VAL B CG1   1 
ATOM   4182 C CG2   . VAL F 3 176 ? 45.747 58.069 -2.206  1.00 27.67 ? 176 VAL B CG2   1 
ATOM   4183 N N     . GLY F 3 177 ? 44.324 53.952 -3.543  1.00 15.74 ? 177 GLY B N     1 
ATOM   4184 C CA    . GLY F 3 177 ? 43.813 53.146 -4.653  1.00 14.62 ? 177 GLY B CA    1 
ATOM   4185 C C     . GLY F 3 177 ? 44.578 53.338 -5.952  1.00 14.08 ? 177 GLY B C     1 
ATOM   4186 O O     . GLY F 3 177 ? 43.999 53.297 -7.028  1.00 13.55 ? 177 GLY B O     1 
ATOM   4187 N N     . CYS F 3 178 ? 45.890 53.462 -5.856  1.00 9.47  ? 178 CYS B N     1 
ATOM   4188 C CA    . CYS F 3 178 ? 46.705 53.755 -7.015  1.00 12.00 ? 178 CYS B CA    1 
ATOM   4189 C C     . CYS F 3 178 ? 47.878 52.819 -6.903  1.00 15.01 ? 178 CYS B C     1 
ATOM   4190 O O     . CYS F 3 178 ? 48.206 52.416 -5.796  1.00 27.69 ? 178 CYS B O     1 
ATOM   4191 C CB    . CYS F 3 178 ? 47.220 55.197 -6.977  1.00 16.92 ? 178 CYS B CB    1 
ATOM   4192 S SG    . CYS F 3 178 ? 48.741 55.421 -5.997  1.00 15.85 ? 178 CYS B SG    1 
ATOM   4193 N N     . SER F 3 179 ? 48.550 52.536 -8.017  1.00 11.40 ? 179 SER B N     1 
ATOM   4194 C CA    . SER F 3 179 ? 49.666 51.611 -8.018  1.00 13.00 ? 179 SER B CA    1 
ATOM   4195 C C     . SER F 3 179 ? 50.700 51.949 -6.969  1.00 19.00 ? 179 SER B C     1 
ATOM   4196 O O     . SER F 3 179 ? 50.925 53.119 -6.639  1.00 19.94 ? 179 SER B O     1 
ATOM   4197 C CB    . SER F 3 179 ? 50.341 51.633 -9.380  1.00 16.78 ? 179 SER B CB    1 
ATOM   4198 O OG    . SER F 3 179 ? 51.592 50.955 -9.373  1.00 18.46 ? 179 SER B OG    1 
ATOM   4199 N N     . ARG F 3 180 ? 51.391 50.929 -6.494  1.00 17.77 ? 180 ARG B N     1 
ATOM   4200 C CA    . ARG F 3 180 ? 52.515 51.195 -5.606  1.00 22.32 ? 180 ARG B CA    1 
ATOM   4201 C C     . ARG F 3 180 ? 53.519 52.046 -6.394  1.00 18.83 ? 180 ARG B C     1 
ATOM   4202 O O     . ARG F 3 180 ? 54.169 52.914 -5.844  1.00 19.41 ? 180 ARG B O     1 
ATOM   4203 C CB    . ARG F 3 180 ? 53.187 49.888 -5.167  1.00 22.79 ? 180 ARG B CB    1 
ATOM   4204 C CG    . ARG F 3 180 ? 54.346 50.088 -4.188  1.00 27.46 ? 180 ARG B CG    1 
ATOM   4205 C CD    . ARG F 3 180 ? 55.436 49.008 -4.340  1.00 28.12 ? 180 ARG B CD    1 
ATOM   4206 N NE    . ARG F 3 180 ? 56.415 49.414 -5.332  1.00 25.14 ? 180 ARG B NE    1 
ATOM   4207 C CZ    . ARG F 3 180 ? 57.287 48.607 -5.908  1.00 31.04 ? 180 ARG B CZ    1 
ATOM   4208 N NH1   . ARG F 3 180 ? 57.305 47.324 -5.592  1.00 36.38 ? 180 ARG B NH1   1 
ATOM   4209 N NH2   . ARG F 3 180 ? 58.168 49.097 -6.776  1.00 25.31 ? 180 ARG B NH2   1 
ATOM   4210 N N     . PHE F 3 181 ? 53.591 51.806 -7.699  1.00 16.64 ? 181 PHE B N     1 
ATOM   4211 C CA    . PHE F 3 181 ? 54.583 52.422 -8.589  1.00 22.83 ? 181 PHE B CA    1 
ATOM   4212 C C     . PHE F 3 181 ? 54.342 53.925 -8.751  1.00 25.67 ? 181 PHE B C     1 
ATOM   4213 O O     . PHE F 3 181 ? 55.284 54.734 -8.750  1.00 32.65 ? 181 PHE B O     1 
ATOM   4214 C CB    . PHE F 3 181 ? 54.544 51.768 -9.986  1.00 23.66 ? 181 PHE B CB    1 
ATOM   4215 C CG    . PHE F 3 181 ? 54.826 50.301 -9.993  1.00 12.36 ? 181 PHE B CG    1 
ATOM   4216 C CD1   . PHE F 3 181 ? 53.904 49.417 -10.546 1.00 6.00  ? 181 PHE B CD1   1 
ATOM   4217 C CD2   . PHE F 3 181 ? 56.051 49.811 -9.515  1.00 12.95 ? 181 PHE B CD2   1 
ATOM   4218 C CE1   . PHE F 3 181 ? 54.211 48.072 -10.631 1.00 19.25 ? 181 PHE B CE1   1 
ATOM   4219 C CE2   . PHE F 3 181 ? 56.370 48.462 -9.595  1.00 6.00  ? 181 PHE B CE2   1 
ATOM   4220 C CZ    . PHE F 3 181 ? 55.463 47.594 -10.150 1.00 11.22 ? 181 PHE B CZ    1 
ATOM   4221 N N     . THR F 3 182 ? 53.092 54.287 -8.995  1.00 20.53 ? 182 THR B N     1 
ATOM   4222 C CA    . THR F 3 182 ? 52.743 55.677 -9.027  1.00 11.84 ? 182 THR B CA    1 
ATOM   4223 C C     . THR F 3 182 ? 53.032 56.319 -7.629  1.00 9.44  ? 182 THR B C     1 
ATOM   4224 O O     . THR F 3 182 ? 53.870 57.203 -7.572  1.00 13.59 ? 182 THR B O     1 
ATOM   4225 C CB    . THR F 3 182 ? 51.300 55.800 -9.432  1.00 21.29 ? 182 THR B CB    1 
ATOM   4226 O OG1   . THR F 3 182 ? 51.035 54.889 -10.530 1.00 16.32 ? 182 THR B OG1   1 
ATOM   4227 C CG2   . THR F 3 182 ? 51.010 57.240 -9.838  1.00 22.39 ? 182 THR B CG2   1 
ATOM   4228 N N     . VAL F 3 183 ? 52.523 55.780 -6.513  1.00 9.29  ? 183 VAL B N     1 
ATOM   4229 C CA    . VAL F 3 183 ? 52.830 56.326 -5.181  1.00 8.09  ? 183 VAL B CA    1 
ATOM   4230 C C     . VAL F 3 183 ? 54.312 56.576 -4.902  1.00 13.20 ? 183 VAL B C     1 
ATOM   4231 O O     . VAL F 3 183 ? 54.667 57.454 -4.105  1.00 14.15 ? 183 VAL B O     1 
ATOM   4232 C CB    . VAL F 3 183 ? 52.289 55.434 -4.062  1.00 6.00  ? 183 VAL B CB    1 
ATOM   4233 C CG1   . VAL F 3 183 ? 52.759 55.921 -2.711  1.00 6.00  ? 183 VAL B CG1   1 
ATOM   4234 C CG2   . VAL F 3 183 ? 50.813 55.507 -4.053  1.00 6.00  ? 183 VAL B CG2   1 
ATOM   4235 N N     . GLY F 3 184 ? 55.183 55.883 -5.612  1.00 20.86 ? 184 GLY B N     1 
ATOM   4236 C CA    . GLY F 3 184 ? 56.600 56.175 -5.485  1.00 27.37 ? 184 GLY B CA    1 
ATOM   4237 C C     . GLY F 3 184 ? 56.931 57.552 -6.059  1.00 31.04 ? 184 GLY B C     1 
ATOM   4238 O O     . GLY F 3 184 ? 57.200 58.497 -5.308  1.00 34.29 ? 184 GLY B O     1 
ATOM   4239 N N     . ARG F 3 185 ? 56.776 57.691 -7.377  1.00 31.38 ? 185 ARG B N     1 
ATOM   4240 C CA    . ARG F 3 185 ? 57.195 58.879 -8.150  1.00 30.06 ? 185 ARG B CA    1 
ATOM   4241 C C     . ARG F 3 185 ? 56.579 60.188 -7.786  1.00 26.81 ? 185 ARG B C     1 
ATOM   4242 O O     . ARG F 3 185 ? 57.171 61.239 -7.975  1.00 24.81 ? 185 ARG B O     1 
ATOM   4243 C CB    . ARG F 3 185 ? 56.916 58.670 -9.624  1.00 31.57 ? 185 ARG B CB    1 
ATOM   4244 C CG    . ARG F 3 185 ? 57.752 57.585 -10.219 1.00 47.05 ? 185 ARG B CG    1 
ATOM   4245 C CD    . ARG F 3 185 ? 57.385 57.387 -11.664 1.00 47.16 ? 185 ARG B CD    1 
ATOM   4246 N NE    . ARG F 3 185 ? 56.259 56.483 -11.850 1.00 36.88 ? 185 ARG B NE    1 
ATOM   4247 C CZ    . ARG F 3 185 ? 56.354 55.385 -12.568 1.00 35.54 ? 185 ARG B CZ    1 
ATOM   4248 N NH1   . ARG F 3 185 ? 57.529 55.077 -13.129 1.00 31.64 ? 185 ARG B NH1   1 
ATOM   4249 N NH2   . ARG F 3 185 ? 55.261 54.693 -12.845 1.00 38.02 ? 185 ARG B NH2   1 
ATOM   4250 N N     . ILE F 3 186 ? 55.313 60.115 -7.444  1.00 28.26 ? 186 ILE B N     1 
ATOM   4251 C CA    . ILE F 3 186 ? 54.537 61.276 -7.081  1.00 24.92 ? 186 ILE B CA    1 
ATOM   4252 C C     . ILE F 3 186 ? 54.978 61.752 -5.699  1.00 28.46 ? 186 ILE B C     1 
ATOM   4253 O O     . ILE F 3 186 ? 55.203 62.940 -5.495  1.00 29.24 ? 186 ILE B O     1 
ATOM   4254 C CB    . ILE F 3 186 ? 53.029 60.936 -7.045  1.00 17.77 ? 186 ILE B CB    1 
ATOM   4255 C CG1   . ILE F 3 186 ? 52.564 60.393 -8.398  1.00 12.11 ? 186 ILE B CG1   1 
ATOM   4256 C CG2   . ILE F 3 186 ? 52.264 62.163 -6.665  1.00 22.09 ? 186 ILE B CG2   1 
ATOM   4257 C CD1   . ILE F 3 186 ? 52.435 61.445 -9.490  1.00 23.23 ? 186 ILE B CD1   1 
ATOM   4258 N N     . LEU F 3 187 ? 55.069 60.821 -4.751  1.00 32.81 ? 187 LEU B N     1 
ATOM   4259 C CA    . LEU F 3 187 ? 55.490 61.147 -3.390  1.00 34.18 ? 187 LEU B CA    1 
ATOM   4260 C C     . LEU F 3 187 ? 56.908 61.735 -3.492  1.00 37.54 ? 187 LEU B C     1 
ATOM   4261 O O     . LEU F 3 187 ? 57.228 62.778 -2.869  1.00 40.17 ? 187 LEU B O     1 
ATOM   4262 C CB    . LEU F 3 187 ? 55.511 59.882 -2.513  1.00 21.69 ? 187 LEU B CB    1 
ATOM   4263 C CG    . LEU F 3 187 ? 55.320 60.200 -1.037  1.00 17.20 ? 187 LEU B CG    1 
ATOM   4264 C CD1   . LEU F 3 187 ? 53.848 60.493 -0.833  1.00 17.64 ? 187 LEU B CD1   1 
ATOM   4265 C CD2   . LEU F 3 187 ? 55.773 59.048 -0.139  1.00 12.83 ? 187 LEU B CD2   1 
ATOM   4266 N N     . LYS F 3 188 ? 57.715 61.095 -4.349  1.00 36.11 ? 188 LYS B N     1 
ATOM   4267 C CA    . LYS F 3 188 ? 59.101 61.476 -4.604  1.00 26.21 ? 188 LYS B CA    1 
ATOM   4268 C C     . LYS F 3 188 ? 59.160 62.920 -5.089  1.00 31.18 ? 188 LYS B C     1 
ATOM   4269 O O     . LYS F 3 188 ? 59.497 63.839 -4.333  1.00 15.06 ? 188 LYS B O     1 
ATOM   4270 C CB    . LYS F 3 188 ? 59.696 60.539 -5.648  1.00 8.82  ? 188 LYS B CB    1 
ATOM   4271 C CG    . LYS F 3 188 ? 61.040 60.941 -6.097  1.00 6.00  ? 188 LYS B CG    1 
ATOM   4272 C CD    . LYS F 3 188 ? 61.923 61.118 -4.906  1.00 6.28  ? 188 LYS B CD    1 
ATOM   4273 C CE    . LYS F 3 188 ? 62.975 60.036 -4.898  1.00 16.59 ? 188 LYS B CE    1 
ATOM   4274 N NZ    . LYS F 3 188 ? 64.076 60.356 -3.941  1.00 21.39 ? 188 LYS B NZ    1 
ATOM   4275 N N     . MET F 3 189 ? 58.703 63.133 -6.314  1.00 37.42 ? 189 MET B N     1 
ATOM   4276 C CA    . MET F 3 189 ? 58.708 64.459 -6.901  1.00 40.96 ? 189 MET B CA    1 
ATOM   4277 C C     . MET F 3 189 ? 57.731 65.411 -6.169  1.00 43.22 ? 189 MET B C     1 
ATOM   4278 O O     . MET F 3 189 ? 57.618 66.591 -6.521  1.00 44.46 ? 189 MET B O     1 
ATOM   4279 C CB    . MET F 3 189 ? 58.429 64.289 -8.411  1.00 42.33 ? 189 MET B CB    1 
ATOM   4280 C CG    . MET F 3 189 ? 57.794 65.410 -9.145  1.00 41.74 ? 189 MET B CG    1 
ATOM   4281 S SD    . MET F 3 189 ? 56.039 65.186 -8.984  1.00 51.87 ? 189 MET B SD    1 
ATOM   4282 C CE    . MET F 3 189 ? 55.833 63.692 -10.057 1.00 40.69 ? 189 MET B CE    1 
ATOM   4283 N N     . LEU F 3 190 ? 57.136 64.922 -5.071  1.00 40.26 ? 190 LEU B N     1 
ATOM   4284 C CA    . LEU F 3 190 ? 56.389 65.758 -4.139  1.00 37.00 ? 190 LEU B CA    1 
ATOM   4285 C C     . LEU F 3 190 ? 57.376 66.472 -3.192  1.00 44.55 ? 190 LEU B C     1 
ATOM   4286 O O     . LEU F 3 190 ? 57.117 67.609 -2.736  1.00 41.28 ? 190 LEU B O     1 
ATOM   4287 C CB    . LEU F 3 190 ? 55.393 64.916 -3.340  1.00 21.80 ? 190 LEU B CB    1 
ATOM   4288 C CG    . LEU F 3 190 ? 54.132 65.703 -2.981  1.00 28.59 ? 190 LEU B CG    1 
ATOM   4289 C CD1   . LEU F 3 190 ? 53.783 66.626 -4.153  1.00 33.54 ? 190 LEU B CD1   1 
ATOM   4290 C CD2   . LEU F 3 190 ? 52.969 64.770 -2.690  1.00 18.27 ? 190 LEU B CD2   1 
ATOM   4291 N N     . GLU F 3 191 ? 58.503 65.821 -2.876  1.00 49.80 ? 191 GLU B N     1 
ATOM   4292 C CA    . GLU F 3 191 ? 59.569 66.521 -2.150  1.00 50.22 ? 191 GLU B CA    1 
ATOM   4293 C C     . GLU F 3 191 ? 60.312 67.498 -3.068  1.00 49.87 ? 191 GLU B C     1 
ATOM   4294 O O     . GLU F 3 191 ? 60.904 68.461 -2.591  1.00 46.86 ? 191 GLU B O     1 
ATOM   4295 C CB    . GLU F 3 191 ? 60.579 65.538 -1.482  1.00 49.25 ? 191 GLU B CB    1 
ATOM   4296 C CG    . GLU F 3 191 ? 61.297 64.472 -2.315  1.00 50.54 ? 191 GLU B CG    1 
ATOM   4297 C CD    . GLU F 3 191 ? 62.410 64.997 -3.230  1.00 50.41 ? 191 GLU B CD    1 
ATOM   4298 O OE1   . GLU F 3 191 ? 63.442 65.510 -2.737  1.00 48.51 ? 191 GLU B OE1   1 
ATOM   4299 O OE2   . GLU F 3 191 ? 62.262 64.854 -4.460  1.00 58.08 ? 191 GLU B OE2   1 
ATOM   4300 N N     . ASP F 3 192 ? 60.241 67.273 -4.385  1.00 49.69 ? 192 ASP B N     1 
ATOM   4301 C CA    . ASP F 3 192 ? 60.848 68.186 -5.368  1.00 45.79 ? 192 ASP B CA    1 
ATOM   4302 C C     . ASP F 3 192 ? 60.296 69.569 -5.099  1.00 42.06 ? 192 ASP B C     1 
ATOM   4303 O O     . ASP F 3 192 ? 61.048 70.509 -4.906  1.00 40.55 ? 192 ASP B O     1 
ATOM   4304 C CB    . ASP F 3 192 ? 60.504 67.770 -6.811  1.00 47.74 ? 192 ASP B CB    1 
ATOM   4305 C CG    . ASP F 3 192 ? 61.594 66.900 -7.464  1.00 45.28 ? 192 ASP B CG    1 
ATOM   4306 O OD1   . ASP F 3 192 ? 62.771 66.987 -7.038  1.00 50.63 ? 192 ASP B OD1   1 
ATOM   4307 O OD2   . ASP F 3 192 ? 61.276 66.150 -8.425  1.00 38.87 ? 192 ASP B OD2   1 
ATOM   4308 N N     . GLN F 3 193 ? 58.978 69.644 -4.949  1.00 40.98 ? 193 GLN B N     1 
ATOM   4309 C CA    . GLN F 3 193 ? 58.280 70.873 -4.550  1.00 36.20 ? 193 GLN B CA    1 
ATOM   4310 C C     . GLN F 3 193 ? 58.613 71.218 -3.082  1.00 35.47 ? 193 GLN B C     1 
ATOM   4311 O O     . GLN F 3 193 ? 57.872 71.956 -2.436  1.00 36.39 ? 193 GLN B O     1 
ATOM   4312 C CB    . GLN F 3 193 ? 56.748 70.685 -4.698  1.00 32.39 ? 193 GLN B CB    1 
ATOM   4313 C CG    . GLN F 3 193 ? 56.305 70.168 -6.074  1.00 32.44 ? 193 GLN B CG    1 
ATOM   4314 C CD    . GLN F 3 193 ? 54.864 69.671 -6.115  1.00 37.05 ? 193 GLN B CD    1 
ATOM   4315 O OE1   . GLN F 3 193 ? 54.595 68.588 -6.639  1.00 49.62 ? 193 GLN B OE1   1 
ATOM   4316 N NE2   . GLN F 3 193 ? 53.928 70.475 -5.618  1.00 27.48 ? 193 GLN B NE2   1 
ATOM   4317 N N     . ASN F 3 194 ? 59.700 70.670 -2.550  1.00 33.91 ? 194 ASN B N     1 
ATOM   4318 C CA    . ASN F 3 194 ? 60.080 70.862 -1.161  1.00 40.75 ? 194 ASN B CA    1 
ATOM   4319 C C     . ASN F 3 194 ? 58.974 70.593 -0.138  1.00 41.31 ? 194 ASN B C     1 
ATOM   4320 O O     . ASN F 3 194 ? 59.090 71.036 1.013   1.00 43.42 ? 194 ASN B O     1 
ATOM   4321 C CB    . ASN F 3 194 ? 60.606 72.295 -0.957  1.00 50.77 ? 194 ASN B CB    1 
ATOM   4322 C CG    . ASN F 3 194 ? 62.114 72.399 -1.141  1.00 55.73 ? 194 ASN B CG    1 
ATOM   4323 O OD1   . ASN F 3 194 ? 62.743 71.510 -1.717  1.00 59.38 ? 194 ASN B OD1   1 
ATOM   4324 N ND2   . ASN F 3 194 ? 62.704 73.480 -0.636  1.00 49.32 ? 194 ASN B ND2   1 
ATOM   4325 N N     . LEU F 3 195 ? 57.944 69.831 -0.505  1.00 35.96 ? 195 LEU B N     1 
ATOM   4326 C CA    . LEU F 3 195 ? 56.810 69.678 0.406   1.00 34.09 ? 195 LEU B CA    1 
ATOM   4327 C C     . LEU F 3 195 ? 56.886 68.443 1.328   1.00 29.34 ? 195 LEU B C     1 
ATOM   4328 O O     . LEU F 3 195 ? 56.156 68.367 2.348   1.00 25.53 ? 195 LEU B O     1 
ATOM   4329 C CB    . LEU F 3 195 ? 55.487 69.669 -0.401  1.00 25.17 ? 195 LEU B CB    1 
ATOM   4330 C CG    . LEU F 3 195 ? 54.143 69.673 0.380   1.00 30.67 ? 195 LEU B CG    1 
ATOM   4331 C CD1   . LEU F 3 195 ? 54.103 70.866 1.335   1.00 28.56 ? 195 LEU B CD1   1 
ATOM   4332 C CD2   . LEU F 3 195 ? 52.939 69.725 -0.596  1.00 27.06 ? 195 LEU B CD2   1 
ATOM   4333 N N     . ILE F 3 196 ? 57.826 67.538 1.053   1.00 23.10 ? 196 ILE B N     1 
ATOM   4334 C CA    . ILE F 3 196 ? 57.809 66.285 1.771   1.00 23.97 ? 196 ILE B CA    1 
ATOM   4335 C C     . ILE F 3 196 ? 59.190 65.735 1.988   1.00 28.35 ? 196 ILE B C     1 
ATOM   4336 O O     . ILE F 3 196 ? 60.158 66.259 1.432   1.00 28.10 ? 196 ILE B O     1 
ATOM   4337 C CB    . ILE F 3 196 ? 56.894 65.243 1.006   1.00 19.74 ? 196 ILE B CB    1 
ATOM   4338 C CG1   . ILE F 3 196 ? 56.275 64.295 2.013   1.00 14.91 ? 196 ILE B CG1   1 
ATOM   4339 C CG2   . ILE F 3 196 ? 57.685 64.442 -0.027  1.00 7.84  ? 196 ILE B CG2   1 
ATOM   4340 C CD1   . ILE F 3 196 ? 55.716 65.001 3.192   1.00 19.65 ? 196 ILE B CD1   1 
ATOM   4341 N N     . SER F 3 197 ? 59.257 64.630 2.730   1.00 34.67 ? 197 SER B N     1 
ATOM   4342 C CA    . SER F 3 197 ? 60.512 64.007 3.170   1.00 39.64 ? 197 SER B CA    1 
ATOM   4343 C C     . SER F 3 197 ? 60.404 62.460 3.058   1.00 40.04 ? 197 SER B C     1 
ATOM   4344 O O     . SER F 3 197 ? 59.284 61.930 2.923   1.00 43.10 ? 197 SER B O     1 
ATOM   4345 C CB    . SER F 3 197 ? 60.761 64.420 4.620   1.00 38.86 ? 197 SER B CB    1 
ATOM   4346 O OG    . SER F 3 197 ? 59.994 65.578 4.954   1.00 32.95 ? 197 SER B OG    1 
ATOM   4347 N N     . ALA F 3 198 ? 61.514 61.729 3.189   1.00 35.11 ? 198 ALA B N     1 
ATOM   4348 C CA    . ALA F 3 198 ? 61.432 60.288 2.977   1.00 32.05 ? 198 ALA B CA    1 
ATOM   4349 C C     . ALA F 3 198 ? 62.373 59.340 3.746   1.00 31.28 ? 198 ALA B C     1 
ATOM   4350 O O     . ALA F 3 198 ? 63.127 59.746 4.650   1.00 21.81 ? 198 ALA B O     1 
ATOM   4351 C CB    . ALA F 3 198 ? 61.556 60.011 1.452   1.00 31.23 ? 198 ALA B CB    1 
ATOM   4352 N N     . HIS F 3 199 ? 62.149 58.057 3.427   1.00 36.10 ? 199 HIS B N     1 
ATOM   4353 C CA    . HIS F 3 199 ? 62.853 56.794 3.767   1.00 35.59 ? 199 HIS B CA    1 
ATOM   4354 C C     . HIS F 3 199 ? 61.770 55.709 3.971   1.00 32.23 ? 199 HIS B C     1 
ATOM   4355 O O     . HIS F 3 199 ? 61.650 54.795 3.174   1.00 30.22 ? 199 HIS B O     1 
ATOM   4356 C CB    . HIS F 3 199 ? 63.759 56.918 5.013   1.00 36.50 ? 199 HIS B CB    1 
ATOM   4357 C CG    . HIS F 3 199 ? 65.203 57.199 4.678   1.00 40.65 ? 199 HIS B CG    1 
ATOM   4358 N ND1   . HIS F 3 199 ? 65.788 58.434 4.863   1.00 51.75 ? 199 HIS B ND1   1 
ATOM   4359 C CD2   . HIS F 3 199 ? 66.173 56.406 4.161   1.00 43.95 ? 199 HIS B CD2   1 
ATOM   4360 C CE1   . HIS F 3 199 ? 67.055 58.389 4.479   1.00 48.35 ? 199 HIS B CE1   1 
ATOM   4361 N NE2   . HIS F 3 199 ? 67.313 57.167 4.049   1.00 38.82 ? 199 HIS B NE2   1 
ATOM   4362 N N     . GLY F 3 200 ? 60.857 55.967 4.891   1.00 34.40 ? 200 GLY B N     1 
ATOM   4363 C CA    . GLY F 3 200 ? 59.742 55.083 5.207   1.00 27.93 ? 200 GLY B CA    1 
ATOM   4364 C C     . GLY F 3 200 ? 58.879 56.057 5.995   1.00 31.99 ? 200 GLY B C     1 
ATOM   4365 O O     . GLY F 3 200 ? 57.670 56.148 5.818   1.00 25.90 ? 200 GLY B O     1 
ATOM   4366 N N     . LYS F 3 201 ? 59.534 56.810 6.882   1.00 38.34 ? 201 LYS B N     1 
ATOM   4367 C CA    . LYS F 3 201 ? 58.901 57.948 7.546   1.00 34.04 ? 201 LYS B CA    1 
ATOM   4368 C C     . LYS F 3 201 ? 58.785 59.161 6.608   1.00 30.30 ? 201 LYS B C     1 
ATOM   4369 O O     . LYS F 3 201 ? 59.739 59.592 5.908   1.00 13.96 ? 201 LYS B O     1 
ATOM   4370 C CB    . LYS F 3 201 ? 59.672 58.369 8.819   1.00 32.78 ? 201 LYS B CB    1 
ATOM   4371 C CG    . LYS F 3 201 ? 60.865 59.319 8.659   1.00 28.09 ? 201 LYS B CG    1 
ATOM   4372 C CD    . LYS F 3 201 ? 62.014 58.705 7.856   1.00 40.41 ? 201 LYS B CD    1 
ATOM   4373 C CE    . LYS F 3 201 ? 63.259 59.565 7.980   1.00 45.48 ? 201 LYS B CE    1 
ATOM   4374 N NZ    . LYS F 3 201 ? 64.425 58.933 7.328   1.00 45.16 ? 201 LYS B NZ    1 
ATOM   4375 N N     . THR F 3 202 ? 57.577 59.676 6.581   1.00 25.40 ? 202 THR B N     1 
ATOM   4376 C CA    . THR F 3 202 ? 57.318 60.845 5.834   1.00 31.32 ? 202 THR B CA    1 
ATOM   4377 C C     . THR F 3 202 ? 57.147 61.926 6.910   1.00 42.44 ? 202 THR B C     1 
ATOM   4378 O O     . THR F 3 202 ? 56.327 61.757 7.856   1.00 40.77 ? 202 THR B O     1 
ATOM   4379 C CB    . THR F 3 202 ? 56.054 60.643 4.985   1.00 28.72 ? 202 THR B CB    1 
ATOM   4380 O OG1   . THR F 3 202 ? 54.943 60.269 5.828   1.00 19.45 ? 202 THR B OG1   1 
ATOM   4381 C CG2   . THR F 3 202 ? 56.326 59.568 3.929   1.00 13.23 ? 202 THR B CG2   1 
ATOM   4382 N N     . ILE F 3 203 ? 58.073 62.903 6.867   1.00 44.60 ? 203 ILE B N     1 
ATOM   4383 C CA    . ILE F 3 203 ? 58.085 64.116 7.712   1.00 43.14 ? 203 ILE B CA    1 
ATOM   4384 C C     . ILE F 3 203 ? 57.273 65.208 6.984   1.00 40.07 ? 203 ILE B C     1 
ATOM   4385 O O     . ILE F 3 203 ? 57.737 65.863 6.035   1.00 30.87 ? 203 ILE B O     1 
ATOM   4386 C CB    . ILE F 3 203 ? 59.561 64.598 7.982   1.00 39.78 ? 203 ILE B CB    1 
ATOM   4387 C CG1   . ILE F 3 203 ? 60.131 63.874 9.215   1.00 35.61 ? 203 ILE B CG1   1 
ATOM   4388 C CG2   . ILE F 3 203 ? 59.595 66.104 8.181   1.00 28.46 ? 203 ILE B CG2   1 
ATOM   4389 C CD1   . ILE F 3 203 ? 61.650 63.522 9.168   1.00 26.96 ? 203 ILE B CD1   1 
ATOM   4390 N N     . VAL F 3 204 ? 56.023 65.339 7.395   1.00 39.45 ? 204 VAL B N     1 
ATOM   4391 C CA    . VAL F 3 204 ? 55.095 66.183 6.680   1.00 38.51 ? 204 VAL B CA    1 
ATOM   4392 C C     . VAL F 3 204 ? 55.096 67.527 7.300   1.00 36.39 ? 204 VAL B C     1 
ATOM   4393 O O     . VAL F 3 204 ? 55.640 67.712 8.386   1.00 32.99 ? 204 VAL B O     1 
ATOM   4394 C CB    . VAL F 3 204 ? 53.620 65.585 6.691   1.00 45.59 ? 204 VAL B CB    1 
ATOM   4395 C CG1   . VAL F 3 204 ? 52.819 66.077 7.910   1.00 44.54 ? 204 VAL B CG1   1 
ATOM   4396 C CG2   . VAL F 3 204 ? 52.904 65.964 5.396   1.00 50.67 ? 204 VAL B CG2   1 
ATOM   4397 N N     . VAL F 3 205 ? 54.441 68.420 6.571   1.00 38.55 ? 205 VAL B N     1 
ATOM   4398 C CA    . VAL F 3 205 ? 54.150 69.814 6.876   1.00 44.54 ? 205 VAL B CA    1 
ATOM   4399 C C     . VAL F 3 205 ? 55.195 70.738 6.369   1.00 46.35 ? 205 VAL B C     1 
ATOM   4400 O O     . VAL F 3 205 ? 54.847 71.814 5.900   1.00 50.80 ? 205 VAL B O     1 
ATOM   4401 C CB    . VAL F 3 205 ? 54.305 70.133 8.466   1.00 49.92 ? 205 VAL B CB    1 
ATOM   4402 C CG1   . VAL F 3 205 ? 55.412 71.112 8.743   1.00 45.22 ? 205 VAL B CG1   1 
ATOM   4403 C CG2   . VAL F 3 205 ? 52.982 70.674 9.025   1.00 48.26 ? 205 VAL B CG2   1 
ATOM   4404 N N     . TYR F 3 206 ? 56.444 70.289 6.242   1.00 48.54 ? 206 TYR B N     1 
ATOM   4405 C CA    . TYR F 3 206 ? 57.471 71.130 5.622   1.00 43.28 ? 206 TYR B CA    1 
ATOM   4406 C C     . TYR F 3 206 ? 58.097 70.409 4.436   1.00 40.49 ? 206 TYR B C     1 
ATOM   4407 O O     . TYR F 3 206 ? 57.651 70.599 3.317   1.00 39.07 ? 206 TYR B O     1 
ATOM   4408 C CB    . TYR F 3 206 ? 58.564 71.524 6.641   1.00 52.17 ? 206 TYR B CB    1 
ATOM   4409 C CG    . TYR F 3 206 ? 58.053 72.358 7.788   1.00 55.70 ? 206 TYR B CG    1 
ATOM   4410 C CD1   . TYR F 3 206 ? 57.211 73.473 7.558   1.00 60.19 ? 206 TYR B CD1   1 
ATOM   4411 C CD2   . TYR F 3 206 ? 58.294 71.969 9.113   1.00 58.06 ? 206 TYR B CD2   1 
ATOM   4412 C CE1   . TYR F 3 206 ? 56.597 74.171 8.635   1.00 61.69 ? 206 TYR B CE1   1 
ATOM   4413 C CE2   . TYR F 3 206 ? 57.692 72.654 10.194  1.00 63.71 ? 206 TYR B CE2   1 
ATOM   4414 C CZ    . TYR F 3 206 ? 56.842 73.746 9.952   1.00 67.13 ? 206 TYR B CZ    1 
ATOM   4415 O OH    . TYR F 3 206 ? 56.221 74.364 11.022  1.00 67.99 ? 206 TYR B OH    1 
ATOM   4416 N N     . GLY F 3 207 ? 59.083 69.554 4.689   1.00 35.95 ? 207 GLY B N     1 
ATOM   4417 C CA    . GLY F 3 207 ? 59.741 68.847 3.610   1.00 32.74 ? 207 GLY B CA    1 
ATOM   4418 C C     . GLY F 3 207 ? 61.155 69.344 3.353   1.00 33.92 ? 207 GLY B C     1 
ATOM   4419 O O     . GLY F 3 207 ? 61.840 69.795 4.294   1.00 38.93 ? 207 GLY B O     1 
ATOM   4420 N N     . THR F 3 208 ? 61.597 69.192 2.099   1.00 33.74 ? 208 THR B N     1 
ATOM   4421 C CA    . THR F 3 208 ? 62.920 69.566 1.584   1.00 34.94 ? 208 THR B CA    1 
ATOM   4422 C C     . THR F 3 208 ? 63.075 68.867 0.204   1.00 37.36 ? 208 THR B C     1 
ATOM   4423 O O     . THR F 3 208 ? 62.126 68.241 -0.276  1.00 36.29 ? 208 THR B O     1 
ATOM   4424 C CB    . THR F 3 208 ? 64.057 69.091 2.564   1.00 38.00 ? 208 THR B CB    1 
ATOM   4425 O OG1   . THR F 3 208 ? 65.314 69.691 2.204   1.00 45.02 ? 208 THR B OG1   1 
ATOM   4426 C CG2   . THR F 3 208 ? 64.194 67.551 2.536   1.00 52.57 ? 208 THR B CG2   1 
ATOM   4427 N N     . ARG F 3 209 ? 64.232 69.045 -0.438  1.00 41.60 ? 209 ARG B N     1 
ATOM   4428 C CA    . ARG F 3 209 ? 64.635 68.315 -1.650  1.00 42.61 ? 209 ARG B CA    1 
ATOM   4429 C C     . ARG F 3 209 ? 66.170 68.286 -1.698  1.00 41.92 ? 209 ARG B C     1 
ATOM   4430 O O     . ARG F 3 209 ? 66.812 68.916 -0.823  1.00 37.48 ? 209 ARG B O     1 
ATOM   4431 C CB    . ARG F 3 209 ? 64.077 68.996 -2.938  1.00 45.67 ? 209 ARG B CB    1 
ATOM   4432 O OXT   . ARG F 3 209 ? 66.722 67.609 -2.590  0.01 43.75 ? 209 ARG B OXT   1 
HETATM 4433 P P     . CMP G 4 .   ? 23.442 65.855 7.374   1.00 17.24 ? 210 CMP A P     1 
HETATM 4434 O O1P   . CMP G 4 .   ? 22.352 66.749 7.916   1.00 14.83 ? 210 CMP A O1P   1 
HETATM 4435 O O2P   . CMP G 4 .   ? 24.786 65.763 8.021   1.00 6.00  ? 210 CMP A O2P   1 
HETATM 4436 O "O5'" . CMP G 4 .   ? 23.832 66.421 5.928   1.00 15.33 ? 210 CMP A "O5'" 1 
HETATM 4437 C "C5'" . CMP G 4 .   ? 23.875 65.593 4.714   1.00 17.44 ? 210 CMP A "C5'" 1 
HETATM 4438 C "C4'" . CMP G 4 .   ? 22.744 64.613 4.733   1.00 19.77 ? 210 CMP A "C4'" 1 
HETATM 4439 O "O4'" . CMP G 4 .   ? 22.759 63.746 3.582   1.00 17.85 ? 210 CMP A "O4'" 1 
HETATM 4440 C "C3'" . CMP G 4 .   ? 23.019 63.728 5.919   1.00 26.42 ? 210 CMP A "C3'" 1 
HETATM 4441 O "O3'" . CMP G 4 .   ? 22.697 64.447 7.121   1.00 19.48 ? 210 CMP A "O3'" 1 
HETATM 4442 C "C2'" . CMP G 4 .   ? 22.467 62.364 5.533   1.00 22.86 ? 210 CMP A "C2'" 1 
HETATM 4443 O "O2'" . CMP G 4 .   ? 21.164 62.063 5.986   1.00 28.45 ? 210 CMP A "O2'" 1 
HETATM 4444 C "C1'" . CMP G 4 .   ? 22.621 62.399 4.002   1.00 16.85 ? 210 CMP A "C1'" 1 
HETATM 4445 N N9    . CMP G 4 .   ? 23.842 61.698 3.633   1.00 13.29 ? 210 CMP A N9    1 
HETATM 4446 C C8    . CMP G 4 .   ? 25.119 62.146 3.759   1.00 7.67  ? 210 CMP A C8    1 
HETATM 4447 N N7    . CMP G 4 .   ? 26.020 61.270 3.397   1.00 9.89  ? 210 CMP A N7    1 
HETATM 4448 C C5    . CMP G 4 .   ? 25.268 60.167 3.001   1.00 6.00  ? 210 CMP A C5    1 
HETATM 4449 C C6    . CMP G 4 .   ? 25.615 58.925 2.519   1.00 6.00  ? 210 CMP A C6    1 
HETATM 4450 N N6    . CMP G 4 .   ? 26.862 58.534 2.357   1.00 6.00  ? 210 CMP A N6    1 
HETATM 4451 N N1    . CMP G 4 .   ? 24.633 58.075 2.197   1.00 6.00  ? 210 CMP A N1    1 
HETATM 4452 C C2    . CMP G 4 .   ? 23.383 58.444 2.354   1.00 6.00  ? 210 CMP A C2    1 
HETATM 4453 N N3    . CMP G 4 .   ? 22.922 59.573 2.797   1.00 13.68 ? 210 CMP A N3    1 
HETATM 4454 C C4    . CMP G 4 .   ? 23.934 60.422 3.115   1.00 11.50 ? 210 CMP A C4    1 
HETATM 4455 P P     . CMP H 4 .   ? 31.054 44.724 10.046  1.00 6.00  ? 210 CMP B P     1 
HETATM 4456 O O1P   . CMP H 4 .   ? 30.540 44.090 11.309  1.00 8.86  ? 210 CMP B O1P   1 
HETATM 4457 O O2P   . CMP H 4 .   ? 30.082 44.985 8.932   1.00 8.20  ? 210 CMP B O2P   1 
HETATM 4458 O "O5'" . CMP H 4 .   ? 32.401 44.109 9.413   1.00 7.02  ? 210 CMP B "O5'" 1 
HETATM 4459 C "C5'" . CMP H 4 .   ? 33.626 44.887 9.104   1.00 8.50  ? 210 CMP B "C5'" 1 
HETATM 4460 C "C4'" . CMP H 4 .   ? 33.729 46.073 10.009  1.00 14.17 ? 210 CMP B "C4'" 1 
HETATM 4461 O "O4'" . CMP H 4 .   ? 34.634 47.113 9.543   1.00 15.48 ? 210 CMP B "O4'" 1 
HETATM 4462 C "C3'" . CMP H 4 .   ? 32.431 46.823 9.988   1.00 9.56  ? 210 CMP B "C3'" 1 
HETATM 4463 O "O3'" . CMP H 4 .   ? 31.557 46.050 10.689  1.00 10.25 ? 210 CMP B "O3'" 1 
HETATM 4464 C "C2'" . CMP H 4 .   ? 32.811 48.097 10.687  1.00 11.28 ? 210 CMP B "C2'" 1 
HETATM 4465 O "O2'" . CMP H 4 .   ? 33.008 47.986 12.080  1.00 18.53 ? 210 CMP B "O2'" 1 
HETATM 4466 C "C1'" . CMP H 4 .   ? 34.114 48.392 9.964   1.00 12.67 ? 210 CMP B "C1'" 1 
HETATM 4467 N N9    . CMP H 4 .   ? 33.664 49.199 8.827   1.00 10.30 ? 210 CMP B N9    1 
HETATM 4468 C C8    . CMP H 4 .   ? 32.729 48.889 7.897   1.00 6.25  ? 210 CMP B C8    1 
HETATM 4469 N N7    . CMP H 4 .   ? 32.527 49.823 7.024   1.00 12.70 ? 210 CMP B N7    1 
HETATM 4470 C C5    . CMP H 4 .   ? 33.387 50.832 7.419   1.00 15.34 ? 210 CMP B C5    1 
HETATM 4471 C C6    . CMP H 4 .   ? 33.661 52.101 6.909   1.00 14.20 ? 210 CMP B C6    1 
HETATM 4472 N N6    . CMP H 4 .   ? 33.031 52.650 5.887   1.00 17.83 ? 210 CMP B N6    1 
HETATM 4473 N N1    . CMP H 4 .   ? 34.603 52.812 7.515   1.00 6.00  ? 210 CMP B N1    1 
HETATM 4474 C C2    . CMP H 4 .   ? 35.194 52.325 8.573   1.00 6.00  ? 210 CMP B C2    1 
HETATM 4475 N N3    . CMP H 4 .   ? 35.011 51.188 9.166   1.00 12.05 ? 210 CMP B N3    1 
HETATM 4476 C C4    . CMP H 4 .   ? 34.093 50.458 8.521   1.00 11.26 ? 210 CMP B C4    1 
HETATM 4477 O O     . HOH I 5 .   ? 21.839 69.580 -16.831 1.00 34.50 ? 104 HOH C O     1 
HETATM 4478 O O     . HOH J 5 .   ? 71.511 45.653 5.915   1.00 39.22 ? 72  HOH D O     1 
HETATM 4479 O O     . HOH J 5 .   ? 72.537 49.350 3.538   1.00 45.32 ? 73  HOH D O     1 
HETATM 4480 O O     . HOH J 5 .   ? 73.095 52.715 1.408   1.00 24.95 ? 75  HOH D O     1 
HETATM 4481 O O     . HOH J 5 .   ? 57.558 48.830 11.114  1.00 57.35 ? 76  HOH D O     1 
HETATM 4482 O O     . HOH J 5 .   ? 62.022 40.474 -7.091  1.00 56.77 ? 77  HOH D O     1 
HETATM 4483 O O     . HOH J 5 .   ? 62.672 44.564 -15.193 1.00 36.96 ? 78  HOH D O     1 
HETATM 4484 O O     . HOH J 5 .   ? 61.944 43.820 -17.883 1.00 34.09 ? 80  HOH D O     1 
HETATM 4485 O O     . HOH J 5 .   ? 59.286 43.154 -19.502 1.00 41.47 ? 81  HOH D O     1 
HETATM 4486 O O     . HOH J 5 .   ? 48.931 58.301 -26.658 1.00 41.63 ? 84  HOH D O     1 
HETATM 4487 O O     . HOH J 5 .   ? 53.632 59.069 -18.232 1.00 43.09 ? 85  HOH D O     1 
HETATM 4488 O O     . HOH K 5 .   ? 68.344 38.360 13.313  1.00 48.36 ? 74  HOH E O     1 
HETATM 4489 O O     . HOH K 5 .   ? 61.357 46.708 -17.661 1.00 39.14 ? 79  HOH E O     1 
HETATM 4490 O O     . HOH L 5 .   ? 36.573 69.500 -30.674 1.00 50.91 ? 89  HOH F O     1 
HETATM 4491 O O     . HOH L 5 .   ? 32.585 69.644 -32.257 1.00 17.36 ? 90  HOH F O     1 
HETATM 4492 O O     . HOH L 5 .   ? 29.198 69.721 -25.162 1.00 28.29 ? 91  HOH F O     1 
HETATM 4493 O O     . HOH M 5 .   ? 33.871 55.464 -24.338 1.00 37.69 ? 211 HOH A O     1 
HETATM 4494 O O     . HOH M 5 .   ? 33.045 54.331 -27.573 1.00 47.17 ? 212 HOH A O     1 
HETATM 4495 O O     . HOH M 5 .   ? 30.369 51.987 -28.612 1.00 24.01 ? 213 HOH A O     1 
HETATM 4496 O O     . HOH M 5 .   ? 27.996 69.195 -22.644 1.00 41.77 ? 214 HOH A O     1 
HETATM 4497 O O     . HOH M 5 .   ? 24.894 69.316 -17.796 1.00 28.07 ? 215 HOH A O     1 
HETATM 4498 O O     . HOH M 5 .   ? 24.321 53.968 -3.524  1.00 27.12 ? 216 HOH A O     1 
HETATM 4499 O O     . HOH M 5 .   ? 20.843 53.522 -6.809  1.00 14.55 ? 217 HOH A O     1 
HETATM 4500 O O     . HOH M 5 .   ? 26.331 51.943 -7.751  1.00 46.75 ? 218 HOH A O     1 
HETATM 4501 O O     . HOH M 5 .   ? 19.937 65.615 -11.632 1.00 30.77 ? 219 HOH A O     1 
HETATM 4502 O O     . HOH M 5 .   ? 8.401  74.768 -0.845  1.00 34.37 ? 220 HOH A O     1 
HETATM 4503 O O     . HOH M 5 .   ? 38.816 56.068 -10.213 1.00 21.52 ? 221 HOH A O     1 
HETATM 4504 O O     . HOH M 5 .   ? 20.621 52.770 -19.514 1.00 33.26 ? 222 HOH A O     1 
HETATM 4505 O O     . HOH M 5 .   ? 23.880 68.025 -13.859 1.00 47.61 ? 223 HOH A O     1 
HETATM 4506 O O     . HOH N 5 .   ? 59.648 58.208 -13.470 1.00 35.91 ? 211 HOH B O     1 
HETATM 4507 O O     . HOH N 5 .   ? 51.347 49.083 -2.495  1.00 28.60 ? 212 HOH B O     1 
HETATM 4508 O O     . HOH N 5 .   ? 45.260 47.697 -2.962  1.00 34.63 ? 213 HOH B O     1 
HETATM 4509 O O     . HOH N 5 .   ? 64.192 63.669 2.293   1.00 30.68 ? 214 HOH B O     1 
HETATM 4510 O O     . HOH N 5 .   ? 40.990 56.116 3.946   1.00 40.25 ? 215 HOH B O     1 
HETATM 4511 O O     . HOH N 5 .   ? 37.874 59.459 3.450   1.00 23.18 ? 216 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   -5  -5  DG  G   C . n 
A 1 2   DC  2   -4  -4  DC  C   C . n 
A 1 3   DG  3   -3  -3  DG  G   C . n 
A 1 4   DA  4   -2  -2  DA  A   C . n 
A 1 5   DA  5   -1  -1  DA  A   C . n 
A 1 6   DA  6   1   1   DA  A   C . n 
A 1 7   DA  7   2   2   DA  A   C . n 
A 1 8   DA  8   3   3   DA  A   C . n 
A 1 9   DT  9   4   4   DT  T   C . n 
A 1 10  DG  10  5   5   DG  G   C . n 
A 1 11  DT  11  6   6   DT  T   C . n 
A 1 12  DG  12  7   7   DG  G   C . n 
A 1 13  DA  13  8   8   DA  A   C . n 
A 1 14  DT  14  9   9   DT  T   C . n 
B 2 1   DC  1   10  10  DC  C   D . n 
B 2 2   DT  2   11  11  DT  T   D . n 
B 2 3   DA  3   12  12  DA  A   D . n 
B 2 4   DG  4   13  13  DG  G   D . n 
B 2 5   DA  5   14  14  DA  A   D . n 
B 2 6   DT  6   15  15  DT  T   D . n 
B 2 7   DC  7   16  16  DC  C   D . n 
B 2 8   DA  8   17  17  DA  A   D . n 
B 2 9   DC  9   18  18  DC  C   D . n 
B 2 10  DA  10  19  19  DA  A   D . n 
B 2 11  DT  11  20  20  DT  T   D . n 
B 2 12  DT  12  21  21  DT  T   D . n 
B 2 13  DT  13  22  22  DT  T   D . n 
B 2 14  DT  14  23  23  DT  T   D . n 
B 2 15  DT  15  24  24  DT  T   D . n 
B 2 16  DC  16  25  25  DC  C   D . n 
B 2 17  DG  17  26  26  DG  G   D . n 
C 1 1   DG  1   27  27  DG  G   E . n 
C 1 2   DC  2   26  26  DC  C   E . n 
C 1 3   DG  3   25  25  DG  G   E . n 
C 1 4   DA  4   24  24  DA  A   E . n 
C 1 5   DA  5   23  23  DA  A   E . n 
C 1 6   DA  6   22  22  DA  A   E . n 
C 1 7   DA  7   21  21  DA  A   E . n 
C 1 8   DA  8   20  20  DA  A   E . n 
C 1 9   DT  9   19  19  DT  T   E . n 
C 1 10  DG  10  18  18  DG  G   E . n 
C 1 11  DT  11  17  17  DT  T   E . n 
C 1 12  DG  12  16  16  DG  G   E . n 
C 1 13  DA  13  15  15  DA  A   E . n 
C 1 14  DT  14  14  14  DT  T   E . n 
D 2 1   DC  1   13  13  DC  C   F . n 
D 2 2   DT  2   12  12  DT  T   F . n 
D 2 3   DA  3   11  11  DA  A   F . n 
D 2 4   DG  4   10  10  DG  G   F . n 
D 2 5   DA  5   9   9   DA  A   F . n 
D 2 6   DT  6   8   8   DT  T   F . n 
D 2 7   DC  7   7   7   DC  C   F . n 
D 2 8   DA  8   6   6   DA  A   F . n 
D 2 9   DC  9   5   5   DC  C   F . n 
D 2 10  DA  10  4   4   DA  A   F . n 
D 2 11  DT  11  3   3   DT  T   F . n 
D 2 12  DT  12  2   2   DT  T   F . n 
D 2 13  DT  13  1   1   DT  T   F . n 
D 2 14  DT  14  -1  -1  DT  T   F . n 
D 2 15  DT  15  -2  -2  DT  T   F . n 
D 2 16  DC  16  -3  -3  DC  C   F . n 
D 2 17  DG  17  -4  -4  DG  G   F . n 
E 3 1   VAL 1   1   ?   ?   ?   A . n 
E 3 2   LEU 2   2   ?   ?   ?   A . n 
E 3 3   GLY 3   3   ?   ?   ?   A . n 
E 3 4   LYS 4   4   ?   ?   ?   A . n 
E 3 5   PRO 5   5   ?   ?   ?   A . n 
E 3 6   GLN 6   6   ?   ?   ?   A . n 
E 3 7   THR 7   7   ?   ?   ?   A . n 
E 3 8   ASP 8   8   ?   ?   ?   A . n 
E 3 9   PRO 9   9   9   PRO PRO A . n 
E 3 10  THR 10  10  10  THR THR A . n 
E 3 11  LEU 11  11  11  LEU LEU A . n 
E 3 12  GLU 12  12  12  GLU GLU A . n 
E 3 13  TRP 13  13  13  TRP TRP A . n 
E 3 14  PHE 14  14  14  PHE PHE A . n 
E 3 15  LEU 15  15  15  LEU LEU A . n 
E 3 16  SER 16  16  16  SER SER A . n 
E 3 17  HIS 17  17  17  HIS HIS A . n 
E 3 18  CYS 18  18  18  CYS CYS A . n 
E 3 19  HIS 19  19  19  HIS HIS A . n 
E 3 20  ILE 20  20  20  ILE ILE A . n 
E 3 21  HIS 21  21  21  HIS HIS A . n 
E 3 22  LYS 22  22  22  LYS LYS A . n 
E 3 23  TYR 23  23  23  TYR TYR A . n 
E 3 24  PRO 24  24  24  PRO PRO A . n 
E 3 25  SER 25  25  25  SER SER A . n 
E 3 26  LYS 26  26  26  LYS LYS A . n 
E 3 27  SER 27  27  27  SER SER A . n 
E 3 28  THR 28  28  28  THR THR A . n 
E 3 29  LEU 29  29  29  LEU LEU A . n 
E 3 30  ILE 30  30  30  ILE ILE A . n 
E 3 31  HIS 31  31  31  HIS HIS A . n 
E 3 32  GLN 32  32  32  GLN GLN A . n 
E 3 33  GLY 33  33  33  GLY GLY A . n 
E 3 34  GLU 34  34  34  GLU GLU A . n 
E 3 35  LYS 35  35  35  LYS LYS A . n 
E 3 36  ALA 36  36  36  ALA ALA A . n 
E 3 37  GLU 37  37  37  GLU GLU A . n 
E 3 38  THR 38  38  38  THR THR A . n 
E 3 39  LEU 39  39  39  LEU LEU A . n 
E 3 40  TYR 40  40  40  TYR TYR A . n 
E 3 41  TYR 41  41  41  TYR TYR A . n 
E 3 42  ILE 42  42  42  ILE ILE A . n 
E 3 43  VAL 43  43  43  VAL VAL A . n 
E 3 44  LYS 44  44  44  LYS LYS A . n 
E 3 45  GLY 45  45  45  GLY GLY A . n 
E 3 46  SER 46  46  46  SER SER A . n 
E 3 47  VAL 47  47  47  VAL VAL A . n 
E 3 48  ALA 48  48  48  ALA ALA A . n 
E 3 49  VAL 49  49  49  VAL VAL A . n 
E 3 50  LEU 50  50  50  LEU LEU A . n 
E 3 51  ILE 51  51  51  ILE ILE A . n 
E 3 52  LYS 52  52  52  LYS LYS A . n 
E 3 53  ASP 53  53  53  ASP ASP A . n 
E 3 54  GLU 54  54  54  GLU GLU A . n 
E 3 55  GLU 55  55  55  GLU GLU A . n 
E 3 56  GLY 56  56  56  GLY GLY A . n 
E 3 57  LYS 57  57  57  LYS LYS A . n 
E 3 58  GLU 58  58  58  GLU GLU A . n 
E 3 59  MET 59  59  59  MET MET A . n 
E 3 60  ILE 60  60  60  ILE ILE A . n 
E 3 61  LEU 61  61  61  LEU LEU A . n 
E 3 62  SER 62  62  62  SER SER A . n 
E 3 63  TYR 63  63  63  TYR TYR A . n 
E 3 64  LEU 64  64  64  LEU LEU A . n 
E 3 65  ASN 65  65  65  ASN ASN A . n 
E 3 66  GLN 66  66  66  GLN GLN A . n 
E 3 67  GLY 67  67  67  GLY GLY A . n 
E 3 68  ASP 68  68  68  ASP ASP A . n 
E 3 69  PHE 69  69  69  PHE PHE A . n 
E 3 70  ILE 70  70  70  ILE ILE A . n 
E 3 71  GLY 71  71  71  GLY GLY A . n 
E 3 72  GLU 72  72  72  GLU GLU A . n 
E 3 73  LEU 73  73  73  LEU LEU A . n 
E 3 74  GLY 74  74  74  GLY GLY A . n 
E 3 75  LEU 75  75  75  LEU LEU A . n 
E 3 76  PHE 76  76  76  PHE PHE A . n 
E 3 77  GLU 77  77  77  GLU GLU A . n 
E 3 78  GLU 78  78  78  GLU GLU A . n 
E 3 79  GLY 79  79  79  GLY GLY A . n 
E 3 80  GLN 80  80  80  GLN GLN A . n 
E 3 81  GLU 81  81  81  GLU GLU A . n 
E 3 82  ARG 82  82  82  ARG ARG A . n 
E 3 83  SER 83  83  83  SER SER A . n 
E 3 84  ALA 84  84  84  ALA ALA A . n 
E 3 85  TRP 85  85  85  TRP TRP A . n 
E 3 86  VAL 86  86  86  VAL VAL A . n 
E 3 87  ARG 87  87  87  ARG ARG A . n 
E 3 88  ALA 88  88  88  ALA ALA A . n 
E 3 89  LYS 89  89  89  LYS LYS A . n 
E 3 90  THR 90  90  90  THR THR A . n 
E 3 91  ALA 91  91  91  ALA ALA A . n 
E 3 92  CYS 92  92  92  CYS CYS A . n 
E 3 93  GLU 93  93  93  GLU GLU A . n 
E 3 94  VAL 94  94  94  VAL VAL A . n 
E 3 95  ALA 95  95  95  ALA ALA A . n 
E 3 96  GLU 96  96  96  GLU GLU A . n 
E 3 97  ILE 97  97  97  ILE ILE A . n 
E 3 98  SER 98  98  98  SER SER A . n 
E 3 99  TYR 99  99  99  TYR TYR A . n 
E 3 100 LYS 100 100 100 LYS LYS A . n 
E 3 101 LYS 101 101 101 LYS LYS A . n 
E 3 102 PHE 102 102 102 PHE PHE A . n 
E 3 103 ARG 103 103 103 ARG ARG A . n 
E 3 104 GLN 104 104 104 GLN GLN A . n 
E 3 105 LEU 105 105 105 LEU LEU A . n 
E 3 106 ILE 106 106 106 ILE ILE A . n 
E 3 107 GLN 107 107 107 GLN GLN A . n 
E 3 108 VAL 108 108 108 VAL VAL A . n 
E 3 109 ASN 109 109 109 ASN ASN A . n 
E 3 110 PRO 110 110 110 PRO PRO A . n 
E 3 111 ASP 111 111 111 ASP ASP A . n 
E 3 112 ILE 112 112 112 ILE ILE A . n 
E 3 113 LEU 113 113 113 LEU LEU A . n 
E 3 114 MET 114 114 114 MET MET A . n 
E 3 115 ARG 115 115 115 ARG ARG A . n 
E 3 116 LEU 116 116 116 LEU LEU A . n 
E 3 117 SER 117 117 117 SER SER A . n 
E 3 118 ALA 118 118 118 ALA ALA A . n 
E 3 119 GLN 119 119 119 GLN GLN A . n 
E 3 120 MET 120 120 120 MET MET A . n 
E 3 121 ALA 121 121 121 ALA ALA A . n 
E 3 122 ARG 122 122 122 ARG ARG A . n 
E 3 123 ARG 123 123 123 ARG ARG A . n 
E 3 124 LEU 124 124 124 LEU LEU A . n 
E 3 125 GLN 125 125 125 GLN GLN A . n 
E 3 126 VAL 126 126 126 VAL VAL A . n 
E 3 127 THR 127 127 127 THR THR A . n 
E 3 128 SER 128 128 128 SER SER A . n 
E 3 129 GLU 129 129 129 GLU GLU A . n 
E 3 130 LYS 130 130 130 LYS LYS A . n 
E 3 131 VAL 131 131 131 VAL VAL A . n 
E 3 132 GLY 132 132 132 GLY GLY A . n 
E 3 133 ASN 133 133 133 ASN ASN A . n 
E 3 134 LEU 134 134 134 LEU LEU A . n 
E 3 135 ALA 135 135 135 ALA ALA A . n 
E 3 136 PHE 136 136 136 PHE PHE A . n 
E 3 137 LEU 137 137 137 LEU LEU A . n 
E 3 138 ASP 138 138 138 ASP ASP A . n 
E 3 139 VAL 139 139 139 VAL VAL A . n 
E 3 140 THR 140 140 140 THR THR A . n 
E 3 141 GLY 141 141 141 GLY GLY A . n 
E 3 142 ARG 142 142 142 ARG ARG A . n 
E 3 143 ILE 143 143 143 ILE ILE A . n 
E 3 144 ALA 144 144 144 ALA ALA A . n 
E 3 145 GLN 145 145 145 GLN GLN A . n 
E 3 146 THR 146 146 146 THR THR A . n 
E 3 147 LEU 147 147 147 LEU LEU A . n 
E 3 148 LEU 148 148 148 LEU LEU A . n 
E 3 149 ASN 149 149 149 ASN ASN A . n 
E 3 150 LEU 150 150 150 LEU LEU A . n 
E 3 151 ALA 151 151 151 ALA ALA A . n 
E 3 152 LYS 152 152 152 LYS LYS A . n 
E 3 153 GLN 153 153 153 GLN GLN A . n 
E 3 154 PRO 154 154 154 PRO PRO A . n 
E 3 155 ASP 155 155 155 ASP ASP A . n 
E 3 156 ALA 156 156 156 ALA ALA A . n 
E 3 157 MET 157 157 157 MET MET A . n 
E 3 158 THR 158 158 158 THR THR A . n 
E 3 159 HIS 159 159 159 HIS HIS A . n 
E 3 160 PRO 160 160 160 PRO PRO A . n 
E 3 161 ASP 161 161 161 ASP ASP A . n 
E 3 162 GLY 162 162 162 GLY GLY A . n 
E 3 163 MET 163 163 163 MET MET A . n 
E 3 164 GLN 164 164 164 GLN GLN A . n 
E 3 165 ILE 165 165 165 ILE ILE A . n 
E 3 166 LYS 166 166 166 LYS LYS A . n 
E 3 167 ILE 167 167 167 ILE ILE A . n 
E 3 168 THR 168 168 168 THR THR A . n 
E 3 169 ARG 169 169 169 ARG ARG A . n 
E 3 170 GLN 170 170 170 GLN GLN A . n 
E 3 171 GLU 171 171 171 GLU GLU A . n 
E 3 172 ILE 172 172 172 ILE ILE A . n 
E 3 173 GLY 173 173 173 GLY GLY A . n 
E 3 174 GLN 174 174 174 GLN GLN A . n 
E 3 175 ILE 175 175 175 ILE ILE A . n 
E 3 176 VAL 176 176 176 VAL VAL A . n 
E 3 177 GLY 177 177 177 GLY GLY A . n 
E 3 178 CYS 178 178 178 CYS CYS A . n 
E 3 179 SER 179 179 179 SER SER A . n 
E 3 180 ARG 180 180 180 ARG ARG A . n 
E 3 181 PHE 181 181 181 PHE PHE A . n 
E 3 182 THR 182 182 182 THR THR A . n 
E 3 183 VAL 183 183 183 VAL VAL A . n 
E 3 184 GLY 184 184 184 GLY GLY A . n 
E 3 185 ARG 185 185 185 ARG ARG A . n 
E 3 186 ILE 186 186 186 ILE ILE A . n 
E 3 187 LEU 187 187 187 LEU LEU A . n 
E 3 188 LYS 188 188 188 LYS LYS A . n 
E 3 189 MET 189 189 189 MET MET A . n 
E 3 190 LEU 190 190 190 LEU LEU A . n 
E 3 191 GLU 191 191 191 GLU GLU A . n 
E 3 192 ASP 192 192 192 ASP ASP A . n 
E 3 193 GLN 193 193 193 GLN GLN A . n 
E 3 194 ASN 194 194 194 ASN ASN A . n 
E 3 195 LEU 195 195 195 LEU LEU A . n 
E 3 196 ILE 196 196 196 ILE ILE A . n 
E 3 197 SER 197 197 197 SER SER A . n 
E 3 198 ALA 198 198 198 ALA ALA A . n 
E 3 199 HIS 199 199 199 HIS HIS A . n 
E 3 200 GLY 200 200 200 GLY GLY A . n 
E 3 201 LYS 201 201 201 LYS LYS A . n 
E 3 202 THR 202 202 202 THR THR A . n 
E 3 203 ILE 203 203 203 ILE ILE A . n 
E 3 204 VAL 204 204 204 VAL VAL A . n 
E 3 205 VAL 205 205 205 VAL VAL A . n 
E 3 206 TYR 206 206 206 TYR TYR A . n 
E 3 207 GLY 207 207 ?   ?   ?   A . n 
E 3 208 THR 208 208 ?   ?   ?   A . n 
E 3 209 ARG 209 209 ?   ?   ?   A . n 
F 3 1   VAL 1   1   ?   ?   ?   B . n 
F 3 2   LEU 2   2   ?   ?   ?   B . n 
F 3 3   GLY 3   3   ?   ?   ?   B . n 
F 3 4   LYS 4   4   ?   ?   ?   B . n 
F 3 5   PRO 5   5   ?   ?   ?   B . n 
F 3 6   GLN 6   6   ?   ?   ?   B . n 
F 3 7   THR 7   7   ?   ?   ?   B . n 
F 3 8   ASP 8   8   ?   ?   ?   B . n 
F 3 9   PRO 9   9   9   PRO PRO B . n 
F 3 10  THR 10  10  10  THR THR B . n 
F 3 11  LEU 11  11  11  LEU LEU B . n 
F 3 12  GLU 12  12  12  GLU GLU B . n 
F 3 13  TRP 13  13  13  TRP TRP B . n 
F 3 14  PHE 14  14  14  PHE PHE B . n 
F 3 15  LEU 15  15  15  LEU LEU B . n 
F 3 16  SER 16  16  16  SER SER B . n 
F 3 17  HIS 17  17  17  HIS HIS B . n 
F 3 18  CYS 18  18  18  CYS CYS B . n 
F 3 19  HIS 19  19  19  HIS HIS B . n 
F 3 20  ILE 20  20  20  ILE ILE B . n 
F 3 21  HIS 21  21  21  HIS HIS B . n 
F 3 22  LYS 22  22  22  LYS LYS B . n 
F 3 23  TYR 23  23  23  TYR TYR B . n 
F 3 24  PRO 24  24  24  PRO PRO B . n 
F 3 25  SER 25  25  25  SER SER B . n 
F 3 26  LYS 26  26  26  LYS LYS B . n 
F 3 27  SER 27  27  27  SER SER B . n 
F 3 28  THR 28  28  28  THR THR B . n 
F 3 29  LEU 29  29  29  LEU LEU B . n 
F 3 30  ILE 30  30  30  ILE ILE B . n 
F 3 31  HIS 31  31  31  HIS HIS B . n 
F 3 32  GLN 32  32  32  GLN GLN B . n 
F 3 33  GLY 33  33  33  GLY GLY B . n 
F 3 34  GLU 34  34  34  GLU GLU B . n 
F 3 35  LYS 35  35  35  LYS LYS B . n 
F 3 36  ALA 36  36  36  ALA ALA B . n 
F 3 37  GLU 37  37  37  GLU GLU B . n 
F 3 38  THR 38  38  38  THR THR B . n 
F 3 39  LEU 39  39  39  LEU LEU B . n 
F 3 40  TYR 40  40  40  TYR TYR B . n 
F 3 41  TYR 41  41  41  TYR TYR B . n 
F 3 42  ILE 42  42  42  ILE ILE B . n 
F 3 43  VAL 43  43  43  VAL VAL B . n 
F 3 44  LYS 44  44  44  LYS LYS B . n 
F 3 45  GLY 45  45  45  GLY GLY B . n 
F 3 46  SER 46  46  46  SER SER B . n 
F 3 47  VAL 47  47  47  VAL VAL B . n 
F 3 48  ALA 48  48  48  ALA ALA B . n 
F 3 49  VAL 49  49  49  VAL VAL B . n 
F 3 50  LEU 50  50  50  LEU LEU B . n 
F 3 51  ILE 51  51  51  ILE ILE B . n 
F 3 52  LYS 52  52  52  LYS LYS B . n 
F 3 53  ASP 53  53  53  ASP ASP B . n 
F 3 54  GLU 54  54  54  GLU GLU B . n 
F 3 55  GLU 55  55  55  GLU GLU B . n 
F 3 56  GLY 56  56  56  GLY GLY B . n 
F 3 57  LYS 57  57  57  LYS LYS B . n 
F 3 58  GLU 58  58  58  GLU GLU B . n 
F 3 59  MET 59  59  59  MET MET B . n 
F 3 60  ILE 60  60  60  ILE ILE B . n 
F 3 61  LEU 61  61  61  LEU LEU B . n 
F 3 62  SER 62  62  62  SER SER B . n 
F 3 63  TYR 63  63  63  TYR TYR B . n 
F 3 64  LEU 64  64  64  LEU LEU B . n 
F 3 65  ASN 65  65  65  ASN ASN B . n 
F 3 66  GLN 66  66  66  GLN GLN B . n 
F 3 67  GLY 67  67  67  GLY GLY B . n 
F 3 68  ASP 68  68  68  ASP ASP B . n 
F 3 69  PHE 69  69  69  PHE PHE B . n 
F 3 70  ILE 70  70  70  ILE ILE B . n 
F 3 71  GLY 71  71  71  GLY GLY B . n 
F 3 72  GLU 72  72  72  GLU GLU B . n 
F 3 73  LEU 73  73  73  LEU LEU B . n 
F 3 74  GLY 74  74  74  GLY GLY B . n 
F 3 75  LEU 75  75  75  LEU LEU B . n 
F 3 76  PHE 76  76  76  PHE PHE B . n 
F 3 77  GLU 77  77  77  GLU GLU B . n 
F 3 78  GLU 78  78  78  GLU GLU B . n 
F 3 79  GLY 79  79  79  GLY GLY B . n 
F 3 80  GLN 80  80  80  GLN GLN B . n 
F 3 81  GLU 81  81  81  GLU GLU B . n 
F 3 82  ARG 82  82  82  ARG ARG B . n 
F 3 83  SER 83  83  83  SER SER B . n 
F 3 84  ALA 84  84  84  ALA ALA B . n 
F 3 85  TRP 85  85  85  TRP TRP B . n 
F 3 86  VAL 86  86  86  VAL VAL B . n 
F 3 87  ARG 87  87  87  ARG ARG B . n 
F 3 88  ALA 88  88  88  ALA ALA B . n 
F 3 89  LYS 89  89  89  LYS LYS B . n 
F 3 90  THR 90  90  90  THR THR B . n 
F 3 91  ALA 91  91  91  ALA ALA B . n 
F 3 92  CYS 92  92  92  CYS CYS B . n 
F 3 93  GLU 93  93  93  GLU GLU B . n 
F 3 94  VAL 94  94  94  VAL VAL B . n 
F 3 95  ALA 95  95  95  ALA ALA B . n 
F 3 96  GLU 96  96  96  GLU GLU B . n 
F 3 97  ILE 97  97  97  ILE ILE B . n 
F 3 98  SER 98  98  98  SER SER B . n 
F 3 99  TYR 99  99  99  TYR TYR B . n 
F 3 100 LYS 100 100 100 LYS LYS B . n 
F 3 101 LYS 101 101 101 LYS LYS B . n 
F 3 102 PHE 102 102 102 PHE PHE B . n 
F 3 103 ARG 103 103 103 ARG ARG B . n 
F 3 104 GLN 104 104 104 GLN GLN B . n 
F 3 105 LEU 105 105 105 LEU LEU B . n 
F 3 106 ILE 106 106 106 ILE ILE B . n 
F 3 107 GLN 107 107 107 GLN GLN B . n 
F 3 108 VAL 108 108 108 VAL VAL B . n 
F 3 109 ASN 109 109 109 ASN ASN B . n 
F 3 110 PRO 110 110 110 PRO PRO B . n 
F 3 111 ASP 111 111 111 ASP ASP B . n 
F 3 112 ILE 112 112 112 ILE ILE B . n 
F 3 113 LEU 113 113 113 LEU LEU B . n 
F 3 114 MET 114 114 114 MET MET B . n 
F 3 115 ARG 115 115 115 ARG ARG B . n 
F 3 116 LEU 116 116 116 LEU LEU B . n 
F 3 117 SER 117 117 117 SER SER B . n 
F 3 118 ALA 118 118 118 ALA ALA B . n 
F 3 119 GLN 119 119 119 GLN GLN B . n 
F 3 120 MET 120 120 120 MET MET B . n 
F 3 121 ALA 121 121 121 ALA ALA B . n 
F 3 122 ARG 122 122 122 ARG ARG B . n 
F 3 123 ARG 123 123 123 ARG ARG B . n 
F 3 124 LEU 124 124 124 LEU LEU B . n 
F 3 125 GLN 125 125 125 GLN GLN B . n 
F 3 126 VAL 126 126 126 VAL VAL B . n 
F 3 127 THR 127 127 127 THR THR B . n 
F 3 128 SER 128 128 128 SER SER B . n 
F 3 129 GLU 129 129 129 GLU GLU B . n 
F 3 130 LYS 130 130 130 LYS LYS B . n 
F 3 131 VAL 131 131 131 VAL VAL B . n 
F 3 132 GLY 132 132 132 GLY GLY B . n 
F 3 133 ASN 133 133 133 ASN ASN B . n 
F 3 134 LEU 134 134 134 LEU LEU B . n 
F 3 135 ALA 135 135 135 ALA ALA B . n 
F 3 136 PHE 136 136 136 PHE PHE B . n 
F 3 137 LEU 137 137 137 LEU LEU B . n 
F 3 138 ASP 138 138 138 ASP ASP B . n 
F 3 139 VAL 139 139 139 VAL VAL B . n 
F 3 140 THR 140 140 140 THR THR B . n 
F 3 141 GLY 141 141 141 GLY GLY B . n 
F 3 142 ARG 142 142 142 ARG ARG B . n 
F 3 143 ILE 143 143 143 ILE ILE B . n 
F 3 144 ALA 144 144 144 ALA ALA B . n 
F 3 145 GLN 145 145 145 GLN GLN B . n 
F 3 146 THR 146 146 146 THR THR B . n 
F 3 147 LEU 147 147 147 LEU LEU B . n 
F 3 148 LEU 148 148 148 LEU LEU B . n 
F 3 149 ASN 149 149 149 ASN ASN B . n 
F 3 150 LEU 150 150 150 LEU LEU B . n 
F 3 151 ALA 151 151 151 ALA ALA B . n 
F 3 152 LYS 152 152 152 LYS LYS B . n 
F 3 153 GLN 153 153 153 GLN GLN B . n 
F 3 154 PRO 154 154 154 PRO PRO B . n 
F 3 155 ASP 155 155 155 ASP ASP B . n 
F 3 156 ALA 156 156 156 ALA ALA B . n 
F 3 157 MET 157 157 157 MET MET B . n 
F 3 158 THR 158 158 158 THR THR B . n 
F 3 159 HIS 159 159 159 HIS HIS B . n 
F 3 160 PRO 160 160 160 PRO PRO B . n 
F 3 161 ASP 161 161 161 ASP ASP B . n 
F 3 162 GLY 162 162 162 GLY GLY B . n 
F 3 163 MET 163 163 163 MET MET B . n 
F 3 164 GLN 164 164 164 GLN GLN B . n 
F 3 165 ILE 165 165 165 ILE ILE B . n 
F 3 166 LYS 166 166 166 LYS LYS B . n 
F 3 167 ILE 167 167 167 ILE ILE B . n 
F 3 168 THR 168 168 168 THR THR B . n 
F 3 169 ARG 169 169 169 ARG ARG B . n 
F 3 170 GLN 170 170 170 GLN GLN B . n 
F 3 171 GLU 171 171 171 GLU GLU B . n 
F 3 172 ILE 172 172 172 ILE ILE B . n 
F 3 173 GLY 173 173 173 GLY GLY B . n 
F 3 174 GLN 174 174 174 GLN GLN B . n 
F 3 175 ILE 175 175 175 ILE ILE B . n 
F 3 176 VAL 176 176 176 VAL VAL B . n 
F 3 177 GLY 177 177 177 GLY GLY B . n 
F 3 178 CYS 178 178 178 CYS CYS B . n 
F 3 179 SER 179 179 179 SER SER B . n 
F 3 180 ARG 180 180 180 ARG ARG B . n 
F 3 181 PHE 181 181 181 PHE PHE B . n 
F 3 182 THR 182 182 182 THR THR B . n 
F 3 183 VAL 183 183 183 VAL VAL B . n 
F 3 184 GLY 184 184 184 GLY GLY B . n 
F 3 185 ARG 185 185 185 ARG ARG B . n 
F 3 186 ILE 186 186 186 ILE ILE B . n 
F 3 187 LEU 187 187 187 LEU LEU B . n 
F 3 188 LYS 188 188 188 LYS LYS B . n 
F 3 189 MET 189 189 189 MET MET B . n 
F 3 190 LEU 190 190 190 LEU LEU B . n 
F 3 191 GLU 191 191 191 GLU GLU B . n 
F 3 192 ASP 192 192 192 ASP ASP B . n 
F 3 193 GLN 193 193 193 GLN GLN B . n 
F 3 194 ASN 194 194 194 ASN ASN B . n 
F 3 195 LEU 195 195 195 LEU LEU B . n 
F 3 196 ILE 196 196 196 ILE ILE B . n 
F 3 197 SER 197 197 197 SER SER B . n 
F 3 198 ALA 198 198 198 ALA ALA B . n 
F 3 199 HIS 199 199 199 HIS HIS B . n 
F 3 200 GLY 200 200 200 GLY GLY B . n 
F 3 201 LYS 201 201 201 LYS LYS B . n 
F 3 202 THR 202 202 202 THR THR B . n 
F 3 203 ILE 203 203 203 ILE ILE B . n 
F 3 204 VAL 204 204 204 VAL VAL B . n 
F 3 205 VAL 205 205 205 VAL VAL B . n 
F 3 206 TYR 206 206 206 TYR TYR B . n 
F 3 207 GLY 207 207 207 GLY GLY B . n 
F 3 208 THR 208 208 208 THR THR B . n 
F 3 209 ARG 209 209 209 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CMP 1  210 2   CMP CMP A . 
H 4 CMP 1  210 1   CMP CMP B . 
I 5 HOH 1  104 104 HOH HOH C . 
J 5 HOH 1  72  72  HOH HOH D . 
J 5 HOH 2  73  73  HOH HOH D . 
J 5 HOH 3  75  75  HOH HOH D . 
J 5 HOH 4  76  76  HOH HOH D . 
J 5 HOH 5  77  77  HOH HOH D . 
J 5 HOH 6  78  78  HOH HOH D . 
J 5 HOH 7  80  80  HOH HOH D . 
J 5 HOH 8  81  81  HOH HOH D . 
J 5 HOH 9  84  84  HOH HOH D . 
J 5 HOH 10 85  85  HOH HOH D . 
K 5 HOH 1  74  74  HOH HOH E . 
K 5 HOH 2  79  79  HOH HOH E . 
L 5 HOH 1  89  89  HOH HOH F . 
L 5 HOH 2  90  90  HOH HOH F . 
L 5 HOH 3  91  91  HOH HOH F . 
M 5 HOH 1  211 86  HOH HOH A . 
M 5 HOH 2  212 87  HOH HOH A . 
M 5 HOH 3  213 88  HOH HOH A . 
M 5 HOH 4  214 92  HOH HOH A . 
M 5 HOH 5  215 93  HOH HOH A . 
M 5 HOH 6  216 94  HOH HOH A . 
M 5 HOH 7  217 95  HOH HOH A . 
M 5 HOH 8  218 96  HOH HOH A . 
M 5 HOH 9  219 97  HOH HOH A . 
M 5 HOH 10 220 98  HOH HOH A . 
M 5 HOH 11 221 99  HOH HOH A . 
M 5 HOH 12 222 102 HOH HOH A . 
M 5 HOH 13 223 103 HOH HOH A . 
N 5 HOH 1  211 71  HOH HOH B . 
N 5 HOH 2  212 82  HOH HOH B . 
N 5 HOH 3  213 83  HOH HOH B . 
N 5 HOH 4  214 100 HOH HOH B . 
N 5 HOH 5  215 101 HOH HOH B . 
N 5 HOH 6  216 105 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-01-10 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
3 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PURDUE 'data collection' SOFTWARE                  ? 1 
X-PLOR refinement        .                         ? 2 
PURDUE 'data reduction'  'DATA PROCESSING PACKAGE' ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG B SER 83 ? ? O2P B CMP 210 ? ? 2.15 
2 1 O  B GLU 58 ? ? O   B HOH 213 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N1    C DA 8  ? ? C2    C DA 8  ? ? 1.409 1.339 0.070 0.009 N 
2 1 N1    D DC 18 ? ? C2    D DC 18 ? ? 1.476 1.397 0.079 0.010 N 
3 1 C2    D DT 22 ? ? N3    D DT 22 ? ? 1.436 1.373 0.063 0.008 N 
4 1 C4    D DT 22 ? ? O4    D DT 22 ? ? 1.290 1.228 0.062 0.009 N 
5 1 "C5'" E DT 19 ? ? "C4'" E DT 19 ? ? 1.559 1.512 0.047 0.007 N 
6 1 C4    E DT 17 ? ? O4    E DT 17 ? ? 1.293 1.228 0.065 0.009 N 
7 1 N1    F DC 7  ? ? C2    F DC 7  ? ? 1.462 1.397 0.065 0.010 N 
8 1 N1    F DC 5  ? ? C2    F DC 5  ? ? 1.474 1.397 0.077 0.010 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N3    C DC  -4  ? ? C4    C DC  -4  ? ? N4    C DC  -4  ? ? 113.03 118.00 -4.97  0.70 N 
2  1 C5    C DC  -4  ? ? C4    C DC  -4  ? ? N4    C DC  -4  ? ? 126.54 120.20 6.34   0.70 N 
3  1 N1    C DA  -2  ? ? C6    C DA  -2  ? ? N6    C DA  -2  ? ? 114.66 118.60 -3.94  0.60 N 
4  1 C5    C DA  -2  ? ? C6    C DA  -2  ? ? N6    C DA  -2  ? ? 128.61 123.70 4.91   0.80 N 
5  1 "O4'" C DA  2   ? ? "C1'" C DA  2   ? ? N9    C DA  2   ? ? 111.54 108.30 3.24   0.30 N 
6  1 "O4'" C DT  6   ? ? "C1'" C DT  6   ? ? N1    C DT  6   ? ? 110.48 108.30 2.18   0.30 N 
7  1 "O3'" D DA  12  ? ? P     D DG  13  ? ? OP2   D DG  13  ? ? 117.75 110.50 7.25   1.10 Y 
8  1 "C3'" D DG  13  ? ? "O3'" D DG  13  ? ? P     D DA  14  ? ? 131.47 119.70 11.77  1.20 Y 
9  1 P     D DA  14  ? ? "O5'" D DA  14  ? ? "C5'" D DA  14  ? ? 110.48 120.90 -10.42 1.60 N 
10 1 "O4'" D DC  16  ? ? "C4'" D DC  16  ? ? "C3'" D DC  16  ? ? 100.87 104.50 -3.63  0.40 N 
11 1 "C4'" D DC  16  ? ? "C3'" D DC  16  ? ? "C2'" D DC  16  ? ? 97.15  102.20 -5.05  0.70 N 
12 1 "O4'" D DC  16  ? ? "C1'" D DC  16  ? ? N1    D DC  16  ? ? 110.18 108.30 1.88   0.30 N 
13 1 N1    D DA  17  ? ? C6    D DA  17  ? ? N6    D DA  17  ? ? 114.45 118.60 -4.15  0.60 N 
14 1 C5    D DA  17  ? ? C6    D DA  17  ? ? N6    D DA  17  ? ? 129.19 123.70 5.49   0.80 N 
15 1 "O4'" D DC  18  ? ? "C1'" D DC  18  ? ? N1    D DC  18  ? ? 110.27 108.30 1.97   0.30 N 
16 1 "C1'" E DG  27  ? ? "O4'" E DG  27  ? ? "C4'" E DG  27  ? ? 100.03 110.10 -10.07 1.00 N 
17 1 "O4'" E DG  27  ? ? "C1'" E DG  27  ? ? N9    E DG  27  ? ? 110.96 108.30 2.66   0.30 N 
18 1 "O4'" E DA  20  ? ? "C1'" E DA  20  ? ? N9    E DA  20  ? ? 111.14 108.30 2.84   0.30 N 
19 1 "C5'" E DT  19  ? ? "C4'" E DT  19  ? ? "O4'" E DT  19  ? ? 117.35 109.80 7.55   1.10 N 
20 1 "O4'" F DT  12  ? ? "C1'" F DT  12  ? ? N1    F DT  12  ? ? 110.67 108.30 2.37   0.30 N 
21 1 N9    F DG  10  ? ? "C1'" F DG  10  ? ? "C2'" F DG  10  ? ? 123.76 114.30 9.46   1.40 N 
22 1 "O4'" F DT  8   ? ? "C1'" F DT  8   ? ? N1    F DT  8   ? ? 112.00 108.30 3.70   0.30 N 
23 1 "C3'" F DC  7   ? ? "C2'" F DC  7   ? ? "C1'" F DC  7   ? ? 95.61  102.40 -6.79  0.80 N 
24 1 N1    F DA  6   ? ? C6    F DA  6   ? ? N6    F DA  6   ? ? 114.52 118.60 -4.08  0.60 N 
25 1 "C3'" F DC  5   ? ? "C2'" F DC  5   ? ? "C1'" F DC  5   ? ? 95.63  102.40 -6.77  0.80 N 
26 1 "O4'" F DC  5   ? ? "C1'" F DC  5   ? ? N1    F DC  5   ? ? 111.01 108.30 2.71   0.30 N 
27 1 N1    F DT  3   ? ? "C1'" F DT  3   ? ? "C2'" F DT  3   ? ? 123.71 114.30 9.41   1.40 N 
28 1 "O4'" F DT  2   ? ? "C1'" F DT  2   ? ? N1    F DT  2   ? ? 102.91 108.00 -5.09  0.70 N 
29 1 "O5'" F DT  -2  ? ? P     F DT  -2  ? ? OP2   F DT  -2  ? ? 98.91  105.70 -6.79  0.90 N 
30 1 "O4'" F DT  -2  ? ? "C1'" F DT  -2  ? ? N1    F DT  -2  ? ? 103.33 108.00 -4.67  0.70 N 
31 1 N3    F DT  -2  ? ? C4    F DT  -2  ? ? O4    F DT  -2  ? ? 115.81 119.90 -4.09  0.60 N 
32 1 C5    F DT  -2  ? ? C4    F DT  -2  ? ? O4    F DT  -2  ? ? 129.72 124.90 4.82   0.70 N 
33 1 C6    F DT  -2  ? ? N1    F DT  -2  ? ? "C1'" F DT  -2  ? ? 110.27 120.40 -10.13 1.50 N 
34 1 C2    F DT  -2  ? ? N1    F DT  -2  ? ? "C1'" F DT  -2  ? ? 128.35 118.20 10.15  1.60 N 
35 1 "O4'" F DC  -3  ? ? "C1'" F DC  -3  ? ? N1    F DC  -3  ? ? 110.12 108.30 1.82   0.30 N 
36 1 N     A LEU 75  ? ? CA    A LEU 75  ? ? C     A LEU 75  ? ? 129.09 111.00 18.09  2.70 N 
37 1 CG1   A ILE 172 ? ? CB    A ILE 172 ? ? CG2   A ILE 172 ? ? 97.72  111.40 -13.68 2.20 N 
38 1 CA    B LEU 11  ? ? CB    B LEU 11  ? ? CG    B LEU 11  ? ? 131.76 115.30 16.46  2.30 N 
39 1 CA    B LEU 29  ? ? CB    B LEU 29  ? ? CG    B LEU 29  ? ? 129.92 115.30 14.62  2.30 N 
40 1 CA    B LEU 61  ? ? CB    B LEU 61  ? ? CG    B LEU 61  ? ? 130.28 115.30 14.98  2.30 N 
41 1 CB    B VAL 205 ? ? CA    B VAL 205 ? ? C     B VAL 205 ? ? 98.31  111.40 -13.09 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 26  ? ? 137.69  -2.52   
2  1 GLU A 34  ? ? -69.40  -155.94 
3  1 ALA A 36  ? ? -49.80  82.48   
4  1 GLU A 37  ? ? -98.39  -77.70  
5  1 ILE A 42  ? ? -64.33  88.14   
6  1 GLU A 54  ? ? -23.21  -57.26  
7  1 SER A 62  ? ? 177.04  171.43  
8  1 ASN A 65  ? ? -109.99 -164.89 
9  1 GLN A 66  ? ? -38.07  117.30  
10 1 LEU A 73  ? ? -54.50  -8.15   
11 1 LEU A 75  ? ? -17.28  -42.61  
12 1 GLU A 77  ? ? -142.87 -153.55 
13 1 ALA A 91  ? ? -46.77  85.88   
14 1 GLU A 93  ? ? -101.99 78.90   
15 1 ILE A 97  ? ? -107.63 -131.44 
16 1 LYS A 101 ? ? -83.34  46.40   
17 1 ASN A 109 ? ? -168.89 112.81  
18 1 THR A 158 ? ? -39.71  132.75  
19 1 PRO A 160 ? ? -29.75  -32.34  
20 1 LYS A 166 ? ? -53.30  109.16  
21 1 SER A 179 ? ? -38.03  139.16  
22 1 GLN A 193 ? ? -71.76  26.47   
23 1 ASN A 194 ? ? 50.64   6.14    
24 1 HIS A 199 ? ? 154.52  53.02   
25 1 VAL A 205 ? ? -65.57  94.76   
26 1 GLU B 12  ? ? 179.84  -24.57  
27 1 HIS B 17  ? ? -89.01  34.56   
28 1 GLU B 34  ? ? -20.25  132.46  
29 1 TYR B 41  ? ? -162.04 116.83  
30 1 SER B 62  ? ? 147.41  157.82  
31 1 GLN B 66  ? ? -33.92  144.02  
32 1 LEU B 75  ? ? -17.70  -37.01  
33 1 ASN B 109 ? ? -163.54 104.89  
34 1 PHE B 136 ? ? -114.10 -83.86  
35 1 LEU B 150 ? ? -79.86  22.64   
36 1 LYS B 152 ? ? -101.77 45.22   
37 1 GLN B 153 ? ? 172.53  139.97  
38 1 ASP B 155 ? ? 151.72  -0.54   
39 1 THR B 158 ? ? -66.59  84.53   
40 1 LYS B 188 ? ? -57.82  -71.35  
41 1 MET B 189 ? ? -66.82  5.47    
42 1 GLN B 193 ? ? -68.93  19.37   
43 1 HIS B 199 ? ? 142.57  -57.34  
44 1 VAL B 205 ? ? 91.46   -27.94  
45 1 TYR B 206 ? ? -123.26 -83.83  
46 1 THR B 208 ? ? 165.70  -178.42 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    159 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    160 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -103.21 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B ARG 209 ? CG  ? F ARG 209 CG  
2 1 Y 1 B ARG 209 ? CD  ? F ARG 209 CD  
3 1 Y 1 B ARG 209 ? NE  ? F ARG 209 NE  
4 1 Y 1 B ARG 209 ? CZ  ? F ARG 209 CZ  
5 1 Y 1 B ARG 209 ? NH1 ? F ARG 209 NH1 
6 1 Y 1 B ARG 209 ? NH2 ? F ARG 209 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? E VAL 1   
2  1 Y 1 A LEU 2   ? E LEU 2   
3  1 Y 1 A GLY 3   ? E GLY 3   
4  1 Y 1 A LYS 4   ? E LYS 4   
5  1 Y 1 A PRO 5   ? E PRO 5   
6  1 Y 1 A GLN 6   ? E GLN 6   
7  1 Y 1 A THR 7   ? E THR 7   
8  1 Y 1 A ASP 8   ? E ASP 8   
9  1 Y 1 A GLY 207 ? E GLY 207 
10 1 Y 1 A THR 208 ? E THR 208 
11 1 Y 1 A ARG 209 ? E ARG 209 
12 1 Y 1 B VAL 1   ? F VAL 1   
13 1 Y 1 B LEU 2   ? F LEU 2   
14 1 Y 1 B GLY 3   ? F GLY 3   
15 1 Y 1 B LYS 4   ? F LYS 4   
16 1 Y 1 B PRO 5   ? F PRO 5   
17 1 Y 1 B GLN 6   ? F GLN 6   
18 1 Y 1 B THR 7   ? F THR 7   
19 1 Y 1 B ASP 8   ? F ASP 8   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RUO 'double helix'        
1RUO 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 D DG 17 1_555 1.081  0.025  -0.612 14.784  -10.679 10.888  1  C_DC-4:DG-4_F C -4 ? F -4 ? 19 1 
1 A DG 3  1_555 D DC 16 1_555 -0.381 0.196  0.105  -3.075  2.241   -2.452  2  C_DG-3:DC-3_F C -3 ? F -3 ? 19 1 
1 A DA 4  1_555 D DT 15 1_555 0.531  0.282  -0.628 -11.150 -21.333 16.034  3  C_DA-2:DT-2_F C -2 ? F -2 ? ?  ? 
1 A DA 5  1_555 D DT 14 1_555 -0.498 0.064  -0.353 2.242   -7.807  -0.648  4  C_DA-1:DT-1_F C -1 ? F -1 ? 20 1 
1 A DA 6  1_555 D DT 13 1_555 0.954  -0.157 0.148  0.833   -17.962 -5.825  5  C_DA1:DT1_F   C 1  ? F 1  ? 20 1 
1 A DA 7  1_555 D DT 12 1_555 0.119  -0.413 0.438  11.276  -21.524 -0.726  6  C_DA2:DT2_F   C 2  ? F 2  ? 20 1 
1 A DA 8  1_555 D DT 11 1_555 -0.130 -0.228 0.321  -10.683 12.826  -3.499  7  C_DA3:DT3_F   C 3  ? F 3  ? 20 1 
1 A DT 9  1_555 D DA 10 1_555 0.537  -0.175 1.062  -4.937  4.065   1.185   8  C_DT4:DA4_F   C 4  ? F 4  ? 20 1 
1 A DG 10 1_555 D DC 9  1_555 -0.034 0.202  0.108  -1.450  -0.415  -1.742  9  C_DG5:DC5_F   C 5  ? F 5  ? 19 1 
1 A DT 11 1_555 D DA 8  1_555 -1.014 -0.049 1.382  -8.700  6.521   15.918  10 C_DT6:DA6_F   C 6  ? F 6  ? 20 1 
1 A DG 12 1_555 D DC 7  1_555 0.905  0.087  0.479  -11.854 3.281   -5.280  11 C_DG7:DC7_F   C 7  ? F 7  ? 19 1 
1 A DA 13 1_555 D DT 6  1_555 1.045  -0.637 0.052  0.782   -8.982  4.144   12 C_DA8:DT8_F   C 8  ? F 8  ? 20 1 
1 A DT 14 1_555 D DA 5  1_555 0.056  -0.039 -1.359 11.340  -26.811 8.180   13 C_DT9:DA9_F   C 9  ? F 9  ? 20 1 
1 B DT 2  1_555 D DA 3  1_555 0.631  -0.196 -1.187 3.267   -18.127 6.991   14 D_DT11:DA11_F D 11 ? F 11 ? 20 1 
1 B DA 3  1_555 D DT 2  1_555 0.583  -0.097 0.100  3.110   4.992   -4.169  15 D_DA12:DT12_F D 12 ? F 12 ? 20 1 
1 B DG 4  1_555 D DC 1  1_555 0.344  0.353  0.610  23.023  17.649  0.392   16 D_DG13:DC13_F D 13 ? F 13 ? 19 1 
1 B DA 5  1_555 C DT 14 1_555 -0.202 -0.417 -1.515 9.882   -3.318  3.967   17 D_DA14:DT14_E D 14 ? E 14 ? 20 1 
1 B DT 6  1_555 C DA 13 1_555 -1.605 0.145  -0.266 6.574   -15.183 2.770   18 D_DT15:DA15_E D 15 ? E 15 ? 20 1 
1 B DC 7  1_555 C DG 12 1_555 -0.184 -0.401 0.340  -9.239  -1.158  -2.371  19 D_DC16:DG16_E D 16 ? E 16 ? 19 1 
1 B DA 8  1_555 C DT 11 1_555 1.798  0.074  -0.362 -9.054  14.623  12.560  20 D_DA17:DT17_E D 17 ? E 17 ? ?  ? 
1 B DC 9  1_555 C DG 10 1_555 1.184  -0.524 -0.027 5.744   -0.155  -15.032 21 D_DC18:DG18_E D 18 ? E 18 ? 19 1 
1 B DA 10 1_555 C DT 9  1_555 0.804  -0.239 -1.302 10.057  -3.629  4.926   22 D_DA19:DT19_E D 19 ? E 19 ? 20 1 
1 B DT 11 1_555 C DA 8  1_555 0.318  -0.321 0.567  -31.830 -43.391 -2.270  23 D_DT20:DA20_E D 20 ? E 20 ? 20 1 
1 B DT 12 1_555 C DA 7  1_555 -0.201 0.126  0.353  -34.351 -45.894 -19.225 24 D_DT21:DA21_E D 21 ? E 21 ? 20 1 
1 B DT 13 1_555 C DA 6  1_555 -1.389 0.309  -1.349 -15.335 -43.667 4.433   25 D_DT22:DA22_E D 22 ? E 22 ? ?  ? 
1 B DT 14 1_555 C DA 5  1_555 -0.119 -0.139 0.068  -9.687  5.078   -14.467 26 D_DT23:DA23_E D 23 ? E 23 ? 20 1 
1 B DT 15 1_555 C DA 4  1_555 -0.637 -0.453 -0.142 3.775   -19.568 -8.511  27 D_DT24:DA24_E D 24 ? E 24 ? 20 1 
1 B DC 16 1_555 C DG 3  1_555 0.591  -0.058 0.612  -15.607 7.551   2.559   28 D_DC25:DG25_E D 25 ? E 25 ? 19 1 
1 B DG 17 1_555 C DC 2  1_555 -1.663 -1.034 -0.493 3.082   -8.732  -0.109  29 D_DG26:DC26_E D 26 ? E 26 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 D DG 17 1_555 A DG 3  1_555 D DC 16 1_555 -0.180 1.261  4.313 -6.183  13.491  25.372 -1.654 -1.543 4.349 27.881  
12.777  29.332 1  CC_DC-4DG-3:DC-3DG-4_FF C -4 ? F -4 ? C -3 ? F -3 ? 
1 A DG 3  1_555 D DC 16 1_555 A DA 4  1_555 D DT 15 1_555 -0.645 1.902  3.646 0.681   -4.178  41.408 3.157  0.987  3.436 -5.890  
-0.961  41.614 2  CC_DG-3DA-2:DT-2DC-3_FF C -3 ? F -3 ? C -2 ? F -2 ? 
1 A DA 4  1_555 D DT 15 1_555 A DA 5  1_555 D DT 14 1_555 -0.419 0.012  2.723 -7.519  0.021   37.804 0.016  -0.153 2.753 0.033   
11.466  38.518 3  CC_DA-2DA-1:DT-1DT-2_FF C -2 ? F -2 ? C -1 ? F -1 ? 
1 A DA 5  1_555 D DT 14 1_555 A DA 6  1_555 D DT 13 1_555 -0.370 -0.498 3.011 -4.409  -8.631  42.717 0.108  0.100  3.072 -11.670 
5.961   43.753 4  CC_DA-1DA1:DT1DT-1_FF   C -1 ? F -1 ? C 1  ? F 1  ? 
1 A DA 6  1_555 D DT 13 1_555 A DA 7  1_555 D DT 12 1_555 0.513  -0.382 3.040 7.266   -18.507 29.864 2.015  0.200  2.847 -31.856 
-12.507 35.752 5  CC_DA1DA2:DT2DT1_FF     C 1  ? F 1  ? C 2  ? F 2  ? 
1 A DA 7  1_555 D DT 12 1_555 A DA 8  1_555 D DT 11 1_555 0.453  -1.350 3.811 0.575   6.367   39.097 -2.839 -0.593 3.563 9.436   
-0.853  39.596 6  CC_DA2DA3:DT3DT2_FF     C 2  ? F 2  ? C 3  ? F 3  ? 
1 A DA 8  1_555 D DT 11 1_555 A DT 9  1_555 D DA 10 1_555 0.844  -1.077 3.017 -1.591  4.555   30.547 -2.807 -1.857 2.785 8.578   
2.995   30.917 7  CC_DA3DT4:DA4DT3_FF     C 3  ? F 3  ? C 4  ? F 4  ? 
1 A DT 9  1_555 D DA 10 1_555 A DG 10 1_555 D DC 9  1_555 0.474  0.673  3.554 8.737   -9.391  40.750 1.948  0.300  3.355 -13.099 
-12.188 42.639 8  CC_DT4DG5:DC5DA4_FF     C 4  ? F 4  ? C 5  ? F 5  ? 
1 A DG 10 1_555 D DC 9  1_555 A DT 11 1_555 D DA 8  1_555 0.233  0.432  3.889 -8.880  6.609   19.027 -1.920 -4.711 3.406 18.141  
24.372  21.987 9  CC_DG5DT6:DA6DC5_FF     C 5  ? F 5  ? C 6  ? F 6  ? 
1 A DT 11 1_555 D DA 8  1_555 A DG 12 1_555 D DC 7  1_555 -0.211 1.557  4.405 8.079   42.000  40.935 -1.925 0.892  4.192 47.368  
-9.112  58.530 10 CC_DT6DG7:DC7DA6_FF     C 6  ? F 6  ? C 7  ? F 7  ? 
1 A DG 12 1_555 D DC 7  1_555 A DA 13 1_555 D DT 6  1_555 -0.267 2.479  2.936 -7.579  0.654   34.005 4.052  -0.608 2.970 1.102   
12.761  34.821 11 CC_DG7DA8:DT8DC7_FF     C 7  ? F 7  ? C 8  ? F 8  ? 
1 A DA 13 1_555 D DT 6  1_555 A DT 14 1_555 D DA 5  1_555 -0.173 0.332  2.494 9.509   9.599   22.676 -1.262 2.353  2.209 22.074  
-21.867 26.351 12 CC_DA8DT9:DA9DT8_FF     C 8  ? F 8  ? C 9  ? F 9  ? 
1 B DT 2  1_555 D DA 3  1_555 B DA 3  1_555 D DT 2  1_555 -0.365 1.350  3.385 -15.442 -0.796  41.064 1.892  -1.067 3.285 -1.090  
21.132  43.760 13 DD_DT11DA12:DT12DA11_FF D 11 ? F 11 ? D 12 ? F 12 ? 
1 B DA 3  1_555 D DT 2  1_555 B DG 4  1_555 D DC 1  1_555 0.380  -0.782 3.067 -4.251  -13.417 25.856 1.312  -1.654 3.003 -27.539 
8.725   29.381 14 DD_DA12DG13:DC13DT12_FF D 12 ? F 12 ? D 13 ? F 13 ? 
1 B DG 4  1_555 D DC 1  1_555 B DA 5  1_555 C DT 14 1_555 0.680  -0.160 4.035 17.773  3.815   40.460 -0.670 1.229  3.957 5.211   
-24.274 44.200 15 DD_DG13DA14:DT14DC13_EF D 13 ? F 13 ? D 14 ? E 14 ? 
1 B DA 5  1_555 C DT 14 1_555 B DT 6  1_555 C DA 13 1_555 0.230  -0.453 3.416 -2.714  6.155   25.032 -2.759 -1.283 3.173 13.884  
6.123   25.906 16 DD_DA14DT15:DA15DT14_EE D 14 ? E 14 ? D 15 ? E 15 ? 
1 B DT 6  1_555 C DA 13 1_555 B DC 7  1_555 C DG 12 1_555 0.154  1.357  3.846 3.327   2.185   40.682 1.659  0.213  3.911 3.133   
-4.772  40.868 17 DD_DT15DC16:DG16DA15_EE D 15 ? E 15 ? D 16 ? E 16 ? 
1 B DC 7  1_555 C DG 12 1_555 B DA 8  1_555 C DT 11 1_555 0.589  1.866  4.435 10.817  32.060  29.644 -2.432 0.874  4.431 47.313  
-15.964 44.697 18 DD_DC16DA17:DT17DG16_EE D 16 ? E 16 ? D 17 ? E 17 ? 
1 B DA 8  1_555 C DT 11 1_555 B DC 9  1_555 C DG 10 1_555 -0.797 -0.100 2.911 -1.999  2.195   26.686 -0.723 1.254  2.944 4.737   
4.314   26.847 19 DD_DA17DC18:DG18DT17_EE D 17 ? E 17 ? D 18 ? E 18 ? 
1 B DC 9  1_555 C DG 10 1_555 B DA 10 1_555 C DT 9  1_555 0.365  0.142  3.380 7.412   7.924   28.459 -1.403 0.870  3.290 15.428  
-14.431 30.418 20 DD_DC18DA19:DT19DG18_EE D 18 ? E 18 ? D 19 ? E 19 ? 
1 B DA 10 1_555 C DT 9  1_555 B DT 11 1_555 C DA 8  1_555 -0.873 -0.994 4.191 -15.695 7.768   36.669 -2.577 -1.044 3.951 11.572  
23.381  40.506 21 DD_DA19DT20:DA20DT19_EE D 19 ? E 19 ? D 20 ? E 20 ? 
1 B DT 11 1_555 C DA 8  1_555 B DT 12 1_555 C DA 7  1_555 -1.366 -0.769 2.797 -8.173  -1.309  29.593 -1.217 1.108  3.086 -2.503  
15.620  30.704 22 DD_DT20DT21:DA21DA20_EE D 20 ? E 20 ? D 21 ? E 21 ? 
1 B DT 12 1_555 C DA 7  1_555 B DT 13 1_555 C DA 6  1_555 -0.084 -0.020 2.781 6.796   -22.701 36.259 1.898  0.692  2.354 -32.560 
-9.748  43.096 23 DD_DT21DT22:DA22DA21_EE D 21 ? E 21 ? D 22 ? E 22 ? 
1 B DT 13 1_555 C DA 6  1_555 B DT 14 1_555 C DA 5  1_555 -0.149 -1.184 3.490 -8.155  -1.437  37.587 -1.604 -0.869 3.487 -2.198  
12.472  38.456 24 DD_DT22DT23:DA23DA22_EE D 22 ? E 22 ? D 23 ? E 23 ? 
1 B DT 14 1_555 C DA 5  1_555 B DT 15 1_555 C DA 4  1_555 1.163  -0.287 2.469 13.652  -11.965 44.359 0.429  -0.543 2.687 -15.118 
-17.250 47.756 25 DD_DT23DT24:DA24DA23_EE D 23 ? E 23 ? D 24 ? E 24 ? 
1 B DT 15 1_555 C DA 4  1_555 B DC 16 1_555 C DG 3  1_555 2.257  0.435  4.840 -7.185  9.896   32.169 -1.478 -5.429 4.203 17.107  
12.420  34.358 26 DD_DT24DC25:DG25DA24_EE D 24 ? E 24 ? D 25 ? E 25 ? 
1 B DC 16 1_555 C DG 3  1_555 B DG 17 1_555 C DC 2  1_555 -0.820 0.125  2.715 6.059   6.879   25.495 -1.141 2.992  2.411 14.984  
-13.198 27.068 27 DD_DC25DG26:DC26DG25_EE D 25 ? E 25 ? D 26 ? E 26 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
5 water                                  HOH 
#