data_1RV5
# 
_entry.id   1RV5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RV5         
RCSB  PD0013       
WWPDB D_1000176239 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RV5 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-01 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horton, N.C.' 1 
'Perona, J.J.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Role of protein-induced bending in the specificity of DNA recognition: crystal structure of EcoRV endonuclease complexed with d(AAAGAT) + d(ATCTT).
;
J.Mol.Biol.            277 779  783 1998 JMOBAK UK 0022-2836 0070 ? 9545372 10.1006/jmbi.1998.1655 
1       'The Crystal Structure of EcoRV Endonuclease and of its Complexes with Cognate and Non-Cognate DNA Fragments' 'Embo J.' 12 
1781 ?   1993 EMJODG UK 0261-4189 0897 ? ?       ?                      
2       'Structure and Function of Restriction Endonucleases' Curr.Opin.Struct.Biol. 2   93   ?   1992 COSBEF UK 0959-440X 0801 ? 
?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horton, N.C.'   1  
primary 'Perona, J.J.'   2  
1       'Winkler, F.K.'  3  
1       'Banner, D.W.'   4  
1       'Oefner, C.'     5  
1       'Tsernoglou, D.' 6  
1       'Brown, R.S.'    7  
1       'Heathman, S.P.' 8  
1       'Bryan, R.K.'    9  
1       'Martin, P.D.'   10 
1       'Petratos, K.'   11 
1       'Wilson, K.S.'   12 
2       'Winkler, F.K.'  13 
# 
_cell.entry_id           1RV5 
_cell.length_a           49.600 
_cell.length_b           50.400 
_cell.length_c           63.900 
_cell.angle_alpha        96.40 
_cell.angle_beta         109.20 
_cell.angle_gamma        108.50 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RV5 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     triclinic 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*AP*AP*AP*GP*AP*T*AP*TP*CP*TP*T)-3'" 3356.235  2   ?        ? ? ? 
2 polymer nat 'ECORV ENDONUCLEASE'                       28559.158 2   3.1.21.4 ? ? ? 
3 water   nat water                                      18.015    164 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'COGNATE SEQUENCE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DG)(DA)(DT)(DA)(DT)(DC)(DT)(DT)' AAAGATATCTT C,D ? 
2 'polypeptide(L)'        no no 
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DT  n 
1 11  DT  n 
2 1   SER n 
2 2   LEU n 
2 3   ARG n 
2 4   SER n 
2 5   ASP n 
2 6   LEU n 
2 7   ILE n 
2 8   ASN n 
2 9   ALA n 
2 10  LEU n 
2 11  TYR n 
2 12  ASP n 
2 13  GLU n 
2 14  ASN n 
2 15  GLN n 
2 16  LYS n 
2 17  TYR n 
2 18  ASP n 
2 19  VAL n 
2 20  CYS n 
2 21  GLY n 
2 22  ILE n 
2 23  ILE n 
2 24  SER n 
2 25  ALA n 
2 26  GLU n 
2 27  GLY n 
2 28  LYS n 
2 29  ILE n 
2 30  TYR n 
2 31  PRO n 
2 32  LEU n 
2 33  GLY n 
2 34  SER n 
2 35  ASP n 
2 36  THR n 
2 37  LYS n 
2 38  VAL n 
2 39  LEU n 
2 40  SER n 
2 41  THR n 
2 42  ILE n 
2 43  PHE n 
2 44  GLU n 
2 45  LEU n 
2 46  PHE n 
2 47  SER n 
2 48  ARG n 
2 49  PRO n 
2 50  ILE n 
2 51  ILE n 
2 52  ASN n 
2 53  LYS n 
2 54  ILE n 
2 55  ALA n 
2 56  GLU n 
2 57  LYS n 
2 58  HIS n 
2 59  GLY n 
2 60  TYR n 
2 61  ILE n 
2 62  VAL n 
2 63  GLU n 
2 64  GLU n 
2 65  PRO n 
2 66  LYS n 
2 67  GLN n 
2 68  GLN n 
2 69  ASN n 
2 70  HIS n 
2 71  TYR n 
2 72  PRO n 
2 73  ASP n 
2 74  PHE n 
2 75  THR n 
2 76  LEU n 
2 77  TYR n 
2 78  LYS n 
2 79  PRO n 
2 80  SER n 
2 81  GLU n 
2 82  PRO n 
2 83  ASN n 
2 84  LYS n 
2 85  LYS n 
2 86  ILE n 
2 87  ALA n 
2 88  ILE n 
2 89  ASP n 
2 90  ILE n 
2 91  LYS n 
2 92  THR n 
2 93  THR n 
2 94  TYR n 
2 95  THR n 
2 96  ASN n 
2 97  LYS n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 LYS n 
2 102 ILE n 
2 103 LYS n 
2 104 PHE n 
2 105 THR n 
2 106 LEU n 
2 107 GLY n 
2 108 GLY n 
2 109 TYR n 
2 110 THR n 
2 111 SER n 
2 112 PHE n 
2 113 ILE n 
2 114 ARG n 
2 115 ASN n 
2 116 ASN n 
2 117 THR n 
2 118 LYS n 
2 119 ASN n 
2 120 ILE n 
2 121 VAL n 
2 122 TYR n 
2 123 PRO n 
2 124 PHE n 
2 125 ASP n 
2 126 GLN n 
2 127 TYR n 
2 128 ILE n 
2 129 ALA n 
2 130 HIS n 
2 131 TRP n 
2 132 ILE n 
2 133 ILE n 
2 134 GLY n 
2 135 TYR n 
2 136 VAL n 
2 137 TYR n 
2 138 THR n 
2 139 ARG n 
2 140 VAL n 
2 141 ALA n 
2 142 THR n 
2 143 ARG n 
2 144 LYS n 
2 145 SER n 
2 146 SER n 
2 147 LEU n 
2 148 LYS n 
2 149 THR n 
2 150 TYR n 
2 151 ASN n 
2 152 ILE n 
2 153 ASN n 
2 154 GLU n 
2 155 LEU n 
2 156 ASN n 
2 157 GLU n 
2 158 ILE n 
2 159 PRO n 
2 160 LYS n 
2 161 PRO n 
2 162 TYR n 
2 163 LYS n 
2 164 GLY n 
2 165 VAL n 
2 166 LYS n 
2 167 VAL n 
2 168 PHE n 
2 169 LEU n 
2 170 GLN n 
2 171 ASP n 
2 172 LYS n 
2 173 TRP n 
2 174 VAL n 
2 175 ILE n 
2 176 ALA n 
2 177 GLY n 
2 178 ASP n 
2 179 LEU n 
2 180 ALA n 
2 181 GLY n 
2 182 SER n 
2 183 GLY n 
2 184 ASN n 
2 185 THR n 
2 186 THR n 
2 187 ASN n 
2 188 ILE n 
2 189 GLY n 
2 190 SER n 
2 191 ILE n 
2 192 HIS n 
2 193 ALA n 
2 194 HIS n 
2 195 TYR n 
2 196 LYS n 
2 197 ASP n 
2 198 PHE n 
2 199 VAL n 
2 200 GLU n 
2 201 GLY n 
2 202 LYS n 
2 203 GLY n 
2 204 ILE n 
2 205 PHE n 
2 206 ASP n 
2 207 SER n 
2 208 GLU n 
2 209 ASP n 
2 210 GLU n 
2 211 PHE n 
2 212 LEU n 
2 213 ASP n 
2 214 TYR n 
2 215 TRP n 
2 216 ARG n 
2 217 ASN n 
2 218 TYR n 
2 219 GLU n 
2 220 ARG n 
2 221 THR n 
2 222 SER n 
2 223 GLN n 
2 224 LEU n 
2 225 ARG n 
2 226 ASN n 
2 227 ASP n 
2 228 LYS n 
2 229 TYR n 
2 230 ASN n 
2 231 ASN n 
2 232 ILE n 
2 233 SER n 
2 234 GLU n 
2 235 TYR n 
2 236 ARG n 
2 237 ASN n 
2 238 TRP n 
2 239 ILE n 
2 240 TYR n 
2 241 ARG n 
2 242 GLY n 
2 243 ARG n 
2 244 LYS n 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E5_ECOLI 2 ? ? P04390 ? 
2 PDB 1RV5       1 ? ? 1RV5   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RV5 A 1 ? 244 ? P04390 1 ? 244 ? 2 245 
2 1 1RV5 B 1 ? 244 ? P04390 1 ? 244 ? 2 245 
3 2 1RV5 C 1 ? 11  ? 1RV5   1 ? 11  ? 1 11  
4 2 1RV5 D 1 ? 11  ? 1RV5   1 ? 11  ? 1 11  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RV5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.45 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1997-04-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1RV5 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   29460 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         80 
_reflns.pdbx_Rmerge_I_obs            0.0780000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        29.4 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1RV5 
_refine.ls_number_reflns_obs                     27705 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    80 
_refine.ls_R_factor_obs                          0.1930000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1930000 
_refine.ls_R_factor_R_free                       0.2720000 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2 
_refine.ls_number_reflns_R_free                  488 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1RVA 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RV5 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4649 
_refine_hist.pdbx_number_atoms_nucleic_acid   478 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             492 
_refine_hist.number_atoms_total               5619 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.62  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.62 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.483 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.1 
_refine_ls_shell.d_res_low                        2.19 
_refine_ls_shell.number_reflns_R_work             2007 
_refine_ls_shell.R_factor_R_work                  0.3040000 
_refine_ls_shell.percent_reflns_obs               58. 
_refine_ls_shell.R_factor_R_free                  0.2720000 
_refine_ls_shell.R_factor_R_free_error            0.043 
_refine_ls_shell.percent_reflns_R_free            1.55 
_refine_ls_shell.number_reflns_R_free             39 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PR0 TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNDBX.DNA0 TOPNDBX.DNA  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RV5 
_struct.title                     'COMPLEX OF ECORV ENDONUCLEASE WITH D(AAAGAT)/D(ATCTT)' 
_struct.pdbx_descriptor           'ECORV ENDONUCLEASE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RV5 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'ENDONUCLEASE ECORV-DNA COMPLEX, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU C 2   ? LYS C 16  ? LEU A 3   LYS A 17  1 ? 15 
HELX_P HELX_P2  2  THR C 36  ? HIS C 58  ? THR A 37  HIS A 59  1 ? 23 
HELX_P HELX_P3  3  PRO C 79  ? GLU C 81  ? PRO A 80  GLU A 82  5 ? 3  
HELX_P HELX_P4  4  PHE C 124 ? GLN C 126 ? PHE A 125 GLN A 127 5 ? 3  
HELX_P HELX_P5  5  ILE C 152 ? GLU C 157 ? ILE A 153 GLU A 158 5 ? 6  
HELX_P HELX_P6  6  LYS C 172 ? ILE C 175 ? LYS A 173 ILE A 176 1 ? 4  
HELX_P HELX_P7  7  TYR C 195 ? GLU C 200 ? TYR A 196 GLU A 201 1 ? 6  
HELX_P HELX_P8  8  GLU C 208 ? ARG C 216 ? GLU A 209 ARG A 217 1 ? 9  
HELX_P HELX_P9  9  SER C 222 ? ARG C 225 ? SER A 223 ARG A 226 1 ? 4  
HELX_P HELX_P10 10 ILE C 232 ? TYR C 240 ? ILE A 233 TYR A 241 1 ? 9  
HELX_P HELX_P11 12 THR D 36  ? HIS D 58  ? THR B 37  HIS B 59  1 ? 23 
HELX_P HELX_P12 13 PHE D 124 ? GLN D 126 ? PHE B 125 GLN B 127 5 ? 3  
HELX_P HELX_P13 14 LEU D 155 ? GLU D 157 ? LEU B 156 GLU B 158 5 ? 3  
HELX_P HELX_P14 15 LYS D 172 ? ILE D 175 ? LYS B 173 ILE B 176 1 ? 4  
HELX_P HELX_P15 16 TYR D 195 ? GLU D 200 ? TYR B 196 GLU B 201 1 ? 6  
HELX_P HELX_P16 17 GLU D 208 ? ASN D 217 ? GLU B 209 ASN B 218 1 ? 10 
HELX_P HELX_P17 18 SER D 222 ? ASP D 227 ? SER B 223 ASP B 228 1 ? 6  
HELX_P HELX_P18 19 ILE D 232 ? TYR D 240 ? ILE B 233 TYR B 241 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 11 N3 ? ? C DA 2  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 2  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 10 N3 ? ? C DA 3  D DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 10 O4 ? ? C DA 3  D DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 9  N3 ? ? C DG 4  D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 9  O2 ? ? C DG 4  D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 9  N4 ? ? C DG 4  D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 8  N3 ? ? C DA 5  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 8  O4 ? ? C DA 5  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 7  N1 ? ? C DT 6  D DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 7  N6 ? ? C DT 6  D DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 6  N3 ? ? C DA 7  D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 6  O4 ? ? C DA 7  D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 8  D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 8  D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 4  N1 ? ? C DC 9  D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 4  O6 ? ? C DC 9  D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 4  N2 ? ? C DC 9  D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 3  N1 ? ? C DT 10 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 3  N6 ? ? C DT 10 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 2  N1 ? ? C DT 11 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 2  N6 ? ? C DT 11 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 71 C . ? TYR 72 A PRO 72 C ? PRO 73 A 1 -0.51 
2 TYR 71 D . ? TYR 72 B PRO 72 D ? PRO 73 B 1 -0.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY C 21  ? ILE C 23  ? GLY A 22  ILE A 24  
A 2 ILE C 29  ? PRO C 31  ? ILE A 30  PRO A 32  
B 1 ILE C 61  ? GLU C 63  ? ILE A 62  GLU A 64  
B 2 PHE C 74  ? TYR C 77  ? PHE A 75  TYR A 78  
B 3 LYS C 85  ? THR C 95  ? LYS A 86  THR A 96  
B 4 TYR C 127 ? THR C 138 ? TYR A 128 THR A 139 
B 5 VAL C 165 ? ASP C 171 ? VAL A 166 ASP A 172 
C 1 GLY D 21  ? ILE D 23  ? GLY B 22  ILE B 24  
C 2 LYS D 28  ? PRO D 31  ? LYS B 29  PRO B 32  
C 3 THR D 149 ? ASN D 151 ? THR B 150 ASN B 152 
D 1 ILE D 61  ? GLU D 63  ? ILE B 62  GLU B 64  
D 2 PHE D 74  ? TYR D 77  ? PHE B 75  TYR B 78  
D 3 LYS D 85  ? THR D 95  ? LYS B 86  THR B 96  
D 4 TYR D 127 ? ARG D 139 ? TYR B 128 ARG B 140 
D 5 TYR D 162 ? ASP D 171 ? TYR B 163 ASP B 172 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE C 22  ? O ILE A 23  N TYR C 30  ? N TYR A 31  
B 1 2 O ILE C 61  ? O ILE A 62  N TYR C 77  ? N TYR A 78  
B 2 3 O PHE C 74  ? O PHE A 75  N ILE C 88  ? N ILE A 89  
B 3 4 O LYS C 85  ? O LYS A 86  N ILE C 128 ? N ILE A 129 
B 4 5 O ILE C 132 ? O ILE A 133 N GLN C 170 ? N GLN A 171 
C 1 2 O ILE D 22  ? O ILE B 23  N TYR D 30  ? N TYR B 31  
C 2 3 O ILE D 29  ? O ILE B 30  N TYR D 150 ? N TYR B 151 
D 1 2 O ILE D 61  ? O ILE B 62  N TYR D 77  ? N TYR B 78  
D 2 3 O PHE D 74  ? O PHE B 75  N ILE D 88  ? N ILE B 89  
D 3 4 O LYS D 85  ? O LYS B 86  N ILE D 128 ? N ILE B 129 
D 4 5 O ILE D 132 ? O ILE B 133 N GLN D 170 ? N GLN B 171 
# 
_database_PDB_matrix.entry_id          1RV5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RV5 
_atom_sites.fract_transf_matrix[1][1]   0.020161 
_atom_sites.fract_transf_matrix[1][2]   0.006746 
_atom_sites.fract_transf_matrix[1][3]   0.008909 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020922 
_atom_sites.fract_transf_matrix[2][3]   0.005195 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017074 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? -3.759  -12.966 -17.456 1.00 72.58 ? 1   DA  C "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? -3.772  -13.499 -16.114 1.00 72.01 ? 1   DA  C "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? -5.149  -14.020 -15.771 1.00 70.71 ? 1   DA  C "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? -5.120  -14.709 -14.501 1.00 68.97 ? 1   DA  C "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? -6.227  -12.951 -15.633 1.00 69.21 ? 1   DA  C "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? -7.474  -13.496 -16.081 1.00 68.43 ? 1   DA  C "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? -6.253  -12.689 -14.140 1.00 67.17 ? 1   DA  C "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? -5.997  -14.075 -13.584 1.00 68.27 ? 1   DA  C "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? -5.360  -14.108 -12.271 1.00 69.44 ? 1   DA  C N9    1 
ATOM   10   C C8    . DA  A 1 1   ? -5.830  -14.725 -11.139 1.00 69.41 ? 1   DA  C C8    1 
ATOM   11   N N7    . DA  A 1 1   ? -5.031  -14.616 -10.104 1.00 70.19 ? 1   DA  C N7    1 
ATOM   12   C C5    . DA  A 1 1   ? -3.960  -13.874 -10.589 1.00 70.36 ? 1   DA  C C5    1 
ATOM   13   C C6    . DA  A 1 1   ? -2.768  -13.428 -9.986  1.00 71.14 ? 1   DA  C C6    1 
ATOM   14   N N6    . DA  A 1 1   ? -2.435  -13.690 -8.715  1.00 71.63 ? 1   DA  C N6    1 
ATOM   15   N N1    . DA  A 1 1   ? -1.916  -12.700 -10.743 1.00 72.79 ? 1   DA  C N1    1 
ATOM   16   C C2    . DA  A 1 1   ? -2.246  -12.453 -12.017 1.00 74.08 ? 1   DA  C C2    1 
ATOM   17   N N3    . DA  A 1 1   ? -3.328  -12.826 -12.696 1.00 73.97 ? 1   DA  C N3    1 
ATOM   18   C C4    . DA  A 1 1   ? -4.156  -13.543 -11.917 1.00 71.10 ? 1   DA  C C4    1 
ATOM   19   H H61   . DA  A 1 1   ? -3.066  -14.224 -8.134  1.00 0.00  ? 1   DA  C H61   1 
ATOM   20   H H62   . DA  A 1 1   ? -1.555  -13.363 -8.345  1.00 0.00  ? 1   DA  C H62   1 
ATOM   21   P P     . DA  A 1 2   ? -8.814  -12.608 -16.000 1.00 68.34 ? 2   DA  C P     1 
ATOM   22   O OP1   . DA  A 1 2   ? -9.824  -13.224 -16.903 1.00 70.57 ? 2   DA  C OP1   1 
ATOM   23   O OP2   . DA  A 1 2   ? -8.458  -11.161 -16.156 1.00 68.30 ? 2   DA  C OP2   1 
ATOM   24   O "O5'" . DA  A 1 2   ? -9.306  -12.815 -14.504 1.00 64.17 ? 2   DA  C "O5'" 1 
ATOM   25   C "C5'" . DA  A 1 2   ? -9.561  -14.128 -14.002 1.00 57.36 ? 2   DA  C "C5'" 1 
ATOM   26   C "C4'" . DA  A 1 2   ? -10.212 -14.036 -12.647 1.00 52.60 ? 2   DA  C "C4'" 1 
ATOM   27   O "O4'" . DA  A 1 2   ? -9.239  -13.672 -11.650 1.00 49.13 ? 2   DA  C "O4'" 1 
ATOM   28   C "C3'" . DA  A 1 2   ? -11.310 -12.990 -12.562 1.00 50.96 ? 2   DA  C "C3'" 1 
ATOM   29   O "O3'" . DA  A 1 2   ? -12.379 -13.534 -11.800 1.00 48.72 ? 2   DA  C "O3'" 1 
ATOM   30   C "C2'" . DA  A 1 2   ? -10.634 -11.798 -11.896 1.00 47.87 ? 2   DA  C "C2'" 1 
ATOM   31   C "C1'" . DA  A 1 2   ? -9.520  -12.413 -11.064 1.00 47.44 ? 2   DA  C "C1'" 1 
ATOM   32   N N9    . DA  A 1 2   ? -8.267  -11.662 -11.090 1.00 46.37 ? 2   DA  C N9    1 
ATOM   33   C C8    . DA  A 1 2   ? -7.795  -10.920 -12.139 1.00 46.49 ? 2   DA  C C8    1 
ATOM   34   N N7    . DA  A 1 2   ? -6.586  -10.454 -11.955 1.00 45.27 ? 2   DA  C N7    1 
ATOM   35   C C5    . DA  A 1 2   ? -6.247  -10.895 -10.690 1.00 41.75 ? 2   DA  C C5    1 
ATOM   36   C C6    . DA  A 1 2   ? -5.094  -10.745 -9.940  1.00 40.82 ? 2   DA  C C6    1 
ATOM   37   N N6    . DA  A 1 2   ? -4.009  -10.117 -10.388 1.00 42.13 ? 2   DA  C N6    1 
ATOM   38   N N1    . DA  A 1 2   ? -5.075  -11.274 -8.702  1.00 41.12 ? 2   DA  C N1    1 
ATOM   39   C C2    . DA  A 1 2   ? -6.157  -11.927 -8.268  1.00 42.52 ? 2   DA  C C2    1 
ATOM   40   N N3    . DA  A 1 2   ? -7.303  -12.154 -8.895  1.00 43.65 ? 2   DA  C N3    1 
ATOM   41   C C4    . DA  A 1 2   ? -7.285  -11.607 -10.123 1.00 44.18 ? 2   DA  C C4    1 
ATOM   42   H H61   . DA  A 1 2   ? -4.022  -9.703  -11.309 1.00 0.00  ? 2   DA  C H61   1 
ATOM   43   H H62   . DA  A 1 2   ? -3.171  -10.055 -9.827  1.00 0.00  ? 2   DA  C H62   1 
ATOM   44   P P     . DA  A 1 3   ? -13.533 -12.576 -11.262 1.00 48.58 ? 3   DA  C P     1 
ATOM   45   O OP1   . DA  A 1 3   ? -14.748 -13.415 -11.073 1.00 51.59 ? 3   DA  C OP1   1 
ATOM   46   O OP2   . DA  A 1 3   ? -13.603 -11.351 -12.111 1.00 49.96 ? 3   DA  C OP2   1 
ATOM   47   O "O5'" . DA  A 1 3   ? -12.989 -12.145 -9.825  1.00 47.14 ? 3   DA  C "O5'" 1 
ATOM   48   C "C5'" . DA  A 1 3   ? -12.280 -13.095 -8.994  1.00 38.58 ? 3   DA  C "C5'" 1 
ATOM   49   C "C4'" . DA  A 1 3   ? -11.872 -12.447 -7.690  1.00 32.52 ? 3   DA  C "C4'" 1 
ATOM   50   O "O4'" . DA  A 1 3   ? -10.623 -11.733 -7.833  1.00 26.61 ? 3   DA  C "O4'" 1 
ATOM   51   C "C3'" . DA  A 1 3   ? -12.881 -11.462 -7.098  1.00 29.55 ? 3   DA  C "C3'" 1 
ATOM   52   O "O3'" . DA  A 1 3   ? -13.082 -11.746 -5.705  1.00 30.49 ? 3   DA  C "O3'" 1 
ATOM   53   C "C2'" . DA  A 1 3   ? -12.224 -10.105 -7.304  1.00 26.08 ? 3   DA  C "C2'" 1 
ATOM   54   C "C1'" . DA  A 1 3   ? -10.740 -10.425 -7.309  1.00 22.83 ? 3   DA  C "C1'" 1 
ATOM   55   N N9    . DA  A 1 3   ? -9.909  -9.543  -8.133  1.00 23.70 ? 3   DA  C N9    1 
ATOM   56   C C8    . DA  A 1 3   ? -10.257 -8.886  -9.292  1.00 23.20 ? 3   DA  C C8    1 
ATOM   57   N N7    . DA  A 1 3   ? -9.291  -8.156  -9.800  1.00 22.44 ? 3   DA  C N7    1 
ATOM   58   C C5    . DA  A 1 3   ? -8.230  -8.351  -8.928  1.00 21.82 ? 3   DA  C C5    1 
ATOM   59   C C6    . DA  A 1 3   ? -6.907  -7.855  -8.909  1.00 22.42 ? 3   DA  C C6    1 
ATOM   60   N N6    . DA  A 1 3   ? -6.410  -7.025  -9.819  1.00 18.72 ? 3   DA  C N6    1 
ATOM   61   N N1    . DA  A 1 3   ? -6.104  -8.247  -7.900  1.00 22.98 ? 3   DA  C N1    1 
ATOM   62   C C2    . DA  A 1 3   ? -6.598  -9.072  -6.972  1.00 24.97 ? 3   DA  C C2    1 
ATOM   63   N N3    . DA  A 1 3   ? -7.818  -9.600  -6.872  1.00 25.87 ? 3   DA  C N3    1 
ATOM   64   C C4    . DA  A 1 3   ? -8.597  -9.200  -7.893  1.00 23.03 ? 3   DA  C C4    1 
ATOM   65   H H61   . DA  A 1 3   ? -6.983  -6.724  -10.597 1.00 0.00  ? 3   DA  C H61   1 
ATOM   66   H H62   . DA  A 1 3   ? -5.455  -6.703  -9.751  1.00 0.00  ? 3   DA  C H62   1 
ATOM   67   P P     . DG  A 1 4   ? -14.113 -10.864 -4.852  1.00 31.04 ? 4   DG  C P     1 
ATOM   68   O OP1   . DG  A 1 4   ? -14.857 -11.815 -4.018  1.00 33.08 ? 4   DG  C OP1   1 
ATOM   69   O OP2   . DG  A 1 4   ? -14.836 -9.955  -5.788  1.00 29.85 ? 4   DG  C OP2   1 
ATOM   70   O "O5'" . DG  A 1 4   ? -13.180 -9.953  -3.932  1.00 27.98 ? 4   DG  C "O5'" 1 
ATOM   71   C "C5'" . DG  A 1 4   ? -12.104 -10.545 -3.193  1.00 25.12 ? 4   DG  C "C5'" 1 
ATOM   72   C "C4'" . DG  A 1 4   ? -11.182 -9.483  -2.649  1.00 20.21 ? 4   DG  C "C4'" 1 
ATOM   73   O "O4'" . DG  A 1 4   ? -10.427 -8.896  -3.727  1.00 19.94 ? 4   DG  C "O4'" 1 
ATOM   74   C "C3'" . DG  A 1 4   ? -11.870 -8.329  -1.918  1.00 20.83 ? 4   DG  C "C3'" 1 
ATOM   75   O "O3'" . DG  A 1 4   ? -11.007 -7.882  -0.872  1.00 23.78 ? 4   DG  C "O3'" 1 
ATOM   76   C "C2'" . DG  A 1 4   ? -11.860 -7.229  -2.965  1.00 20.64 ? 4   DG  C "C2'" 1 
ATOM   77   C "C1'" . DG  A 1 4   ? -10.503 -7.495  -3.589  1.00 21.85 ? 4   DG  C "C1'" 1 
ATOM   78   N N9    . DG  A 1 4   ? -10.248 -6.880  -4.889  1.00 24.37 ? 4   DG  C N9    1 
ATOM   79   C C8    . DG  A 1 4   ? -11.155 -6.624  -5.895  1.00 23.23 ? 4   DG  C C8    1 
ATOM   80   N N7    . DG  A 1 4   ? -10.633 -5.964  -6.897  1.00 23.69 ? 4   DG  C N7    1 
ATOM   81   C C5    . DG  A 1 4   ? -9.300  -5.792  -6.541  1.00 22.45 ? 4   DG  C C5    1 
ATOM   82   C C6    . DG  A 1 4   ? -8.245  -5.121  -7.212  1.00 23.99 ? 4   DG  C C6    1 
ATOM   83   O O6    . DG  A 1 4   ? -8.285  -4.503  -8.269  1.00 23.32 ? 4   DG  C O6    1 
ATOM   84   N N1    . DG  A 1 4   ? -7.051  -5.199  -6.504  1.00 21.17 ? 4   DG  C N1    1 
ATOM   85   C C2    . DG  A 1 4   ? -6.894  -5.823  -5.302  1.00 21.43 ? 4   DG  C C2    1 
ATOM   86   N N2    . DG  A 1 4   ? -5.682  -5.780  -4.788  1.00 18.19 ? 4   DG  C N2    1 
ATOM   87   N N3    . DG  A 1 4   ? -7.866  -6.441  -4.653  1.00 21.96 ? 4   DG  C N3    1 
ATOM   88   C C4    . DG  A 1 4   ? -9.038  -6.382  -5.323  1.00 22.99 ? 4   DG  C C4    1 
ATOM   89   H H1    . DG  A 1 4   ? -6.238  -4.755  -6.909  1.00 0.00  ? 4   DG  C H1    1 
ATOM   90   H H21   . DG  A 1 4   ? -5.498  -6.234  -3.902  1.00 0.00  ? 4   DG  C H21   1 
ATOM   91   H H22   . DG  A 1 4   ? -4.930  -5.295  -5.257  1.00 0.00  ? 4   DG  C H22   1 
ATOM   92   P P     . DA  A 1 5   ? -11.302 -8.223  0.691   1.00 19.37 ? 5   DA  C P     1 
ATOM   93   O OP1   . DA  A 1 5   ? -10.759 -9.559  0.863   1.00 16.46 ? 5   DA  C OP1   1 
ATOM   94   O OP2   . DA  A 1 5   ? -12.687 -7.953  1.124   1.00 20.24 ? 5   DA  C OP2   1 
ATOM   95   O "O5'" . DA  A 1 5   ? -10.368 -7.098  1.344   1.00 21.82 ? 5   DA  C "O5'" 1 
ATOM   96   C "C5'" . DA  A 1 5   ? -8.972  -7.345  1.513   1.00 28.19 ? 5   DA  C "C5'" 1 
ATOM   97   C "C4'" . DA  A 1 5   ? -8.119  -6.113  1.272   1.00 28.41 ? 5   DA  C "C4'" 1 
ATOM   98   O "O4'" . DA  A 1 5   ? -7.731  -5.978  -0.122  1.00 27.60 ? 5   DA  C "O4'" 1 
ATOM   99   C "C3'" . DA  A 1 5   ? -8.563  -4.730  1.762   1.00 27.39 ? 5   DA  C "C3'" 1 
ATOM   100  O "O3'" . DA  A 1 5   ? -7.788  -4.281  2.877   1.00 26.77 ? 5   DA  C "O3'" 1 
ATOM   101  C "C2'" . DA  A 1 5   ? -8.186  -3.811  0.616   1.00 30.88 ? 5   DA  C "C2'" 1 
ATOM   102  C "C1'" . DA  A 1 5   ? -7.364  -4.635  -0.365  1.00 28.02 ? 5   DA  C "C1'" 1 
ATOM   103  N N9    . DA  A 1 5   ? -7.873  -4.247  -1.683  1.00 26.03 ? 5   DA  C N9    1 
ATOM   104  C C8    . DA  A 1 5   ? -9.144  -4.462  -2.138  1.00 21.80 ? 5   DA  C C8    1 
ATOM   105  N N7    . DA  A 1 5   ? -9.416  -3.847  -3.256  1.00 19.43 ? 5   DA  C N7    1 
ATOM   106  C C5    . DA  A 1 5   ? -8.229  -3.220  -3.591  1.00 21.55 ? 5   DA  C C5    1 
ATOM   107  C C6    . DA  A 1 5   ? -7.877  -2.384  -4.663  1.00 20.81 ? 5   DA  C C6    1 
ATOM   108  N N6    . DA  A 1 5   ? -8.721  -2.042  -5.636  1.00 21.14 ? 5   DA  C N6    1 
ATOM   109  N N1    . DA  A 1 5   ? -6.621  -1.902  -4.700  1.00 21.60 ? 5   DA  C N1    1 
ATOM   110  C C2    . DA  A 1 5   ? -5.779  -2.252  -3.728  1.00 23.75 ? 5   DA  C C2    1 
ATOM   111  N N3    . DA  A 1 5   ? -5.986  -3.038  -2.670  1.00 25.31 ? 5   DA  C N3    1 
ATOM   112  C C4    . DA  A 1 5   ? -7.253  -3.492  -2.655  1.00 24.66 ? 5   DA  C C4    1 
ATOM   113  H H61   . DA  A 1 5   ? -9.670  -2.390  -5.628  1.00 0.00  ? 5   DA  C H61   1 
ATOM   114  H H62   . DA  A 1 5   ? -8.420  -1.435  -6.386  1.00 0.00  ? 5   DA  C H62   1 
ATOM   115  P P     . DT  A 1 6   ? -8.007  -2.799  3.485   1.00 20.85 ? 6   DT  C P     1 
ATOM   116  O OP1   . DT  A 1 6   ? -7.866  -2.947  4.972   1.00 30.06 ? 6   DT  C OP1   1 
ATOM   117  O OP2   . DT  A 1 6   ? -9.157  -2.052  2.942   1.00 23.99 ? 6   DT  C OP2   1 
ATOM   118  O "O5'" . DT  A 1 6   ? -6.775  -1.956  2.919   1.00 24.84 ? 6   DT  C "O5'" 1 
ATOM   119  C "C5'" . DT  A 1 6   ? -5.423  -2.435  3.004   1.00 21.40 ? 6   DT  C "C5'" 1 
ATOM   120  C "C4'" . DT  A 1 6   ? -4.482  -1.312  2.653   1.00 24.51 ? 6   DT  C "C4'" 1 
ATOM   121  O "O4'" . DT  A 1 6   ? -4.602  -1.024  1.248   1.00 23.94 ? 6   DT  C "O4'" 1 
ATOM   122  C "C3'" . DT  A 1 6   ? -4.825  -0.018  3.373   1.00 27.53 ? 6   DT  C "C3'" 1 
ATOM   123  O "O3'" . DT  A 1 6   ? -3.657  0.690   3.725   1.00 35.65 ? 6   DT  C "O3'" 1 
ATOM   124  C "C2'" . DT  A 1 6   ? -5.588  0.772   2.338   1.00 29.24 ? 6   DT  C "C2'" 1 
ATOM   125  C "C1'" . DT  A 1 6   ? -4.980  0.314   1.040   1.00 28.36 ? 6   DT  C "C1'" 1 
ATOM   126  N N1    . DT  A 1 6   ? -5.948  0.336   -0.074  1.00 31.03 ? 6   DT  C N1    1 
ATOM   127  C C2    . DT  A 1 6   ? -5.647  1.048   -1.224  1.00 33.30 ? 6   DT  C C2    1 
ATOM   128  O O2    . DT  A 1 6   ? -4.604  1.677   -1.378  1.00 34.61 ? 6   DT  C O2    1 
ATOM   129  N N3    . DT  A 1 6   ? -6.631  1.002   -2.197  1.00 33.08 ? 6   DT  C N3    1 
ATOM   130  C C4    . DT  A 1 6   ? -7.855  0.357   -2.124  1.00 32.42 ? 6   DT  C C4    1 
ATOM   131  O O4    . DT  A 1 6   ? -8.647  0.427   -3.060  1.00 30.71 ? 6   DT  C O4    1 
ATOM   132  C C5    . DT  A 1 6   ? -8.095  -0.361  -0.890  1.00 32.37 ? 6   DT  C C5    1 
ATOM   133  C C7    . DT  A 1 6   ? -9.394  -1.083  -0.712  1.00 29.88 ? 6   DT  C C7    1 
ATOM   134  C C6    . DT  A 1 6   ? -7.139  -0.343  0.051   1.00 31.88 ? 6   DT  C C6    1 
ATOM   135  H H3    . DT  A 1 6   ? -6.421  1.472   -3.061  1.00 0.00  ? 6   DT  C H3    1 
ATOM   136  O "O5'" . DA  A 1 7   ? -6.254  3.044   1.706   1.00 50.50 ? 7   DA  C "O5'" 1 
ATOM   137  C "C5'" . DA  A 1 7   ? -5.036  3.818   1.572   1.00 49.66 ? 7   DA  C "C5'" 1 
ATOM   138  C "C4'" . DA  A 1 7   ? -5.385  5.235   1.197   1.00 50.08 ? 7   DA  C "C4'" 1 
ATOM   139  O "O4'" . DA  A 1 7   ? -5.965  5.199   -0.141  1.00 50.62 ? 7   DA  C "O4'" 1 
ATOM   140  C "C3'" . DA  A 1 7   ? -6.472  5.780   2.126   1.00 48.68 ? 7   DA  C "C3'" 1 
ATOM   141  O "O3'" . DA  A 1 7   ? -6.314  7.147   2.482   1.00 45.71 ? 7   DA  C "O3'" 1 
ATOM   142  C "C2'" . DA  A 1 7   ? -7.753  5.629   1.331   1.00 50.18 ? 7   DA  C "C2'" 1 
ATOM   143  C "C1'" . DA  A 1 7   ? -7.295  5.703   -0.113  1.00 50.81 ? 7   DA  C "C1'" 1 
ATOM   144  N N9    . DA  A 1 7   ? -8.143  4.844   -0.938  1.00 50.22 ? 7   DA  C N9    1 
ATOM   145  C C8    . DA  A 1 7   ? -8.696  3.627   -0.597  1.00 48.88 ? 7   DA  C C8    1 
ATOM   146  N N7    . DA  A 1 7   ? -9.554  3.171   -1.478  1.00 47.11 ? 7   DA  C N7    1 
ATOM   147  C C5    . DA  A 1 7   ? -9.533  4.130   -2.483  1.00 47.65 ? 7   DA  C C5    1 
ATOM   148  C C6    . DA  A 1 7   ? -10.242 4.252   -3.683  1.00 46.20 ? 7   DA  C C6    1 
ATOM   149  N N6    . DA  A 1 7   ? -11.167 3.381   -4.079  1.00 44.90 ? 7   DA  C N6    1 
ATOM   150  N N1    . DA  A 1 7   ? -9.974  5.320   -4.464  1.00 45.82 ? 7   DA  C N1    1 
ATOM   151  C C2    . DA  A 1 7   ? -9.062  6.210   -4.047  1.00 48.32 ? 7   DA  C C2    1 
ATOM   152  N N3    . DA  A 1 7   ? -8.348  6.220   -2.934  1.00 50.11 ? 7   DA  C N3    1 
ATOM   153  C C4    . DA  A 1 7   ? -8.635  5.142   -2.182  1.00 49.60 ? 7   DA  C C4    1 
ATOM   154  H H61   . DA  A 1 7   ? -11.381 2.575   -3.511  1.00 0.00  ? 7   DA  C H61   1 
ATOM   155  H H62   . DA  A 1 7   ? -11.656 3.531   -4.952  1.00 0.00  ? 7   DA  C H62   1 
ATOM   156  P P     . DT  A 1 8   ? -7.530  7.895   3.216   1.00 42.11 ? 8   DT  C P     1 
ATOM   157  O OP1   . DT  A 1 8   ? -7.053  8.898   4.223   1.00 42.13 ? 8   DT  C OP1   1 
ATOM   158  O OP2   . DT  A 1 8   ? -8.507  6.853   3.608   1.00 44.63 ? 8   DT  C OP2   1 
ATOM   159  O "O5'" . DT  A 1 8   ? -8.234  8.691   2.047   1.00 41.62 ? 8   DT  C "O5'" 1 
ATOM   160  C "C5'" . DT  A 1 8   ? -9.330  9.526   2.337   1.00 32.31 ? 8   DT  C "C5'" 1 
ATOM   161  C "C4'" . DT  A 1 8   ? -9.697  10.338  1.122   1.00 24.91 ? 8   DT  C "C4'" 1 
ATOM   162  O "O4'" . DT  A 1 8   ? -9.990  9.452   0.006   1.00 22.47 ? 8   DT  C "O4'" 1 
ATOM   163  C "C3'" . DT  A 1 8   ? -10.969 11.122  1.383   1.00 21.53 ? 8   DT  C "C3'" 1 
ATOM   164  O "O3'" . DT  A 1 8   ? -10.850 12.414  0.808   1.00 20.94 ? 8   DT  C "O3'" 1 
ATOM   165  C "C2'" . DT  A 1 8   ? -12.050 10.243  0.786   1.00 20.28 ? 8   DT  C "C2'" 1 
ATOM   166  C "C1'" . DT  A 1 8   ? -11.346 9.569   -0.374  1.00 17.95 ? 8   DT  C "C1'" 1 
ATOM   167  N N1    . DT  A 1 8   ? -11.842 8.215   -0.691  1.00 17.18 ? 8   DT  C N1    1 
ATOM   168  C C2    . DT  A 1 8   ? -12.495 8.016   -1.900  1.00 15.18 ? 8   DT  C C2    1 
ATOM   169  O O2    . DT  A 1 8   ? -12.614 8.872   -2.741  1.00 18.47 ? 8   DT  C O2    1 
ATOM   170  N N3    . DT  A 1 8   ? -12.985 6.761   -2.083  1.00 12.78 ? 8   DT  C N3    1 
ATOM   171  C C4    . DT  A 1 8   ? -12.857 5.692   -1.226  1.00 16.38 ? 8   DT  C C4    1 
ATOM   172  O O4    . DT  A 1 8   ? -13.359 4.627   -1.507  1.00 15.17 ? 8   DT  C O4    1 
ATOM   173  C C5    . DT  A 1 8   ? -12.116 5.947   -0.019  1.00 17.01 ? 8   DT  C C5    1 
ATOM   174  C C7    . DT  A 1 8   ? -11.871 4.807   0.926   1.00 18.06 ? 8   DT  C C7    1 
ATOM   175  C C6    . DT  A 1 8   ? -11.667 7.186   0.195   1.00 12.54 ? 8   DT  C C6    1 
ATOM   176  H H3    . DT  A 1 8   ? -13.483 6.593   -2.948  1.00 0.00  ? 8   DT  C H3    1 
ATOM   177  P P     . DC  A 1 9   ? -11.981 13.504  1.071   1.00 20.33 ? 9   DC  C P     1 
ATOM   178  O OP1   . DC  A 1 9   ? -11.384 14.850  1.086   1.00 24.23 ? 9   DC  C OP1   1 
ATOM   179  O OP2   . DC  A 1 9   ? -12.798 13.068  2.229   1.00 27.30 ? 9   DC  C OP2   1 
ATOM   180  O "O5'" . DC  A 1 9   ? -12.861 13.366  -0.245  1.00 26.47 ? 9   DC  C "O5'" 1 
ATOM   181  C "C5'" . DC  A 1 9   ? -12.222 13.162  -1.506  1.00 23.55 ? 9   DC  C "C5'" 1 
ATOM   182  C "C4'" . DC  A 1 9   ? -13.249 13.001  -2.598  1.00 20.93 ? 9   DC  C "C4'" 1 
ATOM   183  O "O4'" . DC  A 1 9   ? -13.707 11.641  -2.717  1.00 16.36 ? 9   DC  C "O4'" 1 
ATOM   184  C "C3'" . DC  A 1 9   ? -14.483 13.874  -2.459  1.00 21.06 ? 9   DC  C "C3'" 1 
ATOM   185  O "O3'" . DC  A 1 9   ? -14.700 14.526  -3.699  1.00 26.82 ? 9   DC  C "O3'" 1 
ATOM   186  C "C2'" . DC  A 1 9   ? -15.588 12.883  -2.169  1.00 19.85 ? 9   DC  C "C2'" 1 
ATOM   187  C "C1'" . DC  A 1 9   ? -15.115 11.610  -2.833  1.00 17.22 ? 9   DC  C "C1'" 1 
ATOM   188  N N1    . DC  A 1 9   ? -15.581 10.372  -2.173  1.00 19.39 ? 9   DC  C N1    1 
ATOM   189  C C2    . DC  A 1 9   ? -16.235 9.400   -2.925  1.00 16.55 ? 9   DC  C C2    1 
ATOM   190  O O2    . DC  A 1 9   ? -16.467 9.617   -4.114  1.00 18.40 ? 9   DC  C O2    1 
ATOM   191  N N3    . DC  A 1 9   ? -16.608 8.237   -2.333  1.00 16.27 ? 9   DC  C N3    1 
ATOM   192  C C4    . DC  A 1 9   ? -16.369 8.041   -1.034  1.00 15.26 ? 9   DC  C C4    1 
ATOM   193  N N4    . DC  A 1 9   ? -16.738 6.877   -0.504  1.00 12.96 ? 9   DC  C N4    1 
ATOM   194  C C5    . DC  A 1 9   ? -15.736 9.029   -0.231  1.00 13.70 ? 9   DC  C C5    1 
ATOM   195  C C6    . DC  A 1 9   ? -15.358 10.170  -0.836  1.00 19.38 ? 9   DC  C C6    1 
ATOM   196  H H41   . DC  A 1 9   ? -16.587 6.701   0.480   1.00 0.00  ? 9   DC  C H41   1 
ATOM   197  H H42   . DC  A 1 9   ? -17.166 6.167   -1.079  1.00 0.00  ? 9   DC  C H42   1 
ATOM   198  P P     . DT  A 1 10  ? -15.596 15.863  -3.766  1.00 30.37 ? 10  DT  C P     1 
ATOM   199  O OP1   . DT  A 1 10  ? -14.741 16.916  -4.401  1.00 33.61 ? 10  DT  C OP1   1 
ATOM   200  O OP2   . DT  A 1 10  ? -16.311 16.154  -2.470  1.00 27.46 ? 10  DT  C OP2   1 
ATOM   201  O "O5'" . DT  A 1 10  ? -16.679 15.444  -4.852  1.00 35.29 ? 10  DT  C "O5'" 1 
ATOM   202  C "C5'" . DT  A 1 10  ? -18.066 15.509  -4.565  1.00 36.71 ? 10  DT  C "C5'" 1 
ATOM   203  C "C4'" . DT  A 1 10  ? -18.809 14.537  -5.444  1.00 33.40 ? 10  DT  C "C4'" 1 
ATOM   204  O "O4'" . DT  A 1 10  ? -18.686 13.167  -4.980  1.00 31.00 ? 10  DT  C "O4'" 1 
ATOM   205  C "C3'" . DT  A 1 10  ? -20.300 14.836  -5.470  1.00 36.74 ? 10  DT  C "C3'" 1 
ATOM   206  O "O3'" . DT  A 1 10  ? -20.752 14.580  -6.803  1.00 44.63 ? 10  DT  C "O3'" 1 
ATOM   207  C "C2'" . DT  A 1 10  ? -20.872 13.860  -4.457  1.00 30.19 ? 10  DT  C "C2'" 1 
ATOM   208  C "C1'" . DT  A 1 10  ? -19.983 12.655  -4.665  1.00 26.69 ? 10  DT  C "C1'" 1 
ATOM   209  N N1    . DT  A 1 10  ? -19.858 11.784  -3.487  1.00 23.26 ? 10  DT  C N1    1 
ATOM   210  C C2    . DT  A 1 10  ? -20.214 10.487  -3.650  1.00 20.41 ? 10  DT  C C2    1 
ATOM   211  O O2    . DT  A 1 10  ? -20.602 10.057  -4.703  1.00 22.10 ? 10  DT  C O2    1 
ATOM   212  N N3    . DT  A 1 10  ? -20.091 9.699   -2.532  1.00 18.96 ? 10  DT  C N3    1 
ATOM   213  C C4    . DT  A 1 10  ? -19.641 10.080  -1.298  1.00 18.10 ? 10  DT  C C4    1 
ATOM   214  O O4    . DT  A 1 10  ? -19.589 9.261   -0.394  1.00 23.45 ? 10  DT  C O4    1 
ATOM   215  C C5    . DT  A 1 10  ? -19.258 11.470  -1.191  1.00 20.69 ? 10  DT  C C5    1 
ATOM   216  C C7    . DT  A 1 10  ? -18.712 11.971  0.109   1.00 18.94 ? 10  DT  C C7    1 
ATOM   217  C C6    . DT  A 1 10  ? -19.398 12.251  -2.278  1.00 19.90 ? 10  DT  C C6    1 
ATOM   218  H H3    . DT  A 1 10  ? -20.364 8.731   -2.632  1.00 0.00  ? 10  DT  C H3    1 
ATOM   219  P P     . DT  A 1 11  ? -21.598 15.700  -7.594  1.00 51.02 ? 11  DT  C P     1 
ATOM   220  O OP1   . DT  A 1 11  ? -20.690 16.319  -8.610  1.00 46.73 ? 11  DT  C OP1   1 
ATOM   221  O OP2   . DT  A 1 11  ? -22.239 16.560  -6.539  1.00 47.18 ? 11  DT  C OP2   1 
ATOM   222  O "O5'" . DT  A 1 11  ? -22.707 14.815  -8.343  1.00 50.49 ? 11  DT  C "O5'" 1 
ATOM   223  C "C5'" . DT  A 1 11  ? -22.984 13.462  -7.896  1.00 49.63 ? 11  DT  C "C5'" 1 
ATOM   224  C "C4'" . DT  A 1 11  ? -24.314 13.416  -7.181  1.00 49.96 ? 11  DT  C "C4'" 1 
ATOM   225  O "O4'" . DT  A 1 11  ? -24.217 12.473  -6.079  1.00 47.67 ? 11  DT  C "O4'" 1 
ATOM   226  C "C3'" . DT  A 1 11  ? -24.739 14.752  -6.550  1.00 50.70 ? 11  DT  C "C3'" 1 
ATOM   227  O "O3'" . DT  A 1 11  ? -26.147 14.985  -6.720  1.00 54.55 ? 11  DT  C "O3'" 1 
ATOM   228  C "C2'" . DT  A 1 11  ? -24.456 14.555  -5.076  1.00 48.50 ? 11  DT  C "C2'" 1 
ATOM   229  C "C1'" . DT  A 1 11  ? -24.747 13.082  -4.913  1.00 46.31 ? 11  DT  C "C1'" 1 
ATOM   230  N N1    . DT  A 1 11  ? -24.080 12.514  -3.730  1.00 44.01 ? 11  DT  C N1    1 
ATOM   231  C C2    . DT  A 1 11  ? -24.184 11.168  -3.434  1.00 41.90 ? 11  DT  C C2    1 
ATOM   232  O O2    . DT  A 1 11  ? -24.775 10.360  -4.130  1.00 39.85 ? 11  DT  C O2    1 
ATOM   233  N N3    . DT  A 1 11  ? -23.565 10.800  -2.266  1.00 39.57 ? 11  DT  C N3    1 
ATOM   234  C C4    . DT  A 1 11  ? -22.884 11.612  -1.388  1.00 40.44 ? 11  DT  C C4    1 
ATOM   235  O O4    . DT  A 1 11  ? -22.419 11.142  -0.349  1.00 43.14 ? 11  DT  C O4    1 
ATOM   236  C C5    . DT  A 1 11  ? -22.795 12.987  -1.776  1.00 41.11 ? 11  DT  C C5    1 
ATOM   237  C C7    . DT  A 1 11  ? -22.055 13.940  -0.895  1.00 46.36 ? 11  DT  C C7    1 
ATOM   238  C C6    . DT  A 1 11  ? -23.381 13.364  -2.911  1.00 43.04 ? 11  DT  C C6    1 
ATOM   239  H H3    . DT  A 1 11  ? -23.615 9.824   -2.015  1.00 0.00  ? 11  DT  C H3    1 
ATOM   240  O "O5'" . DA  B 1 1   ? -26.488 8.769   4.927   1.00 39.51 ? 1   DA  D "O5'" 1 
ATOM   241  C "C5'" . DA  B 1 1   ? -27.357 7.736   5.429   1.00 36.65 ? 1   DA  D "C5'" 1 
ATOM   242  C "C4'" . DA  B 1 1   ? -27.663 6.739   4.342   1.00 36.41 ? 1   DA  D "C4'" 1 
ATOM   243  O "O4'" . DA  B 1 1   ? -28.285 7.439   3.239   1.00 33.98 ? 1   DA  D "O4'" 1 
ATOM   244  C "C3'" . DA  B 1 1   ? -26.443 6.064   3.740   1.00 36.18 ? 1   DA  D "C3'" 1 
ATOM   245  O "O3'" . DA  B 1 1   ? -26.087 4.905   4.512   1.00 38.42 ? 1   DA  D "O3'" 1 
ATOM   246  C "C2'" . DA  B 1 1   ? -26.878 5.743   2.314   1.00 38.12 ? 1   DA  D "C2'" 1 
ATOM   247  C "C1'" . DA  B 1 1   ? -27.937 6.806   2.040   1.00 34.63 ? 1   DA  D "C1'" 1 
ATOM   248  N N9    . DA  B 1 1   ? -27.659 7.809   1.015   1.00 36.07 ? 1   DA  D N9    1 
ATOM   249  C C8    . DA  B 1 1   ? -28.145 7.764   -0.274  1.00 37.21 ? 1   DA  D C8    1 
ATOM   250  N N7    . DA  B 1 1   ? -27.836 8.813   -0.998  1.00 35.58 ? 1   DA  D N7    1 
ATOM   251  C C5    . DA  B 1 1   ? -27.086 9.596   -0.139  1.00 34.62 ? 1   DA  D C5    1 
ATOM   252  C C6    . DA  B 1 1   ? -26.505 10.846  -0.299  1.00 32.46 ? 1   DA  D C6    1 
ATOM   253  N N6    . DA  B 1 1   ? -26.637 11.575  -1.403  1.00 29.99 ? 1   DA  D N6    1 
ATOM   254  N N1    . DA  B 1 1   ? -25.795 11.342  0.735   1.00 31.33 ? 1   DA  D N1    1 
ATOM   255  C C2    . DA  B 1 1   ? -25.716 10.624  1.863   1.00 31.57 ? 1   DA  D C2    1 
ATOM   256  N N3    . DA  B 1 1   ? -26.252 9.445   2.149   1.00 32.64 ? 1   DA  D N3    1 
ATOM   257  C C4    . DA  B 1 1   ? -26.936 8.975   1.097   1.00 34.43 ? 1   DA  D C4    1 
ATOM   258  H H61   . DA  B 1 1   ? -27.173 11.217  -2.181  1.00 0.00  ? 1   DA  D H61   1 
ATOM   259  H H62   . DA  B 1 1   ? -26.218 12.493  -1.460  1.00 0.00  ? 1   DA  D H62   1 
ATOM   260  P P     . DA  B 1 2   ? -26.863 3.497   4.295   1.00 38.69 ? 2   DA  D P     1 
ATOM   261  O OP1   . DA  B 1 2   ? -28.294 3.772   4.550   1.00 42.31 ? 2   DA  D OP1   1 
ATOM   262  O OP2   . DA  B 1 2   ? -26.143 2.498   5.123   1.00 41.30 ? 2   DA  D OP2   1 
ATOM   263  O "O5'" . DA  B 1 2   ? -26.674 3.082   2.754   1.00 39.03 ? 2   DA  D "O5'" 1 
ATOM   264  C "C5'" . DA  B 1 2   ? -27.776 2.530   1.948   1.00 32.95 ? 2   DA  D "C5'" 1 
ATOM   265  C "C4'" . DA  B 1 2   ? -27.425 2.544   0.450   1.00 31.51 ? 2   DA  D "C4'" 1 
ATOM   266  O "O4'" . DA  B 1 2   ? -27.225 3.915   0.019   1.00 28.50 ? 2   DA  D "O4'" 1 
ATOM   267  C "C3'" . DA  B 1 2   ? -26.143 1.813   0.048   1.00 32.29 ? 2   DA  D "C3'" 1 
ATOM   268  O "O3'" . DA  B 1 2   ? -26.369 0.420   -0.196  1.00 36.09 ? 2   DA  D "O3'" 1 
ATOM   269  C "C2'" . DA  B 1 2   ? -25.618 2.579   -1.146  1.00 30.40 ? 2   DA  D "C2'" 1 
ATOM   270  C "C1'" . DA  B 1 2   ? -26.114 3.989   -0.861  1.00 26.89 ? 2   DA  D "C1'" 1 
ATOM   271  N N9    . DA  B 1 2   ? -25.138 4.918   -0.304  1.00 24.90 ? 2   DA  D N9    1 
ATOM   272  C C8    . DA  B 1 2   ? -24.422 4.831   0.862   1.00 24.31 ? 2   DA  D C8    1 
ATOM   273  N N7    . DA  B 1 2   ? -23.722 5.907   1.128   1.00 24.34 ? 2   DA  D N7    1 
ATOM   274  C C5    . DA  B 1 2   ? -23.963 6.737   0.045   1.00 22.17 ? 2   DA  D C5    1 
ATOM   275  C C6    . DA  B 1 2   ? -23.512 8.026   -0.282  1.00 25.87 ? 2   DA  D C6    1 
ATOM   276  N N6    . DA  B 1 2   ? -22.661 8.742   0.476   1.00 25.95 ? 2   DA  D N6    1 
ATOM   277  N N1    . DA  B 1 2   ? -23.960 8.568   -1.439  1.00 25.30 ? 2   DA  D N1    1 
ATOM   278  C C2    . DA  B 1 2   ? -24.781 7.848   -2.208  1.00 23.83 ? 2   DA  D C2    1 
ATOM   279  N N3    . DA  B 1 2   ? -25.253 6.632   -2.015  1.00 21.95 ? 2   DA  D N3    1 
ATOM   280  C C4    . DA  B 1 2   ? -24.809 6.128   -0.856  1.00 23.91 ? 2   DA  D C4    1 
ATOM   281  H H61   . DA  B 1 2   ? -22.303 8.340   1.333   1.00 0.00  ? 2   DA  D H61   1 
ATOM   282  H H62   . DA  B 1 2   ? -22.389 9.677   0.203   1.00 0.00  ? 2   DA  D H62   1 
ATOM   283  P P     . DA  B 1 3   ? -26.733 -0.133  -1.671  1.00 30.84 ? 3   DA  D P     1 
ATOM   284  O OP1   . DA  B 1 3   ? -28.128 0.238   -1.967  1.00 32.12 ? 3   DA  D OP1   1 
ATOM   285  O OP2   . DA  B 1 3   ? -26.330 -1.558  -1.640  1.00 30.60 ? 3   DA  D OP2   1 
ATOM   286  O "O5'" . DA  B 1 3   ? -25.791 0.577   -2.742  1.00 33.65 ? 3   DA  D "O5'" 1 
ATOM   287  C "C5'" . DA  B 1 3   ? -26.310 0.922   -4.050  1.00 28.20 ? 3   DA  D "C5'" 1 
ATOM   288  C "C4'" . DA  B 1 3   ? -25.298 1.723   -4.830  1.00 26.70 ? 3   DA  D "C4'" 1 
ATOM   289  O "O4'" . DA  B 1 3   ? -24.789 2.807   -4.038  1.00 26.38 ? 3   DA  D "O4'" 1 
ATOM   290  C "C3'" . DA  B 1 3   ? -24.081 0.971   -5.346  1.00 27.38 ? 3   DA  D "C3'" 1 
ATOM   291  O "O3'" . DA  B 1 3   ? -24.506 0.670   -6.669  1.00 29.63 ? 3   DA  D "O3'" 1 
ATOM   292  C "C2'" . DA  B 1 3   ? -22.980 2.030   -5.410  1.00 26.00 ? 3   DA  D "C2'" 1 
ATOM   293  C "C1'" . DA  B 1 3   ? -23.513 3.146   -4.507  1.00 25.46 ? 3   DA  D "C1'" 1 
ATOM   294  N N9    . DA  B 1 3   ? -22.684 3.539   -3.377  1.00 22.38 ? 3   DA  D N9    1 
ATOM   295  C C8    . DA  B 1 3   ? -22.240 2.841   -2.276  1.00 18.90 ? 3   DA  D C8    1 
ATOM   296  N N7    . DA  B 1 3   ? -21.532 3.562   -1.450  1.00 16.21 ? 3   DA  D N7    1 
ATOM   297  C C5    . DA  B 1 3   ? -21.497 4.814   -2.047  1.00 17.00 ? 3   DA  D C5    1 
ATOM   298  C C6    . DA  B 1 3   ? -20.894 6.020   -1.681  1.00 19.98 ? 3   DA  D C6    1 
ATOM   299  N N6    . DA  B 1 3   ? -20.176 6.184   -0.561  1.00 20.63 ? 3   DA  D N6    1 
ATOM   300  N N1    . DA  B 1 3   ? -21.048 7.082   -2.521  1.00 21.00 ? 3   DA  D N1    1 
ATOM   301  C C2    . DA  B 1 3   ? -21.756 6.914   -3.653  1.00 18.74 ? 3   DA  D C2    1 
ATOM   302  N N3    . DA  B 1 3   ? -22.360 5.828   -4.103  1.00 19.72 ? 3   DA  D N3    1 
ATOM   303  C C4    . DA  B 1 3   ? -22.193 4.807   -3.241  1.00 19.89 ? 3   DA  D C4    1 
ATOM   304  H H61   . DA  B 1 3   ? -20.050 5.411   0.076   1.00 0.00  ? 3   DA  D H61   1 
ATOM   305  H H62   . DA  B 1 3   ? -19.772 7.085   -0.345  1.00 0.00  ? 3   DA  D H62   1 
ATOM   306  P P     . DG  B 1 4   ? -23.557 -0.106  -7.686  1.00 25.40 ? 4   DG  D P     1 
ATOM   307  O OP1   . DG  B 1 4   ? -24.463 -0.350  -8.828  1.00 33.67 ? 4   DG  D OP1   1 
ATOM   308  O OP2   . DG  B 1 4   ? -22.876 -1.231  -7.027  1.00 30.38 ? 4   DG  D OP2   1 
ATOM   309  O "O5'" . DG  B 1 4   ? -22.470 0.955   -8.129  1.00 28.27 ? 4   DG  D "O5'" 1 
ATOM   310  C "C5'" . DG  B 1 4   ? -22.818 2.111   -8.891  1.00 23.50 ? 4   DG  D "C5'" 1 
ATOM   311  C "C4'" . DG  B 1 4   ? -21.685 3.086   -8.817  1.00 22.81 ? 4   DG  D "C4'" 1 
ATOM   312  O "O4'" . DG  B 1 4   ? -21.350 3.312   -7.438  1.00 21.70 ? 4   DG  D "O4'" 1 
ATOM   313  C "C3'" . DG  B 1 4   ? -20.398 2.680   -9.544  1.00 21.66 ? 4   DG  D "C3'" 1 
ATOM   314  O "O3'" . DG  B 1 4   ? -20.302 3.790   -10.433 1.00 25.68 ? 4   DG  D "O3'" 1 
ATOM   315  C "C2'" . DG  B 1 4   ? -19.274 2.936   -8.525  1.00 23.31 ? 4   DG  D "C2'" 1 
ATOM   316  C "C1'" . DG  B 1 4   ? -20.002 3.630   -7.377  1.00 18.15 ? 4   DG  D "C1'" 1 
ATOM   317  N N9    . DG  B 1 4   ? -19.505 3.524   -6.020  1.00 16.14 ? 4   DG  D N9    1 
ATOM   318  C C8    . DG  B 1 4   ? -19.404 2.417   -5.215  1.00 14.96 ? 4   DG  D C8    1 
ATOM   319  N N7    . DG  B 1 4   ? -18.882 2.690   -4.051  1.00 13.17 ? 4   DG  D N7    1 
ATOM   320  C C5    . DG  B 1 4   ? -18.634 4.056   -4.099  1.00 14.67 ? 4   DG  D C5    1 
ATOM   321  C C6    . DG  B 1 4   ? -18.053 4.939   -3.140  1.00 15.11 ? 4   DG  D C6    1 
ATOM   322  O O6    . DG  B 1 4   ? -17.621 4.679   -2.020  1.00 16.31 ? 4   DG  D O6    1 
ATOM   323  N N1    . DG  B 1 4   ? -17.993 6.248   -3.616  1.00 15.35 ? 4   DG  D N1    1 
ATOM   324  C C2    . DG  B 1 4   ? -18.422 6.656   -4.851  1.00 12.96 ? 4   DG  D C2    1 
ATOM   325  N N2    . DG  B 1 4   ? -18.275 7.948   -5.151  1.00 15.69 ? 4   DG  D N2    1 
ATOM   326  N N3    . DG  B 1 4   ? -18.958 5.853   -5.739  1.00 14.68 ? 4   DG  D N3    1 
ATOM   327  C C4    . DG  B 1 4   ? -19.028 4.578   -5.303  1.00 14.75 ? 4   DG  D C4    1 
ATOM   328  H H1    . DG  B 1 4   ? -17.598 6.947   -3.004  1.00 0.00  ? 4   DG  D H1    1 
ATOM   329  H H21   . DG  B 1 4   ? -18.620 8.297   -6.034  1.00 0.00  ? 4   DG  D H21   1 
ATOM   330  H H22   . DG  B 1 4   ? -17.808 8.578   -4.514  1.00 0.00  ? 4   DG  D H22   1 
ATOM   331  P P     . DA  B 1 5   ? -19.914 3.620   -11.966 1.00 19.99 ? 5   DA  D P     1 
ATOM   332  O OP1   . DA  B 1 5   ? -21.139 4.009   -12.661 1.00 28.78 ? 5   DA  D OP1   1 
ATOM   333  O OP2   . DA  B 1 5   ? -19.267 2.339   -12.280 1.00 21.10 ? 5   DA  D OP2   1 
ATOM   334  O "O5'" . DA  B 1 5   ? -18.930 4.846   -12.191 1.00 21.13 ? 5   DA  D "O5'" 1 
ATOM   335  C "C5'" . DA  B 1 5   ? -17.532 4.778   -11.863 1.00 15.95 ? 5   DA  D "C5'" 1 
ATOM   336  C "C4'" . DA  B 1 5   ? -17.049 6.143   -11.423 1.00 15.32 ? 5   DA  D "C4'" 1 
ATOM   337  O "O4'" . DA  B 1 5   ? -17.583 6.416   -10.109 1.00 16.28 ? 5   DA  D "O4'" 1 
ATOM   338  C "C3'" . DA  B 1 5   ? -15.545 6.300   -11.289 1.00 16.34 ? 5   DA  D "C3'" 1 
ATOM   339  O "O3'" . DA  B 1 5   ? -15.074 6.749   -12.556 1.00 21.00 ? 5   DA  D "O3'" 1 
ATOM   340  C "C2'" . DA  B 1 5   ? -15.425 7.385   -10.225 1.00 15.59 ? 5   DA  D "C2'" 1 
ATOM   341  C "C1'" . DA  B 1 5   ? -16.596 7.025   -9.305  1.00 17.26 ? 5   DA  D "C1'" 1 
ATOM   342  N N9    . DA  B 1 5   ? -16.245 6.075   -8.244  1.00 18.59 ? 5   DA  D N9    1 
ATOM   343  C C8    . DA  B 1 5   ? -16.512 4.726   -8.205  1.00 18.89 ? 5   DA  D C8    1 
ATOM   344  N N7    . DA  B 1 5   ? -16.095 4.137   -7.106  1.00 17.80 ? 5   DA  D N7    1 
ATOM   345  C C5    . DA  B 1 5   ? -15.519 5.167   -6.370  1.00 17.02 ? 5   DA  D C5    1 
ATOM   346  C C6    . DA  B 1 5   ? -14.908 5.194   -5.097  1.00 16.18 ? 5   DA  D C6    1 
ATOM   347  N N6    . DA  B 1 5   ? -14.787 4.121   -4.318  1.00 14.79 ? 5   DA  D N6    1 
ATOM   348  N N1    . DA  B 1 5   ? -14.418 6.374   -4.662  1.00 18.56 ? 5   DA  D N1    1 
ATOM   349  C C2    . DA  B 1 5   ? -14.541 7.456   -5.455  1.00 16.80 ? 5   DA  D C2    1 
ATOM   350  N N3    . DA  B 1 5   ? -15.107 7.559   -6.656  1.00 16.92 ? 5   DA  D N3    1 
ATOM   351  C C4    . DA  B 1 5   ? -15.586 6.363   -7.062  1.00 17.40 ? 5   DA  D C4    1 
ATOM   352  H H61   . DA  B 1 5   ? -15.133 3.229   -4.638  1.00 0.00  ? 5   DA  D H61   1 
ATOM   353  H H62   . DA  B 1 5   ? -14.349 4.192   -3.410  1.00 0.00  ? 5   DA  D H62   1 
ATOM   354  P P     . DT  B 1 6   ? -13.540 6.498   -13.000 1.00 21.80 ? 6   DT  D P     1 
ATOM   355  O OP1   . DT  B 1 6   ? -13.427 6.886   -14.428 1.00 23.13 ? 6   DT  D OP1   1 
ATOM   356  O OP2   . DT  B 1 6   ? -13.123 5.135   -12.571 1.00 19.01 ? 6   DT  D OP2   1 
ATOM   357  O "O5'" . DT  B 1 6   ? -12.701 7.527   -12.122 1.00 22.34 ? 6   DT  D "O5'" 1 
ATOM   358  C "C5'" . DT  B 1 6   ? -12.722 8.953   -12.347 1.00 21.88 ? 6   DT  D "C5'" 1 
ATOM   359  C "C4'" . DT  B 1 6   ? -11.632 9.570   -11.514 1.00 28.39 ? 6   DT  D "C4'" 1 
ATOM   360  O "O4'" . DT  B 1 6   ? -11.946 9.300   -10.119 1.00 29.58 ? 6   DT  D "O4'" 1 
ATOM   361  C "C3'" . DT  B 1 6   ? -10.298 8.861   -11.736 1.00 31.00 ? 6   DT  D "C3'" 1 
ATOM   362  O "O3'" . DT  B 1 6   ? -9.566  9.476   -12.797 1.00 38.16 ? 6   DT  D "O3'" 1 
ATOM   363  C "C2'" . DT  B 1 6   ? -9.591  8.969   -10.391 1.00 31.77 ? 6   DT  D "C2'" 1 
ATOM   364  C "C1'" . DT  B 1 6   ? -10.764 8.956   -9.406  1.00 29.61 ? 6   DT  D "C1'" 1 
ATOM   365  N N1    . DT  B 1 6   ? -10.984 7.696   -8.640  1.00 26.96 ? 6   DT  D N1    1 
ATOM   366  C C2    . DT  B 1 6   ? -10.448 7.611   -7.364  1.00 27.98 ? 6   DT  D C2    1 
ATOM   367  O O2    . DT  B 1 6   ? -9.765  8.483   -6.855  1.00 29.85 ? 6   DT  D O2    1 
ATOM   368  N N3    . DT  B 1 6   ? -10.742 6.455   -6.694  1.00 23.37 ? 6   DT  D N3    1 
ATOM   369  C C4    . DT  B 1 6   ? -11.479 5.397   -7.140  1.00 23.67 ? 6   DT  D C4    1 
ATOM   370  O O4    . DT  B 1 6   ? -11.677 4.442   -6.397  1.00 20.98 ? 6   DT  D O4    1 
ATOM   371  C C5    . DT  B 1 6   ? -11.979 5.520   -8.488  1.00 25.12 ? 6   DT  D C5    1 
ATOM   372  C C7    . DT  B 1 6   ? -12.762 4.383   -9.066  1.00 26.77 ? 6   DT  D C7    1 
ATOM   373  C C6    . DT  B 1 6   ? -11.714 6.651   -9.167  1.00 25.87 ? 6   DT  D C6    1 
ATOM   374  H H3    . DT  B 1 6   ? -10.387 6.374   -5.757  1.00 0.00  ? 6   DT  D H3    1 
ATOM   375  O "O5'" . DA  B 1 7   ? -7.218  7.345   -10.627 1.00 41.77 ? 7   DA  D "O5'" 1 
ATOM   376  C "C5'" . DA  B 1 7   ? -6.174  8.281   -10.265 1.00 44.82 ? 7   DA  D "C5'" 1 
ATOM   377  C "C4'" . DA  B 1 7   ? -5.361  7.744   -9.103  1.00 45.65 ? 7   DA  D "C4'" 1 
ATOM   378  O "O4'" . DA  B 1 7   ? -6.248  7.530   -7.965  1.00 48.66 ? 7   DA  D "O4'" 1 
ATOM   379  C "C3'" . DA  B 1 7   ? -4.664  6.400   -9.309  1.00 45.23 ? 7   DA  D "C3'" 1 
ATOM   380  O "O3'" . DA  B 1 7   ? -3.380  6.575   -9.928  1.00 41.34 ? 7   DA  D "O3'" 1 
ATOM   381  C "C2'" . DA  B 1 7   ? -4.510  5.896   -7.873  1.00 48.41 ? 7   DA  D "C2'" 1 
ATOM   382  C "C1'" . DA  B 1 7   ? -5.793  6.418   -7.207  1.00 50.44 ? 7   DA  D "C1'" 1 
ATOM   383  N N9    . DA  B 1 7   ? -6.849  5.397   -7.162  1.00 53.01 ? 7   DA  D N9    1 
ATOM   384  C C8    . DA  B 1 7   ? -7.855  5.147   -8.069  1.00 54.62 ? 7   DA  D C8    1 
ATOM   385  N N7    . DA  B 1 7   ? -8.577  4.084   -7.781  1.00 53.39 ? 7   DA  D N7    1 
ATOM   386  C C5    . DA  B 1 7   ? -8.025  3.621   -6.595  1.00 52.35 ? 7   DA  D C5    1 
ATOM   387  C C6    . DA  B 1 7   ? -8.325  2.526   -5.782  1.00 50.56 ? 7   DA  D C6    1 
ATOM   388  N N6    . DA  B 1 7   ? -9.268  1.638   -6.059  1.00 50.56 ? 7   DA  D N6    1 
ATOM   389  N N1    . DA  B 1 7   ? -7.604  2.364   -4.661  1.00 49.87 ? 7   DA  D N1    1 
ATOM   390  C C2    . DA  B 1 7   ? -6.632  3.239   -4.392  1.00 50.49 ? 7   DA  D C2    1 
ATOM   391  N N3    . DA  B 1 7   ? -6.239  4.291   -5.080  1.00 52.05 ? 7   DA  D N3    1 
ATOM   392  C C4    . DA  B 1 7   ? -6.982  4.435   -6.187  1.00 52.85 ? 7   DA  D C4    1 
ATOM   393  H H61   . DA  B 1 7   ? -9.817  1.749   -6.898  1.00 0.00  ? 7   DA  D H61   1 
ATOM   394  H H62   . DA  B 1 7   ? -9.438  0.862   -5.436  1.00 0.00  ? 7   DA  D H62   1 
ATOM   395  P P     . DT  B 1 8   ? -2.776  5.417   -10.875 1.00 38.85 ? 8   DT  D P     1 
ATOM   396  O OP1   . DT  B 1 8   ? -1.566  5.900   -11.582 1.00 36.44 ? 8   DT  D OP1   1 
ATOM   397  O OP2   . DT  B 1 8   ? -3.906  4.835   -11.642 1.00 43.55 ? 8   DT  D OP2   1 
ATOM   398  O "O5'" . DT  B 1 8   ? -2.327  4.245   -9.894  1.00 36.31 ? 8   DT  D "O5'" 1 
ATOM   399  C "C5'" . DT  B 1 8   ? -1.140  4.323   -9.064  1.00 28.75 ? 8   DT  D "C5'" 1 
ATOM   400  C "C4'" . DT  B 1 8   ? -1.033  3.056   -8.261  1.00 21.58 ? 8   DT  D "C4'" 1 
ATOM   401  O "O4'" . DT  B 1 8   ? -2.366  2.750   -7.829  1.00 21.69 ? 8   DT  D "O4'" 1 
ATOM   402  C "C3'" . DT  B 1 8   ? -0.546  1.807   -8.994  1.00 22.30 ? 8   DT  D "C3'" 1 
ATOM   403  O "O3'" . DT  B 1 8   ? 0.803   1.681   -8.558  1.00 18.42 ? 8   DT  D "O3'" 1 
ATOM   404  C "C2'" . DT  B 1 8   ? -1.365  0.657   -8.402  1.00 22.46 ? 8   DT  D "C2'" 1 
ATOM   405  C "C1'" . DT  B 1 8   ? -2.471  1.375   -7.631  1.00 21.91 ? 8   DT  D "C1'" 1 
ATOM   406  N N1    . DT  B 1 8   ? -3.871  0.942   -7.801  1.00 22.64 ? 8   DT  D N1    1 
ATOM   407  C C2    . DT  B 1 8   ? -4.308  -0.038  -6.922  1.00 22.12 ? 8   DT  D C2    1 
ATOM   408  O O2    . DT  B 1 8   ? -3.594  -0.520  -6.050  1.00 17.85 ? 8   DT  D O2    1 
ATOM   409  N N3    . DT  B 1 8   ? -5.603  -0.416  -7.094  1.00 20.93 ? 8   DT  D N3    1 
ATOM   410  C C4    . DT  B 1 8   ? -6.495  0.075   -8.021  1.00 19.59 ? 8   DT  D C4    1 
ATOM   411  O O4    . DT  B 1 8   ? -7.624  -0.345  -8.046  1.00 21.34 ? 8   DT  D O4    1 
ATOM   412  C C5    . DT  B 1 8   ? -5.989  1.088   -8.912  1.00 21.05 ? 8   DT  D C5    1 
ATOM   413  C C7    . DT  B 1 8   ? -6.910  1.650   -9.955  1.00 19.66 ? 8   DT  D C7    1 
ATOM   414  C C6    . DT  B 1 8   ? -4.711  1.475   -8.763  1.00 20.84 ? 8   DT  D C6    1 
ATOM   415  H H3    . DT  B 1 8   ? -5.951  -1.128  -6.466  1.00 0.00  ? 8   DT  D H3    1 
ATOM   416  P P     . DC  B 1 9   ? 1.667   0.371   -8.892  1.00 18.57 ? 9   DC  D P     1 
ATOM   417  O OP1   . DC  B 1 9   ? 3.088   0.765   -8.672  1.00 23.19 ? 9   DC  D OP1   1 
ATOM   418  O OP2   . DC  B 1 9   ? 1.288   -0.223  -10.200 1.00 25.32 ? 9   DC  D OP2   1 
ATOM   419  O "O5'" . DC  B 1 9   ? 1.271   -0.670  -7.756  1.00 24.85 ? 9   DC  D "O5'" 1 
ATOM   420  C "C5'" . DC  B 1 9   ? 1.122   -0.264  -6.375  1.00 24.24 ? 9   DC  D "C5'" 1 
ATOM   421  C "C4'" . DC  B 1 9   ? 0.341   -1.311  -5.621  1.00 23.74 ? 9   DC  D "C4'" 1 
ATOM   422  O "O4'" . DC  B 1 9   ? -1.034  -1.299  -6.043  1.00 25.25 ? 9   DC  D "O4'" 1 
ATOM   423  C "C3'" . DC  B 1 9   ? 0.818   -2.736  -5.820  1.00 25.72 ? 9   DC  D "C3'" 1 
ATOM   424  O "O3'" . DC  B 1 9   ? 1.720   -2.964  -4.748  1.00 32.27 ? 9   DC  D "O3'" 1 
ATOM   425  C "C2'" . DC  B 1 9   ? -0.442  -3.583  -5.642  1.00 25.13 ? 9   DC  D "C2'" 1 
ATOM   426  C "C1'" . DC  B 1 9   ? -1.576  -2.576  -5.836  1.00 25.50 ? 9   DC  D "C1'" 1 
ATOM   427  N N1    . DC  B 1 9   ? -2.601  -2.868  -6.849  1.00 26.06 ? 9   DC  D N1    1 
ATOM   428  C C2    . DC  B 1 9   ? -3.540  -3.831  -6.549  1.00 24.65 ? 9   DC  D C2    1 
ATOM   429  O O2    . DC  B 1 9   ? -3.466  -4.396  -5.474  1.00 26.88 ? 9   DC  D O2    1 
ATOM   430  N N3    . DC  B 1 9   ? -4.515  -4.123  -7.433  1.00 23.56 ? 9   DC  D N3    1 
ATOM   431  C C4    . DC  B 1 9   ? -4.571  -3.475  -8.594  1.00 23.33 ? 9   DC  D C4    1 
ATOM   432  N N4    . DC  B 1 9   ? -5.545  -3.813  -9.449  1.00 21.11 ? 9   DC  D N4    1 
ATOM   433  C C5    . DC  B 1 9   ? -3.624  -2.464  -8.931  1.00 23.40 ? 9   DC  D C5    1 
ATOM   434  C C6    . DC  B 1 9   ? -2.656  -2.204  -8.040  1.00 23.68 ? 9   DC  D C6    1 
ATOM   435  H H41   . DC  B 1 9   ? -5.597  -3.377  -10.361 1.00 0.00  ? 9   DC  D H41   1 
ATOM   436  H H42   . DC  B 1 9   ? -6.227  -4.513  -9.196  1.00 0.00  ? 9   DC  D H42   1 
ATOM   437  P P     . DT  B 1 10  ? 2.697   -4.241  -4.762  1.00 37.72 ? 10  DT  D P     1 
ATOM   438  O OP1   . DT  B 1 10  ? 3.671   -3.995  -3.665  1.00 42.91 ? 10  DT  D OP1   1 
ATOM   439  O OP2   . DT  B 1 10  ? 3.179   -4.523  -6.142  1.00 39.65 ? 10  DT  D OP2   1 
ATOM   440  O "O5'" . DT  B 1 10  ? 1.787   -5.495  -4.361  1.00 42.36 ? 10  DT  D "O5'" 1 
ATOM   441  C "C5'" . DT  B 1 10  ? 1.185   -5.628  -3.050  1.00 41.43 ? 10  DT  D "C5'" 1 
ATOM   442  C "C4'" . DT  B 1 10  ? 0.341   -6.886  -2.997  1.00 44.70 ? 10  DT  D "C4'" 1 
ATOM   443  O "O4'" . DT  B 1 10  ? -0.878  -6.706  -3.736  1.00 42.22 ? 10  DT  D "O4'" 1 
ATOM   444  C "C3'" . DT  B 1 10  ? 0.980   -8.144  -3.566  1.00 48.27 ? 10  DT  D "C3'" 1 
ATOM   445  O "O3'" . DT  B 1 10  ? 1.712   -8.706  -2.470  1.00 59.42 ? 10  DT  D "O3'" 1 
ATOM   446  C "C2'" . DT  B 1 10  ? -0.215  -8.996  -3.999  1.00 42.80 ? 10  DT  D "C2'" 1 
ATOM   447  C "C1'" . DT  B 1 10  ? -1.304  -7.951  -4.251  1.00 41.54 ? 10  DT  D "C1'" 1 
ATOM   448  N N1    . DT  B 1 10  ? -1.776  -7.736  -5.634  1.00 39.57 ? 10  DT  D N1    1 
ATOM   449  C C2    . DT  B 1 10  ? -3.047  -8.155  -5.939  1.00 37.40 ? 10  DT  D C2    1 
ATOM   450  O O2    . DT  B 1 10  ? -3.745  -8.769  -5.158  1.00 35.03 ? 10  DT  D O2    1 
ATOM   451  N N3    . DT  B 1 10  ? -3.473  -7.820  -7.200  1.00 36.35 ? 10  DT  D N3    1 
ATOM   452  C C4    . DT  B 1 10  ? -2.768  -7.128  -8.166  1.00 37.74 ? 10  DT  D C4    1 
ATOM   453  O O4    . DT  B 1 10  ? -3.290  -6.864  -9.240  1.00 35.76 ? 10  DT  D O4    1 
ATOM   454  C C5    . DT  B 1 10  ? -1.431  -6.755  -7.801  1.00 37.98 ? 10  DT  D C5    1 
ATOM   455  C C7    . DT  B 1 10  ? -0.598  -6.011  -8.796  1.00 37.11 ? 10  DT  D C7    1 
ATOM   456  C C6    . DT  B 1 10  ? -0.995  -7.088  -6.570  1.00 39.50 ? 10  DT  D C6    1 
ATOM   457  H H3    . DT  B 1 10  ? -4.410  -8.102  -7.451  1.00 0.00  ? 10  DT  D H3    1 
ATOM   458  P P     . DT  B 1 11  ? 2.171   -10.252 -2.485  1.00 65.67 ? 11  DT  D P     1 
ATOM   459  O OP1   . DT  B 1 11  ? 2.504   -10.605 -1.064  1.00 65.46 ? 11  DT  D OP1   1 
ATOM   460  O OP2   . DT  B 1 11  ? 3.177   -10.498 -3.575  1.00 64.33 ? 11  DT  D OP2   1 
ATOM   461  O "O5'" . DT  B 1 11  ? 0.839   -11.034 -2.853  1.00 64.82 ? 11  DT  D "O5'" 1 
ATOM   462  C "C5'" . DT  B 1 11  ? 0.010   -11.568 -1.822  1.00 65.41 ? 11  DT  D "C5'" 1 
ATOM   463  C "C4'" . DT  B 1 11  ? -1.004  -12.485 -2.430  1.00 65.62 ? 11  DT  D "C4'" 1 
ATOM   464  O "O4'" . DT  B 1 11  ? -1.869  -11.696 -3.282  1.00 64.92 ? 11  DT  D "O4'" 1 
ATOM   465  C "C3'" . DT  B 1 11  ? -0.433  -13.538 -3.370  1.00 65.51 ? 11  DT  D "C3'" 1 
ATOM   466  O "O3'" . DT  B 1 11  ? 0.030   -14.678 -2.646  1.00 66.12 ? 11  DT  D "O3'" 1 
ATOM   467  C "C2'" . DT  B 1 11  ? -1.641  -13.869 -4.241  1.00 65.24 ? 11  DT  D "C2'" 1 
ATOM   468  C "C1'" . DT  B 1 11  ? -2.340  -12.507 -4.341  1.00 64.55 ? 11  DT  D "C1'" 1 
ATOM   469  N N1    . DT  B 1 11  ? -2.080  -11.816 -5.610  1.00 63.02 ? 11  DT  D N1    1 
ATOM   470  C C2    . DT  B 1 11  ? -3.156  -11.555 -6.426  1.00 62.26 ? 11  DT  D C2    1 
ATOM   471  O O2    . DT  B 1 11  ? -4.308  -11.840 -6.130  1.00 60.92 ? 11  DT  D O2    1 
ATOM   472  N N3    . DT  B 1 11  ? -2.838  -10.942 -7.610  1.00 61.07 ? 11  DT  D N3    1 
ATOM   473  C C4    . DT  B 1 11  ? -1.587  -10.568 -8.049  1.00 60.27 ? 11  DT  D C4    1 
ATOM   474  O O4    . DT  B 1 11  ? -1.467  -10.030 -9.144  1.00 59.58 ? 11  DT  D O4    1 
ATOM   475  C C5    . DT  B 1 11  ? -0.501  -10.862 -7.135  1.00 60.66 ? 11  DT  D C5    1 
ATOM   476  C C7    . DT  B 1 11  ? 0.895   -10.490 -7.516  1.00 62.99 ? 11  DT  D C7    1 
ATOM   477  C C6    . DT  B 1 11  ? -0.800  -11.460 -5.975  1.00 62.70 ? 11  DT  D C6    1 
ATOM   478  H H3    . DT  B 1 11  ? -3.621  -10.751 -8.213  1.00 0.00  ? 11  DT  D H3    1 
ATOM   479  N N     . SER C 2 1   ? 2.812   10.289  28.586  1.00 31.49 ? 2   SER A N     1 
ATOM   480  C CA    . SER C 2 1   ? 2.677   8.999   27.844  1.00 30.05 ? 2   SER A CA    1 
ATOM   481  C C     . SER C 2 1   ? 3.131   9.213   26.412  1.00 27.54 ? 2   SER A C     1 
ATOM   482  O O     . SER C 2 1   ? 3.431   10.345  26.013  1.00 27.47 ? 2   SER A O     1 
ATOM   483  C CB    . SER C 2 1   ? 1.207   8.550   27.826  1.00 33.08 ? 2   SER A CB    1 
ATOM   484  O OG    . SER C 2 1   ? 0.344   9.557   27.287  1.00 35.95 ? 2   SER A OG    1 
ATOM   485  H H1    . SER C 2 1   ? 3.748   10.735  28.495  1.00 0.00  ? 2   SER A H1    1 
ATOM   486  H H2    . SER C 2 1   ? 2.198   10.917  28.016  1.00 0.00  ? 2   SER A H2    1 
ATOM   487  H H3    . SER C 2 1   ? 2.475   10.256  29.558  1.00 0.00  ? 2   SER A H3    1 
ATOM   488  H HG    . SER C 2 1   ? -0.568  9.228   27.317  1.00 0.00  ? 2   SER A HG    1 
ATOM   489  N N     . LEU C 2 2   ? 3.166   8.134   25.641  1.00 27.23 ? 3   LEU A N     1 
ATOM   490  C CA    . LEU C 2 2   ? 3.533   8.227   24.235  1.00 25.78 ? 3   LEU A CA    1 
ATOM   491  C C     . LEU C 2 2   ? 2.438   9.060   23.580  1.00 24.72 ? 3   LEU A C     1 
ATOM   492  O O     . LEU C 2 2   ? 2.713   10.072  22.938  1.00 24.42 ? 3   LEU A O     1 
ATOM   493  C CB    . LEU C 2 2   ? 3.568   6.836   23.624  1.00 24.65 ? 3   LEU A CB    1 
ATOM   494  C CG    . LEU C 2 2   ? 3.791   6.589   22.129  1.00 23.34 ? 3   LEU A CG    1 
ATOM   495  C CD1   . LEU C 2 2   ? 5.201   6.940   21.653  1.00 18.75 ? 3   LEU A CD1   1 
ATOM   496  C CD2   . LEU C 2 2   ? 3.524   5.103   21.920  1.00 23.49 ? 3   LEU A CD2   1 
ATOM   497  H H     . LEU C 2 2   ? 2.891   7.256   25.982  1.00 0.00  ? 3   LEU A H     1 
ATOM   498  N N     . ARG C 2 3   ? 1.200   8.742   23.938  1.00 23.70 ? 4   ARG A N     1 
ATOM   499  C CA    . ARG C 2 3   ? 0.042   9.418   23.380  1.00 23.25 ? 4   ARG A CA    1 
ATOM   500  C C     . ARG C 2 3   ? -0.015  10.926  23.574  1.00 22.45 ? 4   ARG A C     1 
ATOM   501  O O     . ARG C 2 3   ? -0.243  11.689  22.599  1.00 20.99 ? 4   ARG A O     1 
ATOM   502  C CB    . ARG C 2 3   ? -1.242  8.758   23.879  1.00 24.11 ? 4   ARG A CB    1 
ATOM   503  C CG    . ARG C 2 3   ? -2.488  9.369   23.351  1.00 26.30 ? 4   ARG A CG    1 
ATOM   504  C CD    . ARG C 2 3   ? -3.696  8.724   23.974  1.00 26.07 ? 4   ARG A CD    1 
ATOM   505  N NE    . ARG C 2 3   ? -4.952  9.210   23.413  1.00 25.69 ? 4   ARG A NE    1 
ATOM   506  C CZ    . ARG C 2 3   ? -5.932  8.407   23.010  1.00 22.97 ? 4   ARG A CZ    1 
ATOM   507  N NH1   . ARG C 2 3   ? -5.798  7.096   23.096  1.00 20.94 ? 4   ARG A NH1   1 
ATOM   508  N NH2   . ARG C 2 3   ? -7.063  8.916   22.575  1.00 21.67 ? 4   ARG A NH2   1 
ATOM   509  H H     . ARG C 2 3   ? 1.058   8.002   24.568  1.00 0.00  ? 4   ARG A H     1 
ATOM   510  H HE    . ARG C 2 3   ? -5.078  10.178  23.324  1.00 0.00  ? 4   ARG A HE    1 
ATOM   511  H HH11  . ARG C 2 3   ? -4.964  6.694   23.471  1.00 0.00  ? 4   ARG A HH11  1 
ATOM   512  H HH12  . ARG C 2 3   ? -6.529  6.494   22.792  1.00 0.00  ? 4   ARG A HH12  1 
ATOM   513  H HH21  . ARG C 2 3   ? -7.184  9.909   22.547  1.00 0.00  ? 4   ARG A HH21  1 
ATOM   514  H HH22  . ARG C 2 3   ? -7.799  8.314   22.265  1.00 0.00  ? 4   ARG A HH22  1 
ATOM   515  N N     . SER C 2 4   ? 0.156   11.381  24.804  1.00 20.05 ? 5   SER A N     1 
ATOM   516  C CA    . SER C 2 4   ? 0.113   12.817  25.046  1.00 21.75 ? 5   SER A CA    1 
ATOM   517  C C     . SER C 2 4   ? 1.304   13.577  24.408  1.00 19.93 ? 5   SER A C     1 
ATOM   518  O O     . SER C 2 4   ? 1.163   14.719  23.929  1.00 18.52 ? 5   SER A O     1 
ATOM   519  C CB    . SER C 2 4   ? 0.046   13.066  26.544  1.00 20.68 ? 5   SER A CB    1 
ATOM   520  O OG    . SER C 2 4   ? 0.923   12.164  27.201  1.00 30.17 ? 5   SER A OG    1 
ATOM   521  H H     . SER C 2 4   ? 0.327   10.783  25.561  1.00 0.00  ? 5   SER A H     1 
ATOM   522  H HG    . SER C 2 4   ? 0.788   12.492  28.101  1.00 0.00  ? 5   SER A HG    1 
ATOM   523  N N     . ASP C 2 5   ? 2.474   12.949  24.427  1.00 21.47 ? 6   ASP A N     1 
ATOM   524  C CA    . ASP C 2 5   ? 3.650   13.545  23.831  1.00 21.60 ? 6   ASP A CA    1 
ATOM   525  C C     . ASP C 2 5   ? 3.416   13.705  22.319  1.00 22.27 ? 6   ASP A C     1 
ATOM   526  O O     . ASP C 2 5   ? 3.579   14.812  21.766  1.00 20.51 ? 6   ASP A O     1 
ATOM   527  C CB    . ASP C 2 5   ? 4.876   12.660  24.062  1.00 21.88 ? 6   ASP A CB    1 
ATOM   528  C CG    . ASP C 2 5   ? 5.540   12.912  25.410  1.00 22.28 ? 6   ASP A CG    1 
ATOM   529  O OD1   . ASP C 2 5   ? 5.259   13.967  26.025  1.00 19.75 ? 6   ASP A OD1   1 
ATOM   530  O OD2   . ASP C 2 5   ? 6.353   12.054  25.833  1.00 17.53 ? 6   ASP A OD2   1 
ATOM   531  H H     . ASP C 2 5   ? 2.537   12.059  24.825  1.00 0.00  ? 6   ASP A H     1 
ATOM   532  N N     . LEU C 2 6   ? 3.002   12.606  21.677  1.00 20.94 ? 7   LEU A N     1 
ATOM   533  C CA    . LEU C 2 6   ? 2.735   12.589  20.232  1.00 24.06 ? 7   LEU A CA    1 
ATOM   534  C C     . LEU C 2 6   ? 1.692   13.631  19.838  1.00 22.47 ? 7   LEU A C     1 
ATOM   535  O O     . LEU C 2 6   ? 1.902   14.404  18.913  1.00 21.04 ? 7   LEU A O     1 
ATOM   536  C CB    . LEU C 2 6   ? 2.326   11.176  19.773  1.00 25.44 ? 7   LEU A CB    1 
ATOM   537  C CG    . LEU C 2 6   ? 2.192   10.833  18.264  1.00 28.57 ? 7   LEU A CG    1 
ATOM   538  C CD1   . LEU C 2 6   ? 3.306   11.433  17.428  1.00 25.67 ? 7   LEU A CD1   1 
ATOM   539  C CD2   . LEU C 2 6   ? 2.171   9.309   18.081  1.00 28.54 ? 7   LEU A CD2   1 
ATOM   540  H H     . LEU C 2 6   ? 2.860   11.787  22.194  1.00 0.00  ? 7   LEU A H     1 
ATOM   541  N N     . ILE C 2 7   ? 0.610   13.719  20.601  1.00 23.28 ? 8   ILE A N     1 
ATOM   542  C CA    . ILE C 2 7   ? -0.413  14.695  20.274  1.00 24.37 ? 8   ILE A CA    1 
ATOM   543  C C     . ILE C 2 7   ? 0.124   16.115  20.409  1.00 24.15 ? 8   ILE A C     1 
ATOM   544  O O     . ILE C 2 7   ? -0.124  16.973  19.550  1.00 26.00 ? 8   ILE A O     1 
ATOM   545  C CB    . ILE C 2 7   ? -1.756  14.451  21.054  1.00 24.54 ? 8   ILE A CB    1 
ATOM   546  C CG1   . ILE C 2 7   ? -2.902  14.369  20.047  1.00 27.44 ? 8   ILE A CG1   1 
ATOM   547  C CG2   . ILE C 2 7   ? -2.076  15.577  22.001  1.00 24.46 ? 8   ILE A CG2   1 
ATOM   548  C CD1   . ILE C 2 7   ? -2.909  15.509  18.990  1.00 22.91 ? 8   ILE A CD1   1 
ATOM   549  H H     . ILE C 2 7   ? 0.488   13.111  21.364  1.00 0.00  ? 8   ILE A H     1 
ATOM   550  N N     . ASN C 2 8   ? 0.916   16.363  21.438  1.00 23.80 ? 9   ASN A N     1 
ATOM   551  C CA    . ASN C 2 8   ? 1.466   17.707  21.590  1.00 23.86 ? 9   ASN A CA    1 
ATOM   552  C C     . ASN C 2 8   ? 2.461   18.043  20.497  1.00 17.87 ? 9   ASN A C     1 
ATOM   553  O O     . ASN C 2 8   ? 2.514   19.172  20.019  1.00 17.85 ? 9   ASN A O     1 
ATOM   554  C CB    . ASN C 2 8   ? 2.099   17.883  22.968  1.00 28.13 ? 9   ASN A CB    1 
ATOM   555  C CG    . ASN C 2 8   ? 1.074   18.172  24.014  1.00 31.32 ? 9   ASN A CG    1 
ATOM   556  O OD1   . ASN C 2 8   ? 1.144   17.675  25.139  1.00 36.35 ? 9   ASN A OD1   1 
ATOM   557  N ND2   . ASN C 2 8   ? 0.078   18.961  23.639  1.00 33.12 ? 9   ASN A ND2   1 
ATOM   558  H H     . ASN C 2 8   ? 1.133   15.655  22.083  1.00 0.00  ? 9   ASN A H     1 
ATOM   559  H HD21  . ASN C 2 8   ? -0.607  19.148  24.291  1.00 0.00  ? 9   ASN A HD21  1 
ATOM   560  H HD22  . ASN C 2 8   ? 0.070   19.336  22.733  1.00 0.00  ? 9   ASN A HD22  1 
ATOM   561  N N     . ALA C 2 9   ? 3.275   17.060  20.150  1.00 16.17 ? 10  ALA A N     1 
ATOM   562  C CA    . ALA C 2 9   ? 4.283   17.186  19.107  1.00 16.95 ? 10  ALA A CA    1 
ATOM   563  C C     . ALA C 2 9   ? 3.646   17.508  17.731  1.00 17.33 ? 10  ALA A C     1 
ATOM   564  O O     . ALA C 2 9   ? 4.115   18.408  17.014  1.00 19.36 ? 10  ALA A O     1 
ATOM   565  C CB    . ALA C 2 9   ? 5.092   15.908  19.039  1.00 12.21 ? 10  ALA A CB    1 
ATOM   566  H H     . ALA C 2 9   ? 3.181   16.205  20.608  1.00 0.00  ? 10  ALA A H     1 
ATOM   567  N N     . LEU C 2 10  ? 2.556   16.820  17.392  1.00 18.93 ? 11  LEU A N     1 
ATOM   568  C CA    . LEU C 2 10  ? 1.848   17.034  16.129  1.00 18.47 ? 11  LEU A CA    1 
ATOM   569  C C     . LEU C 2 10  ? 1.225   18.392  16.119  1.00 20.75 ? 11  LEU A C     1 
ATOM   570  O O     . LEU C 2 10  ? 1.322   19.130  15.114  1.00 17.54 ? 11  LEU A O     1 
ATOM   571  C CB    . LEU C 2 10  ? 0.714   16.010  15.941  1.00 18.86 ? 11  LEU A CB    1 
ATOM   572  C CG    . LEU C 2 10  ? 1.119   14.569  15.688  1.00 18.35 ? 11  LEU A CG    1 
ATOM   573  C CD1   . LEU C 2 10  ? -0.109  13.690  15.651  1.00 21.88 ? 11  LEU A CD1   1 
ATOM   574  C CD2   . LEU C 2 10  ? 1.924   14.477  14.410  1.00 20.20 ? 11  LEU A CD2   1 
ATOM   575  H H     . LEU C 2 10  ? 2.219   16.130  18.003  1.00 0.00  ? 11  LEU A H     1 
ATOM   576  N N     . TYR C 2 11  ? 0.545   18.692  17.231  1.00 22.56 ? 12  TYR A N     1 
ATOM   577  C CA    . TYR C 2 11  ? -0.160  19.952  17.407  1.00 25.54 ? 12  TYR A CA    1 
ATOM   578  C C     . TYR C 2 11  ? 0.812   21.123  17.296  1.00 29.37 ? 12  TYR A C     1 
ATOM   579  O O     . TYR C 2 11  ? 0.546   22.132  16.614  1.00 30.58 ? 12  TYR A O     1 
ATOM   580  C CB    . TYR C 2 11  ? -0.869  19.993  18.766  1.00 24.86 ? 12  TYR A CB    1 
ATOM   581  C CG    . TYR C 2 11  ? -1.780  21.201  18.943  1.00 28.22 ? 12  TYR A CG    1 
ATOM   582  C CD1   . TYR C 2 11  ? -3.058  21.238  18.365  1.00 27.43 ? 12  TYR A CD1   1 
ATOM   583  C CD2   . TYR C 2 11  ? -1.347  22.334  19.632  1.00 29.00 ? 12  TYR A CD2   1 
ATOM   584  C CE1   . TYR C 2 11  ? -3.873  22.383  18.468  1.00 27.65 ? 12  TYR A CE1   1 
ATOM   585  C CE2   . TYR C 2 11  ? -2.152  23.481  19.732  1.00 29.88 ? 12  TYR A CE2   1 
ATOM   586  C CZ    . TYR C 2 11  ? -3.408  23.499  19.150  1.00 28.45 ? 12  TYR A CZ    1 
ATOM   587  O OH    . TYR C 2 11  ? -4.185  24.645  19.243  1.00 31.04 ? 12  TYR A OH    1 
ATOM   588  H H     . TYR C 2 11  ? 0.512   18.037  17.959  1.00 0.00  ? 12  TYR A H     1 
ATOM   589  H HH    . TYR C 2 11  ? -5.076  24.467  18.926  1.00 0.00  ? 12  TYR A HH    1 
ATOM   590  N N     . ASP C 2 12  ? 1.952   20.994  17.959  1.00 31.38 ? 13  ASP A N     1 
ATOM   591  C CA    . ASP C 2 12  ? 2.897   22.069  17.924  1.00 30.42 ? 13  ASP A CA    1 
ATOM   592  C C     . ASP C 2 12  ? 3.448   22.267  16.525  1.00 30.44 ? 13  ASP A C     1 
ATOM   593  O O     . ASP C 2 12  ? 3.394   23.370  15.988  1.00 28.94 ? 13  ASP A O     1 
ATOM   594  C CB    . ASP C 2 12  ? 4.021   21.827  18.906  1.00 32.87 ? 13  ASP A CB    1 
ATOM   595  C CG    . ASP C 2 12  ? 4.871   23.055  19.090  1.00 35.49 ? 13  ASP A CG    1 
ATOM   596  O OD1   . ASP C 2 12  ? 4.297   24.169  19.135  1.00 35.74 ? 13  ASP A OD1   1 
ATOM   597  O OD2   . ASP C 2 12  ? 6.108   22.920  19.141  1.00 38.96 ? 13  ASP A OD2   1 
ATOM   598  H H     . ASP C 2 12  ? 2.141   20.179  18.466  1.00 0.00  ? 13  ASP A H     1 
ATOM   599  N N     . GLU C 2 13  ? 3.945   21.190  15.931  1.00 31.69 ? 14  GLU A N     1 
ATOM   600  C CA    . GLU C 2 13  ? 4.540   21.218  14.596  1.00 32.26 ? 14  GLU A CA    1 
ATOM   601  C C     . GLU C 2 13  ? 3.616   21.822  13.542  1.00 32.46 ? 14  GLU A C     1 
ATOM   602  O O     . GLU C 2 13  ? 4.039   22.610  12.694  1.00 30.53 ? 14  GLU A O     1 
ATOM   603  C CB    . GLU C 2 13  ? 4.926   19.805  14.195  1.00 34.01 ? 14  GLU A CB    1 
ATOM   604  C CG    . GLU C 2 13  ? 5.742   19.709  12.932  1.00 39.19 ? 14  GLU A CG    1 
ATOM   605  C CD    . GLU C 2 13  ? 7.223   19.980  13.129  1.00 42.00 ? 14  GLU A CD    1 
ATOM   606  O OE1   . GLU C 2 13  ? 7.665   20.210  14.282  1.00 44.70 ? 14  GLU A OE1   1 
ATOM   607  O OE2   . GLU C 2 13  ? 7.952   19.954  12.109  1.00 42.43 ? 14  GLU A OE2   1 
ATOM   608  H H     . GLU C 2 13  ? 3.911   20.330  16.403  1.00 0.00  ? 14  GLU A H     1 
ATOM   609  N N     . ASN C 2 14  ? 2.339   21.498  13.653  1.00 34.76 ? 15  ASN A N     1 
ATOM   610  C CA    . ASN C 2 14  ? 1.329   21.974  12.725  1.00 37.41 ? 15  ASN A CA    1 
ATOM   611  C C     . ASN C 2 14  ? 1.049   23.475  12.866  1.00 38.81 ? 15  ASN A C     1 
ATOM   612  O O     . ASN C 2 14  ? 0.685   24.150  11.898  1.00 39.68 ? 15  ASN A O     1 
ATOM   613  C CB    . ASN C 2 14  ? 0.048   21.145  12.908  1.00 37.64 ? 15  ASN A CB    1 
ATOM   614  C CG    . ASN C 2 14  ? -0.978  21.390  11.808  1.00 38.57 ? 15  ASN A CG    1 
ATOM   615  O OD1   . ASN C 2 14  ? -0.856  20.867  10.697  1.00 37.93 ? 15  ASN A OD1   1 
ATOM   616  N ND2   . ASN C 2 14  ? -2.011  22.169  12.126  1.00 36.07 ? 15  ASN A ND2   1 
ATOM   617  H H     . ASN C 2 14  ? 2.065   20.898  14.380  1.00 0.00  ? 15  ASN A H     1 
ATOM   618  H HD21  . ASN C 2 14  ? -2.670  22.371  11.434  1.00 0.00  ? 15  ASN A HD21  1 
ATOM   619  H HD22  . ASN C 2 14  ? -2.062  22.514  13.044  1.00 0.00  ? 15  ASN A HD22  1 
ATOM   620  N N     . GLN C 2 15  ? 1.214   23.997  14.074  1.00 40.17 ? 16  GLN A N     1 
ATOM   621  C CA    . GLN C 2 15  ? 0.978   25.415  14.327  1.00 41.24 ? 16  GLN A CA    1 
ATOM   622  C C     . GLN C 2 15  ? 2.124   26.237  13.761  1.00 40.15 ? 16  GLN A C     1 
ATOM   623  O O     . GLN C 2 15  ? 1.945   27.354  13.301  1.00 40.34 ? 16  GLN A O     1 
ATOM   624  C CB    . GLN C 2 15  ? 0.949   25.683  15.833  1.00 42.35 ? 16  GLN A CB    1 
ATOM   625  C CG    . GLN C 2 15  ? -0.089  24.942  16.613  1.00 47.84 ? 16  GLN A CG    1 
ATOM   626  C CD    . GLN C 2 15  ? -1.342  25.744  16.763  1.00 51.48 ? 16  GLN A CD    1 
ATOM   627  O OE1   . GLN C 2 15  ? -1.304  26.910  17.165  1.00 53.48 ? 16  GLN A OE1   1 
ATOM   628  N NE2   . GLN C 2 15  ? -2.473  25.136  16.429  1.00 54.97 ? 16  GLN A NE2   1 
ATOM   629  H H     . GLN C 2 15  ? 1.497   23.424  14.820  1.00 0.00  ? 16  GLN A H     1 
ATOM   630  H HE21  . GLN C 2 15  ? -3.292  25.649  16.558  1.00 0.00  ? 16  GLN A HE21  1 
ATOM   631  H HE22  . GLN C 2 15  ? -2.434  24.218  16.085  1.00 0.00  ? 16  GLN A HE22  1 
ATOM   632  N N     . LYS C 2 16  ? 3.313   25.675  13.807  1.00 40.15 ? 17  LYS A N     1 
ATOM   633  C CA    . LYS C 2 16  ? 4.473   26.415  13.382  1.00 43.82 ? 17  LYS A CA    1 
ATOM   634  C C     . LYS C 2 16  ? 4.920   26.292  11.935  1.00 44.59 ? 17  LYS A C     1 
ATOM   635  O O     . LYS C 2 16  ? 5.571   27.195  11.403  1.00 44.69 ? 17  LYS A O     1 
ATOM   636  C CB    . LYS C 2 16  ? 5.641   26.108  14.339  1.00 46.34 ? 17  LYS A CB    1 
ATOM   637  H H     . LYS C 2 16  ? 3.411   24.761  14.142  1.00 0.00  ? 17  LYS A H     1 
ATOM   638  N N     . TYR C 2 17  ? 4.584   25.187  11.292  1.00 45.30 ? 18  TYR A N     1 
ATOM   639  C CA    . TYR C 2 17  ? 5.019   24.982  9.923   1.00 45.97 ? 18  TYR A CA    1 
ATOM   640  C C     . TYR C 2 17  ? 3.921   25.079  8.872   1.00 43.86 ? 18  TYR A C     1 
ATOM   641  O O     . TYR C 2 17  ? 2.715   25.026  9.188   1.00 44.21 ? 18  TYR A O     1 
ATOM   642  C CB    . TYR C 2 17  ? 5.792   23.663  9.823   1.00 48.81 ? 18  TYR A CB    1 
ATOM   643  C CG    . TYR C 2 17  ? 7.052   23.700  10.654  1.00 54.11 ? 18  TYR A CG    1 
ATOM   644  C CD1   . TYR C 2 17  ? 7.034   23.362  12.010  1.00 55.97 ? 18  TYR A CD1   1 
ATOM   645  C CD2   . TYR C 2 17  ? 8.250   24.168  10.105  1.00 57.75 ? 18  TYR A CD2   1 
ATOM   646  C CE1   . TYR C 2 17  ? 8.176   23.500  12.801  1.00 58.45 ? 18  TYR A CE1   1 
ATOM   647  C CE2   . TYR C 2 17  ? 9.400   24.308  10.881  1.00 59.91 ? 18  TYR A CE2   1 
ATOM   648  C CZ    . TYR C 2 17  ? 9.361   23.976  12.229  1.00 59.56 ? 18  TYR A CZ    1 
ATOM   649  O OH    . TYR C 2 17  ? 10.509  24.132  12.988  1.00 60.30 ? 18  TYR A OH    1 
ATOM   650  H H     . TYR C 2 17  ? 4.012   24.513  11.714  1.00 0.00  ? 18  TYR A H     1 
ATOM   651  H HH    . TYR C 2 17  ? 11.210  24.495  12.441  1.00 0.00  ? 18  TYR A HH    1 
ATOM   652  N N     . ASP C 2 18  ? 4.355   25.300  7.632   1.00 38.63 ? 19  ASP A N     1 
ATOM   653  C CA    . ASP C 2 18  ? 3.454   25.415  6.506   1.00 33.35 ? 19  ASP A CA    1 
ATOM   654  C C     . ASP C 2 18  ? 4.100   24.840  5.278   1.00 30.00 ? 19  ASP A C     1 
ATOM   655  O O     . ASP C 2 18  ? 4.996   25.447  4.709   1.00 27.43 ? 19  ASP A O     1 
ATOM   656  C CB    . ASP C 2 18  ? 3.107   26.871  6.251   1.00 32.92 ? 19  ASP A CB    1 
ATOM   657  C CG    . ASP C 2 18  ? 1.690   27.207  6.659   1.00 35.57 ? 19  ASP A CG    1 
ATOM   658  O OD1   . ASP C 2 18  ? 0.883   26.277  6.851   1.00 40.18 ? 19  ASP A OD1   1 
ATOM   659  O OD2   . ASP C 2 18  ? 1.364   28.406  6.782   1.00 36.91 ? 19  ASP A OD2   1 
ATOM   660  H H     . ASP C 2 18  ? 5.311   25.392  7.474   1.00 0.00  ? 19  ASP A H     1 
ATOM   661  N N     . VAL C 2 19  ? 3.701   23.632  4.904   1.00 28.24 ? 20  VAL A N     1 
ATOM   662  C CA    . VAL C 2 19  ? 4.245   22.996  3.707   1.00 26.60 ? 20  VAL A CA    1 
ATOM   663  C C     . VAL C 2 19  ? 3.753   23.761  2.484   1.00 25.20 ? 20  VAL A C     1 
ATOM   664  O O     . VAL C 2 19  ? 2.570   24.070  2.369   1.00 23.26 ? 20  VAL A O     1 
ATOM   665  C CB    . VAL C 2 19  ? 3.831   21.537  3.603   1.00 25.50 ? 20  VAL A CB    1 
ATOM   666  C CG1   . VAL C 2 19  ? 4.334   20.944  2.296   1.00 28.59 ? 20  VAL A CG1   1 
ATOM   667  C CG2   . VAL C 2 19  ? 4.428   20.773  4.770   1.00 26.35 ? 20  VAL A CG2   1 
ATOM   668  H H     . VAL C 2 19  ? 2.990   23.191  5.417   1.00 0.00  ? 20  VAL A H     1 
ATOM   669  N N     . CYS C 2 20  ? 4.675   24.132  1.605   1.00 23.79 ? 21  CYS A N     1 
ATOM   670  C CA    . CYS C 2 20  ? 4.279   24.888  0.432   1.00 22.80 ? 21  CYS A CA    1 
ATOM   671  C C     . CYS C 2 20  ? 4.778   24.342  -0.892  1.00 20.25 ? 21  CYS A C     1 
ATOM   672  O O     . CYS C 2 20  ? 4.394   24.848  -1.934  1.00 21.35 ? 21  CYS A O     1 
ATOM   673  C CB    . CYS C 2 20  ? 4.671   26.346  0.606   1.00 23.19 ? 21  CYS A CB    1 
ATOM   674  S SG    . CYS C 2 20  ? 6.371   26.542  0.952   1.00 25.22 ? 21  CYS A SG    1 
ATOM   675  H H     . CYS C 2 20  ? 5.623   23.906  1.735   1.00 0.00  ? 21  CYS A H     1 
ATOM   676  N N     . GLY C 2 21  ? 5.590   23.288  -0.864  1.00 17.50 ? 22  GLY A N     1 
ATOM   677  C CA    . GLY C 2 21  ? 6.060   22.747  -2.107  1.00 15.30 ? 22  GLY A CA    1 
ATOM   678  C C     . GLY C 2 21  ? 6.879   21.501  -1.984  1.00 16.44 ? 22  GLY A C     1 
ATOM   679  O O     . GLY C 2 21  ? 7.107   20.977  -0.884  1.00 15.40 ? 22  GLY A O     1 
ATOM   680  H H     . GLY C 2 21  ? 5.902   22.874  -0.032  1.00 0.00  ? 22  GLY A H     1 
ATOM   681  N N     . ILE C 2 22  ? 7.246   20.986  -3.154  1.00 15.60 ? 23  ILE A N     1 
ATOM   682  C CA    . ILE C 2 22  ? 8.095   19.805  -3.304  1.00 17.66 ? 23  ILE A CA    1 
ATOM   683  C C     . ILE C 2 22  ? 9.398   20.447  -3.777  1.00 18.45 ? 23  ILE A C     1 
ATOM   684  O O     . ILE C 2 22  ? 9.360   21.503  -4.393  1.00 19.42 ? 23  ILE A O     1 
ATOM   685  C CB    . ILE C 2 22  ? 7.492   18.797  -4.345  1.00 22.28 ? 23  ILE A CB    1 
ATOM   686  C CG1   . ILE C 2 22  ? 6.690   17.701  -3.627  1.00 25.04 ? 23  ILE A CG1   1 
ATOM   687  C CG2   . ILE C 2 22  ? 8.561   18.134  -5.144  1.00 24.30 ? 23  ILE A CG2   1 
ATOM   688  C CD1   . ILE C 2 22  ? 5.543   18.212  -2.749  1.00 25.50 ? 23  ILE A CD1   1 
ATOM   689  H H     . ILE C 2 22  ? 6.958   21.449  -3.965  1.00 0.00  ? 23  ILE A H     1 
ATOM   690  N N     . ILE C 2 23  ? 10.553  19.880  -3.459  1.00 18.97 ? 24  ILE A N     1 
ATOM   691  C CA    . ILE C 2 23  ? 11.787  20.536  -3.862  1.00 19.28 ? 24  ILE A CA    1 
ATOM   692  C C     . ILE C 2 23  ? 12.718  19.573  -4.509  1.00 18.51 ? 24  ILE A C     1 
ATOM   693  O O     . ILE C 2 23  ? 12.718  18.396  -4.167  1.00 17.77 ? 24  ILE A O     1 
ATOM   694  C CB    . ILE C 2 23  ? 12.522  21.209  -2.642  1.00 21.74 ? 24  ILE A CB    1 
ATOM   695  C CG1   . ILE C 2 23  ? 13.757  22.013  -3.128  1.00 22.39 ? 24  ILE A CG1   1 
ATOM   696  C CG2   . ILE C 2 23  ? 12.950  20.110  -1.610  1.00 19.87 ? 24  ILE A CG2   1 
ATOM   697  C CD1   . ILE C 2 23  ? 14.328  23.025  -2.123  1.00 20.99 ? 24  ILE A CD1   1 
ATOM   698  H H     . ILE C 2 23  ? 10.590  19.033  -2.972  1.00 0.00  ? 24  ILE A H     1 
ATOM   699  N N     . SER C 2 24  ? 13.505  20.078  -5.458  1.00 19.92 ? 25  SER A N     1 
ATOM   700  C CA    . SER C 2 24  ? 14.477  19.250  -6.156  1.00 22.22 ? 25  SER A CA    1 
ATOM   701  C C     . SER C 2 24  ? 15.875  19.389  -5.523  1.00 21.24 ? 25  SER A C     1 
ATOM   702  O O     . SER C 2 24  ? 16.160  20.374  -4.863  1.00 18.21 ? 25  SER A O     1 
ATOM   703  C CB    . SER C 2 24  ? 14.481  19.552  -7.684  1.00 22.31 ? 25  SER A CB    1 
ATOM   704  O OG    . SER C 2 24  ? 14.948  20.853  -7.995  1.00 24.68 ? 25  SER A OG    1 
ATOM   705  H H     . SER C 2 24  ? 13.438  21.025  -5.704  1.00 0.00  ? 25  SER A H     1 
ATOM   706  H HG    . SER C 2 24  ? 14.670  21.026  -8.906  1.00 0.00  ? 25  SER A HG    1 
ATOM   707  N N     . ALA C 2 25  ? 16.709  18.371  -5.701  1.00 22.84 ? 26  ALA A N     1 
ATOM   708  C CA    . ALA C 2 25  ? 18.067  18.356  -5.174  1.00 26.16 ? 26  ALA A CA    1 
ATOM   709  C C     . ALA C 2 25  ? 18.876  19.536  -5.678  1.00 29.00 ? 26  ALA A C     1 
ATOM   710  O O     . ALA C 2 25  ? 19.973  19.813  -5.185  1.00 31.81 ? 26  ALA A O     1 
ATOM   711  C CB    . ALA C 2 25  ? 18.755  17.078  -5.603  1.00 24.01 ? 26  ALA A CB    1 
ATOM   712  H H     . ALA C 2 25  ? 16.406  17.582  -6.190  1.00 0.00  ? 26  ALA A H     1 
ATOM   713  N N     . GLU C 2 26  ? 18.336  20.194  -6.699  1.00 29.63 ? 27  GLU A N     1 
ATOM   714  C CA    . GLU C 2 26  ? 18.955  21.313  -7.365  1.00 26.51 ? 27  GLU A CA    1 
ATOM   715  C C     . GLU C 2 26  ? 18.333  22.637  -6.966  1.00 26.89 ? 27  GLU A C     1 
ATOM   716  O O     . GLU C 2 26  ? 18.636  23.661  -7.560  1.00 28.91 ? 27  GLU A O     1 
ATOM   717  C CB    . GLU C 2 26  ? 18.839  21.096  -8.868  1.00 29.93 ? 27  GLU A CB    1 
ATOM   718  C CG    . GLU C 2 26  ? 19.418  19.742  -9.356  1.00 31.83 ? 27  GLU A CG    1 
ATOM   719  C CD    . GLU C 2 26  ? 18.500  18.511  -9.129  1.00 35.14 ? 27  GLU A CD    1 
ATOM   720  O OE1   . GLU C 2 26  ? 17.309  18.679  -8.749  1.00 37.90 ? 27  GLU A OE1   1 
ATOM   721  O OE2   . GLU C 2 26  ? 18.968  17.359  -9.355  1.00 33.09 ? 27  GLU A OE2   1 
ATOM   722  H H     . GLU C 2 26  ? 17.466  19.929  -7.038  1.00 0.00  ? 27  GLU A H     1 
ATOM   723  N N     . GLY C 2 27  ? 17.406  22.613  -6.014  1.00 25.77 ? 28  GLY A N     1 
ATOM   724  C CA    . GLY C 2 27  ? 16.814  23.846  -5.527  1.00 23.09 ? 28  GLY A CA    1 
ATOM   725  C C     . GLY C 2 27  ? 15.567  24.416  -6.163  1.00 21.81 ? 28  GLY A C     1 
ATOM   726  O O     . GLY C 2 27  ? 15.114  25.491  -5.778  1.00 21.18 ? 28  GLY A O     1 
ATOM   727  H H     . GLY C 2 27  ? 17.133  21.764  -5.619  1.00 0.00  ? 28  GLY A H     1 
ATOM   728  N N     . LYS C 2 28  ? 15.000  23.728  -7.142  1.00 23.08 ? 29  LYS A N     1 
ATOM   729  C CA    . LYS C 2 28  ? 13.780  24.230  -7.766  1.00 23.48 ? 29  LYS A CA    1 
ATOM   730  C C     . LYS C 2 28  ? 12.558  23.667  -6.980  1.00 21.39 ? 29  LYS A C     1 
ATOM   731  O O     . LYS C 2 28  ? 12.468  22.474  -6.662  1.00 22.38 ? 29  LYS A O     1 
ATOM   732  C CB    . LYS C 2 28  ? 13.743  23.866  -9.270  1.00 23.87 ? 29  LYS A CB    1 
ATOM   733  C CG    . LYS C 2 28  ? 12.667  24.592  -10.078 1.00 22.50 ? 29  LYS A CG    1 
ATOM   734  H H     . LYS C 2 28  ? 15.377  22.877  -7.439  1.00 0.00  ? 29  LYS A H     1 
ATOM   735  N N     . ILE C 2 29  ? 11.627  24.547  -6.668  1.00 20.23 ? 30  ILE A N     1 
ATOM   736  C CA    . ILE C 2 29  ? 10.465  24.163  -5.915  1.00 20.73 ? 30  ILE A CA    1 
ATOM   737  C C     . ILE C 2 29  ? 9.201   24.130  -6.766  1.00 20.28 ? 30  ILE A C     1 
ATOM   738  O O     . ILE C 2 29  ? 8.918   25.072  -7.509  1.00 20.60 ? 30  ILE A O     1 
ATOM   739  C CB    . ILE C 2 29  ? 10.235  25.159  -4.774  1.00 21.75 ? 30  ILE A CB    1 
ATOM   740  C CG1   . ILE C 2 29  ? 11.547  25.410  -4.023  1.00 22.75 ? 30  ILE A CG1   1 
ATOM   741  C CG2   . ILE C 2 29  ? 9.172   24.617  -3.809  1.00 22.29 ? 30  ILE A CG2   1 
ATOM   742  C CD1   . ILE C 2 29  ? 11.417  26.488  -2.942  1.00 25.31 ? 30  ILE A CD1   1 
ATOM   743  H H     . ILE C 2 29  ? 11.740  25.453  -6.975  1.00 0.00  ? 30  ILE A H     1 
ATOM   744  N N     . TYR C 2 30  ? 8.424   23.060  -6.624  1.00 18.29 ? 31  TYR A N     1 
ATOM   745  C CA    . TYR C 2 30  ? 7.167   22.921  -7.329  1.00 19.16 ? 31  TYR A CA    1 
ATOM   746  C C     . TYR C 2 30  ? 6.032   23.117  -6.315  1.00 20.06 ? 31  TYR A C     1 
ATOM   747  O O     . TYR C 2 30  ? 6.103   22.608  -5.208  1.00 20.35 ? 31  TYR A O     1 
ATOM   748  C CB    . TYR C 2 30  ? 7.090   21.540  -7.968  1.00 18.61 ? 31  TYR A CB    1 
ATOM   749  C CG    . TYR C 2 30  ? 8.181   21.296  -8.977  1.00 21.46 ? 31  TYR A CG    1 
ATOM   750  C CD1   . TYR C 2 30  ? 9.451   20.878  -8.571  1.00 22.80 ? 31  TYR A CD1   1 
ATOM   751  C CD2   . TYR C 2 30  ? 7.958   21.496  -10.348 1.00 23.34 ? 31  TYR A CD2   1 
ATOM   752  C CE1   . TYR C 2 30  ? 10.480  20.665  -9.491  1.00 24.55 ? 31  TYR A CE1   1 
ATOM   753  C CE2   . TYR C 2 30  ? 8.990   21.280  -11.285 1.00 23.86 ? 31  TYR A CE2   1 
ATOM   754  C CZ    . TYR C 2 30  ? 10.244  20.865  -10.843 1.00 26.13 ? 31  TYR A CZ    1 
ATOM   755  O OH    . TYR C 2 30  ? 11.254  20.609  -11.741 1.00 27.31 ? 31  TYR A OH    1 
ATOM   756  H H     . TYR C 2 30  ? 8.701   22.364  -5.991  1.00 0.00  ? 31  TYR A H     1 
ATOM   757  H HH    . TYR C 2 30  ? 10.897  20.673  -12.632 1.00 0.00  ? 31  TYR A HH    1 
ATOM   758  N N     . PRO C 2 31  ? 4.992   23.902  -6.665  1.00 23.48 ? 32  PRO A N     1 
ATOM   759  C CA    . PRO C 2 31  ? 3.812   24.209  -5.832  1.00 22.79 ? 32  PRO A CA    1 
ATOM   760  C C     . PRO C 2 31  ? 2.883   23.017  -5.622  1.00 21.77 ? 32  PRO A C     1 
ATOM   761  O O     . PRO C 2 31  ? 2.939   22.025  -6.357  1.00 21.43 ? 32  PRO A O     1 
ATOM   762  C CB    . PRO C 2 31  ? 3.099   25.280  -6.643  1.00 24.54 ? 32  PRO A CB    1 
ATOM   763  C CG    . PRO C 2 31  ? 4.194   25.873  -7.463  1.00 23.68 ? 32  PRO A CG    1 
ATOM   764  C CD    . PRO C 2 31  ? 4.935   24.680  -7.913  1.00 22.86 ? 32  PRO A CD    1 
ATOM   765  N N     . LEU C 2 32  ? 1.996   23.130  -4.641  1.00 24.17 ? 33  LEU A N     1 
ATOM   766  C CA    . LEU C 2 32  ? 1.062   22.033  -4.335  1.00 25.72 ? 33  LEU A CA    1 
ATOM   767  C C     . LEU C 2 32  ? -0.301  22.261  -4.945  1.00 25.76 ? 33  LEU A C     1 
ATOM   768  O O     . LEU C 2 32  ? -0.731  23.401  -5.104  1.00 26.13 ? 33  LEU A O     1 
ATOM   769  C CB    . LEU C 2 32  ? 0.866   21.870  -2.817  1.00 20.37 ? 33  LEU A CB    1 
ATOM   770  C CG    . LEU C 2 32  ? 2.108   21.662  -1.975  1.00 20.94 ? 33  LEU A CG    1 
ATOM   771  C CD1   . LEU C 2 32  ? 1.715   21.868  -0.541  1.00 22.30 ? 33  LEU A CD1   1 
ATOM   772  C CD2   . LEU C 2 32  ? 2.785   20.301  -2.230  1.00 18.22 ? 33  LEU A CD2   1 
ATOM   773  H H     . LEU C 2 32  ? 1.928   23.952  -4.102  1.00 0.00  ? 33  LEU A H     1 
ATOM   774  N N     . GLY C 2 33  ? -0.961  21.171  -5.314  1.00 28.49 ? 34  GLY A N     1 
ATOM   775  C CA    . GLY C 2 33  ? -2.314  21.266  -5.834  1.00 31.32 ? 34  GLY A CA    1 
ATOM   776  C C     . GLY C 2 33  ? -3.231  21.192  -4.609  1.00 32.26 ? 34  GLY A C     1 
ATOM   777  O O     . GLY C 2 33  ? -2.781  20.838  -3.509  1.00 30.18 ? 34  GLY A O     1 
ATOM   778  H H     . GLY C 2 33  ? -0.552  20.295  -5.200  1.00 0.00  ? 34  GLY A H     1 
ATOM   779  N N     . SER C 2 34  ? -4.514  21.491  -4.782  1.00 34.41 ? 35  SER A N     1 
ATOM   780  C CA    . SER C 2 34  ? -5.442  21.470  -3.657  1.00 34.71 ? 35  SER A CA    1 
ATOM   781  C C     . SER C 2 34  ? -6.486  20.338  -3.591  1.00 33.38 ? 35  SER A C     1 
ATOM   782  O O     . SER C 2 34  ? -7.653  20.569  -3.275  1.00 34.48 ? 35  SER A O     1 
ATOM   783  C CB    . SER C 2 34  ? -6.108  22.846  -3.499  1.00 37.48 ? 35  SER A CB    1 
ATOM   784  O OG    . SER C 2 34  ? -6.463  23.405  -4.756  1.00 41.37 ? 35  SER A OG    1 
ATOM   785  H H     . SER C 2 34  ? -4.868  21.765  -5.650  1.00 0.00  ? 35  SER A H     1 
ATOM   786  H HG    . SER C 2 34  ? -6.920  24.237  -4.561  1.00 0.00  ? 35  SER A HG    1 
ATOM   787  N N     . ASP C 2 35  ? -6.081  19.123  -3.920  1.00 31.43 ? 36  ASP A N     1 
ATOM   788  C CA    . ASP C 2 35  ? -6.996  18.010  -3.814  1.00 30.31 ? 36  ASP A CA    1 
ATOM   789  C C     . ASP C 2 35  ? -6.443  17.059  -2.740  1.00 30.47 ? 36  ASP A C     1 
ATOM   790  O O     . ASP C 2 35  ? -5.226  16.973  -2.532  1.00 31.43 ? 36  ASP A O     1 
ATOM   791  C CB    . ASP C 2 35  ? -7.246  17.325  -5.163  1.00 31.59 ? 36  ASP A CB    1 
ATOM   792  C CG    . ASP C 2 35  ? -5.989  16.772  -5.795  1.00 35.85 ? 36  ASP A CG    1 
ATOM   793  O OD1   . ASP C 2 35  ? -5.211  17.581  -6.329  1.00 43.02 ? 36  ASP A OD1   1 
ATOM   794  O OD2   . ASP C 2 35  ? -5.793  15.530  -5.817  1.00 38.77 ? 36  ASP A OD2   1 
ATOM   795  H H     . ASP C 2 35  ? -5.158  18.972  -4.201  1.00 0.00  ? 36  ASP A H     1 
ATOM   796  N N     . THR C 2 36  ? -7.339  16.362  -2.046  1.00 27.67 ? 37  THR A N     1 
ATOM   797  C CA    . THR C 2 36  ? -6.961  15.476  -0.967  1.00 24.15 ? 37  THR A CA    1 
ATOM   798  C C     . THR C 2 36  ? -5.938  14.425  -1.311  1.00 22.11 ? 37  THR A C     1 
ATOM   799  O O     . THR C 2 36  ? -5.085  14.122  -0.478  1.00 22.64 ? 37  THR A O     1 
ATOM   800  C CB    . THR C 2 36  ? -8.214  14.861  -0.253  1.00 24.48 ? 37  THR A CB    1 
ATOM   801  O OG1   . THR C 2 36  ? -9.099  15.927  0.114   1.00 25.84 ? 37  THR A OG1   1 
ATOM   802  C CG2   . THR C 2 36  ? -7.824  14.105  1.033   1.00 22.37 ? 37  THR A CG2   1 
ATOM   803  H H     . THR C 2 36  ? -8.293  16.436  -2.267  1.00 0.00  ? 37  THR A H     1 
ATOM   804  H HG1   . THR C 2 36  ? -9.849  15.542  0.558   1.00 0.00  ? 37  THR A HG1   1 
ATOM   805  N N     . LYS C 2 37  ? -5.944  13.904  -2.531  1.00 21.41 ? 38  LYS A N     1 
ATOM   806  C CA    . LYS C 2 37  ? -4.947  12.890  -2.847  1.00 19.92 ? 38  LYS A CA    1 
ATOM   807  C C     . LYS C 2 37  ? -3.560  13.480  -2.596  1.00 20.39 ? 38  LYS A C     1 
ATOM   808  O O     . LYS C 2 37  ? -2.672  12.791  -2.116  1.00 20.33 ? 38  LYS A O     1 
ATOM   809  C CB    . LYS C 2 37  ? -5.065  12.429  -4.304  1.00 22.06 ? 38  LYS A CB    1 
ATOM   810  H H     . LYS C 2 37  ? -6.620  14.168  -3.198  1.00 0.00  ? 38  LYS A H     1 
ATOM   811  N N     . VAL C 2 38  ? -3.398  14.771  -2.890  1.00 21.37 ? 39  VAL A N     1 
ATOM   812  C CA    . VAL C 2 38  ? -2.115  15.465  -2.709  1.00 21.45 ? 39  VAL A CA    1 
ATOM   813  C C     . VAL C 2 38  ? -1.871  15.815  -1.246  1.00 19.00 ? 39  VAL A C     1 
ATOM   814  O O     . VAL C 2 38  ? -0.877  15.425  -0.667  1.00 17.88 ? 39  VAL A O     1 
ATOM   815  C CB    . VAL C 2 38  ? -2.003  16.780  -3.611  1.00 24.05 ? 39  VAL A CB    1 
ATOM   816  C CG1   . VAL C 2 38  ? -0.869  17.685  -3.117  1.00 25.66 ? 39  VAL A CG1   1 
ATOM   817  C CG2   . VAL C 2 38  ? -1.704  16.406  -5.057  1.00 24.17 ? 39  VAL A CG2   1 
ATOM   818  H H     . VAL C 2 38  ? -4.163  15.276  -3.234  1.00 0.00  ? 39  VAL A H     1 
ATOM   819  N N     . LEU C 2 39  ? -2.800  16.541  -0.658  1.00 17.71 ? 40  LEU A N     1 
ATOM   820  C CA    . LEU C 2 39  ? -2.667  16.959  0.723   1.00 17.40 ? 40  LEU A CA    1 
ATOM   821  C C     . LEU C 2 39  ? -2.556  15.801  1.702   1.00 17.41 ? 40  LEU A C     1 
ATOM   822  O O     . LEU C 2 39  ? -1.923  15.936  2.734   1.00 19.17 ? 40  LEU A O     1 
ATOM   823  C CB    . LEU C 2 39  ? -3.784  17.932  1.091   1.00 15.83 ? 40  LEU A CB    1 
ATOM   824  C CG    . LEU C 2 39  ? -3.505  19.270  0.415   1.00 16.68 ? 40  LEU A CG    1 
ATOM   825  C CD1   . LEU C 2 39  ? -4.733  19.948  -0.153  1.00 13.88 ? 40  LEU A CD1   1 
ATOM   826  C CD2   . LEU C 2 39  ? -2.820  20.158  1.409   1.00 22.58 ? 40  LEU A CD2   1 
ATOM   827  H H     . LEU C 2 39  ? -3.589  16.814  -1.173  1.00 0.00  ? 40  LEU A H     1 
ATOM   828  N N     . SER C 2 40  ? -3.101  14.643  1.366   1.00 16.72 ? 41  SER A N     1 
ATOM   829  C CA    . SER C 2 40  ? -2.969  13.541  2.278   1.00 19.49 ? 41  SER A CA    1 
ATOM   830  C C     . SER C 2 40  ? -1.566  12.926  2.190   1.00 18.47 ? 41  SER A C     1 
ATOM   831  O O     . SER C 2 40  ? -1.080  12.330  3.156   1.00 16.38 ? 41  SER A O     1 
ATOM   832  C CB    . SER C 2 40  ? -4.067  12.505  2.068   1.00 22.09 ? 41  SER A CB    1 
ATOM   833  O OG    . SER C 2 40  ? -4.000  11.895  0.795   1.00 25.31 ? 41  SER A OG    1 
ATOM   834  H H     . SER C 2 40  ? -3.576  14.534  0.527   1.00 0.00  ? 41  SER A H     1 
ATOM   835  H HG    . SER C 2 40  ? -4.296  12.516  0.125   1.00 0.00  ? 41  SER A HG    1 
ATOM   836  N N     . THR C 2 41  ? -0.917  13.067  1.033   1.00 18.97 ? 42  THR A N     1 
ATOM   837  C CA    . THR C 2 41  ? 0.429   12.535  0.834   1.00 17.64 ? 42  THR A CA    1 
ATOM   838  C C     . THR C 2 41  ? 1.371   13.427  1.603   1.00 15.26 ? 42  THR A C     1 
ATOM   839  O O     . THR C 2 41  ? 2.225   12.956  2.336   1.00 16.61 ? 42  THR A O     1 
ATOM   840  C CB    . THR C 2 41  ? 0.807   12.538  -0.635  1.00 17.91 ? 42  THR A CB    1 
ATOM   841  O OG1   . THR C 2 41  ? 0.129   11.460  -1.287  1.00 17.40 ? 42  THR A OG1   1 
ATOM   842  C CG2   . THR C 2 41  ? 2.308   12.339  -0.812  1.00 20.80 ? 42  THR A CG2   1 
ATOM   843  H H     . THR C 2 41  ? -1.355  13.524  0.287   1.00 0.00  ? 42  THR A H     1 
ATOM   844  H HG1   . THR C 2 41  ? -0.832  11.563  -1.235  1.00 0.00  ? 42  THR A HG1   1 
ATOM   845  N N     . ILE C 2 42  ? 1.152   14.724  1.478   1.00 15.38 ? 43  ILE A N     1 
ATOM   846  C CA    . ILE C 2 42  ? 1.950   15.719  2.178   1.00 16.61 ? 43  ILE A CA    1 
ATOM   847  C C     . ILE C 2 42  ? 1.870   15.575  3.720   1.00 15.88 ? 43  ILE A C     1 
ATOM   848  O O     . ILE C 2 42  ? 2.888   15.576  4.383   1.00 19.21 ? 43  ILE A O     1 
ATOM   849  C CB    . ILE C 2 42  ? 1.548   17.168  1.729   1.00 14.35 ? 43  ILE A CB    1 
ATOM   850  C CG1   . ILE C 2 42  ? 2.462   17.636  0.604   1.00 17.01 ? 43  ILE A CG1   1 
ATOM   851  C CG2   . ILE C 2 42  ? 1.665   18.144  2.871   1.00 19.14 ? 43  ILE A CG2   1 
ATOM   852  C CD1   . ILE C 2 42  ? 2.674   16.614  -0.460  1.00 13.32 ? 43  ILE A CD1   1 
ATOM   853  H H     . ILE C 2 42  ? 0.428   15.032  0.890   1.00 0.00  ? 43  ILE A H     1 
ATOM   854  N N     . PHE C 2 43  ? 0.661   15.437  4.261   1.00 16.85 ? 44  PHE A N     1 
ATOM   855  C CA    . PHE C 2 43  ? 0.426   15.307  5.685   1.00 13.62 ? 44  PHE A CA    1 
ATOM   856  C C     . PHE C 2 43  ? 1.023   14.063  6.254   1.00 13.52 ? 44  PHE A C     1 
ATOM   857  O O     . PHE C 2 43  ? 1.454   14.062  7.391   1.00 16.50 ? 44  PHE A O     1 
ATOM   858  C CB    . PHE C 2 43  ? -1.052  15.354  5.969   1.00 13.41 ? 44  PHE A CB    1 
ATOM   859  C CG    . PHE C 2 43  ? -1.650  16.720  5.792   1.00 12.26 ? 44  PHE A CG    1 
ATOM   860  C CD1   . PHE C 2 43  ? -0.908  17.856  6.084   1.00 12.05 ? 44  PHE A CD1   1 
ATOM   861  C CD2   . PHE C 2 43  ? -2.956  16.867  5.337   1.00 12.03 ? 44  PHE A CD2   1 
ATOM   862  C CE1   . PHE C 2 43  ? -1.486  19.130  5.917   1.00 12.15 ? 44  PHE A CE1   1 
ATOM   863  C CE2   . PHE C 2 43  ? -3.525  18.120  5.171   1.00 9.03  ? 44  PHE A CE2   1 
ATOM   864  C CZ    . PHE C 2 43  ? -2.795  19.251  5.459   1.00 12.09 ? 44  PHE A CZ    1 
ATOM   865  H H     . PHE C 2 43  ? -0.125  15.447  3.674   1.00 0.00  ? 44  PHE A H     1 
ATOM   866  N N     . GLU C 2 44  ? 1.076   13.000  5.479   1.00 13.34 ? 45  GLU A N     1 
ATOM   867  C CA    . GLU C 2 44  ? 1.676   11.780  5.961   1.00 16.18 ? 45  GLU A CA    1 
ATOM   868  C C     . GLU C 2 44  ? 3.167   11.976  6.011   1.00 20.68 ? 45  GLU A C     1 
ATOM   869  O O     . GLU C 2 44  ? 3.837   11.445  6.927   1.00 20.61 ? 45  GLU A O     1 
ATOM   870  C CB    . GLU C 2 44  ? 1.391   10.608  5.056   1.00 24.22 ? 45  GLU A CB    1 
ATOM   871  C CG    . GLU C 2 44  ? 2.185   9.359   5.446   1.00 33.44 ? 45  GLU A CG    1 
ATOM   872  C CD    . GLU C 2 44  ? 2.229   8.308   4.338   1.00 39.78 ? 45  GLU A CD    1 
ATOM   873  O OE1   . GLU C 2 44  ? 2.329   8.697   3.147   1.00 42.01 ? 45  GLU A OE1   1 
ATOM   874  O OE2   . GLU C 2 44  ? 2.185   7.094   4.663   1.00 46.13 ? 45  GLU A OE2   1 
ATOM   875  H H     . GLU C 2 44  ? 0.691   13.022  4.578   1.00 0.00  ? 45  GLU A H     1 
ATOM   876  N N     . LEU C 2 45  ? 3.692   12.712  5.021   1.00 18.84 ? 46  LEU A N     1 
ATOM   877  C CA    . LEU C 2 45  ? 5.125   13.004  4.933   1.00 19.82 ? 46  LEU A CA    1 
ATOM   878  C C     . LEU C 2 45  ? 5.580   13.902  6.075   1.00 16.63 ? 46  LEU A C     1 
ATOM   879  O O     . LEU C 2 45  ? 6.658   13.721  6.631   1.00 12.76 ? 46  LEU A O     1 
ATOM   880  C CB    . LEU C 2 45  ? 5.508   13.642  3.575   1.00 20.07 ? 46  LEU A CB    1 
ATOM   881  C CG    . LEU C 2 45  ? 5.399   12.744  2.319   1.00 20.30 ? 46  LEU A CG    1 
ATOM   882  C CD1   . LEU C 2 45  ? 5.822   13.540  1.068   1.00 20.51 ? 46  LEU A CD1   1 
ATOM   883  C CD2   . LEU C 2 45  ? 6.245   11.469  2.447   1.00 18.94 ? 46  LEU A CD2   1 
ATOM   884  H H     . LEU C 2 45  ? 3.101   13.046  4.314   1.00 0.00  ? 46  LEU A H     1 
ATOM   885  N N     . PHE C 2 46  ? 4.757   14.885  6.386   1.00 15.36 ? 47  PHE A N     1 
ATOM   886  C CA    . PHE C 2 46  ? 5.026   15.821  7.450   1.00 17.49 ? 47  PHE A CA    1 
ATOM   887  C C     . PHE C 2 46  ? 5.005   15.142  8.840   1.00 19.48 ? 47  PHE A C     1 
ATOM   888  O O     . PHE C 2 46  ? 5.780   15.485  9.741   1.00 19.66 ? 47  PHE A O     1 
ATOM   889  C CB    . PHE C 2 46  ? 3.982   16.914  7.342   1.00 19.34 ? 47  PHE A CB    1 
ATOM   890  C CG    . PHE C 2 46  ? 4.062   17.962  8.395   1.00 21.03 ? 47  PHE A CG    1 
ATOM   891  C CD1   . PHE C 2 46  ? 4.895   19.053  8.235   1.00 17.30 ? 47  PHE A CD1   1 
ATOM   892  C CD2   . PHE C 2 46  ? 3.215   17.910  9.503   1.00 22.26 ? 47  PHE A CD2   1 
ATOM   893  C CE1   . PHE C 2 46  ? 4.893   20.097  9.147   1.00 20.89 ? 47  PHE A CE1   1 
ATOM   894  C CE2   . PHE C 2 46  ? 3.192   18.948  10.438  1.00 21.68 ? 47  PHE A CE2   1 
ATOM   895  C CZ    . PHE C 2 46  ? 4.036   20.052  10.259  1.00 23.07 ? 47  PHE A CZ    1 
ATOM   896  H H     . PHE C 2 46  ? 3.939   14.989  5.861   1.00 0.00  ? 47  PHE A H     1 
ATOM   897  N N     . SER C 2 47  ? 4.204   14.093  8.951   1.00 19.05 ? 48  SER A N     1 
ATOM   898  C CA    . SER C 2 47  ? 4.031   13.354  10.189  1.00 19.11 ? 48  SER A CA    1 
ATOM   899  C C     . SER C 2 47  ? 5.135   12.349  10.536  1.00 18.50 ? 48  SER A C     1 
ATOM   900  O O     . SER C 2 47  ? 5.484   12.213  11.720  1.00 18.12 ? 48  SER A O     1 
ATOM   901  C CB    . SER C 2 47  ? 2.681   12.616  10.166  1.00 16.73 ? 48  SER A CB    1 
ATOM   902  O OG    . SER C 2 47  ? 1.599   13.512  10.172  1.00 14.97 ? 48  SER A OG    1 
ATOM   903  H H     . SER C 2 47  ? 3.686   13.803  8.174   1.00 0.00  ? 48  SER A H     1 
ATOM   904  H HG    . SER C 2 47  ? 1.609   14.038  9.358   1.00 0.00  ? 48  SER A HG    1 
ATOM   905  N N     . ARG C 2 48  ? 5.667   11.645  9.537   1.00 15.33 ? 49  ARG A N     1 
ATOM   906  C CA    . ARG C 2 48  ? 6.697   10.629  9.778   1.00 18.79 ? 49  ARG A CA    1 
ATOM   907  C C     . ARG C 2 48  ? 7.829   10.968  10.765  1.00 19.50 ? 49  ARG A C     1 
ATOM   908  O O     . ARG C 2 48  ? 8.092   10.180  11.687  1.00 21.53 ? 49  ARG A O     1 
ATOM   909  C CB    . ARG C 2 48  ? 7.325   10.119  8.478   1.00 19.78 ? 49  ARG A CB    1 
ATOM   910  C CG    . ARG C 2 48  ? 6.424   9.289   7.631   1.00 24.24 ? 49  ARG A CG    1 
ATOM   911  C CD    . ARG C 2 48  ? 6.952   9.151   6.191   1.00 25.33 ? 49  ARG A CD    1 
ATOM   912  N NE    . ARG C 2 48  ? 8.062   8.207   6.082   1.00 24.52 ? 49  ARG A NE    1 
ATOM   913  C CZ    . ARG C 2 48  ? 9.306   8.542   5.764   1.00 28.70 ? 49  ARG A CZ    1 
ATOM   914  N NH1   . ARG C 2 48  ? 9.625   9.812   5.526   1.00 29.34 ? 49  ARG A NH1   1 
ATOM   915  N NH2   . ARG C 2 48  ? 10.221  7.591   5.646   1.00 30.97 ? 49  ARG A NH2   1 
ATOM   916  H H     . ARG C 2 48  ? 5.365   11.809  8.616   1.00 0.00  ? 49  ARG A H     1 
ATOM   917  H HE    . ARG C 2 48  ? 7.883   7.260   6.258   1.00 0.00  ? 49  ARG A HE    1 
ATOM   918  H HH11  . ARG C 2 48  ? 8.900   10.488  5.575   1.00 0.00  ? 49  ARG A HH11  1 
ATOM   919  H HH12  . ARG C 2 48  ? 10.560  10.075  5.285   1.00 0.00  ? 49  ARG A HH12  1 
ATOM   920  H HH21  . ARG C 2 48  ? 9.967   6.636   5.798   1.00 0.00  ? 49  ARG A HH21  1 
ATOM   921  H HH22  . ARG C 2 48  ? 11.160  7.835   5.404   1.00 0.00  ? 49  ARG A HH22  1 
ATOM   922  N N     . PRO C 2 49  ? 8.570   12.077  10.534  1.00 18.86 ? 50  PRO A N     1 
ATOM   923  C CA    . PRO C 2 49  ? 9.668   12.447  11.447  1.00 20.73 ? 50  PRO A CA    1 
ATOM   924  C C     . PRO C 2 49  ? 9.257   12.661  12.922  1.00 19.16 ? 50  PRO A C     1 
ATOM   925  O O     . PRO C 2 49  ? 9.975   12.262  13.833  1.00 17.41 ? 50  PRO A O     1 
ATOM   926  C CB    . PRO C 2 49  ? 10.248  13.726  10.801  1.00 18.02 ? 50  PRO A CB    1 
ATOM   927  C CG    . PRO C 2 49  ? 9.122   14.254  9.979   1.00 17.70 ? 50  PRO A CG    1 
ATOM   928  C CD    . PRO C 2 49  ? 8.529   13.006  9.393   1.00 15.19 ? 50  PRO A CD    1 
ATOM   929  N N     . ILE C 2 50  ? 8.107   13.290  13.127  1.00 20.64 ? 51  ILE A N     1 
ATOM   930  C CA    . ILE C 2 50  ? 7.549   13.569  14.450  1.00 21.76 ? 51  ILE A CA    1 
ATOM   931  C C     . ILE C 2 50  ? 7.241   12.224  15.109  1.00 22.67 ? 51  ILE A C     1 
ATOM   932  O O     . ILE C 2 50  ? 7.768   11.936  16.197  1.00 22.74 ? 51  ILE A O     1 
ATOM   933  C CB    . ILE C 2 50  ? 6.257   14.443  14.311  1.00 23.79 ? 51  ILE A CB    1 
ATOM   934  C CG1   . ILE C 2 50  ? 6.589   15.705  13.541  1.00 23.95 ? 51  ILE A CG1   1 
ATOM   935  C CG2   . ILE C 2 50  ? 5.689   14.869  15.639  1.00 21.83 ? 51  ILE A CG2   1 
ATOM   936  C CD1   . ILE C 2 50  ? 5.395   16.519  13.307  1.00 27.59 ? 51  ILE A CD1   1 
ATOM   937  H H     . ILE C 2 50  ? 7.591   13.569  12.340  1.00 0.00  ? 51  ILE A H     1 
ATOM   938  N N     . ILE C 2 51  ? 6.484   11.363  14.407  1.00 21.36 ? 52  ILE A N     1 
ATOM   939  C CA    . ILE C 2 51  ? 6.125   10.043  14.931  1.00 19.96 ? 52  ILE A CA    1 
ATOM   940  C C     . ILE C 2 51  ? 7.354   9.277   15.379  1.00 23.19 ? 52  ILE A C     1 
ATOM   941  O O     . ILE C 2 51  ? 7.364   8.669   16.445  1.00 24.82 ? 52  ILE A O     1 
ATOM   942  C CB    . ILE C 2 51  ? 5.349   9.195   13.905  1.00 16.07 ? 52  ILE A CB    1 
ATOM   943  C CG1   . ILE C 2 51  ? 4.000   9.857   13.626  1.00 14.05 ? 52  ILE A CG1   1 
ATOM   944  C CG2   . ILE C 2 51  ? 5.152   7.771   14.418  1.00 11.94 ? 52  ILE A CG2   1 
ATOM   945  C CD1   . ILE C 2 51  ? 3.067   9.102   12.668  1.00 13.13 ? 52  ILE A CD1   1 
ATOM   946  H H     . ILE C 2 51  ? 6.162   11.629  13.519  1.00 0.00  ? 52  ILE A H     1 
ATOM   947  N N     . ASN C 2 52  ? 8.416   9.347   14.592  1.00 22.59 ? 53  ASN A N     1 
ATOM   948  C CA    . ASN C 2 52  ? 9.637   8.629   14.917  1.00 23.94 ? 53  ASN A CA    1 
ATOM   949  C C     . ASN C 2 52  ? 10.445  9.268   16.070  1.00 24.77 ? 53  ASN A C     1 
ATOM   950  O O     . ASN C 2 52  ? 11.079  8.566   16.873  1.00 24.31 ? 53  ASN A O     1 
ATOM   951  C CB    . ASN C 2 52  ? 10.482  8.500   13.661  1.00 25.65 ? 53  ASN A CB    1 
ATOM   952  C CG    . ASN C 2 52  ? 11.800  7.914   13.936  1.00 29.59 ? 53  ASN A CG    1 
ATOM   953  O OD1   . ASN C 2 52  ? 11.905  6.715   14.176  1.00 35.95 ? 53  ASN A OD1   1 
ATOM   954  N ND2   . ASN C 2 52  ? 12.840  8.750   13.941  1.00 33.12 ? 53  ASN A ND2   1 
ATOM   955  H H     . ASN C 2 52  ? 8.365   9.870   13.766  1.00 0.00  ? 53  ASN A H     1 
ATOM   956  H HD21  . ASN C 2 52  ? 13.707  8.348   14.133  1.00 0.00  ? 53  ASN A HD21  1 
ATOM   957  H HD22  . ASN C 2 52  ? 12.719  9.711   13.764  1.00 0.00  ? 53  ASN A HD22  1 
ATOM   958  N N     . LYS C 2 53  ? 10.416  10.591  16.151  1.00 23.36 ? 54  LYS A N     1 
ATOM   959  C CA    . LYS C 2 53  ? 11.133  11.287  17.202  1.00 23.21 ? 54  LYS A CA    1 
ATOM   960  C C     . LYS C 2 53  ? 10.533  10.895  18.531  1.00 23.57 ? 54  LYS A C     1 
ATOM   961  O O     . LYS C 2 53  ? 11.268  10.510  19.451  1.00 26.85 ? 54  LYS A O     1 
ATOM   962  C CB    . LYS C 2 53  ? 11.028  12.810  17.046  1.00 22.27 ? 54  LYS A CB    1 
ATOM   963  H H     . LYS C 2 53  ? 9.911   11.108  15.489  1.00 0.00  ? 54  LYS A H     1 
ATOM   964  N N     . ILE C 2 54  ? 9.204   10.977  18.629  1.00 24.05 ? 55  ILE A N     1 
ATOM   965  C CA    . ILE C 2 54  ? 8.507   10.648  19.870  1.00 23.90 ? 55  ILE A CA    1 
ATOM   966  C C     . ILE C 2 54  ? 8.608   9.183   20.295  1.00 23.62 ? 55  ILE A C     1 
ATOM   967  O O     . ILE C 2 54  ? 8.776   8.892   21.477  1.00 23.29 ? 55  ILE A O     1 
ATOM   968  C CB    . ILE C 2 54  ? 7.036   11.070  19.826  1.00 21.83 ? 55  ILE A CB    1 
ATOM   969  C CG1   . ILE C 2 54  ? 6.933   12.557  19.548  1.00 19.80 ? 55  ILE A CG1   1 
ATOM   970  C CG2   . ILE C 2 54  ? 6.349   10.740  21.160  1.00 25.38 ? 55  ILE A CG2   1 
ATOM   971  C CD1   . ILE C 2 54  ? 7.853   13.383  20.399  1.00 17.62 ? 55  ILE A CD1   1 
ATOM   972  H H     . ILE C 2 54  ? 8.686   11.264  17.847  1.00 0.00  ? 55  ILE A H     1 
ATOM   973  N N     . ALA C 2 55  ? 8.499   8.268   19.338  1.00 24.02 ? 56  ALA A N     1 
ATOM   974  C CA    . ALA C 2 55  ? 8.583   6.842   19.625  1.00 24.87 ? 56  ALA A CA    1 
ATOM   975  C C     . ALA C 2 55  ? 9.980   6.478   20.116  1.00 26.77 ? 56  ALA A C     1 
ATOM   976  O O     . ALA C 2 55  ? 10.156  5.592   20.952  1.00 27.93 ? 56  ALA A O     1 
ATOM   977  C CB    . ALA C 2 55  ? 8.242   6.050   18.385  1.00 24.08 ? 56  ALA A CB    1 
ATOM   978  H H     . ALA C 2 55  ? 8.343   8.559   18.412  1.00 0.00  ? 56  ALA A H     1 
ATOM   979  N N     . GLU C 2 56  ? 10.980  7.142   19.551  1.00 29.79 ? 57  GLU A N     1 
ATOM   980  C CA    . GLU C 2 56  ? 12.369  6.909   19.934  1.00 29.84 ? 57  GLU A CA    1 
ATOM   981  C C     . GLU C 2 56  ? 12.538  7.348   21.406  1.00 27.42 ? 57  GLU A C     1 
ATOM   982  O O     . GLU C 2 56  ? 13.109  6.622   22.202  1.00 28.58 ? 57  GLU A O     1 
ATOM   983  C CB    . GLU C 2 56  ? 13.300  7.683   19.003  1.00 30.56 ? 57  GLU A CB    1 
ATOM   984  C CG    . GLU C 2 56  ? 14.746  7.281   19.133  1.00 39.04 ? 57  GLU A CG    1 
ATOM   985  C CD    . GLU C 2 56  ? 15.662  8.186   18.334  1.00 44.03 ? 57  GLU A CD    1 
ATOM   986  O OE1   . GLU C 2 56  ? 15.838  7.905   17.117  1.00 48.34 ? 57  GLU A OE1   1 
ATOM   987  O OE2   . GLU C 2 56  ? 16.194  9.176   18.918  1.00 44.80 ? 57  GLU A OE2   1 
ATOM   988  H H     . GLU C 2 56  ? 10.794  7.790   18.840  1.00 0.00  ? 57  GLU A H     1 
ATOM   989  N N     . LYS C 2 57  ? 11.962  8.493   21.764  1.00 25.19 ? 58  LYS A N     1 
ATOM   990  C CA    . LYS C 2 57  ? 11.998  9.004   23.127  1.00 25.53 ? 58  LYS A CA    1 
ATOM   991  C C     . LYS C 2 57  ? 11.324  8.061   24.161  1.00 25.99 ? 58  LYS A C     1 
ATOM   992  O O     . LYS C 2 57  ? 11.511  8.226   25.367  1.00 26.41 ? 58  LYS A O     1 
ATOM   993  C CB    . LYS C 2 57  ? 11.310  10.369  23.185  1.00 25.70 ? 58  LYS A CB    1 
ATOM   994  C CG    . LYS C 2 57  ? 11.225  10.925  24.598  1.00 32.92 ? 58  LYS A CG    1 
ATOM   995  C CD    . LYS C 2 57  ? 10.307  12.122  24.752  1.00 35.48 ? 58  LYS A CD    1 
ATOM   996  C CE    . LYS C 2 57  ? 10.195  12.492  26.247  1.00 37.27 ? 58  LYS A CE    1 
ATOM   997  N NZ    . LYS C 2 57  ? 9.250   13.627  26.502  1.00 40.33 ? 58  LYS A NZ    1 
ATOM   998  H H     . LYS C 2 57  ? 11.514  9.031   21.075  1.00 0.00  ? 58  LYS A H     1 
ATOM   999  H HZ1   . LYS C 2 57  ? 9.577   14.469  25.987  1.00 0.00  ? 58  LYS A HZ1   1 
ATOM   1000 H HZ2   . LYS C 2 57  ? 8.297   13.367  26.174  1.00 0.00  ? 58  LYS A HZ2   1 
ATOM   1001 H HZ3   . LYS C 2 57  ? 9.224   13.828  27.523  1.00 0.00  ? 58  LYS A HZ3   1 
ATOM   1002 N N     . HIS C 2 58  ? 10.524  7.097   23.709  1.00 23.36 ? 59  HIS A N     1 
ATOM   1003 C CA    . HIS C 2 58  ? 9.857   6.189   24.636  1.00 20.08 ? 59  HIS A CA    1 
ATOM   1004 C C     . HIS C 2 58  ? 10.264  4.760   24.467  1.00 20.13 ? 59  HIS A C     1 
ATOM   1005 O O     . HIS C 2 58  ? 9.646   3.877   25.046  1.00 24.08 ? 59  HIS A O     1 
ATOM   1006 C CB    . HIS C 2 58  ? 8.328   6.293   24.555  1.00 19.93 ? 59  HIS A CB    1 
ATOM   1007 C CG    . HIS C 2 58  ? 7.782   7.619   24.987  1.00 17.57 ? 59  HIS A CG    1 
ATOM   1008 N ND1   . HIS C 2 58  ? 7.154   7.812   26.195  1.00 18.55 ? 59  HIS A ND1   1 
ATOM   1009 C CD2   . HIS C 2 58  ? 7.742   8.810   24.356  1.00 19.49 ? 59  HIS A CD2   1 
ATOM   1010 C CE1   . HIS C 2 58  ? 6.744   9.064   26.289  1.00 15.67 ? 59  HIS A CE1   1 
ATOM   1011 N NE2   . HIS C 2 58  ? 7.091   9.692   25.184  1.00 17.74 ? 59  HIS A NE2   1 
ATOM   1012 H H     . HIS C 2 58  ? 10.390  6.993   22.743  1.00 0.00  ? 59  HIS A H     1 
ATOM   1013 H HD1   . HIS C 2 58  ? 7.087   7.136   26.908  1.00 0.00  ? 59  HIS A HD1   1 
ATOM   1014 H HE2   . HIS C 2 58  ? 6.960   10.597  24.881  1.00 0.00  ? 59  HIS A HE2   1 
ATOM   1015 N N     . GLY C 2 59  ? 11.286  4.519   23.662  1.00 21.53 ? 60  GLY A N     1 
ATOM   1016 C CA    . GLY C 2 59  ? 11.758  3.156   23.470  1.00 21.71 ? 60  GLY A CA    1 
ATOM   1017 C C     . GLY C 2 59  ? 11.065  2.324   22.408  1.00 22.58 ? 60  GLY A C     1 
ATOM   1018 O O     . GLY C 2 59  ? 11.361  1.142   22.231  1.00 24.56 ? 60  GLY A O     1 
ATOM   1019 H H     . GLY C 2 59  ? 11.744  5.250   23.192  1.00 0.00  ? 60  GLY A H     1 
ATOM   1020 N N     . TYR C 2 60  ? 10.191  2.956   21.649  1.00 24.09 ? 61  TYR A N     1 
ATOM   1021 C CA    . TYR C 2 60  ? 9.448   2.259   20.608  1.00 26.41 ? 61  TYR A CA    1 
ATOM   1022 C C     . TYR C 2 60  ? 10.153  2.277   19.269  1.00 27.33 ? 61  TYR A C     1 
ATOM   1023 O O     . TYR C 2 60  ? 10.685  3.302   18.842  1.00 29.61 ? 61  TYR A O     1 
ATOM   1024 C CB    . TYR C 2 60  ? 8.062   2.899   20.432  1.00 27.03 ? 61  TYR A CB    1 
ATOM   1025 C CG    . TYR C 2 60  ? 7.073   2.517   21.508  1.00 28.28 ? 61  TYR A CG    1 
ATOM   1026 C CD1   . TYR C 2 60  ? 7.004   3.225   22.710  1.00 26.32 ? 61  TYR A CD1   1 
ATOM   1027 C CD2   . TYR C 2 60  ? 6.210   1.429   21.324  1.00 28.74 ? 61  TYR A CD2   1 
ATOM   1028 C CE1   . TYR C 2 60  ? 6.106   2.859   23.695  1.00 28.46 ? 61  TYR A CE1   1 
ATOM   1029 C CE2   . TYR C 2 60  ? 5.316   1.053   22.303  1.00 30.19 ? 61  TYR A CE2   1 
ATOM   1030 C CZ    . TYR C 2 60  ? 5.272   1.767   23.484  1.00 29.89 ? 61  TYR A CZ    1 
ATOM   1031 O OH    . TYR C 2 60  ? 4.419   1.362   24.469  1.00 34.32 ? 61  TYR A OH    1 
ATOM   1032 H H     . TYR C 2 60  ? 10.063  3.913   21.766  1.00 0.00  ? 61  TYR A H     1 
ATOM   1033 H HH    . TYR C 2 60  ? 3.857   0.640   24.163  1.00 0.00  ? 61  TYR A HH    1 
ATOM   1034 N N     . ILE C 2 61  ? 10.182  1.132   18.618  1.00 27.36 ? 62  ILE A N     1 
ATOM   1035 C CA    . ILE C 2 61  ? 10.766  1.054   17.308  1.00 28.34 ? 62  ILE A CA    1 
ATOM   1036 C C     . ILE C 2 61  ? 9.558   1.283   16.389  1.00 28.47 ? 62  ILE A C     1 
ATOM   1037 O O     . ILE C 2 61  ? 8.427   0.919   16.744  1.00 28.66 ? 62  ILE A O     1 
ATOM   1038 C CB    . ILE C 2 61  ? 11.475  -0.304  17.079  1.00 28.79 ? 62  ILE A CB    1 
ATOM   1039 C CG1   . ILE C 2 61  ? 10.543  -1.354  16.543  1.00 27.99 ? 62  ILE A CG1   1 
ATOM   1040 C CG2   . ILE C 2 61  ? 11.998  -0.863  18.379  1.00 32.28 ? 62  ILE A CG2   1 
ATOM   1041 C CD1   . ILE C 2 61  ? 11.277  -2.683  16.435  1.00 32.13 ? 62  ILE A CD1   1 
ATOM   1042 H H     . ILE C 2 61  ? 9.811   0.340   19.018  1.00 0.00  ? 62  ILE A H     1 
ATOM   1043 N N     . VAL C 2 62  ? 9.783   1.965   15.268  1.00 26.15 ? 63  VAL A N     1 
ATOM   1044 C CA    . VAL C 2 62  ? 8.724   2.282   14.322  1.00 23.54 ? 63  VAL A CA    1 
ATOM   1045 C C     . VAL C 2 62  ? 8.879   1.578   12.981  1.00 23.90 ? 63  VAL A C     1 
ATOM   1046 O O     . VAL C 2 62  ? 9.933   1.670   12.378  1.00 26.38 ? 63  VAL A O     1 
ATOM   1047 C CB    . VAL C 2 62  ? 8.684   3.784   14.059  1.00 24.15 ? 63  VAL A CB    1 
ATOM   1048 C CG1   . VAL C 2 62  ? 7.637   4.118   13.003  1.00 25.68 ? 63  VAL A CG1   1 
ATOM   1049 C CG2   . VAL C 2 62  ? 8.436   4.531   15.344  1.00 23.11 ? 63  VAL A CG2   1 
ATOM   1050 H H     . VAL C 2 62  ? 10.688  2.271   15.051  1.00 0.00  ? 63  VAL A H     1 
ATOM   1051 N N     . GLU C 2 63  ? 7.833   0.899   12.504  1.00 20.43 ? 64  GLU A N     1 
ATOM   1052 C CA    . GLU C 2 63  ? 7.880   0.222   11.221  1.00 19.81 ? 64  GLU A CA    1 
ATOM   1053 C C     . GLU C 2 63  ? 6.759   0.629   10.287  1.00 20.69 ? 64  GLU A C     1 
ATOM   1054 O O     . GLU C 2 63  ? 5.613   0.818   10.710  1.00 20.29 ? 64  GLU A O     1 
ATOM   1055 C CB    . GLU C 2 63  ? 7.864   -1.272  11.389  1.00 21.90 ? 64  GLU A CB    1 
ATOM   1056 C CG    . GLU C 2 63  ? 9.005   -1.745  12.216  1.00 29.32 ? 64  GLU A CG    1 
ATOM   1057 C CD    . GLU C 2 63  ? 9.047   -3.235  12.310  1.00 31.37 ? 64  GLU A CD    1 
ATOM   1058 O OE1   . GLU C 2 63  ? 8.201   -3.895  11.662  1.00 34.52 ? 64  GLU A OE1   1 
ATOM   1059 O OE2   . GLU C 2 63  ? 9.939   -3.744  13.021  1.00 34.21 ? 64  GLU A OE2   1 
ATOM   1060 H H     . GLU C 2 63  ? 7.011   0.858   13.035  1.00 0.00  ? 64  GLU A H     1 
ATOM   1061 N N     . GLU C 2 64  ? 7.109   0.742   9.006   1.00 19.69 ? 65  GLU A N     1 
ATOM   1062 C CA    . GLU C 2 64  ? 6.198   1.124   7.938   1.00 16.87 ? 65  GLU A CA    1 
ATOM   1063 C C     . GLU C 2 64  ? 5.979   -0.132  7.136   1.00 17.23 ? 65  GLU A C     1 
ATOM   1064 O O     . GLU C 2 64  ? 6.807   -1.028  7.191   1.00 18.63 ? 65  GLU A O     1 
ATOM   1065 C CB    . GLU C 2 64  ? 6.829   2.238   7.132   1.00 15.49 ? 65  GLU A CB    1 
ATOM   1066 C CG    . GLU C 2 64  ? 7.224   3.399   8.021   1.00 19.44 ? 65  GLU A CG    1 
ATOM   1067 C CD    . GLU C 2 64  ? 7.577   4.627   7.228   1.00 23.10 ? 65  GLU A CD    1 
ATOM   1068 O OE1   . GLU C 2 64  ? 8.725   4.727   6.749   1.00 27.42 ? 65  GLU A OE1   1 
ATOM   1069 O OE2   . GLU C 2 64  ? 6.690   5.484   7.048   1.00 27.39 ? 65  GLU A OE2   1 
ATOM   1070 H H     . GLU C 2 64  ? 8.026   0.517   8.753   1.00 0.00  ? 65  GLU A H     1 
ATOM   1071 N N     . PRO C 2 65  ? 4.863   -0.233  6.382   1.00 16.23 ? 66  PRO A N     1 
ATOM   1072 C CA    . PRO C 2 65  ? 4.624   -1.459  5.618   1.00 17.13 ? 66  PRO A CA    1 
ATOM   1073 C C     . PRO C 2 65  ? 5.626   -1.782  4.517   1.00 19.86 ? 66  PRO A C     1 
ATOM   1074 O O     . PRO C 2 65  ? 6.285   -0.897  3.963   1.00 22.35 ? 66  PRO A O     1 
ATOM   1075 C CB    . PRO C 2 65  ? 3.214   -1.262  5.077   1.00 15.79 ? 66  PRO A CB    1 
ATOM   1076 C CG    . PRO C 2 65  ? 2.656   -0.081  5.864   1.00 14.47 ? 66  PRO A CG    1 
ATOM   1077 C CD    . PRO C 2 65  ? 3.807   0.765   6.140   1.00 13.15 ? 66  PRO A CD    1 
ATOM   1078 N N     . LYS C 2 66  ? 5.747   -3.068  4.226   1.00 23.16 ? 67  LYS A N     1 
ATOM   1079 C CA    . LYS C 2 66  ? 6.666   -3.522  3.204   1.00 27.96 ? 67  LYS A CA    1 
ATOM   1080 C C     . LYS C 2 66  ? 5.963   -3.526  1.850   1.00 31.23 ? 67  LYS A C     1 
ATOM   1081 O O     . LYS C 2 66  ? 6.603   -3.311  0.821   1.00 33.02 ? 67  LYS A O     1 
ATOM   1082 C CB    . LYS C 2 66  ? 7.235   -4.909  3.547   1.00 29.42 ? 67  LYS A CB    1 
ATOM   1083 H H     . LYS C 2 66  ? 5.205   -3.721  4.713   1.00 0.00  ? 67  LYS A H     1 
ATOM   1084 N N     . GLN C 2 67  ? 4.640   -3.696  1.873   1.00 32.62 ? 68  GLN A N     1 
ATOM   1085 C CA    . GLN C 2 67  ? 3.831   -3.712  0.663   1.00 34.15 ? 68  GLN A CA    1 
ATOM   1086 C C     . GLN C 2 67  ? 2.813   -2.585  0.688   1.00 34.24 ? 68  GLN A C     1 
ATOM   1087 O O     . GLN C 2 67  ? 2.428   -2.108  1.753   1.00 31.70 ? 68  GLN A O     1 
ATOM   1088 C CB    . GLN C 2 67  ? 3.045   -5.003  0.591   1.00 38.56 ? 68  GLN A CB    1 
ATOM   1089 C CG    . GLN C 2 67  ? 3.732   -6.168  1.232   1.00 45.41 ? 68  GLN A CG    1 
ATOM   1090 C CD    . GLN C 2 67  ? 4.136   -7.226  0.233   1.00 50.37 ? 68  GLN A CD    1 
ATOM   1091 O OE1   . GLN C 2 67  ? 4.237   -8.401  0.590   1.00 52.94 ? 68  GLN A OE1   1 
ATOM   1092 N NE2   . GLN C 2 67  ? 4.374   -6.824  -1.026  1.00 50.50 ? 68  GLN A NE2   1 
ATOM   1093 H H     . GLN C 2 67  ? 4.194   -3.763  2.738   1.00 0.00  ? 68  GLN A H     1 
ATOM   1094 H HE21  . GLN C 2 67  ? 4.636   -7.541  -1.636  1.00 0.00  ? 68  GLN A HE21  1 
ATOM   1095 H HE22  . GLN C 2 67  ? 4.294   -5.890  -1.304  1.00 0.00  ? 68  GLN A HE22  1 
ATOM   1096 N N     . GLN C 2 68  ? 2.384   -2.132  -0.484  1.00 34.51 ? 69  GLN A N     1 
ATOM   1097 C CA    . GLN C 2 68  ? 1.341   -1.116  -0.513  1.00 37.81 ? 69  GLN A CA    1 
ATOM   1098 C C     . GLN C 2 68  ? 0.103   -2.000  -0.395  1.00 39.64 ? 69  GLN A C     1 
ATOM   1099 O O     . GLN C 2 68  ? 0.063   -3.084  -1.010  1.00 42.86 ? 69  GLN A O     1 
ATOM   1100 C CB    . GLN C 2 68  ? 1.323   -0.345  -1.836  1.00 40.34 ? 69  GLN A CB    1 
ATOM   1101 C CG    . GLN C 2 68  ? 2.335   0.784   -1.890  1.00 43.65 ? 69  GLN A CG    1 
ATOM   1102 C CD    . GLN C 2 68  ? 2.213   1.647   -3.143  1.00 45.03 ? 69  GLN A CD    1 
ATOM   1103 O OE1   . GLN C 2 68  ? 3.046   1.553   -4.050  1.00 46.14 ? 69  GLN A OE1   1 
ATOM   1104 N NE2   . GLN C 2 68  ? 1.210   2.530   -3.171  1.00 42.34 ? 69  GLN A NE2   1 
ATOM   1105 H H     . GLN C 2 68  ? 2.737   -2.492  -1.322  1.00 0.00  ? 69  GLN A H     1 
ATOM   1106 H HE21  . GLN C 2 68  ? 1.038   3.036   -3.997  1.00 0.00  ? 69  GLN A HE21  1 
ATOM   1107 H HE22  . GLN C 2 68  ? 0.630   2.606   -2.385  1.00 0.00  ? 69  GLN A HE22  1 
ATOM   1108 N N     . ASN C 2 69  ? -0.844  -1.594  0.450   1.00 36.08 ? 70  ASN A N     1 
ATOM   1109 C CA    . ASN C 2 69  ? -2.093  -2.344  0.695   1.00 34.07 ? 70  ASN A CA    1 
ATOM   1110 C C     . ASN C 2 69  ? -2.037  -3.144  1.998   1.00 30.27 ? 70  ASN A C     1 
ATOM   1111 O O     . ASN C 2 69  ? -2.733  -4.149  2.156   1.00 29.40 ? 70  ASN A O     1 
ATOM   1112 C CB    . ASN C 2 69  ? -2.518  -3.244  -0.501  1.00 32.35 ? 70  ASN A CB    1 
ATOM   1113 H H     . ASN C 2 69  ? -0.719  -0.758  0.943   1.00 0.00  ? 70  ASN A H     1 
ATOM   1114 N N     . HIS C 2 70  ? -1.180  -2.708  2.918   1.00 26.78 ? 71  HIS A N     1 
ATOM   1115 C CA    . HIS C 2 70  ? -1.059  -3.333  4.226   1.00 22.45 ? 71  HIS A CA    1 
ATOM   1116 C C     . HIS C 2 70  ? -1.203  -2.249  5.267   1.00 19.10 ? 71  HIS A C     1 
ATOM   1117 O O     . HIS C 2 70  ? -0.568  -1.217  5.149   1.00 19.19 ? 71  HIS A O     1 
ATOM   1118 C CB    . HIS C 2 70  ? 0.292   -4.002  4.417   1.00 21.38 ? 71  HIS A CB    1 
ATOM   1119 C CG    . HIS C 2 70  ? 0.308   -5.437  4.011   1.00 23.75 ? 71  HIS A CG    1 
ATOM   1120 N ND1   . HIS C 2 70  ? 1.134   -6.369  4.598   1.00 27.30 ? 71  HIS A ND1   1 
ATOM   1121 C CD2   . HIS C 2 70  ? -0.436  -6.115  3.106   1.00 26.02 ? 71  HIS A CD2   1 
ATOM   1122 C CE1   . HIS C 2 70  ? 0.897   -7.562  4.080   1.00 28.35 ? 71  HIS A CE1   1 
ATOM   1123 N NE2   . HIS C 2 70  ? -0.052  -7.434  3.171   1.00 28.91 ? 71  HIS A NE2   1 
ATOM   1124 H H     . HIS C 2 70  ? -0.635  -1.911  2.755   1.00 0.00  ? 71  HIS A H     1 
ATOM   1125 H HD1   . HIS C 2 70  ? 1.820   -6.196  5.290   1.00 0.00  ? 71  HIS A HD1   1 
ATOM   1126 H HE2   . HIS C 2 70  ? -0.380  -8.150  2.572   1.00 0.00  ? 71  HIS A HE2   1 
ATOM   1127 N N     . TYR C 2 71  ? -2.114  -2.458  6.220   1.00 19.38 ? 72  TYR A N     1 
ATOM   1128 C CA    . TYR C 2 71  ? -2.373  -1.559  7.356   1.00 15.26 ? 72  TYR A CA    1 
ATOM   1129 C C     . TYR C 2 71  ? -1.420  -1.994  8.468   1.00 11.80 ? 72  TYR A C     1 
ATOM   1130 O O     . TYR C 2 71  ? -1.005  -3.156  8.493   1.00 12.05 ? 72  TYR A O     1 
ATOM   1131 C CB    . TYR C 2 71  ? -3.810  -1.792  7.831   1.00 14.44 ? 72  TYR A CB    1 
ATOM   1132 C CG    . TYR C 2 71  ? -4.154  -1.263  9.223   1.00 13.16 ? 72  TYR A CG    1 
ATOM   1133 C CD1   . TYR C 2 71  ? -4.626  0.017   9.388   1.00 9.77  ? 72  TYR A CD1   1 
ATOM   1134 C CD2   . TYR C 2 71  ? -4.048  -2.070  10.359  1.00 11.39 ? 72  TYR A CD2   1 
ATOM   1135 C CE1   . TYR C 2 71  ? -4.987  0.493   10.617  1.00 11.38 ? 72  TYR A CE1   1 
ATOM   1136 C CE2   . TYR C 2 71  ? -4.420  -1.585  11.621  1.00 9.47  ? 72  TYR A CE2   1 
ATOM   1137 C CZ    . TYR C 2 71  ? -4.887  -0.306  11.728  1.00 9.86  ? 72  TYR A CZ    1 
ATOM   1138 O OH    . TYR C 2 71  ? -5.267  0.223   12.935  1.00 14.41 ? 72  TYR A OH    1 
ATOM   1139 H H     . TYR C 2 71  ? -2.656  -3.272  6.170   1.00 0.00  ? 72  TYR A H     1 
ATOM   1140 H HH    . TYR C 2 71  ? -5.476  1.172   12.839  1.00 0.00  ? 72  TYR A HH    1 
ATOM   1141 N N     . PRO C 2 72  ? -0.941  -1.049  9.308   1.00 13.71 ? 73  PRO A N     1 
ATOM   1142 C CA    . PRO C 2 72  ? -1.223  0.401   9.281   1.00 13.45 ? 73  PRO A CA    1 
ATOM   1143 C C     . PRO C 2 72  ? -0.037  1.194   8.705   1.00 12.62 ? 73  PRO A C     1 
ATOM   1144 O O     . PRO C 2 72  ? 1.020   0.625   8.359   1.00 13.81 ? 73  PRO A O     1 
ATOM   1145 C CB    . PRO C 2 72  ? -1.441  0.731   10.765  1.00 10.87 ? 73  PRO A CB    1 
ATOM   1146 C CG    . PRO C 2 72  ? -0.431  -0.163  11.455  1.00 9.70  ? 73  PRO A CG    1 
ATOM   1147 C CD    . PRO C 2 72  ? -0.377  -1.451  10.622  1.00 12.72 ? 73  PRO A CD    1 
ATOM   1148 N N     . ASP C 2 73  ? -0.205  2.505   8.623   1.00 15.45 ? 74  ASP A N     1 
ATOM   1149 C CA    . ASP C 2 73  ? 0.867   3.380   8.144   1.00 17.27 ? 74  ASP A CA    1 
ATOM   1150 C C     . ASP C 2 73  ? 2.102   3.218   9.006   1.00 17.64 ? 74  ASP A C     1 
ATOM   1151 O O     . ASP C 2 73  ? 3.217   3.144   8.480   1.00 16.96 ? 74  ASP A O     1 
ATOM   1152 C CB    . ASP C 2 73  ? 0.451   4.849   8.207   1.00 14.67 ? 74  ASP A CB    1 
ATOM   1153 C CG    . ASP C 2 73  ? -0.649  5.178   7.251   1.00 14.95 ? 74  ASP A CG    1 
ATOM   1154 O OD1   . ASP C 2 73  ? -0.923  4.354   6.376   1.00 19.38 ? 74  ASP A OD1   1 
ATOM   1155 O OD2   . ASP C 2 73  ? -1.227  6.272   7.356   1.00 13.44 ? 74  ASP A OD2   1 
ATOM   1156 H H     . ASP C 2 73  ? -1.037  2.918   8.909   1.00 0.00  ? 74  ASP A H     1 
ATOM   1157 N N     . PHE C 2 74  ? 1.877   3.143   10.326  1.00 18.76 ? 75  PHE A N     1 
ATOM   1158 C CA    . PHE C 2 74  ? 2.936   3.013   11.323  1.00 18.07 ? 75  PHE A CA    1 
ATOM   1159 C C     . PHE C 2 74  ? 2.627   2.002   12.424  1.00 17.77 ? 75  PHE A C     1 
ATOM   1160 O O     . PHE C 2 74  ? 1.561   2.029   13.021  1.00 15.12 ? 75  PHE A O     1 
ATOM   1161 C CB    . PHE C 2 74  ? 3.175   4.376   11.986  1.00 20.72 ? 75  PHE A CB    1 
ATOM   1162 C CG    . PHE C 2 74  ? 3.516   5.468   11.022  1.00 25.17 ? 75  PHE A CG    1 
ATOM   1163 C CD1   . PHE C 2 74  ? 4.704   5.432   10.294  1.00 29.16 ? 75  PHE A CD1   1 
ATOM   1164 C CD2   . PHE C 2 74  ? 2.628   6.512   10.784  1.00 26.00 ? 75  PHE A CD2   1 
ATOM   1165 C CE1   . PHE C 2 74  ? 4.988   6.419   9.338   1.00 27.49 ? 75  PHE A CE1   1 
ATOM   1166 C CE2   . PHE C 2 74  ? 2.917   7.503   9.830   1.00 25.14 ? 75  PHE A CE2   1 
ATOM   1167 C CZ    . PHE C 2 74  ? 4.087   7.450   9.115   1.00 27.45 ? 75  PHE A CZ    1 
ATOM   1168 H H     . PHE C 2 74  ? 0.959   3.182   10.667  1.00 0.00  ? 75  PHE A H     1 
ATOM   1169 N N     . THR C 2 75  ? 3.555   1.079   12.646  1.00 19.18 ? 76  THR A N     1 
ATOM   1170 C CA    . THR C 2 75  ? 3.470   0.083   13.710  1.00 20.10 ? 76  THR A CA    1 
ATOM   1171 C C     . THR C 2 75  ? 4.541   0.482   14.750  1.00 21.22 ? 76  THR A C     1 
ATOM   1172 O O     . THR C 2 75  ? 5.716   0.585   14.421  1.00 20.88 ? 76  THR A O     1 
ATOM   1173 C CB    . THR C 2 75  ? 3.828   -1.356  13.234  1.00 19.00 ? 76  THR A CB    1 
ATOM   1174 O OG1   . THR C 2 75  ? 2.897   -1.807  12.250  1.00 20.00 ? 76  THR A OG1   1 
ATOM   1175 C CG2   . THR C 2 75  ? 3.766   -2.331  14.406  1.00 19.75 ? 76  THR A CG2   1 
ATOM   1176 H H     . THR C 2 75  ? 4.344   1.051   12.077  1.00 0.00  ? 76  THR A H     1 
ATOM   1177 H HG1   . THR C 2 75  ? 3.084   -1.411  11.387  1.00 0.00  ? 76  THR A HG1   1 
ATOM   1178 N N     . LEU C 2 76  ? 4.137   0.771   15.976  1.00 23.02 ? 77  LEU A N     1 
ATOM   1179 C CA    . LEU C 2 76  ? 5.099   1.106   17.025  1.00 25.78 ? 77  LEU A CA    1 
ATOM   1180 C C     . LEU C 2 76  ? 5.093   0.015   18.083  1.00 28.09 ? 77  LEU A C     1 
ATOM   1181 O O     . LEU C 2 76  ? 4.028   -0.536  18.391  1.00 27.24 ? 77  LEU A O     1 
ATOM   1182 C CB    . LEU C 2 76  ? 4.763   2.445   17.690  1.00 24.25 ? 77  LEU A CB    1 
ATOM   1183 C CG    . LEU C 2 76  ? 5.082   3.681   16.862  1.00 25.52 ? 77  LEU A CG    1 
ATOM   1184 C CD1   . LEU C 2 76  ? 4.295   3.632   15.578  1.00 26.78 ? 77  LEU A CD1   1 
ATOM   1185 C CD2   . LEU C 2 76  ? 4.744   4.934   17.636  1.00 26.45 ? 77  LEU A CD2   1 
ATOM   1186 H H     . LEU C 2 76  ? 3.189   0.743   16.195  1.00 0.00  ? 77  LEU A H     1 
ATOM   1187 N N     . TYR C 2 77  ? 6.278   -0.328  18.600  1.00 30.35 ? 78  TYR A N     1 
ATOM   1188 C CA    . TYR C 2 77  ? 6.419   -1.340  19.654  1.00 32.22 ? 78  TYR A CA    1 
ATOM   1189 C C     . TYR C 2 77  ? 7.768   -1.354  20.342  1.00 32.99 ? 78  TYR A C     1 
ATOM   1190 O O     . TYR C 2 77  ? 8.728   -0.766  19.856  1.00 33.06 ? 78  TYR A O     1 
ATOM   1191 C CB    . TYR C 2 77  ? 6.124   -2.744  19.140  1.00 31.96 ? 78  TYR A CB    1 
ATOM   1192 C CG    . TYR C 2 77  ? 7.126   -3.316  18.169  1.00 32.02 ? 78  TYR A CG    1 
ATOM   1193 C CD1   . TYR C 2 77  ? 7.149   -2.903  16.823  1.00 32.77 ? 78  TYR A CD1   1 
ATOM   1194 C CD2   . TYR C 2 77  ? 7.988   -4.334  18.561  1.00 32.02 ? 78  TYR A CD2   1 
ATOM   1195 C CE1   . TYR C 2 77  ? 8.003   -3.509  15.893  1.00 30.97 ? 78  TYR A CE1   1 
ATOM   1196 C CE2   . TYR C 2 77  ? 8.850   -4.940  17.645  1.00 32.04 ? 78  TYR A CE2   1 
ATOM   1197 C CZ    . TYR C 2 77  ? 8.848   -4.527  16.313  1.00 33.20 ? 78  TYR A CZ    1 
ATOM   1198 O OH    . TYR C 2 77  ? 9.682   -5.154  15.412  1.00 34.49 ? 78  TYR A OH    1 
ATOM   1199 H H     . TYR C 2 77  ? 7.094   0.102   18.251  1.00 0.00  ? 78  TYR A H     1 
ATOM   1200 H HH    . TYR C 2 77  ? 10.144  -5.874  15.849  1.00 0.00  ? 78  TYR A HH    1 
ATOM   1201 N N     . LYS C 2 78  ? 7.828   -2.016  21.499  1.00 34.19 ? 79  LYS A N     1 
ATOM   1202 C CA    . LYS C 2 78  ? 9.075   -2.145  22.236  1.00 33.20 ? 79  LYS A CA    1 
ATOM   1203 C C     . LYS C 2 78  ? 9.638   -3.539  21.987  1.00 31.91 ? 79  LYS A C     1 
ATOM   1204 O O     . LYS C 2 78  ? 8.892   -4.521  21.905  1.00 31.40 ? 79  LYS A O     1 
ATOM   1205 C CB    . LYS C 2 78  ? 8.851   -1.895  23.717  1.00 34.62 ? 79  LYS A CB    1 
ATOM   1206 C CG    . LYS C 2 78  ? 8.464   -0.476  23.987  1.00 36.07 ? 79  LYS A CG    1 
ATOM   1207 C CD    . LYS C 2 78  ? 8.477   -0.150  25.460  1.00 41.60 ? 79  LYS A CD    1 
ATOM   1208 C CE    . LYS C 2 78  ? 8.127   1.308   25.664  1.00 42.60 ? 79  LYS A CE    1 
ATOM   1209 N NZ    . LYS C 2 78  ? 8.225   1.724   27.084  1.00 47.67 ? 79  LYS A NZ    1 
ATOM   1210 H H     . LYS C 2 78  ? 7.023   -2.456  21.844  1.00 0.00  ? 79  LYS A H     1 
ATOM   1211 H HZ1   . LYS C 2 78  ? 9.197   1.569   27.417  1.00 0.00  ? 79  LYS A HZ1   1 
ATOM   1212 H HZ2   . LYS C 2 78  ? 7.980   2.731   27.167  1.00 0.00  ? 79  LYS A HZ2   1 
ATOM   1213 H HZ3   . LYS C 2 78  ? 7.568   1.152   27.651  1.00 0.00  ? 79  LYS A HZ3   1 
ATOM   1214 N N     . PRO C 2 79  ? 10.967  -3.639  21.800  1.00 32.70 ? 80  PRO A N     1 
ATOM   1215 C CA    . PRO C 2 79  ? 11.645  -4.922  21.549  1.00 33.07 ? 80  PRO A CA    1 
ATOM   1216 C C     . PRO C 2 79  ? 11.439  -5.928  22.682  1.00 33.21 ? 80  PRO A C     1 
ATOM   1217 O O     . PRO C 2 79  ? 11.658  -7.123  22.523  1.00 30.82 ? 80  PRO A O     1 
ATOM   1218 C CB    . PRO C 2 79  ? 13.125  -4.510  21.433  1.00 34.50 ? 80  PRO A CB    1 
ATOM   1219 C CG    . PRO C 2 79  ? 13.061  -3.104  20.901  1.00 34.39 ? 80  PRO A CG    1 
ATOM   1220 C CD    . PRO C 2 79  ? 11.914  -2.505  21.705  1.00 32.51 ? 80  PRO A CD    1 
ATOM   1221 N N     . SER C 2 80  ? 11.057  -5.413  23.839  1.00 33.90 ? 81  SER A N     1 
ATOM   1222 C CA    . SER C 2 80  ? 10.816  -6.218  25.018  1.00 36.72 ? 81  SER A CA    1 
ATOM   1223 C C     . SER C 2 80  ? 9.378   -6.697  25.143  1.00 39.44 ? 81  SER A C     1 
ATOM   1224 O O     . SER C 2 80  ? 9.102   -7.689  25.818  1.00 42.64 ? 81  SER A O     1 
ATOM   1225 C CB    . SER C 2 80  ? 11.152  -5.383  26.238  1.00 36.40 ? 81  SER A CB    1 
ATOM   1226 O OG    . SER C 2 80  ? 10.616  -4.075  26.086  1.00 38.27 ? 81  SER A OG    1 
ATOM   1227 H H     . SER C 2 80  ? 10.939  -4.450  23.962  1.00 0.00  ? 81  SER A H     1 
ATOM   1228 H HG    . SER C 2 80  ? 10.796  -3.627  26.928  1.00 0.00  ? 81  SER A HG    1 
ATOM   1229 N N     . GLU C 2 81  ? 8.453   -5.973  24.530  1.00 39.41 ? 82  GLU A N     1 
ATOM   1230 C CA    . GLU C 2 81  ? 7.042   -6.320  24.610  1.00 38.14 ? 82  GLU A CA    1 
ATOM   1231 C C     . GLU C 2 81  ? 6.454   -6.308  23.194  1.00 39.35 ? 82  GLU A C     1 
ATOM   1232 O O     . GLU C 2 81  ? 5.576   -5.505  22.862  1.00 40.52 ? 82  GLU A O     1 
ATOM   1233 C CB    . GLU C 2 81  ? 6.324   -5.335  25.550  1.00 35.33 ? 82  GLU A CB    1 
ATOM   1234 H H     . GLU C 2 81  ? 8.714   -5.204  23.985  1.00 0.00  ? 82  GLU A H     1 
ATOM   1235 N N     . PRO C 2 82  ? 6.941   -7.219  22.339  1.00 39.62 ? 83  PRO A N     1 
ATOM   1236 C CA    . PRO C 2 82  ? 6.508   -7.359  20.937  1.00 39.98 ? 83  PRO A CA    1 
ATOM   1237 C C     . PRO C 2 82  ? 4.991   -7.378  20.760  1.00 39.61 ? 83  PRO A C     1 
ATOM   1238 O O     . PRO C 2 82  ? 4.445   -6.577  20.024  1.00 40.94 ? 83  PRO A O     1 
ATOM   1239 C CB    . PRO C 2 82  ? 7.101   -8.716  20.524  1.00 41.05 ? 83  PRO A CB    1 
ATOM   1240 C CG    . PRO C 2 82  ? 8.295   -8.880  21.428  1.00 40.29 ? 83  PRO A CG    1 
ATOM   1241 C CD    . PRO C 2 82  ? 7.819   -8.337  22.743  1.00 39.50 ? 83  PRO A CD    1 
ATOM   1242 N N     . ASN C 2 83  ? 4.318   -8.277  21.468  1.00 38.56 ? 84  ASN A N     1 
ATOM   1243 C CA    . ASN C 2 83  ? 2.873   -8.439  21.382  1.00 35.84 ? 84  ASN A CA    1 
ATOM   1244 C C     . ASN C 2 83  ? 1.976   -7.324  21.903  1.00 31.60 ? 84  ASN A C     1 
ATOM   1245 O O     . ASN C 2 83  ? 0.780   -7.532  22.103  1.00 31.32 ? 84  ASN A O     1 
ATOM   1246 C CB    . ASN C 2 83  ? 2.464   -9.778  21.997  1.00 40.10 ? 84  ASN A CB    1 
ATOM   1247 C CG    . ASN C 2 83  ? 2.264   -10.859 20.950  1.00 44.06 ? 84  ASN A CG    1 
ATOM   1248 O OD1   . ASN C 2 83  ? 3.198   -11.223 20.215  1.00 47.83 ? 84  ASN A OD1   1 
ATOM   1249 N ND2   . ASN C 2 83  ? 1.030   -11.366 20.851  1.00 46.72 ? 84  ASN A ND2   1 
ATOM   1250 H H     . ASN C 2 83  ? 4.816   -8.864  22.065  1.00 0.00  ? 84  ASN A H     1 
ATOM   1251 H HD21  . ASN C 2 83  ? 0.893   -12.070 20.187  1.00 0.00  ? 84  ASN A HD21  1 
ATOM   1252 H HD22  . ASN C 2 83  ? 0.325   -11.012 21.435  1.00 0.00  ? 84  ASN A HD22  1 
ATOM   1253 N N     . LYS C 2 84  ? 2.557   -6.160  22.158  1.00 28.85 ? 85  LYS A N     1 
ATOM   1254 C CA    . LYS C 2 84  ? 1.810   -4.992  22.601  1.00 24.65 ? 85  LYS A CA    1 
ATOM   1255 C C     . LYS C 2 84  ? 2.013   -3.851  21.557  1.00 22.77 ? 85  LYS A C     1 
ATOM   1256 O O     . LYS C 2 84  ? 2.325   -2.696  21.906  1.00 23.13 ? 85  LYS A O     1 
ATOM   1257 C CB    . LYS C 2 84  ? 2.254   -4.545  24.013  1.00 23.37 ? 85  LYS A CB    1 
ATOM   1258 C CG    . LYS C 2 84  ? 1.789   -5.442  25.155  1.00 23.36 ? 85  LYS A CG    1 
ATOM   1259 H H     . LYS C 2 84  ? 3.520   -6.037  22.023  1.00 0.00  ? 85  LYS A H     1 
ATOM   1260 N N     . LYS C 2 85  ? 1.766   -4.157  20.286  1.00 20.21 ? 86  LYS A N     1 
ATOM   1261 C CA    . LYS C 2 85  ? 1.946   -3.169  19.232  1.00 16.87 ? 86  LYS A CA    1 
ATOM   1262 C C     . LYS C 2 85  ? 0.903   -2.063  19.163  1.00 16.40 ? 86  LYS A C     1 
ATOM   1263 O O     . LYS C 2 85  ? -0.218  -2.217  19.620  1.00 15.82 ? 86  LYS A O     1 
ATOM   1264 C CB    . LYS C 2 85  ? 2.027   -3.869  17.890  1.00 15.45 ? 86  LYS A CB    1 
ATOM   1265 C CG    . LYS C 2 85  ? 2.952   -5.014  17.891  1.00 13.19 ? 86  LYS A CG    1 
ATOM   1266 C CD    . LYS C 2 85  ? 3.462   -5.254  16.512  1.00 12.65 ? 86  LYS A CD    1 
ATOM   1267 C CE    . LYS C 2 85  ? 4.747   -6.038  16.541  1.00 11.78 ? 86  LYS A CE    1 
ATOM   1268 N NZ    . LYS C 2 85  ? 4.415   -7.463  16.524  1.00 13.93 ? 86  LYS A NZ    1 
ATOM   1269 H H     . LYS C 2 85  ? 1.452   -5.057  20.060  1.00 0.00  ? 86  LYS A H     1 
ATOM   1270 H HZ1   . LYS C 2 85  ? 3.806   -7.674  17.342  1.00 0.00  ? 86  LYS A HZ1   1 
ATOM   1271 H HZ2   . LYS C 2 85  ? 3.897   -7.680  15.648  1.00 0.00  ? 86  LYS A HZ2   1 
ATOM   1272 H HZ3   . LYS C 2 85  ? 5.284   -8.034  16.579  1.00 0.00  ? 86  LYS A HZ3   1 
ATOM   1273 N N     . ILE C 2 86  ? 1.290   -0.931  18.599  1.00 15.76 ? 87  ILE A N     1 
ATOM   1274 C CA    . ILE C 2 86  ? 0.388   0.200   18.445  1.00 17.75 ? 87  ILE A CA    1 
ATOM   1275 C C     . ILE C 2 86  ? 0.301   0.565   16.965  1.00 19.69 ? 87  ILE A C     1 
ATOM   1276 O O     . ILE C 2 86  ? 1.343   0.747   16.312  1.00 19.64 ? 87  ILE A O     1 
ATOM   1277 C CB    . ILE C 2 86  ? 0.855   1.435   19.191  1.00 16.58 ? 87  ILE A CB    1 
ATOM   1278 C CG1   . ILE C 2 86  ? 0.987   1.135   20.696  1.00 15.31 ? 87  ILE A CG1   1 
ATOM   1279 C CG2   . ILE C 2 86  ? -0.122  2.583   18.908  1.00 17.31 ? 87  ILE A CG2   1 
ATOM   1280 C CD1   . ILE C 2 86  ? 1.227   2.376   21.514  1.00 13.30 ? 87  ILE A CD1   1 
ATOM   1281 H H     . ILE C 2 86  ? 2.199   -0.848  18.255  1.00 0.00  ? 87  ILE A H     1 
ATOM   1282 N N     . ALA C 2 87  ? -0.936  0.671   16.453  1.00 19.61 ? 88  ALA A N     1 
ATOM   1283 C CA    . ALA C 2 87  ? -1.189  0.971   15.042  1.00 15.26 ? 88  ALA A CA    1 
ATOM   1284 C C     . ALA C 2 87  ? -1.611  2.403   14.887  1.00 14.54 ? 88  ALA A C     1 
ATOM   1285 O O     . ALA C 2 87  ? -2.404  2.915   15.684  1.00 17.36 ? 88  ALA A O     1 
ATOM   1286 C CB    . ALA C 2 87  ? -2.248  0.050   14.473  1.00 10.34 ? 88  ALA A CB    1 
ATOM   1287 H H     . ALA C 2 87  ? -1.706  0.590   17.049  1.00 0.00  ? 88  ALA A H     1 
ATOM   1288 N N     . ILE C 2 88  ? -1.009  3.083   13.912  1.00 16.05 ? 89  ILE A N     1 
ATOM   1289 C CA    . ILE C 2 88  ? -1.352  4.465   13.630  1.00 15.41 ? 89  ILE A CA    1 
ATOM   1290 C C     . ILE C 2 88  ? -1.556  4.612   12.120  1.00 15.09 ? 89  ILE A C     1 
ATOM   1291 O O     . ILE C 2 88  ? -0.722  4.177   11.352  1.00 13.93 ? 89  ILE A O     1 
ATOM   1292 C CB    . ILE C 2 88  ? -0.230  5.437   14.074  1.00 15.63 ? 89  ILE A CB    1 
ATOM   1293 C CG1   . ILE C 2 88  ? 0.133   5.202   15.547  1.00 17.35 ? 89  ILE A CG1   1 
ATOM   1294 C CG2   . ILE C 2 88  ? -0.668  6.871   13.842  1.00 14.74 ? 89  ILE A CG2   1 
ATOM   1295 C CD1   . ILE C 2 88  ? 1.389   5.950   15.979  1.00 18.12 ? 89  ILE A CD1   1 
ATOM   1296 H H     . ILE C 2 88  ? -0.310  2.655   13.373  1.00 0.00  ? 89  ILE A H     1 
ATOM   1297 N N     . ASP C 2 89  ? -2.696  5.167   11.720  1.00 15.30 ? 90  ASP A N     1 
ATOM   1298 C CA    . ASP C 2 89  ? -3.043  5.416   10.322  1.00 14.33 ? 90  ASP A CA    1 
ATOM   1299 C C     . ASP C 2 89  ? -3.332  6.896   10.308  1.00 13.16 ? 90  ASP A C     1 
ATOM   1300 O O     . ASP C 2 89  ? -3.941  7.392   11.229  1.00 10.62 ? 90  ASP A O     1 
ATOM   1301 C CB    . ASP C 2 89  ? -4.357  4.723   9.959   1.00 16.65 ? 90  ASP A CB    1 
ATOM   1302 C CG    . ASP C 2 89  ? -4.190  3.582   8.991   1.00 18.12 ? 90  ASP A CG    1 
ATOM   1303 O OD1   . ASP C 2 89  ? -3.050  3.178   8.650   1.00 19.83 ? 90  ASP A OD1   1 
ATOM   1304 O OD2   . ASP C 2 89  ? -5.244  3.063   8.577   1.00 20.61 ? 90  ASP A OD2   1 
ATOM   1305 H H     . ASP C 2 89  ? -3.331  5.453   12.414  1.00 0.00  ? 90  ASP A H     1 
ATOM   1306 N N     . ILE C 2 90  ? -2.896  7.590   9.262   1.00 12.24 ? 91  ILE A N     1 
ATOM   1307 C CA    . ILE C 2 90  ? -3.140  9.017   9.089   1.00 12.23 ? 91  ILE A CA    1 
ATOM   1308 C C     . ILE C 2 90  ? -4.368  9.116   8.160   1.00 12.55 ? 91  ILE A C     1 
ATOM   1309 O O     . ILE C 2 90  ? -4.435  8.396   7.161   1.00 13.77 ? 91  ILE A O     1 
ATOM   1310 C CB    . ILE C 2 90  ? -1.942  9.706   8.344   1.00 13.58 ? 91  ILE A CB    1 
ATOM   1311 C CG1   . ILE C 2 90  ? -0.596  9.227   8.911   1.00 13.03 ? 91  ILE A CG1   1 
ATOM   1312 C CG2   . ILE C 2 90  ? -2.081  11.259  8.352   1.00 6.94  ? 91  ILE A CG2   1 
ATOM   1313 C CD1   . ILE C 2 90  ? -0.201  9.870   10.194  1.00 13.13 ? 91  ILE A CD1   1 
ATOM   1314 H H     . ILE C 2 90  ? -2.447  7.126   8.550   1.00 0.00  ? 91  ILE A H     1 
ATOM   1315 N N     . LYS C 2 91  ? -5.339  9.973   8.476   1.00 11.06 ? 92  LYS A N     1 
ATOM   1316 C CA    . LYS C 2 91  ? -6.495  10.123  7.632   1.00 9.84  ? 92  LYS A CA    1 
ATOM   1317 C C     . LYS C 2 91  ? -6.639  11.597  7.395   1.00 11.02 ? 92  LYS A C     1 
ATOM   1318 O O     . LYS C 2 91  ? -6.266  12.417  8.228   1.00 11.11 ? 92  LYS A O     1 
ATOM   1319 C CB    . LYS C 2 91  ? -7.762  9.515   8.242   1.00 10.20 ? 92  LYS A CB    1 
ATOM   1320 C CG    . LYS C 2 91  ? -7.698  7.990   8.472   1.00 9.64  ? 92  LYS A CG    1 
ATOM   1321 C CD    . LYS C 2 91  ? -7.678  7.260   7.159   1.00 11.67 ? 92  LYS A CD    1 
ATOM   1322 C CE    . LYS C 2 91  ? -7.651  5.774   7.329   1.00 9.39  ? 92  LYS A CE    1 
ATOM   1323 N NZ    . LYS C 2 91  ? -7.379  5.119   6.023   1.00 13.28 ? 92  LYS A NZ    1 
ATOM   1324 H H     . LYS C 2 91  ? -5.269  10.559  9.258   1.00 0.00  ? 92  LYS A H     1 
ATOM   1325 H HZ1   . LYS C 2 91  ? -8.117  5.375   5.337   1.00 0.00  ? 92  LYS A HZ1   1 
ATOM   1326 H HZ2   . LYS C 2 91  ? -6.452  5.432   5.670   1.00 0.00  ? 92  LYS A HZ2   1 
ATOM   1327 H HZ3   . LYS C 2 91  ? -7.367  4.085   6.144   1.00 0.00  ? 92  LYS A HZ3   1 
ATOM   1328 N N     . THR C 2 92  ? -7.108  11.925  6.196   1.00 12.67 ? 93  THR A N     1 
ATOM   1329 C CA    . THR C 2 92  ? -7.279  13.294  5.754   1.00 10.78 ? 93  THR A CA    1 
ATOM   1330 C C     . THR C 2 92  ? -8.662  13.535  5.122   1.00 9.84  ? 93  THR A C     1 
ATOM   1331 O O     . THR C 2 92  ? -9.259  12.669  4.475   1.00 9.63  ? 93  THR A O     1 
ATOM   1332 C CB    . THR C 2 92  ? -6.187  13.648  4.696   1.00 9.93  ? 93  THR A CB    1 
ATOM   1333 O OG1   . THR C 2 92  ? -4.896  13.240  5.166   1.00 10.53 ? 93  THR A OG1   1 
ATOM   1334 C CG2   . THR C 2 92  ? -6.151  15.110  4.417   1.00 9.01  ? 93  THR A CG2   1 
ATOM   1335 H H     . THR C 2 92  ? -7.363  11.210  5.577   1.00 0.00  ? 93  THR A H     1 
ATOM   1336 H HG1   . THR C 2 92  ? -4.710  13.688  5.999   1.00 0.00  ? 93  THR A HG1   1 
ATOM   1337 N N     . THR C 2 93  ? -9.182  14.722  5.359   1.00 9.95  ? 94  THR A N     1 
ATOM   1338 C CA    . THR C 2 93  ? -10.429 15.112  4.766   1.00 14.06 ? 94  THR A CA    1 
ATOM   1339 C C     . THR C 2 93  ? -10.424 16.627  4.712   1.00 13.12 ? 94  THR A C     1 
ATOM   1340 O O     . THR C 2 93  ? -9.661  17.279  5.413   1.00 11.40 ? 94  THR A O     1 
ATOM   1341 C CB    . THR C 2 93  ? -11.616 14.553  5.501   1.00 17.70 ? 94  THR A CB    1 
ATOM   1342 O OG1   . THR C 2 93  ? -12.753 14.690  4.650   1.00 21.75 ? 94  THR A OG1   1 
ATOM   1343 C CG2   . THR C 2 93  ? -11.872 15.312  6.809   1.00 19.83 ? 94  THR A CG2   1 
ATOM   1344 H H     . THR C 2 93  ? -8.726  15.373  5.946   1.00 0.00  ? 94  THR A H     1 
ATOM   1345 H HG1   . THR C 2 93  ? -13.501 14.239  5.078   1.00 0.00  ? 94  THR A HG1   1 
ATOM   1346 N N     . TYR C 2 94  ? -11.237 17.206  3.848   1.00 13.71 ? 95  TYR A N     1 
ATOM   1347 C CA    . TYR C 2 94  ? -11.227 18.651  3.739   1.00 14.65 ? 95  TYR A CA    1 
ATOM   1348 C C     . TYR C 2 94  ? -12.545 19.258  4.118   1.00 15.43 ? 95  TYR A C     1 
ATOM   1349 O O     . TYR C 2 94  ? -13.553 18.588  4.219   1.00 13.78 ? 95  TYR A O     1 
ATOM   1350 C CB    . TYR C 2 94  ? -10.847 19.069  2.317   1.00 17.86 ? 95  TYR A CB    1 
ATOM   1351 C CG    . TYR C 2 94  ? -11.957 18.916  1.307   1.00 21.71 ? 95  TYR A CG    1 
ATOM   1352 C CD1   . TYR C 2 94  ? -12.262 17.669  0.744   1.00 23.95 ? 95  TYR A CD1   1 
ATOM   1353 C CD2   . TYR C 2 94  ? -12.753 20.012  0.962   1.00 22.52 ? 95  TYR A CD2   1 
ATOM   1354 C CE1   . TYR C 2 94  ? -13.334 17.525  -0.124  1.00 25.71 ? 95  TYR A CE1   1 
ATOM   1355 C CE2   . TYR C 2 94  ? -13.821 19.880  0.098   1.00 24.35 ? 95  TYR A CE2   1 
ATOM   1356 C CZ    . TYR C 2 94  ? -14.115 18.640  -0.441  1.00 25.35 ? 95  TYR A CZ    1 
ATOM   1357 O OH    . TYR C 2 94  ? -15.211 18.532  -1.279  1.00 23.95 ? 95  TYR A OH    1 
ATOM   1358 H H     . TYR C 2 94  ? -11.874 16.682  3.323   1.00 0.00  ? 95  TYR A H     1 
ATOM   1359 H HH    . TYR C 2 94  ? -15.690 19.370  -1.290  1.00 0.00  ? 95  TYR A HH    1 
ATOM   1360 N N     . THR C 2 95  ? -12.561 20.555  4.282   1.00 16.94 ? 96  THR A N     1 
ATOM   1361 C CA    . THR C 2 95  ? -13.801 21.172  4.616   1.00 23.30 ? 96  THR A CA    1 
ATOM   1362 C C     . THR C 2 95  ? -13.901 22.424  3.757   1.00 27.07 ? 96  THR A C     1 
ATOM   1363 O O     . THR C 2 95  ? -12.888 22.893  3.229   1.00 27.14 ? 96  THR A O     1 
ATOM   1364 C CB    . THR C 2 95  ? -13.844 21.464  6.120   1.00 23.00 ? 96  THR A CB    1 
ATOM   1365 O OG1   . THR C 2 95  ? -15.212 21.561  6.534   1.00 27.67 ? 96  THR A OG1   1 
ATOM   1366 C CG2   . THR C 2 95  ? -13.075 22.745  6.481   1.00 22.12 ? 96  THR A CG2   1 
ATOM   1367 H H     . THR C 2 95  ? -11.767 21.115  4.157   1.00 0.00  ? 96  THR A H     1 
ATOM   1368 H HG1   . THR C 2 95  ? -15.256 21.669  7.489   1.00 0.00  ? 96  THR A HG1   1 
ATOM   1369 N N     . ASN C 2 96  ? -15.109 22.910  3.505   1.00 32.45 ? 97  ASN A N     1 
ATOM   1370 C CA    . ASN C 2 96  ? -15.210 24.121  2.697   1.00 38.22 ? 97  ASN A CA    1 
ATOM   1371 C C     . ASN C 2 96  ? -15.258 25.349  3.577   1.00 41.51 ? 97  ASN A C     1 
ATOM   1372 O O     . ASN C 2 96  ? -15.095 26.469  3.107   1.00 44.05 ? 97  ASN A O     1 
ATOM   1373 C CB    . ASN C 2 96  ? -16.394 24.087  1.741   1.00 37.15 ? 97  ASN A CB    1 
ATOM   1374 C CG    . ASN C 2 96  ? -16.012 23.546  0.389   1.00 37.59 ? 97  ASN A CG    1 
ATOM   1375 O OD1   . ASN C 2 96  ? -16.521 22.507  -0.047  1.00 39.62 ? 97  ASN A OD1   1 
ATOM   1376 N ND2   . ASN C 2 96  ? -15.093 24.237  -0.285  1.00 37.47 ? 97  ASN A ND2   1 
ATOM   1377 H H     . ASN C 2 96  ? -15.886 22.441  3.860   1.00 0.00  ? 97  ASN A H     1 
ATOM   1378 H HD21  . ASN C 2 96  ? -14.840 23.896  -1.166  1.00 0.00  ? 97  ASN A HD21  1 
ATOM   1379 H HD22  . ASN C 2 96  ? -14.714 25.047  0.118   1.00 0.00  ? 97  ASN A HD22  1 
ATOM   1380 N N     . LYS C 2 97  ? -15.425 25.129  4.868   1.00 44.47 ? 98  LYS A N     1 
ATOM   1381 C CA    . LYS C 2 97  ? -15.484 26.223  5.807   1.00 48.84 ? 98  LYS A CA    1 
ATOM   1382 C C     . LYS C 2 97  ? -15.220 25.585  7.143   1.00 50.97 ? 98  LYS A C     1 
ATOM   1383 O O     . LYS C 2 97  ? -15.448 24.390  7.312   1.00 51.61 ? 98  LYS A O     1 
ATOM   1384 C CB    . LYS C 2 97  ? -16.874 26.863  5.785   1.00 49.46 ? 98  LYS A CB    1 
ATOM   1385 H H     . LYS C 2 97  ? -15.505 24.222  5.240   1.00 0.00  ? 98  LYS A H     1 
ATOM   1386 N N     . GLU C 2 98  ? -14.679 26.357  8.072   1.00 53.64 ? 99  GLU A N     1 
ATOM   1387 C CA    . GLU C 2 98  ? -14.392 25.832  9.405   1.00 56.21 ? 99  GLU A CA    1 
ATOM   1388 C C     . GLU C 2 98  ? -15.707 25.621  10.152  1.00 56.35 ? 99  GLU A C     1 
ATOM   1389 O O     . GLU C 2 98  ? -16.706 26.285  9.849   1.00 56.85 ? 99  GLU A O     1 
ATOM   1390 C CB    . GLU C 2 98  ? -13.489 26.802  10.188  1.00 57.61 ? 99  GLU A CB    1 
ATOM   1391 H H     . GLU C 2 98  ? -14.491 27.293  7.864   1.00 0.00  ? 99  GLU A H     1 
ATOM   1392 N N     . ASN C 2 99  ? -15.696 24.680  11.096  1.00 55.95 ? 100 ASN A N     1 
ATOM   1393 C CA    . ASN C 2 99  ? -16.858 24.344  11.926  1.00 55.56 ? 100 ASN A CA    1 
ATOM   1394 C C     . ASN C 2 99  ? -17.751 23.238  11.364  1.00 55.44 ? 100 ASN A C     1 
ATOM   1395 O O     . ASN C 2 99  ? -18.112 22.306  12.085  1.00 57.52 ? 100 ASN A O     1 
ATOM   1396 C CB    . ASN C 2 99  ? -17.702 25.584  12.268  1.00 54.48 ? 100 ASN A CB    1 
ATOM   1397 H H     . ASN C 2 99  ? -14.877 24.169  11.237  1.00 0.00  ? 100 ASN A H     1 
ATOM   1398 N N     . GLU C 2 100 ? -18.085 23.310  10.084  1.00 53.57 ? 101 GLU A N     1 
ATOM   1399 C CA    . GLU C 2 100 ? -18.941 22.299  9.464   1.00 50.86 ? 101 GLU A CA    1 
ATOM   1400 C C     . GLU C 2 100 ? -18.458 20.853  9.668   1.00 45.78 ? 101 GLU A C     1 
ATOM   1401 O O     . GLU C 2 100 ? -17.270 20.598  9.830   1.00 46.58 ? 101 GLU A O     1 
ATOM   1402 C CB    . GLU C 2 100 ? -19.104 22.608  7.973   1.00 53.54 ? 101 GLU A CB    1 
ATOM   1403 C CG    . GLU C 2 100 ? -17.791 22.715  7.221   1.00 58.79 ? 101 GLU A CG    1 
ATOM   1404 C CD    . GLU C 2 100 ? -17.976 23.057  5.751   1.00 60.53 ? 101 GLU A CD    1 
ATOM   1405 O OE1   . GLU C 2 100 ? -18.495 24.163  5.464   1.00 61.31 ? 101 GLU A OE1   1 
ATOM   1406 O OE2   . GLU C 2 100 ? -17.602 22.221  4.890   1.00 61.54 ? 101 GLU A OE2   1 
ATOM   1407 H H     . GLU C 2 100 ? -17.739 24.059  9.550   1.00 0.00  ? 101 GLU A H     1 
ATOM   1408 N N     . LYS C 2 101 ? -19.410 19.929  9.686   1.00 40.15 ? 102 LYS A N     1 
ATOM   1409 C CA    . LYS C 2 101 ? -19.163 18.497  9.876   1.00 33.98 ? 102 LYS A CA    1 
ATOM   1410 C C     . LYS C 2 101 ? -18.224 17.862  8.862   1.00 30.48 ? 102 LYS A C     1 
ATOM   1411 O O     . LYS C 2 101 ? -18.249 18.185  7.677   1.00 31.08 ? 102 LYS A O     1 
ATOM   1412 C CB    . LYS C 2 101 ? -20.478 17.719  9.847   1.00 32.76 ? 102 LYS A CB    1 
ATOM   1413 C CG    . LYS C 2 101 ? -21.486 18.148  10.890  1.00 33.02 ? 102 LYS A CG    1 
ATOM   1414 C CD    . LYS C 2 101 ? -22.726 17.317  10.755  1.00 33.70 ? 102 LYS A CD    1 
ATOM   1415 C CE    . LYS C 2 101 ? -23.766 17.703  11.776  1.00 37.16 ? 102 LYS A CE    1 
ATOM   1416 N NZ    . LYS C 2 101 ? -24.965 16.843  11.587  1.00 35.00 ? 102 LYS A NZ    1 
ATOM   1417 H H     . LYS C 2 101 ? -20.323 20.218  9.506   1.00 0.00  ? 102 LYS A H     1 
ATOM   1418 H HZ1   . LYS C 2 101 ? -25.337 16.971  10.625  1.00 0.00  ? 102 LYS A HZ1   1 
ATOM   1419 H HZ2   . LYS C 2 101 ? -24.694 15.849  11.719  1.00 0.00  ? 102 LYS A HZ2   1 
ATOM   1420 H HZ3   . LYS C 2 101 ? -25.698 17.099  12.279  1.00 0.00  ? 102 LYS A HZ3   1 
ATOM   1421 N N     . ILE C 2 102 ? -17.497 16.858  9.332   1.00 25.11 ? 103 ILE A N     1 
ATOM   1422 C CA    . ILE C 2 102 ? -16.523 16.126  8.550   1.00 20.95 ? 103 ILE A CA    1 
ATOM   1423 C C     . ILE C 2 102 ? -16.731 14.661  8.850   1.00 17.02 ? 103 ILE A C     1 
ATOM   1424 O O     . ILE C 2 102 ? -17.500 14.321  9.727   1.00 17.26 ? 103 ILE A O     1 
ATOM   1425 C CB    . ILE C 2 102 ? -15.074 16.547  8.966   1.00 21.97 ? 103 ILE A CB    1 
ATOM   1426 C CG1   . ILE C 2 102 ? -14.893 16.393  10.484  1.00 21.78 ? 103 ILE A CG1   1 
ATOM   1427 C CG2   . ILE C 2 102 ? -14.866 18.032  8.647   1.00 22.14 ? 103 ILE A CG2   1 
ATOM   1428 C CD1   . ILE C 2 102 ? -13.493 16.645  11.013  1.00 22.47 ? 103 ILE A CD1   1 
ATOM   1429 H H     . ILE C 2 102 ? -17.608 16.561  10.255  1.00 0.00  ? 103 ILE A H     1 
ATOM   1430 N N     . LYS C 2 103 ? -16.098 13.793  8.083   1.00 16.24 ? 104 LYS A N     1 
ATOM   1431 C CA    . LYS C 2 103 ? -16.200 12.366  8.303   1.00 17.88 ? 104 LYS A CA    1 
ATOM   1432 C C     . LYS C 2 103 ? -15.026 11.792  7.559   1.00 14.06 ? 104 LYS A C     1 
ATOM   1433 O O     . LYS C 2 103 ? -14.555 12.408  6.618   1.00 15.30 ? 104 LYS A O     1 
ATOM   1434 C CB    . LYS C 2 103 ? -17.539 11.814  7.798   1.00 22.26 ? 104 LYS A CB    1 
ATOM   1435 C CG    . LYS C 2 103 ? -17.807 11.989  6.299   1.00 30.18 ? 104 LYS A CG    1 
ATOM   1436 C CD    . LYS C 2 103 ? -19.273 11.662  5.948   1.00 35.34 ? 104 LYS A CD    1 
ATOM   1437 C CE    . LYS C 2 103 ? -19.583 12.031  4.499   1.00 39.02 ? 104 LYS A CE    1 
ATOM   1438 N NZ    . LYS C 2 103 ? -19.234 13.471  4.208   1.00 43.65 ? 104 LYS A NZ    1 
ATOM   1439 H H     . LYS C 2 103 ? -15.533 14.096  7.331   1.00 0.00  ? 104 LYS A H     1 
ATOM   1440 H HZ1   . LYS C 2 103 ? -19.777 14.091  4.842   1.00 0.00  ? 104 LYS A HZ1   1 
ATOM   1441 H HZ2   . LYS C 2 103 ? -18.218 13.628  4.371   1.00 0.00  ? 104 LYS A HZ2   1 
ATOM   1442 H HZ3   . LYS C 2 103 ? -19.465 13.697  3.220   1.00 0.00  ? 104 LYS A HZ3   1 
ATOM   1443 N N     . PHE C 2 104 ? -14.532 10.644  7.998   1.00 11.15 ? 105 PHE A N     1 
ATOM   1444 C CA    . PHE C 2 104 ? -13.363 10.023  7.409   1.00 10.79 ? 105 PHE A CA    1 
ATOM   1445 C C     . PHE C 2 104 ? -13.711 8.603   7.000   1.00 10.47 ? 105 PHE A C     1 
ATOM   1446 O O     . PHE C 2 104 ? -14.728 8.060   7.444   1.00 13.43 ? 105 PHE A O     1 
ATOM   1447 C CB    . PHE C 2 104 ? -12.232 9.911   8.456   1.00 9.68  ? 105 PHE A CB    1 
ATOM   1448 C CG    . PHE C 2 104 ? -11.736 11.226  8.990   1.00 9.86  ? 105 PHE A CG    1 
ATOM   1449 C CD1   . PHE C 2 104 ? -12.425 11.891  10.005  1.00 11.48 ? 105 PHE A CD1   1 
ATOM   1450 C CD2   . PHE C 2 104 ? -10.577 11.805  8.487   1.00 12.07 ? 105 PHE A CD2   1 
ATOM   1451 C CE1   . PHE C 2 104 ? -11.987 13.097  10.505  1.00 6.98  ? 105 PHE A CE1   1 
ATOM   1452 C CE2   . PHE C 2 104 ? -10.129 13.035  8.993   1.00 8.76  ? 105 PHE A CE2   1 
ATOM   1453 C CZ    . PHE C 2 104 ? -10.853 13.671  10.009  1.00 10.33 ? 105 PHE A CZ    1 
ATOM   1454 H H     . PHE C 2 104 ? -14.984 10.169  8.706   1.00 0.00  ? 105 PHE A H     1 
ATOM   1455 N N     . THR C 2 105 ? -12.887 8.013   6.151   1.00 7.96  ? 106 THR A N     1 
ATOM   1456 C CA    . THR C 2 105 ? -13.062 6.632   5.753   1.00 9.43  ? 106 THR A CA    1 
ATOM   1457 C C     . THR C 2 105 ? -12.009 5.990   6.637   1.00 7.84  ? 106 THR A C     1 
ATOM   1458 O O     . THR C 2 105 ? -10.901 6.471   6.640   1.00 8.12  ? 106 THR A O     1 
ATOM   1459 C CB    . THR C 2 105 ? -12.667 6.378   4.265   1.00 9.69  ? 106 THR A CB    1 
ATOM   1460 O OG1   . THR C 2 105 ? -11.427 7.036   3.975   1.00 13.93 ? 106 THR A OG1   1 
ATOM   1461 C CG2   . THR C 2 105 ? -13.769 6.915   3.306   1.00 10.51 ? 106 THR A CG2   1 
ATOM   1462 H H     . THR C 2 105 ? -12.125 8.520   5.797   1.00 0.00  ? 106 THR A H     1 
ATOM   1463 H HG1   . THR C 2 105 ? -10.750 6.750   4.611   1.00 0.00  ? 106 THR A HG1   1 
ATOM   1464 N N     . LEU C 2 106 ? -12.290 4.854   7.273   1.00 8.64  ? 107 LEU A N     1 
ATOM   1465 C CA    . LEU C 2 106 ? -11.315 4.264   8.204   1.00 9.43  ? 107 LEU A CA    1 
ATOM   1466 C C     . LEU C 2 106 ? -10.795 2.907   7.877   1.00 11.63 ? 107 LEU A C     1 
ATOM   1467 O O     . LEU C 2 106 ? -10.492 2.157   8.787   1.00 14.60 ? 107 LEU A O     1 
ATOM   1468 C CB    . LEU C 2 106 ? -11.905 4.223   9.629   1.00 9.87  ? 107 LEU A CB    1 
ATOM   1469 C CG    . LEU C 2 106 ? -12.468 5.565   10.115  1.00 6.80  ? 107 LEU A CG    1 
ATOM   1470 C CD1   . LEU C 2 106 ? -13.217 5.463   11.425  1.00 9.03  ? 107 LEU A CD1   1 
ATOM   1471 C CD2   . LEU C 2 106 ? -11.337 6.567   10.206  1.00 10.13 ? 107 LEU A CD2   1 
ATOM   1472 H H     . LEU C 2 106 ? -13.134 4.392   7.123   1.00 0.00  ? 107 LEU A H     1 
ATOM   1473 N N     . GLY C 2 107 ? -10.758 2.531   6.604   1.00 9.71  ? 108 GLY A N     1 
ATOM   1474 C CA    . GLY C 2 107 ? -10.246 1.219   6.280   1.00 8.38  ? 108 GLY A CA    1 
ATOM   1475 C C     . GLY C 2 107 ? -11.351 0.206   6.058   1.00 9.18  ? 108 GLY A C     1 
ATOM   1476 O O     . GLY C 2 107 ? -12.490 0.466   6.388   1.00 10.67 ? 108 GLY A O     1 
ATOM   1477 H H     . GLY C 2 107 ? -11.051 3.133   5.885   1.00 0.00  ? 108 GLY A H     1 
ATOM   1478 N N     . GLY C 2 108 ? -11.014 -0.953  5.520   1.00 8.35  ? 109 GLY A N     1 
ATOM   1479 C CA    . GLY C 2 108 ? -12.018 -1.950  5.239   1.00 11.47 ? 109 GLY A CA    1 
ATOM   1480 C C     . GLY C 2 108 ? -12.527 -2.659  6.465   1.00 15.37 ? 109 GLY A C     1 
ATOM   1481 O O     . GLY C 2 108 ? -11.917 -2.572  7.527   1.00 17.91 ? 109 GLY A O     1 
ATOM   1482 H H     . GLY C 2 108 ? -10.062 -1.127  5.365   1.00 0.00  ? 109 GLY A H     1 
ATOM   1483 N N     . TYR C 2 109 ? -13.684 -3.300  6.345   1.00 15.41 ? 110 TYR A N     1 
ATOM   1484 C CA    . TYR C 2 109 ? -14.253 -4.079  7.448   1.00 15.80 ? 110 TYR A CA    1 
ATOM   1485 C C     . TYR C 2 109 ? -14.276 -5.515  7.032   1.00 15.47 ? 110 TYR A C     1 
ATOM   1486 O O     . TYR C 2 109 ? -14.846 -6.348  7.717   1.00 19.21 ? 110 TYR A O     1 
ATOM   1487 C CB    . TYR C 2 109 ? -15.669 -3.646  7.822   1.00 14.45 ? 110 TYR A CB    1 
ATOM   1488 C CG    . TYR C 2 109 ? -16.619 -3.501  6.664   1.00 12.71 ? 110 TYR A CG    1 
ATOM   1489 C CD1   . TYR C 2 109 ? -17.263 -4.600  6.111   1.00 8.99  ? 110 TYR A CD1   1 
ATOM   1490 C CD2   . TYR C 2 109 ? -16.892 -2.253  6.136   1.00 9.60  ? 110 TYR A CD2   1 
ATOM   1491 C CE1   . TYR C 2 109 ? -18.159 -4.451  5.047   1.00 12.16 ? 110 TYR A CE1   1 
ATOM   1492 C CE2   . TYR C 2 109 ? -17.798 -2.090  5.078   1.00 12.61 ? 110 TYR A CE2   1 
ATOM   1493 C CZ    . TYR C 2 109 ? -18.415 -3.192  4.547   1.00 9.61  ? 110 TYR A CZ    1 
ATOM   1494 O OH    . TYR C 2 109 ? -19.284 -3.011  3.502   1.00 14.70 ? 110 TYR A OH    1 
ATOM   1495 H H     . TYR C 2 109 ? -14.150 -3.229  5.484   1.00 0.00  ? 110 TYR A H     1 
ATOM   1496 H HH    . TYR C 2 109 ? -19.524 -2.081  3.470   1.00 0.00  ? 110 TYR A HH    1 
ATOM   1497 N N     . THR C 2 110 ? -13.596 -5.843  5.940   1.00 12.59 ? 111 THR A N     1 
ATOM   1498 C CA    . THR C 2 110 ? -13.634 -7.221  5.515   1.00 12.30 ? 111 THR A CA    1 
ATOM   1499 C C     . THR C 2 110 ? -12.261 -7.820  5.474   1.00 12.56 ? 111 THR A C     1 
ATOM   1500 O O     . THR C 2 110 ? -12.104 -8.947  5.010   1.00 14.13 ? 111 THR A O     1 
ATOM   1501 C CB    . THR C 2 110 ? -14.343 -7.380  4.098   1.00 13.17 ? 111 THR A CB    1 
ATOM   1502 O OG1   . THR C 2 110 ? -13.533 -6.796  3.071   1.00 16.55 ? 111 THR A OG1   1 
ATOM   1503 C CG2   . THR C 2 110 ? -15.703 -6.686  4.072   1.00 9.83  ? 111 THR A CG2   1 
ATOM   1504 H H     . THR C 2 110 ? -13.094 -5.199  5.392   1.00 0.00  ? 111 THR A H     1 
ATOM   1505 H HG1   . THR C 2 110 ? -13.900 -7.120  2.241   1.00 0.00  ? 111 THR A HG1   1 
ATOM   1506 N N     . SER C 2 111 ? -11.253 -7.092  5.964   1.00 13.93 ? 112 SER A N     1 
ATOM   1507 C CA    . SER C 2 111 ? -9.893  -7.606  5.910   1.00 15.85 ? 112 SER A CA    1 
ATOM   1508 C C     . SER C 2 111 ? -9.371  -8.136  7.260   1.00 18.73 ? 112 SER A C     1 
ATOM   1509 O O     . SER C 2 111 ? -9.911  -9.111  7.754   1.00 20.90 ? 112 SER A O     1 
ATOM   1510 C CB    . SER C 2 111 ? -8.951  -6.574  5.274   1.00 12.73 ? 112 SER A CB    1 
ATOM   1511 O OG    . SER C 2 111 ? -9.041  -5.306  5.905   1.00 11.05 ? 112 SER A OG    1 
ATOM   1512 H H     . SER C 2 111 ? -11.403 -6.224  6.386   1.00 0.00  ? 112 SER A H     1 
ATOM   1513 H HG    . SER C 2 111 ? -8.454  -4.744  5.387   1.00 0.00  ? 112 SER A HG    1 
ATOM   1514 N N     . PHE C 2 112 ? -8.379  -7.485  7.878   1.00 19.76 ? 113 PHE A N     1 
ATOM   1515 C CA    . PHE C 2 112 ? -7.803  -7.939  9.151   1.00 17.90 ? 113 PHE A CA    1 
ATOM   1516 C C     . PHE C 2 112 ? -8.745  -8.080  10.343  1.00 19.61 ? 113 PHE A C     1 
ATOM   1517 O O     . PHE C 2 112 ? -8.480  -8.901  11.246  1.00 19.95 ? 113 PHE A O     1 
ATOM   1518 C CB    . PHE C 2 112 ? -6.586  -7.105  9.550   1.00 14.82 ? 113 PHE A CB    1 
ATOM   1519 C CG    . PHE C 2 112 ? -6.837  -5.631  9.565   1.00 12.42 ? 113 PHE A CG    1 
ATOM   1520 C CD1   . PHE C 2 112 ? -7.382  -5.021  10.663  1.00 12.19 ? 113 PHE A CD1   1 
ATOM   1521 C CD2   . PHE C 2 112 ? -6.594  -4.864  8.440   1.00 12.77 ? 113 PHE A CD2   1 
ATOM   1522 C CE1   . PHE C 2 112 ? -7.692  -3.654  10.634  1.00 14.05 ? 113 PHE A CE1   1 
ATOM   1523 C CE2   . PHE C 2 112 ? -6.901  -3.524  8.409   1.00 11.15 ? 113 PHE A CE2   1 
ATOM   1524 C CZ    . PHE C 2 112 ? -7.454  -2.920  9.508   1.00 14.61 ? 113 PHE A CZ    1 
ATOM   1525 H H     . PHE C 2 112 ? -7.998  -6.681  7.474   1.00 0.00  ? 113 PHE A H     1 
ATOM   1526 N N     . ILE C 2 113 ? -9.828  -7.301  10.390  1.00 18.54 ? 114 ILE A N     1 
ATOM   1527 C CA    . ILE C 2 113 ? -10.720 -7.459  11.515  1.00 19.37 ? 114 ILE A CA    1 
ATOM   1528 C C     . ILE C 2 113 ? -11.470 -8.763  11.382  1.00 21.43 ? 114 ILE A C     1 
ATOM   1529 O O     . ILE C 2 113 ? -11.796 -9.352  12.385  1.00 20.88 ? 114 ILE A O     1 
ATOM   1530 C CB    . ILE C 2 113 ? -11.695 -6.306  11.728  1.00 19.61 ? 114 ILE A CB    1 
ATOM   1531 C CG1   . ILE C 2 113 ? -12.830 -6.351  10.723  1.00 18.03 ? 114 ILE A CG1   1 
ATOM   1532 C CG2   . ILE C 2 113 ? -10.970 -4.942  11.758  1.00 18.34 ? 114 ILE A CG2   1 
ATOM   1533 C CD1   . ILE C 2 113 ? -13.903 -5.320  11.064  1.00 15.27 ? 114 ILE A CD1   1 
ATOM   1534 H H     . ILE C 2 113 ? -10.011 -6.642  9.682   1.00 0.00  ? 114 ILE A H     1 
ATOM   1535 N N     . ARG C 2 114 ? -11.705 -9.236  10.155  1.00 21.81 ? 115 ARG A N     1 
ATOM   1536 C CA    . ARG C 2 114 ? -12.414 -10.508 9.928   1.00 22.61 ? 115 ARG A CA    1 
ATOM   1537 C C     . ARG C 2 114 ? -11.430 -11.679 9.819   1.00 26.14 ? 115 ARG A C     1 
ATOM   1538 O O     . ARG C 2 114 ? -11.733 -12.828 10.171  1.00 25.58 ? 115 ARG A O     1 
ATOM   1539 C CB    . ARG C 2 114 ? -13.262 -10.449 8.643   1.00 17.47 ? 115 ARG A CB    1 
ATOM   1540 C CG    . ARG C 2 114 ? -14.196 -9.286  8.601   1.00 12.97 ? 115 ARG A CG    1 
ATOM   1541 C CD    . ARG C 2 114 ? -15.444 -9.567  7.781   1.00 8.09  ? 115 ARG A CD    1 
ATOM   1542 N NE    . ARG C 2 114 ? -16.347 -8.430  7.927   1.00 8.66  ? 115 ARG A NE    1 
ATOM   1543 C CZ    . ARG C 2 114 ? -17.641 -8.432  7.633   1.00 6.85  ? 115 ARG A CZ    1 
ATOM   1544 N NH1   . ARG C 2 114 ? -18.214 -9.520  7.151   1.00 15.41 ? 115 ARG A NH1   1 
ATOM   1545 N NH2   . ARG C 2 114 ? -18.386 -7.355  7.882   1.00 8.42  ? 115 ARG A NH2   1 
ATOM   1546 H H     . ARG C 2 114 ? -11.382 -8.744  9.376   1.00 0.00  ? 115 ARG A H     1 
ATOM   1547 H HE    . ARG C 2 114 ? -16.013 -7.615  8.335   1.00 0.00  ? 115 ARG A HE    1 
ATOM   1548 H HH11  . ARG C 2 114 ? -17.672 -10.346 7.008   1.00 0.00  ? 115 ARG A HH11  1 
ATOM   1549 H HH12  . ARG C 2 114 ? -19.190 -9.515  6.930   1.00 0.00  ? 115 ARG A HH12  1 
ATOM   1550 H HH21  . ARG C 2 114 ? -17.963 -6.542  8.281   1.00 0.00  ? 115 ARG A HH21  1 
ATOM   1551 H HH22  . ARG C 2 114 ? -19.361 -7.357  7.660   1.00 0.00  ? 115 ARG A HH22  1 
ATOM   1552 N N     . ASN C 2 115 ? -10.269 -11.378 9.253   1.00 31.05 ? 116 ASN A N     1 
ATOM   1553 C CA    . ASN C 2 115 ? -9.205  -12.348 9.057   1.00 35.13 ? 116 ASN A CA    1 
ATOM   1554 C C     . ASN C 2 115 ? -7.984  -11.740 9.703   1.00 35.60 ? 116 ASN A C     1 
ATOM   1555 O O     . ASN C 2 115 ? -7.365  -10.835 9.158   1.00 38.44 ? 116 ASN A O     1 
ATOM   1556 C CB    . ASN C 2 115 ? -8.945  -12.588 7.564   1.00 40.44 ? 116 ASN A CB    1 
ATOM   1557 C CG    . ASN C 2 115 ? -7.615  -13.310 7.314   1.00 47.65 ? 116 ASN A CG    1 
ATOM   1558 O OD1   . ASN C 2 115 ? -6.980  -13.820 8.254   1.00 50.12 ? 116 ASN A OD1   1 
ATOM   1559 N ND2   . ASN C 2 115 ? -7.172  -13.337 6.052   1.00 50.19 ? 116 ASN A ND2   1 
ATOM   1560 H H     . ASN C 2 115 ? -10.096 -10.464 8.970   1.00 0.00  ? 116 ASN A H     1 
ATOM   1561 H HD21  . ASN C 2 115 ? -6.323  -13.797 5.884   1.00 0.00  ? 116 ASN A HD21  1 
ATOM   1562 H HD22  . ASN C 2 115 ? -7.715  -12.902 5.363   1.00 0.00  ? 116 ASN A HD22  1 
ATOM   1563 N N     . ASN C 2 116 ? -7.627  -12.286 10.849  1.00 34.99 ? 117 ASN A N     1 
ATOM   1564 C CA    . ASN C 2 116 ? -6.500  -11.833 11.650  1.00 33.60 ? 117 ASN A CA    1 
ATOM   1565 C C     . ASN C 2 116 ? -5.187  -11.521 10.927  1.00 32.53 ? 117 ASN A C     1 
ATOM   1566 O O     . ASN C 2 116 ? -4.340  -10.807 11.459  1.00 33.24 ? 117 ASN A O     1 
ATOM   1567 C CB    . ASN C 2 116 ? -6.236  -12.893 12.723  1.00 35.52 ? 117 ASN A CB    1 
ATOM   1568 C CG    . ASN C 2 116 ? -5.201  -12.473 13.720  1.00 34.90 ? 117 ASN A CG    1 
ATOM   1569 O OD1   . ASN C 2 116 ? -5.424  -11.541 14.482  1.00 36.77 ? 117 ASN A OD1   1 
ATOM   1570 N ND2   . ASN C 2 116 ? -4.060  -13.173 13.743  1.00 34.59 ? 117 ASN A ND2   1 
ATOM   1571 H H     . ASN C 2 116 ? -8.178  -13.023 11.180  1.00 0.00  ? 117 ASN A H     1 
ATOM   1572 H HD21  . ASN C 2 116 ? -3.387  -12.912 14.403  1.00 0.00  ? 117 ASN A HD21  1 
ATOM   1573 H HD22  . ASN C 2 116 ? -3.946  -13.915 13.116  1.00 0.00  ? 117 ASN A HD22  1 
ATOM   1574 N N     . THR C 2 117 ? -5.008  -12.033 9.721   1.00 30.94 ? 118 THR A N     1 
ATOM   1575 C CA    . THR C 2 117 ? -3.744  -11.840 9.020   1.00 28.62 ? 118 THR A CA    1 
ATOM   1576 C C     . THR C 2 117 ? -3.840  -11.278 7.608   1.00 29.09 ? 118 THR A C     1 
ATOM   1577 O O     . THR C 2 117 ? -2.841  -11.259 6.858   1.00 27.33 ? 118 THR A O     1 
ATOM   1578 C CB    . THR C 2 117 ? -3.000  -13.165 8.954   1.00 28.48 ? 118 THR A CB    1 
ATOM   1579 O OG1   . THR C 2 117 ? -3.896  -14.198 8.518   1.00 31.75 ? 118 THR A OG1   1 
ATOM   1580 C CG2   . THR C 2 117 ? -2.467  -13.530 10.309  1.00 29.75 ? 118 THR A CG2   1 
ATOM   1581 H H     . THR C 2 117 ? -5.715  -12.531 9.262   1.00 0.00  ? 118 THR A H     1 
ATOM   1582 H HG1   . THR C 2 117 ? -4.682  -14.285 9.061   1.00 0.00  ? 118 THR A HG1   1 
ATOM   1583 N N     . LYS C 2 118 ? -5.023  -10.775 7.266   1.00 27.35 ? 119 LYS A N     1 
ATOM   1584 C CA    . LYS C 2 118 ? -5.240  -10.240 5.943   1.00 25.37 ? 119 LYS A CA    1 
ATOM   1585 C C     . LYS C 2 118 ? -4.968  -8.763  5.824   1.00 24.01 ? 119 LYS A C     1 
ATOM   1586 O O     . LYS C 2 118 ? -5.663  -7.972  6.446   1.00 20.82 ? 119 LYS A O     1 
ATOM   1587 C CB    . LYS C 2 118 ? -6.657  -10.511 5.460   1.00 28.24 ? 119 LYS A CB    1 
ATOM   1588 C CG    . LYS C 2 118 ? -6.748  -10.388 3.946   1.00 32.78 ? 119 LYS A CG    1 
ATOM   1589 C CD    . LYS C 2 118 ? -8.091  -9.862  3.474   1.00 36.59 ? 119 LYS A CD    1 
ATOM   1590 C CE    . LYS C 2 118 ? -9.129  -10.954 3.402   1.00 39.96 ? 119 LYS A CE    1 
ATOM   1591 N NZ    . LYS C 2 118 ? -10.473 -10.328 3.477   1.00 42.53 ? 119 LYS A NZ    1 
ATOM   1592 H H     . LYS C 2 118 ? -5.746  -10.725 7.928   1.00 0.00  ? 119 LYS A H     1 
ATOM   1593 H HZ1   . LYS C 2 118 ? -10.587 -9.645  2.703   1.00 0.00  ? 119 LYS A HZ1   1 
ATOM   1594 H HZ2   . LYS C 2 118 ? -11.206 -11.063 3.413   1.00 0.00  ? 119 LYS A HZ2   1 
ATOM   1595 H HZ3   . LYS C 2 118 ? -10.548 -9.833  4.387   1.00 0.00  ? 119 LYS A HZ3   1 
ATOM   1596 N N     . ASN C 2 119 ? -3.964  -8.408  5.013   1.00 23.28 ? 120 ASN A N     1 
ATOM   1597 C CA    . ASN C 2 119 ? -3.596  -7.017  4.745   1.00 21.62 ? 120 ASN A CA    1 
ATOM   1598 C C     . ASN C 2 119 ? -3.182  -6.182  5.943   1.00 20.85 ? 120 ASN A C     1 
ATOM   1599 O O     . ASN C 2 119 ? -3.543  -5.008  6.054   1.00 19.84 ? 120 ASN A O     1 
ATOM   1600 C CB    . ASN C 2 119 ? -4.732  -6.317  4.010   1.00 24.70 ? 120 ASN A CB    1 
ATOM   1601 C CG    . ASN C 2 119 ? -5.027  -6.960  2.704   1.00 25.24 ? 120 ASN A CG    1 
ATOM   1602 O OD1   . ASN C 2 119 ? -5.955  -7.760  2.590   1.00 28.74 ? 120 ASN A OD1   1 
ATOM   1603 N ND2   . ASN C 2 119 ? -4.200  -6.670  1.707   1.00 25.88 ? 120 ASN A ND2   1 
ATOM   1604 H H     . ASN C 2 119 ? -3.473  -9.139  4.588   1.00 0.00  ? 120 ASN A H     1 
ATOM   1605 H HD21  . ASN C 2 119 ? -4.374  -7.101  0.845   1.00 0.00  ? 120 ASN A HD21  1 
ATOM   1606 H HD22  . ASN C 2 119 ? -3.471  -6.031  1.860   1.00 0.00  ? 120 ASN A HD22  1 
ATOM   1607 N N     . ILE C 2 120 ? -2.329  -6.757  6.777   1.00 19.83 ? 121 ILE A N     1 
ATOM   1608 C CA    . ILE C 2 120 ? -1.863  -6.072  7.964   1.00 19.75 ? 121 ILE A CA    1 
ATOM   1609 C C     . ILE C 2 120 ? -0.412  -6.527  8.142   1.00 20.86 ? 121 ILE A C     1 
ATOM   1610 O O     . ILE C 2 120 ? -0.065  -7.667  7.785   1.00 21.56 ? 121 ILE A O     1 
ATOM   1611 C CB    . ILE C 2 120 ? -2.779  -6.430  9.181   1.00 18.09 ? 121 ILE A CB    1 
ATOM   1612 C CG1   . ILE C 2 120 ? -2.360  -5.647  10.423  1.00 13.91 ? 121 ILE A CG1   1 
ATOM   1613 C CG2   . ILE C 2 120 ? -2.846  -7.960  9.385   1.00 13.23 ? 121 ILE A CG2   1 
ATOM   1614 C CD1   . ILE C 2 120 ? -3.384  -5.676  11.503  1.00 12.19 ? 121 ILE A CD1   1 
ATOM   1615 H H     . ILE C 2 120 ? -2.001  -7.671  6.651   1.00 0.00  ? 121 ILE A H     1 
ATOM   1616 N N     . VAL C 2 121 ? 0.444   -5.632  8.637   1.00 21.98 ? 122 VAL A N     1 
ATOM   1617 C CA    . VAL C 2 121 ? 1.869   -5.954  8.791   1.00 23.01 ? 122 VAL A CA    1 
ATOM   1618 C C     . VAL C 2 121 ? 2.100   -7.114  9.773   1.00 23.12 ? 122 VAL A C     1 
ATOM   1619 O O     . VAL C 2 121 ? 2.815   -8.071  9.460   1.00 22.63 ? 122 VAL A O     1 
ATOM   1620 C CB    . VAL C 2 121 ? 2.689   -4.684  9.150   1.00 21.85 ? 122 VAL A CB    1 
ATOM   1621 C CG1   . VAL C 2 121 ? 4.173   -4.961  9.048   1.00 23.54 ? 122 VAL A CG1   1 
ATOM   1622 C CG2   . VAL C 2 121 ? 2.340   -3.548  8.198   1.00 22.02 ? 122 VAL A CG2   1 
ATOM   1623 H H     . VAL C 2 121 ? 0.105   -4.749  8.901   1.00 0.00  ? 122 VAL A H     1 
ATOM   1624 N N     . TYR C 2 122 ? 1.410   -7.064  10.911  1.00 22.18 ? 123 TYR A N     1 
ATOM   1625 C CA    . TYR C 2 122 ? 1.498   -8.094  11.941  1.00 20.44 ? 123 TYR A CA    1 
ATOM   1626 C C     . TYR C 2 122 ? 0.094   -8.583  12.229  1.00 20.01 ? 123 TYR A C     1 
ATOM   1627 O O     . TYR C 2 122 ? -0.877  -7.816  12.100  1.00 19.74 ? 123 TYR A O     1 
ATOM   1628 C CB    . TYR C 2 122 ? 2.069   -7.512  13.242  1.00 20.48 ? 123 TYR A CB    1 
ATOM   1629 C CG    . TYR C 2 122 ? 3.518   -7.186  13.140  1.00 22.98 ? 123 TYR A CG    1 
ATOM   1630 C CD1   . TYR C 2 122 ? 4.460   -8.206  13.114  1.00 23.22 ? 123 TYR A CD1   1 
ATOM   1631 C CD2   . TYR C 2 122 ? 3.963   -5.868  13.014  1.00 21.03 ? 123 TYR A CD2   1 
ATOM   1632 C CE1   . TYR C 2 122 ? 5.802   -7.935  12.960  1.00 26.01 ? 123 TYR A CE1   1 
ATOM   1633 C CE2   . TYR C 2 122 ? 5.321   -5.587  12.861  1.00 22.61 ? 123 TYR A CE2   1 
ATOM   1634 C CZ    . TYR C 2 122 ? 6.225   -6.639  12.837  1.00 25.20 ? 123 TYR A CZ    1 
ATOM   1635 O OH    . TYR C 2 122 ? 7.579   -6.439  12.715  1.00 31.30 ? 123 TYR A OH    1 
ATOM   1636 H H     . TYR C 2 122 ? 0.783   -6.333  11.057  1.00 0.00  ? 123 TYR A H     1 
ATOM   1637 H HH    . TYR C 2 122 ? 7.804   -5.528  12.919  1.00 0.00  ? 123 TYR A HH    1 
ATOM   1638 N N     . PRO C 2 123 ? -0.033  -9.857  12.661  1.00 20.18 ? 124 PRO A N     1 
ATOM   1639 C CA    . PRO C 2 123 ? -1.341  -10.444 12.981  1.00 18.26 ? 124 PRO A CA    1 
ATOM   1640 C C     . PRO C 2 123 ? -2.096  -9.466  13.863  1.00 18.18 ? 124 PRO A C     1 
ATOM   1641 O O     . PRO C 2 123 ? -1.534  -8.961  14.823  1.00 19.36 ? 124 PRO A O     1 
ATOM   1642 C CB    . PRO C 2 123 ? -0.956  -11.705 13.731  1.00 18.51 ? 124 PRO A CB    1 
ATOM   1643 C CG    . PRO C 2 123 ? 0.322   -12.147 12.978  1.00 14.93 ? 124 PRO A CG    1 
ATOM   1644 C CD    . PRO C 2 123 ? 1.063   -10.848 12.814  1.00 15.02 ? 124 PRO A CD    1 
ATOM   1645 N N     . PHE C 2 124 ? -3.347  -9.186  13.495  1.00 17.57 ? 125 PHE A N     1 
ATOM   1646 C CA    . PHE C 2 124 ? -4.241  -8.251  14.173  1.00 18.89 ? 125 PHE A CA    1 
ATOM   1647 C C     . PHE C 2 124 ? -4.213  -8.355  15.701  1.00 19.80 ? 125 PHE A C     1 
ATOM   1648 O O     . PHE C 2 124 ? -4.318  -7.328  16.406  1.00 16.12 ? 125 PHE A O     1 
ATOM   1649 C CB    . PHE C 2 124 ? -5.673  -8.451  13.640  1.00 16.63 ? 125 PHE A CB    1 
ATOM   1650 C CG    . PHE C 2 124 ? -6.702  -7.433  14.156  1.00 17.33 ? 125 PHE A CG    1 
ATOM   1651 C CD1   . PHE C 2 124 ? -6.612  -6.099  13.829  1.00 17.01 ? 125 PHE A CD1   1 
ATOM   1652 C CD2   . PHE C 2 124 ? -7.769  -7.843  14.955  1.00 17.30 ? 125 PHE A CD2   1 
ATOM   1653 C CE1   . PHE C 2 124 ? -7.559  -5.189  14.285  1.00 16.72 ? 125 PHE A CE1   1 
ATOM   1654 C CE2   . PHE C 2 124 ? -8.716  -6.936  15.412  1.00 15.55 ? 125 PHE A CE2   1 
ATOM   1655 C CZ    . PHE C 2 124 ? -8.605  -5.606  15.073  1.00 16.63 ? 125 PHE A CZ    1 
ATOM   1656 H H     . PHE C 2 124 ? -3.684  -9.622  12.695  1.00 0.00  ? 125 PHE A H     1 
ATOM   1657 N N     . ASP C 2 125 ? -4.085  -9.581  16.206  1.00 20.80 ? 126 ASP A N     1 
ATOM   1658 C CA    . ASP C 2 125 ? -4.059  -9.806  17.643  1.00 23.83 ? 126 ASP A CA    1 
ATOM   1659 C C     . ASP C 2 125 ? -2.793  -9.352  18.392  1.00 22.94 ? 126 ASP A C     1 
ATOM   1660 O O     . ASP C 2 125 ? -2.726  -9.484  19.604  1.00 25.09 ? 126 ASP A O     1 
ATOM   1661 C CB    . ASP C 2 125 ? -4.454  -11.254 17.986  1.00 25.07 ? 126 ASP A CB    1 
ATOM   1662 C CG    . ASP C 2 125 ? -3.501  -12.285 17.416  1.00 28.15 ? 126 ASP A CG    1 
ATOM   1663 O OD1   . ASP C 2 125 ? -2.397  -11.900 16.976  1.00 31.92 ? 126 ASP A OD1   1 
ATOM   1664 O OD2   . ASP C 2 125 ? -3.839  -13.492 17.431  1.00 33.74 ? 126 ASP A OD2   1 
ATOM   1665 H H     . ASP C 2 125 ? -4.059  -10.340 15.583  1.00 0.00  ? 126 ASP A H     1 
ATOM   1666 N N     . GLN C 2 126 ? -1.798  -8.805  17.692  1.00 22.68 ? 127 GLN A N     1 
ATOM   1667 C CA    . GLN C 2 126 ? -0.595  -8.299  18.364  1.00 20.67 ? 127 GLN A CA    1 
ATOM   1668 C C     . GLN C 2 126 ? -0.668  -6.811  18.623  1.00 18.64 ? 127 GLN A C     1 
ATOM   1669 O O     . GLN C 2 126 ? 0.282   -6.221  19.101  1.00 20.07 ? 127 GLN A O     1 
ATOM   1670 C CB    . GLN C 2 126 ? 0.680   -8.596  17.557  1.00 22.93 ? 127 GLN A CB    1 
ATOM   1671 C CG    . GLN C 2 126 ? 1.030   -10.072 17.473  1.00 23.14 ? 127 GLN A CG    1 
ATOM   1672 C CD    . GLN C 2 126 ? 2.211   -10.363 16.588  1.00 28.32 ? 127 GLN A CD    1 
ATOM   1673 O OE1   . GLN C 2 126 ? 2.987   -9.481  16.225  1.00 30.82 ? 127 GLN A OE1   1 
ATOM   1674 N NE2   . GLN C 2 126 ? 2.351   -11.620 16.222  1.00 30.42 ? 127 GLN A NE2   1 
ATOM   1675 H H     . GLN C 2 126 ? -1.856  -8.732  16.718  1.00 0.00  ? 127 GLN A H     1 
ATOM   1676 H HE21  . GLN C 2 126 ? 3.104   -11.861 15.644  1.00 0.00  ? 127 GLN A HE21  1 
ATOM   1677 H HE22  . GLN C 2 126 ? 1.684   -12.265 16.549  1.00 0.00  ? 127 GLN A HE22  1 
ATOM   1678 N N     . TYR C 2 127 ? -1.788  -6.187  18.298  1.00 16.58 ? 128 TYR A N     1 
ATOM   1679 C CA    . TYR C 2 127 ? -1.937  -4.741  18.501  1.00 14.85 ? 128 TYR A CA    1 
ATOM   1680 C C     . TYR C 2 127 ? -2.866  -4.510  19.655  1.00 15.23 ? 128 TYR A C     1 
ATOM   1681 O O     . TYR C 2 127 ? -3.909  -5.141  19.708  1.00 16.55 ? 128 TYR A O     1 
ATOM   1682 C CB    . TYR C 2 127 ? -2.524  -4.062  17.242  1.00 14.06 ? 128 TYR A CB    1 
ATOM   1683 C CG    . TYR C 2 127 ? -1.573  -4.035  16.060  1.00 12.16 ? 128 TYR A CG    1 
ATOM   1684 C CD1   . TYR C 2 127 ? -0.692  -2.973  15.873  1.00 12.17 ? 128 TYR A CD1   1 
ATOM   1685 C CD2   . TYR C 2 127 ? -1.569  -5.068  15.125  1.00 13.59 ? 128 TYR A CD2   1 
ATOM   1686 C CE1   . TYR C 2 127 ? 0.172   -2.937  14.768  1.00 14.75 ? 128 TYR A CE1   1 
ATOM   1687 C CE2   . TYR C 2 127 ? -0.726  -5.050  14.011  1.00 13.38 ? 128 TYR A CE2   1 
ATOM   1688 C CZ    . TYR C 2 127 ? 0.135   -3.977  13.836  1.00 16.34 ? 128 TYR A CZ    1 
ATOM   1689 O OH    . TYR C 2 127 ? 0.899   -3.916  12.697  1.00 15.06 ? 128 TYR A OH    1 
ATOM   1690 H H     . TYR C 2 127 ? -2.540  -6.701  17.947  1.00 0.00  ? 128 TYR A H     1 
ATOM   1691 H HH    . TYR C 2 127 ? 0.572   -4.563  12.077  1.00 0.00  ? 128 TYR A HH    1 
ATOM   1692 N N     . ILE C 2 128 ? -2.492  -3.610  20.560  1.00 15.20 ? 129 ILE A N     1 
ATOM   1693 C CA    . ILE C 2 128 ? -3.293  -3.285  21.730  1.00 15.55 ? 129 ILE A CA    1 
ATOM   1694 C C     . ILE C 2 128 ? -3.998  -1.956  21.565  1.00 14.06 ? 129 ILE A C     1 
ATOM   1695 O O     . ILE C 2 128 ? -4.829  -1.565  22.381  1.00 16.17 ? 129 ILE A O     1 
ATOM   1696 C CB    . ILE C 2 128 ? -2.461  -3.327  23.041  1.00 17.29 ? 129 ILE A CB    1 
ATOM   1697 C CG1   . ILE C 2 128 ? -1.162  -2.554  22.910  1.00 18.19 ? 129 ILE A CG1   1 
ATOM   1698 C CG2   . ILE C 2 128 ? -2.093  -4.738  23.359  1.00 22.34 ? 129 ILE A CG2   1 
ATOM   1699 C CD1   . ILE C 2 128 ? -1.192  -1.225  23.550  1.00 21.83 ? 129 ILE A CD1   1 
ATOM   1700 H H     . ILE C 2 128 ? -1.634  -3.156  20.427  1.00 0.00  ? 129 ILE A H     1 
ATOM   1701 N N     . ALA C 2 129 ? -3.681  -1.246  20.497  1.00 13.45 ? 130 ALA A N     1 
ATOM   1702 C CA    . ALA C 2 129 ? -4.347  0.022   20.247  1.00 12.49 ? 130 ALA A CA    1 
ATOM   1703 C C     . ALA C 2 129 ? -4.249  0.373   18.767  1.00 11.56 ? 130 ALA A C     1 
ATOM   1704 O O     . ALA C 2 129 ? -3.304  -0.044  18.078  1.00 7.98  ? 130 ALA A O     1 
ATOM   1705 C CB    . ALA C 2 129 ? -3.774  1.121   21.118  1.00 13.15 ? 130 ALA A CB    1 
ATOM   1706 H H     . ALA C 2 129 ? -2.994  -1.548  19.869  1.00 0.00  ? 130 ALA A H     1 
ATOM   1707 N N     . HIS C 2 130 ? -5.282  1.066   18.287  1.00 11.37 ? 131 HIS A N     1 
ATOM   1708 C CA    . HIS C 2 130 ? -5.398  1.499   16.909  1.00 8.21  ? 131 HIS A CA    1 
ATOM   1709 C C     . HIS C 2 130 ? -5.691  2.981   16.970  1.00 8.13  ? 131 HIS A C     1 
ATOM   1710 O O     . HIS C 2 130 ? -6.764  3.406   17.374  1.00 8.67  ? 131 HIS A O     1 
ATOM   1711 C CB    . HIS C 2 130 ? -6.497  0.694   16.179  1.00 9.04  ? 131 HIS A CB    1 
ATOM   1712 C CG    . HIS C 2 130 ? -6.228  -0.786  16.135  1.00 7.97  ? 131 HIS A CG    1 
ATOM   1713 N ND1   . HIS C 2 130 ? -5.419  -1.368  15.183  1.00 8.65  ? 131 HIS A ND1   1 
ATOM   1714 C CD2   . HIS C 2 130 ? -6.538  -1.779  17.006  1.00 10.23 ? 131 HIS A CD2   1 
ATOM   1715 C CE1   . HIS C 2 130 ? -5.223  -2.642  15.472  1.00 9.12  ? 131 HIS A CE1   1 
ATOM   1716 N NE2   . HIS C 2 130 ? -5.890  -2.920  16.579  1.00 10.03 ? 131 HIS A NE2   1 
ATOM   1717 H H     . HIS C 2 130 ? -5.992  1.360   18.904  1.00 0.00  ? 131 HIS A H     1 
ATOM   1718 H HD1   . HIS C 2 130 ? -5.075  -0.907  14.387  1.00 0.00  ? 131 HIS A HD1   1 
ATOM   1719 H HE2   . HIS C 2 130 ? -5.925  -3.802  17.007  1.00 0.00  ? 131 HIS A HE2   1 
ATOM   1720 N N     . TRP C 2 131 ? -4.699  3.786   16.628  1.00 8.71  ? 132 TRP A N     1 
ATOM   1721 C CA    . TRP C 2 131 ? -4.863  5.223   16.667  1.00 13.79 ? 132 TRP A CA    1 
ATOM   1722 C C     . TRP C 2 131 ? -5.062  5.828   15.289  1.00 13.83 ? 132 TRP A C     1 
ATOM   1723 O O     . TRP C 2 131 ? -4.527  5.343   14.300  1.00 13.90 ? 132 TRP A O     1 
ATOM   1724 C CB    . TRP C 2 131 ? -3.639  5.894   17.309  1.00 14.75 ? 132 TRP A CB    1 
ATOM   1725 C CG    . TRP C 2 131 ? -3.408  5.544   18.745  1.00 21.14 ? 132 TRP A CG    1 
ATOM   1726 C CD1   . TRP C 2 131 ? -4.294  4.947   19.604  1.00 22.44 ? 132 TRP A CD1   1 
ATOM   1727 C CD2   . TRP C 2 131 ? -2.212  5.771   19.496  1.00 22.59 ? 132 TRP A CD2   1 
ATOM   1728 N NE1   . TRP C 2 131 ? -3.716  4.792   20.841  1.00 24.38 ? 132 TRP A NE1   1 
ATOM   1729 C CE2   . TRP C 2 131 ? -2.441  5.289   20.805  1.00 25.02 ? 132 TRP A CE2   1 
ATOM   1730 C CE3   . TRP C 2 131 ? -0.959  6.331   19.190  1.00 24.35 ? 132 TRP A CE3   1 
ATOM   1731 C CZ2   . TRP C 2 131 ? -1.464  5.349   21.812  1.00 26.35 ? 132 TRP A CZ2   1 
ATOM   1732 C CZ3   . TRP C 2 131 ? 0.022   6.385   20.199  1.00 25.63 ? 132 TRP A CZ3   1 
ATOM   1733 C CH2   . TRP C 2 131 ? -0.242  5.897   21.489  1.00 23.88 ? 132 TRP A CH2   1 
ATOM   1734 H H     . TRP C 2 131 ? -3.882  3.417   16.336  1.00 0.00  ? 132 TRP A H     1 
ATOM   1735 H HE1   . TRP C 2 131 ? -4.160  4.385   21.617  1.00 0.00  ? 132 TRP A HE1   1 
ATOM   1736 N N     . ILE C 2 132 ? -5.749  6.957   15.272  1.00 14.88 ? 133 ILE A N     1 
ATOM   1737 C CA    . ILE C 2 132 ? -5.986  7.696   14.064  1.00 14.96 ? 133 ILE A CA    1 
ATOM   1738 C C     . ILE C 2 132 ? -5.524  9.143   14.237  1.00 15.26 ? 133 ILE A C     1 
ATOM   1739 O O     . ILE C 2 132 ? -6.006  9.836   15.128  1.00 15.34 ? 133 ILE A O     1 
ATOM   1740 C CB    . ILE C 2 132 ? -7.493  7.781   13.706  1.00 14.91 ? 133 ILE A CB    1 
ATOM   1741 C CG1   . ILE C 2 132 ? -8.047  6.411   13.322  1.00 15.19 ? 133 ILE A CG1   1 
ATOM   1742 C CG2   . ILE C 2 132 ? -7.720  8.823   12.586  1.00 14.49 ? 133 ILE A CG2   1 
ATOM   1743 C CD1   . ILE C 2 132 ? -7.398  5.776   12.093  1.00 15.41 ? 133 ILE A CD1   1 
ATOM   1744 H H     . ILE C 2 132 ? -6.105  7.316   16.111  1.00 0.00  ? 133 ILE A H     1 
ATOM   1745 N N     . ILE C 2 133 ? -4.589  9.567   13.379  1.00 16.81 ? 134 ILE A N     1 
ATOM   1746 C CA    . ILE C 2 133 ? -4.126  10.974  13.291  1.00 14.98 ? 134 ILE A CA    1 
ATOM   1747 C C     . ILE C 2 133 ? -4.983  11.551  12.122  1.00 13.45 ? 134 ILE A C     1 
ATOM   1748 O O     . ILE C 2 133 ? -4.892  11.092  10.993  1.00 13.44 ? 134 ILE A O     1 
ATOM   1749 C CB    . ILE C 2 133 ? -2.592  11.102  12.925  1.00 12.91 ? 134 ILE A CB    1 
ATOM   1750 C CG1   . ILE C 2 133 ? -1.739  10.263  13.891  1.00 14.89 ? 134 ILE A CG1   1 
ATOM   1751 C CG2   . ILE C 2 133 ? -2.160  12.558  12.983  1.00 7.56  ? 134 ILE A CG2   1 
ATOM   1752 C CD1   . ILE C 2 133 ? -0.272  10.630  13.955  1.00 19.14 ? 134 ILE A CD1   1 
ATOM   1753 H H     . ILE C 2 133 ? -4.224  8.920   12.738  1.00 0.00  ? 134 ILE A H     1 
ATOM   1754 N N     . GLY C 2 134 ? -5.886  12.467  12.416  1.00 13.26 ? 135 GLY A N     1 
ATOM   1755 C CA    . GLY C 2 134 ? -6.714  13.022  11.380  1.00 14.48 ? 135 GLY A CA    1 
ATOM   1756 C C     . GLY C 2 134 ? -6.335  14.459  11.116  1.00 17.72 ? 135 GLY A C     1 
ATOM   1757 O O     . GLY C 2 134 ? -6.124  15.233  12.052  1.00 17.02 ? 135 GLY A O     1 
ATOM   1758 H H     . GLY C 2 134 ? -5.964  12.781  13.342  1.00 0.00  ? 135 GLY A H     1 
ATOM   1759 N N     . TYR C 2 135 ? -6.268  14.815  9.827   1.00 19.82 ? 136 TYR A N     1 
ATOM   1760 C CA    . TYR C 2 135 ? -5.926  16.156  9.364   1.00 17.12 ? 136 TYR A CA    1 
ATOM   1761 C C     . TYR C 2 135 ? -7.128  16.702  8.647   1.00 16.63 ? 136 TYR A C     1 
ATOM   1762 O O     . TYR C 2 135 ? -7.704  16.029  7.806   1.00 17.80 ? 136 TYR A O     1 
ATOM   1763 C CB    . TYR C 2 135 ? -4.753  16.088  8.376   1.00 17.21 ? 136 TYR A CB    1 
ATOM   1764 C CG    . TYR C 2 135 ? -3.405  15.926  9.023   1.00 16.94 ? 136 TYR A CG    1 
ATOM   1765 C CD1   . TYR C 2 135 ? -2.668  17.063  9.418   1.00 18.75 ? 136 TYR A CD1   1 
ATOM   1766 C CD2   . TYR C 2 135 ? -2.852  14.642  9.268   1.00 17.49 ? 136 TYR A CD2   1 
ATOM   1767 C CE1   . TYR C 2 135 ? -1.420  16.936  10.049  1.00 14.60 ? 136 TYR A CE1   1 
ATOM   1768 C CE2   . TYR C 2 135 ? -1.587  14.506  9.895   1.00 14.54 ? 136 TYR A CE2   1 
ATOM   1769 C CZ    . TYR C 2 135 ? -0.889  15.667  10.285  1.00 16.33 ? 136 TYR A CZ    1 
ATOM   1770 O OH    . TYR C 2 135 ? 0.318   15.593  10.944  1.00 16.95 ? 136 TYR A OH    1 
ATOM   1771 H H     . TYR C 2 135 ? -6.479  14.145  9.144   1.00 0.00  ? 136 TYR A H     1 
ATOM   1772 H HH    . TYR C 2 135 ? 0.551   14.674  11.108  1.00 0.00  ? 136 TYR A HH    1 
ATOM   1773 N N     . VAL C 2 136 ? -7.534  17.905  8.992   1.00 16.87 ? 137 VAL A N     1 
ATOM   1774 C CA    . VAL C 2 136 ? -8.664  18.515  8.336   1.00 20.09 ? 137 VAL A CA    1 
ATOM   1775 C C     . VAL C 2 136 ? -8.141  19.822  7.807   1.00 21.53 ? 137 VAL A C     1 
ATOM   1776 O O     . VAL C 2 136 ? -7.585  20.606  8.566   1.00 20.26 ? 137 VAL A O     1 
ATOM   1777 C CB    . VAL C 2 136 ? -9.817  18.884  9.286   1.00 21.14 ? 137 VAL A CB    1 
ATOM   1778 C CG1   . VAL C 2 136 ? -11.020 19.302  8.450   1.00 22.82 ? 137 VAL A CG1   1 
ATOM   1779 C CG2   . VAL C 2 136 ? -10.180 17.724  10.180  1.00 23.16 ? 137 VAL A CG2   1 
ATOM   1780 H H     . VAL C 2 136 ? -7.063  18.413  9.682   1.00 0.00  ? 137 VAL A H     1 
ATOM   1781 N N     . TYR C 2 137 ? -8.368  20.084  6.521   1.00 22.92 ? 138 TYR A N     1 
ATOM   1782 C CA    . TYR C 2 137 ? -7.898  21.328  5.925   1.00 22.82 ? 138 TYR A CA    1 
ATOM   1783 C C     . TYR C 2 137 ? -9.037  22.047  5.182   1.00 22.93 ? 138 TYR A C     1 
ATOM   1784 O O     . TYR C 2 137 ? -9.985  21.419  4.705   1.00 21.64 ? 138 TYR A O     1 
ATOM   1785 C CB    . TYR C 2 137 ? -6.679  21.042  4.996   1.00 21.30 ? 138 TYR A CB    1 
ATOM   1786 C CG    . TYR C 2 137 ? -7.017  20.376  3.660   1.00 20.41 ? 138 TYR A CG    1 
ATOM   1787 C CD1   . TYR C 2 137 ? -7.370  21.150  2.563   1.00 19.98 ? 138 TYR A CD1   1 
ATOM   1788 C CD2   . TYR C 2 137 ? -7.019  18.982  3.512   1.00 18.28 ? 138 TYR A CD2   1 
ATOM   1789 C CE1   . TYR C 2 137 ? -7.722  20.568  1.354   1.00 20.76 ? 138 TYR A CE1   1 
ATOM   1790 C CE2   . TYR C 2 137 ? -7.384  18.369  2.294   1.00 16.44 ? 138 TYR A CE2   1 
ATOM   1791 C CZ    . TYR C 2 137 ? -7.740  19.182  1.213   1.00 22.25 ? 138 TYR A CZ    1 
ATOM   1792 O OH    . TYR C 2 137 ? -8.179  18.654  0.002   1.00 25.01 ? 138 TYR A OH    1 
ATOM   1793 H H     . TYR C 2 137 ? -8.866  19.429  5.983   1.00 0.00  ? 138 TYR A H     1 
ATOM   1794 H HH    . TYR C 2 137 ? -8.220  17.691  0.069   1.00 0.00  ? 138 TYR A HH    1 
ATOM   1795 N N     . THR C 2 138 ? -8.997  23.369  5.173   1.00 24.02 ? 139 THR A N     1 
ATOM   1796 C CA    . THR C 2 138 ? -10.002 24.121  4.444   1.00 26.85 ? 139 THR A CA    1 
ATOM   1797 C C     . THR C 2 138 ? -9.455  24.319  3.034   1.00 29.47 ? 139 THR A C     1 
ATOM   1798 O O     . THR C 2 138 ? -8.335  24.791  2.861   1.00 28.58 ? 139 THR A O     1 
ATOM   1799 C CB    . THR C 2 138 ? -10.300 25.460  5.096   1.00 26.18 ? 139 THR A CB    1 
ATOM   1800 O OG1   . THR C 2 138 ? -10.869 25.237  6.397   1.00 28.40 ? 139 THR A OG1   1 
ATOM   1801 C CG2   . THR C 2 138 ? -11.289 26.236  4.255   1.00 26.14 ? 139 THR A CG2   1 
ATOM   1802 H H     . THR C 2 138 ? -8.292  23.838  5.646   1.00 0.00  ? 139 THR A H     1 
ATOM   1803 H HG1   . THR C 2 138 ? -10.301 24.695  6.955   1.00 0.00  ? 139 THR A HG1   1 
ATOM   1804 N N     . ARG C 2 139 ? -10.216 23.846  2.055   1.00 32.24 ? 140 ARG A N     1 
ATOM   1805 C CA    . ARG C 2 139 ? -9.862  23.923  0.640   1.00 36.32 ? 140 ARG A CA    1 
ATOM   1806 C C     . ARG C 2 139 ? -9.734  25.386  0.210   1.00 37.12 ? 140 ARG A C     1 
ATOM   1807 O O     . ARG C 2 139 ? -10.528 26.234  0.629   1.00 37.95 ? 140 ARG A O     1 
ATOM   1808 C CB    . ARG C 2 139 ? -10.934 23.209  -0.201  1.00 38.71 ? 140 ARG A CB    1 
ATOM   1809 C CG    . ARG C 2 139 ? -10.411 22.533  -1.461  1.00 43.22 ? 140 ARG A CG    1 
ATOM   1810 C CD    . ARG C 2 139 ? -10.569 21.015  -1.397  1.00 48.22 ? 140 ARG A CD    1 
ATOM   1811 N NE    . ARG C 2 139 ? -10.329 20.387  -2.698  1.00 56.06 ? 140 ARG A NE    1 
ATOM   1812 C CZ    . ARG C 2 139 ? -11.283 20.064  -3.577  1.00 58.85 ? 140 ARG A CZ    1 
ATOM   1813 N NH1   . ARG C 2 139 ? -12.571 20.283  -3.300  1.00 60.88 ? 140 ARG A NH1   1 
ATOM   1814 N NH2   . ARG C 2 139 ? -10.948 19.581  -4.772  1.00 59.09 ? 140 ARG A NH2   1 
ATOM   1815 H H     . ARG C 2 139 ? -11.078 23.450  2.304   1.00 0.00  ? 140 ARG A H     1 
ATOM   1816 H HE    . ARG C 2 139 ? -9.422  20.146  -2.937  1.00 0.00  ? 140 ARG A HE    1 
ATOM   1817 H HH11  . ARG C 2 139 ? -12.836 20.694  -2.428  1.00 0.00  ? 140 ARG A HH11  1 
ATOM   1818 H HH12  . ARG C 2 139 ? -13.274 20.036  -3.966  1.00 0.00  ? 140 ARG A HH12  1 
ATOM   1819 H HH21  . ARG C 2 139 ? -9.984  19.458  -5.009  1.00 0.00  ? 140 ARG A HH21  1 
ATOM   1820 H HH22  . ARG C 2 139 ? -11.661 19.337  -5.430  1.00 0.00  ? 140 ARG A HH22  1 
ATOM   1821 N N     . VAL C 2 140 ? -8.687  25.680  -0.561  1.00 38.18 ? 141 VAL A N     1 
ATOM   1822 C CA    . VAL C 2 140 ? -8.422  27.032  -1.057  1.00 38.65 ? 141 VAL A CA    1 
ATOM   1823 C C     . VAL C 2 140 ? -7.371  26.989  -2.168  1.00 38.85 ? 141 VAL A C     1 
ATOM   1824 O O     . VAL C 2 140 ? -7.488  26.204  -3.123  1.00 39.52 ? 141 VAL A O     1 
ATOM   1825 C CB    . VAL C 2 140 ? -7.952  27.980  0.073   1.00 38.51 ? 141 VAL A CB    1 
ATOM   1826 C CG1   . VAL C 2 140 ? -6.502  27.807  0.351   1.00 36.82 ? 141 VAL A CG1   1 
ATOM   1827 C CG2   . VAL C 2 140 ? -8.233  29.403  -0.297  1.00 39.48 ? 141 VAL A CG2   1 
ATOM   1828 H H     . VAL C 2 140 ? -8.058  24.967  -0.811  1.00 0.00  ? 141 VAL A H     1 
ATOM   1829 N N     . SER C 2 145 ? -0.224  30.994  -11.181 1.00 57.60 ? 146 SER A N     1 
ATOM   1830 C CA    . SER C 2 145 ? 0.600   31.222  -9.992  1.00 57.48 ? 146 SER A CA    1 
ATOM   1831 C C     . SER C 2 145 ? 1.168   29.893  -9.484  1.00 57.01 ? 146 SER A C     1 
ATOM   1832 O O     . SER C 2 145 ? 2.352   29.596  -9.653  1.00 57.29 ? 146 SER A O     1 
ATOM   1833 C CB    . SER C 2 145 ? -0.232  31.914  -8.896  1.00 58.73 ? 146 SER A CB    1 
ATOM   1834 O OG    . SER C 2 145 ? 0.500   32.099  -7.688  1.00 60.61 ? 146 SER A OG    1 
ATOM   1835 H H     . SER C 2 145 ? -0.943  31.625  -11.396 1.00 0.00  ? 146 SER A H     1 
ATOM   1836 H HG    . SER C 2 145 ? 1.281   32.660  -7.795  1.00 0.00  ? 146 SER A HG    1 
ATOM   1837 N N     . SER C 2 146 ? 0.297   29.071  -8.917  1.00 55.57 ? 147 SER A N     1 
ATOM   1838 C CA    . SER C 2 146 ? 0.682   27.769  -8.411  1.00 52.94 ? 147 SER A CA    1 
ATOM   1839 C C     . SER C 2 146 ? 1.063   26.858  -9.573  1.00 51.12 ? 147 SER A C     1 
ATOM   1840 O O     . SER C 2 146 ? 1.274   25.665  -9.379  1.00 51.11 ? 147 SER A O     1 
ATOM   1841 C CB    . SER C 2 146 ? -0.509  27.150  -7.701  1.00 52.90 ? 147 SER A CB    1 
ATOM   1842 O OG    . SER C 2 146 ? -1.589  27.065  -8.612  1.00 52.17 ? 147 SER A OG    1 
ATOM   1843 H H     . SER C 2 146 ? -0.650  29.309  -8.839  1.00 0.00  ? 147 SER A H     1 
ATOM   1844 H HG    . SER C 2 146 ? -2.248  26.478  -8.223  1.00 0.00  ? 147 SER A HG    1 
ATOM   1845 N N     . LEU C 2 147 ? 1.062   27.403  -10.790 1.00 50.01 ? 148 LEU A N     1 
ATOM   1846 C CA    . LEU C 2 147 ? 1.396   26.625  -11.982 1.00 47.71 ? 148 LEU A CA    1 
ATOM   1847 C C     . LEU C 2 147 ? 2.848   26.785  -12.418 1.00 46.56 ? 148 LEU A C     1 
ATOM   1848 O O     . LEU C 2 147 ? 3.308   26.074  -13.311 1.00 48.50 ? 148 LEU A O     1 
ATOM   1849 C CB    . LEU C 2 147 ? 0.449   26.976  -13.132 1.00 46.06 ? 148 LEU A CB    1 
ATOM   1850 H H     . LEU C 2 147 ? 0.805   28.321  -10.947 1.00 0.00  ? 148 LEU A H     1 
ATOM   1851 N N     . LYS C 2 148 ? 3.569   27.710  -11.789 1.00 44.58 ? 149 LYS A N     1 
ATOM   1852 C CA    . LYS C 2 148 ? 4.972   27.932  -12.115 1.00 42.72 ? 149 LYS A CA    1 
ATOM   1853 C C     . LYS C 2 148 ? 5.904   27.412  -11.015 1.00 40.66 ? 149 LYS A C     1 
ATOM   1854 O O     . LYS C 2 148 ? 5.476   27.188  -9.890  1.00 40.88 ? 149 LYS A O     1 
ATOM   1855 C CB    . LYS C 2 148 ? 5.222   29.421  -12.324 1.00 43.96 ? 149 LYS A CB    1 
ATOM   1856 C CG    . LYS C 2 148 ? 4.992   30.281  -11.087 1.00 48.26 ? 149 LYS A CG    1 
ATOM   1857 H H     . LYS C 2 148 ? 3.175   28.231  -11.058 1.00 0.00  ? 149 LYS A H     1 
ATOM   1858 N N     . THR C 2 149 ? 7.173   27.212  -11.340 1.00 38.89 ? 150 THR A N     1 
ATOM   1859 C CA    . THR C 2 149 ? 8.132   26.759  -10.346 1.00 38.10 ? 150 THR A CA    1 
ATOM   1860 C C     . THR C 2 149 ? 8.811   27.954  -9.660  1.00 37.75 ? 150 THR A C     1 
ATOM   1861 O O     . THR C 2 149 ? 8.899   29.045  -10.236 1.00 39.00 ? 150 THR A O     1 
ATOM   1862 C CB    . THR C 2 149 ? 9.172   25.857  -10.958 1.00 38.01 ? 150 THR A CB    1 
ATOM   1863 O OG1   . THR C 2 149 ? 9.758   26.519  -12.076 1.00 43.81 ? 150 THR A OG1   1 
ATOM   1864 C CG2   . THR C 2 149 ? 8.529   24.595  -11.427 1.00 39.23 ? 150 THR A CG2   1 
ATOM   1865 H H     . THR C 2 149 ? 7.507   27.383  -12.243 1.00 0.00  ? 150 THR A H     1 
ATOM   1866 H HG1   . THR C 2 149 ? 10.202  27.321  -11.776 1.00 0.00  ? 150 THR A HG1   1 
ATOM   1867 N N     . TYR C 2 150 ? 9.284   27.743  -8.430  1.00 36.57 ? 151 TYR A N     1 
ATOM   1868 C CA    . TYR C 2 150 ? 9.922   28.794  -7.627  1.00 32.91 ? 151 TYR A CA    1 
ATOM   1869 C C     . TYR C 2 150 ? 11.289  28.384  -7.109  1.00 34.62 ? 151 TYR A C     1 
ATOM   1870 O O     . TYR C 2 150 ? 11.640  27.203  -7.136  1.00 35.36 ? 151 TYR A O     1 
ATOM   1871 C CB    . TYR C 2 150 ? 9.052   29.121  -6.425  1.00 26.90 ? 151 TYR A CB    1 
ATOM   1872 C CG    . TYR C 2 150 ? 7.696   29.658  -6.749  1.00 23.42 ? 151 TYR A CG    1 
ATOM   1873 C CD1   . TYR C 2 150 ? 6.714   28.842  -7.308  1.00 22.22 ? 151 TYR A CD1   1 
ATOM   1874 C CD2   . TYR C 2 150 ? 7.379   30.979  -6.444  1.00 21.51 ? 151 TYR A CD2   1 
ATOM   1875 C CE1   . TYR C 2 150 ? 5.443   29.331  -7.559  1.00 22.02 ? 151 TYR A CE1   1 
ATOM   1876 C CE2   . TYR C 2 150 ? 6.121   31.485  -6.670  1.00 22.74 ? 151 TYR A CE2   1 
ATOM   1877 C CZ    . TYR C 2 150 ? 5.144   30.655  -7.235  1.00 23.62 ? 151 TYR A CZ    1 
ATOM   1878 O OH    . TYR C 2 150 ? 3.874   31.167  -7.453  1.00 24.94 ? 151 TYR A OH    1 
ATOM   1879 H H     . TYR C 2 150 ? 9.218   26.849  -8.039  1.00 0.00  ? 151 TYR A H     1 
ATOM   1880 H HH    . TYR C 2 150 ? 3.384   30.516  -7.971  1.00 0.00  ? 151 TYR A HH    1 
ATOM   1881 N N     . ASN C 2 151 ? 12.060  29.356  -6.624  1.00 35.19 ? 152 ASN A N     1 
ATOM   1882 C CA    . ASN C 2 151 ? 13.383  29.043  -6.101  1.00 33.24 ? 152 ASN A CA    1 
ATOM   1883 C C     . ASN C 2 151 ? 13.325  29.320  -4.631  1.00 31.07 ? 152 ASN A C     1 
ATOM   1884 O O     . ASN C 2 151 ? 12.452  30.047  -4.187  1.00 27.93 ? 152 ASN A O     1 
ATOM   1885 C CB    . ASN C 2 151 ? 14.485  29.906  -6.738  1.00 36.43 ? 152 ASN A CB    1 
ATOM   1886 C CG    . ASN C 2 151 ? 14.763  29.558  -8.210  1.00 39.36 ? 152 ASN A CG    1 
ATOM   1887 O OD1   . ASN C 2 151 ? 15.291  28.469  -8.539  1.00 40.40 ? 152 ASN A OD1   1 
ATOM   1888 N ND2   . ASN C 2 151 ? 14.451  30.502  -9.098  1.00 40.91 ? 152 ASN A ND2   1 
ATOM   1889 H H     . ASN C 2 151 ? 11.731  30.272  -6.564  1.00 0.00  ? 152 ASN A H     1 
ATOM   1890 H HD21  . ASN C 2 151 ? 14.643  30.303  -10.037 1.00 0.00  ? 152 ASN A HD21  1 
ATOM   1891 H HD22  . ASN C 2 151 ? 14.068  31.340  -8.772  1.00 0.00  ? 152 ASN A HD22  1 
ATOM   1892 N N     . ILE C 2 152 ? 14.281  28.763  -3.892  1.00 33.74 ? 153 ILE A N     1 
ATOM   1893 C CA    . ILE C 2 152 ? 14.368  28.933  -2.440  1.00 35.86 ? 153 ILE A CA    1 
ATOM   1894 C C     . ILE C 2 152 ? 14.243  30.386  -2.041  1.00 36.74 ? 153 ILE A C     1 
ATOM   1895 O O     . ILE C 2 152 ? 13.688  30.688  -0.995  1.00 38.11 ? 153 ILE A O     1 
ATOM   1896 C CB    . ILE C 2 152 ? 15.687  28.388  -1.827  1.00 36.58 ? 153 ILE A CB    1 
ATOM   1897 C CG1   . ILE C 2 152 ? 16.876  29.253  -2.254  1.00 40.07 ? 153 ILE A CG1   1 
ATOM   1898 C CG2   . ILE C 2 152 ? 15.900  26.935  -2.191  1.00 33.92 ? 153 ILE A CG2   1 
ATOM   1899 C CD1   . ILE C 2 152 ? 17.285  29.111  -3.717  1.00 43.16 ? 153 ILE A CD1   1 
ATOM   1900 H H     . ILE C 2 152 ? 14.925  28.188  -4.356  1.00 0.00  ? 153 ILE A H     1 
ATOM   1901 N N     . ASN C 2 153 ? 14.723  31.287  -2.893  1.00 38.13 ? 154 ASN A N     1 
ATOM   1902 C CA    . ASN C 2 153 ? 14.657  32.707  -2.604  1.00 40.10 ? 154 ASN A CA    1 
ATOM   1903 C C     . ASN C 2 153 ? 13.225  33.223  -2.601  1.00 40.39 ? 154 ASN A C     1 
ATOM   1904 O O     . ASN C 2 153 ? 13.007  34.414  -2.387  1.00 41.68 ? 154 ASN A O     1 
ATOM   1905 C CB    . ASN C 2 153 ? 15.460  33.493  -3.630  1.00 44.90 ? 154 ASN A CB    1 
ATOM   1906 C CG    . ASN C 2 153 ? 14.849  33.424  -5.018  1.00 49.00 ? 154 ASN A CG    1 
ATOM   1907 O OD1   . ASN C 2 153 ? 14.642  32.339  -5.557  1.00 50.72 ? 154 ASN A OD1   1 
ATOM   1908 N ND2   . ASN C 2 153 ? 14.551  34.583  -5.601  1.00 52.00 ? 154 ASN A ND2   1 
ATOM   1909 H H     . ASN C 2 153 ? 15.108  31.003  -3.746  1.00 0.00  ? 154 ASN A H     1 
ATOM   1910 H HD21  . ASN C 2 153 ? 14.171  34.571  -6.498  1.00 0.00  ? 154 ASN A HD21  1 
ATOM   1911 H HD22  . ASN C 2 153 ? 14.732  35.399  -5.089  1.00 0.00  ? 154 ASN A HD22  1 
ATOM   1912 N N     . GLU C 2 154 ? 12.255  32.344  -2.851  1.00 40.58 ? 155 GLU A N     1 
ATOM   1913 C CA    . GLU C 2 154 ? 10.850  32.742  -2.877  1.00 41.00 ? 155 GLU A CA    1 
ATOM   1914 C C     . GLU C 2 154 ? 9.918   31.862  -2.057  1.00 40.44 ? 155 GLU A C     1 
ATOM   1915 O O     . GLU C 2 154 ? 8.705   31.913  -2.279  1.00 38.37 ? 155 GLU A O     1 
ATOM   1916 C CB    . GLU C 2 154 ? 10.324  32.750  -4.308  1.00 42.31 ? 155 GLU A CB    1 
ATOM   1917 C CG    . GLU C 2 154 ? 10.979  33.732  -5.239  1.00 42.11 ? 155 GLU A CG    1 
ATOM   1918 C CD    . GLU C 2 154 ? 10.538  33.510  -6.662  1.00 42.15 ? 155 GLU A CD    1 
ATOM   1919 O OE1   . GLU C 2 154 ? 11.042  32.526  -7.275  1.00 40.19 ? 155 GLU A OE1   1 
ATOM   1920 O OE2   . GLU C 2 154 ? 9.670   34.302  -7.136  1.00 42.21 ? 155 GLU A OE2   1 
ATOM   1921 H H     . GLU C 2 154 ? 12.452  31.412  -3.003  1.00 0.00  ? 155 GLU A H     1 
ATOM   1922 N N     . LEU C 2 155 ? 10.462  31.071  -1.123  1.00 40.99 ? 156 LEU A N     1 
ATOM   1923 C CA    . LEU C 2 155 ? 9.661   30.164  -0.276  1.00 39.52 ? 156 LEU A CA    1 
ATOM   1924 C C     . LEU C 2 155 ? 8.388   30.790  0.276   1.00 39.42 ? 156 LEU A C     1 
ATOM   1925 O O     . LEU C 2 155 ? 7.318   30.200  0.211   1.00 39.14 ? 156 LEU A O     1 
ATOM   1926 C CB    . LEU C 2 155 ? 10.492  29.589  0.887   1.00 38.66 ? 156 LEU A CB    1 
ATOM   1927 C CG    . LEU C 2 155 ? 11.265  28.282  0.655   1.00 38.88 ? 156 LEU A CG    1 
ATOM   1928 C CD1   . LEU C 2 155 ? 11.977  27.828  1.943   1.00 38.88 ? 156 LEU A CD1   1 
ATOM   1929 C CD2   . LEU C 2 155 ? 10.304  27.203  0.189   1.00 38.81 ? 156 LEU A CD2   1 
ATOM   1930 H H     . LEU C 2 155 ? 11.436  31.102  -1.001  1.00 0.00  ? 156 LEU A H     1 
ATOM   1931 N N     . ASN C 2 156 ? 8.503   32.009  0.777   1.00 42.44 ? 157 ASN A N     1 
ATOM   1932 C CA    . ASN C 2 156 ? 7.349   32.703  1.341   1.00 44.27 ? 157 ASN A CA    1 
ATOM   1933 C C     . ASN C 2 156 ? 6.568   33.495  0.284   1.00 43.83 ? 157 ASN A C     1 
ATOM   1934 O O     . ASN C 2 156 ? 5.780   34.392  0.584   1.00 45.66 ? 157 ASN A O     1 
ATOM   1935 C CB    . ASN C 2 156 ? 7.766   33.574  2.548   1.00 46.11 ? 157 ASN A CB    1 
ATOM   1936 C CG    . ASN C 2 156 ? 8.913   34.513  2.231   1.00 47.79 ? 157 ASN A CG    1 
ATOM   1937 O OD1   . ASN C 2 156 ? 9.752   34.233  1.368   1.00 46.72 ? 157 ASN A OD1   1 
ATOM   1938 N ND2   . ASN C 2 156 ? 8.953   35.641  2.926   1.00 50.98 ? 157 ASN A ND2   1 
ATOM   1939 H H     . ASN C 2 156 ? 9.379   32.449  0.760   1.00 0.00  ? 157 ASN A H     1 
ATOM   1940 H HD21  . ASN C 2 156 ? 9.682   36.262  2.732   1.00 0.00  ? 157 ASN A HD21  1 
ATOM   1941 H HD22  . ASN C 2 156 ? 8.254   35.803  3.591   1.00 0.00  ? 157 ASN A HD22  1 
ATOM   1942 N N     . GLU C 2 157 ? 6.779   33.121  -0.966  1.00 43.27 ? 158 GLU A N     1 
ATOM   1943 C CA    . GLU C 2 157 ? 6.100   33.741  -2.097  1.00 42.38 ? 158 GLU A CA    1 
ATOM   1944 C C     . GLU C 2 157 ? 5.052   32.758  -2.610  1.00 38.64 ? 158 GLU A C     1 
ATOM   1945 O O     . GLU C 2 157 ? 3.985   33.141  -3.070  1.00 38.40 ? 158 GLU A O     1 
ATOM   1946 C CB    . GLU C 2 157 ? 7.112   34.001  -3.216  1.00 45.24 ? 158 GLU A CB    1 
ATOM   1947 C CG    . GLU C 2 157 ? 7.913   35.271  -3.081  1.00 50.61 ? 158 GLU A CG    1 
ATOM   1948 C CD    . GLU C 2 157 ? 7.622   36.200  -4.224  1.00 52.53 ? 158 GLU A CD    1 
ATOM   1949 O OE1   . GLU C 2 157 ? 8.026   35.869  -5.370  1.00 53.95 ? 158 GLU A OE1   1 
ATOM   1950 O OE2   . GLU C 2 157 ? 6.951   37.230  -3.980  1.00 55.49 ? 158 GLU A OE2   1 
ATOM   1951 H H     . GLU C 2 157 ? 7.378   32.381  -1.130  1.00 0.00  ? 158 GLU A H     1 
ATOM   1952 N N     . ILE C 2 158 ? 5.413   31.485  -2.553  1.00 35.51 ? 159 ILE A N     1 
ATOM   1953 C CA    . ILE C 2 158 ? 4.580   30.393  -3.013  1.00 32.83 ? 159 ILE A CA    1 
ATOM   1954 C C     . ILE C 2 158 ? 3.272   30.363  -2.228  1.00 34.33 ? 159 ILE A C     1 
ATOM   1955 O O     . ILE C 2 158 ? 3.267   30.333  -0.993  1.00 36.52 ? 159 ILE A O     1 
ATOM   1956 C CB    . ILE C 2 158 ? 5.351   29.071  -2.874  1.00 30.44 ? 159 ILE A CB    1 
ATOM   1957 C CG1   . ILE C 2 158 ? 6.703   29.219  -3.558  1.00 24.89 ? 159 ILE A CG1   1 
ATOM   1958 C CG2   . ILE C 2 158 ? 4.545   27.902  -3.439  1.00 27.37 ? 159 ILE A CG2   1 
ATOM   1959 C CD1   . ILE C 2 158 ? 7.709   28.155  -3.225  1.00 28.62 ? 159 ILE A CD1   1 
ATOM   1960 H H     . ILE C 2 158 ? 6.275   31.281  -2.142  1.00 0.00  ? 159 ILE A H     1 
ATOM   1961 N N     . PRO C 2 159 ? 2.142   30.381  -2.942  1.00 34.60 ? 160 PRO A N     1 
ATOM   1962 C CA    . PRO C 2 159 ? 0.829   30.362  -2.295  1.00 34.72 ? 160 PRO A CA    1 
ATOM   1963 C C     . PRO C 2 159 ? 0.424   28.983  -1.795  1.00 35.19 ? 160 PRO A C     1 
ATOM   1964 O O     . PRO C 2 159 ? 0.752   27.948  -2.402  1.00 34.23 ? 160 PRO A O     1 
ATOM   1965 C CB    . PRO C 2 159 ? -0.097  30.834  -3.415  1.00 35.03 ? 160 PRO A CB    1 
ATOM   1966 C CG    . PRO C 2 159 ? 0.540   30.199  -4.649  1.00 36.08 ? 160 PRO A CG    1 
ATOM   1967 C CD    . PRO C 2 159 ? 2.022   30.421  -4.419  1.00 35.12 ? 160 PRO A CD    1 
ATOM   1968 N N     . LYS C 2 160 ? -0.298  28.959  -0.689  1.00 35.66 ? 161 LYS A N     1 
ATOM   1969 C CA    . LYS C 2 160 ? -0.754  27.683  -0.166  1.00 37.60 ? 161 LYS A CA    1 
ATOM   1970 C C     . LYS C 2 160 ? -2.192  27.388  -0.603  1.00 35.73 ? 161 LYS A C     1 
ATOM   1971 O O     . LYS C 2 160 ? -3.002  28.301  -0.750  1.00 34.45 ? 161 LYS A O     1 
ATOM   1972 C CB    . LYS C 2 160 ? -0.566  27.615  1.348   1.00 36.82 ? 161 LYS A CB    1 
ATOM   1973 C CG    . LYS C 2 160 ? 0.839   27.200  1.727   1.00 40.32 ? 161 LYS A CG    1 
ATOM   1974 C CD    . LYS C 2 160 ? 1.207   27.667  3.108   1.00 42.32 ? 161 LYS A CD    1 
ATOM   1975 C CE    . LYS C 2 160 ? 1.262   29.183  3.163   1.00 44.81 ? 161 LYS A CE    1 
ATOM   1976 N NZ    . LYS C 2 160 ? 2.143   29.723  4.265   1.00 49.07 ? 161 LYS A NZ    1 
ATOM   1977 H H     . LYS C 2 160 ? -0.547  29.796  -0.237  1.00 0.00  ? 161 LYS A H     1 
ATOM   1978 H HZ1   . LYS C 2 160 ? 3.114   29.366  4.156   1.00 0.00  ? 161 LYS A HZ1   1 
ATOM   1979 H HZ2   . LYS C 2 160 ? 2.148   30.763  4.234   1.00 0.00  ? 161 LYS A HZ2   1 
ATOM   1980 H HZ3   . LYS C 2 160 ? 1.765   29.411  5.178   1.00 0.00  ? 161 LYS A HZ3   1 
ATOM   1981 N N     . PRO C 2 161 ? -2.491  26.109  -0.889  1.00 35.38 ? 162 PRO A N     1 
ATOM   1982 C CA    . PRO C 2 161 ? -3.800  25.630  -1.323  1.00 37.07 ? 162 PRO A CA    1 
ATOM   1983 C C     . PRO C 2 161 ? -4.733  25.178  -0.191  1.00 37.16 ? 162 PRO A C     1 
ATOM   1984 O O     . PRO C 2 161 ? -5.710  24.462  -0.441  1.00 38.94 ? 162 PRO A O     1 
ATOM   1985 C CB    . PRO C 2 161 ? -3.422  24.461  -2.229  1.00 36.51 ? 162 PRO A CB    1 
ATOM   1986 C CG    . PRO C 2 161 ? -2.331  23.826  -1.464  1.00 36.17 ? 162 PRO A CG    1 
ATOM   1987 C CD    . PRO C 2 161 ? -1.503  25.014  -0.961  1.00 36.56 ? 162 PRO A CD    1 
ATOM   1988 N N     . TYR C 2 162 ? -4.444  25.591  1.040   1.00 37.22 ? 163 TYR A N     1 
ATOM   1989 C CA    . TYR C 2 162 ? -5.267  25.230  2.196   1.00 36.97 ? 163 TYR A CA    1 
ATOM   1990 C C     . TYR C 2 162 ? -5.281  26.409  3.154   1.00 38.12 ? 163 TYR A C     1 
ATOM   1991 O O     . TYR C 2 162 ? -4.282  27.120  3.282   1.00 39.01 ? 163 TYR A O     1 
ATOM   1992 C CB    . TYR C 2 162 ? -4.730  23.972  2.881   1.00 36.91 ? 163 TYR A CB    1 
ATOM   1993 C CG    . TYR C 2 162 ? -3.282  24.065  3.286   1.00 38.33 ? 163 TYR A CG    1 
ATOM   1994 C CD1   . TYR C 2 162 ? -2.905  24.756  4.438   1.00 36.60 ? 163 TYR A CD1   1 
ATOM   1995 C CD2   . TYR C 2 162 ? -2.288  23.480  2.506   1.00 40.30 ? 163 TYR A CD2   1 
ATOM   1996 C CE1   . TYR C 2 162 ? -1.584  24.863  4.800   1.00 41.04 ? 163 TYR A CE1   1 
ATOM   1997 C CE2   . TYR C 2 162 ? -0.954  23.577  2.856   1.00 41.96 ? 163 TYR A CE2   1 
ATOM   1998 C CZ    . TYR C 2 162 ? -0.605  24.271  4.004   1.00 42.74 ? 163 TYR A CZ    1 
ATOM   1999 O OH    . TYR C 2 162 ? 0.721   24.393  4.347   1.00 47.05 ? 163 TYR A OH    1 
ATOM   2000 H H     . TYR C 2 162 ? -3.691  26.191  1.215   1.00 0.00  ? 163 TYR A H     1 
ATOM   2001 H HH    . TYR C 2 162 ? 1.238   24.031  3.622   1.00 0.00  ? 163 TYR A HH    1 
ATOM   2002 N N     . LYS C 2 163 ? -6.402  26.605  3.832   1.00 38.45 ? 164 LYS A N     1 
ATOM   2003 C CA    . LYS C 2 163 ? -6.578  27.729  4.748   1.00 39.15 ? 164 LYS A CA    1 
ATOM   2004 C C     . LYS C 2 163 ? -6.371  27.493  6.260   1.00 38.08 ? 164 LYS A C     1 
ATOM   2005 O O     . LYS C 2 163 ? -6.051  28.438  6.990   1.00 40.06 ? 164 LYS A O     1 
ATOM   2006 C CB    . LYS C 2 163 ? -7.973  28.306  4.510   1.00 40.45 ? 164 LYS A CB    1 
ATOM   2007 C CG    . LYS C 2 163 ? -8.241  29.675  5.064   1.00 44.90 ? 164 LYS A CG    1 
ATOM   2008 C CD    . LYS C 2 163 ? -9.687  30.081  4.707   1.00 50.72 ? 164 LYS A CD    1 
ATOM   2009 C CE    . LYS C 2 163 ? -10.055 31.494  5.187   1.00 54.57 ? 164 LYS A CE    1 
ATOM   2010 N NZ    . LYS C 2 163 ? -11.544 31.700  5.269   1.00 53.62 ? 164 LYS A NZ    1 
ATOM   2011 H H     . LYS C 2 163 ? -7.141  25.989  3.677   1.00 0.00  ? 164 LYS A H     1 
ATOM   2012 H HZ1   . LYS C 2 163 ? -11.964 31.546  4.330   1.00 0.00  ? 164 LYS A HZ1   1 
ATOM   2013 H HZ2   . LYS C 2 163 ? -11.943 31.014  5.941   1.00 0.00  ? 164 LYS A HZ2   1 
ATOM   2014 H HZ3   . LYS C 2 163 ? -11.750 32.667  5.591   1.00 0.00  ? 164 LYS A HZ3   1 
ATOM   2015 N N     . GLY C 2 164 ? -6.570  26.277  6.763   1.00 35.18 ? 165 GLY A N     1 
ATOM   2016 C CA    . GLY C 2 164 ? -6.399  26.118  8.195   1.00 31.38 ? 165 GLY A CA    1 
ATOM   2017 C C     . GLY C 2 164 ? -6.418  24.712  8.726   1.00 29.85 ? 165 GLY A C     1 
ATOM   2018 O O     . GLY C 2 164 ? -7.432  24.240  9.260   1.00 32.72 ? 165 GLY A O     1 
ATOM   2019 H H     . GLY C 2 164 ? -6.812  25.523  6.198   1.00 0.00  ? 165 GLY A H     1 
ATOM   2020 N N     . VAL C 2 165 ? -5.250  24.084  8.679   1.00 24.85 ? 166 VAL A N     1 
ATOM   2021 C CA    . VAL C 2 165 ? -5.105  22.707  9.103   1.00 20.46 ? 166 VAL A CA    1 
ATOM   2022 C C     . VAL C 2 165 ? -5.369  22.449  10.582  1.00 18.69 ? 166 VAL A C     1 
ATOM   2023 O O     . VAL C 2 165 ? -4.982  23.229  11.430  1.00 17.61 ? 166 VAL A O     1 
ATOM   2024 C CB    . VAL C 2 165 ? -3.725  22.177  8.704   1.00 16.09 ? 166 VAL A CB    1 
ATOM   2025 C CG1   . VAL C 2 165 ? -3.671  20.679  8.863   1.00 17.11 ? 166 VAL A CG1   1 
ATOM   2026 C CG2   . VAL C 2 165 ? -3.441  22.532  7.272   1.00 17.30 ? 166 VAL A CG2   1 
ATOM   2027 H H     . VAL C 2 165 ? -4.462  24.584  8.396   1.00 0.00  ? 166 VAL A H     1 
ATOM   2028 N N     . LYS C 2 166 ? -6.121  21.399  10.873  1.00 18.02 ? 167 LYS A N     1 
ATOM   2029 C CA    . LYS C 2 166 ? -6.390  20.980  12.241  1.00 18.41 ? 167 LYS A CA    1 
ATOM   2030 C C     . LYS C 2 166 ? -6.000  19.511  12.266  1.00 16.95 ? 167 LYS A C     1 
ATOM   2031 O O     . LYS C 2 166 ? -6.081  18.828  11.248  1.00 15.78 ? 167 LYS A O     1 
ATOM   2032 C CB    . LYS C 2 166 ? -7.861  21.177  12.618  1.00 20.12 ? 167 LYS A CB    1 
ATOM   2033 C CG    . LYS C 2 166 ? -8.231  22.630  12.651  1.00 23.23 ? 167 LYS A CG    1 
ATOM   2034 C CD    . LYS C 2 166 ? -9.512  22.907  13.384  1.00 30.48 ? 167 LYS A CD    1 
ATOM   2035 C CE    . LYS C 2 166 ? -10.562 23.510  12.468  1.00 34.26 ? 167 LYS A CE    1 
ATOM   2036 N NZ    . LYS C 2 166 ? -11.088 22.483  11.527  1.00 39.11 ? 167 LYS A NZ    1 
ATOM   2037 H H     . LYS C 2 166 ? -6.516  20.871  10.146  1.00 0.00  ? 167 LYS A H     1 
ATOM   2038 H HZ1   . LYS C 2 166 ? -11.509 21.700  12.066  1.00 0.00  ? 167 LYS A HZ1   1 
ATOM   2039 H HZ2   . LYS C 2 166 ? -11.818 22.924  10.932  1.00 0.00  ? 167 LYS A HZ2   1 
ATOM   2040 H HZ3   . LYS C 2 166 ? -10.317 22.122  10.931  1.00 0.00  ? 167 LYS A HZ3   1 
ATOM   2041 N N     . VAL C 2 167 ? -5.483  19.060  13.399  1.00 15.71 ? 168 VAL A N     1 
ATOM   2042 C CA    . VAL C 2 167 ? -5.051  17.682  13.569  1.00 15.02 ? 168 VAL A CA    1 
ATOM   2043 C C     . VAL C 2 167 ? -5.547  17.143  14.942  1.00 15.89 ? 168 VAL A C     1 
ATOM   2044 O O     . VAL C 2 167 ? -5.773  17.911  15.882  1.00 16.59 ? 168 VAL A O     1 
ATOM   2045 C CB    . VAL C 2 167 ? -3.473  17.572  13.427  1.00 13.50 ? 168 VAL A CB    1 
ATOM   2046 C CG1   . VAL C 2 167 ? -2.762  18.437  14.463  1.00 12.86 ? 168 VAL A CG1   1 
ATOM   2047 C CG2   . VAL C 2 167 ? -3.010  16.121  13.522  1.00 6.86  ? 168 VAL A CG2   1 
ATOM   2048 H H     . VAL C 2 167 ? -5.415  19.644  14.181  1.00 0.00  ? 168 VAL A H     1 
ATOM   2049 N N     . PHE C 2 168 ? -5.817  15.850  15.021  1.00 15.73 ? 169 PHE A N     1 
ATOM   2050 C CA    . PHE C 2 168 ? -6.256  15.252  16.267  1.00 14.48 ? 169 PHE A CA    1 
ATOM   2051 C C     . PHE C 2 168 ? -5.733  13.821  16.286  1.00 13.97 ? 169 PHE A C     1 
ATOM   2052 O O     . PHE C 2 168 ? -5.337  13.288  15.227  1.00 13.05 ? 169 PHE A O     1 
ATOM   2053 C CB    . PHE C 2 168 ? -7.806  15.295  16.394  1.00 16.30 ? 169 PHE A CB    1 
ATOM   2054 C CG    . PHE C 2 168 ? -8.554  14.365  15.445  1.00 17.51 ? 169 PHE A CG    1 
ATOM   2055 C CD1   . PHE C 2 168 ? -8.517  12.966  15.620  1.00 17.70 ? 169 PHE A CD1   1 
ATOM   2056 C CD2   . PHE C 2 168 ? -9.244  14.875  14.344  1.00 13.62 ? 169 PHE A CD2   1 
ATOM   2057 C CE1   . PHE C 2 168 ? -9.145  12.085  14.700  1.00 17.09 ? 169 PHE A CE1   1 
ATOM   2058 C CE2   . PHE C 2 168 ? -9.869  14.010  13.432  1.00 17.55 ? 169 PHE A CE2   1 
ATOM   2059 C CZ    . PHE C 2 168 ? -9.819  12.614  13.604  1.00 12.94 ? 169 PHE A CZ    1 
ATOM   2060 H H     . PHE C 2 168 ? -5.714  15.267  14.235  1.00 0.00  ? 169 PHE A H     1 
ATOM   2061 N N     . LEU C 2 169 ? -5.670  13.220  17.475  1.00 11.64 ? 170 LEU A N     1 
ATOM   2062 C CA    . LEU C 2 169 ? -5.277  11.816  17.604  1.00 12.45 ? 170 LEU A CA    1 
ATOM   2063 C C     . LEU C 2 169 ? -6.393  11.192  18.479  1.00 14.58 ? 170 LEU A C     1 
ATOM   2064 O O     . LEU C 2 169 ? -6.790  11.743  19.513  1.00 14.21 ? 170 LEU A O     1 
ATOM   2065 C CB    . LEU C 2 169 ? -3.860  11.632  18.215  1.00 15.30 ? 170 LEU A CB    1 
ATOM   2066 C CG    . LEU C 2 169 ? -3.230  10.217  18.344  1.00 15.85 ? 170 LEU A CG    1 
ATOM   2067 C CD1   . LEU C 2 169 ? -1.726  10.311  18.492  1.00 15.89 ? 170 LEU A CD1   1 
ATOM   2068 C CD2   . LEU C 2 169 ? -3.821  9.448   19.555  1.00 18.15 ? 170 LEU A CD2   1 
ATOM   2069 H H     . LEU C 2 169 ? -5.937  13.709  18.291  1.00 0.00  ? 170 LEU A H     1 
ATOM   2070 N N     . GLN C 2 170 ? -6.893  10.042  18.061  1.00 11.17 ? 171 GLN A N     1 
ATOM   2071 C CA    . GLN C 2 170 ? -7.957  9.427   18.775  1.00 10.06 ? 171 GLN A CA    1 
ATOM   2072 C C     . GLN C 2 170 ? -7.984  7.957   18.452  1.00 10.42 ? 171 GLN A C     1 
ATOM   2073 O O     . GLN C 2 170 ? -7.377  7.526   17.479  1.00 12.00 ? 171 GLN A O     1 
ATOM   2074 C CB    . GLN C 2 170 ? -9.234  10.131  18.347  1.00 7.64  ? 171 GLN A CB    1 
ATOM   2075 C CG    . GLN C 2 170 ? -10.494 9.755   19.095  1.00 9.87  ? 171 GLN A CG    1 
ATOM   2076 C CD    . GLN C 2 170 ? -10.344 9.985   20.553  1.00 9.34  ? 171 GLN A CD    1 
ATOM   2077 O OE1   . GLN C 2 170 ? -9.807  9.136   21.229  1.00 10.53 ? 171 GLN A OE1   1 
ATOM   2078 N NE2   . GLN C 2 170 ? -10.758 11.149  21.044  1.00 7.14  ? 171 GLN A NE2   1 
ATOM   2079 H H     . GLN C 2 170 ? -6.541  9.609   17.249  1.00 0.00  ? 171 GLN A H     1 
ATOM   2080 H HE21  . GLN C 2 170 ? -10.684 11.328  21.999  1.00 0.00  ? 171 GLN A HE21  1 
ATOM   2081 H HE22  . GLN C 2 170 ? -11.130 11.793  20.403  1.00 0.00  ? 171 GLN A HE22  1 
ATOM   2082 N N     . ASP C 2 171 ? -8.628  7.158   19.295  1.00 12.84 ? 172 ASP A N     1 
ATOM   2083 C CA    . ASP C 2 171 ? -8.708  5.729   19.010  1.00 10.70 ? 172 ASP A CA    1 
ATOM   2084 C C     . ASP C 2 171 ? -9.693  5.514   17.857  1.00 9.83  ? 172 ASP A C     1 
ATOM   2085 O O     . ASP C 2 171 ? -10.700 6.227   17.729  1.00 9.14  ? 172 ASP A O     1 
ATOM   2086 C CB    . ASP C 2 171 ? -9.198  4.943   20.233  1.00 14.31 ? 172 ASP A CB    1 
ATOM   2087 C CG    . ASP C 2 171 ? -8.181  4.891   21.335  1.00 14.08 ? 172 ASP A CG    1 
ATOM   2088 O OD1   . ASP C 2 171 ? -8.129  5.855   22.100  1.00 16.29 ? 172 ASP A OD1   1 
ATOM   2089 O OD2   . ASP C 2 171 ? -7.410  3.907   21.404  1.00 14.53 ? 172 ASP A OD2   1 
ATOM   2090 H H     . ASP C 2 171 ? -9.053  7.542   20.092  1.00 0.00  ? 172 ASP A H     1 
ATOM   2091 N N     . LYS C 2 172 ? -9.397  4.529   17.021  1.00 11.50 ? 173 LYS A N     1 
ATOM   2092 C CA    . LYS C 2 172 ? -10.250 4.225   15.892  1.00 13.81 ? 173 LYS A CA    1 
ATOM   2093 C C     . LYS C 2 172 ? -11.675 3.904   16.361  1.00 13.68 ? 173 LYS A C     1 
ATOM   2094 O O     . LYS C 2 172 ? -12.591 4.621   16.034  1.00 16.33 ? 173 LYS A O     1 
ATOM   2095 C CB    . LYS C 2 172 ? -9.665  3.061   15.093  1.00 16.48 ? 173 LYS A CB    1 
ATOM   2096 C CG    . LYS C 2 172 ? -10.534 2.665   13.905  1.00 23.26 ? 173 LYS A CG    1 
ATOM   2097 C CD    . LYS C 2 172 ? -9.720  2.310   12.694  1.00 24.07 ? 173 LYS A CD    1 
ATOM   2098 C CE    . LYS C 2 172 ? -9.212  0.934   12.777  1.00 25.75 ? 173 LYS A CE    1 
ATOM   2099 N NZ    . LYS C 2 172 ? -8.685  0.553   11.428  1.00 25.91 ? 173 LYS A NZ    1 
ATOM   2100 H H     . LYS C 2 172 ? -8.593  3.997   17.209  1.00 0.00  ? 173 LYS A H     1 
ATOM   2101 H HZ1   . LYS C 2 172 ? -9.445  0.630   10.724  1.00 0.00  ? 173 LYS A HZ1   1 
ATOM   2102 H HZ2   . LYS C 2 172 ? -7.911  1.197   11.174  1.00 0.00  ? 173 LYS A HZ2   1 
ATOM   2103 H HZ3   . LYS C 2 172 ? -8.328  -0.422  11.447  1.00 0.00  ? 173 LYS A HZ3   1 
ATOM   2104 N N     . TRP C 2 173 ? -11.830 2.902   17.218  1.00 14.15 ? 174 TRP A N     1 
ATOM   2105 C CA    . TRP C 2 173 ? -13.141 2.511   17.732  1.00 11.52 ? 174 TRP A CA    1 
ATOM   2106 C C     . TRP C 2 173 ? -13.954 3.646   18.307  1.00 12.10 ? 174 TRP A C     1 
ATOM   2107 O O     . TRP C 2 173 ? -15.178 3.660   18.191  1.00 15.31 ? 174 TRP A O     1 
ATOM   2108 C CB    . TRP C 2 173 ? -13.020 1.349   18.740  1.00 13.11 ? 174 TRP A CB    1 
ATOM   2109 C CG    . TRP C 2 173 ? -12.650 1.722   20.149  1.00 14.47 ? 174 TRP A CG    1 
ATOM   2110 C CD1   . TRP C 2 173 ? -11.404 1.676   20.718  1.00 15.45 ? 174 TRP A CD1   1 
ATOM   2111 C CD2   . TRP C 2 173 ? -13.547 2.165   21.187  1.00 16.62 ? 174 TRP A CD2   1 
ATOM   2112 N NE1   . TRP C 2 173 ? -11.477 2.062   22.035  1.00 17.78 ? 174 TRP A NE1   1 
ATOM   2113 C CE2   . TRP C 2 173 ? -12.774 2.367   22.348  1.00 16.98 ? 174 TRP A CE2   1 
ATOM   2114 C CE3   . TRP C 2 173 ? -14.930 2.410   21.245  1.00 15.49 ? 174 TRP A CE3   1 
ATOM   2115 C CZ2   . TRP C 2 173 ? -13.338 2.801   23.551  1.00 17.45 ? 174 TRP A CZ2   1 
ATOM   2116 C CZ3   . TRP C 2 173 ? -15.481 2.837   22.430  1.00 14.94 ? 174 TRP A CZ3   1 
ATOM   2117 C CH2   . TRP C 2 173 ? -14.684 3.029   23.567  1.00 14.28 ? 174 TRP A CH2   1 
ATOM   2118 H H     . TRP C 2 173 ? -11.028 2.408   17.502  1.00 0.00  ? 174 TRP A H     1 
ATOM   2119 H HE1   . TRP C 2 173 ? -10.706 2.093   22.645  1.00 0.00  ? 174 TRP A HE1   1 
ATOM   2120 N N     . VAL C 2 174 ? -13.285 4.660   18.843  1.00 11.78 ? 175 VAL A N     1 
ATOM   2121 C CA    . VAL C 2 174 ? -13.986 5.804   19.441  1.00 8.26  ? 175 VAL A CA    1 
ATOM   2122 C C     . VAL C 2 174 ? -14.670 6.722   18.432  1.00 10.02 ? 175 VAL A C     1 
ATOM   2123 O O     . VAL C 2 174 ? -15.735 7.311   18.716  1.00 7.96  ? 175 VAL A O     1 
ATOM   2124 C CB    . VAL C 2 174 ? -13.002 6.656   20.311  1.00 9.64  ? 175 VAL A CB    1 
ATOM   2125 C CG1   . VAL C 2 174 ? -13.683 7.930   20.795  1.00 9.35  ? 175 VAL A CG1   1 
ATOM   2126 C CG2   . VAL C 2 174 ? -12.499 5.864   21.500  1.00 8.81  ? 175 VAL A CG2   1 
ATOM   2127 H H     . VAL C 2 174 ? -12.306 4.668   18.817  1.00 0.00  ? 175 VAL A H     1 
ATOM   2128 N N     . ILE C 2 175 ? -14.023 6.896   17.273  1.00 10.88 ? 176 ILE A N     1 
ATOM   2129 C CA    . ILE C 2 175 ? -14.538 7.790   16.217  1.00 12.48 ? 176 ILE A CA    1 
ATOM   2130 C C     . ILE C 2 175 ? -15.297 7.099   15.085  1.00 13.00 ? 176 ILE A C     1 
ATOM   2131 O O     . ILE C 2 175 ? -15.886 7.776   14.242  1.00 15.54 ? 176 ILE A O     1 
ATOM   2132 C CB    . ILE C 2 175 ? -13.415 8.702   15.587  1.00 11.70 ? 176 ILE A CB    1 
ATOM   2133 C CG1   . ILE C 2 175 ? -12.308 7.845   14.958  1.00 11.32 ? 176 ILE A CG1   1 
ATOM   2134 C CG2   . ILE C 2 175 ? -12.903 9.724   16.619  1.00 10.95 ? 176 ILE A CG2   1 
ATOM   2135 C CD1   . ILE C 2 175 ? -11.253 8.633   14.246  1.00 11.03 ? 176 ILE A CD1   1 
ATOM   2136 H H     . ILE C 2 175 ? -13.204 6.387   17.099  1.00 0.00  ? 176 ILE A H     1 
ATOM   2137 N N     . ALA C 2 176 ? -15.248 5.776   15.070  1.00 12.51 ? 177 ALA A N     1 
ATOM   2138 C CA    . ALA C 2 176 ? -15.923 4.931   14.101  1.00 11.13 ? 177 ALA A CA    1 
ATOM   2139 C C     . ALA C 2 176 ? -17.423 5.188   14.163  1.00 13.12 ? 177 ALA A C     1 
ATOM   2140 O O     . ALA C 2 176 ? -17.967 5.468   15.240  1.00 16.31 ? 177 ALA A O     1 
ATOM   2141 C CB    . ALA C 2 176 ? -15.647 3.480   14.424  1.00 8.28  ? 177 ALA A CB    1 
ATOM   2142 H H     . ALA C 2 176 ? -14.708 5.347   15.762  1.00 0.00  ? 177 ALA A H     1 
ATOM   2143 N N     . GLY C 2 177 ? -18.098 5.060   13.027  1.00 10.53 ? 178 GLY A N     1 
ATOM   2144 C CA    . GLY C 2 177 ? -19.524 5.284   12.988  1.00 9.42  ? 178 GLY A CA    1 
ATOM   2145 C C     . GLY C 2 177 ? -20.192 3.961   12.684  1.00 8.39  ? 178 GLY A C     1 
ATOM   2146 O O     . GLY C 2 177 ? -19.558 2.897   12.782  1.00 6.56  ? 178 GLY A O     1 
ATOM   2147 H H     . GLY C 2 177 ? -17.659 4.789   12.193  1.00 0.00  ? 178 GLY A H     1 
ATOM   2148 N N     . ASP C 2 178 ? -21.484 4.018   12.369  1.00 9.15  ? 179 ASP A N     1 
ATOM   2149 C CA    . ASP C 2 178 ? -22.247 2.814   12.046  1.00 12.39 ? 179 ASP A CA    1 
ATOM   2150 C C     . ASP C 2 178 ? -22.647 2.626   10.555  1.00 13.65 ? 179 ASP A C     1 
ATOM   2151 O O     . ASP C 2 178 ? -23.282 1.637   10.220  1.00 13.76 ? 179 ASP A O     1 
ATOM   2152 C CB    . ASP C 2 178 ? -23.495 2.701   12.933  1.00 8.59  ? 179 ASP A CB    1 
ATOM   2153 C CG    . ASP C 2 178 ? -24.384 3.892   12.832  1.00 12.28 ? 179 ASP A CG    1 
ATOM   2154 O OD1   . ASP C 2 178 ? -23.952 4.945   12.331  1.00 22.81 ? 179 ASP A OD1   1 
ATOM   2155 O OD2   . ASP C 2 178 ? -25.533 3.808   13.272  1.00 13.21 ? 179 ASP A OD2   1 
ATOM   2156 H H     . ASP C 2 178 ? -21.903 4.904   12.341  1.00 0.00  ? 179 ASP A H     1 
ATOM   2157 N N     . LEU C 2 179 ? -22.313 3.576   9.681   1.00 16.69 ? 180 LEU A N     1 
ATOM   2158 C CA    . LEU C 2 179 ? -22.635 3.466   8.249   1.00 17.77 ? 180 LEU A CA    1 
ATOM   2159 C C     . LEU C 2 179 ? -21.305 3.354   7.536   1.00 16.43 ? 180 LEU A C     1 
ATOM   2160 O O     . LEU C 2 179 ? -20.318 3.893   8.007   1.00 18.71 ? 180 LEU A O     1 
ATOM   2161 C CB    . LEU C 2 179 ? -23.365 4.720   7.757   1.00 17.53 ? 180 LEU A CB    1 
ATOM   2162 C CG    . LEU C 2 179 ? -24.592 5.250   8.529   1.00 20.81 ? 180 LEU A CG    1 
ATOM   2163 C CD1   . LEU C 2 179 ? -25.087 6.519   7.850   1.00 21.10 ? 180 LEU A CD1   1 
ATOM   2164 C CD2   . LEU C 2 179 ? -25.729 4.212   8.642   1.00 17.88 ? 180 LEU A CD2   1 
ATOM   2165 H H     . LEU C 2 179 ? -21.787 4.347   9.965   1.00 0.00  ? 180 LEU A H     1 
ATOM   2166 N N     . ALA C 2 180 ? -21.266 2.637   6.423   1.00 17.38 ? 181 ALA A N     1 
ATOM   2167 C CA    . ALA C 2 180 ? -20.039 2.456   5.648   1.00 17.34 ? 181 ALA A CA    1 
ATOM   2168 C C     . ALA C 2 180 ? -19.511 3.767   5.077   1.00 16.42 ? 181 ALA A C     1 
ATOM   2169 O O     . ALA C 2 180 ? -20.281 4.663   4.783   1.00 19.21 ? 181 ALA A O     1 
ATOM   2170 C CB    . ALA C 2 180 ? -20.265 1.467   4.524   1.00 19.35 ? 181 ALA A CB    1 
ATOM   2171 H H     . ALA C 2 180 ? -22.098 2.223   6.099   1.00 0.00  ? 181 ALA A H     1 
ATOM   2172 N N     . GLY C 2 181 ? -18.189 3.884   4.975   1.00 18.40 ? 182 GLY A N     1 
ATOM   2173 C CA    . GLY C 2 181 ? -17.559 5.083   4.437   1.00 16.22 ? 182 GLY A CA    1 
ATOM   2174 C C     . GLY C 2 181 ? -17.469 5.015   2.929   1.00 17.57 ? 182 GLY A C     1 
ATOM   2175 O O     . GLY C 2 181 ? -17.348 6.042   2.261   1.00 21.51 ? 182 GLY A O     1 
ATOM   2176 H H     . GLY C 2 181 ? -17.634 3.143   5.282   1.00 0.00  ? 182 GLY A H     1 
ATOM   2177 N N     . SER C 2 182 ? -17.485 3.800   2.393   1.00 20.96 ? 183 SER A N     1 
ATOM   2178 C CA    . SER C 2 182 ? -17.464 3.574   0.941   1.00 21.60 ? 183 SER A CA    1 
ATOM   2179 C C     . SER C 2 182 ? -18.189 2.269   0.562   1.00 20.36 ? 183 SER A C     1 
ATOM   2180 O O     . SER C 2 182 ? -18.383 1.382   1.403   1.00 21.87 ? 183 SER A O     1 
ATOM   2181 C CB    . SER C 2 182 ? -16.030 3.579   0.377   1.00 21.43 ? 183 SER A CB    1 
ATOM   2182 O OG    . SER C 2 182 ? -15.267 2.490   0.845   1.00 22.09 ? 183 SER A OG    1 
ATOM   2183 H H     . SER C 2 182 ? -17.522 3.003   2.961   1.00 0.00  ? 183 SER A H     1 
ATOM   2184 H HG    . SER C 2 182 ? -14.472 2.453   0.290   1.00 0.00  ? 183 SER A HG    1 
ATOM   2185 N N     . GLY C 2 183 ? -18.615 2.162   -0.696  1.00 18.97 ? 184 GLY A N     1 
ATOM   2186 C CA    . GLY C 2 183 ? -19.285 0.961   -1.133  1.00 14.66 ? 184 GLY A CA    1 
ATOM   2187 C C     . GLY C 2 183 ? -18.368 -0.081  -1.729  1.00 16.77 ? 184 GLY A C     1 
ATOM   2188 O O     . GLY C 2 183 ? -18.017 -1.069  -1.076  1.00 16.41 ? 184 GLY A O     1 
ATOM   2189 H H     . GLY C 2 183 ? -18.455 2.903   -1.318  1.00 0.00  ? 184 GLY A H     1 
ATOM   2190 N N     . ASN C 2 184 ? -17.911 0.140   -2.957  1.00 17.53 ? 185 ASN A N     1 
ATOM   2191 C CA    . ASN C 2 184 ? -17.091 -0.881  -3.605  1.00 18.98 ? 185 ASN A CA    1 
ATOM   2192 C C     . ASN C 2 184 ? -15.842 -1.266  -2.864  1.00 18.35 ? 185 ASN A C     1 
ATOM   2193 O O     . ASN C 2 184 ? -15.341 -2.378  -3.016  1.00 20.01 ? 185 ASN A O     1 
ATOM   2194 C CB    . ASN C 2 184 ? -16.792 -0.565  -5.101  1.00 21.03 ? 185 ASN A CB    1 
ATOM   2195 C CG    . ASN C 2 184 ? -16.205 0.851   -5.351  1.00 23.74 ? 185 ASN A CG    1 
ATOM   2196 O OD1   . ASN C 2 184 ? -15.892 1.622   -4.426  1.00 23.41 ? 185 ASN A OD1   1 
ATOM   2197 N ND2   . ASN C 2 184 ? -16.094 1.199   -6.623  1.00 23.86 ? 185 ASN A ND2   1 
ATOM   2198 H H     . ASN C 2 184 ? -18.085 0.981   -3.422  1.00 0.00  ? 185 ASN A H     1 
ATOM   2199 H HD21  . ASN C 2 184 ? -15.746 2.082   -6.853  1.00 0.00  ? 185 ASN A HD21  1 
ATOM   2200 H HD22  . ASN C 2 184 ? -16.372 0.544   -7.310  1.00 0.00  ? 185 ASN A HD22  1 
ATOM   2201 N N     . THR C 2 185 ? -15.333 -0.354  -2.054  1.00 19.28 ? 186 THR A N     1 
ATOM   2202 C CA    . THR C 2 185 ? -14.129 -0.647  -1.294  1.00 19.20 ? 186 THR A CA    1 
ATOM   2203 C C     . THR C 2 185 ? -14.388 -0.943  0.188   1.00 21.28 ? 186 THR A C     1 
ATOM   2204 O O     . THR C 2 185 ? -13.468 -0.870  1.025   1.00 22.78 ? 186 THR A O     1 
ATOM   2205 C CB    . THR C 2 185 ? -13.032 0.438   -1.492  1.00 17.78 ? 186 THR A CB    1 
ATOM   2206 O OG1   . THR C 2 185 ? -13.556 1.754   -1.213  1.00 14.17 ? 186 THR A OG1   1 
ATOM   2207 C CG2   . THR C 2 185 ? -12.492 0.349   -2.918  1.00 18.05 ? 186 THR A CG2   1 
ATOM   2208 H H     . THR C 2 185 ? -15.726 0.536   -1.974  1.00 0.00  ? 186 THR A H     1 
ATOM   2209 H HG1   . THR C 2 185 ? -12.874 2.400   -1.439  1.00 0.00  ? 186 THR A HG1   1 
ATOM   2210 N N     . THR C 2 186 ? -15.646 -1.262  0.488   1.00 19.25 ? 187 THR A N     1 
ATOM   2211 C CA    . THR C 2 186 ? -16.098 -1.665  1.814   1.00 16.08 ? 187 THR A CA    1 
ATOM   2212 C C     . THR C 2 186 ? -15.327 -1.018  2.984   1.00 17.41 ? 187 THR A C     1 
ATOM   2213 O O     . THR C 2 186 ? -14.631 -1.705  3.747   1.00 16.09 ? 187 THR A O     1 
ATOM   2214 C CB    . THR C 2 186 ? -16.039 -3.207  1.944   1.00 14.03 ? 187 THR A CB    1 
ATOM   2215 O OG1   . THR C 2 186 ? -14.731 -3.680  1.638   1.00 15.79 ? 187 THR A OG1   1 
ATOM   2216 C CG2   . THR C 2 186 ? -16.983 -3.893  0.973   1.00 14.35 ? 187 THR A CG2   1 
ATOM   2217 H H     . THR C 2 186 ? -16.306 -1.260  -0.228  1.00 0.00  ? 187 THR A H     1 
ATOM   2218 H HG1   . THR C 2 186 ? -14.119 -3.245  2.254   1.00 0.00  ? 187 THR A HG1   1 
ATOM   2219 N N     . ASN C 2 187 ? -15.410 0.300   3.090   1.00 16.85 ? 188 ASN A N     1 
ATOM   2220 C CA    . ASN C 2 187 ? -14.732 1.011   4.172   1.00 17.56 ? 188 ASN A CA    1 
ATOM   2221 C C     . ASN C 2 187 ? -15.648 1.295   5.369   1.00 16.54 ? 188 ASN A C     1 
ATOM   2222 O O     . ASN C 2 187 ? -16.862 1.440   5.237   1.00 17.79 ? 188 ASN A O     1 
ATOM   2223 C CB    . ASN C 2 187 ? -14.174 2.368   3.690   1.00 14.33 ? 188 ASN A CB    1 
ATOM   2224 C CG    . ASN C 2 187 ? -12.689 2.349   3.475   1.00 14.53 ? 188 ASN A CG    1 
ATOM   2225 O OD1   . ASN C 2 187 ? -11.995 3.259   3.901   1.00 16.15 ? 188 ASN A OD1   1 
ATOM   2226 N ND2   . ASN C 2 187 ? -12.186 1.332   2.778   1.00 15.75 ? 188 ASN A ND2   1 
ATOM   2227 H H     . ASN C 2 187 ? -15.927 0.802   2.428   1.00 0.00  ? 188 ASN A H     1 
ATOM   2228 H HD21  . ASN C 2 187 ? -11.218 1.326   2.629   1.00 0.00  ? 188 ASN A HD21  1 
ATOM   2229 H HD22  . ASN C 2 187 ? -12.783 0.629   2.429   1.00 0.00  ? 188 ASN A HD22  1 
ATOM   2230 N N     . ILE C 2 188 ? -15.024 1.419   6.535   1.00 15.86 ? 189 ILE A N     1 
ATOM   2231 C CA    . ILE C 2 188 ? -15.717 1.786   7.734   1.00 10.62 ? 189 ILE A CA    1 
ATOM   2232 C C     . ILE C 2 188 ? -15.854 3.309   7.652   1.00 10.54 ? 189 ILE A C     1 
ATOM   2233 O O     . ILE C 2 188 ? -14.895 3.995   7.325   1.00 11.83 ? 189 ILE A O     1 
ATOM   2234 C CB    . ILE C 2 188 ? -14.867 1.352   8.937   1.00 12.00 ? 189 ILE A CB    1 
ATOM   2235 C CG1   . ILE C 2 188 ? -14.787 -0.177  8.948   1.00 9.34  ? 189 ILE A CG1   1 
ATOM   2236 C CG2   . ILE C 2 188 ? -15.423 1.958   10.249  1.00 10.44 ? 189 ILE A CG2   1 
ATOM   2237 C CD1   . ILE C 2 188 ? -13.924 -0.754  10.025  1.00 17.07 ? 189 ILE A CD1   1 
ATOM   2238 H H     . ILE C 2 188 ? -14.067 1.280   6.588   1.00 0.00  ? 189 ILE A H     1 
ATOM   2239 N N     . GLY C 2 189 ? -17.061 3.828   7.826   1.00 8.54  ? 190 GLY A N     1 
ATOM   2240 C CA    . GLY C 2 189 ? -17.251 5.253   7.830   1.00 9.00  ? 190 GLY A CA    1 
ATOM   2241 C C     . GLY C 2 189 ? -17.128 5.753   9.270   1.00 13.37 ? 190 GLY A C     1 
ATOM   2242 O O     . GLY C 2 189 ? -17.531 5.052   10.204  1.00 16.54 ? 190 GLY A O     1 
ATOM   2243 H H     . GLY C 2 189 ? -17.839 3.275   8.034   1.00 0.00  ? 190 GLY A H     1 
ATOM   2244 N N     . SER C 2 190 ? -16.523 6.918   9.482   1.00 10.92 ? 191 SER A N     1 
ATOM   2245 C CA    . SER C 2 190 ? -16.374 7.431   10.828  1.00 12.84 ? 191 SER A CA    1 
ATOM   2246 C C     . SER C 2 190 ? -17.676 8.143   11.206  1.00 16.23 ? 191 SER A C     1 
ATOM   2247 O O     . SER C 2 190 ? -18.627 8.119   10.430  1.00 16.88 ? 191 SER A O     1 
ATOM   2248 C CB    . SER C 2 190 ? -15.196 8.398   10.870  1.00 10.27 ? 191 SER A CB    1 
ATOM   2249 O OG    . SER C 2 190 ? -15.543 9.647   10.297  1.00 11.15 ? 191 SER A OG    1 
ATOM   2250 H H     . SER C 2 190 ? -16.215 7.456   8.724   1.00 0.00  ? 191 SER A H     1 
ATOM   2251 H HG    . SER C 2 190 ? -16.198 10.116  10.839  1.00 0.00  ? 191 SER A HG    1 
ATOM   2252 N N     . ILE C 2 191 ? -17.765 8.704   12.416  1.00 14.90 ? 192 ILE A N     1 
ATOM   2253 C CA    . ILE C 2 191 ? -18.958 9.459   12.776  1.00 13.29 ? 192 ILE A CA    1 
ATOM   2254 C C     . ILE C 2 191 ? -18.863 10.673  11.853  1.00 14.45 ? 192 ILE A C     1 
ATOM   2255 O O     . ILE C 2 191 ? -17.767 11.003  11.380  1.00 15.49 ? 192 ILE A O     1 
ATOM   2256 C CB    . ILE C 2 191 ? -18.938 9.959   14.291  1.00 15.13 ? 192 ILE A CB    1 
ATOM   2257 C CG1   . ILE C 2 191 ? -17.612 10.661  14.654  1.00 15.94 ? 192 ILE A CG1   1 
ATOM   2258 C CG2   . ILE C 2 191 ? -19.216 8.804   15.240  1.00 14.53 ? 192 ILE A CG2   1 
ATOM   2259 C CD1   . ILE C 2 191 ? -17.510 11.177  16.146  1.00 13.88 ? 192 ILE A CD1   1 
ATOM   2260 H H     . ILE C 2 191 ? -17.025 8.629   13.044  1.00 0.00  ? 192 ILE A H     1 
ATOM   2261 N N     . HIS C 2 192 ? -19.987 11.331  11.599  1.00 16.42 ? 193 HIS A N     1 
ATOM   2262 C CA    . HIS C 2 192 ? -20.054 12.503  10.735  1.00 18.68 ? 193 HIS A CA    1 
ATOM   2263 C C     . HIS C 2 192 ? -20.344 13.564  11.752  1.00 18.91 ? 193 HIS A C     1 
ATOM   2264 O O     . HIS C 2 192 ? -21.441 13.592  12.298  1.00 20.74 ? 193 HIS A O     1 
ATOM   2265 C CB    . HIS C 2 192 ? -21.208 12.332  9.726   1.00 21.19 ? 193 HIS A CB    1 
ATOM   2266 C CG    . HIS C 2 192 ? -21.368 13.477  8.761   1.00 27.71 ? 193 HIS A CG    1 
ATOM   2267 N ND1   . HIS C 2 192 ? -20.298 14.139  8.185   1.00 30.67 ? 193 HIS A ND1   1 
ATOM   2268 C CD2   . HIS C 2 192 ? -22.481 14.072  8.265   1.00 29.30 ? 193 HIS A CD2   1 
ATOM   2269 C CE1   . HIS C 2 192 ? -20.743 15.085  7.379   1.00 28.18 ? 193 HIS A CE1   1 
ATOM   2270 N NE2   . HIS C 2 192 ? -22.063 15.066  7.411   1.00 30.00 ? 193 HIS A NE2   1 
ATOM   2271 H H     . HIS C 2 192 ? -20.818 11.016  12.022  1.00 0.00  ? 193 HIS A H     1 
ATOM   2272 H HD1   . HIS C 2 192 ? -19.344 13.963  8.372   1.00 0.00  ? 193 HIS A HD1   1 
ATOM   2273 H HE2   . HIS C 2 192 ? -22.647 15.664  6.893   1.00 0.00  ? 193 HIS A HE2   1 
ATOM   2274 N N     . ALA C 2 193 ? -19.372 14.436  12.011  1.00 19.81 ? 194 ALA A N     1 
ATOM   2275 C CA    . ALA C 2 193 ? -19.517 15.442  13.070  1.00 23.78 ? 194 ALA A CA    1 
ATOM   2276 C C     . ALA C 2 193 ? -18.504 16.587  13.027  1.00 24.72 ? 194 ALA A C     1 
ATOM   2277 O O     . ALA C 2 193 ? -17.752 16.738  12.070  1.00 24.65 ? 194 ALA A O     1 
ATOM   2278 C CB    . ALA C 2 193 ? -19.394 14.723  14.464  1.00 27.04 ? 194 ALA A CB    1 
ATOM   2279 H H     . ALA C 2 193 ? -18.525 14.413  11.511  1.00 0.00  ? 194 ALA A H     1 
ATOM   2280 N N     . HIS C 2 194 ? -18.484 17.384  14.090  1.00 25.42 ? 195 HIS A N     1 
ATOM   2281 C CA    . HIS C 2 194 ? -17.553 18.501  14.189  1.00 25.41 ? 195 HIS A CA    1 
ATOM   2282 C C     . HIS C 2 194 ? -16.241 18.008  14.721  1.00 20.74 ? 195 HIS A C     1 
ATOM   2283 O O     . HIS C 2 194 ? -16.199 17.020  15.446  1.00 21.39 ? 195 HIS A O     1 
ATOM   2284 C CB    . HIS C 2 194 ? -18.106 19.589  15.088  1.00 29.03 ? 195 HIS A CB    1 
ATOM   2285 C CG    . HIS C 2 194 ? -19.304 20.282  14.515  1.00 33.57 ? 195 HIS A CG    1 
ATOM   2286 N ND1   . HIS C 2 194 ? -19.389 20.643  13.188  1.00 35.12 ? 195 HIS A ND1   1 
ATOM   2287 C CD2   . HIS C 2 194 ? -20.453 20.705  15.094  1.00 34.42 ? 195 HIS A CD2   1 
ATOM   2288 C CE1   . HIS C 2 194 ? -20.535 21.265  12.974  1.00 35.87 ? 195 HIS A CE1   1 
ATOM   2289 N NE2   . HIS C 2 194 ? -21.200 21.315  14.114  1.00 36.46 ? 195 HIS A NE2   1 
ATOM   2290 H H     . HIS C 2 194 ? -19.080 17.182  14.840  1.00 0.00  ? 195 HIS A H     1 
ATOM   2291 H HD1   . HIS C 2 194 ? -18.672 20.547  12.521  1.00 0.00  ? 195 HIS A HD1   1 
ATOM   2292 H HE2   . HIS C 2 194 ? -22.075 21.742  14.250  1.00 0.00  ? 195 HIS A HE2   1 
ATOM   2293 N N     . TYR C 2 195 ? -15.172 18.698  14.340  1.00 20.07 ? 196 TYR A N     1 
ATOM   2294 C CA    . TYR C 2 195 ? -13.794 18.358  14.712  1.00 19.23 ? 196 TYR A CA    1 
ATOM   2295 C C     . TYR C 2 195 ? -13.581 18.145  16.221  1.00 18.20 ? 196 TYR A C     1 
ATOM   2296 O O     . TYR C 2 195 ? -12.761 17.318  16.617  1.00 18.63 ? 196 TYR A O     1 
ATOM   2297 C CB    . TYR C 2 195 ? -12.827 19.428  14.159  1.00 17.67 ? 196 TYR A CB    1 
ATOM   2298 C CG    . TYR C 2 195 ? -11.447 19.432  14.801  1.00 16.16 ? 196 TYR A CG    1 
ATOM   2299 C CD1   . TYR C 2 195 ? -10.465 18.544  14.404  1.00 17.09 ? 196 TYR A CD1   1 
ATOM   2300 C CD2   . TYR C 2 195 ? -11.144 20.319  15.827  1.00 16.86 ? 196 TYR A CD2   1 
ATOM   2301 C CE1   . TYR C 2 195 ? -9.210  18.532  15.021  1.00 14.01 ? 196 TYR A CE1   1 
ATOM   2302 C CE2   . TYR C 2 195 ? -9.896  20.324  16.437  1.00 14.24 ? 196 TYR A CE2   1 
ATOM   2303 C CZ    . TYR C 2 195 ? -8.939  19.428  16.030  1.00 13.70 ? 196 TYR A CZ    1 
ATOM   2304 O OH    . TYR C 2 195 ? -7.708  19.459  16.625  1.00 16.02 ? 196 TYR A OH    1 
ATOM   2305 H H     . TYR C 2 195 ? -15.321 19.487  13.774  1.00 0.00  ? 196 TYR A H     1 
ATOM   2306 H HH    . TYR C 2 195 ? -7.272  18.614  16.508  1.00 0.00  ? 196 TYR A HH    1 
ATOM   2307 N N     . LYS C 2 196 ? -14.319 18.902  17.032  1.00 20.29 ? 197 LYS A N     1 
ATOM   2308 C CA    . LYS C 2 196 ? -14.266 18.840  18.497  1.00 21.86 ? 197 LYS A CA    1 
ATOM   2309 C C     . LYS C 2 196 ? -14.704 17.486  19.019  1.00 21.85 ? 197 LYS A C     1 
ATOM   2310 O O     . LYS C 2 196 ? -14.162 16.977  20.003  1.00 22.13 ? 197 LYS A O     1 
ATOM   2311 C CB    . LYS C 2 196 ? -15.180 19.907  19.102  1.00 23.22 ? 197 LYS A CB    1 
ATOM   2312 H H     . LYS C 2 196 ? -14.903 19.574  16.620  1.00 0.00  ? 197 LYS A H     1 
ATOM   2313 N N     . ASP C 2 197 ? -15.689 16.898  18.350  1.00 21.69 ? 198 ASP A N     1 
ATOM   2314 C CA    . ASP C 2 197 ? -16.204 15.609  18.761  1.00 20.18 ? 198 ASP A CA    1 
ATOM   2315 C C     . ASP C 2 197 ? -15.198 14.509  18.526  1.00 17.96 ? 198 ASP A C     1 
ATOM   2316 O O     . ASP C 2 197 ? -15.253 13.459  19.175  1.00 17.23 ? 198 ASP A O     1 
ATOM   2317 C CB    . ASP C 2 197 ? -17.537 15.295  18.062  1.00 23.73 ? 198 ASP A CB    1 
ATOM   2318 C CG    . ASP C 2 197 ? -18.647 16.267  18.439  1.00 25.75 ? 198 ASP A CG    1 
ATOM   2319 O OD1   . ASP C 2 197 ? -18.809 16.604  19.633  1.00 30.30 ? 198 ASP A OD1   1 
ATOM   2320 O OD2   . ASP C 2 197 ? -19.384 16.705  17.535  1.00 32.11 ? 198 ASP A OD2   1 
ATOM   2321 H H     . ASP C 2 197 ? -16.062 17.321  17.550  1.00 0.00  ? 198 ASP A H     1 
ATOM   2322 N N     . PHE C 2 198 ? -14.275 14.739  17.598  1.00 17.85 ? 199 PHE A N     1 
ATOM   2323 C CA    . PHE C 2 198 ? -13.225 13.762  17.278  1.00 15.46 ? 199 PHE A CA    1 
ATOM   2324 C C     . PHE C 2 198 ? -12.164 13.859  18.388  1.00 15.73 ? 199 PHE A C     1 
ATOM   2325 O O     . PHE C 2 198 ? -11.699 12.852  18.942  1.00 14.27 ? 199 PHE A O     1 
ATOM   2326 C CB    . PHE C 2 198 ? -12.625 14.065  15.881  1.00 15.31 ? 199 PHE A CB    1 
ATOM   2327 C CG    . PHE C 2 198 ? -13.517 13.653  14.735  1.00 9.84  ? 199 PHE A CG    1 
ATOM   2328 C CD1   . PHE C 2 198 ? -13.500 12.347  14.269  1.00 9.87  ? 199 PHE A CD1   1 
ATOM   2329 C CD2   . PHE C 2 198 ? -14.427 14.542  14.184  1.00 11.18 ? 199 PHE A CD2   1 
ATOM   2330 C CE1   . PHE C 2 198 ? -14.380 11.923  13.282  1.00 5.23  ? 199 PHE A CE1   1 
ATOM   2331 C CE2   . PHE C 2 198 ? -15.321 14.119  13.183  1.00 8.26  ? 199 PHE A CE2   1 
ATOM   2332 C CZ    . PHE C 2 198 ? -15.308 12.827  12.737  1.00 6.61  ? 199 PHE A CZ    1 
ATOM   2333 H H     . PHE C 2 198 ? -14.298 15.582  17.103  1.00 0.00  ? 199 PHE A H     1 
ATOM   2334 N N     . VAL C 2 199 ? -11.868 15.101  18.753  1.00 16.24 ? 200 VAL A N     1 
ATOM   2335 C CA    . VAL C 2 199 ? -10.913 15.422  19.806  1.00 16.30 ? 200 VAL A CA    1 
ATOM   2336 C C     . VAL C 2 199 ? -11.435 14.883  21.125  1.00 17.11 ? 200 VAL A C     1 
ATOM   2337 O O     . VAL C 2 199 ? -10.757 14.083  21.787  1.00 19.47 ? 200 VAL A O     1 
ATOM   2338 C CB    . VAL C 2 199 ? -10.680 16.961  19.939  1.00 13.33 ? 200 VAL A CB    1 
ATOM   2339 C CG1   . VAL C 2 199 ? -9.877  17.289  21.222  1.00 12.56 ? 200 VAL A CG1   1 
ATOM   2340 C CG2   . VAL C 2 199 ? -9.885  17.450  18.753  1.00 9.78  ? 200 VAL A CG2   1 
ATOM   2341 H H     . VAL C 2 199 ? -12.291 15.839  18.268  1.00 0.00  ? 200 VAL A H     1 
ATOM   2342 N N     . GLU C 2 200 ? -12.668 15.265  21.458  1.00 18.31 ? 201 GLU A N     1 
ATOM   2343 C CA    . GLU C 2 200 ? -13.319 14.843  22.700  1.00 20.43 ? 201 GLU A CA    1 
ATOM   2344 C C     . GLU C 2 200 ? -13.635 13.376  22.773  1.00 21.99 ? 201 GLU A C     1 
ATOM   2345 O O     . GLU C 2 200 ? -13.693 12.830  23.849  1.00 24.96 ? 201 GLU A O     1 
ATOM   2346 C CB    . GLU C 2 200 ? -14.594 15.620  22.901  1.00 22.07 ? 201 GLU A CB    1 
ATOM   2347 C CG    . GLU C 2 200 ? -14.352 17.122  22.938  1.00 30.76 ? 201 GLU A CG    1 
ATOM   2348 C CD    . GLU C 2 200 ? -15.585 17.900  23.373  1.00 33.60 ? 201 GLU A CD    1 
ATOM   2349 O OE1   . GLU C 2 200 ? -16.635 17.263  23.650  1.00 37.09 ? 201 GLU A OE1   1 
ATOM   2350 O OE2   . GLU C 2 200 ? -15.500 19.147  23.446  1.00 35.90 ? 201 GLU A OE2   1 
ATOM   2351 H H     . GLU C 2 200 ? -13.130 15.849  20.854  1.00 0.00  ? 201 GLU A H     1 
ATOM   2352 N N     . GLY C 2 201 ? -13.887 12.745  21.630  1.00 22.34 ? 202 GLY A N     1 
ATOM   2353 C CA    . GLY C 2 201 ? -14.201 11.326  21.609  1.00 22.46 ? 202 GLY A CA    1 
ATOM   2354 C C     . GLY C 2 201 ? -15.683 10.999  21.714  1.00 22.78 ? 202 GLY A C     1 
ATOM   2355 O O     . GLY C 2 201 ? -16.034 9.919   22.221  1.00 22.73 ? 202 GLY A O     1 
ATOM   2356 H H     . GLY C 2 201 ? -13.875 13.224  20.777  1.00 0.00  ? 202 GLY A H     1 
ATOM   2357 N N     . LYS C 2 202 ? -16.541 11.930  21.270  1.00 22.64 ? 203 LYS A N     1 
ATOM   2358 C CA    . LYS C 2 202 ? -18.001 11.785  21.275  1.00 23.41 ? 203 LYS A CA    1 
ATOM   2359 C C     . LYS C 2 202 ? -18.468 10.807  20.189  1.00 24.08 ? 203 LYS A C     1 
ATOM   2360 O O     . LYS C 2 202 ? -19.082 11.230  19.193  1.00 25.46 ? 203 LYS A O     1 
ATOM   2361 C CB    . LYS C 2 202 ? -18.648 13.126  21.003  1.00 24.78 ? 203 LYS A CB    1 
ATOM   2362 C CG    . LYS C 2 202 ? -18.273 14.184  21.994  1.00 34.86 ? 203 LYS A CG    1 
ATOM   2363 C CD    . LYS C 2 202 ? -18.744 13.816  23.407  1.00 39.15 ? 203 LYS A CD    1 
ATOM   2364 C CE    . LYS C 2 202 ? -18.438 14.940  24.419  1.00 43.71 ? 203 LYS A CE    1 
ATOM   2365 N NZ    . LYS C 2 202 ? -19.144 16.236  24.122  1.00 49.10 ? 203 LYS A NZ    1 
ATOM   2366 H H     . LYS C 2 202 ? -16.159 12.739  20.867  1.00 0.00  ? 203 LYS A H     1 
ATOM   2367 H HZ1   . LYS C 2 202 ? -18.857 16.578  23.183  1.00 0.00  ? 203 LYS A HZ1   1 
ATOM   2368 H HZ2   . LYS C 2 202 ? -20.173 16.087  24.137  1.00 0.00  ? 203 LYS A HZ2   1 
ATOM   2369 H HZ3   . LYS C 2 202 ? -18.881 16.942  24.839  1.00 0.00  ? 203 LYS A HZ3   1 
ATOM   2370 N N     . GLY C 2 203 ? -18.233 9.510   20.396  1.00 20.06 ? 204 GLY A N     1 
ATOM   2371 C CA    . GLY C 2 203 ? -18.627 8.538   19.398  1.00 20.27 ? 204 GLY A CA    1 
ATOM   2372 C C     . GLY C 2 203 ? -19.960 7.882   19.660  1.00 20.38 ? 204 GLY A C     1 
ATOM   2373 O O     . GLY C 2 203 ? -20.824 8.454   20.327  1.00 19.19 ? 204 GLY A O     1 
ATOM   2374 H H     . GLY C 2 203 ? -17.778 9.221   21.215  1.00 0.00  ? 204 GLY A H     1 
ATOM   2375 N N     . ILE C 2 204 ? -20.129 6.686   19.107  1.00 19.67 ? 205 ILE A N     1 
ATOM   2376 C CA    . ILE C 2 204 ? -21.356 5.931   19.270  1.00 18.62 ? 205 ILE A CA    1 
ATOM   2377 C C     . ILE C 2 204 ? -21.191 4.552   19.912  1.00 16.10 ? 205 ILE A C     1 
ATOM   2378 O O     . ILE C 2 204 ? -22.125 4.048   20.502  1.00 19.18 ? 205 ILE A O     1 
ATOM   2379 C CB    . ILE C 2 204 ? -22.120 5.739   17.923  1.00 18.19 ? 205 ILE A CB    1 
ATOM   2380 C CG1   . ILE C 2 204 ? -21.348 4.848   16.981  1.00 15.72 ? 205 ILE A CG1   1 
ATOM   2381 C CG2   . ILE C 2 204 ? -22.369 7.055   17.263  1.00 19.45 ? 205 ILE A CG2   1 
ATOM   2382 C CD1   . ILE C 2 204 ? -22.211 4.416   15.824  1.00 19.07 ? 205 ILE A CD1   1 
ATOM   2383 H H     . ILE C 2 204 ? -19.432 6.319   18.556  1.00 0.00  ? 205 ILE A H     1 
ATOM   2384 N N     . PHE C 2 205 ? -20.055 3.904   19.749  1.00 11.92 ? 206 PHE A N     1 
ATOM   2385 C CA    . PHE C 2 205 ? -19.896 2.602   20.346  1.00 14.63 ? 206 PHE A CA    1 
ATOM   2386 C C     . PHE C 2 205 ? -19.567 2.720   21.841  1.00 17.29 ? 206 PHE A C     1 
ATOM   2387 O O     . PHE C 2 205 ? -18.867 3.632   22.261  1.00 17.63 ? 206 PHE A O     1 
ATOM   2388 C CB    . PHE C 2 205 ? -18.841 1.799   19.574  1.00 13.53 ? 206 PHE A CB    1 
ATOM   2389 C CG    . PHE C 2 205 ? -19.237 1.504   18.131  1.00 17.09 ? 206 PHE A CG    1 
ATOM   2390 C CD1   . PHE C 2 205 ? -20.089 0.431   17.825  1.00 16.28 ? 206 PHE A CD1   1 
ATOM   2391 C CD2   . PHE C 2 205 ? -18.770 2.288   17.083  1.00 14.11 ? 206 PHE A CD2   1 
ATOM   2392 C CE1   . PHE C 2 205 ? -20.455 0.149   16.515  1.00 12.74 ? 206 PHE A CE1   1 
ATOM   2393 C CE2   . PHE C 2 205 ? -19.146 2.002   15.767  1.00 13.11 ? 206 PHE A CE2   1 
ATOM   2394 C CZ    . PHE C 2 205 ? -19.982 0.939   15.486  1.00 11.12 ? 206 PHE A CZ    1 
ATOM   2395 H H     . PHE C 2 205 ? -19.320 4.311   19.238  1.00 0.00  ? 206 PHE A H     1 
ATOM   2396 N N     . ASP C 2 206 ? -20.096 1.800   22.641  1.00 19.95 ? 207 ASP A N     1 
ATOM   2397 C CA    . ASP C 2 206 ? -19.857 1.800   24.079  1.00 20.05 ? 207 ASP A CA    1 
ATOM   2398 C C     . ASP C 2 206 ? -18.501 1.261   24.410  1.00 17.74 ? 207 ASP A C     1 
ATOM   2399 O O     . ASP C 2 206 ? -17.844 1.739   25.324  1.00 18.09 ? 207 ASP A O     1 
ATOM   2400 C CB    . ASP C 2 206 ? -20.899 0.956   24.799  1.00 23.45 ? 207 ASP A CB    1 
ATOM   2401 C CG    . ASP C 2 206 ? -22.274 1.568   24.755  1.00 27.45 ? 207 ASP A CG    1 
ATOM   2402 O OD1   . ASP C 2 206 ? -22.413 2.822   24.700  1.00 29.60 ? 207 ASP A OD1   1 
ATOM   2403 O OD2   . ASP C 2 206 ? -23.227 0.768   24.755  1.00 34.61 ? 207 ASP A OD2   1 
ATOM   2404 H H     . ASP C 2 206 ? -20.654 1.117   22.292  1.00 0.00  ? 207 ASP A H     1 
ATOM   2405 N N     . SER C 2 207 ? -18.061 0.291   23.633  1.00 15.25 ? 208 SER A N     1 
ATOM   2406 C CA    . SER C 2 207 ? -16.782 -0.319  23.854  1.00 14.46 ? 208 SER A CA    1 
ATOM   2407 C C     . SER C 2 207 ? -16.127 -0.709  22.538  1.00 15.80 ? 208 SER A C     1 
ATOM   2408 O O     . SER C 2 207 ? -16.756 -0.630  21.487  1.00 12.81 ? 208 SER A O     1 
ATOM   2409 C CB    . SER C 2 207 ? -16.984 -1.555  24.706  1.00 17.00 ? 208 SER A CB    1 
ATOM   2410 O OG    . SER C 2 207 ? -17.669 -2.551  23.975  1.00 22.50 ? 208 SER A OG    1 
ATOM   2411 H H     . SER C 2 207 ? -18.578 -0.034  22.873  1.00 0.00  ? 208 SER A H     1 
ATOM   2412 H HG    . SER C 2 207 ? -17.995 -3.205  24.611  1.00 0.00  ? 208 SER A HG    1 
ATOM   2413 N N     . GLU C 2 208 ? -14.867 -1.140  22.604  1.00 15.57 ? 209 GLU A N     1 
ATOM   2414 C CA    . GLU C 2 208 ? -14.120 -1.548  21.431  1.00 17.75 ? 209 GLU A CA    1 
ATOM   2415 C C     . GLU C 2 208 ? -14.572 -2.918  20.975  1.00 19.08 ? 209 GLU A C     1 
ATOM   2416 O O     . GLU C 2 208 ? -14.258 -3.353  19.865  1.00 18.20 ? 209 GLU A O     1 
ATOM   2417 C CB    . GLU C 2 208 ? -12.610 -1.550  21.685  1.00 18.66 ? 209 GLU A CB    1 
ATOM   2418 C CG    . GLU C 2 208 ? -11.796 -2.055  20.465  1.00 27.06 ? 209 GLU A CG    1 
ATOM   2419 C CD    . GLU C 2 208 ? -10.311 -1.704  20.519  1.00 31.88 ? 209 GLU A CD    1 
ATOM   2420 O OE1   . GLU C 2 208 ? -9.723  -1.704  21.620  1.00 37.15 ? 209 GLU A OE1   1 
ATOM   2421 O OE2   . GLU C 2 208 ? -9.727  -1.441  19.445  1.00 29.80 ? 209 GLU A OE2   1 
ATOM   2422 H H     . GLU C 2 208 ? -14.413 -1.161  23.468  1.00 0.00  ? 209 GLU A H     1 
ATOM   2423 N N     . ASP C 2 209 ? -15.306 -3.607  21.837  1.00 19.17 ? 210 ASP A N     1 
ATOM   2424 C CA    . ASP C 2 209 ? -15.815 -4.922  21.498  1.00 17.77 ? 210 ASP A CA    1 
ATOM   2425 C C     . ASP C 2 209 ? -17.084 -4.776  20.695  1.00 14.52 ? 210 ASP A C     1 
ATOM   2426 O O     . ASP C 2 209 ? -17.397 -5.612  19.870  1.00 12.96 ? 210 ASP A O     1 
ATOM   2427 C CB    . ASP C 2 209 ? -16.095 -5.697  22.758  1.00 22.38 ? 210 ASP A CB    1 
ATOM   2428 C CG    . ASP C 2 209 ? -14.868 -5.885  23.567  1.00 27.89 ? 210 ASP A CG    1 
ATOM   2429 O OD1   . ASP C 2 209 ? -14.069 -6.783  23.206  1.00 34.27 ? 210 ASP A OD1   1 
ATOM   2430 O OD2   . ASP C 2 209 ? -14.684 -5.088  24.520  1.00 33.79 ? 210 ASP A OD2   1 
ATOM   2431 H H     . ASP C 2 209 ? -15.513 -3.242  22.718  1.00 0.00  ? 210 ASP A H     1 
ATOM   2432 N N     . GLU C 2 210 ? -17.819 -3.717  20.985  1.00 11.92 ? 211 GLU A N     1 
ATOM   2433 C CA    . GLU C 2 210 ? -19.030 -3.452  20.306  1.00 13.83 ? 211 GLU A CA    1 
ATOM   2434 C C     . GLU C 2 210 ? -18.623 -3.083  18.899  1.00 16.44 ? 211 GLU A C     1 
ATOM   2435 O O     . GLU C 2 210 ? -19.102 -3.697  17.940  1.00 18.12 ? 211 GLU A O     1 
ATOM   2436 C CB    . GLU C 2 210 ? -19.808 -2.297  20.955  1.00 15.26 ? 211 GLU A CB    1 
ATOM   2437 C CG    . GLU C 2 210 ? -21.259 -2.218  20.463  1.00 14.81 ? 211 GLU A CG    1 
ATOM   2438 C CD    . GLU C 2 210 ? -22.108 -1.153  21.126  1.00 16.02 ? 211 GLU A CD    1 
ATOM   2439 O OE1   . GLU C 2 210 ? -21.666 0.009   21.242  1.00 15.84 ? 211 GLU A OE1   1 
ATOM   2440 O OE2   . GLU C 2 210 ? -23.264 -1.470  21.481  1.00 18.22 ? 211 GLU A OE2   1 
ATOM   2441 H H     . GLU C 2 210 ? -17.523 -3.103  21.689  1.00 0.00  ? 211 GLU A H     1 
ATOM   2442 N N     . PHE C 2 211 ? -17.699 -2.128  18.778  1.00 14.00 ? 212 PHE A N     1 
ATOM   2443 C CA    . PHE C 2 211 ? -17.239 -1.671  17.478  1.00 14.59 ? 212 PHE A CA    1 
ATOM   2444 C C     . PHE C 2 211 ? -16.823 -2.824  16.559  1.00 15.41 ? 212 PHE A C     1 
ATOM   2445 O O     . PHE C 2 211 ? -17.245 -2.898  15.398  1.00 16.23 ? 212 PHE A O     1 
ATOM   2446 C CB    . PHE C 2 211 ? -16.116 -0.623  17.650  1.00 15.40 ? 212 PHE A CB    1 
ATOM   2447 C CG    . PHE C 2 211 ? -15.116 -0.582  16.497  1.00 13.77 ? 212 PHE A CG    1 
ATOM   2448 C CD1   . PHE C 2 211 ? -15.396 0.142   15.330  1.00 16.72 ? 212 PHE A CD1   1 
ATOM   2449 C CD2   . PHE C 2 211 ? -13.904 -1.288  16.576  1.00 12.56 ? 212 PHE A CD2   1 
ATOM   2450 C CE1   . PHE C 2 211 ? -14.479 0.157   14.251  1.00 15.56 ? 212 PHE A CE1   1 
ATOM   2451 C CE2   . PHE C 2 211 ? -12.982 -1.285  15.516  1.00 14.62 ? 212 PHE A CE2   1 
ATOM   2452 C CZ    . PHE C 2 211 ? -13.262 -0.568  14.349  1.00 13.95 ? 212 PHE A CZ    1 
ATOM   2453 H H     . PHE C 2 211 ? -17.324 -1.715  19.584  1.00 0.00  ? 212 PHE A H     1 
ATOM   2454 N N     . LEU C 2 212 ? -15.991 -3.720  17.073  1.00 14.94 ? 213 LEU A N     1 
ATOM   2455 C CA    . LEU C 2 212 ? -15.523 -4.846  16.307  1.00 14.95 ? 213 LEU A CA    1 
ATOM   2456 C C     . LEU C 2 212 ? -16.664 -5.813  15.932  1.00 18.38 ? 213 LEU A C     1 
ATOM   2457 O O     . LEU C 2 212 ? -16.669 -6.362  14.811  1.00 20.59 ? 213 LEU A O     1 
ATOM   2458 C CB    . LEU C 2 212 ? -14.432 -5.592  17.080  1.00 12.67 ? 213 LEU A CB    1 
ATOM   2459 C CG    . LEU C 2 212 ? -13.028 -5.029  17.193  1.00 17.19 ? 213 LEU A CG    1 
ATOM   2460 C CD1   . LEU C 2 212 ? -12.100 -6.039  17.869  1.00 17.75 ? 213 LEU A CD1   1 
ATOM   2461 C CD2   . LEU C 2 212 ? -12.489 -4.757  15.811  1.00 20.53 ? 213 LEU A CD2   1 
ATOM   2462 H H     . LEU C 2 212 ? -15.661 -3.604  17.991  1.00 0.00  ? 213 LEU A H     1 
ATOM   2463 N N     . ASP C 2 213 ? -17.632 -6.026  16.837  1.00 17.90 ? 214 ASP A N     1 
ATOM   2464 C CA    . ASP C 2 213 ? -18.717 -6.948  16.536  1.00 14.89 ? 214 ASP A CA    1 
ATOM   2465 C C     . ASP C 2 213 ? -19.650 -6.394  15.479  1.00 13.47 ? 214 ASP A C     1 
ATOM   2466 O O     . ASP C 2 213 ? -20.116 -7.122  14.597  1.00 14.51 ? 214 ASP A O     1 
ATOM   2467 C CB    . ASP C 2 213 ? -19.486 -7.346  17.800  1.00 16.54 ? 214 ASP A CB    1 
ATOM   2468 C CG    . ASP C 2 213 ? -20.392 -8.560  17.575  1.00 14.74 ? 214 ASP A CG    1 
ATOM   2469 O OD1   . ASP C 2 213 ? -19.893 -9.636  17.148  1.00 13.53 ? 214 ASP A OD1   1 
ATOM   2470 O OD2   . ASP C 2 213 ? -21.602 -8.424  17.812  1.00 15.88 ? 214 ASP A OD2   1 
ATOM   2471 H H     . ASP C 2 213 ? -17.627 -5.553  17.694  1.00 0.00  ? 214 ASP A H     1 
ATOM   2472 N N     . TYR C 2 214 ? -19.983 -5.125  15.610  1.00 11.83 ? 215 TYR A N     1 
ATOM   2473 C CA    . TYR C 2 214 ? -20.820 -4.446  14.637  1.00 13.69 ? 215 TYR A CA    1 
ATOM   2474 C C     . TYR C 2 214 ? -20.141 -4.530  13.230  1.00 15.23 ? 215 TYR A C     1 
ATOM   2475 O O     . TYR C 2 214 ? -20.762 -4.954  12.247  1.00 16.19 ? 215 TYR A O     1 
ATOM   2476 C CB    . TYR C 2 214 ? -20.997 -2.985  15.081  1.00 11.97 ? 215 TYR A CB    1 
ATOM   2477 C CG    . TYR C 2 214 ? -21.835 -2.156  14.176  1.00 12.51 ? 215 TYR A CG    1 
ATOM   2478 C CD1   . TYR C 2 214 ? -21.352 -1.745  12.927  1.00 12.92 ? 215 TYR A CD1   1 
ATOM   2479 C CD2   . TYR C 2 214 ? -23.164 -1.896  14.490  1.00 13.01 ? 215 TYR A CD2   1 
ATOM   2480 C CE1   . TYR C 2 214 ? -22.194 -1.123  12.012  1.00 10.86 ? 215 TYR A CE1   1 
ATOM   2481 C CE2   . TYR C 2 214 ? -24.010 -1.273  13.593  1.00 12.98 ? 215 TYR A CE2   1 
ATOM   2482 C CZ    . TYR C 2 214 ? -23.523 -0.892  12.348  1.00 12.13 ? 215 TYR A CZ    1 
ATOM   2483 O OH    . TYR C 2 214 ? -24.370 -0.274  11.463  1.00 7.34  ? 215 TYR A OH    1 
ATOM   2484 H H     . TYR C 2 214 ? -19.666 -4.633  16.388  1.00 0.00  ? 215 TYR A H     1 
ATOM   2485 H HH    . TYR C 2 214 ? -23.874 -0.039  10.671  1.00 0.00  ? 215 TYR A HH    1 
ATOM   2486 N N     . TRP C 2 215 ? -18.840 -4.253  13.150  1.00 14.14 ? 216 TRP A N     1 
ATOM   2487 C CA    . TRP C 2 215 ? -18.146 -4.284  11.870  1.00 10.86 ? 216 TRP A CA    1 
ATOM   2488 C C     . TRP C 2 215 ? -17.814 -5.682  11.325  1.00 10.38 ? 216 TRP A C     1 
ATOM   2489 O O     . TRP C 2 215 ? -17.797 -5.894  10.108  1.00 14.17 ? 216 TRP A O     1 
ATOM   2490 C CB    . TRP C 2 215 ? -16.985 -3.262  11.871  1.00 8.10  ? 216 TRP A CB    1 
ATOM   2491 C CG    . TRP C 2 215 ? -17.529 -1.797  11.754  1.00 5.47  ? 216 TRP A CG    1 
ATOM   2492 C CD1   . TRP C 2 215 ? -17.573 -0.865  12.735  1.00 6.55  ? 216 TRP A CD1   1 
ATOM   2493 C CD2   . TRP C 2 215 ? -18.187 -1.190  10.604  1.00 7.77  ? 216 TRP A CD2   1 
ATOM   2494 N NE1   . TRP C 2 215 ? -18.226 0.279   12.295  1.00 6.54  ? 216 TRP A NE1   1 
ATOM   2495 C CE2   . TRP C 2 215 ? -18.609 0.098   10.990  1.00 8.66  ? 216 TRP A CE2   1 
ATOM   2496 C CE3   . TRP C 2 215 ? -18.459 -1.621  9.284   1.00 10.22 ? 216 TRP A CE3   1 
ATOM   2497 C CZ2   . TRP C 2 215 ? -19.296 0.969   10.104  1.00 9.77  ? 216 TRP A CZ2   1 
ATOM   2498 C CZ3   . TRP C 2 215 ? -19.140 -0.743  8.413   1.00 12.32 ? 216 TRP A CZ3   1 
ATOM   2499 C CH2   . TRP C 2 215 ? -19.547 0.532   8.838   1.00 7.95  ? 216 TRP A CH2   1 
ATOM   2500 H H     . TRP C 2 215 ? -18.326 -3.999  13.944  1.00 0.00  ? 216 TRP A H     1 
ATOM   2501 H HE1   . TRP C 2 215 ? -18.382 1.110   12.808  1.00 0.00  ? 216 TRP A HE1   1 
ATOM   2502 N N     . ARG C 2 216 ? -17.701 -6.668  12.202  1.00 10.46 ? 217 ARG A N     1 
ATOM   2503 C CA    . ARG C 2 216 ? -17.472 -8.051  11.771  1.00 13.59 ? 217 ARG A CA    1 
ATOM   2504 C C     . ARG C 2 216 ? -18.730 -8.739  11.180  1.00 14.39 ? 217 ARG A C     1 
ATOM   2505 O O     . ARG C 2 216 ? -18.649 -9.804  10.553  1.00 14.94 ? 217 ARG A O     1 
ATOM   2506 C CB    . ARG C 2 216 ? -16.989 -8.870  12.959  1.00 13.36 ? 217 ARG A CB    1 
ATOM   2507 C CG    . ARG C 2 216 ? -15.535 -8.628  13.232  1.00 20.72 ? 217 ARG A CG    1 
ATOM   2508 C CD    . ARG C 2 216 ? -15.025 -9.295  14.481  1.00 24.96 ? 217 ARG A CD    1 
ATOM   2509 N NE    . ARG C 2 216 ? -13.581 -9.145  14.526  1.00 28.09 ? 217 ARG A NE    1 
ATOM   2510 C CZ    . ARG C 2 216 ? -12.833 -9.244  15.621  1.00 30.82 ? 217 ARG A CZ    1 
ATOM   2511 N NH1   . ARG C 2 216 ? -13.396 -9.488  16.804  1.00 28.47 ? 217 ARG A NH1   1 
ATOM   2512 N NH2   . ARG C 2 216 ? -11.509 -9.155  15.518  1.00 30.32 ? 217 ARG A NH2   1 
ATOM   2513 H H     . ARG C 2 216 ? -17.726 -6.472  13.159  1.00 0.00  ? 217 ARG A H     1 
ATOM   2514 H HE    . ARG C 2 216 ? -13.136 -8.931  13.686  1.00 0.00  ? 217 ARG A HE    1 
ATOM   2515 H HH11  . ARG C 2 216 ? -14.386 -9.599  16.881  1.00 0.00  ? 217 ARG A HH11  1 
ATOM   2516 H HH12  . ARG C 2 216 ? -12.825 -9.560  17.622  1.00 0.00  ? 217 ARG A HH12  1 
ATOM   2517 H HH21  . ARG C 2 216 ? -11.087 -9.013  14.621  1.00 0.00  ? 217 ARG A HH21  1 
ATOM   2518 H HH22  . ARG C 2 216 ? -10.940 -9.226  16.337  1.00 0.00  ? 217 ARG A HH22  1 
ATOM   2519 N N     . ASN C 2 217 ? -19.898 -8.143  11.425  1.00 16.09 ? 218 ASN A N     1 
ATOM   2520 C CA    . ASN C 2 217 ? -21.179 -8.698  10.984  1.00 17.01 ? 218 ASN A CA    1 
ATOM   2521 C C     . ASN C 2 217 ? -21.962 -7.788  10.060  1.00 18.02 ? 218 ASN A C     1 
ATOM   2522 O O     . ASN C 2 217 ? -23.063 -8.127  9.680   1.00 18.82 ? 218 ASN A O     1 
ATOM   2523 C CB    . ASN C 2 217 ? -22.045 -9.052  12.196  1.00 15.99 ? 218 ASN A CB    1 
ATOM   2524 C CG    . ASN C 2 217 ? -21.384 -10.057 13.081  1.00 16.52 ? 218 ASN A CG    1 
ATOM   2525 O OD1   . ASN C 2 217 ? -21.280 -11.226 12.732  1.00 18.79 ? 218 ASN A OD1   1 
ATOM   2526 N ND2   . ASN C 2 217 ? -20.820 -9.592  14.182  1.00 20.52 ? 218 ASN A ND2   1 
ATOM   2527 H H     . ASN C 2 217 ? -19.909 -7.302  11.924  1.00 0.00  ? 218 ASN A H     1 
ATOM   2528 H HD21  . ASN C 2 217 ? -20.326 -10.211 14.756  1.00 0.00  ? 218 ASN A HD21  1 
ATOM   2529 H HD22  . ASN C 2 217 ? -20.928 -8.650  14.357  1.00 0.00  ? 218 ASN A HD22  1 
ATOM   2530 N N     . TYR C 2 218 ? -21.407 -6.625  9.741   1.00 17.60 ? 219 TYR A N     1 
ATOM   2531 C CA    . TYR C 2 218 ? -22.047 -5.652  8.849   1.00 17.42 ? 219 TYR A CA    1 
ATOM   2532 C C     . TYR C 2 218 ? -22.102 -6.220  7.436   1.00 18.52 ? 219 TYR A C     1 
ATOM   2533 O O     . TYR C 2 218 ? -21.061 -6.585  6.894   1.00 20.43 ? 219 TYR A O     1 
ATOM   2534 C CB    . TYR C 2 218 ? -21.190 -4.400  8.801   1.00 12.87 ? 219 TYR A CB    1 
ATOM   2535 C CG    . TYR C 2 218 ? -21.809 -3.233  8.082   1.00 12.39 ? 219 TYR A CG    1 
ATOM   2536 C CD1   . TYR C 2 218 ? -22.702 -2.408  8.741   1.00 6.56  ? 219 TYR A CD1   1 
ATOM   2537 C CD2   . TYR C 2 218 ? -21.425 -2.901  6.781   1.00 7.26  ? 219 TYR A CD2   1 
ATOM   2538 C CE1   . TYR C 2 218 ? -23.196 -1.284  8.153   1.00 12.21 ? 219 TYR A CE1   1 
ATOM   2539 C CE2   . TYR C 2 218 ? -21.914 -1.762  6.172   1.00 10.13 ? 219 TYR A CE2   1 
ATOM   2540 C CZ    . TYR C 2 218 ? -22.800 -0.957  6.861   1.00 9.96  ? 219 TYR A CZ    1 
ATOM   2541 O OH    . TYR C 2 218 ? -23.310 0.195   6.299   1.00 13.15 ? 219 TYR A OH    1 
ATOM   2542 H H     . TYR C 2 218 ? -20.518 -6.408  10.082  1.00 0.00  ? 219 TYR A H     1 
ATOM   2543 H HH    . TYR C 2 218 ? -24.091 0.472   6.809   1.00 0.00  ? 219 TYR A HH    1 
ATOM   2544 N N     . GLU C 2 219 ? -23.289 -6.348  6.855   1.00 18.51 ? 220 GLU A N     1 
ATOM   2545 C CA    . GLU C 2 219 ? -23.369 -6.874  5.491   1.00 22.57 ? 220 GLU A CA    1 
ATOM   2546 C C     . GLU C 2 219 ? -22.929 -5.841  4.427   1.00 22.97 ? 220 GLU A C     1 
ATOM   2547 O O     . GLU C 2 219 ? -23.067 -4.627  4.638   1.00 22.39 ? 220 GLU A O     1 
ATOM   2548 C CB    . GLU C 2 219 ? -24.761 -7.424  5.222   1.00 22.29 ? 220 GLU A CB    1 
ATOM   2549 C CG    . GLU C 2 219 ? -25.088 -8.622  6.110   1.00 24.08 ? 220 GLU A CG    1 
ATOM   2550 C CD    . GLU C 2 219 ? -24.287 -9.879  5.764   1.00 27.28 ? 220 GLU A CD    1 
ATOM   2551 O OE1   . GLU C 2 219 ? -23.809 -10.027 4.625   1.00 29.67 ? 220 GLU A OE1   1 
ATOM   2552 O OE2   . GLU C 2 219 ? -24.172 -10.757 6.628   1.00 29.46 ? 220 GLU A OE2   1 
ATOM   2553 H H     . GLU C 2 219 ? -24.094 -6.107  7.355   1.00 0.00  ? 220 GLU A H     1 
ATOM   2554 N N     . ARG C 2 220 ? -22.367 -6.320  3.312   1.00 25.19 ? 221 ARG A N     1 
ATOM   2555 C CA    . ARG C 2 220 ? -21.851 -5.443  2.242   1.00 25.34 ? 221 ARG A CA    1 
ATOM   2556 C C     . ARG C 2 220 ? -22.848 -4.570  1.507   1.00 24.83 ? 221 ARG A C     1 
ATOM   2557 O O     . ARG C 2 220 ? -22.460 -3.554  0.947   1.00 25.31 ? 221 ARG A O     1 
ATOM   2558 C CB    . ARG C 2 220 ? -21.025 -6.229  1.222   1.00 27.03 ? 221 ARG A CB    1 
ATOM   2559 C CG    . ARG C 2 220 ? -19.587 -6.541  1.652   1.00 29.70 ? 221 ARG A CG    1 
ATOM   2560 C CD    . ARG C 2 220 ? -19.110 -7.812  0.967   1.00 35.59 ? 221 ARG A CD    1 
ATOM   2561 N NE    . ARG C 2 220 ? -17.833 -8.377  1.443   1.00 43.04 ? 221 ARG A NE    1 
ATOM   2562 C CZ    . ARG C 2 220 ? -16.677 -8.334  0.757   1.00 45.73 ? 221 ARG A CZ    1 
ATOM   2563 N NH1   . ARG C 2 220 ? -16.608 -7.713  -0.419  1.00 47.88 ? 221 ARG A NH1   1 
ATOM   2564 N NH2   . ARG C 2 220 ? -15.630 -9.067  1.140   1.00 45.61 ? 221 ARG A NH2   1 
ATOM   2565 H H     . ARG C 2 220 ? -22.299 -7.290  3.218   1.00 0.00  ? 221 ARG A H     1 
ATOM   2566 H HE    . ARG C 2 220 ? -17.822 -8.810  2.322   1.00 0.00  ? 221 ARG A HE    1 
ATOM   2567 H HH11  . ARG C 2 220 ? -17.416 -7.272  -0.809  1.00 0.00  ? 221 ARG A HH11  1 
ATOM   2568 H HH12  . ARG C 2 220 ? -15.742 -7.691  -0.918  1.00 0.00  ? 221 ARG A HH12  1 
ATOM   2569 H HH21  . ARG C 2 220 ? -15.696 -9.652  1.949   1.00 0.00  ? 221 ARG A HH21  1 
ATOM   2570 H HH22  . ARG C 2 220 ? -14.774 -9.025  0.624   1.00 0.00  ? 221 ARG A HH22  1 
ATOM   2571 N N     . THR C 2 221 ? -24.129 -4.930  1.528   1.00 23.97 ? 222 THR A N     1 
ATOM   2572 C CA    . THR C 2 221 ? -25.152 -4.146  0.811   1.00 24.97 ? 222 THR A CA    1 
ATOM   2573 C C     . THR C 2 221 ? -26.473 -3.940  1.580   1.00 25.13 ? 222 THR A C     1 
ATOM   2574 O O     . THR C 2 221 ? -26.863 -4.791  2.408   1.00 23.43 ? 222 THR A O     1 
ATOM   2575 C CB    . THR C 2 221 ? -25.534 -4.837  -0.539  1.00 22.97 ? 222 THR A CB    1 
ATOM   2576 O OG1   . THR C 2 221 ? -26.359 -5.983  -0.272  1.00 24.69 ? 222 THR A OG1   1 
ATOM   2577 C CG2   . THR C 2 221 ? -24.293 -5.326  -1.279  1.00 22.29 ? 222 THR A CG2   1 
ATOM   2578 H H     . THR C 2 221 ? -24.421 -5.711  2.035   1.00 0.00  ? 222 THR A H     1 
ATOM   2579 H HG1   . THR C 2 221 ? -26.423 -6.492  -1.092  1.00 0.00  ? 222 THR A HG1   1 
ATOM   2580 N N     . SER C 2 222 ? -27.182 -2.860  1.234   1.00 24.19 ? 223 SER A N     1 
ATOM   2581 C CA    . SER C 2 222 ? -28.479 -2.547  1.823   1.00 26.58 ? 223 SER A CA    1 
ATOM   2582 C C     . SER C 2 222 ? -29.401 -3.743  1.843   1.00 28.33 ? 223 SER A C     1 
ATOM   2583 O O     . SER C 2 222 ? -30.039 -4.020  2.846   1.00 25.04 ? 223 SER A O     1 
ATOM   2584 C CB    . SER C 2 222 ? -29.204 -1.474  1.022   1.00 23.54 ? 223 SER A CB    1 
ATOM   2585 O OG    . SER C 2 222 ? -28.838 -0.185  1.431   1.00 30.86 ? 223 SER A OG    1 
ATOM   2586 H H     . SER C 2 222 ? -26.804 -2.222  0.592   1.00 0.00  ? 223 SER A H     1 
ATOM   2587 H HG    . SER C 2 222 ? -29.288 0.484   0.909   1.00 0.00  ? 223 SER A HG    1 
ATOM   2588 N N     . GLN C 2 223 ? -29.484 -4.425  0.708   1.00 30.85 ? 224 GLN A N     1 
ATOM   2589 C CA    . GLN C 2 223 ? -30.367 -5.571  0.555   1.00 34.24 ? 224 GLN A CA    1 
ATOM   2590 C C     . GLN C 2 223 ? -30.119 -6.632  1.610   1.00 34.19 ? 224 GLN A C     1 
ATOM   2591 O O     . GLN C 2 223 ? -31.076 -7.156  2.176   1.00 33.47 ? 224 GLN A O     1 
ATOM   2592 C CB    . GLN C 2 223 ? -30.228 -6.175  -0.839  1.00 37.78 ? 224 GLN A CB    1 
ATOM   2593 C CG    . GLN C 2 223 ? -31.300 -7.179  -1.178  1.00 43.24 ? 224 GLN A CG    1 
ATOM   2594 C CD    . GLN C 2 223 ? -30.890 -8.083  -2.330  1.00 49.05 ? 224 GLN A CD    1 
ATOM   2595 O OE1   . GLN C 2 223 ? -30.144 -9.053  -2.131  1.00 53.08 ? 224 GLN A OE1   1 
ATOM   2596 N NE2   . GLN C 2 223 ? -31.351 -7.763  -3.544  1.00 50.40 ? 224 GLN A NE2   1 
ATOM   2597 H H     . GLN C 2 223 ? -28.918 -4.158  -0.043  1.00 0.00  ? 224 GLN A H     1 
ATOM   2598 H HE21  . GLN C 2 223 ? -31.071 -8.334  -4.288  1.00 0.00  ? 224 GLN A HE21  1 
ATOM   2599 H HE22  . GLN C 2 223 ? -31.926 -6.982  -3.652  1.00 0.00  ? 224 GLN A HE22  1 
ATOM   2600 N N     . LEU C 2 224 ? -28.851 -6.956  1.869   1.00 32.85 ? 225 LEU A N     1 
ATOM   2601 C CA    . LEU C 2 224 ? -28.525 -7.952  2.885   1.00 32.80 ? 225 LEU A CA    1 
ATOM   2602 C C     . LEU C 2 224 ? -28.638 -7.350  4.308   1.00 35.20 ? 225 LEU A C     1 
ATOM   2603 O O     . LEU C 2 224 ? -28.808 -8.076  5.304   1.00 37.16 ? 225 LEU A O     1 
ATOM   2604 C CB    . LEU C 2 224 ? -27.114 -8.497  2.673   1.00 32.57 ? 225 LEU A CB    1 
ATOM   2605 C CG    . LEU C 2 224 ? -26.722 -9.037  1.301   1.00 31.04 ? 225 LEU A CG    1 
ATOM   2606 C CD1   . LEU C 2 224 ? -25.271 -9.474  1.343   1.00 31.69 ? 225 LEU A CD1   1 
ATOM   2607 C CD2   . LEU C 2 224 ? -27.621 -10.206 0.904   1.00 32.70 ? 225 LEU A CD2   1 
ATOM   2608 H H     . LEU C 2 224 ? -28.120 -6.520  1.381   1.00 0.00  ? 225 LEU A H     1 
ATOM   2609 N N     . ARG C 2 225 ? -28.516 -6.033  4.415   1.00 32.49 ? 226 ARG A N     1 
ATOM   2610 C CA    . ARG C 2 225 ? -28.620 -5.400  5.716   1.00 32.16 ? 226 ARG A CA    1 
ATOM   2611 C C     . ARG C 2 225 ? -30.075 -5.204  6.126   1.00 34.59 ? 226 ARG A C     1 
ATOM   2612 O O     . ARG C 2 225 ? -30.359 -4.707  7.212   1.00 36.14 ? 226 ARG A O     1 
ATOM   2613 C CB    . ARG C 2 225 ? -27.871 -4.072  5.738   1.00 27.81 ? 226 ARG A CB    1 
ATOM   2614 C CG    . ARG C 2 225 ? -26.390 -4.236  5.558   1.00 22.47 ? 226 ARG A CG    1 
ATOM   2615 C CD    . ARG C 2 225 ? -25.650 -2.986  5.904   1.00 21.15 ? 226 ARG A CD    1 
ATOM   2616 N NE    . ARG C 2 225 ? -25.966 -1.838  5.050   1.00 19.74 ? 226 ARG A NE    1 
ATOM   2617 C CZ    . ARG C 2 225 ? -25.325 -1.532  3.921   1.00 20.15 ? 226 ARG A CZ    1 
ATOM   2618 N NH1   . ARG C 2 225 ? -24.338 -2.293  3.460   1.00 20.85 ? 226 ARG A NH1   1 
ATOM   2619 N NH2   . ARG C 2 225 ? -25.575 -0.379  3.325   1.00 20.23 ? 226 ARG A NH2   1 
ATOM   2620 H H     . ARG C 2 225 ? -28.342 -5.476  3.627   1.00 0.00  ? 226 ARG A H     1 
ATOM   2621 H HE    . ARG C 2 225 ? -26.674 -1.231  5.312   1.00 0.00  ? 226 ARG A HE    1 
ATOM   2622 H HH11  . ARG C 2 225 ? -24.061 -3.113  3.956   1.00 0.00  ? 226 ARG A HH11  1 
ATOM   2623 H HH12  . ARG C 2 225 ? -23.872 -2.047  2.611   1.00 0.00  ? 226 ARG A HH12  1 
ATOM   2624 H HH21  . ARG C 2 225 ? -26.240 0.258   3.717   1.00 0.00  ? 226 ARG A HH21  1 
ATOM   2625 H HH22  . ARG C 2 225 ? -25.100 -0.146  2.477   1.00 0.00  ? 226 ARG A HH22  1 
ATOM   2626 N N     . ASN C 2 226 ? -30.996 -5.549  5.241   1.00 37.13 ? 227 ASN A N     1 
ATOM   2627 C CA    . ASN C 2 226 ? -32.416 -5.440  5.540   1.00 38.80 ? 227 ASN A CA    1 
ATOM   2628 C C     . ASN C 2 226 ? -32.768 -6.424  6.643   1.00 38.74 ? 227 ASN A C     1 
ATOM   2629 O O     . ASN C 2 226 ? -33.412 -6.069  7.630   1.00 39.73 ? 227 ASN A O     1 
ATOM   2630 C CB    . ASN C 2 226 ? -33.267 -5.814  4.318   1.00 42.73 ? 227 ASN A CB    1 
ATOM   2631 C CG    . ASN C 2 226 ? -33.354 -4.709  3.299   1.00 43.96 ? 227 ASN A CG    1 
ATOM   2632 O OD1   . ASN C 2 226 ? -33.432 -3.526  3.648   1.00 43.78 ? 227 ASN A OD1   1 
ATOM   2633 N ND2   . ASN C 2 226 ? -33.348 -5.087  2.018   1.00 46.65 ? 227 ASN A ND2   1 
ATOM   2634 H H     . ASN C 2 226 ? -30.715 -5.838  4.348   1.00 0.00  ? 227 ASN A H     1 
ATOM   2635 H HD21  . ASN C 2 226 ? -33.437 -4.372  1.357   1.00 0.00  ? 227 ASN A HD21  1 
ATOM   2636 H HD22  . ASN C 2 226 ? -33.265 -6.043  1.816   1.00 0.00  ? 227 ASN A HD22  1 
ATOM   2637 N N     . ASP C 2 227 ? -32.344 -7.669  6.462   1.00 38.91 ? 228 ASP A N     1 
ATOM   2638 C CA    . ASP C 2 227 ? -32.647 -8.713  7.422   1.00 41.09 ? 228 ASP A CA    1 
ATOM   2639 C C     . ASP C 2 227 ? -31.709 -8.770  8.617   1.00 38.80 ? 228 ASP A C     1 
ATOM   2640 O O     . ASP C 2 227 ? -31.828 -9.675  9.452   1.00 42.19 ? 228 ASP A O     1 
ATOM   2641 C CB    . ASP C 2 227 ? -32.663 -10.083 6.717   1.00 47.54 ? 228 ASP A CB    1 
ATOM   2642 C CG    . ASP C 2 227 ? -31.256 -10.652 6.483   1.00 53.66 ? 228 ASP A CG    1 
ATOM   2643 O OD1   . ASP C 2 227 ? -30.431 -9.948  5.852   1.00 55.09 ? 228 ASP A OD1   1 
ATOM   2644 O OD2   . ASP C 2 227 ? -30.980 -11.803 6.931   1.00 56.10 ? 228 ASP A OD2   1 
ATOM   2645 H H     . ASP C 2 227 ? -31.809 -7.890  5.673   1.00 0.00  ? 228 ASP A H     1 
ATOM   2646 N N     . LYS C 2 228 ? -30.772 -7.827  8.688   1.00 33.81 ? 229 LYS A N     1 
ATOM   2647 C CA    . LYS C 2 228 ? -29.764 -7.775  9.758   1.00 29.11 ? 229 LYS A CA    1 
ATOM   2648 C C     . LYS C 2 228 ? -29.900 -6.479  10.544  1.00 25.81 ? 229 LYS A C     1 
ATOM   2649 O O     . LYS C 2 228 ? -30.792 -6.335  11.375  1.00 25.37 ? 229 LYS A O     1 
ATOM   2650 C CB    . LYS C 2 228 ? -28.375 -7.827  9.131   1.00 29.10 ? 229 LYS A CB    1 
ATOM   2651 C CG    . LYS C 2 228 ? -27.733 -9.172  9.043   1.00 26.36 ? 229 LYS A CG    1 
ATOM   2652 C CD    . LYS C 2 228 ? -27.288 -9.573  10.398  1.00 24.86 ? 229 LYS A CD    1 
ATOM   2653 C CE    . LYS C 2 228 ? -26.295 -10.701 10.307  1.00 28.40 ? 229 LYS A CE    1 
ATOM   2654 N NZ    . LYS C 2 228 ? -24.991 -10.269 9.745   1.00 25.21 ? 229 LYS A NZ    1 
ATOM   2655 H H     . LYS C 2 228 ? -30.772 -7.110  8.031   1.00 0.00  ? 229 LYS A H     1 
ATOM   2656 H HZ1   . LYS C 2 228 ? -24.590 -9.528  10.355  1.00 0.00  ? 229 LYS A HZ1   1 
ATOM   2657 H HZ2   . LYS C 2 228 ? -24.348 -11.080 9.713   1.00 0.00  ? 229 LYS A HZ2   1 
ATOM   2658 H HZ3   . LYS C 2 228 ? -25.123 -9.888  8.786   1.00 0.00  ? 229 LYS A HZ3   1 
ATOM   2659 N N     . TYR C 2 229 ? -28.978 -5.556  10.288  1.00 21.03 ? 230 TYR A N     1 
ATOM   2660 C CA    . TYR C 2 229 ? -28.969 -4.242  10.898  1.00 19.72 ? 230 TYR A CA    1 
ATOM   2661 C C     . TYR C 2 229 ? -28.282 -3.280  9.936   1.00 20.06 ? 230 TYR A C     1 
ATOM   2662 O O     . TYR C 2 229 ? -27.366 -3.646  9.176   1.00 19.68 ? 230 TYR A O     1 
ATOM   2663 C CB    . TYR C 2 229 ? -28.267 -4.235  12.273  1.00 15.01 ? 230 TYR A CB    1 
ATOM   2664 C CG    . TYR C 2 229 ? -26.873 -4.803  12.300  1.00 12.17 ? 230 TYR A CG    1 
ATOM   2665 C CD1   . TYR C 2 229 ? -26.664 -6.147  12.567  1.00 10.07 ? 230 TYR A CD1   1 
ATOM   2666 C CD2   . TYR C 2 229 ? -25.755 -3.984  12.107  1.00 9.81  ? 230 TYR A CD2   1 
ATOM   2667 C CE1   . TYR C 2 229 ? -25.384 -6.673  12.644  1.00 9.76  ? 230 TYR A CE1   1 
ATOM   2668 C CE2   . TYR C 2 229 ? -24.444 -4.513  12.191  1.00 7.74  ? 230 TYR A CE2   1 
ATOM   2669 C CZ    . TYR C 2 229 ? -24.283 -5.841  12.459  1.00 10.07 ? 230 TYR A CZ    1 
ATOM   2670 O OH    . TYR C 2 229 ? -23.024 -6.372  12.587  1.00 13.88 ? 230 TYR A OH    1 
ATOM   2671 H H     . TYR C 2 229 ? -28.256 -5.659  9.646   1.00 0.00  ? 230 TYR A H     1 
ATOM   2672 H HH    . TYR C 2 229 ? -22.410 -5.726  12.228  1.00 0.00  ? 230 TYR A HH    1 
ATOM   2673 N N     . ASN C 2 230 ? -28.759 -2.056  9.968   1.00 21.09 ? 231 ASN A N     1 
ATOM   2674 C CA    . ASN C 2 230 ? -28.236 -1.024  9.120   1.00 24.59 ? 231 ASN A CA    1 
ATOM   2675 C C     . ASN C 2 230 ? -27.723 0.125   9.946   1.00 23.29 ? 231 ASN A C     1 
ATOM   2676 O O     . ASN C 2 230 ? -27.282 1.129   9.391   1.00 25.28 ? 231 ASN A O     1 
ATOM   2677 C CB    . ASN C 2 230 ? -29.317 -0.521  8.169   1.00 28.62 ? 231 ASN A CB    1 
ATOM   2678 C CG    . ASN C 2 230 ? -29.234 -1.177  6.810   1.00 33.89 ? 231 ASN A CG    1 
ATOM   2679 O OD1   . ASN C 2 230 ? -28.359 -0.856  5.991   1.00 37.61 ? 231 ASN A OD1   1 
ATOM   2680 N ND2   . ASN C 2 230 ? -30.133 -2.110  6.560   1.00 36.49 ? 231 ASN A ND2   1 
ATOM   2681 H H     . ASN C 2 230 ? -29.470 -1.826  10.593  1.00 0.00  ? 231 ASN A H     1 
ATOM   2682 H HD21  . ASN C 2 230 ? -30.104 -2.490  5.657   1.00 0.00  ? 231 ASN A HD21  1 
ATOM   2683 H HD22  . ASN C 2 230 ? -30.790 -2.385  7.233   1.00 0.00  ? 231 ASN A HD22  1 
ATOM   2684 N N     . ASN C 2 231 ? -27.835 0.013   11.266  1.00 21.32 ? 232 ASN A N     1 
ATOM   2685 C CA    . ASN C 2 231 ? -27.341 1.059   12.135  1.00 18.72 ? 232 ASN A CA    1 
ATOM   2686 C C     . ASN C 2 231 ? -27.188 0.517   13.552  1.00 16.77 ? 232 ASN A C     1 
ATOM   2687 O O     . ASN C 2 231 ? -27.544 -0.624  13.804  1.00 16.15 ? 232 ASN A O     1 
ATOM   2688 C CB    . ASN C 2 231 ? -28.228 2.301   12.066  1.00 19.63 ? 232 ASN A CB    1 
ATOM   2689 C CG    . ASN C 2 231 ? -29.598 2.044   12.553  1.00 20.55 ? 232 ASN A CG    1 
ATOM   2690 O OD1   . ASN C 2 231 ? -29.849 1.037   13.161  1.00 25.31 ? 232 ASN A OD1   1 
ATOM   2691 N ND2   . ASN C 2 231 ? -30.486 2.976   12.342  1.00 25.52 ? 232 ASN A ND2   1 
ATOM   2692 H H     . ASN C 2 231 ? -28.204 -0.779  11.703  1.00 0.00  ? 232 ASN A H     1 
ATOM   2693 H HD21  . ASN C 2 231 ? -31.405 2.807   12.637  1.00 0.00  ? 232 ASN A HD21  1 
ATOM   2694 H HD22  . ASN C 2 231 ? -30.210 3.796   11.888  1.00 0.00  ? 232 ASN A HD22  1 
ATOM   2695 N N     . ILE C 2 232 ? -26.610 1.327   14.440  1.00 17.31 ? 233 ILE A N     1 
ATOM   2696 C CA    . ILE C 2 232 ? -26.359 0.957   15.828  1.00 17.35 ? 233 ILE A CA    1 
ATOM   2697 C C     . ILE C 2 232 ? -27.625 0.507   16.625  1.00 15.33 ? 233 ILE A C     1 
ATOM   2698 O O     . ILE C 2 232 ? -27.612 -0.567  17.206  1.00 15.52 ? 233 ILE A O     1 
ATOM   2699 C CB    . ILE C 2 232 ? -25.521 2.080   16.530  1.00 16.03 ? 233 ILE A CB    1 
ATOM   2700 C CG1   . ILE C 2 232 ? -24.925 1.588   17.852  1.00 15.49 ? 233 ILE A CG1   1 
ATOM   2701 C CG2   . ILE C 2 232 ? -26.332 3.363   16.657  1.00 16.16 ? 233 ILE A CG2   1 
ATOM   2702 C CD1   . ILE C 2 232 ? -24.186 0.260   17.741  1.00 10.80 ? 233 ILE A CD1   1 
ATOM   2703 H H     . ILE C 2 232 ? -26.332 2.205   14.140  1.00 0.00  ? 233 ILE A H     1 
ATOM   2704 N N     . SER C 2 233 ? -28.708 1.286   16.625  1.00 13.84 ? 234 SER A N     1 
ATOM   2705 C CA    . SER C 2 233 ? -29.930 0.887   17.305  1.00 15.59 ? 234 SER A CA    1 
ATOM   2706 C C     . SER C 2 233 ? -30.304 -0.528  16.880  1.00 18.35 ? 234 SER A C     1 
ATOM   2707 O O     . SER C 2 233 ? -30.392 -1.430  17.706  1.00 21.44 ? 234 SER A O     1 
ATOM   2708 C CB    . SER C 2 233 ? -31.086 1.795   16.902  1.00 16.61 ? 234 SER A CB    1 
ATOM   2709 O OG    . SER C 2 233 ? -30.740 3.156   17.044  1.00 21.42 ? 234 SER A OG    1 
ATOM   2710 H H     . SER C 2 233 ? -28.708 2.148   16.165  1.00 0.00  ? 234 SER A H     1 
ATOM   2711 H HG    . SER C 2 233 ? -30.716 3.388   17.979  1.00 0.00  ? 234 SER A HG    1 
ATOM   2712 N N     . GLU C 2 234 ? -30.457 -0.730  15.569  1.00 17.70 ? 235 GLU A N     1 
ATOM   2713 C CA    . GLU C 2 234 ? -30.837 -2.022  15.038  1.00 16.67 ? 235 GLU A CA    1 
ATOM   2714 C C     . GLU C 2 234 ? -29.860 -3.093  15.416  1.00 17.09 ? 235 GLU A C     1 
ATOM   2715 O O     . GLU C 2 234 ? -30.257 -4.249  15.531  1.00 21.05 ? 235 GLU A O     1 
ATOM   2716 C CB    . GLU C 2 234 ? -30.987 -1.994  13.511  1.00 16.99 ? 235 GLU A CB    1 
ATOM   2717 C CG    . GLU C 2 234 ? -31.983 -0.976  12.985  1.00 20.65 ? 235 GLU A CG    1 
ATOM   2718 C CD    . GLU C 2 234 ? -32.206 -1.055  11.468  1.00 21.97 ? 235 GLU A CD    1 
ATOM   2719 O OE1   . GLU C 2 234 ? -31.527 -1.829  10.765  1.00 21.87 ? 235 GLU A OE1   1 
ATOM   2720 O OE2   . GLU C 2 234 ? -33.095 -0.334  10.980  1.00 26.53 ? 235 GLU A OE2   1 
ATOM   2721 H H     . GLU C 2 234 ? -30.287 0.000   14.933  1.00 0.00  ? 235 GLU A H     1 
ATOM   2722 N N     . TYR C 2 235 ? -28.577 -2.749  15.549  1.00 14.77 ? 236 TYR A N     1 
ATOM   2723 C CA    . TYR C 2 235 ? -27.587 -3.749  15.925  1.00 13.39 ? 236 TYR A CA    1 
ATOM   2724 C C     . TYR C 2 235 ? -27.885 -4.173  17.359  1.00 13.72 ? 236 TYR A C     1 
ATOM   2725 O O     . TYR C 2 235 ? -27.844 -5.348  17.659  1.00 13.56 ? 236 TYR A O     1 
ATOM   2726 C CB    . TYR C 2 235 ? -26.150 -3.204  15.836  1.00 10.87 ? 236 TYR A CB    1 
ATOM   2727 C CG    . TYR C 2 235 ? -25.081 -4.014  16.609  1.00 11.46 ? 236 TYR A CG    1 
ATOM   2728 C CD1   . TYR C 2 235 ? -24.485 -5.149  16.048  1.00 9.96  ? 236 TYR A CD1   1 
ATOM   2729 C CD2   . TYR C 2 235 ? -24.677 -3.636  17.901  1.00 11.39 ? 236 TYR A CD2   1 
ATOM   2730 C CE1   . TYR C 2 235 ? -23.518 -5.887  16.737  1.00 10.90 ? 236 TYR A CE1   1 
ATOM   2731 C CE2   . TYR C 2 235 ? -23.719 -4.385  18.614  1.00 10.03 ? 236 TYR A CE2   1 
ATOM   2732 C CZ    . TYR C 2 235 ? -23.154 -5.499  18.039  1.00 11.84 ? 236 TYR A CZ    1 
ATOM   2733 O OH    . TYR C 2 235 ? -22.311 -6.309  18.783  1.00 10.13 ? 236 TYR A OH    1 
ATOM   2734 H H     . TYR C 2 235 ? -28.293 -1.825  15.388  1.00 0.00  ? 236 TYR A H     1 
ATOM   2735 H HH    . TYR C 2 235 ? -22.713 -7.175  18.749  1.00 0.00  ? 236 TYR A HH    1 
ATOM   2736 N N     . ARG C 2 236 ? -28.156 -3.215  18.241  1.00 12.25 ? 237 ARG A N     1 
ATOM   2737 C CA    . ARG C 2 236 ? -28.444 -3.549  19.641  1.00 15.30 ? 237 ARG A CA    1 
ATOM   2738 C C     . ARG C 2 236 ? -29.667 -4.449  19.813  1.00 17.19 ? 237 ARG A C     1 
ATOM   2739 O O     . ARG C 2 236 ? -29.615 -5.440  20.536  1.00 17.60 ? 237 ARG A O     1 
ATOM   2740 C CB    . ARG C 2 236 ? -28.504 -2.267  20.480  1.00 14.63 ? 237 ARG A CB    1 
ATOM   2741 C CG    . ARG C 2 236 ? -27.099 -1.688  20.654  1.00 11.85 ? 237 ARG A CG    1 
ATOM   2742 C CD    . ARG C 2 236 ? -27.023 -0.281  21.201  1.00 14.52 ? 237 ARG A CD    1 
ATOM   2743 N NE    . ARG C 2 236 ? -25.619 0.055   21.385  1.00 16.37 ? 237 ARG A NE    1 
ATOM   2744 C CZ    . ARG C 2 236 ? -25.098 1.273   21.432  1.00 12.54 ? 237 ARG A CZ    1 
ATOM   2745 N NH1   . ARG C 2 236 ? -25.856 2.356   21.318  1.00 11.79 ? 237 ARG A NH1   1 
ATOM   2746 N NH2   . ARG C 2 236 ? -23.781 1.383   21.594  1.00 10.91 ? 237 ARG A NH2   1 
ATOM   2747 H H     . ARG C 2 236 ? -28.172 -2.278  17.946  1.00 0.00  ? 237 ARG A H     1 
ATOM   2748 H HE    . ARG C 2 236 ? -25.026 -0.702  21.493  1.00 0.00  ? 237 ARG A HE    1 
ATOM   2749 H HH11  . ARG C 2 236 ? -26.845 2.265   21.202  1.00 0.00  ? 237 ARG A HH11  1 
ATOM   2750 H HH12  . ARG C 2 236 ? -25.444 3.266   21.354  1.00 0.00  ? 237 ARG A HH12  1 
ATOM   2751 H HH21  . ARG C 2 236 ? -23.284 0.546   21.732  1.00 0.00  ? 237 ARG A HH21  1 
ATOM   2752 H HH22  . ARG C 2 236 ? -23.329 2.273   21.638  1.00 0.00  ? 237 ARG A HH22  1 
ATOM   2753 N N     . ASN C 2 237 ? -30.721 -4.173  19.048  1.00 17.52 ? 238 ASN A N     1 
ATOM   2754 C CA    . ASN C 2 237 ? -31.938 -4.990  19.047  1.00 16.60 ? 238 ASN A CA    1 
ATOM   2755 C C     . ASN C 2 237 ? -31.605 -6.365  18.523  1.00 15.74 ? 238 ASN A C     1 
ATOM   2756 O O     . ASN C 2 237 ? -31.950 -7.380  19.130  1.00 18.98 ? 238 ASN A O     1 
ATOM   2757 C CB    . ASN C 2 237 ? -33.011 -4.375  18.165  1.00 17.40 ? 238 ASN A CB    1 
ATOM   2758 C CG    . ASN C 2 237 ? -33.450 -3.029  18.659  1.00 22.18 ? 238 ASN A CG    1 
ATOM   2759 O OD1   . ASN C 2 237 ? -33.337 -2.711  19.855  1.00 22.65 ? 238 ASN A OD1   1 
ATOM   2760 N ND2   . ASN C 2 237 ? -33.938 -2.206  17.745  1.00 23.66 ? 238 ASN A ND2   1 
ATOM   2761 H H     . ASN C 2 237 ? -30.657 -3.368  18.488  1.00 0.00  ? 238 ASN A H     1 
ATOM   2762 H HD21  . ASN C 2 237 ? -34.225 -1.330  18.072  1.00 0.00  ? 238 ASN A HD21  1 
ATOM   2763 H HD22  . ASN C 2 237 ? -33.993 -2.508  16.814  1.00 0.00  ? 238 ASN A HD22  1 
ATOM   2764 N N     . TRP C 2 238 ? -30.891 -6.398  17.407  1.00 15.20 ? 239 TRP A N     1 
ATOM   2765 C CA    . TRP C 2 238 ? -30.471 -7.651  16.793  1.00 14.76 ? 239 TRP A CA    1 
ATOM   2766 C C     . TRP C 2 238 ? -29.851 -8.527  17.890  1.00 16.84 ? 239 TRP A C     1 
ATOM   2767 O O     . TRP C 2 238 ? -30.104 -9.748  17.976  1.00 18.06 ? 239 TRP A O     1 
ATOM   2768 C CB    . TRP C 2 238 ? -29.430 -7.335  15.688  1.00 12.54 ? 239 TRP A CB    1 
ATOM   2769 C CG    . TRP C 2 238 ? -28.894 -8.552  14.950  1.00 10.84 ? 239 TRP A CG    1 
ATOM   2770 C CD1   . TRP C 2 238 ? -29.612 -9.432  14.197  1.00 13.74 ? 239 TRP A CD1   1 
ATOM   2771 C CD2   . TRP C 2 238 ? -27.531 -9.005  14.889  1.00 9.13  ? 239 TRP A CD2   1 
ATOM   2772 N NE1   . TRP C 2 238 ? -28.790 -10.399 13.681  1.00 11.02 ? 239 TRP A NE1   1 
ATOM   2773 C CE2   . TRP C 2 238 ? -27.508 -10.149 14.079  1.00 6.54  ? 239 TRP A CE2   1 
ATOM   2774 C CE3   . TRP C 2 238 ? -26.343 -8.551  15.433  1.00 9.76  ? 239 TRP A CE3   1 
ATOM   2775 C CZ2   . TRP C 2 238 ? -26.326 -10.845 13.792  1.00 10.66 ? 239 TRP A CZ2   1 
ATOM   2776 C CZ3   . TRP C 2 238 ? -25.162 -9.257  15.143  1.00 7.79  ? 239 TRP A CZ3   1 
ATOM   2777 C CH2   . TRP C 2 238 ? -25.173 -10.377 14.334  1.00 8.37  ? 239 TRP A CH2   1 
ATOM   2778 H H     . TRP C 2 238 ? -30.638 -5.558  16.967  1.00 0.00  ? 239 TRP A H     1 
ATOM   2779 H HE1   . TRP C 2 238 ? -29.113 -11.146 13.127  1.00 0.00  ? 239 TRP A HE1   1 
ATOM   2780 N N     . ILE C 2 239 ? -28.983 -7.876  18.679  1.00 20.07 ? 240 ILE A N     1 
ATOM   2781 C CA    . ILE C 2 239 ? -28.229 -8.456  19.802  1.00 16.77 ? 240 ILE A CA    1 
ATOM   2782 C C     . ILE C 2 239 ? -29.215 -8.893  20.893  1.00 15.04 ? 240 ILE A C     1 
ATOM   2783 O O     . ILE C 2 239 ? -29.234 -10.046 21.294  1.00 13.49 ? 240 ILE A O     1 
ATOM   2784 C CB    . ILE C 2 239 ? -27.169 -7.406  20.303  1.00 21.06 ? 240 ILE A CB    1 
ATOM   2785 C CG1   . ILE C 2 239 ? -25.968 -7.408  19.347  1.00 20.34 ? 240 ILE A CG1   1 
ATOM   2786 C CG2   . ILE C 2 239 ? -26.735 -7.591  21.757  1.00 18.23 ? 240 ILE A CG2   1 
ATOM   2787 C CD1   . ILE C 2 239 ? -25.407 -8.796  19.064  1.00 22.91 ? 240 ILE A CD1   1 
ATOM   2788 H H     . ILE C 2 239 ? -28.827 -6.932  18.474  1.00 0.00  ? 240 ILE A H     1 
ATOM   2789 N N     . TYR C 2 240 ? -30.127 -8.011  21.248  1.00 14.76 ? 241 TYR A N     1 
ATOM   2790 C CA    . TYR C 2 240 ? -31.122 -8.314  22.261  1.00 17.39 ? 241 TYR A CA    1 
ATOM   2791 C C     . TYR C 2 240 ? -31.855 -9.651  22.050  1.00 18.11 ? 241 TYR A C     1 
ATOM   2792 O O     . TYR C 2 240 ? -32.010 -10.460 22.977  1.00 18.41 ? 241 TYR A O     1 
ATOM   2793 C CB    . TYR C 2 240 ? -32.128 -7.172  22.308  1.00 16.81 ? 241 TYR A CB    1 
ATOM   2794 C CG    . TYR C 2 240 ? -33.095 -7.328  23.432  1.00 21.74 ? 241 TYR A CG    1 
ATOM   2795 C CD1   . TYR C 2 240 ? -32.705 -7.026  24.747  1.00 22.40 ? 241 TYR A CD1   1 
ATOM   2796 C CD2   . TYR C 2 240 ? -34.355 -7.902  23.223  1.00 20.75 ? 241 TYR A CD2   1 
ATOM   2797 C CE1   . TYR C 2 240 ? -33.539 -7.306  25.822  1.00 20.88 ? 241 TYR A CE1   1 
ATOM   2798 C CE2   . TYR C 2 240 ? -35.193 -8.188  24.298  1.00 23.47 ? 241 TYR A CE2   1 
ATOM   2799 C CZ    . TYR C 2 240 ? -34.764 -7.888  25.591  1.00 21.21 ? 241 TYR A CZ    1 
ATOM   2800 O OH    . TYR C 2 240 ? -35.523 -8.216  26.668  1.00 26.14 ? 241 TYR A OH    1 
ATOM   2801 H H     . TYR C 2 240 ? -30.165 -7.160  20.784  1.00 0.00  ? 241 TYR A H     1 
ATOM   2802 H HH    . TYR C 2 240 ? -36.300 -8.704  26.374  1.00 0.00  ? 241 TYR A HH    1 
ATOM   2803 N N     . ARG C 2 241 ? -32.289 -9.873  20.812  1.00 20.68 ? 242 ARG A N     1 
ATOM   2804 C CA    . ARG C 2 241 ? -33.024 -11.054 20.394  1.00 18.31 ? 242 ARG A CA    1 
ATOM   2805 C C     . ARG C 2 241 ? -32.210 -12.302 20.173  1.00 16.75 ? 242 ARG A C     1 
ATOM   2806 O O     . ARG C 2 241 ? -32.756 -13.330 19.852  1.00 20.25 ? 242 ARG A O     1 
ATOM   2807 C CB    . ARG C 2 241 ? -33.758 -10.768 19.091  1.00 22.67 ? 242 ARG A CB    1 
ATOM   2808 C CG    . ARG C 2 241 ? -34.631 -9.535  19.110  1.00 27.92 ? 242 ARG A CG    1 
ATOM   2809 C CD    . ARG C 2 241 ? -35.347 -9.361  17.776  1.00 32.30 ? 242 ARG A CD    1 
ATOM   2810 N NE    . ARG C 2 241 ? -34.488 -9.672  16.628  1.00 33.58 ? 242 ARG A NE    1 
ATOM   2811 C CZ    . ARG C 2 241 ? -33.983 -8.769  15.787  1.00 35.00 ? 242 ARG A CZ    1 
ATOM   2812 N NH1   . ARG C 2 241 ? -34.238 -7.477  15.958  1.00 37.19 ? 242 ARG A NH1   1 
ATOM   2813 N NH2   . ARG C 2 241 ? -33.280 -9.158  14.729  1.00 33.30 ? 242 ARG A NH2   1 
ATOM   2814 H H     . ARG C 2 241 ? -32.096 -9.192  20.131  1.00 0.00  ? 242 ARG A H     1 
ATOM   2815 H HE    . ARG C 2 241 ? -34.333 -10.619 16.487  1.00 0.00  ? 242 ARG A HE    1 
ATOM   2816 H HH11  . ARG C 2 241 ? -34.810 -7.168  16.719  1.00 0.00  ? 242 ARG A HH11  1 
ATOM   2817 H HH12  . ARG C 2 241 ? -33.854 -6.806  15.324  1.00 0.00  ? 242 ARG A HH12  1 
ATOM   2818 H HH21  . ARG C 2 241 ? -33.117 -10.105 14.488  1.00 0.00  ? 242 ARG A HH21  1 
ATOM   2819 H HH22  . ARG C 2 241 ? -32.918 -8.447  14.125  1.00 0.00  ? 242 ARG A HH22  1 
ATOM   2820 N N     . GLY C 2 242 ? -30.905 -12.244 20.295  1.00 19.01 ? 243 GLY A N     1 
ATOM   2821 C CA    . GLY C 2 242 ? -30.145 -13.453 20.068  1.00 21.15 ? 243 GLY A CA    1 
ATOM   2822 C C     . GLY C 2 242 ? -29.559 -13.527 18.678  1.00 25.12 ? 243 GLY A C     1 
ATOM   2823 O O     . GLY C 2 242 ? -29.270 -14.611 18.208  1.00 25.00 ? 243 GLY A O     1 
ATOM   2824 H H     . GLY C 2 242 ? -30.460 -11.407 20.531  1.00 0.00  ? 243 GLY A H     1 
ATOM   2825 N N     . ARG C 2 243 ? -29.337 -12.377 18.037  1.00 29.95 ? 244 ARG A N     1 
ATOM   2826 C CA    . ARG C 2 243 ? -28.739 -12.314 16.693  1.00 31.19 ? 244 ARG A CA    1 
ATOM   2827 C C     . ARG C 2 243 ? -29.543 -13.115 15.689  1.00 34.02 ? 244 ARG A C     1 
ATOM   2828 O O     . ARG C 2 243 ? -29.005 -13.911 14.924  1.00 33.56 ? 244 ARG A O     1 
ATOM   2829 C CB    . ARG C 2 243 ? -27.287 -12.798 16.735  1.00 30.25 ? 244 ARG A CB    1 
ATOM   2830 C CG    . ARG C 2 243 ? -26.465 -12.017 17.750  1.00 31.57 ? 244 ARG A CG    1 
ATOM   2831 C CD    . ARG C 2 243 ? -25.202 -12.761 18.128  1.00 34.42 ? 244 ARG A CD    1 
ATOM   2832 N NE    . ARG C 2 243 ? -24.089 -12.408 17.256  1.00 35.73 ? 244 ARG A NE    1 
ATOM   2833 C CZ    . ARG C 2 243 ? -23.218 -11.433 17.505  1.00 33.49 ? 244 ARG A CZ    1 
ATOM   2834 N NH1   . ARG C 2 243 ? -23.318 -10.704 18.620  1.00 30.92 ? 244 ARG A NH1   1 
ATOM   2835 N NH2   . ARG C 2 243 ? -22.264 -11.177 16.614  1.00 30.14 ? 244 ARG A NH2   1 
ATOM   2836 H H     . ARG C 2 243 ? -29.606 -11.540 18.462  1.00 0.00  ? 244 ARG A H     1 
ATOM   2837 H HE    . ARG C 2 243 ? -23.979 -12.921 16.429  1.00 0.00  ? 244 ARG A HE    1 
ATOM   2838 H HH11  . ARG C 2 243 ? -24.046 -10.885 19.280  1.00 0.00  ? 244 ARG A HH11  1 
ATOM   2839 H HH12  . ARG C 2 243 ? -22.655 -9.977  18.799  1.00 0.00  ? 244 ARG A HH12  1 
ATOM   2840 H HH21  . ARG C 2 243 ? -22.209 -11.711 15.770  1.00 0.00  ? 244 ARG A HH21  1 
ATOM   2841 H HH22  . ARG C 2 243 ? -21.609 -10.448 16.787  1.00 0.00  ? 244 ARG A HH22  1 
ATOM   2842 N N     . LYS C 2 244 ? -30.845 -12.871 15.712  1.00 37.64 ? 245 LYS A N     1 
ATOM   2843 C CA    . LYS C 2 244 ? -31.824 -13.518 14.847  1.00 40.87 ? 245 LYS A CA    1 
ATOM   2844 C C     . LYS C 2 244 ? -32.949 -12.483 14.745  1.00 42.66 ? 245 LYS A C     1 
ATOM   2845 O O     . LYS C 2 244 ? -33.832 -12.620 13.878  1.00 46.27 ? 245 LYS A O     1 
ATOM   2846 C CB    . LYS C 2 244 ? -32.349 -14.800 15.514  1.00 42.25 ? 245 LYS A CB    1 
ATOM   2847 C CG    . LYS C 2 244 ? -33.096 -14.521 16.831  1.00 44.68 ? 245 LYS A CG    1 
ATOM   2848 C CD    . LYS C 2 244 ? -33.490 -15.756 17.668  1.00 45.20 ? 245 LYS A CD    1 
ATOM   2849 C CE    . LYS C 2 244 ? -34.566 -15.314 18.692  1.00 44.92 ? 245 LYS A CE    1 
ATOM   2850 N NZ    . LYS C 2 244 ? -35.046 -16.331 19.673  1.00 45.22 ? 245 LYS A NZ    1 
ATOM   2851 O OXT   . LYS C 2 244 ? -32.930 -11.528 15.549  1.00 42.37 ? 245 LYS A OXT   1 
ATOM   2852 H H     . LYS C 2 244 ? -31.211 -12.195 16.322  1.00 0.00  ? 245 LYS A H     1 
ATOM   2853 H HZ1   . LYS C 2 244 ? -35.463 -17.134 19.160  1.00 0.00  ? 245 LYS A HZ1   1 
ATOM   2854 H HZ2   . LYS C 2 244 ? -34.245 -16.666 20.247  1.00 0.00  ? 245 LYS A HZ2   1 
ATOM   2855 H HZ3   . LYS C 2 244 ? -35.762 -15.902 20.293  1.00 0.00  ? 245 LYS A HZ3   1 
ATOM   2856 N N     . SER D 2 1   ? 4.684   20.803  -32.613 1.00 18.64 ? 2   SER B N     1 
ATOM   2857 C CA    . SER D 2 1   ? 3.245   20.797  -32.176 1.00 18.05 ? 2   SER B CA    1 
ATOM   2858 C C     . SER D 2 1   ? 3.159   20.847  -30.650 1.00 17.16 ? 2   SER B C     1 
ATOM   2859 O O     . SER D 2 1   ? 4.162   20.764  -29.968 1.00 18.26 ? 2   SER B O     1 
ATOM   2860 C CB    . SER D 2 1   ? 2.552   19.517  -32.675 1.00 15.76 ? 2   SER B CB    1 
ATOM   2861 O OG    . SER D 2 1   ? 3.357   18.363  -32.448 1.00 13.37 ? 2   SER B OG    1 
ATOM   2862 H H1    . SER D 2 1   ? 5.131   21.667  -32.246 1.00 0.00  ? 2   SER B H1    1 
ATOM   2863 H H2    . SER D 2 1   ? 5.088   19.958  -32.156 1.00 0.00  ? 2   SER B H2    1 
ATOM   2864 H H3    . SER D 2 1   ? 4.798   20.755  -33.651 1.00 0.00  ? 2   SER B H3    1 
ATOM   2865 H HG    . SER D 2 1   ? 3.628   18.006  -33.306 1.00 0.00  ? 2   SER B HG    1 
ATOM   2866 N N     . LEU D 2 2   ? 1.952   21.003  -30.128 1.00 19.59 ? 3   LEU B N     1 
ATOM   2867 C CA    . LEU D 2 2   ? 1.732   20.984  -28.702 1.00 18.99 ? 3   LEU B CA    1 
ATOM   2868 C C     . LEU D 2 2   ? 2.269   19.640  -28.211 1.00 19.32 ? 3   LEU B C     1 
ATOM   2869 O O     . LEU D 2 2   ? 2.972   19.579  -27.216 1.00 21.03 ? 3   LEU B O     1 
ATOM   2870 C CB    . LEU D 2 2   ? 0.236   21.081  -28.399 1.00 19.46 ? 3   LEU B CB    1 
ATOM   2871 C CG    . LEU D 2 2   ? -0.237  20.824  -26.960 1.00 19.17 ? 3   LEU B CG    1 
ATOM   2872 C CD1   . LEU D 2 2   ? 0.328   21.846  -25.990 1.00 21.68 ? 3   LEU B CD1   1 
ATOM   2873 C CD2   . LEU D 2 2   ? -1.737  20.865  -26.935 1.00 17.00 ? 3   LEU B CD2   1 
ATOM   2874 H H     . LEU D 2 2   ? 1.172   21.095  -30.715 1.00 0.00  ? 3   LEU B H     1 
ATOM   2875 N N     . ARG D 2 3   ? 2.012   18.583  -28.970 1.00 17.50 ? 4   ARG B N     1 
ATOM   2876 C CA    . ARG D 2 3   ? 2.465   17.261  -28.590 1.00 16.20 ? 4   ARG B CA    1 
ATOM   2877 C C     . ARG D 2 3   ? 3.963   17.033  -28.585 1.00 17.53 ? 4   ARG B C     1 
ATOM   2878 O O     . ARG D 2 3   ? 4.507   16.545  -27.603 1.00 19.12 ? 4   ARG B O     1 
ATOM   2879 C CB    . ARG D 2 3   ? 1.772   16.190  -29.431 1.00 13.35 ? 4   ARG B CB    1 
ATOM   2880 C CG    . ARG D 2 3   ? 2.290   14.787  -29.147 1.00 13.27 ? 4   ARG B CG    1 
ATOM   2881 C CD    . ARG D 2 3   ? 1.464   13.732  -29.781 1.00 13.96 ? 4   ARG B CD    1 
ATOM   2882 N NE    . ARG D 2 3   ? 1.988   12.373  -29.563 1.00 12.19 ? 4   ARG B NE    1 
ATOM   2883 C CZ    . ARG D 2 3   ? 1.182   11.320  -29.516 1.00 13.81 ? 4   ARG B CZ    1 
ATOM   2884 N NH1   . ARG D 2 3   ? -0.114  11.518  -29.666 1.00 17.75 ? 4   ARG B NH1   1 
ATOM   2885 N NH2   . ARG D 2 3   ? 1.632   10.093  -29.343 1.00 13.21 ? 4   ARG B NH2   1 
ATOM   2886 H H     . ARG D 2 3   ? 1.474   18.670  -29.783 1.00 0.00  ? 4   ARG B H     1 
ATOM   2887 H HE    . ARG D 2 3   ? 2.953   12.239  -29.459 1.00 0.00  ? 4   ARG B HE    1 
ATOM   2888 H HH11  . ARG D 2 3   ? -0.465  12.443  -29.808 1.00 0.00  ? 4   ARG B HH11  1 
ATOM   2889 H HH12  . ARG D 2 3   ? -0.757  10.787  -29.649 1.00 0.00  ? 4   ARG B HH12  1 
ATOM   2890 H HH21  . ARG D 2 3   ? 2.614   9.932   -29.237 1.00 0.00  ? 4   ARG B HH21  1 
ATOM   2891 H HH22  . ARG D 2 3   ? 0.990   9.326   -29.319 1.00 0.00  ? 4   ARG B HH22  1 
ATOM   2892 N N     . SER D 2 4   ? 4.647   17.335  -29.680 1.00 17.79 ? 5   SER B N     1 
ATOM   2893 C CA    . SER D 2 4   ? 6.102   17.122  -29.742 1.00 15.73 ? 5   SER B CA    1 
ATOM   2894 C C     . SER D 2 4   ? 6.830   17.980  -28.691 1.00 15.17 ? 5   SER B C     1 
ATOM   2895 O O     . SER D 2 4   ? 7.891   17.623  -28.180 1.00 11.13 ? 5   SER B O     1 
ATOM   2896 C CB    . SER D 2 4   ? 6.607   17.479  -31.142 1.00 14.35 ? 5   SER B CB    1 
ATOM   2897 O OG    . SER D 2 4   ? 6.304   18.829  -31.451 1.00 15.40 ? 5   SER B OG    1 
ATOM   2898 H H     . SER D 2 4   ? 4.192   17.688  -30.475 1.00 0.00  ? 5   SER B H     1 
ATOM   2899 H HG    . SER D 2 4   ? 6.946   18.979  -32.161 1.00 0.00  ? 5   SER B HG    1 
ATOM   2900 N N     . ASP D 2 5   ? 6.242   19.140  -28.416 1.00 17.11 ? 6   ASP B N     1 
ATOM   2901 C CA    . ASP D 2 5   ? 6.747   20.090  -27.450 1.00 20.04 ? 6   ASP B CA    1 
ATOM   2902 C C     . ASP D 2 5   ? 6.607   19.625  -25.998 1.00 22.59 ? 6   ASP B C     1 
ATOM   2903 O O     . ASP D 2 5   ? 7.510   19.812  -25.198 1.00 24.55 ? 6   ASP B O     1 
ATOM   2904 C CB    . ASP D 2 5   ? 6.020   21.401  -27.640 1.00 17.91 ? 6   ASP B CB    1 
ATOM   2905 C CG    . ASP D 2 5   ? 6.722   22.310  -28.600 1.00 20.04 ? 6   ASP B CG    1 
ATOM   2906 O OD1   . ASP D 2 5   ? 7.795   21.913  -29.108 1.00 19.99 ? 6   ASP B OD1   1 
ATOM   2907 O OD2   . ASP D 2 5   ? 6.205   23.417  -28.834 1.00 16.35 ? 6   ASP B OD2   1 
ATOM   2908 H H     . ASP D 2 5   ? 5.418   19.361  -28.898 1.00 0.00  ? 6   ASP B H     1 
ATOM   2909 N N     . LEU D 2 6   ? 5.474   19.028  -25.660 1.00 22.79 ? 7   LEU B N     1 
ATOM   2910 C CA    . LEU D 2 6   ? 5.233   18.534  -24.317 1.00 23.60 ? 7   LEU B CA    1 
ATOM   2911 C C     . LEU D 2 6   ? 6.179   17.376  -24.076 1.00 23.90 ? 7   LEU B C     1 
ATOM   2912 O O     . LEU D 2 6   ? 6.776   17.241  -23.005 1.00 24.19 ? 7   LEU B O     1 
ATOM   2913 C CB    . LEU D 2 6   ? 3.792   18.050  -24.196 1.00 26.16 ? 7   LEU B CB    1 
ATOM   2914 C CG    . LEU D 2 6   ? 3.114   18.405  -22.877 1.00 28.99 ? 7   LEU B CG    1 
ATOM   2915 C CD1   . LEU D 2 6   ? 1.670   17.918  -22.850 1.00 27.87 ? 7   LEU B CD1   1 
ATOM   2916 C CD2   . LEU D 2 6   ? 3.899   17.796  -21.747 1.00 29.63 ? 7   LEU B CD2   1 
ATOM   2917 H H     . LEU D 2 6   ? 4.765   18.933  -26.335 1.00 0.00  ? 7   LEU B H     1 
ATOM   2918 N N     . ILE D 2 7   ? 6.337   16.567  -25.106 1.00 23.31 ? 8   ILE B N     1 
ATOM   2919 C CA    . ILE D 2 7   ? 7.203   15.412  -25.056 1.00 23.55 ? 8   ILE B CA    1 
ATOM   2920 C C     . ILE D 2 7   ? 8.644   15.821  -24.905 1.00 24.35 ? 8   ILE B C     1 
ATOM   2921 O O     . ILE D 2 7   ? 9.429   15.089  -24.335 1.00 26.64 ? 8   ILE B O     1 
ATOM   2922 C CB    . ILE D 2 7   ? 7.074   14.536  -26.316 1.00 21.59 ? 8   ILE B CB    1 
ATOM   2923 C CG1   . ILE D 2 7   ? 5.642   14.000  -26.438 1.00 24.18 ? 8   ILE B CG1   1 
ATOM   2924 C CG2   . ILE D 2 7   ? 8.050   13.401  -26.235 1.00 21.74 ? 8   ILE B CG2   1 
ATOM   2925 C CD1   . ILE D 2 7   ? 5.485   12.770  -27.324 1.00 25.75 ? 8   ILE B CD1   1 
ATOM   2926 H H     . ILE D 2 7   ? 5.833   16.743  -25.931 1.00 0.00  ? 8   ILE B H     1 
ATOM   2927 N N     . ASN D 2 8   ? 9.031   16.953  -25.466 1.00 24.13 ? 9   ASN B N     1 
ATOM   2928 C CA    . ASN D 2 8   ? 10.429  17.338  -25.282 1.00 25.22 ? 9   ASN B CA    1 
ATOM   2929 C C     . ASN D 2 8   ? 10.636  17.918  -23.880 1.00 21.06 ? 9   ASN B C     1 
ATOM   2930 O O     . ASN D 2 8   ? 11.628  17.613  -23.240 1.00 21.43 ? 9   ASN B O     1 
ATOM   2931 C CB    . ASN D 2 8   ? 10.921  18.318  -26.373 1.00 29.05 ? 9   ASN B CB    1 
ATOM   2932 C CG    . ASN D 2 8   ? 11.056  17.656  -27.747 1.00 34.46 ? 9   ASN B CG    1 
ATOM   2933 O OD1   . ASN D 2 8   ? 11.478  16.502  -27.854 1.00 38.17 ? 9   ASN B OD1   1 
ATOM   2934 N ND2   . ASN D 2 8   ? 10.695  18.391  -28.807 1.00 34.60 ? 9   ASN B ND2   1 
ATOM   2935 H H     . ASN D 2 8   ? 8.410   17.494  -25.991 1.00 0.00  ? 9   ASN B H     1 
ATOM   2936 H HD21  . ASN D 2 8   ? 10.788  17.969  -29.685 1.00 0.00  ? 9   ASN B HD21  1 
ATOM   2937 H HD22  . ASN D 2 8   ? 10.363  19.298  -28.660 1.00 0.00  ? 9   ASN B HD22  1 
ATOM   2938 N N     . ALA D 2 9   ? 9.682   18.721  -23.407 1.00 19.57 ? 10  ALA B N     1 
ATOM   2939 C CA    . ALA D 2 9   ? 9.755   19.344  -22.089 1.00 17.73 ? 10  ALA B CA    1 
ATOM   2940 C C     . ALA D 2 9   ? 9.733   18.371  -20.914 1.00 19.63 ? 10  ALA B C     1 
ATOM   2941 O O     . ALA D 2 9   ? 10.214  18.702  -19.828 1.00 23.84 ? 10  ALA B O     1 
ATOM   2942 C CB    . ALA D 2 9   ? 8.650   20.334  -21.920 1.00 12.19 ? 10  ALA B CB    1 
ATOM   2943 H H     . ALA D 2 9   ? 8.896   18.901  -23.962 1.00 0.00  ? 10  ALA B H     1 
ATOM   2944 N N     . LEU D 2 10  ? 9.091   17.220  -21.085 1.00 20.95 ? 11  LEU B N     1 
ATOM   2945 C CA    . LEU D 2 10  ? 9.034   16.228  -20.022 1.00 20.68 ? 11  LEU B CA    1 
ATOM   2946 C C     . LEU D 2 10  ? 10.370  15.496  -19.947 1.00 21.71 ? 11  LEU B C     1 
ATOM   2947 O O     . LEU D 2 10  ? 10.849  14.952  -20.949 1.00 24.24 ? 11  LEU B O     1 
ATOM   2948 C CB    . LEU D 2 10  ? 7.892   15.224  -20.251 1.00 19.09 ? 11  LEU B CB    1 
ATOM   2949 C CG    . LEU D 2 10  ? 6.476   15.809  -20.101 1.00 21.09 ? 11  LEU B CG    1 
ATOM   2950 C CD1   . LEU D 2 10  ? 5.439   14.834  -20.661 1.00 18.69 ? 11  LEU B CD1   1 
ATOM   2951 C CD2   . LEU D 2 10  ? 6.164   16.196  -18.669 1.00 18.70 ? 11  LEU B CD2   1 
ATOM   2952 H H     . LEU D 2 10  ? 8.663   17.024  -21.944 1.00 0.00  ? 11  LEU B H     1 
ATOM   2953 N N     . ASP D 2 18  ? 15.346  16.021  -10.438 1.00 28.58 ? 19  ASP B N     1 
ATOM   2954 C CA    . ASP D 2 18  ? 15.360  15.148  -9.253  1.00 31.22 ? 19  ASP B CA    1 
ATOM   2955 C C     . ASP D 2 18  ? 14.733  15.698  -7.979  1.00 28.89 ? 19  ASP B C     1 
ATOM   2956 O O     . ASP D 2 18  ? 15.340  16.491  -7.244  1.00 26.98 ? 19  ASP B O     1 
ATOM   2957 C CB    . ASP D 2 18  ? 16.761  14.659  -8.944  1.00 36.19 ? 19  ASP B CB    1 
ATOM   2958 C CG    . ASP D 2 18  ? 16.921  13.184  -9.226  1.00 44.47 ? 19  ASP B CG    1 
ATOM   2959 O OD1   . ASP D 2 18  ? 16.895  12.780  -10.419 1.00 49.73 ? 19  ASP B OD1   1 
ATOM   2960 O OD2   . ASP D 2 18  ? 17.048  12.412  -8.244  1.00 48.87 ? 19  ASP B OD2   1 
ATOM   2961 H H     . ASP D 2 18  ? 15.427  16.989  -10.319 1.00 0.00  ? 19  ASP B H     1 
ATOM   2962 N N     . VAL D 2 19  ? 13.518  15.240  -7.710  1.00 27.70 ? 20  VAL B N     1 
ATOM   2963 C CA    . VAL D 2 19  ? 12.783  15.660  -6.529  1.00 25.59 ? 20  VAL B CA    1 
ATOM   2964 C C     . VAL D 2 19  ? 13.262  14.868  -5.335  1.00 23.64 ? 20  VAL B C     1 
ATOM   2965 O O     . VAL D 2 19  ? 13.372  13.632  -5.397  1.00 21.20 ? 20  VAL B O     1 
ATOM   2966 C CB    . VAL D 2 19  ? 11.233  15.496  -6.686  1.00 27.99 ? 20  VAL B CB    1 
ATOM   2967 C CG1   . VAL D 2 19  ? 10.656  16.671  -7.440  1.00 28.55 ? 20  VAL B CG1   1 
ATOM   2968 C CG2   . VAL D 2 19  ? 10.921  14.210  -7.427  1.00 28.96 ? 20  VAL B CG2   1 
ATOM   2969 H H     . VAL D 2 19  ? 13.156  14.562  -8.315  1.00 0.00  ? 20  VAL B H     1 
ATOM   2970 N N     . CYS D 2 20  ? 13.496  15.577  -4.232  1.00 23.28 ? 21  CYS B N     1 
ATOM   2971 C CA    . CYS D 2 20  ? 13.974  14.921  -3.036  1.00 22.52 ? 21  CYS B CA    1 
ATOM   2972 C C     . CYS D 2 20  ? 13.206  15.204  -1.724  1.00 20.05 ? 21  CYS B C     1 
ATOM   2973 O O     . CYS D 2 20  ? 13.513  14.586  -0.697  1.00 20.80 ? 21  CYS B O     1 
ATOM   2974 C CB    . CYS D 2 20  ? 15.493  15.165  -2.877  1.00 22.55 ? 21  CYS B CB    1 
ATOM   2975 S SG    . CYS D 2 20  ? 15.977  16.839  -2.493  1.00 24.69 ? 21  CYS B SG    1 
ATOM   2976 H H     . CYS D 2 20  ? 13.363  16.549  -4.223  1.00 0.00  ? 21  CYS B H     1 
ATOM   2977 N N     . GLY D 2 21  ? 12.209  16.083  -1.717  1.00 16.88 ? 22  GLY B N     1 
ATOM   2978 C CA    . GLY D 2 21  ? 11.509  16.271  -0.449  1.00 18.52 ? 22  GLY B CA    1 
ATOM   2979 C C     . GLY D 2 21  ? 10.418  17.311  -0.459  1.00 18.02 ? 22  GLY B C     1 
ATOM   2980 O O     . GLY D 2 21  ? 10.166  17.873  -1.518  1.00 20.77 ? 22  GLY B O     1 
ATOM   2981 H H     . GLY D 2 21  ? 11.928  16.603  -2.496  1.00 0.00  ? 22  GLY B H     1 
ATOM   2982 N N     . ILE D 2 22  ? 9.673   17.474  0.638   1.00 17.03 ? 23  ILE B N     1 
ATOM   2983 C CA    . ILE D 2 22  ? 8.684   18.544  0.660   1.00 18.21 ? 23  ILE B CA    1 
ATOM   2984 C C     . ILE D 2 22  ? 9.293   19.614  1.544   1.00 16.42 ? 23  ILE B C     1 
ATOM   2985 O O     . ILE D 2 22  ? 10.028  19.303  2.465   1.00 14.91 ? 23  ILE B O     1 
ATOM   2986 C CB    . ILE D 2 22  ? 7.228   18.128  1.111   1.00 21.74 ? 23  ILE B CB    1 
ATOM   2987 C CG1   . ILE D 2 22  ? 7.129   17.892  2.604   1.00 22.97 ? 23  ILE B CG1   1 
ATOM   2988 C CG2   . ILE D 2 22  ? 6.708   16.894  0.303   1.00 23.63 ? 23  ILE B CG2   1 
ATOM   2989 C CD1   . ILE D 2 22  ? 5.689   17.710  3.024   1.00 25.59 ? 23  ILE B CD1   1 
ATOM   2990 H H     . ILE D 2 22  ? 9.805   16.914  1.426   1.00 0.00  ? 23  ILE B H     1 
ATOM   2991 N N     . ILE D 2 23  ? 9.034   20.872  1.245   1.00 15.60 ? 24  ILE B N     1 
ATOM   2992 C CA    . ILE D 2 23  ? 9.632   21.930  2.011   1.00 16.43 ? 24  ILE B CA    1 
ATOM   2993 C C     . ILE D 2 23  ? 8.568   22.849  2.565   1.00 17.50 ? 24  ILE B C     1 
ATOM   2994 O O     . ILE D 2 23  ? 7.507   22.983  1.968   1.00 16.92 ? 24  ILE B O     1 
ATOM   2995 C CB    . ILE D 2 23  ? 10.645  22.725  1.120   1.00 19.58 ? 24  ILE B CB    1 
ATOM   2996 C CG1   . ILE D 2 23  ? 11.292  23.873  1.910   1.00 17.33 ? 24  ILE B CG1   1 
ATOM   2997 C CG2   . ILE D 2 23  ? 9.956   23.240  -0.150  1.00 16.40 ? 24  ILE B CG2   1 
ATOM   2998 C CD1   . ILE D 2 23  ? 12.535  24.409  1.250   1.00 20.33 ? 24  ILE B CD1   1 
ATOM   2999 H H     . ILE D 2 23  ? 8.414   21.099  0.523   1.00 0.00  ? 24  ILE B H     1 
ATOM   3000 N N     . SER D 2 24  ? 8.845   23.473  3.706   1.00 16.99 ? 25  SER B N     1 
ATOM   3001 C CA    . SER D 2 24  ? 7.880   24.367  4.305   1.00 22.66 ? 25  SER B CA    1 
ATOM   3002 C C     . SER D 2 24  ? 8.314   25.794  4.120   1.00 24.84 ? 25  SER B C     1 
ATOM   3003 O O     . SER D 2 24  ? 9.483   26.058  3.905   1.00 27.93 ? 25  SER B O     1 
ATOM   3004 C CB    . SER D 2 24  ? 7.726   24.076  5.791   1.00 24.27 ? 25  SER B CB    1 
ATOM   3005 O OG    . SER D 2 24  ? 8.937   24.295  6.478   1.00 24.66 ? 25  SER B OG    1 
ATOM   3006 H H     . SER D 2 24  ? 9.724   23.336  4.114   1.00 0.00  ? 25  SER B H     1 
ATOM   3007 H HG    . SER D 2 24  ? 9.504   23.545  6.237   1.00 0.00  ? 25  SER B HG    1 
ATOM   3008 N N     . ALA D 2 25  ? 7.380   26.714  4.283   1.00 27.50 ? 26  ALA B N     1 
ATOM   3009 C CA    . ALA D 2 25  ? 7.617   28.146  4.122   1.00 31.88 ? 26  ALA B CA    1 
ATOM   3010 C C     . ALA D 2 25  ? 8.634   28.718  5.092   1.00 32.27 ? 26  ALA B C     1 
ATOM   3011 O O     . ALA D 2 25  ? 8.909   29.921  5.080   1.00 35.14 ? 26  ALA B O     1 
ATOM   3012 C CB    . ALA D 2 25  ? 6.283   28.904  4.265   1.00 33.56 ? 26  ALA B CB    1 
ATOM   3013 H H     . ALA D 2 25  ? 6.472   26.453  4.502   1.00 0.00  ? 26  ALA B H     1 
ATOM   3014 N N     . GLU D 2 26  ? 9.155   27.854  5.950   1.00 32.84 ? 27  GLU B N     1 
ATOM   3015 C CA    . GLU D 2 26  ? 10.119  28.215  6.972   1.00 30.44 ? 27  GLU B CA    1 
ATOM   3016 C C     . GLU D 2 26  ? 11.435  27.491  6.716   1.00 29.36 ? 27  GLU B C     1 
ATOM   3017 O O     . GLU D 2 26  ? 12.337  27.536  7.524   1.00 30.38 ? 27  GLU B O     1 
ATOM   3018 C CB    . GLU D 2 26  ? 9.547   27.846  8.343   1.00 32.69 ? 27  GLU B CB    1 
ATOM   3019 C CG    . GLU D 2 26  ? 8.097   28.412  8.616   1.00 33.03 ? 27  GLU B CG    1 
ATOM   3020 C CD    . GLU D 2 26  ? 6.938   27.592  7.993   1.00 33.01 ? 27  GLU B CD    1 
ATOM   3021 O OE1   . GLU D 2 26  ? 7.150   26.475  7.459   1.00 29.34 ? 27  GLU B OE1   1 
ATOM   3022 O OE2   . GLU D 2 26  ? 5.790   28.074  8.064   1.00 33.49 ? 27  GLU B OE2   1 
ATOM   3023 H H     . GLU D 2 26  ? 8.899   26.918  5.940   1.00 0.00  ? 27  GLU B H     1 
ATOM   3024 N N     . GLY D 2 27  ? 11.527  26.794  5.592   1.00 26.32 ? 28  GLY B N     1 
ATOM   3025 C CA    . GLY D 2 27  ? 12.762  26.118  5.231   1.00 22.29 ? 28  GLY B CA    1 
ATOM   3026 C C     . GLY D 2 27  ? 13.032  24.700  5.660   1.00 21.78 ? 28  GLY B C     1 
ATOM   3027 O O     . GLY D 2 27  ? 14.054  24.105  5.288   1.00 18.95 ? 28  GLY B O     1 
ATOM   3028 H H     . GLY D 2 27  ? 10.776  26.769  4.978   1.00 0.00  ? 28  GLY B H     1 
ATOM   3029 N N     . LYS D 2 28  ? 12.125  24.129  6.426   1.00 23.20 ? 29  LYS B N     1 
ATOM   3030 C CA    . LYS D 2 28  ? 12.326  22.757  6.884   1.00 24.53 ? 29  LYS B CA    1 
ATOM   3031 C C     . LYS D 2 28  ? 11.998  21.833  5.721   1.00 23.50 ? 29  LYS B C     1 
ATOM   3032 O O     . LYS D 2 28  ? 11.024  22.069  5.030   1.00 23.93 ? 29  LYS B O     1 
ATOM   3033 C CB    . LYS D 2 28  ? 11.390  22.481  8.073   1.00 26.77 ? 29  LYS B CB    1 
ATOM   3034 C CG    . LYS D 2 28  ? 11.774  21.311  8.937   1.00 30.42 ? 29  LYS B CG    1 
ATOM   3035 C CD    . LYS D 2 28  ? 11.027  21.391  10.290  1.00 34.80 ? 29  LYS B CD    1 
ATOM   3036 C CE    . LYS D 2 28  ? 11.506  20.295  11.242  1.00 34.65 ? 29  LYS B CE    1 
ATOM   3037 N NZ    . LYS D 2 28  ? 10.893  20.380  12.585  1.00 35.15 ? 29  LYS B NZ    1 
ATOM   3038 H H     . LYS D 2 28  ? 11.330  24.635  6.676   1.00 0.00  ? 29  LYS B H     1 
ATOM   3039 H HZ1   . LYS D 2 28  ? 11.114  21.305  13.008  1.00 0.00  ? 29  LYS B HZ1   1 
ATOM   3040 H HZ2   . LYS D 2 28  ? 9.863   20.278  12.505  1.00 0.00  ? 29  LYS B HZ2   1 
ATOM   3041 H HZ3   . LYS D 2 28  ? 11.274  19.624  13.189  1.00 0.00  ? 29  LYS B HZ3   1 
ATOM   3042 N N     . ILE D 2 29  ? 12.785  20.784  5.525   1.00 20.65 ? 30  ILE B N     1 
ATOM   3043 C CA    . ILE D 2 29  ? 12.538  19.840  4.449   1.00 20.53 ? 30  ILE B CA    1 
ATOM   3044 C C     . ILE D 2 29  ? 12.229  18.429  4.983   1.00 21.99 ? 30  ILE B C     1 
ATOM   3045 O O     . ILE D 2 29  ? 13.008  17.873  5.746   1.00 20.30 ? 30  ILE B O     1 
ATOM   3046 C CB    . ILE D 2 29  ? 13.756  19.753  3.497   1.00 19.79 ? 30  ILE B CB    1 
ATOM   3047 C CG1   . ILE D 2 29  ? 14.092  21.146  2.930   1.00 18.39 ? 30  ILE B CG1   1 
ATOM   3048 C CG2   . ILE D 2 29  ? 13.469  18.761  2.351   1.00 16.91 ? 30  ILE B CG2   1 
ATOM   3049 C CD1   . ILE D 2 29  ? 15.387  21.199  2.082   1.00 18.03 ? 30  ILE B CD1   1 
ATOM   3050 H H     . ILE D 2 29  ? 13.567  20.645  6.107   1.00 0.00  ? 30  ILE B H     1 
ATOM   3051 N N     . TYR D 2 30  ? 11.087  17.867  4.588   1.00 21.55 ? 31  TYR B N     1 
ATOM   3052 C CA    . TYR D 2 30  ? 10.688  16.521  4.991   1.00 21.92 ? 31  TYR B CA    1 
ATOM   3053 C C     . TYR D 2 30  ? 10.975  15.529  3.853   1.00 23.45 ? 31  TYR B C     1 
ATOM   3054 O O     . TYR D 2 30  ? 10.645  15.794  2.686   1.00 26.04 ? 31  TYR B O     1 
ATOM   3055 C CB    . TYR D 2 30  ? 9.206   16.536  5.346   1.00 21.81 ? 31  TYR B CB    1 
ATOM   3056 C CG    . TYR D 2 30  ? 8.878   17.519  6.452   1.00 22.29 ? 31  TYR B CG    1 
ATOM   3057 C CD1   . TYR D 2 30  ? 8.889   18.896  6.206   1.00 21.54 ? 31  TYR B CD1   1 
ATOM   3058 C CD2   . TYR D 2 30  ? 8.578   17.072  7.752   1.00 21.09 ? 31  TYR B CD2   1 
ATOM   3059 C CE1   . TYR D 2 30  ? 8.604   19.810  7.214   1.00 23.40 ? 31  TYR B CE1   1 
ATOM   3060 C CE2   . TYR D 2 30  ? 8.303   17.975  8.782   1.00 19.17 ? 31  TYR B CE2   1 
ATOM   3061 C CZ    . TYR D 2 30  ? 8.311   19.338  8.507   1.00 24.63 ? 31  TYR B CZ    1 
ATOM   3062 O OH    . TYR D 2 30  ? 7.999   20.245  9.499   1.00 27.99 ? 31  TYR B OH    1 
ATOM   3063 H H     . TYR D 2 30  ? 10.509  18.363  3.978   1.00 0.00  ? 31  TYR B H     1 
ATOM   3064 H HH    . TYR D 2 30  ? 7.980   21.133  9.142   1.00 0.00  ? 31  TYR B HH    1 
ATOM   3065 N N     . PRO D 2 31  ? 11.631  14.392  4.154   1.00 24.73 ? 32  PRO B N     1 
ATOM   3066 C CA    . PRO D 2 31  ? 11.961  13.378  3.133   1.00 25.02 ? 32  PRO B CA    1 
ATOM   3067 C C     . PRO D 2 31  ? 10.740  12.685  2.488   1.00 26.01 ? 32  PRO B C     1 
ATOM   3068 O O     . PRO D 2 31  ? 9.634   12.690  3.032   1.00 23.84 ? 32  PRO B O     1 
ATOM   3069 C CB    . PRO D 2 31  ? 12.820  12.356  3.910   1.00 24.56 ? 32  PRO B CB    1 
ATOM   3070 C CG    . PRO D 2 31  ? 13.356  13.112  5.007   1.00 25.30 ? 32  PRO B CG    1 
ATOM   3071 C CD    . PRO D 2 31  ? 12.208  14.012  5.451   1.00 24.21 ? 32  PRO B CD    1 
ATOM   3072 N N     . LEU D 2 32  ? 10.975  12.055  1.342   1.00 28.72 ? 33  LEU B N     1 
ATOM   3073 C CA    . LEU D 2 32  ? 9.921   11.357  0.615   1.00 28.82 ? 33  LEU B CA    1 
ATOM   3074 C C     . LEU D 2 32  ? 9.811   9.889   1.030   1.00 29.45 ? 33  LEU B C     1 
ATOM   3075 O O     . LEU D 2 32  ? 10.792  9.278   1.453   1.00 27.63 ? 33  LEU B O     1 
ATOM   3076 C CB    . LEU D 2 32  ? 10.173  11.420  -0.909  1.00 25.32 ? 33  LEU B CB    1 
ATOM   3077 C CG    . LEU D 2 32  ? 10.238  12.770  -1.646  1.00 22.48 ? 33  LEU B CG    1 
ATOM   3078 C CD1   . LEU D 2 32  ? 10.438  12.489  -3.121  1.00 19.63 ? 33  LEU B CD1   1 
ATOM   3079 C CD2   . LEU D 2 32  ? 8.997   13.632  -1.428  1.00 21.03 ? 33  LEU B CD2   1 
ATOM   3080 H H     . LEU D 2 32  ? 11.883  12.026  0.969   1.00 0.00  ? 33  LEU B H     1 
ATOM   3081 N N     . GLY D 2 33  ? 8.598   9.350   0.902   1.00 33.56 ? 34  GLY B N     1 
ATOM   3082 C CA    . GLY D 2 33  ? 8.312   7.957   1.200   1.00 35.42 ? 34  GLY B CA    1 
ATOM   3083 C C     . GLY D 2 33  ? 8.637   7.132   -0.034  1.00 37.81 ? 34  GLY B C     1 
ATOM   3084 O O     . GLY D 2 33  ? 8.744   7.672   -1.128  1.00 38.05 ? 34  GLY B O     1 
ATOM   3085 H H     . GLY D 2 33  ? 7.882   9.916   0.562   1.00 0.00  ? 34  GLY B H     1 
ATOM   3086 N N     . SER D 2 34  ? 8.713   5.818   0.123   1.00 39.11 ? 35  SER B N     1 
ATOM   3087 C CA    . SER D 2 34  ? 9.083   4.919   -0.968  1.00 41.58 ? 35  SER B CA    1 
ATOM   3088 C C     . SER D 2 34  ? 7.939   4.296   -1.807  1.00 40.56 ? 35  SER B C     1 
ATOM   3089 O O     . SER D 2 34  ? 8.199   3.643   -2.807  1.00 42.19 ? 35  SER B O     1 
ATOM   3090 C CB    . SER D 2 34  ? 9.947   3.802   -0.362  1.00 44.65 ? 35  SER B CB    1 
ATOM   3091 O OG    . SER D 2 34  ? 10.631  3.037   -1.334  1.00 52.74 ? 35  SER B OG    1 
ATOM   3092 H H     . SER D 2 34  ? 8.536   5.440   1.005   1.00 0.00  ? 35  SER B H     1 
ATOM   3093 H HG    . SER D 2 34  ? 10.036  2.847   -2.078  1.00 0.00  ? 35  SER B HG    1 
ATOM   3094 N N     . ASP D 2 35  ? 6.691   4.488   -1.398  1.00 38.03 ? 36  ASP B N     1 
ATOM   3095 C CA    . ASP D 2 35  ? 5.541   3.904   -2.083  1.00 35.47 ? 36  ASP B CA    1 
ATOM   3096 C C     . ASP D 2 35  ? 4.972   4.673   -3.268  1.00 32.66 ? 36  ASP B C     1 
ATOM   3097 O O     . ASP D 2 35  ? 5.130   5.892   -3.380  1.00 30.16 ? 36  ASP B O     1 
ATOM   3098 C CB    . ASP D 2 35  ? 4.421   3.710   -1.078  1.00 37.88 ? 36  ASP B CB    1 
ATOM   3099 C CG    . ASP D 2 35  ? 4.045   4.994   -0.394  1.00 41.33 ? 36  ASP B CG    1 
ATOM   3100 O OD1   . ASP D 2 35  ? 4.873   5.505   0.378   1.00 45.91 ? 36  ASP B OD1   1 
ATOM   3101 O OD2   . ASP D 2 35  ? 2.937   5.512   -0.628  1.00 42.57 ? 36  ASP B OD2   1 
ATOM   3102 H H     . ASP D 2 35  ? 6.573   5.088   -0.646  1.00 0.00  ? 36  ASP B H     1 
ATOM   3103 N N     . THR D 2 36  ? 4.199   3.966   -4.095  1.00 31.36 ? 37  THR B N     1 
ATOM   3104 C CA    . THR D 2 36  ? 3.578   4.593   -5.257  1.00 27.37 ? 37  THR B CA    1 
ATOM   3105 C C     . THR D 2 36  ? 2.575   5.659   -4.919  1.00 24.95 ? 37  THR B C     1 
ATOM   3106 O O     . THR D 2 36  ? 2.480   6.625   -5.664  1.00 27.07 ? 37  THR B O     1 
ATOM   3107 C CB    . THR D 2 36  ? 2.945   3.612   -6.210  1.00 26.49 ? 37  THR B CB    1 
ATOM   3108 O OG1   . THR D 2 36  ? 3.942   2.682   -6.633  1.00 28.24 ? 37  THR B OG1   1 
ATOM   3109 C CG2   . THR D 2 36  ? 2.400   4.360   -7.448  1.00 25.18 ? 37  THR B CG2   1 
ATOM   3110 H H     . THR D 2 36  ? 4.141   2.998   -4.001  1.00 0.00  ? 37  THR B H     1 
ATOM   3111 H HG1   . THR D 2 36  ? 3.508   1.936   -7.068  1.00 0.00  ? 37  THR B HG1   1 
ATOM   3112 N N     . LYS D 2 37  ? 1.872   5.537   -3.794  1.00 21.13 ? 38  LYS B N     1 
ATOM   3113 C CA    . LYS D 2 37  ? 0.902   6.573   -3.414  1.00 19.91 ? 38  LYS B CA    1 
ATOM   3114 C C     . LYS D 2 37  ? 1.603   7.917   -3.264  1.00 19.02 ? 38  LYS B C     1 
ATOM   3115 O O     . LYS D 2 37  ? 1.019   8.981   -3.528  1.00 17.04 ? 38  LYS B O     1 
ATOM   3116 C CB    . LYS D 2 37  ? 0.198   6.219   -2.098  1.00 20.92 ? 38  LYS B CB    1 
ATOM   3117 H H     . LYS D 2 37  ? 2.001   4.752   -3.232  1.00 0.00  ? 38  LYS B H     1 
ATOM   3118 N N     . VAL D 2 38  ? 2.879   7.851   -2.879  1.00 18.64 ? 39  VAL B N     1 
ATOM   3119 C CA    . VAL D 2 38  ? 3.682   9.043   -2.685  1.00 19.48 ? 39  VAL B CA    1 
ATOM   3120 C C     . VAL D 2 38  ? 4.259   9.554   -4.006  1.00 18.10 ? 39  VAL B C     1 
ATOM   3121 O O     . VAL D 2 38  ? 4.123   10.735  -4.331  1.00 17.77 ? 39  VAL B O     1 
ATOM   3122 C CB    . VAL D 2 38  ? 4.815   8.798   -1.635  1.00 20.02 ? 39  VAL B CB    1 
ATOM   3123 C CG1   . VAL D 2 38  ? 5.675   10.044  -1.471  1.00 23.63 ? 39  VAL B CG1   1 
ATOM   3124 C CG2   . VAL D 2 38  ? 4.199   8.485   -0.289  1.00 21.00 ? 39  VAL B CG2   1 
ATOM   3125 H H     . VAL D 2 38  ? 3.306   6.986   -2.741  1.00 0.00  ? 39  VAL B H     1 
ATOM   3126 N N     . LEU D 2 39  ? 4.885   8.666   -4.768  1.00 18.60 ? 40  LEU B N     1 
ATOM   3127 C CA    . LEU D 2 39  ? 5.496   9.033   -6.048  1.00 19.21 ? 40  LEU B CA    1 
ATOM   3128 C C     . LEU D 2 39  ? 4.488   9.499   -7.106  1.00 20.18 ? 40  LEU B C     1 
ATOM   3129 O O     . LEU D 2 39  ? 4.753   10.456  -7.814  1.00 22.95 ? 40  LEU B O     1 
ATOM   3130 C CB    . LEU D 2 39  ? 6.467   7.936   -6.525  1.00 19.52 ? 40  LEU B CB    1 
ATOM   3131 C CG    . LEU D 2 39  ? 7.703   7.910   -5.581  1.00 22.65 ? 40  LEU B CG    1 
ATOM   3132 C CD1   . LEU D 2 39  ? 8.530   6.630   -5.627  1.00 23.35 ? 40  LEU B CD1   1 
ATOM   3133 C CD2   . LEU D 2 39  ? 8.600   9.111   -5.822  1.00 22.58 ? 40  LEU B CD2   1 
ATOM   3134 H H     . LEU D 2 39  ? 4.946   7.738   -4.451  1.00 0.00  ? 40  LEU B H     1 
ATOM   3135 N N     . SER D 2 40  ? 3.274   8.969   -7.066  1.00 21.01 ? 41  SER B N     1 
ATOM   3136 C CA    . SER D 2 40  ? 2.223   9.385   -7.975  1.00 20.48 ? 41  SER B CA    1 
ATOM   3137 C C     . SER D 2 40  ? 1.966   10.863  -7.776  1.00 19.93 ? 41  SER B C     1 
ATOM   3138 O O     . SER D 2 40  ? 1.921   11.639  -8.733  1.00 22.16 ? 41  SER B O     1 
ATOM   3139 C CB    . SER D 2 40  ? 0.921   8.652   -7.653  1.00 23.11 ? 41  SER B CB    1 
ATOM   3140 O OG    . SER D 2 40  ? 1.108   7.243   -7.612  1.00 30.14 ? 41  SER B OG    1 
ATOM   3141 H H     . SER D 2 40  ? 3.060   8.264   -6.424  1.00 0.00  ? 41  SER B H     1 
ATOM   3142 H HG    . SER D 2 40  ? 0.327   6.815   -7.252  1.00 0.00  ? 41  SER B HG    1 
ATOM   3143 N N     . THR D 2 41  ? 1.764   11.261  -6.525  1.00 21.32 ? 42  THR B N     1 
ATOM   3144 C CA    . THR D 2 41  ? 1.489   12.661  -6.193  1.00 18.09 ? 42  THR B CA    1 
ATOM   3145 C C     . THR D 2 41  ? 2.644   13.578  -6.591  1.00 16.68 ? 42  THR B C     1 
ATOM   3146 O O     . THR D 2 41  ? 2.453   14.668  -7.141  1.00 16.04 ? 42  THR B O     1 
ATOM   3147 C CB    . THR D 2 41  ? 1.241   12.785  -4.688  1.00 19.54 ? 42  THR B CB    1 
ATOM   3148 O OG1   . THR D 2 41  ? 0.006   12.130  -4.379  1.00 21.98 ? 42  THR B OG1   1 
ATOM   3149 C CG2   . THR D 2 41  ? 1.198   14.238  -4.254  1.00 17.58 ? 42  THR B CG2   1 
ATOM   3150 H H     . THR D 2 41  ? 1.772   10.625  -5.778  1.00 0.00  ? 42  THR B H     1 
ATOM   3151 H HG1   . THR D 2 41  ? -0.041  11.939  -3.428  1.00 0.00  ? 42  THR B HG1   1 
ATOM   3152 N N     . ILE D 2 42  ? 3.844   13.111  -6.313  1.00 16.72 ? 43  ILE B N     1 
ATOM   3153 C CA    . ILE D 2 42  ? 5.037   13.852  -6.627  1.00 20.40 ? 43  ILE B CA    1 
ATOM   3154 C C     . ILE D 2 42  ? 5.074   14.098  -8.150  1.00 19.19 ? 43  ILE B C     1 
ATOM   3155 O O     . ILE D 2 42  ? 4.885   15.228  -8.597  1.00 21.00 ? 43  ILE B O     1 
ATOM   3156 C CB    . ILE D 2 42  ? 6.292   13.094  -6.040  1.00 22.23 ? 43  ILE B CB    1 
ATOM   3157 C CG1   . ILE D 2 42  ? 6.672   13.691  -4.681  1.00 26.45 ? 43  ILE B CG1   1 
ATOM   3158 C CG2   . ILE D 2 42  ? 7.492   13.160  -6.957  1.00 24.26 ? 43  ILE B CG2   1 
ATOM   3159 C CD1   . ILE D 2 42  ? 5.584   13.657  -3.627  1.00 28.66 ? 43  ILE B CD1   1 
ATOM   3160 H H     . ILE D 2 42  ? 3.914   12.233  -5.876  1.00 0.00  ? 43  ILE B H     1 
ATOM   3161 N N     . PHE D 2 43  ? 5.103   13.028  -8.932  1.00 15.62 ? 44  PHE B N     1 
ATOM   3162 C CA    . PHE D 2 43  ? 5.160   13.148  -10.386 1.00 17.31 ? 44  PHE B CA    1 
ATOM   3163 C C     . PHE D 2 43  ? 4.083   13.994  -10.996 1.00 18.60 ? 44  PHE B C     1 
ATOM   3164 O O     . PHE D 2 43  ? 4.306   14.705  -11.951 1.00 20.64 ? 44  PHE B O     1 
ATOM   3165 C CB    . PHE D 2 43  ? 5.211   11.775  -11.009 1.00 15.27 ? 44  PHE B CB    1 
ATOM   3166 C CG    . PHE D 2 43  ? 6.477   11.061  -10.704 1.00 14.40 ? 44  PHE B CG    1 
ATOM   3167 C CD1   . PHE D 2 43  ? 7.666   11.774  -10.622 1.00 14.19 ? 44  PHE B CD1   1 
ATOM   3168 C CD2   . PHE D 2 43  ? 6.481   9.698   -10.417 1.00 15.17 ? 44  PHE B CD2   1 
ATOM   3169 C CE1   . PHE D 2 43  ? 8.847   11.133  -10.246 1.00 18.63 ? 44  PHE B CE1   1 
ATOM   3170 C CE2   . PHE D 2 43  ? 7.666   9.042   -10.035 1.00 14.48 ? 44  PHE B CE2   1 
ATOM   3171 C CZ    . PHE D 2 43  ? 8.850   9.761   -9.947  1.00 15.33 ? 44  PHE B CZ    1 
ATOM   3172 H H     . PHE D 2 43  ? 5.088   12.144  -8.520  1.00 0.00  ? 44  PHE B H     1 
ATOM   3173 N N     . GLU D 2 44  ? 2.950   14.031  -10.339 1.00 21.43 ? 45  GLU B N     1 
ATOM   3174 C CA    . GLU D 2 44  ? 1.810   14.804  -10.789 1.00 20.79 ? 45  GLU B CA    1 
ATOM   3175 C C     . GLU D 2 44  ? 2.106   16.281  -10.673 1.00 20.52 ? 45  GLU B C     1 
ATOM   3176 O O     . GLU D 2 44  ? 1.908   17.039  -11.621 1.00 18.11 ? 45  GLU B O     1 
ATOM   3177 C CB    . GLU D 2 44  ? 0.634   14.430  -9.894  1.00 21.80 ? 45  GLU B CB    1 
ATOM   3178 C CG    . GLU D 2 44  ? -0.714  14.972  -10.265 1.00 28.86 ? 45  GLU B CG    1 
ATOM   3179 C CD    . GLU D 2 44  ? -1.785  14.295  -9.440  1.00 29.60 ? 45  GLU B CD    1 
ATOM   3180 O OE1   . GLU D 2 44  ? -1.783  13.051  -9.385  1.00 33.69 ? 45  GLU B OE1   1 
ATOM   3181 O OE2   . GLU D 2 44  ? -2.579  14.994  -8.790  1.00 34.03 ? 45  GLU B OE2   1 
ATOM   3182 H H     . GLU D 2 44  ? 2.860   13.504  -9.516  1.00 0.00  ? 45  GLU B H     1 
ATOM   3183 N N     . LEU D 2 45  ? 2.598   16.681  -9.498  1.00 19.37 ? 46  LEU B N     1 
ATOM   3184 C CA    . LEU D 2 45  ? 2.912   18.089  -9.210  1.00 19.75 ? 46  LEU B CA    1 
ATOM   3185 C C     . LEU D 2 45  ? 4.143   18.541  -9.946  1.00 15.90 ? 46  LEU B C     1 
ATOM   3186 O O     . LEU D 2 45  ? 4.352   19.716  -10.124 1.00 17.35 ? 46  LEU B O     1 
ATOM   3187 C CB    . LEU D 2 45  ? 3.143   18.295  -7.708  1.00 21.62 ? 46  LEU B CB    1 
ATOM   3188 C CG    . LEU D 2 45  ? 2.005   17.909  -6.755  1.00 21.80 ? 46  LEU B CG    1 
ATOM   3189 C CD1   . LEU D 2 45  ? 2.524   17.892  -5.329  1.00 25.47 ? 46  LEU B CD1   1 
ATOM   3190 C CD2   . LEU D 2 45  ? 0.851   18.898  -6.915  1.00 22.55 ? 46  LEU B CD2   1 
ATOM   3191 H H     . LEU D 2 45  ? 2.771   16.008  -8.800  1.00 0.00  ? 46  LEU B H     1 
ATOM   3192 N N     . PHE D 2 46  ? 5.023   17.601  -10.228 1.00 16.35 ? 47  PHE B N     1 
ATOM   3193 C CA    . PHE D 2 46  ? 6.255   17.867  -10.956 1.00 19.80 ? 47  PHE B CA    1 
ATOM   3194 C C     . PHE D 2 46  ? 5.896   18.279  -12.395 1.00 20.67 ? 47  PHE B C     1 
ATOM   3195 O O     . PHE D 2 46  ? 6.433   19.263  -12.927 1.00 22.50 ? 47  PHE B O     1 
ATOM   3196 C CB    . PHE D 2 46  ? 7.112   16.594  -10.955 1.00 20.95 ? 47  PHE B CB    1 
ATOM   3197 C CG    . PHE D 2 46  ? 8.459   16.775  -11.546 1.00 22.78 ? 47  PHE B CG    1 
ATOM   3198 C CD1   . PHE D 2 46  ? 9.393   17.617  -10.945 1.00 23.76 ? 47  PHE B CD1   1 
ATOM   3199 C CD2   . PHE D 2 46  ? 8.806   16.121  -12.712 1.00 24.78 ? 47  PHE B CD2   1 
ATOM   3200 C CE1   . PHE D 2 46  ? 10.644  17.800  -11.502 1.00 22.78 ? 47  PHE B CE1   1 
ATOM   3201 C CE2   . PHE D 2 46  ? 10.054  16.302  -13.272 1.00 23.05 ? 47  PHE B CE2   1 
ATOM   3202 C CZ    . PHE D 2 46  ? 10.970  17.142  -12.665 1.00 23.04 ? 47  PHE B CZ    1 
ATOM   3203 H H     . PHE D 2 46  ? 4.837   16.693  -9.911  1.00 0.00  ? 47  PHE B H     1 
ATOM   3204 N N     . SER D 2 47  ? 4.916   17.574  -12.968 1.00 18.40 ? 48  SER B N     1 
ATOM   3205 C CA    . SER D 2 47  ? 4.430   17.808  -14.330 1.00 15.01 ? 48  SER B CA    1 
ATOM   3206 C C     . SER D 2 47  ? 3.537   19.022  -14.576 1.00 15.28 ? 48  SER B C     1 
ATOM   3207 O O     . SER D 2 47  ? 3.518   19.557  -15.673 1.00 15.71 ? 48  SER B O     1 
ATOM   3208 C CB    . SER D 2 47  ? 3.677   16.583  -14.793 1.00 13.38 ? 48  SER B CB    1 
ATOM   3209 O OG    . SER D 2 47  ? 4.452   15.420  -14.660 1.00 15.17 ? 48  SER B OG    1 
ATOM   3210 H H     . SER D 2 47  ? 4.497   16.852  -12.453 1.00 0.00  ? 48  SER B H     1 
ATOM   3211 H HG    . SER D 2 47  ? 4.706   15.260  -13.742 1.00 0.00  ? 48  SER B HG    1 
ATOM   3212 N N     . ARG D 2 48  ? 2.807   19.482  -13.579 1.00 14.80 ? 49  ARG B N     1 
ATOM   3213 C CA    . ARG D 2 48  ? 1.893   20.587  -13.805 1.00 18.56 ? 49  ARG B CA    1 
ATOM   3214 C C     . ARG D 2 48  ? 2.492   21.826  -14.387 1.00 20.09 ? 49  ARG B C     1 
ATOM   3215 O O     . ARG D 2 48  ? 1.881   22.424  -15.264 1.00 21.99 ? 49  ARG B O     1 
ATOM   3216 C CB    . ARG D 2 48  ? 1.103   20.962  -12.549 1.00 20.96 ? 49  ARG B CB    1 
ATOM   3217 C CG    . ARG D 2 48  ? 0.282   19.820  -11.984 1.00 25.03 ? 49  ARG B CG    1 
ATOM   3218 C CD    . ARG D 2 48  ? -0.243  20.103  -10.584 1.00 25.54 ? 49  ARG B CD    1 
ATOM   3219 N NE    . ARG D 2 48  ? -1.134  21.257  -10.536 1.00 27.83 ? 49  ARG B NE    1 
ATOM   3220 C CZ    . ARG D 2 48  ? -0.895  22.353  -9.820  1.00 27.94 ? 49  ARG B CZ    1 
ATOM   3221 N NH1   . ARG D 2 48  ? 0.219   22.468  -9.097  1.00 30.15 ? 49  ARG B NH1   1 
ATOM   3222 N NH2   . ARG D 2 48  ? -1.813  23.304  -9.760  1.00 28.84 ? 49  ARG B NH2   1 
ATOM   3223 H H     . ARG D 2 48  ? 2.874   19.073  -12.690 1.00 0.00  ? 49  ARG B H     1 
ATOM   3224 H HE    . ARG D 2 48  ? -1.963  21.230  -11.059 1.00 0.00  ? 49  ARG B HE    1 
ATOM   3225 H HH11  . ARG D 2 48  ? 0.878   21.720  -9.084  1.00 0.00  ? 49  ARG B HH11  1 
ATOM   3226 H HH12  . ARG D 2 48  ? 0.389   23.297  -8.563  1.00 0.00  ? 49  ARG B HH12  1 
ATOM   3227 H HH21  . ARG D 2 48  ? -2.677  23.194  -10.249 1.00 0.00  ? 49  ARG B HH21  1 
ATOM   3228 H HH22  . ARG D 2 48  ? -1.643  24.131  -9.224  1.00 0.00  ? 49  ARG B HH22  1 
ATOM   3229 N N     . PRO D 2 49  ? 3.629   22.316  -13.839 1.00 22.04 ? 50  PRO B N     1 
ATOM   3230 C CA    . PRO D 2 49  ? 4.226   23.535  -14.408 1.00 20.30 ? 50  PRO B CA    1 
ATOM   3231 C C     . PRO D 2 49  ? 4.680   23.343  -15.870 1.00 16.83 ? 50  PRO B C     1 
ATOM   3232 O O     . PRO D 2 49  ? 4.632   24.278  -16.661 1.00 14.58 ? 50  PRO B O     1 
ATOM   3233 C CB    . PRO D 2 49  ? 5.419   23.794  -13.479 1.00 21.41 ? 50  PRO B CB    1 
ATOM   3234 C CG    . PRO D 2 49  ? 4.983   23.159  -12.187 1.00 20.43 ? 50  PRO B CG    1 
ATOM   3235 C CD    . PRO D 2 49  ? 4.401   21.873  -12.661 1.00 20.42 ? 50  PRO B CD    1 
ATOM   3236 N N     . ILE D 2 50  ? 5.159   22.143  -16.179 1.00 15.68 ? 51  ILE B N     1 
ATOM   3237 C CA    . ILE D 2 50  ? 5.604   21.784  -17.511 1.00 21.02 ? 51  ILE B CA    1 
ATOM   3238 C C     . ILE D 2 50  ? 4.433   21.862  -18.504 1.00 20.12 ? 51  ILE B C     1 
ATOM   3239 O O     . ILE D 2 50  ? 4.520   22.503  -19.560 1.00 21.50 ? 51  ILE B O     1 
ATOM   3240 C CB    . ILE D 2 50  ? 6.147   20.365  -17.530 1.00 23.49 ? 51  ILE B CB    1 
ATOM   3241 C CG1   . ILE D 2 50  ? 7.205   20.178  -16.439 1.00 24.35 ? 51  ILE B CG1   1 
ATOM   3242 C CG2   . ILE D 2 50  ? 6.779   20.066  -18.896 1.00 24.09 ? 51  ILE B CG2   1 
ATOM   3243 C CD1   . ILE D 2 50  ? 7.838   18.735  -16.449 1.00 25.08 ? 51  ILE B CD1   1 
ATOM   3244 H H     . ILE D 2 50  ? 5.199   21.475  -15.466 1.00 0.00  ? 51  ILE B H     1 
ATOM   3245 N N     . ILE D 2 51  ? 3.324   21.230  -18.132 1.00 18.60 ? 52  ILE B N     1 
ATOM   3246 C CA    . ILE D 2 51  ? 2.128   21.231  -18.950 1.00 16.39 ? 52  ILE B CA    1 
ATOM   3247 C C     . ILE D 2 51  ? 1.615   22.654  -19.139 1.00 16.12 ? 52  ILE B C     1 
ATOM   3248 O O     . ILE D 2 51  ? 1.412   23.091  -20.260 1.00 18.45 ? 52  ILE B O     1 
ATOM   3249 C CB    . ILE D 2 51  ? 1.032   20.257  -18.368 1.00 15.46 ? 52  ILE B CB    1 
ATOM   3250 C CG1   . ILE D 2 51  ? 1.512   18.803  -18.543 1.00 11.41 ? 52  ILE B CG1   1 
ATOM   3251 C CG2   . ILE D 2 51  ? -0.290  20.472  -19.052 1.00 16.50 ? 52  ILE B CG2   1 
ATOM   3252 C CD1   . ILE D 2 51  ? 0.811   17.773  -17.657 1.00 17.14 ? 52  ILE B CD1   1 
ATOM   3253 H H     . ILE D 2 51  ? 3.317   20.736  -17.285 1.00 0.00  ? 52  ILE B H     1 
ATOM   3254 N N     . ASN D 2 52  ? 1.511   23.426  -18.080 1.00 15.21 ? 53  ASN B N     1 
ATOM   3255 C CA    . ASN D 2 52  ? 1.011   24.757  -18.248 1.00 17.97 ? 53  ASN B CA    1 
ATOM   3256 C C     . ASN D 2 52  ? 1.933   25.653  -19.089 1.00 19.40 ? 53  ASN B C     1 
ATOM   3257 O O     . ASN D 2 52  ? 1.457   26.556  -19.782 1.00 17.60 ? 53  ASN B O     1 
ATOM   3258 C CB    . ASN D 2 52  ? 0.748   25.408  -16.908 1.00 20.16 ? 53  ASN B CB    1 
ATOM   3259 C CG    . ASN D 2 52  ? -0.292  26.487  -17.010 1.00 27.62 ? 53  ASN B CG    1 
ATOM   3260 O OD1   . ASN D 2 52  ? -1.475  26.231  -16.824 1.00 33.25 ? 53  ASN B OD1   1 
ATOM   3261 N ND2   . ASN D 2 52  ? 0.128   27.698  -17.347 1.00 30.85 ? 53  ASN B ND2   1 
ATOM   3262 H H     . ASN D 2 52  ? 1.750   23.095  -17.185 1.00 0.00  ? 53  ASN B H     1 
ATOM   3263 H HD21  . ASN D 2 52  ? -0.546  28.399  -17.418 1.00 0.00  ? 53  ASN B HD21  1 
ATOM   3264 H HD22  . ASN D 2 52  ? 1.083   27.835  -17.516 1.00 0.00  ? 53  ASN B HD22  1 
ATOM   3265 N N     . LYS D 2 53  ? 3.239   25.393  -19.050 1.00 19.89 ? 54  LYS B N     1 
ATOM   3266 C CA    . LYS D 2 53  ? 4.201   26.202  -19.791 1.00 23.18 ? 54  LYS B CA    1 
ATOM   3267 C C     . LYS D 2 53  ? 3.981   26.017  -21.281 1.00 25.02 ? 54  LYS B C     1 
ATOM   3268 O O     . LYS D 2 53  ? 3.798   26.992  -22.013 1.00 26.19 ? 54  LYS B O     1 
ATOM   3269 C CB    . LYS D 2 53  ? 5.634   25.782  -19.425 1.00 26.24 ? 54  LYS B CB    1 
ATOM   3270 C CG    . LYS D 2 53  ? 6.754   26.798  -19.783 1.00 32.52 ? 54  LYS B CG    1 
ATOM   3271 C CD    . LYS D 2 53  ? 7.141   26.724  -21.259 1.00 37.84 ? 54  LYS B CD    1 
ATOM   3272 C CE    . LYS D 2 53  ? 7.957   27.935  -21.709 1.00 42.79 ? 54  LYS B CE    1 
ATOM   3273 N NZ    . LYS D 2 53  ? 7.960   28.061  -23.211 1.00 47.28 ? 54  LYS B NZ    1 
ATOM   3274 H H     . LYS D 2 53  ? 3.572   24.652  -18.501 1.00 0.00  ? 54  LYS B H     1 
ATOM   3275 H HZ1   . LYS D 2 53  ? 8.345   27.197  -23.643 1.00 0.00  ? 54  LYS B HZ1   1 
ATOM   3276 H HZ2   . LYS D 2 53  ? 6.985   28.204  -23.537 1.00 0.00  ? 54  LYS B HZ2   1 
ATOM   3277 H HZ3   . LYS D 2 53  ? 8.537   28.879  -23.495 1.00 0.00  ? 54  LYS B HZ3   1 
ATOM   3278 N N     . ILE D 2 54  ? 3.957   24.749  -21.697 1.00 24.43 ? 55  ILE B N     1 
ATOM   3279 C CA    . ILE D 2 54  ? 3.797   24.368  -23.091 1.00 22.46 ? 55  ILE B CA    1 
ATOM   3280 C C     . ILE D 2 54  ? 2.431   24.669  -23.662 1.00 22.70 ? 55  ILE B C     1 
ATOM   3281 O O     . ILE D 2 54  ? 2.319   24.982  -24.835 1.00 24.21 ? 55  ILE B O     1 
ATOM   3282 C CB    . ILE D 2 54  ? 4.117   22.883  -23.326 1.00 21.59 ? 55  ILE B CB    1 
ATOM   3283 C CG1   . ILE D 2 54  ? 5.536   22.571  -22.857 1.00 22.01 ? 55  ILE B CG1   1 
ATOM   3284 C CG2   . ILE D 2 54  ? 3.938   22.533  -24.821 1.00 23.12 ? 55  ILE B CG2   1 
ATOM   3285 C CD1   . ILE D 2 54  ? 6.572   23.460  -23.481 1.00 22.76 ? 55  ILE B CD1   1 
ATOM   3286 H H     . ILE D 2 54  ? 4.053   24.039  -21.024 1.00 0.00  ? 55  ILE B H     1 
ATOM   3287 N N     . ALA D 2 55  ? 1.387   24.498  -22.869 1.00 20.95 ? 56  ALA B N     1 
ATOM   3288 C CA    . ALA D 2 55  ? 0.060   24.793  -23.327 1.00 20.09 ? 56  ALA B CA    1 
ATOM   3289 C C     . ALA D 2 55  ? -0.028  26.300  -23.633 1.00 21.33 ? 56  ALA B C     1 
ATOM   3290 O O     . ALA D 2 55  ? -0.482  26.703  -24.701 1.00 23.35 ? 56  ALA B O     1 
ATOM   3291 C CB    . ALA D 2 55  ? -0.929  24.408  -22.293 1.00 21.30 ? 56  ALA B CB    1 
ATOM   3292 H H     . ALA D 2 55  ? 1.521   24.154  -21.960 1.00 0.00  ? 56  ALA B H     1 
ATOM   3293 N N     . GLU D 2 56  ? 0.468   27.127  -22.729 1.00 22.47 ? 57  GLU B N     1 
ATOM   3294 C CA    . GLU D 2 56  ? 0.426   28.573  -22.911 1.00 24.97 ? 57  GLU B CA    1 
ATOM   3295 C C     . GLU D 2 56  ? 1.117   28.961  -24.211 1.00 26.25 ? 57  GLU B C     1 
ATOM   3296 O O     . GLU D 2 56  ? 0.592   29.750  -24.999 1.00 29.92 ? 57  GLU B O     1 
ATOM   3297 C CB    . GLU D 2 56  ? 1.099   29.272  -21.729 1.00 26.67 ? 57  GLU B CB    1 
ATOM   3298 H H     . GLU D 2 56  ? 0.862   26.768  -21.905 1.00 0.00  ? 57  GLU B H     1 
ATOM   3299 N N     . LYS D 2 57  ? 2.294   28.387  -24.440 1.00 26.34 ? 58  LYS B N     1 
ATOM   3300 C CA    . LYS D 2 57  ? 3.058   28.622  -25.663 1.00 25.20 ? 58  LYS B CA    1 
ATOM   3301 C C     . LYS D 2 57  ? 2.142   28.516  -26.871 1.00 22.73 ? 58  LYS B C     1 
ATOM   3302 O O     . LYS D 2 57  ? 2.278   29.265  -27.833 1.00 24.04 ? 58  LYS B O     1 
ATOM   3303 C CB    . LYS D 2 57  ? 4.102   27.519  -25.852 1.00 26.91 ? 58  LYS B CB    1 
ATOM   3304 C CG    . LYS D 2 57  ? 5.418   27.678  -25.154 1.00 33.05 ? 58  LYS B CG    1 
ATOM   3305 C CD    . LYS D 2 57  ? 6.428   26.729  -25.800 1.00 35.74 ? 58  LYS B CD    1 
ATOM   3306 C CE    . LYS D 2 57  ? 6.564   27.018  -27.313 1.00 37.66 ? 58  LYS B CE    1 
ATOM   3307 N NZ    . LYS D 2 57  ? 7.663   26.240  -28.013 1.00 41.52 ? 58  LYS B NZ    1 
ATOM   3308 H H     . LYS D 2 57  ? 2.670   27.805  -23.743 1.00 0.00  ? 58  LYS B H     1 
ATOM   3309 H HZ1   . LYS D 2 57  ? 8.584   26.466  -27.586 1.00 0.00  ? 58  LYS B HZ1   1 
ATOM   3310 H HZ2   . LYS D 2 57  ? 7.477   25.221  -27.918 1.00 0.00  ? 58  LYS B HZ2   1 
ATOM   3311 H HZ3   . LYS D 2 57  ? 7.678   26.496  -29.021 1.00 0.00  ? 58  LYS B HZ3   1 
ATOM   3312 N N     . HIS D 2 58  ? 1.262   27.523  -26.829 1.00 19.83 ? 59  HIS B N     1 
ATOM   3313 C CA    . HIS D 2 58  ? 0.371   27.224  -27.927 1.00 18.47 ? 59  HIS B CA    1 
ATOM   3314 C C     . HIS D 2 58  ? -1.012  27.776  -27.867 1.00 17.32 ? 59  HIS B C     1 
ATOM   3315 O O     . HIS D 2 58  ? -1.859  27.343  -28.610 1.00 21.66 ? 59  HIS B O     1 
ATOM   3316 C CB    . HIS D 2 58  ? 0.308   25.725  -28.167 1.00 17.16 ? 59  HIS B CB    1 
ATOM   3317 C CG    . HIS D 2 58  ? 1.613   25.127  -28.581 1.00 17.86 ? 59  HIS B CG    1 
ATOM   3318 N ND1   . HIS D 2 58  ? 1.913   24.825  -29.888 1.00 21.64 ? 59  HIS B ND1   1 
ATOM   3319 C CD2   . HIS D 2 58  ? 2.668   24.697  -27.852 1.00 23.40 ? 59  HIS B CD2   1 
ATOM   3320 C CE1   . HIS D 2 58  ? 3.085   24.219  -29.950 1.00 21.61 ? 59  HIS B CE1   1 
ATOM   3321 N NE2   . HIS D 2 58  ? 3.563   24.127  -28.726 1.00 23.50 ? 59  HIS B NE2   1 
ATOM   3322 H H     . HIS D 2 58  ? 1.189   26.994  -26.005 1.00 0.00  ? 59  HIS B H     1 
ATOM   3323 H HD1   . HIS D 2 58  ? 1.357   25.046  -30.671 1.00 0.00  ? 59  HIS B HD1   1 
ATOM   3324 H HE2   . HIS D 2 58  ? 4.361   23.668  -28.423 1.00 0.00  ? 59  HIS B HE2   1 
ATOM   3325 N N     . GLY D 2 59  ? -1.253  28.710  -26.969 1.00 18.90 ? 60  GLY B N     1 
ATOM   3326 C CA    . GLY D 2 59  ? -2.565  29.330  -26.887 1.00 20.46 ? 60  GLY B CA    1 
ATOM   3327 C C     . GLY D 2 59  ? -3.685  28.485  -26.319 1.00 22.81 ? 60  GLY B C     1 
ATOM   3328 O O     . GLY D 2 59  ? -4.862  28.733  -26.576 1.00 27.00 ? 60  GLY B O     1 
ATOM   3329 H H     . GLY D 2 59  ? -0.552  28.994  -26.352 1.00 0.00  ? 60  GLY B H     1 
ATOM   3330 N N     . TYR D 2 60  ? -3.323  27.507  -25.510 1.00 23.48 ? 61  TYR B N     1 
ATOM   3331 C CA    . TYR D 2 60  ? -4.285  26.621  -24.897 1.00 23.99 ? 61  TYR B CA    1 
ATOM   3332 C C     . TYR D 2 60  ? -4.500  26.947  -23.423 1.00 25.69 ? 61  TYR B C     1 
ATOM   3333 O O     . TYR D 2 60  ? -3.577  27.317  -22.705 1.00 26.44 ? 61  TYR B O     1 
ATOM   3334 C CB    . TYR D 2 60  ? -3.775  25.195  -24.994 1.00 22.70 ? 61  TYR B CB    1 
ATOM   3335 C CG    . TYR D 2 60  ? -3.994  24.527  -26.316 1.00 25.37 ? 61  TYR B CG    1 
ATOM   3336 C CD1   . TYR D 2 60  ? -3.048  24.622  -27.340 1.00 24.80 ? 61  TYR B CD1   1 
ATOM   3337 C CD2   . TYR D 2 60  ? -5.109  23.719  -26.511 1.00 25.27 ? 61  TYR B CD2   1 
ATOM   3338 C CE1   . TYR D 2 60  ? -3.215  23.921  -28.508 1.00 29.36 ? 61  TYR B CE1   1 
ATOM   3339 C CE2   . TYR D 2 60  ? -5.283  23.023  -27.646 1.00 26.08 ? 61  TYR B CE2   1 
ATOM   3340 C CZ    . TYR D 2 60  ? -4.344  23.113  -28.645 1.00 27.89 ? 61  TYR B CZ    1 
ATOM   3341 O OH    . TYR D 2 60  ? -4.524  22.342  -29.757 1.00 31.84 ? 61  TYR B OH    1 
ATOM   3342 H H     . TYR D 2 60  ? -2.376  27.385  -25.292 1.00 0.00  ? 61  TYR B H     1 
ATOM   3343 H HH    . TYR D 2 60  ? -5.348  21.848  -29.675 1.00 0.00  ? 61  TYR B HH    1 
ATOM   3344 N N     . ILE D 2 61  ? -5.723  26.758  -22.979 1.00 24.97 ? 62  ILE B N     1 
ATOM   3345 C CA    . ILE D 2 61  ? -6.107  26.964  -21.605 1.00 27.83 ? 62  ILE B CA    1 
ATOM   3346 C C     . ILE D 2 61  ? -5.963  25.587  -20.913 1.00 27.17 ? 62  ILE B C     1 
ATOM   3347 O O     . ILE D 2 61  ? -6.179  24.548  -21.545 1.00 28.67 ? 62  ILE B O     1 
ATOM   3348 C CB    . ILE D 2 61  ? -7.555  27.518  -21.570 1.00 30.24 ? 62  ILE B CB    1 
ATOM   3349 C CG1   . ILE D 2 61  ? -7.518  29.030  -21.721 1.00 34.59 ? 62  ILE B CG1   1 
ATOM   3350 C CG2   . ILE D 2 61  ? -8.305  27.107  -20.330 1.00 35.05 ? 62  ILE B CG2   1 
ATOM   3351 C CD1   . ILE D 2 61  ? -6.609  29.726  -20.724 1.00 37.76 ? 62  ILE B CD1   1 
ATOM   3352 H H     . ILE D 2 61  ? -6.393  26.460  -23.603 1.00 0.00  ? 62  ILE B H     1 
ATOM   3353 N N     . VAL D 2 62  ? -5.462  25.574  -19.673 1.00 24.81 ? 63  VAL B N     1 
ATOM   3354 C CA    . VAL D 2 62  ? -5.303  24.321  -18.948 1.00 19.88 ? 63  VAL B CA    1 
ATOM   3355 C C     . VAL D 2 62  ? -6.314  24.351  -17.839 1.00 20.29 ? 63  VAL B C     1 
ATOM   3356 O O     . VAL D 2 62  ? -6.531  25.395  -17.227 1.00 19.68 ? 63  VAL B O     1 
ATOM   3357 C CB    . VAL D 2 62  ? -3.874  24.105  -18.389 1.00 19.51 ? 63  VAL B CB    1 
ATOM   3358 C CG1   . VAL D 2 62  ? -3.788  22.750  -17.711 1.00 13.95 ? 63  VAL B CG1   1 
ATOM   3359 C CG2   . VAL D 2 62  ? -2.853  24.154  -19.524 1.00 15.86 ? 63  VAL B CG2   1 
ATOM   3360 H H     . VAL D 2 62  ? -5.225  26.403  -19.212 1.00 0.00  ? 63  VAL B H     1 
ATOM   3361 N N     . GLU D 2 63  ? -7.005  23.230  -17.655 1.00 21.16 ? 64  GLU B N     1 
ATOM   3362 C CA    . GLU D 2 63  ? -8.021  23.131  -16.622 1.00 20.83 ? 64  GLU B CA    1 
ATOM   3363 C C     . GLU D 2 63  ? -8.017  21.805  -15.865 1.00 20.04 ? 64  GLU B C     1 
ATOM   3364 O O     . GLU D 2 63  ? -7.921  20.731  -16.457 1.00 20.72 ? 64  GLU B O     1 
ATOM   3365 C CB    . GLU D 2 63  ? -9.374  23.368  -17.232 1.00 24.90 ? 64  GLU B CB    1 
ATOM   3366 C CG    . GLU D 2 63  ? -10.353 23.766  -16.241 1.00 30.19 ? 64  GLU B CG    1 
ATOM   3367 C CD    . GLU D 2 63  ? -11.679 23.942  -16.860 1.00 34.41 ? 64  GLU B CD    1 
ATOM   3368 O OE1   . GLU D 2 63  ? -11.765 24.734  -17.833 1.00 33.84 ? 64  GLU B OE1   1 
ATOM   3369 O OE2   . GLU D 2 63  ? -12.624 23.268  -16.379 1.00 41.06 ? 64  GLU B OE2   1 
ATOM   3370 H H     . GLU D 2 63  ? -6.843  22.450  -18.224 1.00 0.00  ? 64  GLU B H     1 
ATOM   3371 N N     . GLU D 2 64  ? -8.021  21.905  -14.537 1.00 19.68 ? 65  GLU B N     1 
ATOM   3372 C CA    . GLU D 2 64  ? -8.027  20.740  -13.649 1.00 20.26 ? 65  GLU B CA    1 
ATOM   3373 C C     . GLU D 2 64  ? -9.439  20.629  -13.120 1.00 19.18 ? 65  GLU B C     1 
ATOM   3374 O O     . GLU D 2 64  ? -10.207 21.608  -13.179 1.00 17.79 ? 65  GLU B O     1 
ATOM   3375 C CB    . GLU D 2 64  ? -7.026  20.918  -12.511 1.00 21.20 ? 65  GLU B CB    1 
ATOM   3376 C CG    . GLU D 2 64  ? -5.610  20.939  -13.025 1.00 25.34 ? 65  GLU B CG    1 
ATOM   3377 C CD    . GLU D 2 64  ? -4.565  21.024  -11.939 1.00 26.24 ? 65  GLU B CD    1 
ATOM   3378 O OE1   . GLU D 2 64  ? -4.336  22.129  -11.428 1.00 27.91 ? 65  GLU B OE1   1 
ATOM   3379 O OE2   . GLU D 2 64  ? -3.940  19.988  -11.644 1.00 30.89 ? 65  GLU B OE2   1 
ATOM   3380 H H     . GLU D 2 64  ? -8.068  22.793  -14.131 1.00 0.00  ? 65  GLU B H     1 
ATOM   3381 N N     . PRO D 2 65  ? -9.825  19.427  -12.649 1.00 18.28 ? 66  PRO B N     1 
ATOM   3382 C CA    . PRO D 2 65  ? -11.160 19.122  -12.108 1.00 21.76 ? 66  PRO B CA    1 
ATOM   3383 C C     . PRO D 2 65  ? -11.489 19.796  -10.773 1.00 24.27 ? 66  PRO B C     1 
ATOM   3384 O O     . PRO D 2 65  ? -10.609 19.946  -9.923  1.00 24.85 ? 66  PRO B O     1 
ATOM   3385 C CB    . PRO D 2 65  ? -11.116 17.603  -11.920 1.00 17.94 ? 66  PRO B CB    1 
ATOM   3386 C CG    . PRO D 2 65  ? -10.010 17.159  -12.803 1.00 19.08 ? 66  PRO B CG    1 
ATOM   3387 C CD    . PRO D 2 65  ? -8.977  18.232  -12.631 1.00 14.60 ? 66  PRO B CD    1 
ATOM   3388 N N     . LYS D 2 66  ? -12.739 20.229  -10.607 1.00 27.93 ? 67  LYS B N     1 
ATOM   3389 C CA    . LYS D 2 66  ? -13.171 20.829  -9.348  1.00 31.60 ? 67  LYS B CA    1 
ATOM   3390 C C     . LYS D 2 66  ? -13.647 19.678  -8.454  1.00 33.36 ? 67  LYS B C     1 
ATOM   3391 O O     . LYS D 2 66  ? -13.311 19.636  -7.257  1.00 35.84 ? 67  LYS B O     1 
ATOM   3392 C CB    . LYS D 2 66  ? -14.294 21.851  -9.537  1.00 34.58 ? 67  LYS B CB    1 
ATOM   3393 C CG    . LYS D 2 66  ? -14.642 22.178  -10.978 1.00 41.12 ? 67  LYS B CG    1 
ATOM   3394 C CD    . LYS D 2 66  ? -15.802 21.325  -11.485 1.00 44.41 ? 67  LYS B CD    1 
ATOM   3395 C CE    . LYS D 2 66  ? -17.148 21.996  -11.180 1.00 47.75 ? 67  LYS B CE    1 
ATOM   3396 N NZ    . LYS D 2 66  ? -17.353 22.390  -9.757  1.00 47.42 ? 67  LYS B NZ    1 
ATOM   3397 H H     . LYS D 2 66  ? -13.351 20.137  -11.358 1.00 0.00  ? 67  LYS B H     1 
ATOM   3398 H HZ1   . LYS D 2 66  ? -17.221 21.583  -9.123  1.00 0.00  ? 67  LYS B HZ1   1 
ATOM   3399 H HZ2   . LYS D 2 66  ? -16.651 23.117  -9.512  1.00 0.00  ? 67  LYS B HZ2   1 
ATOM   3400 H HZ3   . LYS D 2 66  ? -18.309 22.783  -9.637  1.00 0.00  ? 67  LYS B HZ3   1 
ATOM   3401 N N     . GLN D 2 67  ? -14.437 18.751  -9.005  1.00 31.74 ? 68  GLN B N     1 
ATOM   3402 C CA    . GLN D 2 67  ? -14.866 17.600  -8.203  1.00 32.25 ? 68  GLN B CA    1 
ATOM   3403 C C     . GLN D 2 67  ? -13.675 16.649  -8.250  1.00 30.57 ? 68  GLN B C     1 
ATOM   3404 O O     . GLN D 2 67  ? -13.129 16.373  -9.334  1.00 30.95 ? 68  GLN B O     1 
ATOM   3405 C CB    . GLN D 2 67  ? -16.134 16.903  -8.741  1.00 34.07 ? 68  GLN B CB    1 
ATOM   3406 C CG    . GLN D 2 67  ? -17.451 17.631  -8.501  1.00 35.13 ? 68  GLN B CG    1 
ATOM   3407 C CD    . GLN D 2 67  ? -17.572 18.904  -9.325  1.00 40.25 ? 68  GLN B CD    1 
ATOM   3408 O OE1   . GLN D 2 67  ? -17.882 19.966  -8.795  1.00 43.19 ? 68  GLN B OE1   1 
ATOM   3409 N NE2   . GLN D 2 67  ? -17.313 18.804  -10.632 1.00 41.36 ? 68  GLN B NE2   1 
ATOM   3410 H H     . GLN D 2 67  ? -14.697 18.849  -9.933  1.00 0.00  ? 68  GLN B H     1 
ATOM   3411 H HE21  . GLN D 2 67  ? -17.485 19.611  -11.150 1.00 0.00  ? 68  GLN B HE21  1 
ATOM   3412 H HE22  . GLN D 2 67  ? -17.021 17.959  -11.000 1.00 0.00  ? 68  GLN B HE22  1 
ATOM   3413 N N     . GLN D 2 68  ? -13.317 16.119  -7.088  1.00 28.35 ? 69  GLN B N     1 
ATOM   3414 C CA    . GLN D 2 68  ? -12.157 15.251  -6.945  1.00 26.92 ? 69  GLN B CA    1 
ATOM   3415 C C     . GLN D 2 68  ? -12.092 13.885  -7.619  1.00 25.83 ? 69  GLN B C     1 
ATOM   3416 O O     . GLN D 2 68  ? -11.010 13.276  -7.711  1.00 28.93 ? 69  GLN B O     1 
ATOM   3417 C CB    . GLN D 2 68  ? -11.770 15.169  -5.462  1.00 29.73 ? 69  GLN B CB    1 
ATOM   3418 C CG    . GLN D 2 68  ? -11.671 16.556  -4.803  1.00 28.56 ? 69  GLN B CG    1 
ATOM   3419 C CD    . GLN D 2 68  ? -10.908 16.534  -3.502  1.00 29.46 ? 69  GLN B CD    1 
ATOM   3420 O OE1   . GLN D 2 68  ? -9.977  15.751  -3.344  1.00 30.41 ? 69  GLN B OE1   1 
ATOM   3421 N NE2   . GLN D 2 68  ? -11.300 17.385  -2.554  1.00 28.08 ? 69  GLN B NE2   1 
ATOM   3422 H H     . GLN D 2 68  ? -13.858 16.340  -6.298  1.00 0.00  ? 69  GLN B H     1 
ATOM   3423 H HE21  . GLN D 2 68  ? -10.787 17.410  -1.719  1.00 0.00  ? 69  GLN B HE21  1 
ATOM   3424 H HE22  . GLN D 2 68  ? -12.074 17.955  -2.738  1.00 0.00  ? 69  GLN B HE22  1 
ATOM   3425 N N     . ASN D 2 69  ? -13.214 13.353  -8.063  1.00 24.12 ? 70  ASN B N     1 
ATOM   3426 C CA    . ASN D 2 69  ? -13.136 12.060  -8.754  1.00 22.12 ? 70  ASN B CA    1 
ATOM   3427 C C     . ASN D 2 69  ? -13.553 12.184  -10.220 1.00 20.56 ? 70  ASN B C     1 
ATOM   3428 O O     . ASN D 2 69  ? -14.297 11.362  -10.741 1.00 21.76 ? 70  ASN B O     1 
ATOM   3429 C CB    . ASN D 2 69  ? -13.871 10.904  -8.011  1.00 21.79 ? 70  ASN B CB    1 
ATOM   3430 C CG    . ASN D 2 69  ? -15.268 11.288  -7.485  1.00 23.43 ? 70  ASN B CG    1 
ATOM   3431 O OD1   . ASN D 2 69  ? -15.793 12.370  -7.755  1.00 25.22 ? 70  ASN B OD1   1 
ATOM   3432 N ND2   . ASN D 2 69  ? -15.870 10.379  -6.726  1.00 26.80 ? 70  ASN B ND2   1 
ATOM   3433 H H     . ASN D 2 69  ? -14.088 13.768  -7.918  1.00 0.00  ? 70  ASN B H     1 
ATOM   3434 H HD21  . ASN D 2 69  ? -16.749 10.608  -6.360  1.00 0.00  ? 70  ASN B HD21  1 
ATOM   3435 H HD22  . ASN D 2 69  ? -15.410 9.538   -6.545  1.00 0.00  ? 70  ASN B HD22  1 
ATOM   3436 N N     . HIS D 2 70  ? -13.093 13.257  -10.861 1.00 20.07 ? 71  HIS B N     1 
ATOM   3437 C CA    . HIS D 2 70  ? -13.373 13.517  -12.285 1.00 19.64 ? 71  HIS B CA    1 
ATOM   3438 C C     . HIS D 2 70  ? -12.165 13.336  -13.190 1.00 19.23 ? 71  HIS B C     1 
ATOM   3439 O O     . HIS D 2 70  ? -11.046 13.700  -12.832 1.00 20.92 ? 71  HIS B O     1 
ATOM   3440 C CB    . HIS D 2 70  ? -13.837 14.938  -12.490 1.00 17.97 ? 71  HIS B CB    1 
ATOM   3441 C CG    . HIS D 2 70  ? -15.289 15.125  -12.261 1.00 19.45 ? 71  HIS B CG    1 
ATOM   3442 N ND1   . HIS D 2 70  ? -16.062 14.185  -11.618 1.00 18.56 ? 71  HIS B ND1   1 
ATOM   3443 C CD2   . HIS D 2 70  ? -16.118 16.145  -12.583 1.00 23.22 ? 71  HIS B CD2   1 
ATOM   3444 C CE1   . HIS D 2 70  ? -17.306 14.621  -11.551 1.00 20.33 ? 71  HIS B CE1   1 
ATOM   3445 N NE2   . HIS D 2 70  ? -17.367 15.807  -12.131 1.00 20.51 ? 71  HIS B NE2   1 
ATOM   3446 H H     . HIS D 2 70  ? -12.489 13.868  -10.383 1.00 0.00  ? 71  HIS B H     1 
ATOM   3447 H HD1   . HIS D 2 70  ? -15.755 13.325  -11.246 1.00 0.00  ? 71  HIS B HD1   1 
ATOM   3448 H HE2   . HIS D 2 70  ? -18.197 16.312  -12.286 1.00 0.00  ? 71  HIS B HE2   1 
ATOM   3449 N N     . TYR D 2 71  ? -12.395 12.788  -14.374 1.00 19.16 ? 72  TYR B N     1 
ATOM   3450 C CA    . TYR D 2 71  ? -11.343 12.628  -15.360 1.00 14.99 ? 72  TYR B CA    1 
ATOM   3451 C C     . TYR D 2 71  ? -11.422 13.909  -16.210 1.00 13.60 ? 72  TYR B C     1 
ATOM   3452 O O     . TYR D 2 71  ? -12.460 14.550  -16.243 1.00 15.07 ? 72  TYR B O     1 
ATOM   3453 C CB    . TYR D 2 71  ? -11.654 11.419  -16.219 1.00 15.41 ? 72  TYR B CB    1 
ATOM   3454 C CG    . TYR D 2 71  ? -10.862 11.317  -17.492 1.00 14.14 ? 72  TYR B CG    1 
ATOM   3455 C CD1   . TYR D 2 71  ? -11.338 11.871  -18.696 1.00 9.87  ? 72  TYR B CD1   1 
ATOM   3456 C CD2   . TYR D 2 71  ? -9.669  10.612  -17.513 1.00 12.91 ? 72  TYR B CD2   1 
ATOM   3457 C CE1   . TYR D 2 71  ? -10.622 11.704  -19.898 1.00 8.69  ? 72  TYR B CE1   1 
ATOM   3458 C CE2   . TYR D 2 71  ? -8.949  10.438  -18.693 1.00 13.65 ? 72  TYR B CE2   1 
ATOM   3459 C CZ    . TYR D 2 71  ? -9.429  10.980  -19.878 1.00 13.39 ? 72  TYR B CZ    1 
ATOM   3460 O OH    . TYR D 2 71  ? -8.700  10.767  -21.014 1.00 15.51 ? 72  TYR B OH    1 
ATOM   3461 H H     . TYR D 2 71  ? -13.291 12.466  -14.611 1.00 0.00  ? 72  TYR B H     1 
ATOM   3462 H HH    . TYR D 2 71  ? -7.924  10.245  -20.776 1.00 0.00  ? 72  TYR B HH    1 
ATOM   3463 N N     . PRO D 2 72  ? -10.288 14.396  -16.751 1.00 12.74 ? 73  PRO B N     1 
ATOM   3464 C CA    . PRO D 2 72  ? -8.912  13.878  -16.637 1.00 12.83 ? 73  PRO B CA    1 
ATOM   3465 C C     . PRO D 2 72  ? -8.156  14.782  -15.657 1.00 12.21 ? 73  PRO B C     1 
ATOM   3466 O O     . PRO D 2 72  ? -8.742  15.722  -15.103 1.00 13.55 ? 73  PRO B O     1 
ATOM   3467 C CB    . PRO D 2 72  ? -8.384  14.038  -18.062 1.00 6.60  ? 73  PRO B CB    1 
ATOM   3468 C CG    . PRO D 2 72  ? -9.049  15.353  -18.515 1.00 7.73  ? 73  PRO B CG    1 
ATOM   3469 C CD    . PRO D 2 72  ? -10.392 15.433  -17.807 1.00 10.34 ? 73  PRO B CD    1 
ATOM   3470 N N     . ASP D 2 73  ? -6.857  14.566  -15.499 1.00 12.84 ? 74  ASP B N     1 
ATOM   3471 C CA    . ASP D 2 73  ? -6.050  15.399  -14.608 1.00 11.84 ? 74  ASP B CA    1 
ATOM   3472 C C     . ASP D 2 73  ? -5.965  16.781  -15.205 1.00 11.47 ? 74  ASP B C     1 
ATOM   3473 O O     . ASP D 2 73  ? -6.117  17.782  -14.496 1.00 13.48 ? 74  ASP B O     1 
ATOM   3474 C CB    . ASP D 2 73  ? -4.643  14.818  -14.443 1.00 11.87 ? 74  ASP B CB    1 
ATOM   3475 C CG    . ASP D 2 73  ? -4.636  13.568  -13.627 1.00 10.13 ? 74  ASP B CG    1 
ATOM   3476 O OD1   . ASP D 2 73  ? -5.445  13.525  -12.707 1.00 17.21 ? 74  ASP B OD1   1 
ATOM   3477 O OD2   . ASP D 2 73  ? -3.849  12.631  -13.881 1.00 11.66 ? 74  ASP B OD2   1 
ATOM   3478 H H     . ASP D 2 73  ? -6.419  13.846  -15.983 1.00 0.00  ? 74  ASP B H     1 
ATOM   3479 N N     . PHE D 2 74  ? -5.746  16.848  -16.521 1.00 12.56 ? 75  PHE B N     1 
ATOM   3480 C CA    . PHE D 2 74  ? -5.669  18.151  -17.189 1.00 11.29 ? 75  PHE B CA    1 
ATOM   3481 C C     . PHE D 2 74  ? -6.487  18.192  -18.473 1.00 12.16 ? 75  PHE B C     1 
ATOM   3482 O O     . PHE D 2 74  ? -6.483  17.250  -19.266 1.00 9.47  ? 75  PHE B O     1 
ATOM   3483 C CB    . PHE D 2 74  ? -4.220  18.495  -17.531 1.00 13.36 ? 75  PHE B CB    1 
ATOM   3484 C CG    . PHE D 2 74  ? -3.303  18.488  -16.351 1.00 11.62 ? 75  PHE B CG    1 
ATOM   3485 C CD1   . PHE D 2 74  ? -2.684  17.308  -15.952 1.00 9.35  ? 75  PHE B CD1   1 
ATOM   3486 C CD2   . PHE D 2 74  ? -3.077  19.652  -15.611 1.00 13.88 ? 75  PHE B CD2   1 
ATOM   3487 C CE1   . PHE D 2 74  ? -1.860  17.282  -14.832 1.00 9.38  ? 75  PHE B CE1   1 
ATOM   3488 C CE2   . PHE D 2 74  ? -2.249  19.627  -14.490 1.00 11.43 ? 75  PHE B CE2   1 
ATOM   3489 C CZ    . PHE D 2 74  ? -1.645  18.438  -14.104 1.00 8.85  ? 75  PHE B CZ    1 
ATOM   3490 H H     . PHE D 2 74  ? -5.633  16.035  -17.050 1.00 0.00  ? 75  PHE B H     1 
ATOM   3491 N N     . THR D 2 75  ? -7.211  19.284  -18.652 1.00 13.85 ? 76  THR B N     1 
ATOM   3492 C CA    . THR D 2 75  ? -8.000  19.493  -19.856 1.00 18.91 ? 76  THR B CA    1 
ATOM   3493 C C     . THR D 2 75  ? -7.410  20.727  -20.553 1.00 19.82 ? 76  THR B C     1 
ATOM   3494 O O     . THR D 2 75  ? -7.355  21.804  -19.939 1.00 17.61 ? 76  THR B O     1 
ATOM   3495 C CB    . THR D 2 75  ? -9.493  19.763  -19.540 1.00 18.99 ? 76  THR B CB    1 
ATOM   3496 O OG1   . THR D 2 75  ? -10.111 18.560  -19.042 1.00 22.63 ? 76  THR B OG1   1 
ATOM   3497 C CG2   . THR D 2 75  ? -10.220 20.238  -20.813 1.00 19.55 ? 76  THR B CG2   1 
ATOM   3498 H H     . THR D 2 75  ? -7.218  19.977  -17.973 1.00 0.00  ? 76  THR B H     1 
ATOM   3499 H HG1   . THR D 2 75  ? -9.703  18.407  -18.170 1.00 0.00  ? 76  THR B HG1   1 
ATOM   3500 N N     . LEU D 2 76  ? -6.941  20.556  -21.796 1.00 19.04 ? 77  LEU B N     1 
ATOM   3501 C CA    . LEU D 2 76  ? -6.360  21.664  -22.589 1.00 20.77 ? 77  LEU B CA    1 
ATOM   3502 C C     . LEU D 2 76  ? -7.241  21.984  -23.797 1.00 22.68 ? 77  LEU B C     1 
ATOM   3503 O O     . LEU D 2 76  ? -7.671  21.072  -24.502 1.00 22.84 ? 77  LEU B O     1 
ATOM   3504 C CB    . LEU D 2 76  ? -4.984  21.287  -23.139 1.00 19.89 ? 77  LEU B CB    1 
ATOM   3505 C CG    . LEU D 2 76  ? -3.709  21.261  -22.317 1.00 19.17 ? 77  LEU B CG    1 
ATOM   3506 C CD1   . LEU D 2 76  ? -3.884  20.459  -21.049 1.00 20.08 ? 77  LEU B CD1   1 
ATOM   3507 C CD2   . LEU D 2 76  ? -2.658  20.613  -23.181 1.00 19.29 ? 77  LEU B CD2   1 
ATOM   3508 H H     . LEU D 2 76  ? -7.006  19.671  -22.211 1.00 0.00  ? 77  LEU B H     1 
ATOM   3509 N N     . TYR D 2 77  ? -7.469  23.267  -24.063 1.00 25.70 ? 78  TYR B N     1 
ATOM   3510 C CA    . TYR D 2 77  ? -8.275  23.674  -25.210 1.00 27.99 ? 78  TYR B CA    1 
ATOM   3511 C C     . TYR D 2 77  ? -8.122  25.154  -25.492 1.00 30.11 ? 78  TYR B C     1 
ATOM   3512 O O     . TYR D 2 77  ? -7.727  25.921  -24.625 1.00 30.52 ? 78  TYR B O     1 
ATOM   3513 C CB    . TYR D 2 77  ? -9.762  23.374  -24.963 1.00 27.84 ? 78  TYR B CB    1 
ATOM   3514 C CG    . TYR D 2 77  ? -10.393 24.225  -23.879 1.00 25.01 ? 78  TYR B CG    1 
ATOM   3515 C CD1   . TYR D 2 77  ? -10.263 23.882  -22.533 1.00 23.62 ? 78  TYR B CD1   1 
ATOM   3516 C CD2   . TYR D 2 77  ? -11.076 25.396  -24.203 1.00 24.37 ? 78  TYR B CD2   1 
ATOM   3517 C CE1   . TYR D 2 77  ? -10.788 24.682  -21.546 1.00 25.84 ? 78  TYR B CE1   1 
ATOM   3518 C CE2   . TYR D 2 77  ? -11.602 26.208  -23.221 1.00 27.06 ? 78  TYR B CE2   1 
ATOM   3519 C CZ    . TYR D 2 77  ? -11.453 25.845  -21.893 1.00 27.98 ? 78  TYR B CZ    1 
ATOM   3520 O OH    . TYR D 2 77  ? -11.950 26.665  -20.918 1.00 29.91 ? 78  TYR B OH    1 
ATOM   3521 H H     . TYR D 2 77  ? -7.100  23.955  -23.463 1.00 0.00  ? 78  TYR B H     1 
ATOM   3522 H HH    . TYR D 2 77  ? -12.430 27.391  -21.323 1.00 0.00  ? 78  TYR B HH    1 
ATOM   3523 N N     . LYS D 2 78  ? -8.447  25.557  -26.712 1.00 33.44 ? 79  LYS B N     1 
ATOM   3524 C CA    . LYS D 2 78  ? -8.397  26.967  -27.086 1.00 34.43 ? 79  LYS B CA    1 
ATOM   3525 C C     . LYS D 2 78  ? -9.856  27.374  -27.003 1.00 34.54 ? 79  LYS B C     1 
ATOM   3526 O O     . LYS D 2 78  ? -10.720 26.674  -27.507 1.00 31.88 ? 79  LYS B O     1 
ATOM   3527 C CB    . LYS D 2 78  ? -7.855  27.123  -28.497 1.00 35.10 ? 79  LYS B CB    1 
ATOM   3528 C CG    . LYS D 2 78  ? -6.504  26.427  -28.709 1.00 37.99 ? 79  LYS B CG    1 
ATOM   3529 C CD    . LYS D 2 78  ? -5.586  27.268  -29.612 1.00 40.91 ? 79  LYS B CD    1 
ATOM   3530 C CE    . LYS D 2 78  ? -5.075  26.505  -30.844 1.00 43.55 ? 79  LYS B CE    1 
ATOM   3531 N NZ    . LYS D 2 78  ? -4.101  27.369  -31.601 1.00 46.40 ? 79  LYS B NZ    1 
ATOM   3532 H H     . LYS D 2 78  ? -8.766  24.906  -27.372 1.00 0.00  ? 79  LYS B H     1 
ATOM   3533 H HZ1   . LYS D 2 78  ? -4.573  28.247  -31.900 1.00 0.00  ? 79  LYS B HZ1   1 
ATOM   3534 H HZ2   . LYS D 2 78  ? -3.293  27.605  -30.990 1.00 0.00  ? 79  LYS B HZ2   1 
ATOM   3535 H HZ3   . LYS D 2 78  ? -3.760  26.859  -32.442 1.00 0.00  ? 79  LYS B HZ3   1 
ATOM   3536 N N     . PRO D 2 79  ? -10.161 28.481  -26.318 1.00 37.27 ? 80  PRO B N     1 
ATOM   3537 C CA    . PRO D 2 79  ? -11.550 28.940  -26.174 1.00 39.96 ? 80  PRO B CA    1 
ATOM   3538 C C     . PRO D 2 79  ? -12.314 29.055  -27.473 1.00 41.39 ? 80  PRO B C     1 
ATOM   3539 O O     . PRO D 2 79  ? -13.540 29.105  -27.469 1.00 41.84 ? 80  PRO B O     1 
ATOM   3540 C CB    . PRO D 2 79  ? -11.396 30.294  -25.484 1.00 40.32 ? 80  PRO B CB    1 
ATOM   3541 C CG    . PRO D 2 79  ? -10.190 30.077  -24.634 1.00 40.73 ? 80  PRO B CG    1 
ATOM   3542 C CD    . PRO D 2 79  ? -9.242  29.379  -25.601 1.00 39.69 ? 80  PRO B CD    1 
ATOM   3543 N N     . SER D 2 80  ? -11.574 29.093  -28.575 1.00 43.65 ? 81  SER B N     1 
ATOM   3544 C CA    . SER D 2 80  ? -12.128 29.191  -29.919 1.00 44.00 ? 81  SER B CA    1 
ATOM   3545 C C     . SER D 2 80  ? -12.702 27.857  -30.418 1.00 44.55 ? 81  SER B C     1 
ATOM   3546 O O     . SER D 2 80  ? -13.781 27.832  -31.008 1.00 46.32 ? 81  SER B O     1 
ATOM   3547 C CB    . SER D 2 80  ? -11.038 29.699  -30.872 1.00 44.34 ? 81  SER B CB    1 
ATOM   3548 O OG    . SER D 2 80  ? -9.743  29.226  -30.492 1.00 44.10 ? 81  SER B OG    1 
ATOM   3549 H H     . SER D 2 80  ? -10.600 29.064  -28.531 1.00 0.00  ? 81  SER B H     1 
ATOM   3550 H HG    . SER D 2 80  ? -9.105  29.522  -31.153 1.00 0.00  ? 81  SER B HG    1 
ATOM   3551 N N     . GLU D 2 81  ? -11.978 26.759  -30.183 1.00 44.18 ? 82  GLU B N     1 
ATOM   3552 C CA    . GLU D 2 81  ? -12.406 25.424  -30.606 1.00 44.22 ? 82  GLU B CA    1 
ATOM   3553 C C     . GLU D 2 81  ? -12.748 24.511  -29.416 1.00 41.65 ? 82  GLU B C     1 
ATOM   3554 O O     . GLU D 2 81  ? -11.977 23.636  -29.056 1.00 40.40 ? 82  GLU B O     1 
ATOM   3555 C CB    . GLU D 2 81  ? -11.320 24.787  -31.466 1.00 47.36 ? 82  GLU B CB    1 
ATOM   3556 C CG    . GLU D 2 81  ? -11.096 25.502  -32.789 1.00 55.04 ? 82  GLU B CG    1 
ATOM   3557 C CD    . GLU D 2 81  ? -11.283 24.585  -33.997 1.00 60.36 ? 82  GLU B CD    1 
ATOM   3558 O OE1   . GLU D 2 81  ? -12.441 24.161  -34.265 1.00 62.10 ? 82  GLU B OE1   1 
ATOM   3559 O OE2   . GLU D 2 81  ? -10.266 24.292  -34.678 1.00 64.07 ? 82  GLU B OE2   1 
ATOM   3560 H H     . GLU D 2 81  ? -11.147 26.844  -29.672 1.00 0.00  ? 82  GLU B H     1 
ATOM   3561 N N     . PRO D 2 82  ? -13.958 24.656  -28.850 1.00 41.05 ? 83  PRO B N     1 
ATOM   3562 C CA    . PRO D 2 82  ? -14.477 23.895  -27.703 1.00 38.30 ? 83  PRO B CA    1 
ATOM   3563 C C     . PRO D 2 82  ? -14.535 22.395  -27.860 1.00 36.31 ? 83  PRO B C     1 
ATOM   3564 O O     . PRO D 2 82  ? -14.534 21.694  -26.861 1.00 38.02 ? 83  PRO B O     1 
ATOM   3565 C CB    . PRO D 2 82  ? -15.898 24.418  -27.548 1.00 40.10 ? 83  PRO B CB    1 
ATOM   3566 C CG    . PRO D 2 82  ? -15.823 25.793  -28.131 1.00 43.21 ? 83  PRO B CG    1 
ATOM   3567 C CD    . PRO D 2 82  ? -14.987 25.579  -29.357 1.00 41.88 ? 83  PRO B CD    1 
ATOM   3568 N N     . ASN D 2 83  ? -14.644 21.901  -29.094 1.00 32.72 ? 84  ASN B N     1 
ATOM   3569 C CA    . ASN D 2 83  ? -14.750 20.460  -29.336 1.00 29.25 ? 84  ASN B CA    1 
ATOM   3570 C C     . ASN D 2 83  ? -13.501 19.796  -29.767 1.00 26.54 ? 84  ASN B C     1 
ATOM   3571 O O     . ASN D 2 83  ? -13.533 18.677  -30.275 1.00 25.37 ? 84  ASN B O     1 
ATOM   3572 C CB    . ASN D 2 83  ? -15.850 20.121  -30.323 1.00 31.72 ? 84  ASN B CB    1 
ATOM   3573 C CG    . ASN D 2 83  ? -17.195 20.338  -29.746 1.00 31.19 ? 84  ASN B CG    1 
ATOM   3574 O OD1   . ASN D 2 83  ? -17.884 19.385  -29.370 1.00 34.91 ? 84  ASN B OD1   1 
ATOM   3575 N ND2   . ASN D 2 83  ? -17.581 21.603  -29.621 1.00 32.37 ? 84  ASN B ND2   1 
ATOM   3576 H H     . ASN D 2 83  ? -14.625 22.509  -29.860 1.00 0.00  ? 84  ASN B H     1 
ATOM   3577 H HD21  . ASN D 2 83  ? -18.464 21.756  -29.229 1.00 0.00  ? 84  ASN B HD21  1 
ATOM   3578 H HD22  . ASN D 2 83  ? -16.985 22.315  -29.923 1.00 0.00  ? 84  ASN B HD22  1 
ATOM   3579 N N     . LYS D 2 84  ? -12.399 20.507  -29.613 1.00 26.06 ? 85  LYS B N     1 
ATOM   3580 C CA    . LYS D 2 84  ? -11.103 19.945  -29.927 1.00 25.87 ? 85  LYS B CA    1 
ATOM   3581 C C     . LYS D 2 84  ? -10.271 19.993  -28.616 1.00 23.40 ? 85  LYS B C     1 
ATOM   3582 O O     . LYS D 2 84  ? -9.134  20.461  -28.600 1.00 21.69 ? 85  LYS B O     1 
ATOM   3583 C CB    . LYS D 2 84  ? -10.447 20.726  -31.064 1.00 29.83 ? 85  LYS B CB    1 
ATOM   3584 C CG    . LYS D 2 84  ? -11.251 20.746  -32.385 1.00 31.66 ? 85  LYS B CG    1 
ATOM   3585 C CD    . LYS D 2 84  ? -11.534 19.338  -32.927 1.00 33.57 ? 85  LYS B CD    1 
ATOM   3586 C CE    . LYS D 2 84  ? -12.553 19.363  -34.105 1.00 38.64 ? 85  LYS B CE    1 
ATOM   3587 N NZ    . LYS D 2 84  ? -13.153 18.013  -34.430 1.00 36.67 ? 85  LYS B NZ    1 
ATOM   3588 H H     . LYS D 2 84  ? -12.420 21.421  -29.257 1.00 0.00  ? 85  LYS B H     1 
ATOM   3589 H HZ1   . LYS D 2 84  ? -13.638 17.640  -33.590 1.00 0.00  ? 85  LYS B HZ1   1 
ATOM   3590 H HZ2   . LYS D 2 84  ? -13.838 18.114  -35.206 1.00 0.00  ? 85  LYS B HZ2   1 
ATOM   3591 H HZ3   . LYS D 2 84  ? -12.398 17.358  -34.717 1.00 0.00  ? 85  LYS B HZ3   1 
ATOM   3592 N N     . LYS D 2 85  ? -10.890 19.525  -27.522 1.00 20.00 ? 86  LYS B N     1 
ATOM   3593 C CA    . LYS D 2 85  ? -10.276 19.477  -26.203 1.00 16.20 ? 86  LYS B CA    1 
ATOM   3594 C C     . LYS D 2 85  ? -9.371  18.293  -26.092 1.00 15.16 ? 86  LYS B C     1 
ATOM   3595 O O     . LYS D 2 85  ? -9.603  17.238  -26.704 1.00 14.00 ? 86  LYS B O     1 
ATOM   3596 C CB    . LYS D 2 85  ? -11.315 19.332  -25.110 1.00 13.25 ? 86  LYS B CB    1 
ATOM   3597 C CG    . LYS D 2 85  ? -12.098 20.562  -24.853 1.00 14.66 ? 86  LYS B CG    1 
ATOM   3598 C CD    . LYS D 2 85  ? -12.834 20.428  -23.544 1.00 13.22 ? 86  LYS B CD    1 
ATOM   3599 C CE    . LYS D 2 85  ? -13.561 21.712  -23.248 1.00 12.70 ? 86  LYS B CE    1 
ATOM   3600 N NZ    . LYS D 2 85  ? -14.593 21.847  -24.269 1.00 16.30 ? 86  LYS B NZ    1 
ATOM   3601 H H     . LYS D 2 85  ? -11.806 19.180  -27.606 1.00 0.00  ? 86  LYS B H     1 
ATOM   3602 H HZ1   . LYS D 2 85  ? -15.137 20.964  -24.323 1.00 0.00  ? 86  LYS B HZ1   1 
ATOM   3603 H HZ2   . LYS D 2 85  ? -15.240 22.612  -24.046 1.00 0.00  ? 86  LYS B HZ2   1 
ATOM   3604 H HZ3   . LYS D 2 85  ? -14.125 22.034  -25.171 1.00 0.00  ? 86  LYS B HZ3   1 
ATOM   3605 N N     . ILE D 2 86  ? -8.320  18.471  -25.305 1.00 14.07 ? 87  ILE B N     1 
ATOM   3606 C CA    . ILE D 2 86  ? -7.375  17.404  -25.081 1.00 14.45 ? 87  ILE B CA    1 
ATOM   3607 C C     . ILE D 2 86  ? -7.398  17.003  -23.587 1.00 14.64 ? 87  ILE B C     1 
ATOM   3608 O O     . ILE D 2 86  ? -7.556  17.858  -22.691 1.00 14.42 ? 87  ILE B O     1 
ATOM   3609 C CB    . ILE D 2 86  ? -5.963  17.811  -25.551 1.00 14.21 ? 87  ILE B CB    1 
ATOM   3610 C CG1   . ILE D 2 86  ? -6.002  18.094  -27.056 1.00 16.18 ? 87  ILE B CG1   1 
ATOM   3611 C CG2   . ILE D 2 86  ? -4.947  16.703  -25.258 1.00 11.04 ? 87  ILE B CG2   1 
ATOM   3612 C CD1   . ILE D 2 86  ? -4.805  18.852  -27.560 1.00 17.93 ? 87  ILE B CD1   1 
ATOM   3613 H H     . ILE D 2 86  ? -8.187  19.321  -24.849 1.00 0.00  ? 87  ILE B H     1 
ATOM   3614 N N     . ALA D 2 87  ? -7.307  15.693  -23.362 1.00 13.64 ? 88  ALA B N     1 
ATOM   3615 C CA    . ALA D 2 87  ? -7.277  15.124  -22.030 1.00 14.87 ? 88  ALA B CA    1 
ATOM   3616 C C     . ALA D 2 87  ? -5.936  14.502  -21.726 1.00 13.51 ? 88  ALA B C     1 
ATOM   3617 O O     . ALA D 2 87  ? -5.417  13.702  -22.494 1.00 11.36 ? 88  ALA B O     1 
ATOM   3618 C CB    . ALA D 2 87  ? -8.340  14.071  -21.884 1.00 14.20 ? 88  ALA B CB    1 
ATOM   3619 H H     . ALA D 2 87  ? -7.225  15.080  -24.120 1.00 0.00  ? 88  ALA B H     1 
ATOM   3620 N N     . ILE D 2 88  ? -5.376  14.873  -20.573 1.00 17.12 ? 89  ILE B N     1 
ATOM   3621 C CA    . ILE D 2 88  ? -4.110  14.287  -20.140 1.00 16.07 ? 89  ILE B CA    1 
ATOM   3622 C C     . ILE D 2 88  ? -4.262  13.715  -18.727 1.00 12.77 ? 89  ILE B C     1 
ATOM   3623 O O     . ILE D 2 88  ? -4.736  14.391  -17.793 1.00 11.00 ? 89  ILE B O     1 
ATOM   3624 C CB    . ILE D 2 88  ? -2.908  15.293  -20.137 1.00 16.59 ? 89  ILE B CB    1 
ATOM   3625 C CG1   . ILE D 2 88  ? -2.960  16.282  -21.321 1.00 18.64 ? 89  ILE B CG1   1 
ATOM   3626 C CG2   . ILE D 2 88  ? -1.603  14.503  -20.212 1.00 19.70 ? 89  ILE B CG2   1 
ATOM   3627 C CD1   . ILE D 2 88  ? -1.672  17.135  -21.462 1.00 14.69 ? 89  ILE B CD1   1 
ATOM   3628 H H     . ILE D 2 88  ? -5.821  15.539  -20.008 1.00 0.00  ? 89  ILE B H     1 
ATOM   3629 N N     . ASP D 2 89  ? -3.897  12.452  -18.599 1.00 13.14 ? 90  ASP B N     1 
ATOM   3630 C CA    . ASP D 2 89  ? -3.925  11.745  -17.325 1.00 14.27 ? 90  ASP B CA    1 
ATOM   3631 C C     . ASP D 2 89  ? -2.503  11.276  -17.017 1.00 11.63 ? 90  ASP B C     1 
ATOM   3632 O O     . ASP D 2 89  ? -1.821  10.734  -17.892 1.00 11.22 ? 90  ASP B O     1 
ATOM   3633 C CB    . ASP D 2 89  ? -4.817  10.497  -17.433 1.00 14.91 ? 90  ASP B CB    1 
ATOM   3634 C CG    . ASP D 2 89  ? -5.959  10.491  -16.441 1.00 12.02 ? 90  ASP B CG    1 
ATOM   3635 O OD1   . ASP D 2 89  ? -6.314  11.557  -15.879 1.00 13.69 ? 90  ASP B OD1   1 
ATOM   3636 O OD2   . ASP D 2 89  ? -6.532  9.402   -16.273 1.00 18.17 ? 90  ASP B OD2   1 
ATOM   3637 H H     . ASP D 2 89  ? -3.580  11.973  -19.398 1.00 0.00  ? 90  ASP B H     1 
ATOM   3638 N N     . ILE D 2 90  ? -2.089  11.426  -15.759 1.00 13.16 ? 91  ILE B N     1 
ATOM   3639 C CA    . ILE D 2 90  ? -0.757  10.990  -15.306 1.00 12.17 ? 91  ILE B CA    1 
ATOM   3640 C C     . ILE D 2 90  ? -0.874  9.649   -14.583 1.00 12.13 ? 91  ILE B C     1 
ATOM   3641 O O     . ILE D 2 90  ? -1.703  9.518   -13.714 1.00 16.06 ? 91  ILE B O     1 
ATOM   3642 C CB    . ILE D 2 90  ? -0.093  12.089  -14.444 1.00 14.85 ? 91  ILE B CB    1 
ATOM   3643 C CG1   . ILE D 2 90  ? -0.047  13.372  -15.288 1.00 12.10 ? 91  ILE B CG1   1 
ATOM   3644 C CG2   . ILE D 2 90  ? 1.317   11.644  -13.971 1.00 13.11 ? 91  ILE B CG2   1 
ATOM   3645 C CD1   . ILE D 2 90  ? 0.470   14.544  -14.609 1.00 20.51 ? 91  ILE B CD1   1 
ATOM   3646 H H     . ILE D 2 90  ? -2.689  11.773  -15.101 1.00 0.00  ? 91  ILE B H     1 
ATOM   3647 N N     . LYS D 2 91  ? -0.084  8.652   -14.988 1.00 10.52 ? 92  LYS B N     1 
ATOM   3648 C CA    . LYS D 2 91  ? -0.093  7.300   -14.424 1.00 12.44 ? 92  LYS B CA    1 
ATOM   3649 C C     . LYS D 2 91  ? 1.302   6.892   -13.960 1.00 14.58 ? 92  LYS B C     1 
ATOM   3650 O O     . LYS D 2 91  ? 2.294   7.122   -14.636 1.00 16.89 ? 92  LYS B O     1 
ATOM   3651 C CB    . LYS D 2 91  ? -0.590  6.289   -15.468 1.00 14.87 ? 92  LYS B CB    1 
ATOM   3652 C CG    . LYS D 2 91  ? -1.960  6.610   -16.014 1.00 13.32 ? 92  LYS B CG    1 
ATOM   3653 C CD    . LYS D 2 91  ? -3.029  6.281   -14.985 1.00 19.54 ? 92  LYS B CD    1 
ATOM   3654 C CE    . LYS D 2 91  ? -4.352  6.905   -15.381 1.00 20.27 ? 92  LYS B CE    1 
ATOM   3655 N NZ    . LYS D 2 91  ? -5.434  6.779   -14.386 1.00 20.81 ? 92  LYS B NZ    1 
ATOM   3656 H H     . LYS D 2 91  ? 0.575   8.826   -15.694 1.00 0.00  ? 92  LYS B H     1 
ATOM   3657 H HZ1   . LYS D 2 91  ? -5.135  7.205   -13.485 1.00 0.00  ? 92  LYS B HZ1   1 
ATOM   3658 H HZ2   . LYS D 2 91  ? -6.280  7.269   -14.740 1.00 0.00  ? 92  LYS B HZ2   1 
ATOM   3659 H HZ3   . LYS D 2 91  ? -5.651  5.773   -14.240 1.00 0.00  ? 92  LYS B HZ3   1 
ATOM   3660 N N     . THR D 2 92  ? 1.355   6.123   -12.888 1.00 15.00 ? 93  THR B N     1 
ATOM   3661 C CA    . THR D 2 92  ? 2.625   5.755   -12.300 1.00 15.94 ? 93  THR B CA    1 
ATOM   3662 C C     . THR D 2 92  ? 2.650   4.298   -11.933 1.00 15.84 ? 93  THR B C     1 
ATOM   3663 O O     . THR D 2 92  ? 1.631   3.719   -11.603 1.00 19.12 ? 93  THR B O     1 
ATOM   3664 C CB    . THR D 2 92  ? 2.880   6.636   -11.008 1.00 17.30 ? 93  THR B CB    1 
ATOM   3665 O OG1   . THR D 2 92  ? 2.823   8.032   -11.356 1.00 16.96 ? 93  THR B OG1   1 
ATOM   3666 C CG2   . THR D 2 92  ? 4.243   6.354   -10.383 1.00 16.51 ? 93  THR B CG2   1 
ATOM   3667 H H     . THR D 2 92  ? 0.546   5.774   -12.461 1.00 0.00  ? 93  THR B H     1 
ATOM   3668 H HG1   . THR D 2 92  ? 2.949   8.549   -10.558 1.00 0.00  ? 93  THR B HG1   1 
ATOM   3669 N N     . THR D 2 93  ? 3.825   3.703   -12.034 1.00 16.55 ? 94  THR B N     1 
ATOM   3670 C CA    . THR D 2 93  ? 4.025   2.326   -11.673 1.00 18.50 ? 94  THR B CA    1 
ATOM   3671 C C     . THR D 2 93  ? 5.525   2.243   -11.414 1.00 19.86 ? 94  THR B C     1 
ATOM   3672 O O     . THR D 2 93  ? 6.237   3.168   -11.742 1.00 20.04 ? 94  THR B O     1 
ATOM   3673 C CB    . THR D 2 93  ? 3.582   1.357   -12.797 1.00 17.42 ? 94  THR B CB    1 
ATOM   3674 O OG1   . THR D 2 93  ? 3.578   0.020   -12.283 1.00 18.71 ? 94  THR B OG1   1 
ATOM   3675 C CG2   . THR D 2 93  ? 4.526   1.425   -13.985 1.00 15.93 ? 94  THR B CG2   1 
ATOM   3676 H H     . THR D 2 93  ? 4.598   4.206   -12.381 1.00 0.00  ? 94  THR B H     1 
ATOM   3677 H HG1   . THR D 2 93  ? 3.148   -0.536  -12.957 1.00 0.00  ? 94  THR B HG1   1 
ATOM   3678 N N     . TYR D 2 94  ? 6.006   1.120   -10.892 1.00 22.46 ? 95  TYR B N     1 
ATOM   3679 C CA    . TYR D 2 94  ? 7.412   0.978   -10.572 1.00 24.29 ? 95  TYR B CA    1 
ATOM   3680 C C     . TYR D 2 94  ? 8.021   -0.313  -11.132 1.00 25.95 ? 95  TYR B C     1 
ATOM   3681 O O     . TYR D 2 94  ? 7.319   -1.208  -11.616 1.00 25.37 ? 95  TYR B O     1 
ATOM   3682 C CB    . TYR D 2 94  ? 7.575   0.988   -9.022  1.00 27.36 ? 95  TYR B CB    1 
ATOM   3683 C CG    . TYR D 2 94  ? 7.116   -0.313  -8.370  1.00 28.27 ? 95  TYR B CG    1 
ATOM   3684 C CD1   . TYR D 2 94  ? 5.764   -0.552  -8.136  1.00 27.48 ? 95  TYR B CD1   1 
ATOM   3685 C CD2   . TYR D 2 94  ? 8.006   -1.387  -8.229  1.00 29.67 ? 95  TYR B CD2   1 
ATOM   3686 C CE1   . TYR D 2 94  ? 5.304   -1.817  -7.823  1.00 31.68 ? 95  TYR B CE1   1 
ATOM   3687 C CE2   . TYR D 2 94  ? 7.564   -2.654  -7.918  1.00 33.30 ? 95  TYR B CE2   1 
ATOM   3688 C CZ    . TYR D 2 94  ? 6.208   -2.870  -7.732  1.00 33.91 ? 95  TYR B CZ    1 
ATOM   3689 O OH    . TYR D 2 94  ? 5.749   -4.162  -7.582  1.00 38.62 ? 95  TYR B OH    1 
ATOM   3690 H H     . TYR D 2 94  ? 5.397   0.360   -10.761 1.00 0.00  ? 95  TYR B H     1 
ATOM   3691 H HH    . TYR D 2 94  ? 6.495   -4.775  -7.592  1.00 0.00  ? 95  TYR B HH    1 
ATOM   3692 N N     . THR D 2 95  ? 9.340   -0.403  -11.025 1.00 28.72 ? 96  THR B N     1 
ATOM   3693 C CA    . THR D 2 95  ? 10.091  -1.585  -11.411 1.00 32.14 ? 96  THR B CA    1 
ATOM   3694 C C     . THR D 2 95  ? 11.061  -1.858  -10.283 1.00 34.49 ? 96  THR B C     1 
ATOM   3695 O O     . THR D 2 95  ? 11.377  -0.966  -9.493  1.00 33.21 ? 96  THR B O     1 
ATOM   3696 C CB    . THR D 2 95  ? 10.915  -1.384  -12.650 1.00 32.50 ? 96  THR B CB    1 
ATOM   3697 O OG1   . THR D 2 95  ? 11.043  0.015   -12.928 1.00 35.97 ? 96  THR B OG1   1 
ATOM   3698 C CG2   . THR D 2 95  ? 10.282  -2.112  -13.797 1.00 33.93 ? 96  THR B CG2   1 
ATOM   3699 H H     . THR D 2 95  ? 9.834   0.351   -10.645 1.00 0.00  ? 96  THR B H     1 
ATOM   3700 H HG1   . THR D 2 95  ? 11.068  0.531   -12.116 1.00 0.00  ? 96  THR B HG1   1 
ATOM   3701 N N     . ASN D 2 96  ? 11.506  -3.106  -10.188 1.00 39.36 ? 97  ASN B N     1 
ATOM   3702 C CA    . ASN D 2 96  ? 12.457  -3.517  -9.150  1.00 39.45 ? 97  ASN B CA    1 
ATOM   3703 C C     . ASN D 2 96  ? 13.866  -3.585  -9.743  1.00 39.58 ? 97  ASN B C     1 
ATOM   3704 O O     . ASN D 2 96  ? 14.041  -3.654  -10.972 1.00 40.60 ? 97  ASN B O     1 
ATOM   3705 C CB    . ASN D 2 96  ? 12.065  -4.888  -8.571  1.00 42.25 ? 97  ASN B CB    1 
ATOM   3706 C CG    . ASN D 2 96  ? 10.648  -4.910  -7.974  1.00 46.08 ? 97  ASN B CG    1 
ATOM   3707 O OD1   . ASN D 2 96  ? 9.680   -5.292  -8.641  1.00 46.04 ? 97  ASN B OD1   1 
ATOM   3708 N ND2   . ASN D 2 96  ? 10.530  -4.520  -6.711  1.00 47.89 ? 97  ASN B ND2   1 
ATOM   3709 H H     . ASN D 2 96  ? 11.210  -3.777  -10.838 1.00 0.00  ? 97  ASN B H     1 
ATOM   3710 H HD21  . ASN D 2 96  ? 9.634   -4.542  -6.318  1.00 0.00  ? 97  ASN B HD21  1 
ATOM   3711 H HD22  . ASN D 2 96  ? 11.329  -4.234  -6.224  1.00 0.00  ? 97  ASN B HD22  1 
ATOM   3712 N N     . LYS D 2 101 ? 9.260   -5.140  -17.820 1.00 30.80 ? 102 LYS B N     1 
ATOM   3713 C CA    . LYS D 2 101 ? 7.821   -5.150  -18.120 1.00 28.59 ? 102 LYS B CA    1 
ATOM   3714 C C     . LYS D 2 101 ? 6.981   -4.487  -17.048 1.00 26.75 ? 102 LYS B C     1 
ATOM   3715 O O     . LYS D 2 101 ? 6.972   -4.916  -15.898 1.00 26.32 ? 102 LYS B O     1 
ATOM   3716 C CB    . LYS D 2 101 ? 7.295   -6.562  -18.345 1.00 32.03 ? 102 LYS B CB    1 
ATOM   3717 C CG    . LYS D 2 101 ? 7.601   -7.124  -19.732 1.00 35.07 ? 102 LYS B CG    1 
ATOM   3718 C CD    . LYS D 2 101 ? 6.816   -8.380  -19.976 1.00 37.27 ? 102 LYS B CD    1 
ATOM   3719 C CE    . LYS D 2 101 ? 7.092   -8.917  -21.344 1.00 39.05 ? 102 LYS B CE    1 
ATOM   3720 N NZ    . LYS D 2 101 ? 6.247   -10.129 -21.557 1.00 43.02 ? 102 LYS B NZ    1 
ATOM   3721 H H     . LYS D 2 101 ? 9.485   -5.098  -16.862 1.00 0.00  ? 102 LYS B H     1 
ATOM   3722 H HZ1   . LYS D 2 101 ? 6.479   -10.838 -20.833 1.00 0.00  ? 102 LYS B HZ1   1 
ATOM   3723 H HZ2   . LYS D 2 101 ? 5.244   -9.867  -21.473 1.00 0.00  ? 102 LYS B HZ2   1 
ATOM   3724 H HZ3   . LYS D 2 101 ? 6.431   -10.519 -22.503 1.00 0.00  ? 102 LYS B HZ3   1 
ATOM   3725 N N     . ILE D 2 102 ? 6.250   -3.463  -17.450 1.00 24.43 ? 103 ILE B N     1 
ATOM   3726 C CA    . ILE D 2 102 ? 5.392   -2.704  -16.555 1.00 22.46 ? 103 ILE B CA    1 
ATOM   3727 C C     . ILE D 2 102 ? 3.946   -2.734  -17.083 1.00 21.57 ? 103 ILE B C     1 
ATOM   3728 O O     . ILE D 2 102 ? 3.690   -3.264  -18.175 1.00 19.32 ? 103 ILE B O     1 
ATOM   3729 C CB    . ILE D 2 102 ? 5.892   -1.262  -16.490 1.00 20.03 ? 103 ILE B CB    1 
ATOM   3730 C CG1   . ILE D 2 102 ? 6.007   -0.712  -17.912 1.00 20.37 ? 103 ILE B CG1   1 
ATOM   3731 C CG2   . ILE D 2 102 ? 7.238   -1.250  -15.858 1.00 23.63 ? 103 ILE B CG2   1 
ATOM   3732 C CD1   . ILE D 2 102 ? 6.567   0.639   -18.039 1.00 21.24 ? 103 ILE B CD1   1 
ATOM   3733 H H     . ILE D 2 102 ? 6.250   -3.195  -18.383 1.00 0.00  ? 103 ILE B H     1 
ATOM   3734 N N     . LYS D 2 103 ? 3.010   -2.237  -16.276 1.00 19.47 ? 104 LYS B N     1 
ATOM   3735 C CA    . LYS D 2 103 ? 1.605   -2.168  -16.643 1.00 17.66 ? 104 LYS B CA    1 
ATOM   3736 C C     . LYS D 2 103 ? 1.008   -1.030  -15.855 1.00 15.80 ? 104 LYS B C     1 
ATOM   3737 O O     . LYS D 2 103 ? 1.515   -0.687  -14.810 1.00 16.92 ? 104 LYS B O     1 
ATOM   3738 C CB    . LYS D 2 103 ? 0.878   -3.484  -16.342 1.00 19.92 ? 104 LYS B CB    1 
ATOM   3739 C CG    . LYS D 2 103 ? 0.825   -3.893  -14.914 1.00 25.60 ? 104 LYS B CG    1 
ATOM   3740 C CD    . LYS D 2 103 ? -0.007  -5.146  -14.795 1.00 30.19 ? 104 LYS B CD    1 
ATOM   3741 C CE    . LYS D 2 103 ? 0.093   -5.738  -13.402 1.00 30.92 ? 104 LYS B CE    1 
ATOM   3742 N NZ    . LYS D 2 103 ? -0.133  -7.208  -13.469 1.00 34.99 ? 104 LYS B NZ    1 
ATOM   3743 H H     . LYS D 2 103 ? 3.263   -1.906  -15.380 1.00 0.00  ? 104 LYS B H     1 
ATOM   3744 H HZ1   . LYS D 2 103 ? 0.588   -7.631  -14.090 1.00 0.00  ? 104 LYS B HZ1   1 
ATOM   3745 H HZ2   . LYS D 2 103 ? -0.052  -7.613  -12.514 1.00 0.00  ? 104 LYS B HZ2   1 
ATOM   3746 H HZ3   . LYS D 2 103 ? -1.080  -7.399  -13.853 1.00 0.00  ? 104 LYS B HZ3   1 
ATOM   3747 N N     . PHE D 2 104 ? 0.004   -0.379  -16.412 1.00 14.11 ? 105 PHE B N     1 
ATOM   3748 C CA    . PHE D 2 104 ? -0.640  0.744   -15.776 1.00 14.74 ? 105 PHE B CA    1 
ATOM   3749 C C     . PHE D 2 104 ? -2.144  0.433   -15.636 1.00 15.12 ? 105 PHE B C     1 
ATOM   3750 O O     . PHE D 2 104 ? -2.606  -0.550  -16.165 1.00 15.36 ? 105 PHE B O     1 
ATOM   3751 C CB    . PHE D 2 104 ? -0.461  2.001   -16.647 1.00 16.69 ? 105 PHE B CB    1 
ATOM   3752 C CG    . PHE D 2 104 ? 0.968   2.497   -16.748 1.00 19.10 ? 105 PHE B CG    1 
ATOM   3753 C CD1   . PHE D 2 104 ? 1.813   2.035   -17.750 1.00 15.01 ? 105 PHE B CD1   1 
ATOM   3754 C CD2   . PHE D 2 104 ? 1.455   3.439   -15.842 1.00 18.07 ? 105 PHE B CD2   1 
ATOM   3755 C CE1   . PHE D 2 104 ? 3.128   2.496   -17.853 1.00 16.38 ? 105 PHE B CE1   1 
ATOM   3756 C CE2   . PHE D 2 104 ? 2.770   3.911   -15.933 1.00 17.93 ? 105 PHE B CE2   1 
ATOM   3757 C CZ    . PHE D 2 104 ? 3.614   3.436   -16.946 1.00 16.81 ? 105 PHE B CZ    1 
ATOM   3758 H H     . PHE D 2 104 ? -0.326  -0.671  -17.289 1.00 0.00  ? 105 PHE B H     1 
ATOM   3759 N N     . THR D 2 105 ? -2.862  1.218   -14.840 1.00 13.18 ? 106 THR B N     1 
ATOM   3760 C CA    . THR D 2 105 ? -4.300  1.079   -14.662 1.00 13.63 ? 106 THR B CA    1 
ATOM   3761 C C     . THR D 2 105 ? -4.710  2.361   -15.335 1.00 13.48 ? 106 THR B C     1 
ATOM   3762 O O     . THR D 2 105 ? -4.282  3.433   -14.942 1.00 16.22 ? 106 THR B O     1 
ATOM   3763 C CB    . THR D 2 105 ? -4.765  1.022   -13.163 1.00 10.82 ? 106 THR B CB    1 
ATOM   3764 O OG1   . THR D 2 105 ? -4.069  1.979   -12.359 1.00 12.46 ? 106 THR B OG1   1 
ATOM   3765 C CG2   . THR D 2 105 ? -4.537  -0.331  -12.608 1.00 9.75  ? 106 THR B CG2   1 
ATOM   3766 H H     . THR D 2 105 ? -2.418  1.951   -14.356 1.00 0.00  ? 106 THR B H     1 
ATOM   3767 H HG1   . THR D 2 105 ? -4.266  2.878   -12.677 1.00 0.00  ? 106 THR B HG1   1 
ATOM   3768 N N     . LEU D 2 106 ? -5.494  2.238   -16.396 1.00 14.65 ? 107 LEU B N     1 
ATOM   3769 C CA    . LEU D 2 106 ? -5.871  3.372   -17.221 1.00 14.05 ? 107 LEU B CA    1 
ATOM   3770 C C     . LEU D 2 106 ? -7.212  4.055   -17.038 1.00 15.37 ? 107 LEU B C     1 
ATOM   3771 O O     . LEU D 2 106 ? -7.712  4.660   -17.963 1.00 18.40 ? 107 LEU B O     1 
ATOM   3772 C CB    . LEU D 2 106 ? -5.688  2.966   -18.686 1.00 18.07 ? 107 LEU B CB    1 
ATOM   3773 C CG    . LEU D 2 106 ? -4.250  2.504   -18.997 1.00 19.25 ? 107 LEU B CG    1 
ATOM   3774 C CD1   . LEU D 2 106 ? -4.189  1.821   -20.347 1.00 21.84 ? 107 LEU B CD1   1 
ATOM   3775 C CD2   . LEU D 2 106 ? -3.299  3.715   -18.926 1.00 16.03 ? 107 LEU B CD2   1 
ATOM   3776 H H     . LEU D 2 106 ? -5.830  1.358   -16.625 1.00 0.00  ? 107 LEU B H     1 
ATOM   3777 N N     . GLY D 2 107 ? -7.824  3.947   -15.872 1.00 15.31 ? 108 GLY B N     1 
ATOM   3778 C CA    . GLY D 2 107 ? -9.092  4.626   -15.660 1.00 10.47 ? 108 GLY B CA    1 
ATOM   3779 C C     . GLY D 2 107 ? -10.180 3.604   -15.708 1.00 8.30  ? 108 GLY B C     1 
ATOM   3780 O O     . GLY D 2 107 ? -9.946  2.475   -16.122 1.00 8.39  ? 108 GLY B O     1 
ATOM   3781 H H     . GLY D 2 107 ? -7.451  3.413   -15.137 1.00 0.00  ? 108 GLY B H     1 
ATOM   3782 N N     . GLY D 2 108 ? -11.381 3.986   -15.307 1.00 10.04 ? 109 GLY B N     1 
ATOM   3783 C CA    . GLY D 2 108 ? -12.467 3.025   -15.293 1.00 11.96 ? 109 GLY B CA    1 
ATOM   3784 C C     . GLY D 2 108 ? -13.092 2.810   -16.661 1.00 15.87 ? 109 GLY B C     1 
ATOM   3785 O O     . GLY D 2 108 ? -13.042 3.692   -17.518 1.00 16.60 ? 109 GLY B O     1 
ATOM   3786 H H     . GLY D 2 108 ? -11.539 4.925   -15.059 1.00 0.00  ? 109 GLY B H     1 
ATOM   3787 N N     . TYR D 2 109 ? -13.686 1.646   -16.864 1.00 15.68 ? 110 TYR B N     1 
ATOM   3788 C CA    . TYR D 2 109 ? -14.353 1.348   -18.126 1.00 17.51 ? 110 TYR B CA    1 
ATOM   3789 C C     . TYR D 2 109 ? -15.859 1.398   -18.072 1.00 17.83 ? 110 TYR B C     1 
ATOM   3790 O O     . TYR D 2 109 ? -16.501 1.081   -19.059 1.00 19.76 ? 110 TYR B O     1 
ATOM   3791 C CB    . TYR D 2 109 ? -13.938 -0.006  -18.661 1.00 15.86 ? 110 TYR B CB    1 
ATOM   3792 C CG    . TYR D 2 109 ? -14.096 -1.153  -17.708 1.00 16.61 ? 110 TYR B CG    1 
ATOM   3793 C CD1   . TYR D 2 109 ? -15.311 -1.835  -17.611 1.00 16.26 ? 110 TYR B CD1   1 
ATOM   3794 C CD2   . TYR D 2 109 ? -13.007 -1.642  -16.989 1.00 17.35 ? 110 TYR B CD2   1 
ATOM   3795 C CE1   . TYR D 2 109 ? -15.438 -2.987  -16.831 1.00 17.16 ? 110 TYR B CE1   1 
ATOM   3796 C CE2   . TYR D 2 109 ? -13.121 -2.801  -16.198 1.00 17.19 ? 110 TYR B CE2   1 
ATOM   3797 C CZ    . TYR D 2 109 ? -14.343 -3.470  -16.126 1.00 17.98 ? 110 TYR B CZ    1 
ATOM   3798 O OH    . TYR D 2 109 ? -14.483 -4.635  -15.371 1.00 15.86 ? 110 TYR B OH    1 
ATOM   3799 H H     . TYR D 2 109 ? -13.676 0.994   -16.129 1.00 0.00  ? 110 TYR B H     1 
ATOM   3800 H HH    . TYR D 2 109 ? -13.647 -4.873  -14.951 1.00 0.00  ? 110 TYR B HH    1 
ATOM   3801 N N     . THR D 2 110 ? -16.427 1.802   -16.945 1.00 13.66 ? 111 THR B N     1 
ATOM   3802 C CA    . THR D 2 110 ? -17.858 1.857   -16.831 1.00 13.94 ? 111 THR B CA    1 
ATOM   3803 C C     . THR D 2 110 ? -18.276 3.293   -16.661 1.00 15.58 ? 111 THR B C     1 
ATOM   3804 O O     . THR D 2 110 ? -19.455 3.556   -16.416 1.00 17.81 ? 111 THR B O     1 
ATOM   3805 C CB    . THR D 2 110 ? -18.410 1.039   -15.612 1.00 13.89 ? 111 THR B CB    1 
ATOM   3806 O OG1   . THR D 2 110 ? -18.048 1.684   -14.400 1.00 15.90 ? 111 THR B OG1   1 
ATOM   3807 C CG2   . THR D 2 110 ? -17.843 -0.345  -15.566 1.00 13.69 ? 111 THR B CG2   1 
ATOM   3808 H H     . THR D 2 110 ? -15.887 2.084   -16.172 1.00 0.00  ? 111 THR B H     1 
ATOM   3809 H HG1   . THR D 2 110 ? -18.379 1.169   -13.641 1.00 0.00  ? 111 THR B HG1   1 
ATOM   3810 N N     . SER D 2 111 ? -17.337 4.234   -16.777 1.00 15.47 ? 112 SER B N     1 
ATOM   3811 C CA    . SER D 2 111 ? -17.710 5.624   -16.611 1.00 18.30 ? 112 SER B CA    1 
ATOM   3812 C C     . SER D 2 111 ? -18.035 6.449   -17.913 1.00 20.86 ? 112 SER B C     1 
ATOM   3813 O O     . SER D 2 111 ? -18.952 6.086   -18.682 1.00 22.01 ? 112 SER B O     1 
ATOM   3814 C CB    . SER D 2 111 ? -16.715 6.334   -15.687 1.00 18.62 ? 112 SER B CB    1 
ATOM   3815 O OG    . SER D 2 111 ? -15.422 6.373   -16.264 1.00 20.69 ? 112 SER B OG    1 
ATOM   3816 H H     . SER D 2 111 ? -16.405 4.029   -16.995 1.00 0.00  ? 112 SER B H     1 
ATOM   3817 H HG    . SER D 2 111 ? -14.845 6.825   -15.635 1.00 0.00  ? 112 SER B HG    1 
ATOM   3818 N N     . PHE D 2 112 ? -17.325 7.553   -18.131 1.00 17.23 ? 113 PHE B N     1 
ATOM   3819 C CA    . PHE D 2 112 ? -17.552 8.430   -19.269 1.00 17.31 ? 113 PHE B CA    1 
ATOM   3820 C C     . PHE D 2 112 ? -17.498 7.739   -20.669 1.00 19.07 ? 113 PHE B C     1 
ATOM   3821 O O     . PHE D 2 112 ? -18.019 8.274   -21.656 1.00 17.50 ? 113 PHE B O     1 
ATOM   3822 C CB    . PHE D 2 112 ? -16.593 9.650   -19.179 1.00 13.78 ? 113 PHE B CB    1 
ATOM   3823 C CG    . PHE D 2 112 ? -15.162 9.263   -19.012 1.00 12.36 ? 113 PHE B CG    1 
ATOM   3824 C CD1   . PHE D 2 112 ? -14.398 8.902   -20.116 1.00 12.89 ? 113 PHE B CD1   1 
ATOM   3825 C CD2   . PHE D 2 112 ? -14.603 9.132   -17.739 1.00 13.77 ? 113 PHE B CD2   1 
ATOM   3826 C CE1   . PHE D 2 112 ? -13.115 8.404   -19.966 1.00 11.65 ? 113 PHE B CE1   1 
ATOM   3827 C CE2   . PHE D 2 112 ? -13.303 8.629   -17.577 1.00 13.34 ? 113 PHE B CE2   1 
ATOM   3828 C CZ    . PHE D 2 112 ? -12.570 8.265   -18.686 1.00 15.93 ? 113 PHE B CZ    1 
ATOM   3829 H H     . PHE D 2 112 ? -16.626 7.809   -17.502 1.00 0.00  ? 113 PHE B H     1 
ATOM   3830 N N     . ILE D 2 113 ? -16.854 6.582   -20.780 1.00 18.67 ? 114 ILE B N     1 
ATOM   3831 C CA    . ILE D 2 113 ? -16.827 5.938   -22.083 1.00 20.38 ? 114 ILE B CA    1 
ATOM   3832 C C     . ILE D 2 113 ? -18.181 5.294   -22.343 1.00 21.12 ? 114 ILE B C     1 
ATOM   3833 O O     . ILE D 2 113 ? -18.600 5.200   -23.490 1.00 22.55 ? 114 ILE B O     1 
ATOM   3834 C CB    . ILE D 2 113 ? -15.675 4.925   -22.289 1.00 19.82 ? 114 ILE B CB    1 
ATOM   3835 C CG1   . ILE D 2 113 ? -15.911 3.641   -21.541 1.00 19.11 ? 114 ILE B CG1   1 
ATOM   3836 C CG2   . ILE D 2 113 ? -14.354 5.528   -21.920 1.00 17.98 ? 114 ILE B CG2   1 
ATOM   3837 C CD1   . ILE D 2 113 ? -14.949 2.580   -21.954 1.00 25.15 ? 114 ILE B CD1   1 
ATOM   3838 H H     . ILE D 2 113 ? -16.409 6.173   -20.004 1.00 0.00  ? 114 ILE B H     1 
ATOM   3839 N N     . ARG D 2 114 ? -18.880 4.885   -21.281 1.00 20.04 ? 115 ARG B N     1 
ATOM   3840 C CA    . ARG D 2 114 ? -20.203 4.309   -21.432 1.00 17.35 ? 115 ARG B CA    1 
ATOM   3841 C C     . ARG D 2 114 ? -21.207 5.398   -21.203 1.00 20.91 ? 115 ARG B C     1 
ATOM   3842 O O     . ARG D 2 114 ? -22.343 5.259   -21.588 1.00 25.65 ? 115 ARG B O     1 
ATOM   3843 C CB    . ARG D 2 114 ? -20.476 3.195   -20.449 1.00 13.16 ? 115 ARG B CB    1 
ATOM   3844 C CG    . ARG D 2 114 ? -19.527 2.072   -20.589 1.00 9.49  ? 115 ARG B CG    1 
ATOM   3845 C CD    . ARG D 2 114 ? -20.018 0.832   -19.933 1.00 3.99  ? 115 ARG B CD    1 
ATOM   3846 N NE    . ARG D 2 114 ? -18.958 -0.154  -20.027 1.00 5.94  ? 115 ARG B NE    1 
ATOM   3847 C CZ    . ARG D 2 114 ? -19.077 -1.424  -19.713 1.00 7.12  ? 115 ARG B CZ    1 
ATOM   3848 N NH1   . ARG D 2 114 ? -20.240 -1.873  -19.249 1.00 14.32 ? 115 ARG B NH1   1 
ATOM   3849 N NH2   . ARG D 2 114 ? -18.057 -2.242  -19.959 1.00 12.02 ? 115 ARG B NH2   1 
ATOM   3850 H H     . ARG D 2 114 ? -18.521 4.983   -20.375 1.00 0.00  ? 115 ARG B H     1 
ATOM   3851 H HE    . ARG D 2 114 ? -18.085 0.154   -20.349 1.00 0.00  ? 115 ARG B HE    1 
ATOM   3852 H HH11  . ARG D 2 114 ? -21.015 -1.253  -19.144 1.00 0.00  ? 115 ARG B HH11  1 
ATOM   3853 H HH12  . ARG D 2 114 ? -20.329 -2.838  -18.999 1.00 0.00  ? 115 ARG B HH12  1 
ATOM   3854 H HH21  . ARG D 2 114 ? -17.226 -1.877  -20.362 1.00 0.00  ? 115 ARG B HH21  1 
ATOM   3855 H HH22  . ARG D 2 114 ? -18.121 -3.210  -19.726 1.00 0.00  ? 115 ARG B HH22  1 
ATOM   3856 N N     . ASN D 2 115 ? -20.823 6.491   -20.577 1.00 24.20 ? 116 ASN B N     1 
ATOM   3857 C CA    . ASN D 2 115 ? -21.801 7.539   -20.372 1.00 27.80 ? 116 ASN B CA    1 
ATOM   3858 C C     . ASN D 2 115 ? -21.163 8.896   -20.526 1.00 28.94 ? 116 ASN B C     1 
ATOM   3859 O O     . ASN D 2 115 ? -20.525 9.409   -19.612 1.00 30.51 ? 116 ASN B O     1 
ATOM   3860 C CB    . ASN D 2 115 ? -22.469 7.415   -19.012 1.00 31.96 ? 116 ASN B CB    1 
ATOM   3861 C CG    . ASN D 2 115 ? -23.739 8.252   -18.924 1.00 38.85 ? 116 ASN B CG    1 
ATOM   3862 O OD1   . ASN D 2 115 ? -23.793 9.385   -19.447 1.00 41.77 ? 116 ASN B OD1   1 
ATOM   3863 N ND2   . ASN D 2 115 ? -24.782 7.693   -18.304 1.00 40.99 ? 116 ASN B ND2   1 
ATOM   3864 H H     . ASN D 2 115 ? -19.913 6.607   -20.244 1.00 0.00  ? 116 ASN B H     1 
ATOM   3865 H HD21  . ASN D 2 115 ? -25.595 8.233   -18.253 1.00 0.00  ? 116 ASN B HD21  1 
ATOM   3866 H HD22  . ASN D 2 115 ? -24.680 6.791   -17.938 1.00 0.00  ? 116 ASN B HD22  1 
ATOM   3867 N N     . ASN D 2 116 ? -21.401 9.488   -21.683 1.00 26.78 ? 117 ASN B N     1 
ATOM   3868 C CA    . ASN D 2 116 ? -20.868 10.783  -22.103 1.00 25.79 ? 117 ASN B CA    1 
ATOM   3869 C C     . ASN D 2 116 ? -20.507 11.868  -21.043 1.00 24.91 ? 117 ASN B C     1 
ATOM   3870 O O     . ASN D 2 116 ? -19.573 12.664  -21.259 1.00 22.98 ? 117 ASN B O     1 
ATOM   3871 C CB    . ASN D 2 116 ? -21.848 11.342  -23.141 1.00 28.31 ? 117 ASN B CB    1 
ATOM   3872 C CG    . ASN D 2 116 ? -21.243 12.399  -24.021 1.00 29.92 ? 117 ASN B CG    1 
ATOM   3873 O OD1   . ASN D 2 116 ? -20.141 12.236  -24.541 1.00 31.49 ? 117 ASN B OD1   1 
ATOM   3874 N ND2   . ASN D 2 116 ? -21.987 13.488  -24.228 1.00 28.00 ? 117 ASN B ND2   1 
ATOM   3875 H H     . ASN D 2 116 ? -21.976 8.999   -22.304 1.00 0.00  ? 117 ASN B H     1 
ATOM   3876 H HD21  . ASN D 2 116 ? -21.655 14.253  -24.721 1.00 0.00  ? 117 ASN B HD21  1 
ATOM   3877 H HD22  . ASN D 2 116 ? -22.881 13.487  -23.828 1.00 0.00  ? 117 ASN B HD22  1 
ATOM   3878 N N     . THR D 2 117 ? -21.236 11.921  -19.925 1.00 21.16 ? 118 THR B N     1 
ATOM   3879 C CA    . THR D 2 117 ? -20.976 12.929  -18.923 1.00 20.69 ? 118 THR B CA    1 
ATOM   3880 C C     . THR D 2 117 ? -20.720 12.390  -17.511 1.00 21.15 ? 118 THR B C     1 
ATOM   3881 O O     . THR D 2 117 ? -20.637 13.149  -16.553 1.00 20.81 ? 118 THR B O     1 
ATOM   3882 C CB    . THR D 2 117 ? -22.144 13.868  -18.843 1.00 21.37 ? 118 THR B CB    1 
ATOM   3883 O OG1   . THR D 2 117 ? -23.321 13.103  -18.566 1.00 25.54 ? 118 THR B OG1   1 
ATOM   3884 C CG2   . THR D 2 117 ? -22.332 14.597  -20.135 1.00 24.31 ? 118 THR B CG2   1 
ATOM   3885 H H     . THR D 2 117 ? -21.960 11.282  -19.746 1.00 0.00  ? 118 THR B H     1 
ATOM   3886 H HG1   . THR D 2 117 ? -24.080 13.683  -18.484 1.00 0.00  ? 118 THR B HG1   1 
ATOM   3887 N N     . LYS D 2 118 ? -20.536 11.091  -17.378 1.00 20.66 ? 119 LYS B N     1 
ATOM   3888 C CA    . LYS D 2 118 ? -20.329 10.519  -16.068 1.00 21.97 ? 119 LYS B CA    1 
ATOM   3889 C C     . LYS D 2 118 ? -18.896 10.661  -15.597 1.00 20.65 ? 119 LYS B C     1 
ATOM   3890 O O     . LYS D 2 118 ? -18.018 10.032  -16.161 1.00 21.41 ? 119 LYS B O     1 
ATOM   3891 C CB    . LYS D 2 118 ? -20.714 9.036   -16.080 1.00 19.36 ? 119 LYS B CB    1 
ATOM   3892 H H     . LYS D 2 118 ? -20.511 10.518  -18.161 1.00 0.00  ? 119 LYS B H     1 
ATOM   3893 N N     . ASN D 2 119 ? -18.674 11.479  -14.562 1.00 20.09 ? 120 ASN B N     1 
ATOM   3894 C CA    . ASN D 2 119 ? -17.356 11.674  -13.944 1.00 18.31 ? 120 ASN B CA    1 
ATOM   3895 C C     . ASN D 2 119 ? -16.316 12.229  -14.875 1.00 14.63 ? 120 ASN B C     1 
ATOM   3896 O O     . ASN D 2 119 ? -15.195 11.755  -14.910 1.00 14.57 ? 120 ASN B O     1 
ATOM   3897 C CB    . ASN D 2 119 ? -16.826 10.349  -13.376 1.00 20.75 ? 120 ASN B CB    1 
ATOM   3898 C CG    . ASN D 2 119 ? -17.665 9.831   -12.236 1.00 23.20 ? 120 ASN B CG    1 
ATOM   3899 O OD1   . ASN D 2 119 ? -18.496 8.950   -12.423 1.00 24.80 ? 120 ASN B OD1   1 
ATOM   3900 N ND2   . ASN D 2 119 ? -17.444 10.375  -11.037 1.00 22.32 ? 120 ASN B ND2   1 
ATOM   3901 H H     . ASN D 2 119 ? -19.449 11.975  -14.243 1.00 0.00  ? 120 ASN B H     1 
ATOM   3902 H HD21  . ASN D 2 119 ? -18.027 10.062  -10.315 1.00 0.00  ? 120 ASN B HD21  1 
ATOM   3903 H HD22  . ASN D 2 119 ? -16.732 11.034  -10.928 1.00 0.00  ? 120 ASN B HD22  1 
ATOM   3904 N N     . ILE D 2 120 ? -16.673 13.247  -15.620 1.00 14.02 ? 121 ILE B N     1 
ATOM   3905 C CA    . ILE D 2 120 ? -15.722 13.808  -16.543 1.00 16.39 ? 121 ILE B CA    1 
ATOM   3906 C C     . ILE D 2 120 ? -15.965 15.283  -16.516 1.00 16.40 ? 121 ILE B C     1 
ATOM   3907 O O     . ILE D 2 120 ? -17.078 15.689  -16.222 1.00 19.10 ? 121 ILE B O     1 
ATOM   3908 C CB    . ILE D 2 120 ? -15.871 13.159  -17.951 1.00 16.60 ? 121 ILE B CB    1 
ATOM   3909 C CG1   . ILE D 2 120 ? -14.862 13.758  -18.942 1.00 14.28 ? 121 ILE B CG1   1 
ATOM   3910 C CG2   . ILE D 2 120 ? -17.325 13.228  -18.442 1.00 17.07 ? 121 ILE B CG2   1 
ATOM   3911 C CD1   . ILE D 2 120 ? -14.754 12.933  -20.220 1.00 13.95 ? 121 ILE B CD1   1 
ATOM   3912 H H     . ILE D 2 120 ? -17.574 13.639  -15.603 1.00 0.00  ? 121 ILE B H     1 
ATOM   3913 N N     . VAL D 2 121 ? -14.898 16.074  -16.668 1.00 16.56 ? 122 VAL B N     1 
ATOM   3914 C CA    . VAL D 2 121 ? -14.999 17.546  -16.622 1.00 18.72 ? 122 VAL B CA    1 
ATOM   3915 C C     . VAL D 2 121 ? -15.887 18.165  -17.715 1.00 18.35 ? 122 VAL B C     1 
ATOM   3916 O O     . VAL D 2 121 ? -16.630 19.126  -17.478 1.00 21.39 ? 122 VAL B O     1 
ATOM   3917 C CB    . VAL D 2 121 ? -13.600 18.193  -16.691 1.00 19.02 ? 122 VAL B CB    1 
ATOM   3918 C CG1   . VAL D 2 121 ? -13.697 19.694  -16.543 1.00 22.32 ? 122 VAL B CG1   1 
ATOM   3919 C CG2   . VAL D 2 121 ? -12.721 17.622  -15.617 1.00 18.50 ? 122 VAL B CG2   1 
ATOM   3920 H H     . VAL D 2 121 ? -14.023 15.655  -16.838 1.00 0.00  ? 122 VAL B H     1 
ATOM   3921 N N     . TYR D 2 122 ? -15.798 17.606  -18.917 1.00 16.46 ? 123 TYR B N     1 
ATOM   3922 C CA    . TYR D 2 122 ? -16.573 18.075  -20.057 1.00 12.54 ? 123 TYR B CA    1 
ATOM   3923 C C     . TYR D 2 122 ? -17.050 16.830  -20.719 1.00 9.98  ? 123 TYR B C     1 
ATOM   3924 O O     . TYR D 2 122 ? -16.433 15.780  -20.569 1.00 11.25 ? 123 TYR B O     1 
ATOM   3925 C CB    . TYR D 2 122 ? -15.676 18.836  -21.021 1.00 7.91  ? 123 TYR B CB    1 
ATOM   3926 C CG    . TYR D 2 122 ? -15.295 20.195  -20.494 1.00 10.46 ? 123 TYR B CG    1 
ATOM   3927 C CD1   . TYR D 2 122 ? -16.232 21.216  -20.455 1.00 9.33  ? 123 TYR B CD1   1 
ATOM   3928 C CD2   . TYR D 2 122 ? -13.988 20.468  -20.059 1.00 10.31 ? 123 TYR B CD2   1 
ATOM   3929 C CE1   . TYR D 2 122 ? -15.898 22.454  -20.007 1.00 10.96 ? 123 TYR B CE1   1 
ATOM   3930 C CE2   . TYR D 2 122 ? -13.645 21.725  -19.611 1.00 12.06 ? 123 TYR B CE2   1 
ATOM   3931 C CZ    . TYR D 2 122 ? -14.617 22.706  -19.589 1.00 10.28 ? 123 TYR B CZ    1 
ATOM   3932 O OH    . TYR D 2 122 ? -14.333 23.966  -19.132 1.00 14.13 ? 123 TYR B OH    1 
ATOM   3933 H H     . TYR D 2 122 ? -15.207 16.838  -19.065 1.00 0.00  ? 123 TYR B H     1 
ATOM   3934 H HH    . TYR D 2 122 ? -13.387 24.057  -18.993 1.00 0.00  ? 123 TYR B HH    1 
ATOM   3935 N N     . PRO D 2 123 ? -18.176 16.905  -21.438 1.00 12.22 ? 124 PRO B N     1 
ATOM   3936 C CA    . PRO D 2 123 ? -18.722 15.731  -22.126 1.00 12.62 ? 124 PRO B CA    1 
ATOM   3937 C C     . PRO D 2 123 ? -17.641 15.075  -22.967 1.00 14.83 ? 124 PRO B C     1 
ATOM   3938 O O     . PRO D 2 123 ? -16.859 15.780  -23.607 1.00 15.41 ? 124 PRO B O     1 
ATOM   3939 C CB    . PRO D 2 123 ? -19.805 16.338  -22.971 1.00 13.15 ? 124 PRO B CB    1 
ATOM   3940 C CG    . PRO D 2 123 ? -20.302 17.450  -22.085 1.00 11.11 ? 124 PRO B CG    1 
ATOM   3941 C CD    . PRO D 2 123 ? -19.057 18.076  -21.590 1.00 8.74  ? 124 PRO B CD    1 
ATOM   3942 N N     . PHE D 2 124 ? -17.571 13.743  -22.915 1.00 13.96 ? 125 PHE B N     1 
ATOM   3943 C CA    . PHE D 2 124 ? -16.570 12.946  -23.634 1.00 16.67 ? 125 PHE B CA    1 
ATOM   3944 C C     . PHE D 2 124 ? -16.382 13.295  -25.128 1.00 19.26 ? 125 PHE B C     1 
ATOM   3945 O O     . PHE D 2 124 ? -15.265 13.255  -25.663 1.00 17.83 ? 125 PHE B O     1 
ATOM   3946 C CB    . PHE D 2 124 ? -16.924 11.464  -23.488 1.00 13.09 ? 125 PHE B CB    1 
ATOM   3947 C CG    . PHE D 2 124 ? -15.874 10.506  -24.022 1.00 12.13 ? 125 PHE B CG    1 
ATOM   3948 C CD1   . PHE D 2 124 ? -14.694 10.268  -23.312 1.00 10.61 ? 125 PHE B CD1   1 
ATOM   3949 C CD2   . PHE D 2 124 ? -16.117 9.750   -25.170 1.00 7.85  ? 125 PHE B CD2   1 
ATOM   3950 C CE1   . PHE D 2 124 ? -13.797 9.302   -23.730 1.00 8.51  ? 125 PHE B CE1   1 
ATOM   3951 C CE2   . PHE D 2 124 ? -15.211 8.784   -25.582 1.00 8.81  ? 125 PHE B CE2   1 
ATOM   3952 C CZ    . PHE D 2 124 ? -14.054 8.565   -24.857 1.00 9.49  ? 125 PHE B CZ    1 
ATOM   3953 H H     . PHE D 2 124 ? -18.211 13.263  -22.355 1.00 0.00  ? 125 PHE B H     1 
ATOM   3954 N N     . ASP D 2 125 ? -17.481 13.581  -25.806 1.00 24.20 ? 126 ASP B N     1 
ATOM   3955 C CA    . ASP D 2 125 ? -17.442 13.903  -27.236 1.00 25.00 ? 126 ASP B CA    1 
ATOM   3956 C C     . ASP D 2 125 ? -16.718 15.205  -27.576 1.00 23.43 ? 126 ASP B C     1 
ATOM   3957 O O     . ASP D 2 125 ? -16.449 15.462  -28.751 1.00 25.06 ? 126 ASP B O     1 
ATOM   3958 C CB    . ASP D 2 125 ? -18.854 13.918  -27.828 1.00 26.01 ? 126 ASP B CB    1 
ATOM   3959 C CG    . ASP D 2 125 ? -19.810 14.778  -27.026 1.00 28.24 ? 126 ASP B CG    1 
ATOM   3960 O OD1   . ASP D 2 125 ? -19.715 16.018  -27.042 1.00 34.87 ? 126 ASP B OD1   1 
ATOM   3961 O OD2   . ASP D 2 125 ? -20.671 14.206  -26.361 1.00 29.45 ? 126 ASP B OD2   1 
ATOM   3962 H H     . ASP D 2 125 ? -18.343 13.535  -25.338 1.00 0.00  ? 126 ASP B H     1 
ATOM   3963 N N     . GLN D 2 126 ? -16.441 16.043  -26.574 1.00 21.83 ? 127 GLN B N     1 
ATOM   3964 C CA    . GLN D 2 126 ? -15.708 17.291  -26.823 1.00 18.49 ? 127 GLN B CA    1 
ATOM   3965 C C     . GLN D 2 126 ? -14.194 17.098  -26.791 1.00 17.72 ? 127 GLN B C     1 
ATOM   3966 O O     . GLN D 2 126 ? -13.450 18.022  -27.063 1.00 18.77 ? 127 GLN B O     1 
ATOM   3967 C CB    . GLN D 2 126 ? -16.086 18.348  -25.809 1.00 18.62 ? 127 GLN B CB    1 
ATOM   3968 C CG    . GLN D 2 126 ? -17.557 18.549  -25.738 1.00 19.22 ? 127 GLN B CG    1 
ATOM   3969 C CD    . GLN D 2 126 ? -17.928 19.620  -24.763 1.00 22.32 ? 127 GLN B CD    1 
ATOM   3970 O OE1   . GLN D 2 126 ? -17.074 20.193  -24.098 1.00 20.64 ? 127 GLN B OE1   1 
ATOM   3971 N NE2   . GLN D 2 126 ? -19.222 19.922  -24.683 1.00 25.47 ? 127 GLN B NE2   1 
ATOM   3972 H H     . GLN D 2 126 ? -16.698 15.831  -25.652 1.00 0.00  ? 127 GLN B H     1 
ATOM   3973 H HE21  . GLN D 2 126 ? -19.473 20.609  -24.038 1.00 0.00  ? 127 GLN B HE21  1 
ATOM   3974 H HE22  . GLN D 2 126 ? -19.849 19.449  -25.269 1.00 0.00  ? 127 GLN B HE22  1 
ATOM   3975 N N     . TYR D 2 127 ? -13.750 15.889  -26.467 1.00 16.12 ? 128 TYR B N     1 
ATOM   3976 C CA    . TYR D 2 127 ? -12.341 15.547  -26.375 1.00 17.66 ? 128 TYR B CA    1 
ATOM   3977 C C     . TYR D 2 127 ? -11.928 14.818  -27.632 1.00 18.30 ? 128 TYR B C     1 
ATOM   3978 O O     . TYR D 2 127 ? -12.463 13.759  -27.928 1.00 18.39 ? 128 TYR B O     1 
ATOM   3979 C CB    . TYR D 2 127 ? -12.089 14.629  -25.146 1.00 16.02 ? 128 TYR B CB    1 
ATOM   3980 C CG    . TYR D 2 127 ? -12.176 15.363  -23.818 1.00 14.99 ? 128 TYR B CG    1 
ATOM   3981 C CD1   . TYR D 2 127 ? -11.071 16.063  -23.316 1.00 11.47 ? 128 TYR B CD1   1 
ATOM   3982 C CD2   . TYR D 2 127 ? -13.371 15.391  -23.085 1.00 13.08 ? 128 TYR B CD2   1 
ATOM   3983 C CE1   . TYR D 2 127 ? -11.150 16.776  -22.112 1.00 16.64 ? 128 TYR B CE1   1 
ATOM   3984 C CE2   . TYR D 2 127 ? -13.469 16.105  -21.884 1.00 15.20 ? 128 TYR B CE2   1 
ATOM   3985 C CZ    . TYR D 2 127 ? -12.354 16.794  -21.395 1.00 16.08 ? 128 TYR B CZ    1 
ATOM   3986 O OH    . TYR D 2 127 ? -12.423 17.468  -20.188 1.00 18.46 ? 128 TYR B OH    1 
ATOM   3987 H H     . TYR D 2 127 ? -14.396 15.172  -26.302 1.00 0.00  ? 128 TYR B H     1 
ATOM   3988 H HH    . TYR D 2 127 ? -11.539 17.797  -19.959 1.00 0.00  ? 128 TYR B HH    1 
ATOM   3989 N N     . ILE D 2 128 ? -10.969 15.377  -28.358 1.00 19.76 ? 129 ILE B N     1 
ATOM   3990 C CA    . ILE D 2 128 ? -10.479 14.753  -29.589 1.00 20.29 ? 129 ILE B CA    1 
ATOM   3991 C C     . ILE D 2 128 ? -9.239  13.901  -29.375 1.00 19.99 ? 129 ILE B C     1 
ATOM   3992 O O     . ILE D 2 128 ? -8.912  13.096  -30.236 1.00 19.13 ? 129 ILE B O     1 
ATOM   3993 C CB    . ILE D 2 128 ? -10.155 15.800  -30.645 1.00 23.57 ? 129 ILE B CB    1 
ATOM   3994 C CG1   . ILE D 2 128 ? -9.022  16.688  -30.135 1.00 22.41 ? 129 ILE B CG1   1 
ATOM   3995 C CG2   . ILE D 2 128 ? -11.410 16.627  -30.942 1.00 23.96 ? 129 ILE B CG2   1 
ATOM   3996 C CD1   . ILE D 2 128 ? -8.477  17.580  -31.152 1.00 27.86 ? 129 ILE B CD1   1 
ATOM   3997 H H     . ILE D 2 128 ? -10.590 16.228  -28.048 1.00 0.00  ? 129 ILE B H     1 
ATOM   3998 N N     . ALA D 2 129 ? -8.552  14.078  -28.234 1.00 19.36 ? 130 ALA B N     1 
ATOM   3999 C CA    . ALA D 2 129 ? -7.344  13.306  -27.897 1.00 15.46 ? 130 ALA B CA    1 
ATOM   4000 C C     . ALA D 2 129 ? -7.347  12.944  -26.422 1.00 12.62 ? 130 ALA B C     1 
ATOM   4001 O O     . ALA D 2 129 ? -7.868  13.711  -25.603 1.00 13.01 ? 130 ALA B O     1 
ATOM   4002 C CB    . ALA D 2 129 ? -6.108  14.123  -28.195 1.00 16.97 ? 130 ALA B CB    1 
ATOM   4003 H H     . ALA D 2 129 ? -8.857  14.747  -27.587 1.00 0.00  ? 130 ALA B H     1 
ATOM   4004 N N     . HIS D 2 130 ? -6.757  11.801  -26.084 1.00 9.86  ? 131 HIS B N     1 
ATOM   4005 C CA    . HIS D 2 130 ? -6.692  11.339  -24.695 1.00 9.78  ? 131 HIS B CA    1 
ATOM   4006 C C     . HIS D 2 130 ? -5.285  10.822  -24.498 1.00 10.65 ? 131 HIS B C     1 
ATOM   4007 O O     . HIS D 2 130 ? -4.977  9.688   -24.887 1.00 11.22 ? 131 HIS B O     1 
ATOM   4008 C CB    . HIS D 2 130 ? -7.711  10.200  -24.393 1.00 11.52 ? 131 HIS B CB    1 
ATOM   4009 C CG    . HIS D 2 130 ? -9.153  10.617  -24.470 1.00 10.19 ? 131 HIS B CG    1 
ATOM   4010 N ND1   . HIS D 2 130 ? -9.731  11.473  -23.557 1.00 11.59 ? 131 HIS B ND1   1 
ATOM   4011 C CD2   . HIS D 2 130 ? -10.099 10.387  -25.409 1.00 11.42 ? 131 HIS B CD2   1 
ATOM   4012 C CE1   . HIS D 2 130 ? -10.960 11.769  -23.939 1.00 10.31 ? 131 HIS B CE1   1 
ATOM   4013 N NE2   . HIS D 2 130 ? -11.207 11.124  -25.063 1.00 12.28 ? 131 HIS B NE2   1 
ATOM   4014 H H     . HIS D 2 130 ? -6.342  11.239  -26.780 1.00 0.00  ? 131 HIS B H     1 
ATOM   4015 H HD1   . HIS D 2 130 ? -9.315  11.730  -22.698 1.00 0.00  ? 131 HIS B HD1   1 
ATOM   4016 H HE2   . HIS D 2 130 ? -12.056 11.168  -25.572 1.00 0.00  ? 131 HIS B HE2   1 
ATOM   4017 N N     . TRP D 2 131 ? -4.430  11.656  -23.886 1.00 11.92 ? 132 TRP B N     1 
ATOM   4018 C CA    . TRP D 2 131 ? -3.027  11.279  -23.643 1.00 15.04 ? 132 TRP B CA    1 
ATOM   4019 C C     . TRP D 2 131 ? -2.732  10.767  -22.226 1.00 15.28 ? 132 TRP B C     1 
ATOM   4020 O O     . TRP D 2 131 ? -3.317  11.242  -21.240 1.00 12.98 ? 132 TRP B O     1 
ATOM   4021 C CB    . TRP D 2 131 ? -2.093  12.465  -23.905 1.00 15.49 ? 132 TRP B CB    1 
ATOM   4022 C CG    . TRP D 2 131 ? -2.173  12.995  -25.307 1.00 16.40 ? 132 TRP B CG    1 
ATOM   4023 C CD1   . TRP D 2 131 ? -2.602  12.319  -26.428 1.00 15.75 ? 132 TRP B CD1   1 
ATOM   4024 C CD2   . TRP D 2 131 ? -1.793  14.302  -25.743 1.00 13.61 ? 132 TRP B CD2   1 
ATOM   4025 N NE1   . TRP D 2 131 ? -2.508  13.130  -27.527 1.00 15.54 ? 132 TRP B NE1   1 
ATOM   4026 C CE2   . TRP D 2 131 ? -2.014  14.354  -27.143 1.00 15.31 ? 132 TRP B CE2   1 
ATOM   4027 C CE3   . TRP D 2 131 ? -1.277  15.429  -25.097 1.00 14.11 ? 132 TRP B CE3   1 
ATOM   4028 C CZ2   . TRP D 2 131 ? -1.729  15.502  -27.904 1.00 16.11 ? 132 TRP B CZ2   1 
ATOM   4029 C CZ3   . TRP D 2 131 ? -0.991  16.566  -25.850 1.00 16.39 ? 132 TRP B CZ3   1 
ATOM   4030 C CH2   . TRP D 2 131 ? -1.218  16.594  -27.242 1.00 15.76 ? 132 TRP B CH2   1 
ATOM   4031 H H     . TRP D 2 131 ? -4.721  12.534  -23.618 1.00 0.00  ? 132 TRP B H     1 
ATOM   4032 H HE1   . TRP D 2 131 ? -2.757  12.856  -28.437 1.00 0.00  ? 132 TRP B HE1   1 
ATOM   4033 N N     . ILE D 2 132 ? -1.775  9.853   -22.158 1.00 14.41 ? 133 ILE B N     1 
ATOM   4034 C CA    . ILE D 2 132 ? -1.329  9.269   -20.930 1.00 15.01 ? 133 ILE B CA    1 
ATOM   4035 C C     . ILE D 2 132 ? 0.132   9.636   -20.724 1.00 14.73 ? 133 ILE B C     1 
ATOM   4036 O O     . ILE D 2 132 ? 0.969   9.287   -21.551 1.00 11.37 ? 133 ILE B O     1 
ATOM   4037 C CB    . ILE D 2 132 ? -1.409  7.705   -20.983 1.00 15.94 ? 133 ILE B CB    1 
ATOM   4038 C CG1   . ILE D 2 132 ? -2.863  7.214   -20.907 1.00 13.30 ? 133 ILE B CG1   1 
ATOM   4039 C CG2   . ILE D 2 132 ? -0.586  7.078   -19.848 1.00 18.05 ? 133 ILE B CG2   1 
ATOM   4040 C CD1   . ILE D 2 132 ? -3.611  7.643   -19.659 1.00 9.18  ? 133 ILE B CD1   1 
ATOM   4041 H H     . ILE D 2 132 ? -1.324  9.576   -22.972 1.00 0.00  ? 133 ILE B H     1 
ATOM   4042 N N     . ILE D 2 133 ? 0.435   10.392  -19.662 1.00 14.57 ? 134 ILE B N     1 
ATOM   4043 C CA    . ILE D 2 133 ? 1.836   10.663  -19.350 1.00 13.41 ? 134 ILE B CA    1 
ATOM   4044 C C     . ILE D 2 133 ? 2.177   9.577   -18.321 1.00 13.90 ? 134 ILE B C     1 
ATOM   4045 O O     . ILE D 2 133 ? 1.541   9.473   -17.270 1.00 13.77 ? 134 ILE B O     1 
ATOM   4046 C CB    . ILE D 2 133 ? 2.067   12.075  -18.808 1.00 12.79 ? 134 ILE B CB    1 
ATOM   4047 C CG1   . ILE D 2 133 ? 1.870   13.118  -19.917 1.00 11.76 ? 134 ILE B CG1   1 
ATOM   4048 C CG2   . ILE D 2 133 ? 3.508   12.217  -18.361 1.00 14.64 ? 134 ILE B CG2   1 
ATOM   4049 C CD1   . ILE D 2 133 ? 2.023   14.582  -19.440 1.00 14.09 ? 134 ILE B CD1   1 
ATOM   4050 H H     . ILE D 2 133 ? -0.271  10.716  -19.067 1.00 0.00  ? 134 ILE B H     1 
ATOM   4051 N N     . GLY D 2 134 ? 3.102   8.700   -18.647 1.00 12.07 ? 135 GLY B N     1 
ATOM   4052 C CA    . GLY D 2 134 ? 3.396   7.639   -17.721 1.00 13.96 ? 135 GLY B CA    1 
ATOM   4053 C C     . GLY D 2 134 ? 4.773   7.785   -17.144 1.00 17.47 ? 135 GLY B C     1 
ATOM   4054 O O     . GLY D 2 134 ? 5.689   8.208   -17.834 1.00 19.95 ? 135 GLY B O     1 
ATOM   4055 H H     . GLY D 2 134 ? 3.594   8.784   -19.489 1.00 0.00  ? 135 GLY B H     1 
ATOM   4056 N N     . TYR D 2 135 ? 4.910   7.482   -15.859 1.00 18.22 ? 136 TYR B N     1 
ATOM   4057 C CA    . TYR D 2 135 ? 6.186   7.575   -15.178 1.00 17.32 ? 136 TYR B CA    1 
ATOM   4058 C C     . TYR D 2 135 ? 6.415   6.222   -14.594 1.00 18.99 ? 136 TYR B C     1 
ATOM   4059 O O     . TYR D 2 135 ? 5.489   5.616   -14.050 1.00 19.81 ? 136 TYR B O     1 
ATOM   4060 C CB    . TYR D 2 135 ? 6.124   8.563   -14.018 1.00 15.23 ? 136 TYR B CB    1 
ATOM   4061 C CG    . TYR D 2 135 ? 6.157   10.020  -14.395 1.00 11.84 ? 136 TYR B CG    1 
ATOM   4062 C CD1   . TYR D 2 135 ? 4.972   10.732  -14.652 1.00 10.70 ? 136 TYR B CD1   1 
ATOM   4063 C CD2   . TYR D 2 135 ? 7.363   10.695  -14.478 1.00 10.35 ? 136 TYR B CD2   1 
ATOM   4064 C CE1   . TYR D 2 135 ? 4.998   12.093  -14.992 1.00 12.88 ? 136 TYR B CE1   1 
ATOM   4065 C CE2   . TYR D 2 135 ? 7.399   12.047  -14.816 1.00 12.45 ? 136 TYR B CE2   1 
ATOM   4066 C CZ    . TYR D 2 135 ? 6.220   12.742  -15.072 1.00 13.39 ? 136 TYR B CZ    1 
ATOM   4067 O OH    . TYR D 2 135 ? 6.299   14.090  -15.411 1.00 10.27 ? 136 TYR B OH    1 
ATOM   4068 H H     . TYR D 2 135 ? 4.141   7.159   -15.339 1.00 0.00  ? 136 TYR B H     1 
ATOM   4069 H HH    . TYR D 2 135 ? 5.436   14.390  -15.702 1.00 0.00  ? 136 TYR B HH    1 
ATOM   4070 N N     . VAL D 2 136 ? 7.626   5.720   -14.750 1.00 18.89 ? 137 VAL B N     1 
ATOM   4071 C CA    . VAL D 2 136 ? 7.978   4.447   -14.183 1.00 19.56 ? 137 VAL B CA    1 
ATOM   4072 C C     . VAL D 2 136 ? 9.225   4.804   -13.378 1.00 21.94 ? 137 VAL B C     1 
ATOM   4073 O O     . VAL D 2 136 ? 10.105  5.528   -13.871 1.00 18.99 ? 137 VAL B O     1 
ATOM   4074 C CB    . VAL D 2 136 ? 8.396   3.425   -15.226 1.00 20.70 ? 137 VAL B CB    1 
ATOM   4075 C CG1   . VAL D 2 136 ? 8.019   2.032   -14.774 1.00 17.97 ? 137 VAL B CG1   1 
ATOM   4076 C CG2   . VAL D 2 136 ? 7.830   3.760   -16.572 1.00 22.81 ? 137 VAL B CG2   1 
ATOM   4077 H H     . VAL D 2 136 ? 8.309   6.229   -15.232 1.00 0.00  ? 137 VAL B H     1 
ATOM   4078 N N     . TYR D 2 137 ? 9.264   4.364   -12.118 1.00 22.88 ? 138 TYR B N     1 
ATOM   4079 C CA    . TYR D 2 137 ? 10.414  4.612   -11.262 1.00 21.36 ? 138 TYR B CA    1 
ATOM   4080 C C     . TYR D 2 137 ? 10.907  3.261   -10.811 1.00 20.33 ? 138 TYR B C     1 
ATOM   4081 O O     . TYR D 2 137 ? 10.138  2.303   -10.743 1.00 19.37 ? 138 TYR B O     1 
ATOM   4082 C CB    . TYR D 2 137 ? 10.053  5.477   -10.057 1.00 19.90 ? 138 TYR B CB    1 
ATOM   4083 C CG    . TYR D 2 137 ? 9.125   4.823   -9.044  1.00 24.29 ? 138 TYR B CG    1 
ATOM   4084 C CD1   . TYR D 2 137 ? 9.637   4.021   -8.023  1.00 24.86 ? 138 TYR B CD1   1 
ATOM   4085 C CD2   . TYR D 2 137 ? 7.727   5.040   -9.082  1.00 24.86 ? 138 TYR B CD2   1 
ATOM   4086 C CE1   . TYR D 2 137 ? 8.803   3.460   -7.076  1.00 25.86 ? 138 TYR B CE1   1 
ATOM   4087 C CE2   . TYR D 2 137 ? 6.880   4.483   -8.133  1.00 23.32 ? 138 TYR B CE2   1 
ATOM   4088 C CZ    . TYR D 2 137 ? 7.430   3.693   -7.134  1.00 27.59 ? 138 TYR B CZ    1 
ATOM   4089 O OH    . TYR D 2 137 ? 6.631   3.121   -6.166  1.00 29.96 ? 138 TYR B OH    1 
ATOM   4090 H H     . TYR D 2 137 ? 8.509   3.836   -11.774 1.00 0.00  ? 138 TYR B H     1 
ATOM   4091 H HH    . TYR D 2 137 ? 5.701   3.239   -6.389  1.00 0.00  ? 138 TYR B HH    1 
ATOM   4092 N N     . THR D 2 138 ? 12.213  3.152   -10.642 1.00 24.27 ? 139 THR B N     1 
ATOM   4093 C CA    . THR D 2 138 ? 12.823  1.925   -10.150 1.00 28.18 ? 139 THR B CA    1 
ATOM   4094 C C     . THR D 2 138 ? 12.983  2.149   -8.656  1.00 28.88 ? 139 THR B C     1 
ATOM   4095 O O     . THR D 2 138 ? 13.518  3.179   -8.232  1.00 27.31 ? 139 THR B O     1 
ATOM   4096 C CB    . THR D 2 138 ? 14.214  1.714   -10.695 1.00 28.52 ? 139 THR B CB    1 
ATOM   4097 O OG1   . THR D 2 138 ? 14.200  1.851   -12.123 1.00 30.32 ? 139 THR B OG1   1 
ATOM   4098 C CG2   . THR D 2 138 ? 14.681  0.345   -10.313 1.00 29.77 ? 139 THR B CG2   1 
ATOM   4099 H H     . THR D 2 138 ? 12.782  3.923   -10.851 1.00 0.00  ? 139 THR B H     1 
ATOM   4100 H HG1   . THR D 2 138 ? 13.621  1.195   -12.528 1.00 0.00  ? 139 THR B HG1   1 
ATOM   4101 N N     . ARG D 2 139 ? 12.504  1.205   -7.866  1.00 31.44 ? 140 ARG B N     1 
ATOM   4102 C CA    . ARG D 2 139 ? 12.591  1.336   -6.425  1.00 35.21 ? 140 ARG B CA    1 
ATOM   4103 C C     . ARG D 2 139 ? 13.984  0.967   -5.918  1.00 37.43 ? 140 ARG B C     1 
ATOM   4104 O O     . ARG D 2 139 ? 14.648  0.060   -6.448  1.00 39.07 ? 140 ARG B O     1 
ATOM   4105 C CB    . ARG D 2 139 ? 11.510  0.477   -5.746  1.00 37.44 ? 140 ARG B CB    1 
ATOM   4106 H H     . ARG D 2 139 ? 12.111  0.397   -8.254  1.00 0.00  ? 140 ARG B H     1 
ATOM   4107 N N     . VAL D 2 140 ? 14.455  1.748   -4.954  1.00 38.88 ? 141 VAL B N     1 
ATOM   4108 C CA    . VAL D 2 140 ? 15.750  1.511   -4.342  1.00 38.76 ? 141 VAL B CA    1 
ATOM   4109 C C     . VAL D 2 140 ? 15.693  0.188   -3.541  1.00 39.92 ? 141 VAL B C     1 
ATOM   4110 O O     . VAL D 2 140 ? 16.497  -0.745  -3.748  1.00 41.92 ? 141 VAL B O     1 
ATOM   4111 C CB    . VAL D 2 140 ? 16.124  2.680   -3.414  1.00 37.49 ? 141 VAL B CB    1 
ATOM   4112 C CG1   . VAL D 2 140 ? 16.593  3.840   -4.216  1.00 34.05 ? 141 VAL B CG1   1 
ATOM   4113 C CG2   . VAL D 2 140 ? 14.925  3.100   -2.610  1.00 37.96 ? 141 VAL B CG2   1 
ATOM   4114 H H     . VAL D 2 140 ? 13.890  2.502   -4.679  1.00 0.00  ? 141 VAL B H     1 
ATOM   4115 N N     . LEU D 2 147 ? 13.568  9.249   8.182   1.00 43.05 ? 148 LEU B N     1 
ATOM   4116 C CA    . LEU D 2 147 ? 12.670  9.780   9.210   1.00 43.44 ? 148 LEU B CA    1 
ATOM   4117 C C     . LEU D 2 147 ? 13.284  10.967  9.963   1.00 43.13 ? 148 LEU B C     1 
ATOM   4118 O O     . LEU D 2 147 ? 13.081  11.123  11.169  1.00 47.90 ? 148 LEU B O     1 
ATOM   4119 C CB    . LEU D 2 147 ? 12.265  8.661   10.183  1.00 44.55 ? 148 LEU B CB    1 
ATOM   4120 C CG    . LEU D 2 147 ? 11.428  7.559   9.525   1.00 43.63 ? 148 LEU B CG    1 
ATOM   4121 C CD1   . LEU D 2 147 ? 11.686  6.214   10.168  1.00 42.92 ? 148 LEU B CD1   1 
ATOM   4122 C CD2   . LEU D 2 147 ? 9.954   7.930   9.566   1.00 42.71 ? 148 LEU B CD2   1 
ATOM   4123 H H     . LEU D 2 147 ? 14.014  8.389   8.322   1.00 0.00  ? 148 LEU B H     1 
ATOM   4124 N N     . LYS D 2 148 ? 13.958  11.844  9.224   1.00 39.72 ? 149 LYS B N     1 
ATOM   4125 C CA    . LYS D 2 148 ? 14.620  13.009  9.783   1.00 36.19 ? 149 LYS B CA    1 
ATOM   4126 C C     . LYS D 2 148 ? 14.372  14.188  8.865   1.00 33.78 ? 149 LYS B C     1 
ATOM   4127 O O     . LYS D 2 148 ? 14.291  14.024  7.657   1.00 32.56 ? 149 LYS B O     1 
ATOM   4128 C CB    . LYS D 2 148 ? 16.125  12.723  9.891   1.00 38.39 ? 149 LYS B CB    1 
ATOM   4129 C CG    . LYS D 2 148 ? 17.066  13.936  9.704   1.00 42.99 ? 149 LYS B CG    1 
ATOM   4130 C CD    . LYS D 2 148 ? 18.555  13.624  10.007  1.00 44.28 ? 149 LYS B CD    1 
ATOM   4131 C CE    . LYS D 2 148 ? 19.113  12.537  9.096   1.00 45.29 ? 149 LYS B CE    1 
ATOM   4132 N NZ    . LYS D 2 148 ? 20.427  11.977  9.547   1.00 47.79 ? 149 LYS B NZ    1 
ATOM   4133 H H     . LYS D 2 148 ? 13.994  11.727  8.250   1.00 0.00  ? 149 LYS B H     1 
ATOM   4134 H HZ1   . LYS D 2 148 ? 21.132  12.740  9.596   1.00 0.00  ? 149 LYS B HZ1   1 
ATOM   4135 H HZ2   . LYS D 2 148 ? 20.320  11.544  10.487  1.00 0.00  ? 149 LYS B HZ2   1 
ATOM   4136 H HZ3   . LYS D 2 148 ? 20.747  11.255  8.869   1.00 0.00  ? 149 LYS B HZ3   1 
ATOM   4137 N N     . THR D 2 149 ? 14.179  15.366  9.433   1.00 33.04 ? 150 THR B N     1 
ATOM   4138 C CA    . THR D 2 149 ? 13.975  16.538  8.605   1.00 31.64 ? 150 THR B CA    1 
ATOM   4139 C C     . THR D 2 149 ? 15.373  17.051  8.274   1.00 30.21 ? 150 THR B C     1 
ATOM   4140 O O     . THR D 2 149 ? 16.352  16.627  8.880   1.00 33.01 ? 150 THR B O     1 
ATOM   4141 C CB    . THR D 2 149 ? 13.134  17.601  9.299   1.00 32.35 ? 150 THR B CB    1 
ATOM   4142 O OG1   . THR D 2 149 ? 13.784  18.020  10.499  1.00 33.17 ? 150 THR B OG1   1 
ATOM   4143 C CG2   . THR D 2 149 ? 11.780  17.036  9.650   1.00 30.49 ? 150 THR B CG2   1 
ATOM   4144 H H     . THR D 2 149 ? 14.225  15.503  10.398  1.00 0.00  ? 150 THR B H     1 
ATOM   4145 H HG1   . THR D 2 149 ? 13.317  18.751  10.903  1.00 0.00  ? 150 THR B HG1   1 
ATOM   4146 N N     . TYR D 2 150 ? 15.473  17.924  7.288   1.00 26.55 ? 151 TYR B N     1 
ATOM   4147 C CA    . TYR D 2 150 ? 16.752  18.435  6.845   1.00 21.91 ? 151 TYR B CA    1 
ATOM   4148 C C     . TYR D 2 150 ? 16.574  19.909  6.679   1.00 24.05 ? 151 TYR B C     1 
ATOM   4149 O O     . TYR D 2 150 ? 15.468  20.434  6.855   1.00 23.82 ? 151 TYR B O     1 
ATOM   4150 C CB    . TYR D 2 150 ? 17.128  17.838  5.489   1.00 19.02 ? 151 TYR B CB    1 
ATOM   4151 C CG    . TYR D 2 150 ? 17.456  16.351  5.503   1.00 16.58 ? 151 TYR B CG    1 
ATOM   4152 C CD1   . TYR D 2 150 ? 16.465  15.389  5.402   1.00 15.22 ? 151 TYR B CD1   1 
ATOM   4153 C CD2   . TYR D 2 150 ? 18.776  15.918  5.579   1.00 18.34 ? 151 TYR B CD2   1 
ATOM   4154 C CE1   . TYR D 2 150 ? 16.786  14.022  5.383   1.00 15.47 ? 151 TYR B CE1   1 
ATOM   4155 C CE2   . TYR D 2 150 ? 19.104  14.573  5.552   1.00 18.91 ? 151 TYR B CE2   1 
ATOM   4156 C CZ    . TYR D 2 150 ? 18.108  13.627  5.463   1.00 17.54 ? 151 TYR B CZ    1 
ATOM   4157 O OH    . TYR D 2 150 ? 18.454  12.282  5.511   1.00 18.56 ? 151 TYR B OH    1 
ATOM   4158 H H     . TYR D 2 150 ? 14.659  18.246  6.844   1.00 0.00  ? 151 TYR B H     1 
ATOM   4159 H HH    . TYR D 2 150 ? 17.644  11.769  5.563   1.00 0.00  ? 151 TYR B HH    1 
ATOM   4160 N N     . ASN D 2 151 ? 17.672  20.595  6.376   1.00 28.13 ? 152 ASN B N     1 
ATOM   4161 C CA    . ASN D 2 151 ? 17.601  22.032  6.177   1.00 29.61 ? 152 ASN B CA    1 
ATOM   4162 C C     . ASN D 2 151 ? 18.045  22.293  4.743   1.00 29.49 ? 152 ASN B C     1 
ATOM   4163 O O     . ASN D 2 151 ? 18.627  21.401  4.115   1.00 28.14 ? 152 ASN B O     1 
ATOM   4164 C CB    . ASN D 2 151 ? 18.452  22.797  7.229   1.00 34.40 ? 152 ASN B CB    1 
ATOM   4165 C CG    . ASN D 2 151 ? 19.957  22.662  7.011   1.00 36.71 ? 152 ASN B CG    1 
ATOM   4166 O OD1   . ASN D 2 151 ? 20.640  23.635  6.661   1.00 41.03 ? 152 ASN B OD1   1 
ATOM   4167 N ND2   . ASN D 2 151 ? 20.479  21.472  7.231   1.00 40.73 ? 152 ASN B ND2   1 
ATOM   4168 H H     . ASN D 2 151 ? 18.507  20.115  6.216   1.00 0.00  ? 152 ASN B H     1 
ATOM   4169 H HD21  . ASN D 2 151 ? 21.445  21.353  7.116   1.00 0.00  ? 152 ASN B HD21  1 
ATOM   4170 H HD22  . ASN D 2 151 ? 19.853  20.791  7.529   1.00 0.00  ? 152 ASN B HD22  1 
ATOM   4171 N N     . ILE D 2 152 ? 17.753  23.487  4.233   1.00 30.61 ? 153 ILE B N     1 
ATOM   4172 C CA    . ILE D 2 152 ? 18.112  23.860  2.865   1.00 36.84 ? 153 ILE B CA    1 
ATOM   4173 C C     . ILE D 2 152 ? 19.555  23.556  2.478   1.00 37.58 ? 153 ILE B C     1 
ATOM   4174 O O     . ILE D 2 152 ? 19.859  23.304  1.313   1.00 39.63 ? 153 ILE B O     1 
ATOM   4175 C CB    . ILE D 2 152 ? 17.882  25.364  2.609   1.00 39.13 ? 153 ILE B CB    1 
ATOM   4176 C CG1   . ILE D 2 152 ? 16.413  25.729  2.835   1.00 41.19 ? 153 ILE B CG1   1 
ATOM   4177 C CG2   . ILE D 2 152 ? 18.268  25.719  1.170   1.00 41.45 ? 153 ILE B CG2   1 
ATOM   4178 C CD1   . ILE D 2 152 ? 16.133  27.236  2.711   1.00 41.41 ? 153 ILE B CD1   1 
ATOM   4179 H H     . ILE D 2 152 ? 17.251  24.122  4.785   1.00 0.00  ? 153 ILE B H     1 
ATOM   4180 N N     . ASN D 2 153 ? 20.439  23.601  3.459   1.00 40.25 ? 154 ASN B N     1 
ATOM   4181 C CA    . ASN D 2 153 ? 21.849  23.364  3.220   1.00 41.81 ? 154 ASN B CA    1 
ATOM   4182 C C     . ASN D 2 153 ? 22.226  21.909  3.086   1.00 41.75 ? 154 ASN B C     1 
ATOM   4183 O O     . ASN D 2 153 ? 23.354  21.595  2.697   1.00 41.78 ? 154 ASN B O     1 
ATOM   4184 C CB    . ASN D 2 153 ? 22.662  24.030  4.321   1.00 46.60 ? 154 ASN B CB    1 
ATOM   4185 C CG    . ASN D 2 153 ? 22.376  25.515  4.408   1.00 50.97 ? 154 ASN B CG    1 
ATOM   4186 O OD1   . ASN D 2 153 ? 22.848  26.297  3.573   1.00 53.61 ? 154 ASN B OD1   1 
ATOM   4187 N ND2   . ASN D 2 153 ? 21.546  25.908  5.372   1.00 53.65 ? 154 ASN B ND2   1 
ATOM   4188 H H     . ASN D 2 153 ? 20.149  23.813  4.367   1.00 0.00  ? 154 ASN B H     1 
ATOM   4189 H HD21  . ASN D 2 153 ? 21.359  26.867  5.415   1.00 0.00  ? 154 ASN B HD21  1 
ATOM   4190 H HD22  . ASN D 2 153 ? 21.178  25.246  5.985   1.00 0.00  ? 154 ASN B HD22  1 
ATOM   4191 N N     . GLU D 2 154 ? 21.279  21.022  3.381   1.00 40.61 ? 155 GLU B N     1 
ATOM   4192 C CA    . GLU D 2 154 ? 21.531  19.592  3.299   1.00 40.11 ? 155 GLU B CA    1 
ATOM   4193 C C     . GLU D 2 154 ? 20.910  18.900  2.094   1.00 38.15 ? 155 GLU B C     1 
ATOM   4194 O O     . GLU D 2 154 ? 21.007  17.679  1.972   1.00 36.23 ? 155 GLU B O     1 
ATOM   4195 C CB    . GLU D 2 154 ? 21.086  18.906  4.581   1.00 42.47 ? 155 GLU B CB    1 
ATOM   4196 C CG    . GLU D 2 154 ? 21.879  19.342  5.787   1.00 45.92 ? 155 GLU B CG    1 
ATOM   4197 C CD    . GLU D 2 154 ? 21.456  18.629  7.043   1.00 48.75 ? 155 GLU B CD    1 
ATOM   4198 O OE1   . GLU D 2 154 ? 20.337  18.908  7.527   1.00 46.78 ? 155 GLU B OE1   1 
ATOM   4199 O OE2   . GLU D 2 154 ? 22.243  17.780  7.538   1.00 49.88 ? 155 GLU B OE2   1 
ATOM   4200 H H     . GLU D 2 154 ? 20.396  21.336  3.632   1.00 0.00  ? 155 GLU B H     1 
ATOM   4201 N N     . LEU D 2 155 ? 20.377  19.691  1.162   1.00 36.42 ? 156 LEU B N     1 
ATOM   4202 C CA    . LEU D 2 155 ? 19.735  19.170  -0.044  1.00 35.12 ? 156 LEU B CA    1 
ATOM   4203 C C     . LEU D 2 155 ? 20.429  18.020  -0.740  1.00 34.66 ? 156 LEU B C     1 
ATOM   4204 O O     . LEU D 2 155 ? 19.780  17.056  -1.153  1.00 34.30 ? 156 LEU B O     1 
ATOM   4205 C CB    . LEU D 2 155 ? 19.514  20.280  -1.056  1.00 34.42 ? 156 LEU B CB    1 
ATOM   4206 C CG    . LEU D 2 155 ? 18.081  20.778  -1.024  1.00 34.29 ? 156 LEU B CG    1 
ATOM   4207 C CD1   . LEU D 2 155 ? 17.910  21.922  -1.980  1.00 34.19 ? 156 LEU B CD1   1 
ATOM   4208 C CD2   . LEU D 2 155 ? 17.155  19.630  -1.380  1.00 34.21 ? 156 LEU B CD2   1 
ATOM   4209 H H     . LEU D 2 155 ? 20.420  20.663  1.281   1.00 0.00  ? 156 LEU B H     1 
ATOM   4210 N N     . ASN D 2 156 ? 21.751  18.077  -0.816  1.00 34.47 ? 157 ASN B N     1 
ATOM   4211 C CA    . ASN D 2 156 ? 22.478  17.034  -1.512  1.00 35.03 ? 157 ASN B CA    1 
ATOM   4212 C C     . ASN D 2 156 ? 22.766  15.726  -0.771  1.00 34.11 ? 157 ASN B C     1 
ATOM   4213 O O     . ASN D 2 156 ? 23.324  14.788  -1.348  1.00 33.15 ? 157 ASN B O     1 
ATOM   4214 C CB    . ASN D 2 156 ? 23.728  17.643  -2.124  1.00 40.64 ? 157 ASN B CB    1 
ATOM   4215 C CG    . ASN D 2 156 ? 23.393  18.787  -3.091  1.00 45.40 ? 157 ASN B CG    1 
ATOM   4216 O OD1   . ASN D 2 156 ? 23.124  19.924  -2.666  1.00 47.21 ? 157 ASN B OD1   1 
ATOM   4217 N ND2   . ASN D 2 156 ? 23.380  18.487  -4.391  1.00 46.15 ? 157 ASN B ND2   1 
ATOM   4218 H H     . ASN D 2 156 ? 22.229  18.839  -0.432  1.00 0.00  ? 157 ASN B H     1 
ATOM   4219 H HD21  . ASN D 2 156 ? 23.150  19.202  -5.016  1.00 0.00  ? 157 ASN B HD21  1 
ATOM   4220 H HD22  . ASN D 2 156 ? 23.588  17.568  -4.667  1.00 0.00  ? 157 ASN B HD22  1 
ATOM   4221 N N     . GLU D 2 157 ? 22.322  15.630  0.480   1.00 33.33 ? 158 GLU B N     1 
ATOM   4222 C CA    . GLU D 2 157 ? 22.524  14.413  1.267   1.00 33.00 ? 158 GLU B CA    1 
ATOM   4223 C C     . GLU D 2 157 ? 21.214  13.641  1.577   1.00 30.33 ? 158 GLU B C     1 
ATOM   4224 O O     . GLU D 2 157 ? 21.236  12.560  2.166   1.00 26.62 ? 158 GLU B O     1 
ATOM   4225 C CB    . GLU D 2 157 ? 23.256  14.757  2.558   1.00 37.19 ? 158 GLU B CB    1 
ATOM   4226 C CG    . GLU D 2 157 ? 22.473  15.646  3.514   1.00 42.15 ? 158 GLU B CG    1 
ATOM   4227 C CD    . GLU D 2 157 ? 23.189  15.794  4.854   1.00 47.13 ? 158 GLU B CD    1 
ATOM   4228 O OE1   . GLU D 2 157 ? 24.211  16.521  4.893   1.00 47.10 ? 158 GLU B OE1   1 
ATOM   4229 O OE2   . GLU D 2 157 ? 22.751  15.162  5.850   1.00 48.22 ? 158 GLU B OE2   1 
ATOM   4230 H H     . GLU D 2 157 ? 21.839  16.376  0.886   1.00 0.00  ? 158 GLU B H     1 
ATOM   4231 N N     . ILE D 2 158 ? 20.086  14.186  1.135   1.00 26.60 ? 159 ILE B N     1 
ATOM   4232 C CA    . ILE D 2 158 ? 18.787  13.593  1.348   1.00 23.66 ? 159 ILE B CA    1 
ATOM   4233 C C     . ILE D 2 158 ? 18.624  12.386  0.430   1.00 27.26 ? 159 ILE B C     1 
ATOM   4234 O O     . ILE D 2 158 ? 18.736  12.500  -0.793  1.00 29.73 ? 159 ILE B O     1 
ATOM   4235 C CB    . ILE D 2 158 ? 17.719  14.617  1.028   1.00 22.91 ? 159 ILE B CB    1 
ATOM   4236 C CG1   . ILE D 2 158 ? 17.972  15.884  1.831   1.00 15.52 ? 159 ILE B CG1   1 
ATOM   4237 C CG2   . ILE D 2 158 ? 16.325  14.032  1.240   1.00 22.97 ? 159 ILE B CG2   1 
ATOM   4238 C CD1   . ILE D 2 158 ? 16.997  16.956  1.585   1.00 17.79 ? 159 ILE B CD1   1 
ATOM   4239 H H     . ILE D 2 158 ? 20.140  15.008  0.609   1.00 0.00  ? 159 ILE B H     1 
ATOM   4240 N N     . PRO D 2 159 ? 18.374  11.205  1.002   1.00 26.60 ? 160 PRO B N     1 
ATOM   4241 C CA    . PRO D 2 159 ? 18.208  10.008  0.178   1.00 28.28 ? 160 PRO B CA    1 
ATOM   4242 C C     . PRO D 2 159 ? 16.928  10.032  -0.658  1.00 29.28 ? 160 PRO B C     1 
ATOM   4243 O O     . PRO D 2 159 ? 15.858  10.395  -0.172  1.00 32.83 ? 160 PRO B O     1 
ATOM   4244 C CB    . PRO D 2 159 ? 18.181  8.880   1.215   1.00 26.03 ? 160 PRO B CB    1 
ATOM   4245 C CG    . PRO D 2 159 ? 17.551  9.532   2.391   1.00 26.39 ? 160 PRO B CG    1 
ATOM   4246 C CD    . PRO D 2 159 ? 18.225  10.884  2.430   1.00 26.12 ? 160 PRO B CD    1 
ATOM   4247 N N     . LYS D 2 160 ? 17.038  9.686   -1.932  1.00 31.04 ? 161 LYS B N     1 
ATOM   4248 C CA    . LYS D 2 160 ? 15.857  9.662   -2.798  1.00 31.68 ? 161 LYS B CA    1 
ATOM   4249 C C     . LYS D 2 160 ? 15.333  8.241   -2.793  1.00 30.47 ? 161 LYS B C     1 
ATOM   4250 O O     . LYS D 2 160 ? 16.103  7.265   -2.738  1.00 29.14 ? 161 LYS B O     1 
ATOM   4251 C CB    . LYS D 2 160 ? 16.193  10.168  -4.194  1.00 34.40 ? 161 LYS B CB    1 
ATOM   4252 C CG    . LYS D 2 160 ? 16.443  11.677  -4.205  1.00 37.90 ? 161 LYS B CG    1 
ATOM   4253 C CD    . LYS D 2 160 ? 17.449  12.060  -5.271  1.00 41.05 ? 161 LYS B CD    1 
ATOM   4254 C CE    . LYS D 2 160 ? 17.715  13.571  -5.275  1.00 44.14 ? 161 LYS B CE    1 
ATOM   4255 N NZ    . LYS D 2 160 ? 18.357  14.097  -4.022  1.00 46.48 ? 161 LYS B NZ    1 
ATOM   4256 H H     . LYS D 2 160 ? 17.904  9.419   -2.298  1.00 0.00  ? 161 LYS B H     1 
ATOM   4257 H HZ1   . LYS D 2 160 ? 17.750  13.877  -3.206  1.00 0.00  ? 161 LYS B HZ1   1 
ATOM   4258 H HZ2   . LYS D 2 160 ? 19.283  13.642  -3.890  1.00 0.00  ? 161 LYS B HZ2   1 
ATOM   4259 H HZ3   . LYS D 2 160 ? 18.483  15.126  -4.090  1.00 0.00  ? 161 LYS B HZ3   1 
ATOM   4260 N N     . PRO D 2 161 ? 14.007  8.101   -2.773  1.00 30.00 ? 162 PRO B N     1 
ATOM   4261 C CA    . PRO D 2 161 ? 13.340  6.795   -2.749  1.00 29.40 ? 162 PRO B CA    1 
ATOM   4262 C C     . PRO D 2 161 ? 13.249  6.022   -4.086  1.00 29.98 ? 162 PRO B C     1 
ATOM   4263 O O     . PRO D 2 161 ? 12.570  4.986   -4.162  1.00 31.96 ? 162 PRO B O     1 
ATOM   4264 C CB    . PRO D 2 161 ? 11.974  7.149   -2.165  1.00 28.94 ? 162 PRO B CB    1 
ATOM   4265 C CG    . PRO D 2 161 ? 11.702  8.505   -2.815  1.00 28.32 ? 162 PRO B CG    1 
ATOM   4266 C CD    . PRO D 2 161 ? 13.039  9.214   -2.752  1.00 29.24 ? 162 PRO B CD    1 
ATOM   4267 N N     . TYR D 2 162 ? 13.953  6.498   -5.112  1.00 28.93 ? 163 TYR B N     1 
ATOM   4268 C CA    . TYR D 2 162 ? 13.958  5.861   -6.434  1.00 29.52 ? 163 TYR B CA    1 
ATOM   4269 C C     . TYR D 2 162 ? 15.353  5.883   -7.058  1.00 30.44 ? 163 TYR B C     1 
ATOM   4270 O O     . TYR D 2 162 ? 16.098  6.841   -6.876  1.00 30.59 ? 163 TYR B O     1 
ATOM   4271 C CB    . TYR D 2 162 ? 12.977  6.568   -7.388  1.00 27.38 ? 163 TYR B CB    1 
ATOM   4272 C CG    . TYR D 2 162 ? 13.173  8.060   -7.510  1.00 27.39 ? 163 TYR B CG    1 
ATOM   4273 C CD1   . TYR D 2 162 ? 14.250  8.587   -8.196  1.00 25.27 ? 163 TYR B CD1   1 
ATOM   4274 C CD2   . TYR D 2 162 ? 12.296  8.936   -6.885  1.00 29.39 ? 163 TYR B CD2   1 
ATOM   4275 C CE1   . TYR D 2 162 ? 14.458  9.938   -8.250  1.00 32.07 ? 163 TYR B CE1   1 
ATOM   4276 C CE2   . TYR D 2 162 ? 12.482  10.299  -6.929  1.00 31.21 ? 163 TYR B CE2   1 
ATOM   4277 C CZ    . TYR D 2 162 ? 13.567  10.804  -7.611  1.00 35.15 ? 163 TYR B CZ    1 
ATOM   4278 O OH    . TYR D 2 162 ? 13.770  12.177  -7.630  1.00 40.64 ? 163 TYR B OH    1 
ATOM   4279 H H     . TYR D 2 162 ? 14.544  7.269   -5.005  1.00 0.00  ? 163 TYR B H     1 
ATOM   4280 H HH    . TYR D 2 162 ? 13.209  12.562  -6.947  1.00 0.00  ? 163 TYR B HH    1 
ATOM   4281 N N     . LYS D 2 163 ? 15.692  4.829   -7.793  1.00 31.84 ? 164 LYS B N     1 
ATOM   4282 C CA    . LYS D 2 163 ? 16.978  4.727   -8.466  1.00 33.12 ? 164 LYS B CA    1 
ATOM   4283 C C     . LYS D 2 163 ? 16.925  5.510   -9.765  1.00 34.58 ? 164 LYS B C     1 
ATOM   4284 O O     . LYS D 2 163 ? 17.929  6.095   -10.186 1.00 38.51 ? 164 LYS B O     1 
ATOM   4285 C CB    . LYS D 2 163 ? 17.294  3.284   -8.847  1.00 33.15 ? 164 LYS B CB    1 
ATOM   4286 C CG    . LYS D 2 163 ? 17.700  2.400   -7.746  1.00 38.25 ? 164 LYS B CG    1 
ATOM   4287 C CD    . LYS D 2 163 ? 17.658  0.976   -8.225  1.00 42.54 ? 164 LYS B CD    1 
ATOM   4288 C CE    . LYS D 2 163 ? 17.795  -0.014  -7.080  1.00 48.15 ? 164 LYS B CE    1 
ATOM   4289 N NZ    . LYS D 2 163 ? 17.211  -1.328  -7.470  1.00 49.75 ? 164 LYS B NZ    1 
ATOM   4290 H H     . LYS D 2 163 ? 15.058  4.099   -7.872  1.00 0.00  ? 164 LYS B H     1 
ATOM   4291 H HZ1   . LYS D 2 163 ? 17.705  -1.692  -8.310  1.00 0.00  ? 164 LYS B HZ1   1 
ATOM   4292 H HZ2   . LYS D 2 163 ? 17.310  -2.008  -6.689  1.00 0.00  ? 164 LYS B HZ2   1 
ATOM   4293 H HZ3   . LYS D 2 163 ? 16.202  -1.202  -7.693  1.00 0.00  ? 164 LYS B HZ3   1 
ATOM   4294 N N     . GLY D 2 164 ? 15.786  5.458   -10.446 1.00 31.79 ? 165 GLY B N     1 
ATOM   4295 C CA    . GLY D 2 164 ? 15.686  6.149   -11.708 1.00 32.00 ? 165 GLY B CA    1 
ATOM   4296 C C     . GLY D 2 164 ? 14.240  6.450   -11.991 1.00 31.70 ? 165 GLY B C     1 
ATOM   4297 O O     . GLY D 2 164 ? 13.386  6.006   -11.215 1.00 34.89 ? 165 GLY B O     1 
ATOM   4298 H H     . GLY D 2 164 ? 14.996  4.997   -10.097 1.00 0.00  ? 165 GLY B H     1 
ATOM   4299 N N     . VAL D 2 165 ? 13.968  7.215   -13.054 1.00 26.67 ? 166 VAL B N     1 
ATOM   4300 C CA    . VAL D 2 165 ? 12.608  7.576   -13.424 1.00 25.58 ? 166 VAL B CA    1 
ATOM   4301 C C     . VAL D 2 165 ? 12.539  7.770   -14.927 1.00 26.04 ? 166 VAL B C     1 
ATOM   4302 O O     . VAL D 2 165 ? 13.368  8.481   -15.490 1.00 26.43 ? 166 VAL B O     1 
ATOM   4303 C CB    . VAL D 2 165 ? 12.164  8.892   -12.751 1.00 24.95 ? 166 VAL B CB    1 
ATOM   4304 C CG1   . VAL D 2 165 ? 10.799  9.305   -13.257 1.00 23.74 ? 166 VAL B CG1   1 
ATOM   4305 C CG2   . VAL D 2 165 ? 12.101  8.724   -11.254 1.00 25.70 ? 166 VAL B CG2   1 
ATOM   4306 H H     . VAL D 2 165 ? 14.683  7.559   -13.629 1.00 0.00  ? 166 VAL B H     1 
ATOM   4307 N N     . LYS D 2 166 ? 11.598  7.085   -15.576 1.00 23.61 ? 167 LYS B N     1 
ATOM   4308 C CA    . LYS D 2 166 ? 11.366  7.203   -17.025 1.00 21.35 ? 167 LYS B CA    1 
ATOM   4309 C C     . LYS D 2 166 ? 9.963   7.769   -17.221 1.00 21.59 ? 167 LYS B C     1 
ATOM   4310 O O     . LYS D 2 166 ? 9.049   7.463   -16.465 1.00 20.36 ? 167 LYS B O     1 
ATOM   4311 C CB    . LYS D 2 166 ? 11.396  5.844   -17.706 1.00 23.01 ? 167 LYS B CB    1 
ATOM   4312 C CG    . LYS D 2 166 ? 12.734  5.137   -17.767 1.00 29.34 ? 167 LYS B CG    1 
ATOM   4313 C CD    . LYS D 2 166 ? 12.510  3.700   -18.257 1.00 34.01 ? 167 LYS B CD    1 
ATOM   4314 C CE    . LYS D 2 166 ? 13.742  2.790   -18.040 1.00 38.27 ? 167 LYS B CE    1 
ATOM   4315 N NZ    . LYS D 2 166 ? 13.455  1.326   -18.281 1.00 42.42 ? 167 LYS B NZ    1 
ATOM   4316 H H     . LYS D 2 166 ? 11.006  6.504   -15.073 1.00 0.00  ? 167 LYS B H     1 
ATOM   4317 H HZ1   . LYS D 2 166 ? 12.697  1.015   -17.639 1.00 0.00  ? 167 LYS B HZ1   1 
ATOM   4318 H HZ2   . LYS D 2 166 ? 13.153  1.197   -19.268 1.00 0.00  ? 167 LYS B HZ2   1 
ATOM   4319 H HZ3   . LYS D 2 166 ? 14.317  0.773   -18.099 1.00 0.00  ? 167 LYS B HZ3   1 
ATOM   4320 N N     . VAL D 2 167 ? 9.786   8.597   -18.235 1.00 22.05 ? 168 VAL B N     1 
ATOM   4321 C CA    . VAL D 2 167 ? 8.479   9.167   -18.517 1.00 21.86 ? 168 VAL B CA    1 
ATOM   4322 C C     . VAL D 2 167 ? 8.164   9.027   -20.020 1.00 22.74 ? 168 VAL B C     1 
ATOM   4323 O O     . VAL D 2 167 ? 9.080   8.848   -20.831 1.00 25.28 ? 168 VAL B O     1 
ATOM   4324 C CB    . VAL D 2 167 ? 8.410   10.607  -18.078 1.00 17.23 ? 168 VAL B CB    1 
ATOM   4325 C CG1   . VAL D 2 167 ? 9.546   11.386  -18.680 1.00 18.97 ? 168 VAL B CG1   1 
ATOM   4326 C CG2   . VAL D 2 167 ? 7.064   11.194  -18.441 1.00 16.48 ? 168 VAL B CG2   1 
ATOM   4327 H H     . VAL D 2 167 ? 10.525  8.811   -18.842 1.00 0.00  ? 168 VAL B H     1 
ATOM   4328 N N     . PHE D 2 168 ? 6.884   8.972   -20.379 1.00 20.53 ? 169 PHE B N     1 
ATOM   4329 C CA    . PHE D 2 168 ? 6.507   8.870   -21.782 1.00 18.59 ? 169 PHE B CA    1 
ATOM   4330 C C     . PHE D 2 168 ? 5.140   9.525   -21.979 1.00 17.34 ? 169 PHE B C     1 
ATOM   4331 O O     . PHE D 2 168 ? 4.440   9.786   -20.998 1.00 16.62 ? 169 PHE B O     1 
ATOM   4332 C CB    . PHE D 2 168 ? 6.557   7.403   -22.275 1.00 16.39 ? 169 PHE B CB    1 
ATOM   4333 C CG    . PHE D 2 168 ? 5.474   6.502   -21.698 1.00 15.90 ? 169 PHE B CG    1 
ATOM   4334 C CD1   . PHE D 2 168 ? 4.144   6.622   -22.107 1.00 15.16 ? 169 PHE B CD1   1 
ATOM   4335 C CD2   . PHE D 2 168 ? 5.784   5.549   -20.745 1.00 14.78 ? 169 PHE B CD2   1 
ATOM   4336 C CE1   . PHE D 2 168 ? 3.139   5.817   -21.578 1.00 13.88 ? 169 PHE B CE1   1 
ATOM   4337 C CE2   . PHE D 2 168 ? 4.775   4.731   -20.210 1.00 19.56 ? 169 PHE B CE2   1 
ATOM   4338 C CZ    . PHE D 2 168 ? 3.454   4.870   -20.629 1.00 13.30 ? 169 PHE B CZ    1 
ATOM   4339 H H     . PHE D 2 168 ? 6.176   9.008   -19.693 1.00 0.00  ? 169 PHE B H     1 
ATOM   4340 N N     . LEU D 2 169 ? 4.862   9.982   -23.203 1.00 16.31 ? 170 LEU B N     1 
ATOM   4341 C CA    . LEU D 2 169 ? 3.557   10.555  -23.527 1.00 13.17 ? 170 LEU B CA    1 
ATOM   4342 C C     . LEU D 2 169 ? 3.045   9.679   -24.660 1.00 16.65 ? 170 LEU B C     1 
ATOM   4343 O O     . LEU D 2 169 ? 3.771   9.434   -25.623 1.00 16.49 ? 170 LEU B O     1 
ATOM   4344 C CB    . LEU D 2 169 ? 3.641   11.995  -23.969 1.00 10.73 ? 170 LEU B CB    1 
ATOM   4345 C CG    . LEU D 2 169 ? 2.273   12.660  -24.160 1.00 10.85 ? 170 LEU B CG    1 
ATOM   4346 C CD1   . LEU D 2 169 ? 2.347   14.073  -23.762 1.00 9.65  ? 170 LEU B CD1   1 
ATOM   4347 C CD2   . LEU D 2 169 ? 1.846   12.593  -25.628 1.00 18.41 ? 170 LEU B CD2   1 
ATOM   4348 H H     . LEU D 2 169 ? 5.506   9.907   -23.936 1.00 0.00  ? 170 LEU B H     1 
ATOM   4349 N N     . GLN D 2 170 ? 1.824   9.166   -24.532 1.00 15.48 ? 171 GLN B N     1 
ATOM   4350 C CA    . GLN D 2 170 ? 1.284   8.305   -25.561 1.00 14.91 ? 171 GLN B CA    1 
ATOM   4351 C C     . GLN D 2 170 ? -0.221  8.366   -25.522 1.00 16.66 ? 171 GLN B C     1 
ATOM   4352 O O     . GLN D 2 170 ? -0.805  8.771   -24.507 1.00 15.16 ? 171 GLN B O     1 
ATOM   4353 C CB    . GLN D 2 170 ? 1.780   6.888   -25.325 1.00 16.14 ? 171 GLN B CB    1 
ATOM   4354 C CG    . GLN D 2 170 ? 1.410   5.880   -26.396 1.00 20.97 ? 171 GLN B CG    1 
ATOM   4355 C CD    . GLN D 2 170 ? 1.883   6.309   -27.769 1.00 18.58 ? 171 GLN B CD    1 
ATOM   4356 O OE1   . GLN D 2 170 ? 1.220   7.097   -28.431 1.00 17.84 ? 171 GLN B OE1   1 
ATOM   4357 N NE2   . GLN D 2 170 ? 3.034   5.816   -28.183 1.00 16.17 ? 171 GLN B NE2   1 
ATOM   4358 H H     . GLN D 2 170 ? 1.276   9.349   -23.737 1.00 0.00  ? 171 GLN B H     1 
ATOM   4359 H HE21  . GLN D 2 170 ? 3.368   6.086   -29.060 1.00 0.00  ? 171 GLN B HE21  1 
ATOM   4360 H HE22  . GLN D 2 170 ? 3.522   5.211   -27.580 1.00 0.00  ? 171 GLN B HE22  1 
ATOM   4361 N N     . ASP D 2 171 ? -0.854  8.010   -26.639 1.00 15.10 ? 172 ASP B N     1 
ATOM   4362 C CA    . ASP D 2 171 ? -2.311  7.995   -26.711 1.00 14.19 ? 172 ASP B CA    1 
ATOM   4363 C C     . ASP D 2 171 ? -2.812  6.795   -25.927 1.00 13.92 ? 172 ASP B C     1 
ATOM   4364 O O     . ASP D 2 171 ? -2.305  5.685   -26.076 1.00 11.97 ? 172 ASP B O     1 
ATOM   4365 C CB    . ASP D 2 171 ? -2.802  7.897   -28.158 1.00 11.36 ? 172 ASP B CB    1 
ATOM   4366 C CG    . ASP D 2 171 ? -2.561  9.153   -28.919 1.00 11.27 ? 172 ASP B CG    1 
ATOM   4367 O OD1   . ASP D 2 171 ? -3.415  10.066  -28.877 1.00 16.09 ? 172 ASP B OD1   1 
ATOM   4368 O OD2   . ASP D 2 171 ? -1.491  9.257   -29.525 1.00 17.87 ? 172 ASP B OD2   1 
ATOM   4369 H H     . ASP D 2 171 ? -0.330  7.751   -27.426 1.00 0.00  ? 172 ASP B H     1 
ATOM   4370 N N     . LYS D 2 172 ? -3.823  7.041   -25.108 1.00 13.12 ? 173 LYS B N     1 
ATOM   4371 C CA    . LYS D 2 172 ? -4.414  6.013   -24.290 1.00 12.58 ? 173 LYS B CA    1 
ATOM   4372 C C     . LYS D 2 172 ? -4.794  4.742   -25.060 1.00 12.24 ? 173 LYS B C     1 
ATOM   4373 O O     . LYS D 2 172 ? -4.451  3.602   -24.653 1.00 10.93 ? 173 LYS B O     1 
ATOM   4374 C CB    . LYS D 2 172 ? -5.650  6.618   -23.602 1.00 14.15 ? 173 LYS B CB    1 
ATOM   4375 C CG    . LYS D 2 172 ? -6.381  5.665   -22.667 1.00 17.28 ? 173 LYS B CG    1 
ATOM   4376 C CD    . LYS D 2 172 ? -7.053  6.445   -21.575 1.00 18.61 ? 173 LYS B CD    1 
ATOM   4377 C CE    . LYS D 2 172 ? -8.275  5.765   -21.008 1.00 21.74 ? 173 LYS B CE    1 
ATOM   4378 N NZ    . LYS D 2 172 ? -8.952  6.785   -20.148 1.00 18.41 ? 173 LYS B NZ    1 
ATOM   4379 H H     . LYS D 2 172 ? -4.188  7.948   -25.072 1.00 0.00  ? 173 LYS B H     1 
ATOM   4380 H HZ1   . LYS D 2 172 ? -9.151  7.623   -20.728 1.00 0.00  ? 173 LYS B HZ1   1 
ATOM   4381 H HZ2   . LYS D 2 172 ? -9.836  6.405   -19.768 1.00 0.00  ? 173 LYS B HZ2   1 
ATOM   4382 H HZ3   . LYS D 2 172 ? -8.323  7.071   -19.372 1.00 0.00  ? 173 LYS B HZ3   1 
ATOM   4383 N N     . TRP D 2 173 ? -5.454  4.921   -26.213 1.00 14.08 ? 174 TRP B N     1 
ATOM   4384 C CA    . TRP D 2 173 ? -5.910  3.772   -26.993 1.00 14.12 ? 174 TRP B CA    1 
ATOM   4385 C C     . TRP D 2 173 ? -4.818  2.879   -27.483 1.00 13.70 ? 174 TRP B C     1 
ATOM   4386 O O     . TRP D 2 173 ? -5.010  1.672   -27.594 1.00 16.13 ? 174 TRP B O     1 
ATOM   4387 C CB    . TRP D 2 173 ? -6.818  4.214   -28.139 1.00 14.15 ? 174 TRP B CB    1 
ATOM   4388 C CG    . TRP D 2 173 ? -6.106  4.656   -29.368 1.00 14.34 ? 174 TRP B CG    1 
ATOM   4389 C CD1   . TRP D 2 173 ? -5.921  5.933   -29.787 1.00 13.55 ? 174 TRP B CD1   1 
ATOM   4390 C CD2   . TRP D 2 173 ? -5.599  3.807   -30.418 1.00 14.91 ? 174 TRP B CD2   1 
ATOM   4391 N NE1   . TRP D 2 173 ? -5.360  5.936   -31.037 1.00 13.76 ? 174 TRP B NE1   1 
ATOM   4392 C CE2   . TRP D 2 173 ? -5.153  4.643   -31.448 1.00 13.22 ? 174 TRP B CE2   1 
ATOM   4393 C CE3   . TRP D 2 173 ? -5.484  2.413   -30.582 1.00 12.78 ? 174 TRP B CE3   1 
ATOM   4394 C CZ2   . TRP D 2 173 ? -4.602  4.139   -32.633 1.00 16.51 ? 174 TRP B CZ2   1 
ATOM   4395 C CZ3   . TRP D 2 173 ? -4.926  1.912   -31.774 1.00 13.89 ? 174 TRP B CZ3   1 
ATOM   4396 C CH2   . TRP D 2 173 ? -4.500  2.768   -32.771 1.00 13.86 ? 174 TRP B CH2   1 
ATOM   4397 H H     . TRP D 2 173 ? -5.632  5.831   -26.538 1.00 0.00  ? 174 TRP B H     1 
ATOM   4398 H HE1   . TRP D 2 173 ? -5.122  6.749   -31.543 1.00 0.00  ? 174 TRP B HE1   1 
ATOM   4399 N N     . VAL D 2 174 ? -3.645  3.468   -27.702 1.00 14.37 ? 175 VAL B N     1 
ATOM   4400 C CA    . VAL D 2 174 ? -2.479  2.752   -28.228 1.00 13.55 ? 175 VAL B CA    1 
ATOM   4401 C C     . VAL D 2 174 ? -1.861  1.787   -27.233 1.00 16.45 ? 175 VAL B C     1 
ATOM   4402 O O     . VAL D 2 174 ? -1.336  0.718   -27.606 1.00 16.17 ? 175 VAL B O     1 
ATOM   4403 C CB    . VAL D 2 174 ? -1.384  3.759   -28.698 1.00 13.10 ? 175 VAL B CB    1 
ATOM   4404 C CG1   . VAL D 2 174 ? -0.193  3.032   -29.177 1.00 14.15 ? 175 VAL B CG1   1 
ATOM   4405 C CG2   . VAL D 2 174 ? -1.894  4.606   -29.839 1.00 12.92 ? 175 VAL B CG2   1 
ATOM   4406 H H     . VAL D 2 174 ? -3.550  4.419   -27.489 1.00 0.00  ? 175 VAL B H     1 
ATOM   4407 N N     . ILE D 2 175 ? -1.950  2.160   -25.954 1.00 18.25 ? 176 ILE B N     1 
ATOM   4408 C CA    . ILE D 2 175 ? -1.373  1.374   -24.868 1.00 17.61 ? 176 ILE B CA    1 
ATOM   4409 C C     . ILE D 2 175 ? -2.343  0.513   -24.070 1.00 15.42 ? 176 ILE B C     1 
ATOM   4410 O O     . ILE D 2 175 ? -1.918  -0.339  -23.328 1.00 18.18 ? 176 ILE B O     1 
ATOM   4411 C CB    . ILE D 2 175 ? -0.495  2.257   -23.918 1.00 17.77 ? 176 ILE B CB    1 
ATOM   4412 C CG1   . ILE D 2 175 ? -1.319  3.381   -23.297 1.00 15.20 ? 176 ILE B CG1   1 
ATOM   4413 C CG2   . ILE D 2 175 ? 0.727   2.809   -24.691 1.00 15.49 ? 176 ILE B CG2   1 
ATOM   4414 C CD1   . ILE D 2 175 ? -0.606  4.076   -22.186 1.00 17.35 ? 176 ILE B CD1   1 
ATOM   4415 H H     . ILE D 2 175 ? -2.435  2.979   -25.728 1.00 0.00  ? 176 ILE B H     1 
ATOM   4416 N N     . ALA D 2 176 ? -3.637  0.727   -24.228 1.00 16.82 ? 177 ALA B N     1 
ATOM   4417 C CA    . ALA D 2 176 ? -4.640  -0.088  -23.561 1.00 15.19 ? 177 ALA B CA    1 
ATOM   4418 C C     . ALA D 2 176 ? -4.461  -1.563  -23.912 1.00 13.09 ? 177 ALA B C     1 
ATOM   4419 O O     . ALA D 2 176 ? -3.984  -1.933  -24.994 1.00 15.52 ? 177 ALA B O     1 
ATOM   4420 C CB    . ALA D 2 176 ? -6.052  0.385   -23.936 1.00 11.33 ? 177 ALA B CB    1 
ATOM   4421 H H     . ALA D 2 176 ? -3.929  1.457   -24.811 1.00 0.00  ? 177 ALA B H     1 
ATOM   4422 N N     . GLY D 2 177 ? -4.836  -2.417  -22.976 1.00 9.58  ? 178 GLY B N     1 
ATOM   4423 C CA    . GLY D 2 177 ? -4.706  -3.838  -23.181 1.00 7.13  ? 178 GLY B CA    1 
ATOM   4424 C C     . GLY D 2 177 ? -6.106  -4.401  -23.212 1.00 6.34  ? 178 GLY B C     1 
ATOM   4425 O O     . GLY D 2 177 ? -7.099  -3.650  -23.309 1.00 8.43  ? 178 GLY B O     1 
ATOM   4426 H H     . GLY D 2 177 ? -5.272  -2.091  -22.169 1.00 0.00  ? 178 GLY B H     1 
ATOM   4427 N N     . ASP D 2 178 ? -6.210  -5.713  -23.106 1.00 9.90  ? 179 ASP B N     1 
ATOM   4428 C CA    . ASP D 2 178 ? -7.517  -6.340  -23.148 1.00 13.28 ? 179 ASP B CA    1 
ATOM   4429 C C     . ASP D 2 178 ? -7.988  -6.956  -21.797 1.00 16.96 ? 179 ASP B C     1 
ATOM   4430 O O     . ASP D 2 178 ? -9.087  -7.513  -21.706 1.00 15.76 ? 179 ASP B O     1 
ATOM   4431 C CB    . ASP D 2 178 ? -7.560  -7.374  -24.301 1.00 8.81  ? 179 ASP B CB    1 
ATOM   4432 C CG    . ASP D 2 178 ? -6.492  -8.410  -24.173 1.00 9.62  ? 179 ASP B CG    1 
ATOM   4433 O OD1   . ASP D 2 178 ? -5.565  -8.198  -23.367 1.00 13.63 ? 179 ASP B OD1   1 
ATOM   4434 O OD2   . ASP D 2 178 ? -6.578  -9.453  -24.845 1.00 11.45 ? 179 ASP B OD2   1 
ATOM   4435 H H     . ASP D 2 178 ? -5.389  -6.226  -22.997 1.00 0.00  ? 179 ASP B H     1 
ATOM   4436 N N     . LEU D 2 179 ? -7.149  -6.855  -20.767 1.00 18.03 ? 180 LEU B N     1 
ATOM   4437 C CA    . LEU D 2 179 ? -7.467  -7.394  -19.443 1.00 17.22 ? 180 LEU B CA    1 
ATOM   4438 C C     . LEU D 2 179 ? -7.667  -6.247  -18.465 1.00 16.31 ? 180 LEU B C     1 
ATOM   4439 O O     . LEU D 2 179 ? -7.031  -5.209  -18.579 1.00 15.80 ? 180 LEU B O     1 
ATOM   4440 C CB    . LEU D 2 179 ? -6.349  -8.301  -18.957 1.00 15.81 ? 180 LEU B CB    1 
ATOM   4441 C CG    . LEU D 2 179 ? -6.026  -9.535  -19.795 1.00 18.93 ? 180 LEU B CG    1 
ATOM   4442 C CD1   . LEU D 2 179 ? -4.888  -10.255 -19.113 1.00 23.48 ? 180 LEU B CD1   1 
ATOM   4443 C CD2   . LEU D 2 179 ? -7.225  -10.461 -19.945 1.00 19.80 ? 180 LEU B CD2   1 
ATOM   4444 H H     . LEU D 2 179 ? -6.315  -6.359  -20.851 1.00 0.00  ? 180 LEU B H     1 
ATOM   4445 N N     . ALA D 2 180 ? -8.578  -6.415  -17.520 1.00 16.79 ? 181 ALA B N     1 
ATOM   4446 C CA    . ALA D 2 180 ? -8.863  -5.371  -16.544 1.00 17.26 ? 181 ALA B CA    1 
ATOM   4447 C C     . ALA D 2 180 ? -7.652  -4.998  -15.686 1.00 18.69 ? 181 ALA B C     1 
ATOM   4448 O O     . ALA D 2 180 ? -6.804  -5.839  -15.397 1.00 19.51 ? 181 ALA B O     1 
ATOM   4449 C CB    . ALA D 2 180 ? -10.009 -5.789  -15.670 1.00 17.63 ? 181 ALA B CB    1 
ATOM   4450 H H     . ALA D 2 180 ? -9.075  -7.257  -17.480 1.00 0.00  ? 181 ALA B H     1 
ATOM   4451 N N     . GLY D 2 181 ? -7.536  -3.719  -15.355 1.00 19.29 ? 182 GLY B N     1 
ATOM   4452 C CA    . GLY D 2 181 ? -6.439  -3.282  -14.525 1.00 19.50 ? 182 GLY B CA    1 
ATOM   4453 C C     . GLY D 2 181 ? -6.745  -3.514  -13.055 1.00 21.70 ? 182 GLY B C     1 
ATOM   4454 O O     . GLY D 2 181 ? -5.837  -3.771  -12.268 1.00 23.95 ? 182 GLY B O     1 
ATOM   4455 H H     . GLY D 2 181 ? -8.164  -3.090  -15.722 1.00 0.00  ? 182 GLY B H     1 
ATOM   4456 N N     . SER D 2 182 ? -8.017  -3.386  -12.673 1.00 21.40 ? 183 SER B N     1 
ATOM   4457 C CA    . SER D 2 182 ? -8.460  -3.607  -11.296 1.00 21.28 ? 183 SER B CA    1 
ATOM   4458 C C     . SER D 2 182 ? -9.840  -4.246  -11.272 1.00 19.59 ? 183 SER B C     1 
ATOM   4459 O O     . SER D 2 182 ? -10.623 -4.048  -12.181 1.00 19.57 ? 183 SER B O     1 
ATOM   4460 C CB    . SER D 2 182 ? -8.495  -2.297  -10.514 1.00 18.17 ? 183 SER B CB    1 
ATOM   4461 O OG    . SER D 2 182 ? -9.554  -1.490  -10.952 1.00 24.66 ? 183 SER B OG    1 
ATOM   4462 H H     . SER D 2 182 ? -8.712  -3.159  -13.322 1.00 0.00  ? 183 SER B H     1 
ATOM   4463 H HG    . SER D 2 182 ? -9.706  -0.824  -10.270 1.00 0.00  ? 183 SER B HG    1 
ATOM   4464 N N     . GLY D 2 183 ? -10.155 -4.932  -10.175 1.00 21.11 ? 184 GLY B N     1 
ATOM   4465 C CA    . GLY D 2 183 ? -11.436 -5.601  -10.024 1.00 19.33 ? 184 GLY B CA    1 
ATOM   4466 C C     . GLY D 2 183 ? -12.545 -4.706  -9.519  1.00 18.54 ? 184 GLY B C     1 
ATOM   4467 O O     . GLY D 2 183 ? -13.251 -4.082  -10.308 1.00 21.60 ? 184 GLY B O     1 
ATOM   4468 H H     . GLY D 2 183 ? -9.501  -5.013  -9.471  1.00 0.00  ? 184 GLY B H     1 
ATOM   4469 N N     . ASN D 2 184 ? -12.682 -4.582  -8.209  1.00 16.98 ? 185 ASN B N     1 
ATOM   4470 C CA    . ASN D 2 184 ? -13.749 -3.763  -7.670  1.00 16.67 ? 185 ASN B CA    1 
ATOM   4471 C C     . ASN D 2 184 ? -13.850 -2.328  -8.197  1.00 16.33 ? 185 ASN B C     1 
ATOM   4472 O O     . ASN D 2 184 ? -14.925 -1.729  -8.153  1.00 14.17 ? 185 ASN B O     1 
ATOM   4473 C CB    . ASN D 2 184 ? -13.727 -3.791  -6.121  1.00 19.22 ? 185 ASN B CB    1 
ATOM   4474 C CG    . ASN D 2 184 ? -12.383 -3.382  -5.520  1.00 20.74 ? 185 ASN B CG    1 
ATOM   4475 O OD1   . ASN D 2 184 ? -11.475 -2.887  -6.202  1.00 18.98 ? 185 ASN B OD1   1 
ATOM   4476 N ND2   . ASN D 2 184 ? -12.244 -3.610  -4.221  1.00 23.90 ? 185 ASN B ND2   1 
ATOM   4477 H H     . ASN D 2 184 ? -12.072 -5.027  -7.601  1.00 0.00  ? 185 ASN B H     1 
ATOM   4478 H HD21  . ASN D 2 184 ? -11.398 -3.365  -3.797  1.00 0.00  ? 185 ASN B HD21  1 
ATOM   4479 H HD22  . ASN D 2 184 ? -12.991 -4.028  -3.733  1.00 0.00  ? 185 ASN B HD22  1 
ATOM   4480 N N     . THR D 2 185 ? -12.741 -1.744  -8.653  1.00 16.27 ? 186 THR B N     1 
ATOM   4481 C CA    . THR D 2 185 ? -12.796 -0.374  -9.164  1.00 15.79 ? 186 THR B CA    1 
ATOM   4482 C C     . THR D 2 185 ? -12.757 -0.308  -10.701 1.00 15.64 ? 186 THR B C     1 
ATOM   4483 O O     . THR D 2 185 ? -12.370 0.726   -11.286 1.00 15.83 ? 186 THR B O     1 
ATOM   4484 C CB    . THR D 2 185 ? -11.704 0.509   -8.557  1.00 16.57 ? 186 THR B CB    1 
ATOM   4485 O OG1   . THR D 2 185 ? -10.438 -0.140  -8.735  1.00 17.42 ? 186 THR B OG1   1 
ATOM   4486 C CG2   . THR D 2 185 ? -11.963 0.738   -7.078  1.00 16.85 ? 186 THR B CG2   1 
ATOM   4487 H H     . THR D 2 185 ? -11.872 -2.192  -8.614  1.00 0.00  ? 186 THR B H     1 
ATOM   4488 H HG1   . THR D 2 185 ? -9.742  0.375   -8.306  1.00 0.00  ? 186 THR B HG1   1 
ATOM   4489 N N     . THR D 2 186 ? -13.105 -1.435  -11.319 1.00 14.34 ? 187 THR B N     1 
ATOM   4490 C CA    . THR D 2 186 ? -13.240 -1.606  -12.771 1.00 14.07 ? 187 THR B CA    1 
ATOM   4491 C C     . THR D 2 186 ? -12.385 -0.649  -13.621 1.00 13.34 ? 187 THR B C     1 
ATOM   4492 O O     . THR D 2 186 ? -12.893 0.291   -14.231 1.00 12.99 ? 187 THR B O     1 
ATOM   4493 C CB    . THR D 2 186 ? -14.705 -1.438  -13.163 1.00 11.59 ? 187 THR B CB    1 
ATOM   4494 O OG1   . THR D 2 186 ? -15.179 -0.203  -12.646 1.00 10.63 ? 187 THR B OG1   1 
ATOM   4495 C CG2   . THR D 2 186 ? -15.564 -2.524  -12.588 1.00 13.92 ? 187 THR B CG2   1 
ATOM   4496 H H     . THR D 2 186 ? -13.300 -2.217  -10.768 1.00 0.00  ? 187 THR B H     1 
ATOM   4497 H HG1   . THR D 2 186 ? -14.597 0.501   -12.977 1.00 0.00  ? 187 THR B HG1   1 
ATOM   4498 N N     . ASN D 2 187 ? -11.085 -0.915  -13.661 1.00 13.75 ? 188 ASN B N     1 
ATOM   4499 C CA    . ASN D 2 187 ? -10.161 -0.083  -14.391 1.00 12.37 ? 188 ASN B CA    1 
ATOM   4500 C C     . ASN D 2 187 ? -9.687  -0.825  -15.595 1.00 11.55 ? 188 ASN B C     1 
ATOM   4501 O O     . ASN D 2 187 ? -9.587  -2.057  -15.579 1.00 12.23 ? 188 ASN B O     1 
ATOM   4502 C CB    . ASN D 2 187 ? -8.950  0.253   -13.517 1.00 11.65 ? 188 ASN B CB    1 
ATOM   4503 C CG    . ASN D 2 187 ? -9.014  1.629   -12.967 1.00 12.75 ? 188 ASN B CG    1 
ATOM   4504 O OD1   . ASN D 2 187 ? -8.140  2.432   -13.247 1.00 15.09 ? 188 ASN B OD1   1 
ATOM   4505 N ND2   . ASN D 2 187 ? -10.070 1.942   -12.206 1.00 13.53 ? 188 ASN B ND2   1 
ATOM   4506 H H     . ASN D 2 187 ? -10.747 -1.704  -13.185 1.00 0.00  ? 188 ASN B H     1 
ATOM   4507 H HD21  . ASN D 2 187 ? -10.143 2.814   -11.795 1.00 0.00  ? 188 ASN B HD21  1 
ATOM   4508 H HD22  . ASN D 2 187 ? -10.746 1.247   -12.068 1.00 0.00  ? 188 ASN B HD22  1 
ATOM   4509 N N     . ILE D 2 188 ? -9.350  -0.062  -16.629 1.00 13.19 ? 189 ILE B N     1 
ATOM   4510 C CA    . ILE D 2 188 ? -8.814  -0.618  -17.874 1.00 11.61 ? 189 ILE B CA    1 
ATOM   4511 C C     . ILE D 2 188 ? -7.345  -0.975  -17.625 1.00 12.51 ? 189 ILE B C     1 
ATOM   4512 O O     . ILE D 2 188 ? -6.627  -0.228  -16.950 1.00 12.06 ? 189 ILE B O     1 
ATOM   4513 C CB    . ILE D 2 188 ? -8.887  0.464   -19.006 1.00 12.11 ? 189 ILE B CB    1 
ATOM   4514 C CG1   . ILE D 2 188 ? -10.340 0.829   -19.291 1.00 8.37  ? 189 ILE B CG1   1 
ATOM   4515 C CG2   . ILE D 2 188 ? -8.196  -0.030  -20.297 1.00 14.36 ? 189 ILE B CG2   1 
ATOM   4516 C CD1   . ILE D 2 188 ? -10.509 1.828   -20.405 1.00 14.71 ? 189 ILE B CD1   1 
ATOM   4517 H H     . ILE D 2 188 ? -9.421  0.893   -16.574 1.00 0.00  ? 189 ILE B H     1 
ATOM   4518 N N     . GLY D 2 189 ? -6.911  -2.128  -18.099 1.00 12.86 ? 190 GLY B N     1 
ATOM   4519 C CA    . GLY D 2 189 ? -5.514  -2.481  -17.966 1.00 12.78 ? 190 GLY B CA    1 
ATOM   4520 C C     . GLY D 2 189 ? -4.778  -2.068  -19.254 1.00 17.70 ? 190 GLY B C     1 
ATOM   4521 O O     . GLY D 2 189 ? -5.389  -2.038  -20.341 1.00 19.85 ? 190 GLY B O     1 
ATOM   4522 H H     . GLY D 2 189 ? -7.485  -2.757  -18.586 1.00 0.00  ? 190 GLY B H     1 
ATOM   4523 N N     . SER D 2 190 ? -3.518  -1.652  -19.132 1.00 13.53 ? 191 SER B N     1 
ATOM   4524 C CA    . SER D 2 190 ? -2.711  -1.262  -20.280 1.00 14.53 ? 191 SER B CA    1 
ATOM   4525 C C     . SER D 2 190 ? -1.989  -2.530  -20.673 1.00 16.30 ? 191 SER B C     1 
ATOM   4526 O O     . SER D 2 190 ? -2.049  -3.540  -19.941 1.00 14.83 ? 191 SER B O     1 
ATOM   4527 C CB    . SER D 2 190 ? -1.650  -0.245  -19.871 1.00 15.31 ? 191 SER B CB    1 
ATOM   4528 O OG    . SER D 2 190 ? -0.547  -0.910  -19.242 1.00 18.46 ? 191 SER B OG    1 
ATOM   4529 H H     . SER D 2 190 ? -3.093  -1.646  -18.254 1.00 0.00  ? 191 SER B H     1 
ATOM   4530 H HG    . SER D 2 190 ? -0.021  -1.457  -19.845 1.00 0.00  ? 191 SER B HG    1 
ATOM   4531 N N     . ILE D 2 191 ? -1.255  -2.482  -21.785 1.00 15.31 ? 192 ILE B N     1 
ATOM   4532 C CA    . ILE D 2 191 ? -0.495  -3.659  -22.194 1.00 15.94 ? 192 ILE B CA    1 
ATOM   4533 C C     . ILE D 2 191 ? 0.520   -3.918  -21.094 1.00 17.40 ? 192 ILE B C     1 
ATOM   4534 O O     . ILE D 2 191 ? 0.865   -3.018  -20.337 1.00 16.51 ? 192 ILE B O     1 
ATOM   4535 C CB    . ILE D 2 191 ? 0.274   -3.452  -23.547 1.00 16.62 ? 192 ILE B CB    1 
ATOM   4536 C CG1   . ILE D 2 191 ? 1.142   -2.181  -23.462 1.00 13.30 ? 192 ILE B CG1   1 
ATOM   4537 C CG2   . ILE D 2 191 ? -0.719  -3.435  -24.717 1.00 14.42 ? 192 ILE B CG2   1 
ATOM   4538 C CD1   . ILE D 2 191 ? 1.860   -1.807  -24.729 1.00 13.77 ? 192 ILE B CD1   1 
ATOM   4539 H H     . ILE D 2 191 ? -1.202  -1.667  -22.312 1.00 0.00  ? 192 ILE B H     1 
ATOM   4540 N N     . HIS D 2 192 ? 0.954   -5.161  -20.989 1.00 18.93 ? 193 HIS B N     1 
ATOM   4541 C CA    . HIS D 2 192 ? 1.957   -5.532  -20.024 1.00 22.95 ? 193 HIS B CA    1 
ATOM   4542 C C     . HIS D 2 192 ? 3.221   -5.726  -20.828 1.00 23.88 ? 193 HIS B C     1 
ATOM   4543 O O     . HIS D 2 192 ? 3.477   -6.838  -21.287 1.00 26.30 ? 193 HIS B O     1 
ATOM   4544 C CB    . HIS D 2 192 ? 1.594   -6.848  -19.366 1.00 27.03 ? 193 HIS B CB    1 
ATOM   4545 C CG    . HIS D 2 192 ? 2.695   -7.393  -18.524 1.00 34.40 ? 193 HIS B CG    1 
ATOM   4546 N ND1   . HIS D 2 192 ? 3.307   -6.647  -17.537 1.00 36.59 ? 193 HIS B ND1   1 
ATOM   4547 C CD2   . HIS D 2 192 ? 3.350   -8.577  -18.568 1.00 36.64 ? 193 HIS B CD2   1 
ATOM   4548 C CE1   . HIS D 2 192 ? 4.294   -7.346  -17.012 1.00 37.54 ? 193 HIS B CE1   1 
ATOM   4549 N NE2   . HIS D 2 192 ? 4.342   -8.521  -17.620 1.00 39.33 ? 193 HIS B NE2   1 
ATOM   4550 H H     . HIS D 2 192 ? 0.601   -5.846  -21.590 1.00 0.00  ? 193 HIS B H     1 
ATOM   4551 H HD1   . HIS D 2 192 ? 3.080   -5.723  -17.277 1.00 0.00  ? 193 HIS B HD1   1 
ATOM   4552 H HE2   . HIS D 2 192 ? 4.990   -9.235  -17.432 1.00 0.00  ? 193 HIS B HE2   1 
ATOM   4553 N N     . ALA D 2 193 ? 4.064   -4.699  -20.903 1.00 23.84 ? 194 ALA B N     1 
ATOM   4554 C CA    . ALA D 2 193 ? 5.263   -4.778  -21.723 1.00 24.55 ? 194 ALA B CA    1 
ATOM   4555 C C     . ALA D 2 193 ? 6.405   -3.911  -21.233 1.00 25.29 ? 194 ALA B C     1 
ATOM   4556 O O     . ALA D 2 193 ? 6.319   -3.315  -20.172 1.00 24.87 ? 194 ALA B O     1 
ATOM   4557 C CB    . ALA D 2 193 ? 4.902   -4.367  -23.141 1.00 24.88 ? 194 ALA B CB    1 
ATOM   4558 H H     . ALA D 2 193 ? 3.900   -3.871  -20.392 1.00 0.00  ? 194 ALA B H     1 
ATOM   4559 N N     . HIS D 2 194 ? 7.463   -3.833  -22.038 1.00 26.29 ? 195 HIS B N     1 
ATOM   4560 C CA    . HIS D 2 194 ? 8.647   -3.025  -21.733 1.00 26.77 ? 195 HIS B CA    1 
ATOM   4561 C C     . HIS D 2 194 ? 8.416   -1.546  -22.030 1.00 25.19 ? 195 HIS B C     1 
ATOM   4562 O O     . HIS D 2 194 ? 7.572   -1.206  -22.854 1.00 27.29 ? 195 HIS B O     1 
ATOM   4563 C CB    . HIS D 2 194 ? 9.851   -3.515  -22.544 1.00 27.67 ? 195 HIS B CB    1 
ATOM   4564 C CG    . HIS D 2 194 ? 10.263  -4.921  -22.231 1.00 29.93 ? 195 HIS B CG    1 
ATOM   4565 N ND1   . HIS D 2 194 ? 10.684  -5.314  -20.979 1.00 33.22 ? 195 HIS B ND1   1 
ATOM   4566 C CD2   . HIS D 2 194 ? 10.327  -6.027  -23.011 1.00 31.94 ? 195 HIS B CD2   1 
ATOM   4567 C CE1   . HIS D 2 194 ? 10.989  -6.600  -21.003 1.00 33.85 ? 195 HIS B CE1   1 
ATOM   4568 N NE2   . HIS D 2 194 ? 10.780  -7.055  -22.224 1.00 32.44 ? 195 HIS B NE2   1 
ATOM   4569 H H     . HIS D 2 194 ? 7.408   -4.304  -22.893 1.00 0.00  ? 195 HIS B H     1 
ATOM   4570 H HD1   . HIS D 2 194 ? 10.757  -4.771  -20.160 1.00 0.00  ? 195 HIS B HD1   1 
ATOM   4571 H HE2   . HIS D 2 194 ? 10.933  -7.981  -22.519 1.00 0.00  ? 195 HIS B HE2   1 
ATOM   4572 N N     . TYR D 2 195 ? 9.205   -0.678  -21.402 1.00 22.54 ? 196 TYR B N     1 
ATOM   4573 C CA    . TYR D 2 195 ? 9.096   0.771   -21.581 1.00 23.15 ? 196 TYR B CA    1 
ATOM   4574 C C     . TYR D 2 195 ? 9.095   1.233   -23.052 1.00 25.70 ? 196 TYR B C     1 
ATOM   4575 O O     . TYR D 2 195 ? 8.382   2.170   -23.432 1.00 24.20 ? 196 TYR B O     1 
ATOM   4576 C CB    . TYR D 2 195 ? 10.260  1.443   -20.839 1.00 20.07 ? 196 TYR B CB    1 
ATOM   4577 C CG    . TYR D 2 195 ? 10.385  2.936   -21.052 1.00 17.40 ? 196 TYR B CG    1 
ATOM   4578 C CD1   . TYR D 2 195 ? 9.412   3.809   -20.569 1.00 13.58 ? 196 TYR B CD1   1 
ATOM   4579 C CD2   . TYR D 2 195 ? 11.463  3.473   -21.765 1.00 14.03 ? 196 TYR B CD2   1 
ATOM   4580 C CE1   . TYR D 2 195 ? 9.497   5.173   -20.789 1.00 11.95 ? 196 TYR B CE1   1 
ATOM   4581 C CE2   . TYR D 2 195 ? 11.554  4.833   -21.984 1.00 11.73 ? 196 TYR B CE2   1 
ATOM   4582 C CZ    . TYR D 2 195 ? 10.566  5.675   -21.493 1.00 12.36 ? 196 TYR B CZ    1 
ATOM   4583 O OH    . TYR D 2 195 ? 10.642  7.029   -21.686 1.00 12.13 ? 196 TYR B OH    1 
ATOM   4584 H H     . TYR D 2 195 ? 9.872   -1.003  -20.765 1.00 0.00  ? 196 TYR B H     1 
ATOM   4585 H HH    . TYR D 2 195 ? 9.786   7.403   -21.502 1.00 0.00  ? 196 TYR B HH    1 
ATOM   4586 N N     . LYS D 2 196 ? 9.937   0.590   -23.857 1.00 28.89 ? 197 LYS B N     1 
ATOM   4587 C CA    . LYS D 2 196 ? 10.091  0.919   -25.281 1.00 32.66 ? 197 LYS B CA    1 
ATOM   4588 C C     . LYS D 2 196 ? 8.761   0.871   -26.006 1.00 30.79 ? 197 LYS B C     1 
ATOM   4589 O O     . LYS D 2 196 ? 8.392   1.798   -26.729 1.00 28.20 ? 197 LYS B O     1 
ATOM   4590 C CB    . LYS D 2 196 ? 11.055  -0.082  -25.943 1.00 37.56 ? 197 LYS B CB    1 
ATOM   4591 C CG    . LYS D 2 196 ? 11.499  0.292   -27.358 1.00 44.90 ? 197 LYS B CG    1 
ATOM   4592 C CD    . LYS D 2 196 ? 11.648  -0.973  -28.222 1.00 51.48 ? 197 LYS B CD    1 
ATOM   4593 C CE    . LYS D 2 196 ? 12.496  -0.743  -29.486 1.00 52.78 ? 197 LYS B CE    1 
ATOM   4594 N NZ    . LYS D 2 196 ? 12.371  -1.886  -30.453 1.00 55.55 ? 197 LYS B NZ    1 
ATOM   4595 H H     . LYS D 2 196 ? 10.487  -0.115  -23.475 1.00 0.00  ? 197 LYS B H     1 
ATOM   4596 H HZ1   . LYS D 2 196 ? 12.684  -2.762  -29.991 1.00 0.00  ? 197 LYS B HZ1   1 
ATOM   4597 H HZ2   . LYS D 2 196 ? 11.376  -1.984  -30.740 1.00 0.00  ? 197 LYS B HZ2   1 
ATOM   4598 H HZ3   . LYS D 2 196 ? 12.959  -1.702  -31.290 1.00 0.00  ? 197 LYS B HZ3   1 
ATOM   4599 N N     . ASP D 2 197 ? 8.031   -0.212  -25.756 1.00 30.23 ? 198 ASP B N     1 
ATOM   4600 C CA    . ASP D 2 197 ? 6.730   -0.466  -26.362 1.00 28.51 ? 198 ASP B CA    1 
ATOM   4601 C C     . ASP D 2 197 ? 5.675   0.616   -26.098 1.00 26.70 ? 198 ASP B C     1 
ATOM   4602 O O     . ASP D 2 197 ? 4.870   0.945   -26.972 1.00 25.83 ? 198 ASP B O     1 
ATOM   4603 C CB    . ASP D 2 197 ? 6.276   -1.870  -25.956 1.00 31.92 ? 198 ASP B CB    1 
ATOM   4604 C CG    . ASP D 2 197 ? 7.337   -2.937  -26.291 1.00 35.09 ? 198 ASP B CG    1 
ATOM   4605 O OD1   . ASP D 2 197 ? 8.051   -2.762  -27.306 1.00 35.80 ? 198 ASP B OD1   1 
ATOM   4606 O OD2   . ASP D 2 197 ? 7.486   -3.926  -25.535 1.00 40.07 ? 198 ASP B OD2   1 
ATOM   4607 H H     . ASP D 2 197 ? 8.373   -0.854  -25.105 1.00 0.00  ? 198 ASP B H     1 
ATOM   4608 N N     . PHE D 2 198 ? 5.711   1.236   -24.931 1.00 23.25 ? 199 PHE B N     1 
ATOM   4609 C CA    . PHE D 2 198 ? 4.753   2.285   -24.673 1.00 21.42 ? 199 PHE B CA    1 
ATOM   4610 C C     . PHE D 2 198 ? 5.232   3.518   -25.427 1.00 21.26 ? 199 PHE B C     1 
ATOM   4611 O O     . PHE D 2 198 ? 4.435   4.263   -25.967 1.00 20.76 ? 199 PHE B O     1 
ATOM   4612 C CB    . PHE D 2 198 ? 4.660   2.604   -23.169 1.00 21.64 ? 199 PHE B CB    1 
ATOM   4613 C CG    . PHE D 2 198 ? 4.069   1.488   -22.319 1.00 18.31 ? 199 PHE B CG    1 
ATOM   4614 C CD1   . PHE D 2 198 ? 4.842   0.408   -21.921 1.00 18.58 ? 199 PHE B CD1   1 
ATOM   4615 C CD2   . PHE D 2 198 ? 2.756   1.562   -21.872 1.00 16.81 ? 199 PHE B CD2   1 
ATOM   4616 C CE1   . PHE D 2 198 ? 4.308   -0.570  -21.090 1.00 18.49 ? 199 PHE B CE1   1 
ATOM   4617 C CE2   . PHE D 2 198 ? 2.226   0.587   -21.047 1.00 15.86 ? 199 PHE B CE2   1 
ATOM   4618 C CZ    . PHE D 2 198 ? 2.998   -0.476  -20.656 1.00 16.07 ? 199 PHE B CZ    1 
ATOM   4619 H H     . PHE D 2 198 ? 6.371   0.993   -24.248 1.00 0.00  ? 199 PHE B H     1 
ATOM   4620 N N     . VAL D 2 199 ? 6.545   3.736   -25.460 1.00 22.23 ? 200 VAL B N     1 
ATOM   4621 C CA    . VAL D 2 199 ? 7.117   4.896   -26.143 1.00 21.62 ? 200 VAL B CA    1 
ATOM   4622 C C     . VAL D 2 199 ? 6.754   4.788   -27.598 1.00 22.86 ? 200 VAL B C     1 
ATOM   4623 O O     . VAL D 2 199 ? 6.265   5.742   -28.186 1.00 24.69 ? 200 VAL B O     1 
ATOM   4624 C CB    . VAL D 2 199 ? 8.694   4.945   -26.023 1.00 22.73 ? 200 VAL B CB    1 
ATOM   4625 C CG1   . VAL D 2 199 ? 9.289   6.043   -26.924 1.00 24.65 ? 200 VAL B CG1   1 
ATOM   4626 C CG2   . VAL D 2 199 ? 9.109   5.232   -24.622 1.00 23.83 ? 200 VAL B CG2   1 
ATOM   4627 H H     . VAL D 2 199 ? 7.151   3.110   -25.006 1.00 0.00  ? 200 VAL B H     1 
ATOM   4628 N N     . GLU D 2 200 ? 7.004   3.613   -28.164 1.00 23.79 ? 201 GLU B N     1 
ATOM   4629 C CA    . GLU D 2 200 ? 6.737   3.328   -29.563 1.00 27.91 ? 201 GLU B CA    1 
ATOM   4630 C C     . GLU D 2 200 ? 5.283   3.053   -29.962 1.00 29.16 ? 201 GLU B C     1 
ATOM   4631 O O     . GLU D 2 200 ? 4.970   3.039   -31.151 1.00 30.68 ? 201 GLU B O     1 
ATOM   4632 C CB    . GLU D 2 200 ? 7.638   2.189   -30.019 1.00 30.02 ? 201 GLU B CB    1 
ATOM   4633 C CG    . GLU D 2 200 ? 9.115   2.560   -29.894 1.00 35.81 ? 201 GLU B CG    1 
ATOM   4634 C CD    . GLU D 2 200 ? 10.063  1.524   -30.504 1.00 39.09 ? 201 GLU B CD    1 
ATOM   4635 O OE1   . GLU D 2 200 ? 9.615   0.393   -30.857 1.00 37.97 ? 201 GLU B OE1   1 
ATOM   4636 O OE2   . GLU D 2 200 ? 11.274  1.846   -30.618 1.00 41.47 ? 201 GLU B OE2   1 
ATOM   4637 H H     . GLU D 2 200 ? 7.363   2.917   -27.607 1.00 0.00  ? 201 GLU B H     1 
ATOM   4638 N N     . GLY D 2 201 ? 4.413   2.809   -28.981 1.00 30.41 ? 202 GLY B N     1 
ATOM   4639 C CA    . GLY D 2 201 ? 3.005   2.557   -29.248 1.00 29.62 ? 202 GLY B CA    1 
ATOM   4640 C C     . GLY D 2 201 ? 2.624   1.198   -29.832 1.00 29.89 ? 202 GLY B C     1 
ATOM   4641 O O     . GLY D 2 201 ? 1.630   1.059   -30.543 1.00 32.97 ? 202 GLY B O     1 
ATOM   4642 H H     . GLY D 2 201 ? 4.724   2.786   -28.053 1.00 0.00  ? 202 GLY B H     1 
ATOM   4643 N N     . LYS D 2 202 ? 3.393   0.174   -29.518 1.00 29.70 ? 203 LYS B N     1 
ATOM   4644 C CA    . LYS D 2 202 ? 3.104   -1.158  -30.011 1.00 28.62 ? 203 LYS B CA    1 
ATOM   4645 C C     . LYS D 2 202 ? 1.923   -1.741  -29.219 1.00 28.27 ? 203 LYS B C     1 
ATOM   4646 O O     . LYS D 2 202 ? 2.122   -2.479  -28.244 1.00 28.20 ? 203 LYS B O     1 
ATOM   4647 C CB    . LYS D 2 202 ? 4.350   -2.036  -29.855 1.00 29.22 ? 203 LYS B CB    1 
ATOM   4648 H H     . LYS D 2 202 ? 4.138   0.328   -28.902 1.00 0.00  ? 203 LYS B H     1 
ATOM   4649 N N     . GLY D 2 203 ? 0.705   -1.372  -29.612 1.00 26.84 ? 204 GLY B N     1 
ATOM   4650 C CA    . GLY D 2 203 ? -0.486  -1.863  -28.931 1.00 27.13 ? 204 GLY B CA    1 
ATOM   4651 C C     . GLY D 2 203 ? -1.095  -3.155  -29.456 1.00 25.29 ? 204 GLY B C     1 
ATOM   4652 O O     . GLY D 2 203 ? -0.447  -3.885  -30.208 1.00 26.55 ? 204 GLY B O     1 
ATOM   4653 H H     . GLY D 2 203 ? 0.620   -0.745  -30.359 1.00 0.00  ? 204 GLY B H     1 
ATOM   4654 N N     . ILE D 2 204 ? -2.306  -3.479  -28.995 1.00 24.74 ? 205 ILE B N     1 
ATOM   4655 C CA    . ILE D 2 204 ? -3.012  -4.686  -29.439 1.00 23.30 ? 205 ILE B CA    1 
ATOM   4656 C C     . ILE D 2 204 ? -4.261  -4.337  -30.249 1.00 21.53 ? 205 ILE B C     1 
ATOM   4657 O O     . ILE D 2 204 ? -4.713  -5.146  -31.056 1.00 22.14 ? 205 ILE B O     1 
ATOM   4658 C CB    . ILE D 2 204 ? -3.461  -5.618  -28.279 1.00 25.10 ? 205 ILE B CB    1 
ATOM   4659 C CG1   . ILE D 2 204 ? -4.568  -4.959  -27.478 1.00 25.66 ? 205 ILE B CG1   1 
ATOM   4660 C CG2   . ILE D 2 204 ? -2.304  -5.981  -27.371 1.00 26.91 ? 205 ILE B CG2   1 
ATOM   4661 C CD1   . ILE D 2 204 ? -5.081  -5.820  -26.390 1.00 27.26 ? 205 ILE B CD1   1 
ATOM   4662 H H     . ILE D 2 204 ? -2.729  -2.885  -28.341 1.00 0.00  ? 205 ILE B H     1 
ATOM   4663 N N     . PHE D 2 205 ? -4.804  -3.141  -30.027 1.00 20.35 ? 206 PHE B N     1 
ATOM   4664 C CA    . PHE D 2 205 ? -5.993  -2.664  -30.726 1.00 21.81 ? 206 PHE B CA    1 
ATOM   4665 C C     . PHE D 2 205 ? -5.726  -2.074  -32.113 1.00 23.75 ? 206 PHE B C     1 
ATOM   4666 O O     . PHE D 2 205 ? -4.763  -1.335  -32.299 1.00 23.96 ? 206 PHE B O     1 
ATOM   4667 C CB    . PHE D 2 205 ? -6.730  -1.636  -29.869 1.00 17.55 ? 206 PHE B CB    1 
ATOM   4668 C CG    . PHE D 2 205 ? -7.382  -2.237  -28.646 1.00 20.93 ? 206 PHE B CG    1 
ATOM   4669 C CD1   . PHE D 2 205 ? -8.520  -3.038  -28.767 1.00 17.14 ? 206 PHE B CD1   1 
ATOM   4670 C CD2   . PHE D 2 205 ? -6.860  -2.006  -27.368 1.00 15.73 ? 206 PHE B CD2   1 
ATOM   4671 C CE1   . PHE D 2 205 ? -9.123  -3.587  -27.631 1.00 15.00 ? 206 PHE B CE1   1 
ATOM   4672 C CE2   . PHE D 2 205 ? -7.454  -2.552  -26.250 1.00 14.01 ? 206 PHE B CE2   1 
ATOM   4673 C CZ    . PHE D 2 205 ? -8.578  -3.337  -26.375 1.00 14.25 ? 206 PHE B CZ    1 
ATOM   4674 H H     . PHE D 2 205 ? -4.377  -2.534  -29.382 1.00 0.00  ? 206 PHE B H     1 
ATOM   4675 N N     . ASP D 2 206 ? -6.613  -2.354  -33.063 1.00 22.10 ? 207 ASP B N     1 
ATOM   4676 C CA    . ASP D 2 206 ? -6.460  -1.856  -34.413 1.00 22.08 ? 207 ASP B CA    1 
ATOM   4677 C C     . ASP D 2 206 ? -6.780  -0.389  -34.648 1.00 20.11 ? 207 ASP B C     1 
ATOM   4678 O O     . ASP D 2 206 ? -6.221  0.225   -35.541 1.00 20.29 ? 207 ASP B O     1 
ATOM   4679 C CB    . ASP D 2 206 ? -7.226  -2.729  -35.361 1.00 25.74 ? 207 ASP B CB    1 
ATOM   4680 C CG    . ASP D 2 206 ? -6.577  -4.097  -35.535 1.00 31.54 ? 207 ASP B CG    1 
ATOM   4681 O OD1   . ASP D 2 206 ? -5.348  -4.216  -35.301 1.00 37.43 ? 207 ASP B OD1   1 
ATOM   4682 O OD2   . ASP D 2 206 ? -7.299  -5.060  -35.915 1.00 35.87 ? 207 ASP B OD2   1 
ATOM   4683 H H     . ASP D 2 206 ? -7.343  -2.929  -32.848 1.00 0.00  ? 207 ASP B H     1 
ATOM   4684 N N     . SER D 2 207 ? -7.621  0.194   -33.810 1.00 15.60 ? 208 SER B N     1 
ATOM   4685 C CA    . SER D 2 207 ? -7.989  1.587   -33.943 1.00 11.88 ? 208 SER B CA    1 
ATOM   4686 C C     . SER D 2 207 ? -8.539  1.977   -32.615 1.00 12.25 ? 208 SER B C     1 
ATOM   4687 O O     . SER D 2 207 ? -8.791  1.102   -31.801 1.00 14.72 ? 208 SER B O     1 
ATOM   4688 C CB    . SER D 2 207 ? -9.123  1.727   -34.943 1.00 9.94  ? 208 SER B CB    1 
ATOM   4689 O OG    . SER D 2 207 ? -10.248 0.929   -34.561 1.00 13.23 ? 208 SER B OG    1 
ATOM   4690 H H     . SER D 2 207 ? -8.009  -0.297  -33.060 1.00 0.00  ? 208 SER B H     1 
ATOM   4691 H HG    . SER D 2 207 ? -10.847 0.960   -35.321 1.00 0.00  ? 208 SER B HG    1 
ATOM   4692 N N     . GLU D 2 208 ? -8.755  3.269   -32.417 1.00 13.79 ? 209 GLU B N     1 
ATOM   4693 C CA    . GLU D 2 208 ? -9.352  3.808   -31.201 1.00 15.98 ? 209 GLU B CA    1 
ATOM   4694 C C     . GLU D 2 208 ? -10.817 3.353   -31.087 1.00 18.68 ? 209 GLU B C     1 
ATOM   4695 O O     . GLU D 2 208 ? -11.361 3.265   -29.988 1.00 20.45 ? 209 GLU B O     1 
ATOM   4696 C CB    . GLU D 2 208 ? -9.308  5.331   -31.233 1.00 14.14 ? 209 GLU B CB    1 
ATOM   4697 C CG    . GLU D 2 208 ? -9.914  6.030   -30.017 1.00 15.29 ? 209 GLU B CG    1 
ATOM   4698 C CD    . GLU D 2 208 ? -9.527  7.491   -30.002 1.00 21.65 ? 209 GLU B CD    1 
ATOM   4699 O OE1   . GLU D 2 208 ? -9.063  7.967   -31.064 1.00 20.26 ? 209 GLU B OE1   1 
ATOM   4700 O OE2   . GLU D 2 208 ? -9.649  8.177   -28.946 1.00 22.50 ? 209 GLU B OE2   1 
ATOM   4701 H H     . GLU D 2 208 ? -8.489  3.898   -33.123 1.00 0.00  ? 209 GLU B H     1 
ATOM   4702 N N     . ASP D 2 209 ? -11.451 3.108   -32.234 1.00 19.77 ? 210 ASP B N     1 
ATOM   4703 C CA    . ASP D 2 209 ? -12.835 2.644   -32.302 1.00 18.03 ? 210 ASP B CA    1 
ATOM   4704 C C     . ASP D 2 209 ? -12.977 1.209   -31.721 1.00 14.59 ? 210 ASP B C     1 
ATOM   4705 O O     . ASP D 2 209 ? -13.943 0.893   -31.043 1.00 17.47 ? 210 ASP B O     1 
ATOM   4706 C CB    . ASP D 2 209 ? -13.296 2.712   -33.758 1.00 22.69 ? 210 ASP B CB    1 
ATOM   4707 C CG    . ASP D 2 209 ? -14.774 2.415   -33.929 1.00 25.61 ? 210 ASP B CG    1 
ATOM   4708 O OD1   . ASP D 2 209 ? -15.604 3.225   -33.426 1.00 29.57 ? 210 ASP B OD1   1 
ATOM   4709 O OD2   . ASP D 2 209 ? -15.091 1.389   -34.595 1.00 27.56 ? 210 ASP B OD2   1 
ATOM   4710 H H     . ASP D 2 209 ? -10.967 3.264   -33.072 1.00 0.00  ? 210 ASP B H     1 
ATOM   4711 N N     . GLU D 2 210 ? -12.022 0.348   -31.995 1.00 9.37  ? 211 GLU B N     1 
ATOM   4712 C CA    . GLU D 2 210 ? -12.064 -0.992  -31.473 1.00 11.39 ? 211 GLU B CA    1 
ATOM   4713 C C     . GLU D 2 210 ? -11.842 -0.952  -29.952 1.00 14.06 ? 211 GLU B C     1 
ATOM   4714 O O     . GLU D 2 210 ? -12.506 -1.683  -29.194 1.00 15.35 ? 211 GLU B O     1 
ATOM   4715 C CB    . GLU D 2 210 ? -10.975 -1.836  -32.102 1.00 11.64 ? 211 GLU B CB    1 
ATOM   4716 C CG    . GLU D 2 210 ? -11.044 -3.279  -31.717 1.00 12.03 ? 211 GLU B CG    1 
ATOM   4717 C CD    . GLU D 2 210 ? -10.088 -4.140  -32.459 1.00 11.99 ? 211 GLU B CD    1 
ATOM   4718 O OE1   . GLU D 2 210 ? -8.883  -3.890  -32.399 1.00 19.74 ? 211 GLU B OE1   1 
ATOM   4719 O OE2   . GLU D 2 210 ? -10.527 -5.105  -33.104 1.00 17.74 ? 211 GLU B OE2   1 
ATOM   4720 H H     . GLU D 2 210 ? -11.282 0.635   -32.572 1.00 0.00  ? 211 GLU B H     1 
ATOM   4721 N N     . PHE D 2 211 ? -10.832 -0.189  -29.529 1.00 13.02 ? 212 PHE B N     1 
ATOM   4722 C CA    . PHE D 2 211 ? -10.506 0.008   -28.114 1.00 11.27 ? 212 PHE B CA    1 
ATOM   4723 C C     . PHE D 2 211 ? -11.773 0.388   -27.315 1.00 10.40 ? 212 PHE B C     1 
ATOM   4724 O O     . PHE D 2 211 ? -12.091 -0.245  -26.307 1.00 12.25 ? 212 PHE B O     1 
ATOM   4725 C CB    . PHE D 2 211 ? -9.407  1.094   -27.997 1.00 10.82 ? 212 PHE B CB    1 
ATOM   4726 C CG    . PHE D 2 211 ? -9.412  1.836   -26.690 1.00 8.62  ? 212 PHE B CG    1 
ATOM   4727 C CD1   . PHE D 2 211 ? -8.940  1.241   -25.534 1.00 12.23 ? 212 PHE B CD1   1 
ATOM   4728 C CD2   . PHE D 2 211 ? -9.952  3.106   -26.604 1.00 10.42 ? 212 PHE B CD2   1 
ATOM   4729 C CE1   . PHE D 2 211 ? -9.015  1.894   -24.316 1.00 10.46 ? 212 PHE B CE1   1 
ATOM   4730 C CE2   . PHE D 2 211 ? -10.034 3.768   -25.392 1.00 14.05 ? 212 PHE B CE2   1 
ATOM   4731 C CZ    . PHE D 2 211 ? -9.568  3.165   -24.242 1.00 11.14 ? 212 PHE B CZ    1 
ATOM   4732 H H     . PHE D 2 211 ? -10.278 0.266   -30.199 1.00 0.00  ? 212 PHE B H     1 
ATOM   4733 N N     . LEU D 2 212 ? -12.480 1.419   -27.769 1.00 10.57 ? 213 LEU B N     1 
ATOM   4734 C CA    . LEU D 2 212 ? -13.708 1.904   -27.158 1.00 12.26 ? 213 LEU B CA    1 
ATOM   4735 C C     . LEU D 2 212 ? -14.857 0.875   -27.159 1.00 15.13 ? 213 LEU B C     1 
ATOM   4736 O O     . LEU D 2 212 ? -15.559 0.724   -26.173 1.00 18.34 ? 213 LEU B O     1 
ATOM   4737 C CB    . LEU D 2 212 ? -14.162 3.163   -27.878 1.00 9.55  ? 213 LEU B CB    1 
ATOM   4738 C CG    . LEU D 2 212 ? -13.621 4.517   -27.465 1.00 11.92 ? 213 LEU B CG    1 
ATOM   4739 C CD1   . LEU D 2 212 ? -14.244 5.581   -28.334 1.00 10.68 ? 213 LEU B CD1   1 
ATOM   4740 C CD2   . LEU D 2 212 ? -14.002 4.795   -26.024 1.00 10.95 ? 213 LEU B CD2   1 
ATOM   4741 H H     . LEU D 2 212 ? -12.146 1.897   -28.558 1.00 0.00  ? 213 LEU B H     1 
ATOM   4742 N N     . ASP D 2 213 ? -15.049 0.182   -28.274 1.00 15.04 ? 214 ASP B N     1 
ATOM   4743 C CA    . ASP D 2 213 ? -16.064 -0.831  -28.413 1.00 11.00 ? 214 ASP B CA    1 
ATOM   4744 C C     . ASP D 2 213 ? -15.773 -1.980  -27.484 1.00 9.69  ? 214 ASP B C     1 
ATOM   4745 O O     . ASP D 2 213 ? -16.684 -2.495  -26.890 1.00 10.60 ? 214 ASP B O     1 
ATOM   4746 C CB    . ASP D 2 213 ? -16.100 -1.355  -29.848 1.00 12.51 ? 214 ASP B CB    1 
ATOM   4747 C CG    . ASP D 2 213 ? -17.264 -2.304  -30.099 1.00 14.62 ? 214 ASP B CG    1 
ATOM   4748 O OD1   . ASP D 2 213 ? -18.413 -1.868  -29.909 1.00 15.67 ? 214 ASP B OD1   1 
ATOM   4749 O OD2   . ASP D 2 213 ? -17.040 -3.479  -30.475 1.00 16.00 ? 214 ASP B OD2   1 
ATOM   4750 H H     . ASP D 2 213 ? -14.473 0.376   -29.042 1.00 0.00  ? 214 ASP B H     1 
ATOM   4751 N N     . TYR D 2 214 ? -14.536 -2.466  -27.457 1.00 8.44  ? 215 TYR B N     1 
ATOM   4752 C CA    . TYR D 2 214 ? -14.142 -3.573  -26.574 1.00 8.63  ? 215 TYR B CA    1 
ATOM   4753 C C     . TYR D 2 214 ? -14.409 -3.267  -25.063 1.00 10.83 ? 215 TYR B C     1 
ATOM   4754 O O     . TYR D 2 214 ? -14.940 -4.102  -24.328 1.00 11.45 ? 215 TYR B O     1 
ATOM   4755 C CB    . TYR D 2 214 ? -12.664 -3.855  -26.770 1.00 7.21  ? 215 TYR B CB    1 
ATOM   4756 C CG    . TYR D 2 214 ? -12.100 -4.993  -25.930 1.00 7.23  ? 215 TYR B CG    1 
ATOM   4757 C CD1   . TYR D 2 214 ? -11.823 -4.816  -24.558 1.00 11.70 ? 215 TYR B CD1   1 
ATOM   4758 C CD2   . TYR D 2 214 ? -11.887 -6.255  -26.481 1.00 5.01  ? 215 TYR B CD2   1 
ATOM   4759 C CE1   . TYR D 2 214 ? -11.371 -5.871  -23.763 1.00 7.34  ? 215 TYR B CE1   1 
ATOM   4760 C CE2   . TYR D 2 214 ? -11.430 -7.307  -25.709 1.00 6.56  ? 215 TYR B CE2   1 
ATOM   4761 C CZ    . TYR D 2 214 ? -11.182 -7.109  -24.344 1.00 12.57 ? 215 TYR B CZ    1 
ATOM   4762 O OH    . TYR D 2 214 ? -10.760 -8.151  -23.573 1.00 10.92 ? 215 TYR B OH    1 
ATOM   4763 H H     . TYR D 2 214 ? -13.875 -2.056  -28.039 1.00 0.00  ? 215 TYR B H     1 
ATOM   4764 H HH    . TYR D 2 214 ? -10.591 -7.865  -22.666 1.00 0.00  ? 215 TYR B HH    1 
ATOM   4765 N N     . TRP D 2 215 ? -14.125 -2.048  -24.621 1.00 11.12 ? 216 TRP B N     1 
ATOM   4766 C CA    . TRP D 2 215 ? -14.282 -1.679  -23.204 1.00 10.58 ? 216 TRP B CA    1 
ATOM   4767 C C     . TRP D 2 215 ? -15.706 -1.272  -22.803 1.00 13.10 ? 216 TRP B C     1 
ATOM   4768 O O     . TRP D 2 215 ? -16.111 -1.368  -21.640 1.00 15.33 ? 216 TRP B O     1 
ATOM   4769 C CB    . TRP D 2 215 ? -13.213 -0.622  -22.831 1.00 6.36  ? 216 TRP B CB    1 
ATOM   4770 C CG    . TRP D 2 215 ? -11.872 -1.297  -22.649 1.00 10.68 ? 216 TRP B CG    1 
ATOM   4771 C CD1   . TRP D 2 215 ? -10.793 -1.265  -23.496 1.00 11.20 ? 216 TRP B CD1   1 
ATOM   4772 C CD2   . TRP D 2 215 ? -11.521 -2.215  -21.596 1.00 11.82 ? 216 TRP B CD2   1 
ATOM   4773 N NE1   . TRP D 2 215 ? -9.809  -2.113  -23.045 1.00 10.58 ? 216 TRP B NE1   1 
ATOM   4774 C CE2   . TRP D 2 215 ? -10.232 -2.709  -21.883 1.00 10.70 ? 216 TRP B CE2   1 
ATOM   4775 C CE3   . TRP D 2 215 ? -12.186 -2.671  -20.437 1.00 11.43 ? 216 TRP B CE3   1 
ATOM   4776 C CZ2   . TRP D 2 215 ? -9.589  -3.636  -21.063 1.00 10.54 ? 216 TRP B CZ2   1 
ATOM   4777 C CZ3   . TRP D 2 215 ? -11.543 -3.596  -19.622 1.00 10.44 ? 216 TRP B CZ3   1 
ATOM   4778 C CH2   . TRP D 2 215 ? -10.261 -4.067  -19.943 1.00 11.08 ? 216 TRP B CH2   1 
ATOM   4779 H H     . TRP D 2 215 ? -13.776 -1.383  -25.257 1.00 0.00  ? 216 TRP B H     1 
ATOM   4780 H HE1   . TRP D 2 215 ? -8.938  -2.287  -23.473 1.00 0.00  ? 216 TRP B HE1   1 
ATOM   4781 N N     . ARG D 2 216 ? -16.487 -0.873  -23.794 1.00 16.74 ? 217 ARG B N     1 
ATOM   4782 C CA    . ARG D 2 216 ? -17.867 -0.484  -23.593 1.00 17.63 ? 217 ARG B CA    1 
ATOM   4783 C C     . ARG D 2 216 ? -18.686 -1.744  -23.444 1.00 17.89 ? 217 ARG B C     1 
ATOM   4784 O O     . ARG D 2 216 ? -19.820 -1.683  -22.966 1.00 20.35 ? 217 ARG B O     1 
ATOM   4785 C CB    . ARG D 2 216 ? -18.382 0.265   -24.812 1.00 16.68 ? 217 ARG B CB    1 
ATOM   4786 C CG    . ARG D 2 216 ? -18.037 1.675   -24.808 1.00 21.66 ? 217 ARG B CG    1 
ATOM   4787 C CD    . ARG D 2 216 ? -18.271 2.306   -26.162 1.00 20.89 ? 217 ARG B CD    1 
ATOM   4788 N NE    . ARG D 2 216 ? -18.139 3.740   -26.001 1.00 22.40 ? 217 ARG B NE    1 
ATOM   4789 C CZ    . ARG D 2 216 ? -18.062 4.612   -26.989 1.00 24.16 ? 217 ARG B CZ    1 
ATOM   4790 N NH1   . ARG D 2 216 ? -18.114 4.179   -28.236 1.00 26.55 ? 217 ARG B NH1   1 
ATOM   4791 N NH2   . ARG D 2 216 ? -17.884 5.903   -26.722 1.00 24.05 ? 217 ARG B NH2   1 
ATOM   4792 H H     . ARG D 2 216 ? -16.115 -0.808  -24.699 1.00 0.00  ? 217 ARG B H     1 
ATOM   4793 H HE    . ARG D 2 216 ? -18.097 4.094   -25.090 1.00 0.00  ? 217 ARG B HE    1 
ATOM   4794 H HH11  . ARG D 2 216 ? -18.208 3.203   -28.433 1.00 0.00  ? 217 ARG B HH11  1 
ATOM   4795 H HH12  . ARG D 2 216 ? -18.056 4.833   -28.991 1.00 0.00  ? 217 ARG B HH12  1 
ATOM   4796 H HH21  . ARG D 2 216 ? -17.805 6.210   -25.773 1.00 0.00  ? 217 ARG B HH21  1 
ATOM   4797 H HH22  . ARG D 2 216 ? -17.827 6.564   -27.471 1.00 0.00  ? 217 ARG B HH22  1 
ATOM   4798 N N     . ASN D 2 217 ? -18.113 -2.873  -23.853 1.00 16.55 ? 218 ASN B N     1 
ATOM   4799 C CA    . ASN D 2 217 ? -18.822 -4.139  -23.811 1.00 18.97 ? 218 ASN B CA    1 
ATOM   4800 C C     . ASN D 2 217 ? -18.199 -5.208  -22.967 1.00 18.86 ? 218 ASN B C     1 
ATOM   4801 O O     . ASN D 2 217 ? -18.661 -6.344  -22.983 1.00 21.85 ? 218 ASN B O     1 
ATOM   4802 C CB    . ASN D 2 217 ? -19.045 -4.684  -25.228 1.00 17.27 ? 218 ASN B CB    1 
ATOM   4803 C CG    . ASN D 2 217 ? -19.965 -3.802  -26.034 1.00 15.83 ? 218 ASN B CG    1 
ATOM   4804 O OD1   . ASN D 2 217 ? -21.162 -3.737  -25.787 1.00 17.57 ? 218 ASN B OD1   1 
ATOM   4805 N ND2   . ASN D 2 217 ? -19.397 -3.060  -26.968 1.00 21.91 ? 218 ASN B ND2   1 
ATOM   4806 H H     . ASN D 2 217 ? -17.206 -2.869  -24.218 1.00 0.00  ? 218 ASN B H     1 
ATOM   4807 H HD21  . ASN D 2 217 ? -19.977 -2.474  -27.488 1.00 0.00  ? 218 ASN B HD21  1 
ATOM   4808 H HD22  . ASN D 2 217 ? -18.428 -3.136  -27.088 1.00 0.00  ? 218 ASN B HD22  1 
ATOM   4809 N N     . TYR D 2 218 ? -17.165 -4.842  -22.223 1.00 18.35 ? 219 TYR B N     1 
ATOM   4810 C CA    . TYR D 2 218 ? -16.440 -5.756  -21.353 1.00 17.20 ? 219 TYR B CA    1 
ATOM   4811 C C     . TYR D 2 218 ? -17.336 -5.981  -20.127 1.00 17.68 ? 219 TYR B C     1 
ATOM   4812 O O     . TYR D 2 218 ? -17.934 -5.036  -19.599 1.00 17.28 ? 219 TYR B O     1 
ATOM   4813 C CB    . TYR D 2 218 ? -15.099 -5.107  -20.948 1.00 13.51 ? 219 TYR B CB    1 
ATOM   4814 C CG    . TYR D 2 218 ? -14.118 -6.000  -20.206 1.00 11.78 ? 219 TYR B CG    1 
ATOM   4815 C CD1   . TYR D 2 218 ? -13.324 -6.886  -20.899 1.00 11.81 ? 219 TYR B CD1   1 
ATOM   4816 C CD2   . TYR D 2 218 ? -13.955 -5.923  -18.807 1.00 11.47 ? 219 TYR B CD2   1 
ATOM   4817 C CE1   . TYR D 2 218 ? -12.384 -7.685  -20.248 1.00 13.12 ? 219 TYR B CE1   1 
ATOM   4818 C CE2   . TYR D 2 218 ? -12.993 -6.716  -18.145 1.00 8.34  ? 219 TYR B CE2   1 
ATOM   4819 C CZ    . TYR D 2 218 ? -12.221 -7.584  -18.870 1.00 12.91 ? 219 TYR B CZ    1 
ATOM   4820 O OH    . TYR D 2 218 ? -11.231 -8.358  -18.294 1.00 13.62 ? 219 TYR B OH    1 
ATOM   4821 H H     . TYR D 2 218 ? -16.898 -3.901  -22.231 1.00 0.00  ? 219 TYR B H     1 
ATOM   4822 H HH    . TYR D 2 218 ? -11.262 -9.224  -18.730 1.00 0.00  ? 219 TYR B HH    1 
ATOM   4823 N N     . GLU D 2 219 ? -17.503 -7.236  -19.744 1.00 18.51 ? 220 GLU B N     1 
ATOM   4824 C CA    . GLU D 2 219 ? -18.323 -7.557  -18.580 1.00 24.23 ? 220 GLU B CA    1 
ATOM   4825 C C     . GLU D 2 219 ? -17.444 -7.482  -17.322 1.00 26.24 ? 220 GLU B C     1 
ATOM   4826 O O     . GLU D 2 219 ? -16.244 -7.791  -17.378 1.00 25.24 ? 220 GLU B O     1 
ATOM   4827 C CB    . GLU D 2 219 ? -18.939 -8.955  -18.738 1.00 25.81 ? 220 GLU B CB    1 
ATOM   4828 C CG    . GLU D 2 219 ? -19.931 -9.062  -19.884 1.00 27.93 ? 220 GLU B CG    1 
ATOM   4829 C CD    . GLU D 2 219 ? -21.151 -8.192  -19.677 1.00 29.66 ? 220 GLU B CD    1 
ATOM   4830 O OE1   . GLU D 2 219 ? -21.479 -7.933  -18.513 1.00 34.90 ? 220 GLU B OE1   1 
ATOM   4831 O OE2   . GLU D 2 219 ? -21.793 -7.760  -20.657 1.00 31.79 ? 220 GLU B OE2   1 
ATOM   4832 H H     . GLU D 2 219 ? -17.087 -7.968  -20.252 1.00 0.00  ? 220 GLU B H     1 
ATOM   4833 N N     . ARG D 2 220 ? -18.035 -7.078  -16.195 1.00 28.00 ? 221 ARG B N     1 
ATOM   4834 C CA    . ARG D 2 220 ? -17.287 -6.963  -14.935 1.00 29.83 ? 221 ARG B CA    1 
ATOM   4835 C C     . ARG D 2 220 ? -16.632 -8.223  -14.310 1.00 30.70 ? 221 ARG B C     1 
ATOM   4836 O O     . ARG D 2 220 ? -15.518 -8.150  -13.781 1.00 31.06 ? 221 ARG B O     1 
ATOM   4837 C CB    . ARG D 2 220 ? -18.144 -6.276  -13.879 1.00 32.10 ? 221 ARG B CB    1 
ATOM   4838 C CG    . ARG D 2 220 ? -18.331 -4.785  -14.070 1.00 32.93 ? 221 ARG B CG    1 
ATOM   4839 C CD    . ARG D 2 220 ? -19.597 -4.484  -14.809 1.00 35.59 ? 221 ARG B CD    1 
ATOM   4840 N NE    . ARG D 2 220 ? -20.156 -3.204  -14.387 1.00 38.48 ? 221 ARG B NE    1 
ATOM   4841 C CZ    . ARG D 2 220 ? -21.066 -2.526  -15.082 1.00 39.54 ? 221 ARG B CZ    1 
ATOM   4842 N NH1   . ARG D 2 220 ? -21.519 -3.002  -16.240 1.00 42.11 ? 221 ARG B NH1   1 
ATOM   4843 N NH2   . ARG D 2 220 ? -21.549 -1.382  -14.612 1.00 41.17 ? 221 ARG B NH2   1 
ATOM   4844 H H     . ARG D 2 220 ? -18.981 -6.837  -16.224 1.00 0.00  ? 221 ARG B H     1 
ATOM   4845 H HE    . ARG D 2 220 ? -19.842 -2.811  -13.545 1.00 0.00  ? 221 ARG B HE    1 
ATOM   4846 H HH11  . ARG D 2 220 ? -21.179 -3.869  -16.604 1.00 0.00  ? 221 ARG B HH11  1 
ATOM   4847 H HH12  . ARG D 2 220 ? -22.204 -2.485  -16.753 1.00 0.00  ? 221 ARG B HH12  1 
ATOM   4848 H HH21  . ARG D 2 220 ? -21.228 -1.025  -13.736 1.00 0.00  ? 221 ARG B HH21  1 
ATOM   4849 H HH22  . ARG D 2 220 ? -22.236 -0.878  -15.138 1.00 0.00  ? 221 ARG B HH22  1 
ATOM   4850 N N     . THR D 2 221 ? -17.319 -9.360  -14.337 1.00 30.75 ? 222 THR B N     1 
ATOM   4851 C CA    . THR D 2 221 ? -16.783 -10.585 -13.734 1.00 33.03 ? 222 THR B CA    1 
ATOM   4852 C C     . THR D 2 221 ? -16.474 -11.665 -14.762 1.00 34.48 ? 222 THR B C     1 
ATOM   4853 O O     . THR D 2 221 ? -17.013 -11.630 -15.863 1.00 34.29 ? 222 THR B O     1 
ATOM   4854 C CB    . THR D 2 221 ? -17.783 -11.188 -12.737 1.00 30.81 ? 222 THR B CB    1 
ATOM   4855 O OG1   . THR D 2 221 ? -19.099 -11.110 -13.298 1.00 35.79 ? 222 THR B OG1   1 
ATOM   4856 C CG2   . THR D 2 221 ? -17.730 -10.473 -11.424 1.00 33.66 ? 222 THR B CG2   1 
ATOM   4857 H H     . THR D 2 221 ? -18.194 -9.423  -14.763 1.00 0.00  ? 222 THR B H     1 
ATOM   4858 H HG1   . THR D 2 221 ? -19.718 -11.260 -12.576 1.00 0.00  ? 222 THR B HG1   1 
ATOM   4859 N N     . SER D 2 222 ? -15.697 -12.669 -14.357 1.00 35.22 ? 223 SER B N     1 
ATOM   4860 C CA    . SER D 2 222 ? -15.330 -13.760 -15.242 1.00 38.38 ? 223 SER B CA    1 
ATOM   4861 C C     . SER D 2 222 ? -16.517 -14.550 -15.779 1.00 40.18 ? 223 SER B C     1 
ATOM   4862 O O     . SER D 2 222 ? -16.541 -14.913 -16.959 1.00 40.40 ? 223 SER B O     1 
ATOM   4863 C CB    . SER D 2 222 ? -14.359 -14.705 -14.545 1.00 37.59 ? 223 SER B CB    1 
ATOM   4864 O OG    . SER D 2 222 ? -13.143 -14.043 -14.247 1.00 39.79 ? 223 SER B OG    1 
ATOM   4865 H H     . SER D 2 222 ? -15.332 -12.675 -13.448 1.00 0.00  ? 223 SER B H     1 
ATOM   4866 H HG    . SER D 2 222 ? -12.662 -13.858 -15.064 1.00 0.00  ? 223 SER B HG    1 
ATOM   4867 N N     . GLN D 2 223 ? -17.508 -14.793 -14.924 1.00 43.02 ? 224 GLN B N     1 
ATOM   4868 C CA    . GLN D 2 223 ? -18.682 -15.565 -15.320 1.00 45.39 ? 224 GLN B CA    1 
ATOM   4869 C C     . GLN D 2 223 ? -19.540 -14.843 -16.352 1.00 42.63 ? 224 GLN B C     1 
ATOM   4870 O O     . GLN D 2 223 ? -20.163 -15.471 -17.208 1.00 39.42 ? 224 GLN B O     1 
ATOM   4871 C CB    . GLN D 2 223 ? -19.524 -15.981 -14.094 1.00 49.95 ? 224 GLN B CB    1 
ATOM   4872 C CG    . GLN D 2 223 ? -20.375 -14.870 -13.435 1.00 57.62 ? 224 GLN B CG    1 
ATOM   4873 C CD    . GLN D 2 223 ? -19.685 -14.159 -12.262 1.00 61.74 ? 224 GLN B CD    1 
ATOM   4874 O OE1   . GLN D 2 223 ? -18.455 -14.167 -12.136 1.00 62.86 ? 224 GLN B OE1   1 
ATOM   4875 N NE2   . GLN D 2 223 ? -20.485 -13.539 -11.402 1.00 63.40 ? 224 GLN B NE2   1 
ATOM   4876 H H     . GLN D 2 223 ? -17.450 -14.457 -14.003 1.00 0.00  ? 224 GLN B H     1 
ATOM   4877 H HE21  . GLN D 2 223 ? -20.053 -13.093 -10.646 1.00 0.00  ? 224 GLN B HE21  1 
ATOM   4878 H HE22  . GLN D 2 223 ? -21.453 -13.564 -11.558 1.00 0.00  ? 224 GLN B HE22  1 
ATOM   4879 N N     . LEU D 2 224 ? -19.556 -13.521 -16.277 1.00 42.42 ? 225 LEU B N     1 
ATOM   4880 C CA    . LEU D 2 224 ? -20.330 -12.724 -17.218 1.00 42.33 ? 225 LEU B CA    1 
ATOM   4881 C C     . LEU D 2 224 ? -19.573 -12.520 -18.534 1.00 40.74 ? 225 LEU B C     1 
ATOM   4882 O O     . LEU D 2 224 ? -20.176 -12.287 -19.586 1.00 41.72 ? 225 LEU B O     1 
ATOM   4883 C CB    . LEU D 2 224 ? -20.686 -11.384 -16.587 1.00 44.28 ? 225 LEU B CB    1 
ATOM   4884 C CG    . LEU D 2 224 ? -21.554 -11.518 -15.343 1.00 46.99 ? 225 LEU B CG    1 
ATOM   4885 C CD1   . LEU D 2 224 ? -22.203 -10.176 -15.073 1.00 49.48 ? 225 LEU B CD1   1 
ATOM   4886 C CD2   . LEU D 2 224 ? -22.638 -12.566 -15.568 1.00 48.06 ? 225 LEU B CD2   1 
ATOM   4887 H H     . LEU D 2 224 ? -19.033 -13.057 -15.593 1.00 0.00  ? 225 LEU B H     1 
ATOM   4888 N N     . ARG D 2 225 ? -18.248 -12.623 -18.457 1.00 38.13 ? 226 ARG B N     1 
ATOM   4889 C CA    . ARG D 2 225 ? -17.366 -12.476 -19.601 1.00 36.31 ? 226 ARG B CA    1 
ATOM   4890 C C     . ARG D 2 225 ? -17.141 -13.788 -20.325 1.00 37.48 ? 226 ARG B C     1 
ATOM   4891 O O     . ARG D 2 225 ? -16.767 -13.797 -21.490 1.00 38.21 ? 226 ARG B O     1 
ATOM   4892 C CB    . ARG D 2 225 ? -16.024 -11.916 -19.161 1.00 32.39 ? 226 ARG B CB    1 
ATOM   4893 C CG    . ARG D 2 225 ? -16.097 -10.498 -18.695 1.00 28.97 ? 226 ARG B CG    1 
ATOM   4894 C CD    . ARG D 2 225 ? -14.744 -9.882  -18.671 1.00 30.24 ? 226 ARG B CD    1 
ATOM   4895 N NE    . ARG D 2 225 ? -13.783 -10.652 -17.883 1.00 31.64 ? 226 ARG B NE    1 
ATOM   4896 C CZ    . ARG D 2 225 ? -13.456 -10.394 -16.615 1.00 31.51 ? 226 ARG B CZ    1 
ATOM   4897 N NH1   . ARG D 2 225 ? -14.017 -9.378  -15.967 1.00 27.81 ? 226 ARG B NH1   1 
ATOM   4898 N NH2   . ARG D 2 225 ? -12.534 -11.143 -16.008 1.00 32.77 ? 226 ARG B NH2   1 
ATOM   4899 H H     . ARG D 2 225 ? -17.822 -12.772 -17.588 1.00 0.00  ? 226 ARG B H     1 
ATOM   4900 H HE    . ARG D 2 225 ? -13.328 -11.394 -18.315 1.00 0.00  ? 226 ARG B HE    1 
ATOM   4901 H HH11  . ARG D 2 225 ? -14.686 -8.792  -16.424 1.00 0.00  ? 226 ARG B HH11  1 
ATOM   4902 H HH12  . ARG D 2 225 ? -13.763 -9.201  -15.017 1.00 0.00  ? 226 ARG B HH12  1 
ATOM   4903 H HH21  . ARG D 2 225 ? -12.094 -11.890 -16.509 1.00 0.00  ? 226 ARG B HH21  1 
ATOM   4904 H HH22  . ARG D 2 225 ? -12.282 -10.965 -15.058 1.00 0.00  ? 226 ARG B HH22  1 
ATOM   4905 N N     . ASN D 2 226 ? -17.346 -14.901 -19.636 1.00 39.52 ? 227 ASN B N     1 
ATOM   4906 C CA    . ASN D 2 226 ? -17.160 -16.199 -20.266 1.00 41.86 ? 227 ASN B CA    1 
ATOM   4907 C C     . ASN D 2 226 ? -18.160 -16.496 -21.377 1.00 41.44 ? 227 ASN B C     1 
ATOM   4908 O O     . ASN D 2 226 ? -17.944 -17.388 -22.190 1.00 42.78 ? 227 ASN B O     1 
ATOM   4909 C CB    . ASN D 2 226 ? -17.140 -17.318 -19.236 1.00 44.59 ? 227 ASN B CB    1 
ATOM   4910 C CG    . ASN D 2 226 ? -15.772 -17.513 -18.642 1.00 45.37 ? 227 ASN B CG    1 
ATOM   4911 O OD1   . ASN D 2 226 ? -14.826 -16.785 -18.968 1.00 45.25 ? 227 ASN B OD1   1 
ATOM   4912 N ND2   . ASN D 2 226 ? -15.647 -18.500 -17.770 1.00 47.91 ? 227 ASN B ND2   1 
ATOM   4913 H H     . ASN D 2 226 ? -17.587 -14.847 -18.689 1.00 0.00  ? 227 ASN B H     1 
ATOM   4914 H HD21  . ASN D 2 226 ? -14.760 -18.638 -17.382 1.00 0.00  ? 227 ASN B HD21  1 
ATOM   4915 H HD22  . ASN D 2 226 ? -16.437 -19.039 -17.563 1.00 0.00  ? 227 ASN B HD22  1 
ATOM   4916 N N     . ASP D 2 227 ? -19.263 -15.763 -21.407 1.00 40.80 ? 228 ASP B N     1 
ATOM   4917 C CA    . ASP D 2 227 ? -20.221 -15.957 -22.470 1.00 38.55 ? 228 ASP B CA    1 
ATOM   4918 C C     . ASP D 2 227 ? -20.112 -14.903 -23.558 1.00 34.32 ? 228 ASP B C     1 
ATOM   4919 O O     . ASP D 2 227 ? -20.791 -15.008 -24.577 1.00 34.38 ? 228 ASP B O     1 
ATOM   4920 C CB    . ASP D 2 227 ? -21.622 -16.076 -21.917 1.00 45.24 ? 228 ASP B CB    1 
ATOM   4921 C CG    . ASP D 2 227 ? -21.900 -17.475 -21.388 1.00 53.00 ? 228 ASP B CG    1 
ATOM   4922 O OD1   . ASP D 2 227 ? -22.166 -18.388 -22.220 1.00 54.60 ? 228 ASP B OD1   1 
ATOM   4923 O OD2   . ASP D 2 227 ? -21.804 -17.665 -20.147 1.00 57.25 ? 228 ASP B OD2   1 
ATOM   4924 H H     . ASP D 2 227 ? -19.438 -15.099 -20.711 1.00 0.00  ? 228 ASP B H     1 
ATOM   4925 N N     . LYS D 2 228 ? -19.268 -13.886 -23.332 1.00 28.86 ? 229 LYS B N     1 
ATOM   4926 C CA    . LYS D 2 228 ? -18.996 -12.824 -24.313 1.00 21.89 ? 229 LYS B CA    1 
ATOM   4927 C C     . LYS D 2 228 ? -17.534 -13.003 -24.768 1.00 21.36 ? 229 LYS B C     1 
ATOM   4928 O O     . LYS D 2 228 ? -17.240 -13.725 -25.722 1.00 22.91 ? 229 LYS B O     1 
ATOM   4929 C CB    . LYS D 2 228 ? -19.145 -11.435 -23.699 1.00 17.71 ? 229 LYS B CB    1 
ATOM   4930 C CG    . LYS D 2 228 ? -20.409 -10.666 -24.081 1.00 15.67 ? 229 LYS B CG    1 
ATOM   4931 C CD    . LYS D 2 228 ? -20.208 -9.169  -23.910 1.00 6.72  ? 229 LYS B CD    1 
ATOM   4932 C CE    . LYS D 2 228 ? -21.523 -8.541  -23.811 1.00 15.74 ? 229 LYS B CE    1 
ATOM   4933 N NZ    . LYS D 2 228 ? -21.453 -7.115  -23.541 1.00 14.57 ? 229 LYS B NZ    1 
ATOM   4934 H H     . LYS D 2 228 ? -18.773 -13.859 -22.492 1.00 0.00  ? 229 LYS B H     1 
ATOM   4935 H HZ1   . LYS D 2 228 ? -20.903 -6.651  -24.293 1.00 0.00  ? 229 LYS B HZ1   1 
ATOM   4936 H HZ2   . LYS D 2 228 ? -22.409 -6.712  -23.501 1.00 0.00  ? 229 LYS B HZ2   1 
ATOM   4937 H HZ3   . LYS D 2 228 ? -20.967 -6.965  -22.632 1.00 0.00  ? 229 LYS B HZ3   1 
ATOM   4938 N N     . TYR D 2 229 ? -16.614 -12.365 -24.053 1.00 19.35 ? 230 TYR B N     1 
ATOM   4939 C CA    . TYR D 2 229 ? -15.191 -12.454 -24.354 1.00 17.56 ? 230 TYR B CA    1 
ATOM   4940 C C     . TYR D 2 229 ? -14.404 -11.986 -23.160 1.00 17.23 ? 230 TYR B C     1 
ATOM   4941 O O     . TYR D 2 229 ? -14.865 -11.142 -22.384 1.00 14.00 ? 230 TYR B O     1 
ATOM   4942 C CB    . TYR D 2 229 ? -14.805 -11.592 -25.578 1.00 11.52 ? 230 TYR B CB    1 
ATOM   4943 C CG    . TYR D 2 229 ? -15.227 -10.177 -25.478 1.00 4.67  ? 230 TYR B CG    1 
ATOM   4944 C CD1   . TYR D 2 229 ? -16.480 -9.778  -25.910 1.00 4.38  ? 230 TYR B CD1   1 
ATOM   4945 C CD2   . TYR D 2 229 ? -14.395 -9.229  -24.868 1.00 6.28  ? 230 TYR B CD2   1 
ATOM   4946 C CE1   . TYR D 2 229 ? -16.906 -8.443  -25.727 1.00 7.24  ? 230 TYR B CE1   1 
ATOM   4947 C CE2   . TYR D 2 229 ? -14.802 -7.914  -24.689 1.00 5.46  ? 230 TYR B CE2   1 
ATOM   4948 C CZ    . TYR D 2 229 ? -16.030 -7.524  -25.117 1.00 6.77  ? 230 TYR B CZ    1 
ATOM   4949 O OH    . TYR D 2 229 ? -16.349 -6.205  -25.016 1.00 8.40  ? 230 TYR B OH    1 
ATOM   4950 H H     . TYR D 2 229 ? -16.845 -11.832 -23.263 1.00 0.00  ? 230 TYR B H     1 
ATOM   4951 H HH    . TYR D 2 229 ? -15.669 -5.772  -24.489 1.00 0.00  ? 230 TYR B HH    1 
ATOM   4952 N N     . ASN D 2 230 ? -13.190 -12.515 -23.071 1.00 21.16 ? 231 ASN B N     1 
ATOM   4953 C CA    . ASN D 2 230 ? -12.257 -12.217 -22.002 1.00 25.56 ? 231 ASN B CA    1 
ATOM   4954 C C     . ASN D 2 230 ? -10.951 -11.654 -22.553 1.00 25.76 ? 231 ASN B C     1 
ATOM   4955 O O     . ASN D 2 230 ? -10.079 -11.276 -21.792 1.00 26.37 ? 231 ASN B O     1 
ATOM   4956 C CB    . ASN D 2 230 ? -11.960 -13.500 -21.224 1.00 31.04 ? 231 ASN B CB    1 
ATOM   4957 C CG    . ASN D 2 230 ? -13.001 -13.789 -20.145 1.00 36.62 ? 231 ASN B CG    1 
ATOM   4958 O OD1   . ASN D 2 230 ? -13.027 -13.122 -19.091 1.00 37.29 ? 231 ASN B OD1   1 
ATOM   4959 N ND2   . ASN D 2 230 ? -13.871 -14.786 -20.399 1.00 39.16 ? 231 ASN B ND2   1 
ATOM   4960 H H     . ASN D 2 230 ? -12.905 -13.117 -23.779 1.00 0.00  ? 231 ASN B H     1 
ATOM   4961 H HD21  . ASN D 2 230 ? -14.493 -14.991 -19.669 1.00 0.00  ? 231 ASN B HD21  1 
ATOM   4962 H HD22  . ASN D 2 230 ? -13.863 -15.289 -21.233 1.00 0.00  ? 231 ASN B HD22  1 
ATOM   4963 N N     . ASN D 2 231 ? -10.789 -11.648 -23.869 1.00 21.96 ? 232 ASN B N     1 
ATOM   4964 C CA    . ASN D 2 231 ? -9.568  -11.141 -24.482 1.00 22.42 ? 232 ASN B CA    1 
ATOM   4965 C C     . ASN D 2 231 ? -9.856  -10.658 -25.925 1.00 20.54 ? 232 ASN B C     1 
ATOM   4966 O O     . ASN D 2 231 ? -10.953 -10.861 -26.414 1.00 18.56 ? 232 ASN B O     1 
ATOM   4967 C CB    . ASN D 2 231 ? -8.485  -12.222 -24.458 1.00 24.04 ? 232 ASN B CB    1 
ATOM   4968 C CG    . ASN D 2 231 ? -8.841  -13.418 -25.311 1.00 24.72 ? 232 ASN B CG    1 
ATOM   4969 O OD1   . ASN D 2 231 ? -9.507  -13.287 -26.321 1.00 29.48 ? 232 ASN B OD1   1 
ATOM   4970 N ND2   . ASN D 2 231 ? -8.402  -14.582 -24.909 1.00 25.53 ? 232 ASN B ND2   1 
ATOM   4971 H H     . ASN D 2 231 ? -11.497 -11.918 -24.481 1.00 0.00  ? 232 ASN B H     1 
ATOM   4972 H HD21  . ASN D 2 231 ? -8.621  -15.375 -25.440 1.00 0.00  ? 232 ASN B HD21  1 
ATOM   4973 H HD22  . ASN D 2 231 ? -7.871  -14.613 -24.084 1.00 0.00  ? 232 ASN B HD22  1 
ATOM   4974 N N     . ILE D 2 232 ? -8.864  -10.072 -26.603 1.00 18.68 ? 233 ILE B N     1 
ATOM   4975 C CA    . ILE D 2 232 ? -9.028  -9.526  -27.957 1.00 18.87 ? 233 ILE B CA    1 
ATOM   4976 C C     . ILE D 2 232 ? -9.408  -10.579 -29.023 1.00 17.18 ? 233 ILE B C     1 
ATOM   4977 O O     . ILE D 2 232 ? -10.277 -10.344 -29.851 1.00 14.87 ? 233 ILE B O     1 
ATOM   4978 C CB    . ILE D 2 232 ? -7.734  -8.711  -28.387 1.00 19.43 ? 233 ILE B CB    1 
ATOM   4979 C CG1   . ILE D 2 232 ? -7.944  -7.934  -29.690 1.00 16.61 ? 233 ILE B CG1   1 
ATOM   4980 C CG2   . ILE D 2 232 ? -6.564  -9.645  -28.565 1.00 17.51 ? 233 ILE B CG2   1 
ATOM   4981 C CD1   . ILE D 2 232 ? -8.948  -6.836  -29.604 1.00 14.77 ? 233 ILE B CD1   1 
ATOM   4982 H H     . ILE D 2 232 ? -7.992  -10.014 -26.180 1.00 0.00  ? 233 ILE B H     1 
ATOM   4983 N N     . SER D 2 233 ? -8.803  -11.752 -28.975 1.00 17.02 ? 234 SER B N     1 
ATOM   4984 C CA    . SER D 2 233 ? -9.147  -12.767 -29.951 1.00 20.27 ? 234 SER B CA    1 
ATOM   4985 C C     . SER D 2 233 ? -10.617 -13.152 -29.799 1.00 19.08 ? 234 SER B C     1 
ATOM   4986 O O     . SER D 2 233 ? -11.349 -13.235 -30.784 1.00 19.56 ? 234 SER B O     1 
ATOM   4987 C CB    . SER D 2 233 ? -8.230  -13.990 -29.801 1.00 22.73 ? 234 SER B CB    1 
ATOM   4988 O OG    . SER D 2 233 ? -8.565  -14.738 -28.644 1.00 32.67 ? 234 SER B OG    1 
ATOM   4989 H H     . SER D 2 233 ? -8.114  -11.938 -28.302 1.00 0.00  ? 234 SER B H     1 
ATOM   4990 H HG    . SER D 2 233 ? -8.530  -14.174 -27.862 1.00 0.00  ? 234 SER B HG    1 
ATOM   4991 N N     . GLU D 2 234 ? -11.070 -13.283 -28.551 1.00 18.03 ? 235 GLU B N     1 
ATOM   4992 C CA    . GLU D 2 234 ? -12.457 -13.641 -28.243 1.00 16.06 ? 235 GLU B CA    1 
ATOM   4993 C C     . GLU D 2 234 ? -13.485 -12.587 -28.608 1.00 13.84 ? 235 GLU B C     1 
ATOM   4994 O O     . GLU D 2 234 ? -14.614 -12.909 -28.974 1.00 15.04 ? 235 GLU B O     1 
ATOM   4995 C CB    . GLU D 2 234 ? -12.588 -13.974 -26.788 1.00 15.53 ? 235 GLU B CB    1 
ATOM   4996 C CG    . GLU D 2 234 ? -11.901 -15.235 -26.461 1.00 18.84 ? 235 GLU B CG    1 
ATOM   4997 C CD    . GLU D 2 234 ? -12.246 -15.721 -25.087 1.00 22.06 ? 235 GLU B CD    1 
ATOM   4998 O OE1   . GLU D 2 234 ? -13.056 -15.057 -24.395 1.00 24.27 ? 235 GLU B OE1   1 
ATOM   4999 O OE2   . GLU D 2 234 ? -11.712 -16.783 -24.712 1.00 24.70 ? 235 GLU B OE2   1 
ATOM   5000 H H     . GLU D 2 234 ? -10.452 -13.130 -27.828 1.00 0.00  ? 235 GLU B H     1 
ATOM   5001 N N     . TYR D 2 235 ? -13.095 -11.332 -28.488 1.00 11.47 ? 236 TYR B N     1 
ATOM   5002 C CA    . TYR D 2 235 ? -13.942 -10.216 -28.836 1.00 11.98 ? 236 TYR B CA    1 
ATOM   5003 C C     . TYR D 2 235 ? -14.187 -10.168 -30.361 1.00 14.73 ? 236 TYR B C     1 
ATOM   5004 O O     . TYR D 2 235 ? -15.259 -9.786  -30.819 1.00 14.30 ? 236 TYR B O     1 
ATOM   5005 C CB    . TYR D 2 235 ? -13.226 -8.958  -28.415 1.00 8.13  ? 236 TYR B CB    1 
ATOM   5006 C CG    . TYR D 2 235 ? -13.663 -7.718  -29.109 1.00 6.42  ? 236 TYR B CG    1 
ATOM   5007 C CD1   . TYR D 2 235 ? -14.805 -7.062  -28.720 1.00 6.59  ? 236 TYR B CD1   1 
ATOM   5008 C CD2   . TYR D 2 235 ? -12.897 -7.175  -30.160 1.00 8.45  ? 236 TYR B CD2   1 
ATOM   5009 C CE1   . TYR D 2 235 ? -15.206 -5.893  -29.335 1.00 6.30  ? 236 TYR B CE1   1 
ATOM   5010 C CE2   . TYR D 2 235 ? -13.286 -5.999  -30.789 1.00 6.11  ? 236 TYR B CE2   1 
ATOM   5011 C CZ    . TYR D 2 235 ? -14.438 -5.371  -30.369 1.00 10.07 ? 236 TYR B CZ    1 
ATOM   5012 O OH    . TYR D 2 235 ? -14.819 -4.201  -30.966 1.00 11.48 ? 236 TYR B OH    1 
ATOM   5013 H H     . TYR D 2 235 ? -12.191 -11.161 -28.142 1.00 0.00  ? 236 TYR B H     1 
ATOM   5014 H HH    . TYR D 2 235 ? -14.050 -3.727  -31.291 1.00 0.00  ? 236 TYR B HH    1 
ATOM   5015 N N     . ARG D 2 236 ? -13.146 -10.462 -31.128 1.00 16.73 ? 237 ARG B N     1 
ATOM   5016 C CA    . ARG D 2 236 ? -13.213 -10.456 -32.582 1.00 16.90 ? 237 ARG B CA    1 
ATOM   5017 C C     . ARG D 2 236 ? -14.135 -11.568 -33.096 1.00 16.34 ? 237 ARG B C     1 
ATOM   5018 O O     . ARG D 2 236 ? -14.930 -11.339 -34.006 1.00 18.03 ? 237 ARG B O     1 
ATOM   5019 C CB    . ARG D 2 236 ? -11.790 -10.504 -33.149 1.00 19.24 ? 237 ARG B CB    1 
ATOM   5020 C CG    . ARG D 2 236 ? -11.059 -9.184  -32.841 1.00 15.90 ? 237 ARG B CG    1 
ATOM   5021 C CD    . ARG D 2 236 ? -9.661  -9.103  -33.336 1.00 19.42 ? 237 ARG B CD    1 
ATOM   5022 N NE    . ARG D 2 236 ? -9.149  -7.740  -33.181 1.00 22.28 ? 237 ARG B NE    1 
ATOM   5023 C CZ    . ARG D 2 236 ? -7.858  -7.425  -33.121 1.00 21.52 ? 237 ARG B CZ    1 
ATOM   5024 N NH1   . ARG D 2 236 ? -6.949  -8.388  -33.195 1.00 26.28 ? 237 ARG B NH1   1 
ATOM   5025 N NH2   . ARG D 2 236 ? -7.480  -6.154  -33.037 1.00 20.10 ? 237 ARG B NH2   1 
ATOM   5026 H H     . ARG D 2 236 ? -12.288 -10.688 -30.695 1.00 0.00  ? 237 ARG B H     1 
ATOM   5027 H HE    . ARG D 2 236 ? -9.798  -7.018  -33.114 1.00 0.00  ? 237 ARG B HE    1 
ATOM   5028 H HH11  . ARG D 2 236 ? -7.230  -9.342  -33.295 1.00 0.00  ? 237 ARG B HH11  1 
ATOM   5029 H HH12  . ARG D 2 236 ? -5.975  -8.164  -33.149 1.00 0.00  ? 237 ARG B HH12  1 
ATOM   5030 H HH21  . ARG D 2 236 ? -8.169  -5.441  -33.043 1.00 0.00  ? 237 ARG B HH21  1 
ATOM   5031 H HH22  . ARG D 2 236 ? -6.508  -5.919  -32.994 1.00 0.00  ? 237 ARG B HH22  1 
ATOM   5032 N N     . ASN D 2 237 ? -14.082 -12.733 -32.448 1.00 16.29 ? 238 ASN B N     1 
ATOM   5033 C CA    . ASN D 2 237 ? -14.956 -13.861 -32.759 1.00 16.17 ? 238 ASN B CA    1 
ATOM   5034 C C     . ASN D 2 237 ? -16.395 -13.576 -32.344 1.00 14.83 ? 238 ASN B C     1 
ATOM   5035 O O     . ASN D 2 237 ? -17.331 -14.124 -32.895 1.00 14.00 ? 238 ASN B O     1 
ATOM   5036 C CB    . ASN D 2 237 ? -14.491 -15.109 -32.055 1.00 14.49 ? 238 ASN B CB    1 
ATOM   5037 C CG    . ASN D 2 237 ? -15.213 -16.334 -32.543 1.00 20.19 ? 238 ASN B CG    1 
ATOM   5038 O OD1   . ASN D 2 237 ? -16.380 -16.539 -32.249 1.00 21.70 ? 238 ASN B OD1   1 
ATOM   5039 N ND2   . ASN D 2 237 ? -14.517 -17.163 -33.294 1.00 21.43 ? 238 ASN B ND2   1 
ATOM   5040 H H     . ASN D 2 237 ? -13.401 -12.833 -31.742 1.00 0.00  ? 238 ASN B H     1 
ATOM   5041 H HD21  . ASN D 2 237 ? -14.988 -17.951 -33.628 1.00 0.00  ? 238 ASN B HD21  1 
ATOM   5042 H HD22  . ASN D 2 237 ? -13.576 -16.944 -33.475 1.00 0.00  ? 238 ASN B HD22  1 
ATOM   5043 N N     . TRP D 2 238 ? -16.553 -12.683 -31.384 1.00 14.69 ? 239 TRP B N     1 
ATOM   5044 C CA    . TRP D 2 238 ? -17.854 -12.272 -30.868 1.00 15.33 ? 239 TRP B CA    1 
ATOM   5045 C C     . TRP D 2 238 ? -18.491 -11.259 -31.851 1.00 17.86 ? 239 TRP B C     1 
ATOM   5046 O O     . TRP D 2 238 ? -19.733 -11.158 -31.973 1.00 18.60 ? 239 TRP B O     1 
ATOM   5047 C CB    . TRP D 2 238 ? -17.613 -11.662 -29.492 1.00 11.80 ? 239 TRP B CB    1 
ATOM   5048 C CG    . TRP D 2 238 ? -18.780 -11.083 -28.868 1.00 9.23  ? 239 TRP B CG    1 
ATOM   5049 C CD1   . TRP D 2 238 ? -19.786 -11.754 -28.234 1.00 7.11  ? 239 TRP B CD1   1 
ATOM   5050 C CD2   . TRP D 2 238 ? -19.092 -9.695  -28.775 1.00 7.45  ? 239 TRP B CD2   1 
ATOM   5051 N NE1   . TRP D 2 238 ? -20.705 -10.850 -27.757 1.00 7.72  ? 239 TRP B NE1   1 
ATOM   5052 C CE2   . TRP D 2 238 ? -20.296 -9.583  -28.071 1.00 7.39  ? 239 TRP B CE2   1 
ATOM   5053 C CE3   . TRP D 2 238 ? -18.464 -8.526  -29.223 1.00 10.05 ? 239 TRP B CE3   1 
ATOM   5054 C CZ2   . TRP D 2 238 ? -20.888 -8.354  -27.798 1.00 10.52 ? 239 TRP B CZ2   1 
ATOM   5055 C CZ3   . TRP D 2 238 ? -19.057 -7.303  -28.952 1.00 10.03 ? 239 TRP B CZ3   1 
ATOM   5056 C CH2   . TRP D 2 238 ? -20.253 -7.231  -28.247 1.00 10.29 ? 239 TRP B CH2   1 
ATOM   5057 H H     . TRP D 2 238 ? -15.756 -12.301 -30.965 1.00 0.00  ? 239 TRP B H     1 
ATOM   5058 H HE1   . TRP D 2 238 ? -21.542 -11.136 -27.316 1.00 0.00  ? 239 TRP B HE1   1 
ATOM   5059 N N     . ILE D 2 239 ? -17.642 -10.453 -32.492 1.00 16.75 ? 240 ILE B N     1 
ATOM   5060 C CA    . ILE D 2 239 ? -18.098 -9.499  -33.502 1.00 19.20 ? 240 ILE B CA    1 
ATOM   5061 C C     . ILE D 2 239 ? -18.626 -10.350 -34.678 1.00 18.45 ? 240 ILE B C     1 
ATOM   5062 O O     . ILE D 2 239 ? -19.675 -10.073 -35.238 1.00 21.75 ? 240 ILE B O     1 
ATOM   5063 C CB    . ILE D 2 239 ? -16.931 -8.611  -34.005 1.00 20.44 ? 240 ILE B CB    1 
ATOM   5064 C CG1   . ILE D 2 239 ? -16.588 -7.499  -32.982 1.00 19.31 ? 240 ILE B CG1   1 
ATOM   5065 C CG2   . ILE D 2 239 ? -17.257 -8.036  -35.378 1.00 20.43 ? 240 ILE B CG2   1 
ATOM   5066 C CD1   . ILE D 2 239 ? -17.717 -6.518  -32.687 1.00 19.50 ? 240 ILE B CD1   1 
ATOM   5067 H H     . ILE D 2 239 ? -16.690 -10.471 -32.256 1.00 0.00  ? 240 ILE B H     1 
ATOM   5068 N N     . TYR D 2 240 ? -17.900 -11.420 -34.990 1.00 19.09 ? 241 TYR B N     1 
ATOM   5069 C CA    . TYR D 2 240 ? -18.257 -12.346 -36.044 1.00 20.13 ? 241 TYR B CA    1 
ATOM   5070 C C     . TYR D 2 240 ? -19.603 -13.030 -35.777 1.00 22.11 ? 241 TYR B C     1 
ATOM   5071 O O     . TYR D 2 240 ? -20.422 -13.125 -36.691 1.00 24.52 ? 241 TYR B O     1 
ATOM   5072 C CB    . TYR D 2 240 ? -17.144 -13.379 -36.255 1.00 16.39 ? 241 TYR B CB    1 
ATOM   5073 C CG    . TYR D 2 240 ? -17.633 -14.624 -36.938 1.00 18.85 ? 241 TYR B CG    1 
ATOM   5074 C CD1   . TYR D 2 240 ? -17.645 -14.716 -38.321 1.00 20.54 ? 241 TYR B CD1   1 
ATOM   5075 C CD2   . TYR D 2 240 ? -18.133 -15.693 -36.203 1.00 18.22 ? 241 TYR B CD2   1 
ATOM   5076 C CE1   . TYR D 2 240 ? -18.142 -15.841 -38.963 1.00 21.13 ? 241 TYR B CE1   1 
ATOM   5077 C CE2   . TYR D 2 240 ? -18.639 -16.831 -36.818 1.00 18.19 ? 241 TYR B CE2   1 
ATOM   5078 C CZ    . TYR D 2 240 ? -18.640 -16.899 -38.216 1.00 22.40 ? 241 TYR B CZ    1 
ATOM   5079 O OH    . TYR D 2 240 ? -19.126 -18.013 -38.870 1.00 19.62 ? 241 TYR B OH    1 
ATOM   5080 H H     . TYR D 2 240 ? -17.075 -11.575 -34.484 1.00 0.00  ? 241 TYR B H     1 
ATOM   5081 H HH    . TYR D 2 240 ? -19.526 -18.586 -38.206 1.00 0.00  ? 241 TYR B HH    1 
ATOM   5082 N N     . ARG D 2 241 ? -19.832 -13.525 -34.557 1.00 20.89 ? 242 ARG B N     1 
ATOM   5083 C CA    . ARG D 2 241 ? -21.089 -14.183 -34.182 1.00 17.25 ? 242 ARG B CA    1 
ATOM   5084 C C     . ARG D 2 241 ? -22.263 -13.229 -34.194 1.00 19.11 ? 242 ARG B C     1 
ATOM   5085 O O     . ARG D 2 241 ? -23.395 -13.634 -33.913 1.00 23.77 ? 242 ARG B O     1 
ATOM   5086 C CB    . ARG D 2 241 ? -21.009 -14.776 -32.789 1.00 16.63 ? 242 ARG B CB    1 
ATOM   5087 C CG    . ARG D 2 241 ? -20.129 -15.955 -32.694 1.00 20.33 ? 242 ARG B CG    1 
ATOM   5088 C CD    . ARG D 2 241 ? -20.244 -16.583 -31.305 1.00 26.14 ? 242 ARG B CD    1 
ATOM   5089 N NE    . ARG D 2 241 ? -20.204 -15.596 -30.217 1.00 28.96 ? 242 ARG B NE    1 
ATOM   5090 C CZ    . ARG D 2 241 ? -19.185 -15.449 -29.373 1.00 29.04 ? 242 ARG B CZ    1 
ATOM   5091 N NH1   . ARG D 2 241 ? -18.104 -16.216 -29.474 1.00 30.59 ? 242 ARG B NH1   1 
ATOM   5092 N NH2   . ARG D 2 241 ? -19.240 -14.519 -28.432 1.00 30.53 ? 242 ARG B NH2   1 
ATOM   5093 H H     . ARG D 2 241 ? -19.117 -13.473 -33.887 1.00 0.00  ? 242 ARG B H     1 
ATOM   5094 H HE    . ARG D 2 241 ? -20.976 -15.005 -30.104 1.00 0.00  ? 242 ARG B HE    1 
ATOM   5095 H HH11  . ARG D 2 241 ? -18.039 -16.914 -30.185 1.00 0.00  ? 242 ARG B HH11  1 
ATOM   5096 H HH12  . ARG D 2 241 ? -17.349 -16.088 -28.831 1.00 0.00  ? 242 ARG B HH12  1 
ATOM   5097 H HH21  . ARG D 2 241 ? -20.061 -13.955 -28.364 1.00 0.00  ? 242 ARG B HH21  1 
ATOM   5098 H HH22  . ARG D 2 241 ? -18.482 -14.395 -27.791 1.00 0.00  ? 242 ARG B HH22  1 
ATOM   5099 N N     . GLY D 2 242 ? -21.999 -11.954 -34.454 1.00 17.79 ? 243 GLY B N     1 
ATOM   5100 C CA    . GLY D 2 242 ? -23.070 -10.988 -34.510 1.00 20.03 ? 243 GLY B CA    1 
ATOM   5101 C C     . GLY D 2 242 ? -23.303 -10.232 -33.229 1.00 22.90 ? 243 GLY B C     1 
ATOM   5102 O O     . GLY D 2 242 ? -24.393 -9.698  -33.036 1.00 23.43 ? 243 GLY B O     1 
ATOM   5103 H H     . GLY D 2 242 ? -21.091 -11.637 -34.625 1.00 0.00  ? 243 GLY B H     1 
ATOM   5104 N N     . ARG D 2 243 ? -22.279 -10.156 -32.377 1.00 26.72 ? 244 ARG B N     1 
ATOM   5105 C CA    . ARG D 2 243 ? -22.366 -9.446  -31.104 1.00 27.10 ? 244 ARG B CA    1 
ATOM   5106 C C     . ARG D 2 243 ? -23.422 -10.069 -30.203 1.00 27.17 ? 244 ARG B C     1 
ATOM   5107 O O     . ARG D 2 243 ? -24.150 -9.364  -29.518 1.00 27.16 ? 244 ARG B O     1 
ATOM   5108 C CB    . ARG D 2 243 ? -22.675 -7.959  -31.320 1.00 26.23 ? 244 ARG B CB    1 
ATOM   5109 C CG    . ARG D 2 243 ? -21.671 -7.265  -32.236 1.00 28.06 ? 244 ARG B CG    1 
ATOM   5110 C CD    . ARG D 2 243 ? -22.032 -5.813  -32.488 1.00 28.98 ? 244 ARG B CD    1 
ATOM   5111 N NE    . ARG D 2 243 ? -21.941 -4.990  -31.286 1.00 32.12 ? 244 ARG B NE    1 
ATOM   5112 C CZ    . ARG D 2 243 ? -20.846 -4.350  -30.869 1.00 33.13 ? 244 ARG B CZ    1 
ATOM   5113 N NH1   . ARG D 2 243 ? -19.709 -4.429  -31.555 1.00 28.67 ? 244 ARG B NH1   1 
ATOM   5114 N NH2   . ARG D 2 243 ? -20.906 -3.614  -29.761 1.00 33.42 ? 244 ARG B NH2   1 
ATOM   5115 H H     . ARG D 2 243 ? -21.445 -10.609 -32.599 1.00 0.00  ? 244 ARG B H     1 
ATOM   5116 H HE    . ARG D 2 243 ? -22.746 -4.893  -30.734 1.00 0.00  ? 244 ARG B HE    1 
ATOM   5117 H HH11  . ARG D 2 243 ? -19.668 -4.966  -32.397 1.00 0.00  ? 244 ARG B HH11  1 
ATOM   5118 H HH12  . ARG D 2 243 ? -18.896 -3.948  -31.231 1.00 0.00  ? 244 ARG B HH12  1 
ATOM   5119 H HH21  . ARG D 2 243 ? -21.766 -3.549  -29.256 1.00 0.00  ? 244 ARG B HH21  1 
ATOM   5120 H HH22  . ARG D 2 243 ? -20.089 -3.138  -29.435 1.00 0.00  ? 244 ARG B HH22  1 
ATOM   5121 N N     . LYS D 2 244 ? -23.480 -11.392 -30.207 1.00 29.31 ? 245 LYS B N     1 
ATOM   5122 C CA    . LYS D 2 244 ? -24.421 -12.136 -29.391 1.00 31.83 ? 245 LYS B CA    1 
ATOM   5123 C C     . LYS D 2 244 ? -23.634 -13.298 -28.792 1.00 34.22 ? 245 LYS B C     1 
ATOM   5124 O O     . LYS D 2 244 ? -22.806 -13.921 -29.509 1.00 33.70 ? 245 LYS B O     1 
ATOM   5125 C CB    . LYS D 2 244 ? -25.575 -12.668 -30.246 1.00 30.64 ? 245 LYS B CB    1 
ATOM   5126 O OXT   . LYS D 2 244 ? -23.819 -13.539 -27.579 1.00 40.34 ? 245 LYS B OXT   1 
ATOM   5127 H H     . LYS D 2 244 ? -22.859 -11.941 -30.725 1.00 0.00  ? 245 LYS B H     1 
HETATM 5128 O O     . HOH E 3 .   ? -5.318  -6.901  -1.877  1.00 38.25 ? 13  HOH C O     1 
HETATM 5129 H H1    . HOH E 3 .   ? -5.846  -6.392  -1.256  1.00 0.00  ? 13  HOH C H1    1 
HETATM 5130 H H2    . HOH E 3 .   ? -5.862  -7.712  -1.936  1.00 0.00  ? 13  HOH C H2    1 
HETATM 5131 O O     . HOH E 3 .   ? -13.849 11.455  3.999   1.00 20.06 ? 16  HOH C O     1 
HETATM 5132 H H1    . HOH E 3 .   ? -13.584 12.166  3.398   1.00 0.00  ? 16  HOH C H1    1 
HETATM 5133 H H2    . HOH E 3 .   ? -14.150 11.922  4.784   1.00 0.00  ? 16  HOH C H2    1 
HETATM 5134 O O     . HOH E 3 .   ? -9.239  4.175   3.694   1.00 23.24 ? 19  HOH C O     1 
HETATM 5135 H H1    . HOH E 3 .   ? -10.178 4.095   3.503   1.00 0.00  ? 19  HOH C H1    1 
HETATM 5136 H H2    . HOH E 3 .   ? -9.017  5.078   3.428   1.00 0.00  ? 19  HOH C H2    1 
HETATM 5137 O O     . HOH E 3 .   ? -7.500  -0.731  6.418   1.00 29.83 ? 21  HOH C O     1 
HETATM 5138 H H1    . HOH E 3 .   ? -7.290  -1.664  6.300   1.00 0.00  ? 21  HOH C H1    1 
HETATM 5139 H H2    . HOH E 3 .   ? -6.758  -0.272  6.009   1.00 0.00  ? 21  HOH C H2    1 
HETATM 5140 O O     . HOH E 3 .   ? -12.416 10.850  -4.629  1.00 41.80 ? 49  HOH C O     1 
HETATM 5141 H H1    . HOH E 3 .   ? -12.961 11.407  -4.056  1.00 0.00  ? 49  HOH C H1    1 
HETATM 5142 H H2    . HOH E 3 .   ? -12.284 10.096  -4.044  1.00 0.00  ? 49  HOH C H2    1 
HETATM 5143 O O     . HOH E 3 .   ? -14.389 -7.489  -5.571  1.00 46.45 ? 79  HOH C O     1 
HETATM 5144 H H1    . HOH E 3 .   ? -14.631 -8.419  -5.703  1.00 0.00  ? 79  HOH C H1    1 
HETATM 5145 H H2    . HOH E 3 .   ? -14.211 -7.423  -4.624  1.00 0.00  ? 79  HOH C H2    1 
HETATM 5146 O O     . HOH E 3 .   ? -6.905  -7.206  -12.579 1.00 29.53 ? 91  HOH C O     1 
HETATM 5147 H H1    . HOH E 3 .   ? -6.945  -8.109  -12.901 1.00 0.00  ? 91  HOH C H1    1 
HETATM 5148 H H2    . HOH E 3 .   ? -6.576  -6.720  -13.351 1.00 0.00  ? 91  HOH C H2    1 
HETATM 5149 O O     . HOH E 3 .   ? -3.980  4.776   -2.132  1.00 56.39 ? 94  HOH C O     1 
HETATM 5150 H H1    . HOH E 3 .   ? -4.627  5.090   -1.481  1.00 0.00  ? 94  HOH C H1    1 
HETATM 5151 H H2    . HOH E 3 .   ? -3.908  3.845   -1.892  1.00 0.00  ? 94  HOH C H2    1 
HETATM 5152 O O     . HOH E 3 .   ? -22.356 16.669  -4.087  1.00 37.40 ? 135 HOH C O     1 
HETATM 5153 H H1    . HOH E 3 .   ? -22.493 16.673  -5.049  1.00 0.00  ? 135 HOH C H1    1 
HETATM 5154 H H2    . HOH E 3 .   ? -21.426 16.886  -4.010  1.00 0.00  ? 135 HOH C H2    1 
HETATM 5155 O O     . HOH E 3 .   ? -23.278 10.258  -7.449  1.00 40.38 ? 140 HOH C O     1 
HETATM 5156 H H1    . HOH E 3 .   ? -23.938 9.611   -7.145  1.00 0.00  ? 140 HOH C H1    1 
HETATM 5157 H H2    . HOH E 3 .   ? -23.610 11.078  -7.062  1.00 0.00  ? 140 HOH C H2    1 
HETATM 5158 O O     . HOH E 3 .   ? -25.213 8.740   -6.148  1.00 45.68 ? 141 HOH C O     1 
HETATM 5159 H H1    . HOH E 3 .   ? -25.151 9.304   -5.359  1.00 0.00  ? 141 HOH C H1    1 
HETATM 5160 H H2    . HOH E 3 .   ? -25.401 7.868   -5.786  1.00 0.00  ? 141 HOH C H2    1 
HETATM 5161 O O     . HOH E 3 .   ? -7.431  -8.603  -1.512  1.00 50.02 ? 149 HOH C O     1 
HETATM 5162 H H1    . HOH E 3 .   ? -8.135  -8.796  -2.143  1.00 0.00  ? 149 HOH C H1    1 
HETATM 5163 H H2    . HOH E 3 .   ? -7.880  -8.064  -0.844  1.00 0.00  ? 149 HOH C H2    1 
HETATM 5164 O O     . HOH F 3 .   ? -23.822 -0.450  -0.687  1.00 32.74 ? 40  HOH D O     1 
HETATM 5165 H H1    . HOH F 3 .   ? -23.004 -0.691  -1.126  1.00 0.00  ? 40  HOH D H1    1 
HETATM 5166 H H2    . HOH F 3 .   ? -23.525 -0.287  0.232   1.00 0.00  ? 40  HOH D H2    1 
HETATM 5167 O O     . HOH F 3 .   ? -10.984 6.894   -15.523 1.00 16.55 ? 57  HOH D O     1 
HETATM 5168 H H1    . HOH F 3 .   ? -11.024 6.954   -16.489 1.00 0.00  ? 57  HOH D H1    1 
HETATM 5169 H H2    . HOH F 3 .   ? -10.251 7.508   -15.310 1.00 0.00  ? 57  HOH D H2    1 
HETATM 5170 O O     . HOH F 3 .   ? -13.850 2.862   -12.014 1.00 15.98 ? 59  HOH D O     1 
HETATM 5171 H H1    . HOH F 3 .   ? -13.036 2.334   -11.994 1.00 0.00  ? 59  HOH D H1    1 
HETATM 5172 H H2    . HOH F 3 .   ? -13.479 3.747   -12.200 1.00 0.00  ? 59  HOH D H2    1 
HETATM 5173 O O     . HOH F 3 .   ? -21.365 1.217   -13.609 1.00 50.14 ? 101 HOH D O     1 
HETATM 5174 H H1    . HOH F 3 .   ? -20.533 1.673   -13.722 1.00 0.00  ? 101 HOH D H1    1 
HETATM 5175 H H2    . HOH F 3 .   ? -21.127 0.503   -12.979 1.00 0.00  ? 101 HOH D H2    1 
HETATM 5176 O O     . HOH F 3 .   ? -2.192  -0.162  -3.800  1.00 35.26 ? 108 HOH D O     1 
HETATM 5177 H H1    . HOH F 3 .   ? -1.825  -1.034  -3.643  1.00 0.00  ? 108 HOH D H1    1 
HETATM 5178 H H2    . HOH F 3 .   ? -2.484  -0.241  -4.719  1.00 0.00  ? 108 HOH D H2    1 
HETATM 5179 O O     . HOH F 3 .   ? -26.786 -1.756  -7.578  1.00 46.21 ? 114 HOH D O     1 
HETATM 5180 H H1    . HOH F 3 .   ? -26.619 -1.346  -6.729  1.00 0.00  ? 114 HOH D H1    1 
HETATM 5181 H H2    . HOH F 3 .   ? -26.247 -1.248  -8.193  1.00 0.00  ? 114 HOH D H2    1 
HETATM 5182 O O     . HOH F 3 .   ? 1.261   -2.723  -10.159 1.00 33.28 ? 125 HOH D O     1 
HETATM 5183 H H1    . HOH F 3 .   ? 2.175   -3.038  -10.065 1.00 0.00  ? 125 HOH D H1    1 
HETATM 5184 H H2    . HOH F 3 .   ? 1.383   -1.814  -10.464 1.00 0.00  ? 125 HOH D H2    1 
HETATM 5185 O O     . HOH F 3 .   ? -20.761 6.994   -14.063 1.00 44.03 ? 128 HOH D O     1 
HETATM 5186 H H1    . HOH F 3 .   ? -19.822 6.863   -13.888 1.00 0.00  ? 128 HOH D H1    1 
HETATM 5187 H H2    . HOH F 3 .   ? -21.106 6.091   -14.027 1.00 0.00  ? 128 HOH D H2    1 
HETATM 5188 O O     . HOH F 3 .   ? -22.533 6.808   3.304   1.00 36.57 ? 136 HOH D O     1 
HETATM 5189 H H1    . HOH F 3 .   ? -23.294 7.159   3.781   1.00 0.00  ? 136 HOH D H1    1 
HETATM 5190 H H2    . HOH F 3 .   ? -21.925 6.530   4.001   1.00 0.00  ? 136 HOH D H2    1 
HETATM 5191 O O     . HOH F 3 .   ? -26.271 4.974   -5.100  1.00 44.38 ? 137 HOH D O     1 
HETATM 5192 H H1    . HOH F 3 .   ? -25.681 4.360   -4.647  1.00 0.00  ? 137 HOH D H1    1 
HETATM 5193 H H2    . HOH F 3 .   ? -27.080 4.469   -5.191  1.00 0.00  ? 137 HOH D H2    1 
HETATM 5194 O O     . HOH F 3 .   ? -8.572  8.266   -14.779 1.00 35.23 ? 138 HOH D O     1 
HETATM 5195 H H1    . HOH F 3 .   ? -8.965  8.772   -14.036 1.00 0.00  ? 138 HOH D H1    1 
HETATM 5196 H H2    . HOH F 3 .   ? -7.642  8.259   -14.527 1.00 0.00  ? 138 HOH D H2    1 
HETATM 5197 O O     . HOH F 3 .   ? -23.763 3.597   4.156   1.00 41.81 ? 142 HOH D O     1 
HETATM 5198 H H1    . HOH F 3 .   ? -23.573 2.977   3.445   1.00 0.00  ? 142 HOH D H1    1 
HETATM 5199 H H2    . HOH F 3 .   ? -23.418 4.434   3.825   1.00 0.00  ? 142 HOH D H2    1 
HETATM 5200 O O     . HOH F 3 .   ? -8.074  11.307  -13.943 1.00 34.74 ? 178 HOH D O     1 
HETATM 5201 H H1    . HOH F 3 .   ? -8.756  10.853  -13.415 1.00 0.00  ? 178 HOH D H1    1 
HETATM 5202 H H2    . HOH F 3 .   ? -7.270  10.875  -13.642 1.00 0.00  ? 178 HOH D H2    1 
HETATM 5203 O O     . HOH G 3 .   ? 0.069   24.304  22.238  1.00 46.03 ? 246 HOH A O     1 
HETATM 5204 H H1    . HOH G 3 .   ? -0.322  24.975  21.670  1.00 0.00  ? 246 HOH A H1    1 
HETATM 5205 H H2    . HOH G 3 .   ? -0.684  23.980  22.739  1.00 0.00  ? 246 HOH A H2    1 
HETATM 5206 O O     . HOH G 3 .   ? 1.871   25.413  -2.385  1.00 17.60 ? 247 HOH A O     1 
HETATM 5207 H H1    . HOH G 3 .   ? 1.409   26.247  -2.489  1.00 0.00  ? 247 HOH A H1    1 
HETATM 5208 H H2    . HOH G 3 .   ? 2.792   25.682  -2.344  1.00 0.00  ? 247 HOH A H2    1 
HETATM 5209 O O     . HOH G 3 .   ? -9.072  12.535  -2.357  1.00 40.88 ? 248 HOH A O     1 
HETATM 5210 H H1    . HOH G 3 .   ? -9.559  11.975  -2.981  1.00 0.00  ? 248 HOH A H1    1 
HETATM 5211 H H2    . HOH G 3 .   ? -9.344  12.160  -1.507  1.00 0.00  ? 248 HOH A H2    1 
HETATM 5212 O O     . HOH G 3 .   ? 8.792   12.178  5.945   1.00 21.00 ? 249 HOH A O     1 
HETATM 5213 H H1    . HOH G 3 .   ? 8.128   12.858  6.048   1.00 0.00  ? 249 HOH A H1    1 
HETATM 5214 H H2    . HOH G 3 .   ? 8.929   12.166  4.989   1.00 0.00  ? 249 HOH A H2    1 
HETATM 5215 O O     . HOH G 3 .   ? 3.302   -0.816  9.612   1.00 13.57 ? 250 HOH A O     1 
HETATM 5216 H H1    . HOH G 3 .   ? 2.546   -0.559  9.059   1.00 0.00  ? 250 HOH A H1    1 
HETATM 5217 H H2    . HOH G 3 .   ? 3.825   -0.008  9.666   1.00 0.00  ? 250 HOH A H2    1 
HETATM 5218 O O     . HOH G 3 .   ? 4.404   -5.559  5.200   1.00 33.24 ? 251 HOH A O     1 
HETATM 5219 H H1    . HOH G 3 .   ? 4.769   -6.403  4.906   1.00 0.00  ? 251 HOH A H1    1 
HETATM 5220 H H2    . HOH G 3 .   ? 5.074   -5.339  5.884   1.00 0.00  ? 251 HOH A H2    1 
HETATM 5221 O O     . HOH G 3 .   ? -1.403  -8.525  0.063   1.00 52.86 ? 252 HOH A O     1 
HETATM 5222 H H1    . HOH G 3 .   ? -2.210  -8.831  -0.370  1.00 0.00  ? 252 HOH A H1    1 
HETATM 5223 H H2    . HOH G 3 .   ? -0.938  -8.098  -0.670  1.00 0.00  ? 252 HOH A H2    1 
HETATM 5224 O O     . HOH G 3 .   ? -3.504  6.568   5.263   1.00 50.02 ? 253 HOH A O     1 
HETATM 5225 H H1    . HOH G 3 .   ? -3.979  7.231   5.778   1.00 0.00  ? 253 HOH A H1    1 
HETATM 5226 H H2    . HOH G 3 .   ? -4.198  6.116   4.775   1.00 0.00  ? 253 HOH A H2    1 
HETATM 5227 O O     . HOH G 3 .   ? -10.841 10.223  5.225   1.00 16.62 ? 254 HOH A O     1 
HETATM 5228 H H1    . HOH G 3 .   ? -10.774 9.657   4.448   1.00 0.00  ? 254 HOH A H1    1 
HETATM 5229 H H2    . HOH G 3 .   ? -10.859 11.098  4.818   1.00 0.00  ? 254 HOH A H2    1 
HETATM 5230 O O     . HOH G 3 .   ? -15.165 15.111  5.110   1.00 26.03 ? 255 HOH A O     1 
HETATM 5231 H H1    . HOH G 3 .   ? -14.616 15.899  4.983   1.00 0.00  ? 255 HOH A H1    1 
HETATM 5232 H H2    . HOH G 3 .   ? -15.831 15.221  4.426   1.00 0.00  ? 255 HOH A H2    1 
HETATM 5233 O O     . HOH G 3 .   ? -15.543 21.867  15.930  1.00 50.09 ? 256 HOH A O     1 
HETATM 5234 H H1    . HOH G 3 .   ? -15.459 22.681  16.441  1.00 0.00  ? 256 HOH A H1    1 
HETATM 5235 H H2    . HOH G 3 .   ? -15.487 22.185  15.022  1.00 0.00  ? 256 HOH A H2    1 
HETATM 5236 O O     . HOH G 3 .   ? -10.645 -4.885  8.243   1.00 18.32 ? 257 HOH A O     1 
HETATM 5237 H H1    . HOH G 3 .   ? -10.951 -3.999  8.500   1.00 0.00  ? 257 HOH A H1    1 
HETATM 5238 H H2    . HOH G 3 .   ? -10.033 -4.666  7.526   1.00 0.00  ? 257 HOH A H2    1 
HETATM 5239 O O     . HOH G 3 .   ? -12.335 -4.399  3.468   1.00 12.83 ? 258 HOH A O     1 
HETATM 5240 H H1    . HOH G 3 .   ? -12.631 -5.174  2.962   1.00 0.00  ? 258 HOH A H1    1 
HETATM 5241 H H2    . HOH G 3 .   ? -11.771 -3.960  2.823   1.00 0.00  ? 258 HOH A H2    1 
HETATM 5242 O O     . HOH G 3 .   ? -5.689  -5.521  17.636  1.00 19.77 ? 259 HOH A O     1 
HETATM 5243 H H1    . HOH G 3 .   ? -5.624  -6.310  17.085  1.00 0.00  ? 259 HOH A H1    1 
HETATM 5244 H H2    . HOH G 3 .   ? -5.064  -5.745  18.349  1.00 0.00  ? 259 HOH A H2    1 
HETATM 5245 O O     . HOH G 3 .   ? -9.588  -10.198 13.711  1.00 18.85 ? 260 HOH A O     1 
HETATM 5246 H H1    . HOH G 3 .   ? -10.535 -10.048 13.620  1.00 0.00  ? 260 HOH A H1    1 
HETATM 5247 H H2    . HOH G 3 .   ? -9.223  -9.785  12.920  1.00 0.00  ? 260 HOH A H2    1 
HETATM 5248 O O     . HOH G 3 .   ? -9.297  1.098   18.245  1.00 11.25 ? 261 HOH A O     1 
HETATM 5249 H H1    . HOH G 3 .   ? -9.015  0.382   18.821  1.00 0.00  ? 261 HOH A H1    1 
HETATM 5250 H H2    . HOH G 3 .   ? -9.546  0.556   17.459  1.00 0.00  ? 261 HOH A H2    1 
HETATM 5251 O O     . HOH G 3 .   ? 17.577  25.426  -9.415  1.00 54.28 ? 262 HOH A O     1 
HETATM 5252 H H1    . HOH G 3 .   ? 17.207  26.231  -9.039  1.00 0.00  ? 262 HOH A H1    1 
HETATM 5253 H H2    . HOH G 3 .   ? 18.145  25.082  -8.717  1.00 0.00  ? 262 HOH A H2    1 
HETATM 5254 O O     . HOH G 3 .   ? -3.358  22.509  14.593  1.00 47.90 ? 263 HOH A O     1 
HETATM 5255 H H1    . HOH G 3 .   ? -3.953  21.980  15.133  1.00 0.00  ? 263 HOH A H1    1 
HETATM 5256 H H2    . HOH G 3 .   ? -3.944  22.898  13.928  1.00 0.00  ? 263 HOH A H2    1 
HETATM 5257 O O     . HOH G 3 .   ? -8.155  13.549  20.891  1.00 16.52 ? 264 HOH A O     1 
HETATM 5258 H H1    . HOH G 3 .   ? -8.944  13.447  21.436  1.00 0.00  ? 264 HOH A H1    1 
HETATM 5259 H H2    . HOH G 3 .   ? -7.884  12.641  20.724  1.00 0.00  ? 264 HOH A H2    1 
HETATM 5260 O O     . HOH G 3 .   ? -9.610  8.266   23.998  1.00 28.18 ? 265 HOH A O     1 
HETATM 5261 H H1    . HOH G 3 .   ? -9.772  8.258   23.046  1.00 0.00  ? 265 HOH A H1    1 
HETATM 5262 H H2    . HOH G 3 .   ? -9.489  9.201   24.171  1.00 0.00  ? 265 HOH A H2    1 
HETATM 5263 O O     . HOH G 3 .   ? -7.377  1.770   20.135  1.00 11.03 ? 266 HOH A O     1 
HETATM 5264 H H1    . HOH G 3 .   ? -8.212  1.785   19.643  1.00 0.00  ? 266 HOH A H1    1 
HETATM 5265 H H2    . HOH G 3 .   ? -7.566  1.199   20.914  1.00 0.00  ? 266 HOH A H2    1 
HETATM 5266 O O     . HOH G 3 .   ? -17.903 5.642   18.095  1.00 18.56 ? 267 HOH A O     1 
HETATM 5267 H H1    . HOH G 3 .   ? -17.186 6.291   18.046  1.00 0.00  ? 267 HOH A H1    1 
HETATM 5268 H H2    . HOH G 3 .   ? -17.880 5.289   17.187  1.00 0.00  ? 267 HOH A H2    1 
HETATM 5269 O O     . HOH G 3 .   ? -22.598 10.299  12.607  1.00 21.74 ? 268 HOH A O     1 
HETATM 5270 H H1    . HOH G 3 .   ? -22.833 11.225  12.759  1.00 0.00  ? 268 HOH A H1    1 
HETATM 5271 H H2    . HOH G 3 .   ? -23.106 9.860   13.301  1.00 0.00  ? 268 HOH A H2    1 
HETATM 5272 O O     . HOH G 3 .   ? -16.461 -8.018  19.828  1.00 28.59 ? 269 HOH A O     1 
HETATM 5273 H H1    . HOH G 3 .   ? -16.710 -7.300  19.234  1.00 0.00  ? 269 HOH A H1    1 
HETATM 5274 H H2    . HOH G 3 .   ? -17.049 -7.855  20.570  1.00 0.00  ? 269 HOH A H2    1 
HETATM 5275 O O     . HOH G 3 .   ? -22.999 -12.334 10.078  1.00 33.98 ? 270 HOH A O     1 
HETATM 5276 H H1    . HOH G 3 .   ? -23.044 -11.404 9.848   1.00 0.00  ? 270 HOH A H1    1 
HETATM 5277 H H2    . HOH G 3 .   ? -22.424 -12.327 10.854  1.00 0.00  ? 270 HOH A H2    1 
HETATM 5278 O O     . HOH G 3 .   ? -25.860 -5.636  8.938   1.00 9.12  ? 271 HOH A O     1 
HETATM 5279 H H1    . HOH G 3 .   ? -26.804 -5.699  9.029   1.00 0.00  ? 271 HOH A H1    1 
HETATM 5280 H H2    . HOH G 3 .   ? -25.799 -4.915  8.311   1.00 0.00  ? 271 HOH A H2    1 
HETATM 5281 O O     . HOH G 3 .   ? -20.443 -3.077  -0.733  1.00 13.89 ? 272 HOH A O     1 
HETATM 5282 H H1    . HOH G 3 .   ? -20.081 -3.606  -0.021  1.00 0.00  ? 272 HOH A H1    1 
HETATM 5283 H H2    . HOH G 3 .   ? -21.357 -2.965  -0.445  1.00 0.00  ? 272 HOH A H2    1 
HETATM 5284 O O     . HOH G 3 .   ? -28.595 -7.302  -4.758  1.00 61.28 ? 273 HOH A O     1 
HETATM 5285 H H1    . HOH G 3 .   ? -28.582 -8.059  -4.162  1.00 0.00  ? 273 HOH A H1    1 
HETATM 5286 H H2    . HOH G 3 .   ? -27.848 -7.449  -5.340  1.00 0.00  ? 273 HOH A H2    1 
HETATM 5287 O O     . HOH G 3 .   ? -25.001 10.115  16.443  1.00 47.97 ? 274 HOH A O     1 
HETATM 5288 H H1    . HOH G 3 .   ? -25.842 9.910   16.857  1.00 0.00  ? 274 HOH A H1    1 
HETATM 5289 H H2    . HOH G 3 .   ? -24.458 10.416  17.183  1.00 0.00  ? 274 HOH A H2    1 
HETATM 5290 O O     . HOH G 3 .   ? -15.936 2.143   -9.924  1.00 24.26 ? 275 HOH A O     1 
HETATM 5291 H H1    . HOH G 3 .   ? -15.124 2.147   -10.466 1.00 0.00  ? 275 HOH A H1    1 
HETATM 5292 H H2    . HOH G 3 .   ? -16.321 2.987   -10.169 1.00 0.00  ? 275 HOH A H2    1 
HETATM 5293 O O     . HOH G 3 .   ? 3.868   12.457  28.243  1.00 66.42 ? 276 HOH A O     1 
HETATM 5294 H H1    . HOH G 3 .   ? 4.332   13.149  28.745  1.00 0.00  ? 276 HOH A H1    1 
HETATM 5295 H H2    . HOH G 3 .   ? 3.683   12.961  27.428  1.00 0.00  ? 276 HOH A H2    1 
HETATM 5296 O O     . HOH G 3 .   ? -0.749  3.177   -4.828  1.00 34.56 ? 277 HOH A O     1 
HETATM 5297 H H1    . HOH G 3 .   ? -1.485  3.521   -5.345  1.00 0.00  ? 277 HOH A H1    1 
HETATM 5298 H H2    . HOH G 3 .   ? -1.128  2.360   -4.475  1.00 0.00  ? 277 HOH A H2    1 
HETATM 5299 O O     . HOH G 3 .   ? -19.684 -1.021  2.082   1.00 23.15 ? 278 HOH A O     1 
HETATM 5300 H H1    . HOH G 3 .   ? -19.155 -0.246  1.857   1.00 0.00  ? 278 HOH A H1    1 
HETATM 5301 H H2    . HOH G 3 .   ? -19.628 -1.545  1.270   1.00 0.00  ? 278 HOH A H2    1 
HETATM 5302 O O     . HOH G 3 .   ? -22.522 -0.251  1.861   1.00 34.22 ? 279 HOH A O     1 
HETATM 5303 H H1    . HOH G 3 .   ? -22.952 -0.556  2.668   1.00 0.00  ? 279 HOH A H1    1 
HETATM 5304 H H2    . HOH G 3 .   ? -21.608 -0.553  2.012   1.00 0.00  ? 279 HOH A H2    1 
HETATM 5305 O O     . HOH G 3 .   ? 1.722   21.550  21.949  1.00 53.00 ? 280 HOH A O     1 
HETATM 5306 H H1    . HOH G 3 .   ? 2.245   21.594  21.147  1.00 0.00  ? 280 HOH A H1    1 
HETATM 5307 H H2    . HOH G 3 .   ? 1.383   22.452  22.053  1.00 0.00  ? 280 HOH A H2    1 
HETATM 5308 O O     . HOH G 3 .   ? 4.662   16.579  25.545  1.00 25.05 ? 281 HOH A O     1 
HETATM 5309 H H1    . HOH G 3 .   ? 3.791   16.914  25.305  1.00 0.00  ? 281 HOH A H1    1 
HETATM 5310 H H2    . HOH G 3 .   ? 5.073   16.359  24.696  1.00 0.00  ? 281 HOH A H2    1 
HETATM 5311 O O     . HOH G 3 .   ? 6.223   15.685  22.805  1.00 35.38 ? 282 HOH A O     1 
HETATM 5312 H H1    . HOH G 3 .   ? 5.639   15.538  22.054  1.00 0.00  ? 282 HOH A H1    1 
HETATM 5313 H H2    . HOH G 3 .   ? 7.103   15.699  22.423  1.00 0.00  ? 282 HOH A H2    1 
HETATM 5314 O O     . HOH G 3 .   ? -0.479  9.289   3.117   1.00 48.48 ? 283 HOH A O     1 
HETATM 5315 H H1    . HOH G 3 .   ? -0.814  10.190  3.191   1.00 0.00  ? 283 HOH A H1    1 
HETATM 5316 H H2    . HOH G 3 .   ? -1.235  8.756   3.379   1.00 0.00  ? 283 HOH A H2    1 
HETATM 5317 O O     . HOH G 3 .   ? 0.718   22.103  8.570   1.00 33.51 ? 284 HOH A O     1 
HETATM 5318 H H1    . HOH G 3 .   ? 0.875   22.924  9.052   1.00 0.00  ? 284 HOH A H1    1 
HETATM 5319 H H2    . HOH G 3 .   ? 0.184   21.590  9.186   1.00 0.00  ? 284 HOH A H2    1 
HETATM 5320 O O     . HOH G 3 .   ? -3.694  19.427  -7.523  1.00 43.64 ? 285 HOH A O     1 
HETATM 5321 H H1    . HOH G 3 .   ? -4.451  19.771  -8.009  1.00 0.00  ? 285 HOH A H1    1 
HETATM 5322 H H2    . HOH G 3 .   ? -3.407  18.700  -8.086  1.00 0.00  ? 285 HOH A H2    1 
HETATM 5323 O O     . HOH G 3 .   ? -15.807 21.111  12.253  1.00 48.79 ? 286 HOH A O     1 
HETATM 5324 H H1    . HOH G 3 .   ? -16.470 21.079  11.547  1.00 0.00  ? 286 HOH A H1    1 
HETATM 5325 H H2    . HOH G 3 .   ? -15.029 20.850  11.749  1.00 0.00  ? 286 HOH A H2    1 
HETATM 5326 O O     . HOH G 3 .   ? -17.240 8.033   6.244   1.00 23.76 ? 287 HOH A O     1 
HETATM 5327 H H1    . HOH G 3 .   ? -17.525 8.481   5.437   1.00 0.00  ? 287 HOH A H1    1 
HETATM 5328 H H2    . HOH G 3 .   ? -16.379 8.416   6.432   1.00 0.00  ? 287 HOH A H2    1 
HETATM 5329 O O     . HOH G 3 .   ? -8.142  -1.603  13.021  1.00 23.78 ? 288 HOH A O     1 
HETATM 5330 H H1    . HOH G 3 .   ? -8.927  -1.775  12.487  1.00 0.00  ? 288 HOH A H1    1 
HETATM 5331 H H2    . HOH G 3 .   ? -7.584  -1.136  12.388  1.00 0.00  ? 288 HOH A H2    1 
HETATM 5332 O O     . HOH G 3 .   ? 4.245   27.020  -15.716 1.00 41.71 ? 289 HOH A O     1 
HETATM 5333 H H1    . HOH G 3 .   ? 4.505   26.255  -16.242 1.00 0.00  ? 289 HOH A H1    1 
HETATM 5334 H H2    . HOH G 3 .   ? 4.060   26.625  -14.864 1.00 0.00  ? 289 HOH A H2    1 
HETATM 5335 O O     . HOH G 3 .   ? -0.807  31.496  0.714   1.00 46.00 ? 290 HOH A O     1 
HETATM 5336 H H1    . HOH G 3 .   ? -1.575  31.628  1.277   1.00 0.00  ? 290 HOH A H1    1 
HETATM 5337 H H2    . HOH G 3 .   ? -0.181  32.169  0.997   1.00 0.00  ? 290 HOH A H2    1 
HETATM 5338 O O     . HOH G 3 .   ? -20.991 13.237  18.501  1.00 53.25 ? 291 HOH A O     1 
HETATM 5339 H H1    . HOH G 3 .   ? -21.768 12.944  18.984  1.00 0.00  ? 291 HOH A H1    1 
HETATM 5340 H H2    . HOH G 3 .   ? -20.306 12.614  18.759  1.00 0.00  ? 291 HOH A H2    1 
HETATM 5341 O O     . HOH G 3 .   ? -23.046 10.724  19.414  1.00 27.59 ? 292 HOH A O     1 
HETATM 5342 H H1    . HOH G 3 .   ? -23.182 9.939   19.952  1.00 0.00  ? 292 HOH A H1    1 
HETATM 5343 H H2    . HOH G 3 .   ? -22.120 10.625  19.164  1.00 0.00  ? 292 HOH A H2    1 
HETATM 5344 O O     . HOH G 3 .   ? -22.658 -5.754  21.696  1.00 26.43 ? 293 HOH A O     1 
HETATM 5345 H H1    . HOH G 3 .   ? -22.163 -6.527  21.964  1.00 0.00  ? 293 HOH A H1    1 
HETATM 5346 H H2    . HOH G 3 .   ? -22.489 -5.696  20.746  1.00 0.00  ? 293 HOH A H2    1 
HETATM 5347 O O     . HOH G 3 .   ? -16.341 -9.717  17.675  1.00 29.76 ? 294 HOH A O     1 
HETATM 5348 H H1    . HOH G 3 .   ? -16.442 -9.235  18.518  1.00 0.00  ? 294 HOH A H1    1 
HETATM 5349 H H2    . HOH G 3 .   ? -15.441 -10.034 17.739  1.00 0.00  ? 294 HOH A H2    1 
HETATM 5350 O O     . HOH G 3 .   ? -22.313 -9.107  2.760   1.00 41.60 ? 295 HOH A O     1 
HETATM 5351 H H1    . HOH G 3 .   ? -22.206 -9.382  1.840   1.00 0.00  ? 295 HOH A H1    1 
HETATM 5352 H H2    . HOH G 3 .   ? -21.682 -9.671  3.225   1.00 0.00  ? 295 HOH A H2    1 
HETATM 5353 O O     . HOH G 3 .   ? -28.804 -4.843  23.185  1.00 17.53 ? 296 HOH A O     1 
HETATM 5354 H H1    . HOH G 3 .   ? -29.488 -4.181  23.335  1.00 0.00  ? 296 HOH A H1    1 
HETATM 5355 H H2    . HOH G 3 .   ? -28.820 -4.952  22.226  1.00 0.00  ? 296 HOH A H2    1 
HETATM 5356 O O     . HOH G 3 .   ? -10.048 14.192  24.575  1.00 32.18 ? 297 HOH A O     1 
HETATM 5357 H H1    . HOH G 3 .   ? -10.495 14.133  23.726  1.00 0.00  ? 297 HOH A H1    1 
HETATM 5358 H H2    . HOH G 3 .   ? -10.695 14.681  25.116  1.00 0.00  ? 297 HOH A H2    1 
HETATM 5359 O O     . HOH G 3 .   ? -22.264 7.204   11.246  1.00 35.39 ? 298 HOH A O     1 
HETATM 5360 H H1    . HOH G 3 .   ? -22.502 8.103   11.513  1.00 0.00  ? 298 HOH A H1    1 
HETATM 5361 H H2    . HOH G 3 .   ? -21.587 7.370   10.576  1.00 0.00  ? 298 HOH A H2    1 
HETATM 5362 O O     . HOH G 3 .   ? -18.118 8.745   2.980   1.00 47.06 ? 299 HOH A O     1 
HETATM 5363 H H1    . HOH G 3 .   ? -17.696 7.896   2.804   1.00 0.00  ? 299 HOH A H1    1 
HETATM 5364 H H2    . HOH G 3 .   ? -18.941 8.669   2.492   1.00 0.00  ? 299 HOH A H2    1 
HETATM 5365 O O     . HOH G 3 .   ? -21.146 -7.346  -2.527  1.00 42.47 ? 300 HOH A O     1 
HETATM 5366 H H1    . HOH G 3 .   ? -20.805 -6.521  -2.882  1.00 0.00  ? 300 HOH A H1    1 
HETATM 5367 H H2    . HOH G 3 .   ? -20.639 -8.030  -2.969  1.00 0.00  ? 300 HOH A H2    1 
HETATM 5368 O O     . HOH G 3 .   ? -10.214 -0.548  8.968   1.00 20.59 ? 301 HOH A O     1 
HETATM 5369 H H1    . HOH G 3 .   ? -10.944 -1.023  8.558   1.00 0.00  ? 301 HOH A H1    1 
HETATM 5370 H H2    . HOH G 3 .   ? -10.541 0.351   9.045   1.00 0.00  ? 301 HOH A H2    1 
HETATM 5371 O O     . HOH G 3 .   ? -5.765  2.956   13.378  1.00 21.87 ? 302 HOH A O     1 
HETATM 5372 H H1    . HOH G 3 .   ? -6.545  3.391   13.022  1.00 0.00  ? 302 HOH A H1    1 
HETATM 5373 H H2    . HOH G 3 .   ? -5.191  3.709   13.588  1.00 0.00  ? 302 HOH A H2    1 
HETATM 5374 O O     . HOH G 3 .   ? 3.208   4.537   5.924   1.00 39.41 ? 303 HOH A O     1 
HETATM 5375 H H1    . HOH G 3 .   ? 3.506   5.368   6.294   1.00 0.00  ? 303 HOH A H1    1 
HETATM 5376 H H2    . HOH G 3 .   ? 3.422   3.901   6.618   1.00 0.00  ? 303 HOH A H2    1 
HETATM 5377 O O     . HOH G 3 .   ? 0.678   6.132   25.310  1.00 27.79 ? 304 HOH A O     1 
HETATM 5378 H H1    . HOH G 3 .   ? 0.980   5.246   25.061  1.00 0.00  ? 304 HOH A H1    1 
HETATM 5379 H H2    . HOH G 3 .   ? -0.282  6.001   25.286  1.00 0.00  ? 304 HOH A H2    1 
HETATM 5380 O O     . HOH G 3 .   ? -4.230  5.213   24.967  1.00 36.25 ? 305 HOH A O     1 
HETATM 5381 H H1    . HOH G 3 .   ? -4.812  5.945   24.749  1.00 0.00  ? 305 HOH A H1    1 
HETATM 5382 H H2    . HOH G 3 .   ? -4.673  4.787   25.703  1.00 0.00  ? 305 HOH A H2    1 
HETATM 5383 O O     . HOH G 3 .   ? 12.262  4.589   16.792  1.00 24.07 ? 306 HOH A O     1 
HETATM 5384 H H1    . HOH G 3 .   ? 11.941  5.356   16.303  1.00 0.00  ? 306 HOH A H1    1 
HETATM 5385 H H2    . HOH G 3 .   ? 11.645  4.478   17.525  1.00 0.00  ? 306 HOH A H2    1 
HETATM 5386 O O     . HOH G 3 .   ? 2.671   -0.707  24.056  1.00 41.90 ? 307 HOH A O     1 
HETATM 5387 H H1    . HOH G 3 .   ? 2.633   -1.499  24.594  1.00 0.00  ? 307 HOH A H1    1 
HETATM 5388 H H2    . HOH G 3 .   ? 2.513   -1.072  23.169  1.00 0.00  ? 307 HOH A H2    1 
HETATM 5389 O O     . HOH G 3 .   ? 6.867   -5.207  6.631   1.00 54.66 ? 308 HOH A O     1 
HETATM 5390 H H1    . HOH G 3 .   ? 7.275   -4.345  6.790   1.00 0.00  ? 308 HOH A H1    1 
HETATM 5391 H H2    . HOH G 3 .   ? 7.312   -5.765  7.280   1.00 0.00  ? 308 HOH A H2    1 
HETATM 5392 O O     . HOH G 3 .   ? 0.497   -13.874 16.923  1.00 46.93 ? 309 HOH A O     1 
HETATM 5393 H H1    . HOH G 3 .   ? -0.187  -14.477 17.228  1.00 0.00  ? 309 HOH A H1    1 
HETATM 5394 H H2    . HOH G 3 .   ? 1.292   -14.417 16.941  1.00 0.00  ? 309 HOH A H2    1 
HETATM 5395 O O     . HOH G 3 .   ? 5.026   -12.042 14.275  1.00 44.53 ? 310 HOH A O     1 
HETATM 5396 H H1    . HOH G 3 .   ? 5.103   -11.365 14.959  1.00 0.00  ? 310 HOH A H1    1 
HETATM 5397 H H2    . HOH G 3 .   ? 5.545   -11.684 13.551  1.00 0.00  ? 310 HOH A H2    1 
HETATM 5398 O O     . HOH G 3 .   ? -15.592 6.515   23.311  1.00 37.74 ? 311 HOH A O     1 
HETATM 5399 H H1    . HOH G 3 .   ? -16.115 6.045   22.609  1.00 0.00  ? 311 HOH A H1    1 
HETATM 5400 H H2    . HOH G 3 .   ? -15.253 7.248   22.778  1.00 0.00  ? 311 HOH A H2    1 
HETATM 5401 O O     . HOH G 3 .   ? -7.374  -0.038  22.036  1.00 32.14 ? 312 HOH A O     1 
HETATM 5402 H H1    . HOH G 3 .   ? -6.549  -0.193  22.523  1.00 0.00  ? 312 HOH A H1    1 
HETATM 5403 H H2    . HOH G 3 .   ? -7.406  -0.861  21.511  1.00 0.00  ? 312 HOH A H2    1 
HETATM 5404 O O     . HOH G 3 .   ? -9.866  -0.766  16.388  1.00 40.73 ? 313 HOH A O     1 
HETATM 5405 H H1    . HOH G 3 .   ? -10.011 -1.647  16.814  1.00 0.00  ? 313 HOH A H1    1 
HETATM 5406 H H2    . HOH G 3 .   ? -9.858  -1.023  15.458  1.00 0.00  ? 313 HOH A H2    1 
HETATM 5407 O O     . HOH G 3 .   ? -19.027 9.501   24.778  1.00 34.84 ? 314 HOH A O     1 
HETATM 5408 H H1    . HOH G 3 .   ? -18.448 10.080  24.268  1.00 0.00  ? 314 HOH A H1    1 
HETATM 5409 H H2    . HOH G 3 .   ? -19.786 9.412   24.188  1.00 0.00  ? 314 HOH A H2    1 
HETATM 5410 O O     . HOH G 3 .   ? -17.122 5.426   21.498  1.00 27.42 ? 315 HOH A O     1 
HETATM 5411 H H1    . HOH G 3 .   ? -17.468 4.540   21.626  1.00 0.00  ? 315 HOH A H1    1 
HETATM 5412 H H2    . HOH G 3 .   ? -17.212 5.524   20.539  1.00 0.00  ? 315 HOH A H2    1 
HETATM 5413 O O     . HOH G 3 .   ? -10.072 -3.166  17.479  1.00 38.26 ? 316 HOH A O     1 
HETATM 5414 H H1    . HOH G 3 .   ? -10.931 -3.477  17.785  1.00 0.00  ? 316 HOH A H1    1 
HETATM 5415 H H2    . HOH G 3 .   ? -9.482  -3.846  17.854  1.00 0.00  ? 316 HOH A H2    1 
HETATM 5416 O O     . HOH G 3 .   ? -7.084  -2.469  20.545  1.00 46.17 ? 317 HOH A O     1 
HETATM 5417 H H1    . HOH G 3 .   ? -6.626  -2.903  21.276  1.00 0.00  ? 317 HOH A H1    1 
HETATM 5418 H H2    . HOH G 3 .   ? -7.706  -3.152  20.258  1.00 0.00  ? 317 HOH A H2    1 
HETATM 5419 O O     . HOH G 3 .   ? -8.238  -5.261  18.711  1.00 32.17 ? 318 HOH A O     1 
HETATM 5420 H H1    . HOH G 3 .   ? -7.340  -5.359  18.333  1.00 0.00  ? 318 HOH A H1    1 
HETATM 5421 H H2    . HOH G 3 .   ? -8.468  -6.178  18.889  1.00 0.00  ? 318 HOH A H2    1 
HETATM 5422 O O     . HOH G 3 .   ? -32.690 -5.217  14.148  1.00 37.92 ? 319 HOH A O     1 
HETATM 5423 H H1    . HOH G 3 .   ? -31.753 -5.200  14.369  1.00 0.00  ? 319 HOH A H1    1 
HETATM 5424 H H2    . HOH G 3 .   ? -32.682 -5.638  13.279  1.00 0.00  ? 319 HOH A H2    1 
HETATM 5425 O O     . HOH G 3 .   ? -32.508 2.023   8.936   1.00 25.44 ? 320 HOH A O     1 
HETATM 5426 H H1    . HOH G 3 .   ? -32.011 2.287   8.157   1.00 0.00  ? 320 HOH A H1    1 
HETATM 5427 H H2    . HOH G 3 .   ? -33.411 2.277   8.734   1.00 0.00  ? 320 HOH A H2    1 
HETATM 5428 O O     . HOH G 3 .   ? -28.569 -6.853  25.089  1.00 20.18 ? 321 HOH A O     1 
HETATM 5429 H H1    . HOH G 3 .   ? -28.788 -7.717  24.706  1.00 0.00  ? 321 HOH A H1    1 
HETATM 5430 H H2    . HOH G 3 .   ? -28.723 -6.239  24.341  1.00 0.00  ? 321 HOH A H2    1 
HETATM 5431 O O     . HOH G 3 .   ? -28.278 -9.555  24.300  1.00 24.19 ? 322 HOH A O     1 
HETATM 5432 H H1    . HOH G 3 .   ? -27.411 -9.307  24.652  1.00 0.00  ? 322 HOH A H1    1 
HETATM 5433 H H2    . HOH G 3 .   ? -28.071 -9.830  23.395  1.00 0.00  ? 322 HOH A H2    1 
HETATM 5434 O O     . HOH H 3 .   ? 2.704   21.718  -8.971  1.00 29.16 ? 246 HOH B O     1 
HETATM 5435 H H1    . HOH H 3 .   ? 2.486   21.621  -8.048  1.00 0.00  ? 246 HOH B H1    1 
HETATM 5436 H H2    . HOH H 3 .   ? 3.565   21.299  -9.049  1.00 0.00  ? 246 HOH B H2    1 
HETATM 5437 O O     . HOH H 3 .   ? -8.355  14.124  -4.329  1.00 18.65 ? 247 HOH B O     1 
HETATM 5438 H H1    . HOH H 3 .   ? -8.725  13.618  -3.578  1.00 0.00  ? 247 HOH B H1    1 
HETATM 5439 H H2    . HOH H 3 .   ? -9.136  14.606  -4.614  1.00 0.00  ? 247 HOH B H2    1 
HETATM 5440 O O     . HOH H 3 .   ? 12.759  11.690  13.862  1.00 36.60 ? 248 HOH B O     1 
HETATM 5441 H H1    . HOH H 3 .   ? 11.950  12.186  14.028  1.00 0.00  ? 248 HOH B H1    1 
HETATM 5442 H H2    . HOH H 3 .   ? 12.882  11.770  12.910  1.00 0.00  ? 248 HOH B H2    1 
HETATM 5443 O O     . HOH H 3 .   ? -14.195 -5.624  -2.704  1.00 42.46 ? 249 HOH B O     1 
HETATM 5444 H H1    . HOH H 3 .   ? -14.890 -5.003  -2.958  1.00 0.00  ? 249 HOH B H1    1 
HETATM 5445 H H2    . HOH H 3 .   ? -14.309 -5.683  -1.751  1.00 0.00  ? 249 HOH B H2    1 
HETATM 5446 O O     . HOH H 3 .   ? 5.621   23.363  -31.955 1.00 24.18 ? 250 HOH B O     1 
HETATM 5447 H H1    . HOH H 3 .   ? 5.602   24.028  -32.666 1.00 0.00  ? 250 HOH B H1    1 
HETATM 5448 H H2    . HOH H 3 .   ? 6.479   23.570  -31.554 1.00 0.00  ? 250 HOH B H2    1 
HETATM 5449 O O     . HOH H 3 .   ? -0.288  18.331  -30.760 1.00 15.00 ? 251 HOH B O     1 
HETATM 5450 H H1    . HOH H 3 .   ? -0.241  17.461  -31.170 1.00 0.00  ? 251 HOH B H1    1 
HETATM 5451 H H2    . HOH H 3 .   ? -1.232  18.526  -30.785 1.00 0.00  ? 251 HOH B H2    1 
HETATM 5452 O O     . HOH H 3 .   ? -3.889  12.355  -30.870 1.00 25.22 ? 252 HOH B O     1 
HETATM 5453 H H1    . HOH H 3 .   ? -3.086  12.457  -31.384 1.00 0.00  ? 252 HOH B H1    1 
HETATM 5454 H H2    . HOH H 3 .   ? -4.450  13.075  -31.177 1.00 0.00  ? 252 HOH B H2    1 
HETATM 5455 O O     . HOH H 3 .   ? 13.370  12.091  -0.234  1.00 13.58 ? 253 HOH B O     1 
HETATM 5456 H H1    . HOH H 3 .   ? 13.869  12.908  -0.172  1.00 0.00  ? 253 HOH B H1    1 
HETATM 5457 H H2    . HOH H 3 .   ? 14.077  11.434  -0.286  1.00 0.00  ? 253 HOH B H2    1 
HETATM 5458 O O     . HOH H 3 .   ? -9.559  18.325  -16.233 1.00 11.76 ? 254 HOH B O     1 
HETATM 5459 H H1    . HOH H 3 .   ? -9.377  17.506  -15.746 1.00 0.00  ? 254 HOH B H1    1 
HETATM 5460 H H2    . HOH H 3 .   ? -10.339 18.668  -15.801 1.00 0.00  ? 254 HOH B H2    1 
HETATM 5461 O O     . HOH H 3 .   ? -5.047  17.612  -11.819 1.00 37.61 ? 255 HOH B O     1 
HETATM 5462 H H1    . HOH H 3 .   ? -5.105  17.820  -12.761 1.00 0.00  ? 255 HOH B H1    1 
HETATM 5463 H H2    . HOH H 3 .   ? -5.894  17.920  -11.498 1.00 0.00  ? 255 HOH B H2    1 
HETATM 5464 O O     . HOH H 3 .   ? -6.202  10.028  -21.053 1.00 15.77 ? 256 HOH B O     1 
HETATM 5465 H H1    . HOH H 3 .   ? -5.930  9.220   -20.599 1.00 0.00  ? 256 HOH B H1    1 
HETATM 5466 H H2    . HOH H 3 .   ? -5.387  10.554  -21.043 1.00 0.00  ? 256 HOH B H2    1 
HETATM 5467 O O     . HOH H 3 .   ? -20.724 23.279  -28.636 1.00 43.56 ? 257 HOH B O     1 
HETATM 5468 H H1    . HOH H 3 .   ? -20.472 24.136  -28.280 1.00 0.00  ? 257 HOH B H1    1 
HETATM 5469 H H2    . HOH H 3 .   ? -20.841 22.744  -27.845 1.00 0.00  ? 257 HOH B H2    1 
HETATM 5470 O O     . HOH H 3 .   ? -15.776 24.170  -23.707 1.00 41.24 ? 258 HOH B O     1 
HETATM 5471 H H1    . HOH H 3 .   ? -15.635 23.721  -24.541 1.00 0.00  ? 258 HOH B H1    1 
HETATM 5472 H H2    . HOH H 3 .   ? -16.043 23.446  -23.135 1.00 0.00  ? 258 HOH B H2    1 
HETATM 5473 O O     . HOH H 3 .   ? -4.778  9.173   -13.005 1.00 40.43 ? 259 HOH B O     1 
HETATM 5474 H H1    . HOH H 3 .   ? -3.823  9.068   -13.106 1.00 0.00  ? 259 HOH B H1    1 
HETATM 5475 H H2    . HOH H 3 .   ? -4.969  8.684   -12.198 1.00 0.00  ? 259 HOH B H2    1 
HETATM 5476 O O     . HOH H 3 .   ? -0.782  2.838   -13.114 1.00 10.45 ? 260 HOH B O     1 
HETATM 5477 H H1    . HOH H 3 .   ? -0.648  3.471   -12.401 1.00 0.00  ? 260 HOH B H1    1 
HETATM 5478 H H2    . HOH H 3 .   ? -0.956  2.030   -12.624 1.00 0.00  ? 260 HOH B H2    1 
HETATM 5479 O O     . HOH H 3 .   ? -10.404 4.558   -11.814 1.00 24.79 ? 261 HOH B O     1 
HETATM 5480 H H1    . HOH H 3 .   ? -10.619 5.456   -12.083 1.00 0.00  ? 261 HOH B H1    1 
HETATM 5481 H H2    . HOH H 3 .   ? -9.436  4.569   -11.858 1.00 0.00  ? 261 HOH B H2    1 
HETATM 5482 O O     . HOH H 3 .   ? -10.722 5.381   -18.535 1.00 16.24 ? 262 HOH B O     1 
HETATM 5483 H H1    . HOH H 3 .   ? -11.467 4.769   -18.492 1.00 0.00  ? 262 HOH B H1    1 
HETATM 5484 H H2    . HOH H 3 .   ? -9.949  4.815   -18.422 1.00 0.00  ? 262 HOH B H2    1 
HETATM 5485 O O     . HOH H 3 .   ? -15.161 5.209   -18.375 1.00 16.18 ? 263 HOH B O     1 
HETATM 5486 H H1    . HOH H 3 .   ? -14.784 5.943   -17.881 1.00 0.00  ? 263 HOH B H1    1 
HETATM 5487 H H2    . HOH H 3 .   ? -14.371 4.652   -18.454 1.00 0.00  ? 263 HOH B H2    1 
HETATM 5488 O O     . HOH H 3 .   ? -19.662 10.035  -26.229 1.00 27.05 ? 264 HOH B O     1 
HETATM 5489 H H1    . HOH H 3 .   ? -19.690 9.207   -25.711 1.00 0.00  ? 264 HOH B H1    1 
HETATM 5490 H H2    . HOH H 3 .   ? -19.753 10.693  -25.537 1.00 0.00  ? 264 HOH B H2    1 
HETATM 5491 O O     . HOH H 3 .   ? -13.338 11.756  -26.805 1.00 17.28 ? 265 HOH B O     1 
HETATM 5492 H H1    . HOH H 3 .   ? -13.994 12.451  -26.688 1.00 0.00  ? 265 HOH B H1    1 
HETATM 5493 H H2    . HOH H 3 .   ? -13.110 11.927  -27.727 1.00 0.00  ? 265 HOH B H2    1 
HETATM 5494 O O     . HOH H 3 .   ? -20.235 12.809  -12.822 1.00 35.71 ? 266 HOH B O     1 
HETATM 5495 H H1    . HOH H 3 .   ? -20.937 13.315  -13.257 1.00 0.00  ? 266 HOH B H1    1 
HETATM 5496 H H2    . HOH H 3 .   ? -20.743 12.202  -12.261 1.00 0.00  ? 266 HOH B H2    1 
HETATM 5497 O O     . HOH H 3 .   ? -19.532 7.844   -24.412 1.00 21.51 ? 267 HOH B O     1 
HETATM 5498 H H1    . HOH H 3 .   ? -19.402 6.885   -24.487 1.00 0.00  ? 267 HOH B H1    1 
HETATM 5499 H H2    . HOH H 3 .   ? -18.957 8.054   -23.661 1.00 0.00  ? 267 HOH B H2    1 
HETATM 5500 O O     . HOH H 3 .   ? -5.993  10.014  -28.278 1.00 11.20 ? 268 HOH B O     1 
HETATM 5501 H H1    . HOH H 3 .   ? -5.710  10.426  -29.105 1.00 0.00  ? 268 HOH B H1    1 
HETATM 5502 H H2    . HOH H 3 .   ? -6.101  9.092   -28.544 1.00 0.00  ? 268 HOH B H2    1 
HETATM 5503 O O     . HOH H 3 .   ? -6.982  7.269   -26.810 1.00 10.00 ? 269 HOH B O     1 
HETATM 5504 H H1    . HOH H 3 .   ? -7.676  6.976   -26.202 1.00 0.00  ? 269 HOH B H1    1 
HETATM 5505 H H2    . HOH H 3 .   ? -7.090  8.226   -26.782 1.00 0.00  ? 269 HOH B H2    1 
HETATM 5506 O O     . HOH H 3 .   ? -4.975  8.462   -32.465 1.00 24.33 ? 270 HOH B O     1 
HETATM 5507 H H1    . HOH H 3 .   ? -5.054  9.421   -32.472 1.00 0.00  ? 270 HOH B H1    1 
HETATM 5508 H H2    . HOH H 3 .   ? -5.862  8.194   -32.801 1.00 0.00  ? 270 HOH B H2    1 
HETATM 5509 O O     . HOH H 3 .   ? -10.086 10.591  -28.857 1.00 17.93 ? 271 HOH B O     1 
HETATM 5510 H H1    . HOH H 3 .   ? -10.757 11.209  -29.158 1.00 0.00  ? 271 HOH B H1    1 
HETATM 5511 H H2    . HOH H 3 .   ? -9.341  10.827  -29.424 1.00 0.00  ? 271 HOH B H2    1 
HETATM 5512 O O     . HOH H 3 .   ? -11.128 7.253   -27.014 1.00 22.39 ? 272 HOH B O     1 
HETATM 5513 H H1    . HOH H 3 .   ? -11.286 7.999   -27.611 1.00 0.00  ? 272 HOH B H1    1 
HETATM 5514 H H2    . HOH H 3 .   ? -11.514 6.524   -27.515 1.00 0.00  ? 272 HOH B H2    1 
HETATM 5515 O O     . HOH H 3 .   ? -9.851  7.208   -24.652 1.00 30.64 ? 273 HOH B O     1 
HETATM 5516 H H1    . HOH H 3 .   ? -10.236 7.275   -25.560 1.00 0.00  ? 273 HOH B H1    1 
HETATM 5517 H H2    . HOH H 3 .   ? -10.500 6.609   -24.256 1.00 0.00  ? 273 HOH B H2    1 
HETATM 5518 O O     . HOH H 3 .   ? -10.215 8.095   -22.215 1.00 16.78 ? 274 HOH B O     1 
HETATM 5519 H H1    . HOH H 3 .   ? -9.462  8.316   -21.667 1.00 0.00  ? 274 HOH B H1    1 
HETATM 5520 H H2    . HOH H 3 .   ? -9.813  7.725   -23.019 1.00 0.00  ? 274 HOH B H2    1 
HETATM 5521 O O     . HOH H 3 .   ? -3.643  -1.329  -27.928 1.00 21.55 ? 275 HOH B O     1 
HETATM 5522 H H1    . HOH H 3 .   ? -4.023  -1.272  -27.036 1.00 0.00  ? 275 HOH B H1    1 
HETATM 5523 H H2    . HOH H 3 .   ? -3.198  -0.472  -27.997 1.00 0.00  ? 275 HOH B H2    1 
HETATM 5524 O O     . HOH H 3 .   ? -6.212  -12.570 -27.629 1.00 44.43 ? 276 HOH B O     1 
HETATM 5525 H H1    . HOH H 3 .   ? -6.041  -13.485 -27.889 1.00 0.00  ? 276 HOH B H1    1 
HETATM 5526 H H2    . HOH H 3 .   ? -5.318  -12.219 -27.541 1.00 0.00  ? 276 HOH B H2    1 
HETATM 5527 O O     . HOH H 3 .   ? -17.298 -1.284  -8.711  1.00 26.99 ? 277 HOH B O     1 
HETATM 5528 H H1    . HOH H 3 .   ? -17.566 -0.945  -9.573  1.00 0.00  ? 277 HOH B H1    1 
HETATM 5529 H H2    . HOH H 3 .   ? -16.543 -1.829  -8.930  1.00 0.00  ? 277 HOH B H2    1 
HETATM 5530 O O     . HOH H 3 .   ? -20.179 -0.665  -11.927 1.00 46.91 ? 278 HOH B O     1 
HETATM 5531 H H1    . HOH H 3 .   ? -19.946 -1.605  -11.797 1.00 0.00  ? 278 HOH B H1    1 
HETATM 5532 H H2    . HOH H 3 .   ? -19.387 -0.237  -11.551 1.00 0.00  ? 278 HOH B H2    1 
HETATM 5533 O O     . HOH H 3 .   ? -18.997 -3.257  -11.334 1.00 42.36 ? 279 HOH B O     1 
HETATM 5534 H H1    . HOH H 3 .   ? -18.289 -3.860  -11.592 1.00 0.00  ? 279 HOH B H1    1 
HETATM 5535 H H2    . HOH H 3 .   ? -19.076 -3.429  -10.389 1.00 0.00  ? 279 HOH B H2    1 
HETATM 5536 O O     . HOH H 3 .   ? -15.712 -6.028  -11.312 1.00 21.08 ? 280 HOH B O     1 
HETATM 5537 H H1    . HOH H 3 .   ? -14.871 -5.622  -11.089 1.00 0.00  ? 280 HOH B H1    1 
HETATM 5538 H H2    . HOH H 3 .   ? -15.479 -6.574  -12.076 1.00 0.00  ? 280 HOH B H2    1 
HETATM 5539 O O     . HOH H 3 .   ? -17.541 0.206   -11.431 1.00 26.41 ? 281 HOH B O     1 
HETATM 5540 H H1    . HOH H 3 .   ? -16.874 -0.241  -11.965 1.00 0.00  ? 281 HOH B H1    1 
HETATM 5541 H H2    . HOH H 3 .   ? -16.979 0.808   -10.906 1.00 0.00  ? 281 HOH B H2    1 
HETATM 5542 O O     . HOH H 3 .   ? -17.570 4.031   -34.876 1.00 25.34 ? 282 HOH B O     1 
HETATM 5543 H H1    . HOH H 3 .   ? -17.470 4.986   -34.946 1.00 0.00  ? 282 HOH B H1    1 
HETATM 5544 H H2    . HOH H 3 .   ? -17.784 3.770   -35.771 1.00 0.00  ? 282 HOH B H2    1 
HETATM 5545 O O     . HOH H 3 .   ? -16.867 -9.187  -22.075 1.00 17.08 ? 283 HOH B O     1 
HETATM 5546 H H1    . HOH H 3 .   ? -16.058 -9.668  -22.284 1.00 0.00  ? 283 HOH B H1    1 
HETATM 5547 H H2    . HOH H 3 .   ? -17.036 -8.614  -22.831 1.00 0.00  ? 283 HOH B H2    1 
HETATM 5548 O O     . HOH H 3 .   ? -20.965 -4.917  -19.632 1.00 44.74 ? 284 HOH B O     1 
HETATM 5549 H H1    . HOH H 3 .   ? -21.268 -4.316  -20.318 1.00 0.00  ? 284 HOH B H1    1 
HETATM 5550 H H2    . HOH H 3 .   ? -20.002 -4.837  -19.685 1.00 0.00  ? 284 HOH B H2    1 
HETATM 5551 O O     . HOH H 3 .   ? -12.488 -8.029  -13.895 1.00 31.32 ? 285 HOH B O     1 
HETATM 5552 H H1    . HOH H 3 .   ? -12.387 -8.224  -14.828 1.00 0.00  ? 285 HOH B H1    1 
HETATM 5553 H H2    . HOH H 3 .   ? -13.449 -8.012  -13.795 1.00 0.00  ? 285 HOH B H2    1 
HETATM 5554 O O     . HOH H 3 .   ? -13.638 -17.229 -29.037 1.00 31.66 ? 286 HOH B O     1 
HETATM 5555 H H1    . HOH H 3 .   ? -14.452 -16.917 -28.598 1.00 0.00  ? 286 HOH B H1    1 
HETATM 5556 H H2    . HOH H 3 .   ? -13.091 -16.446 -28.993 1.00 0.00  ? 286 HOH B H2    1 
HETATM 5557 O O     . HOH H 3 .   ? -15.797 -15.686 -27.667 1.00 44.76 ? 287 HOH B O     1 
HETATM 5558 H H1    . HOH H 3 .   ? -16.202 -15.171 -28.372 1.00 0.00  ? 287 HOH B H1    1 
HETATM 5559 H H2    . HOH H 3 .   ? -16.300 -15.371 -26.899 1.00 0.00  ? 287 HOH B H2    1 
HETATM 5560 O O     . HOH H 3 .   ? -24.432 -17.277 -32.520 1.00 40.98 ? 288 HOH B O     1 
HETATM 5561 H H1    . HOH H 3 .   ? -24.328 -16.339 -32.730 1.00 0.00  ? 288 HOH B H1    1 
HETATM 5562 H H2    . HOH H 3 .   ? -24.300 -17.275 -31.566 1.00 0.00  ? 288 HOH B H2    1 
HETATM 5563 O O     . HOH H 3 .   ? -18.021 17.111  -30.116 1.00 27.75 ? 289 HOH B O     1 
HETATM 5564 H H1    . HOH H 3 .   ? -17.127 16.881  -29.845 1.00 0.00  ? 289 HOH B H1    1 
HETATM 5565 H H2    . HOH H 3 .   ? -17.916 17.952  -30.552 1.00 0.00  ? 289 HOH B H2    1 
HETATM 5566 O O     . HOH H 3 .   ? 4.142   -2.299  -13.421 1.00 21.46 ? 290 HOH B O     1 
HETATM 5567 H H1    . HOH H 3 .   ? 4.907   -1.858  -13.022 1.00 0.00  ? 290 HOH B H1    1 
HETATM 5568 H H2    . HOH H 3 .   ? 3.808   -2.812  -12.675 1.00 0.00  ? 290 HOH B H2    1 
HETATM 5569 O O     . HOH H 3 .   ? 4.171   -3.628  -9.797  1.00 53.85 ? 291 HOH B O     1 
HETATM 5570 H H1    . HOH H 3 .   ? 4.167   -3.963  -8.886  1.00 0.00  ? 291 HOH B H1    1 
HETATM 5571 H H2    . HOH H 3 .   ? 5.095   -3.749  -10.029 1.00 0.00  ? 291 HOH B H2    1 
HETATM 5572 O O     . HOH H 3 .   ? -2.983  -2.909  -15.349 1.00 45.06 ? 292 HOH B O     1 
HETATM 5573 H H1    . HOH H 3 .   ? -2.970  -2.088  -14.857 1.00 0.00  ? 292 HOH B H1    1 
HETATM 5574 H H2    . HOH H 3 .   ? -2.727  -2.625  -16.227 1.00 0.00  ? 292 HOH B H2    1 
HETATM 5575 O O     . HOH H 3 .   ? -6.868  7.422   -18.194 1.00 20.12 ? 293 HOH B O     1 
HETATM 5576 H H1    . HOH H 3 .   ? -7.191  6.542   -18.435 1.00 0.00  ? 293 HOH B H1    1 
HETATM 5577 H H2    . HOH H 3 .   ? -7.506  7.697   -17.528 1.00 0.00  ? 293 HOH B H2    1 
HETATM 5578 O O     . HOH H 3 .   ? -22.338 -0.654  -17.865 1.00 25.18 ? 294 HOH B O     1 
HETATM 5579 H H1    . HOH H 3 .   ? -22.355 -0.181  -17.026 1.00 0.00  ? 294 HOH B H1    1 
HETATM 5580 H H2    . HOH H 3 .   ? -21.606 -1.264  -17.778 1.00 0.00  ? 294 HOH B H2    1 
HETATM 5581 O O     . HOH H 3 .   ? 21.062  12.011  4.640   1.00 40.61 ? 295 HOH B O     1 
HETATM 5582 H H1    . HOH H 3 .   ? 21.306  11.542  3.835   1.00 0.00  ? 295 HOH B H1    1 
HETATM 5583 H H2    . HOH H 3 .   ? 20.254  11.588  4.932   1.00 0.00  ? 295 HOH B H2    1 
HETATM 5584 O O     . HOH H 3 .   ? -15.385 2.744   -14.298 1.00 26.39 ? 296 HOH B O     1 
HETATM 5585 H H1    . HOH H 3 .   ? -16.261 2.455   -13.995 1.00 0.00  ? 296 HOH B H1    1 
HETATM 5586 H H2    . HOH H 3 .   ? -14.892 2.855   -13.461 1.00 0.00  ? 296 HOH B H2    1 
HETATM 5587 O O     . HOH H 3 .   ? -9.859  -2.795  -42.936 1.00 57.59 ? 297 HOH B O     1 
HETATM 5588 H H1    . HOH H 3 .   ? -9.795  -2.501  -43.845 1.00 0.00  ? 297 HOH B H1    1 
HETATM 5589 H H2    . HOH H 3 .   ? -9.430  -2.087  -42.444 1.00 0.00  ? 297 HOH B H2    1 
HETATM 5590 O O     . HOH H 3 .   ? -20.945 8.097   -11.565 1.00 42.27 ? 298 HOH B O     1 
HETATM 5591 H H1    . HOH H 3 .   ? -21.096 7.844   -12.490 1.00 0.00  ? 298 HOH B H1    1 
HETATM 5592 H H2    . HOH H 3 .   ? -19.985 8.161   -11.543 1.00 0.00  ? 298 HOH B H2    1 
HETATM 5593 O O     . HOH H 3 .   ? 8.116   25.241  0.121   1.00 29.46 ? 299 HOH B O     1 
HETATM 5594 H H1    . HOH H 3 .   ? 7.935   25.972  -0.472  1.00 0.00  ? 299 HOH B H1    1 
HETATM 5595 H H2    . HOH H 3 .   ? 8.292   25.673  0.957   1.00 0.00  ? 299 HOH B H2    1 
HETATM 5596 O O     . HOH H 3 .   ? -8.133  20.482  -8.750  1.00 27.70 ? 300 HOH B O     1 
HETATM 5597 H H1    . HOH H 3 .   ? -8.350  21.051  -8.009  1.00 0.00  ? 300 HOH B H1    1 
HETATM 5598 H H2    . HOH H 3 .   ? -9.008  20.179  -9.022  1.00 0.00  ? 300 HOH B H2    1 
HETATM 5599 O O     . HOH H 3 .   ? 8.826   15.292  -29.337 1.00 35.04 ? 301 HOH B O     1 
HETATM 5600 H H1    . HOH H 3 .   ? 8.802   15.992  -28.678 1.00 0.00  ? 301 HOH B H1    1 
HETATM 5601 H H2    . HOH H 3 .   ? 9.698   14.918  -29.182 1.00 0.00  ? 301 HOH B H2    1 
HETATM 5602 O O     . HOH H 3 .   ? -0.097  30.864  -29.928 1.00 33.78 ? 302 HOH B O     1 
HETATM 5603 H H1    . HOH H 3 .   ? -0.106  31.587  -29.301 1.00 0.00  ? 302 HOH B H1    1 
HETATM 5604 H H2    . HOH H 3 .   ? 0.663   30.347  -29.638 1.00 0.00  ? 302 HOH B H2    1 
HETATM 5605 O O     . HOH H 3 .   ? -17.009 10.054  -28.724 1.00 40.54 ? 303 HOH B O     1 
HETATM 5606 H H1    . HOH H 3 .   ? -17.140 9.127   -28.519 1.00 0.00  ? 303 HOH B H1    1 
HETATM 5607 H H2    . HOH H 3 .   ? -17.615 10.479  -28.103 1.00 0.00  ? 303 HOH B H2    1 
HETATM 5608 O O     . HOH H 3 .   ? -22.935 17.208  -28.984 1.00 45.46 ? 304 HOH B O     1 
HETATM 5609 H H1    . HOH H 3 .   ? -23.277 16.884  -29.820 1.00 0.00  ? 304 HOH B H1    1 
HETATM 5610 H H2    . HOH H 3 .   ? -21.990 17.279  -29.159 1.00 0.00  ? 304 HOH B H2    1 
HETATM 5611 O O     . HOH H 3 .   ? -15.826 22.800  -16.166 1.00 43.17 ? 305 HOH B O     1 
HETATM 5612 H H1    . HOH H 3 .   ? -15.656 23.357  -16.930 1.00 0.00  ? 305 HOH B H1    1 
HETATM 5613 H H2    . HOH H 3 .   ? -16.231 22.011  -16.541 1.00 0.00  ? 305 HOH B H2    1 
HETATM 5614 O O     . HOH H 3 .   ? -2.778  7.346   -33.325 1.00 35.30 ? 306 HOH B O     1 
HETATM 5615 H H1    . HOH H 3 .   ? -3.562  7.754   -32.907 1.00 0.00  ? 306 HOH B H1    1 
HETATM 5616 H H2    . HOH H 3 .   ? -2.570  7.974   -34.017 1.00 0.00  ? 306 HOH B H2    1 
HETATM 5617 O O     . HOH H 3 .   ? 14.401  -3.654  -18.020 1.00 35.43 ? 307 HOH B O     1 
HETATM 5618 H H1    . HOH H 3 .   ? 14.591  -2.770  -17.701 1.00 0.00  ? 307 HOH B H1    1 
HETATM 5619 H H2    . HOH H 3 .   ? 15.175  -4.159  -17.765 1.00 0.00  ? 307 HOH B H2    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DG  4   4   4   DG  G   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DT  8   8   8   DT  T   C . n 
A 1 9   DC  9   9   9   DC  C   C . n 
A 1 10  DT  10  10  10  DT  T   C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
B 1 1   DA  1   1   1   DA  A   D . n 
B 1 2   DA  2   2   2   DA  A   D . n 
B 1 3   DA  3   3   3   DA  A   D . n 
B 1 4   DG  4   4   4   DG  G   D . n 
B 1 5   DA  5   5   5   DA  A   D . n 
B 1 6   DT  6   6   6   DT  T   D . n 
B 1 7   DA  7   7   7   DA  A   D . n 
B 1 8   DT  8   8   8   DT  T   D . n 
B 1 9   DC  9   9   9   DC  C   D . n 
B 1 10  DT  10  10  10  DT  T   D . n 
B 1 11  DT  11  11  11  DT  T   D . n 
C 2 1   SER 1   2   2   SER SER A . n 
C 2 2   LEU 2   3   3   LEU LEU A . n 
C 2 3   ARG 3   4   4   ARG ARG A . n 
C 2 4   SER 4   5   5   SER SER A . n 
C 2 5   ASP 5   6   6   ASP ASP A . n 
C 2 6   LEU 6   7   7   LEU LEU A . n 
C 2 7   ILE 7   8   8   ILE ILE A . n 
C 2 8   ASN 8   9   9   ASN ASN A . n 
C 2 9   ALA 9   10  10  ALA ALA A . n 
C 2 10  LEU 10  11  11  LEU LEU A . n 
C 2 11  TYR 11  12  12  TYR TYR A . n 
C 2 12  ASP 12  13  13  ASP ASP A . n 
C 2 13  GLU 13  14  14  GLU GLU A . n 
C 2 14  ASN 14  15  15  ASN ASN A . n 
C 2 15  GLN 15  16  16  GLN GLN A . n 
C 2 16  LYS 16  17  17  LYS LYS A . n 
C 2 17  TYR 17  18  18  TYR TYR A . n 
C 2 18  ASP 18  19  19  ASP ASP A . n 
C 2 19  VAL 19  20  20  VAL VAL A . n 
C 2 20  CYS 20  21  21  CYS CYS A . n 
C 2 21  GLY 21  22  22  GLY GLY A . n 
C 2 22  ILE 22  23  23  ILE ILE A . n 
C 2 23  ILE 23  24  24  ILE ILE A . n 
C 2 24  SER 24  25  25  SER SER A . n 
C 2 25  ALA 25  26  26  ALA ALA A . n 
C 2 26  GLU 26  27  27  GLU GLU A . n 
C 2 27  GLY 27  28  28  GLY GLY A . n 
C 2 28  LYS 28  29  29  LYS LYS A . n 
C 2 29  ILE 29  30  30  ILE ILE A . n 
C 2 30  TYR 30  31  31  TYR TYR A . n 
C 2 31  PRO 31  32  32  PRO PRO A . n 
C 2 32  LEU 32  33  33  LEU LEU A . n 
C 2 33  GLY 33  34  34  GLY GLY A . n 
C 2 34  SER 34  35  35  SER SER A . n 
C 2 35  ASP 35  36  36  ASP ASP A . n 
C 2 36  THR 36  37  37  THR THR A . n 
C 2 37  LYS 37  38  38  LYS LYS A . n 
C 2 38  VAL 38  39  39  VAL VAL A . n 
C 2 39  LEU 39  40  40  LEU LEU A . n 
C 2 40  SER 40  41  41  SER SER A . n 
C 2 41  THR 41  42  42  THR THR A . n 
C 2 42  ILE 42  43  43  ILE ILE A . n 
C 2 43  PHE 43  44  44  PHE PHE A . n 
C 2 44  GLU 44  45  45  GLU GLU A . n 
C 2 45  LEU 45  46  46  LEU LEU A . n 
C 2 46  PHE 46  47  47  PHE PHE A . n 
C 2 47  SER 47  48  48  SER SER A . n 
C 2 48  ARG 48  49  49  ARG ARG A . n 
C 2 49  PRO 49  50  50  PRO PRO A . n 
C 2 50  ILE 50  51  51  ILE ILE A . n 
C 2 51  ILE 51  52  52  ILE ILE A . n 
C 2 52  ASN 52  53  53  ASN ASN A . n 
C 2 53  LYS 53  54  54  LYS LYS A . n 
C 2 54  ILE 54  55  55  ILE ILE A . n 
C 2 55  ALA 55  56  56  ALA ALA A . n 
C 2 56  GLU 56  57  57  GLU GLU A . n 
C 2 57  LYS 57  58  58  LYS LYS A . n 
C 2 58  HIS 58  59  59  HIS HIS A . n 
C 2 59  GLY 59  60  60  GLY GLY A . n 
C 2 60  TYR 60  61  61  TYR TYR A . n 
C 2 61  ILE 61  62  62  ILE ILE A . n 
C 2 62  VAL 62  63  63  VAL VAL A . n 
C 2 63  GLU 63  64  64  GLU GLU A . n 
C 2 64  GLU 64  65  65  GLU GLU A . n 
C 2 65  PRO 65  66  66  PRO PRO A . n 
C 2 66  LYS 66  67  67  LYS LYS A . n 
C 2 67  GLN 67  68  68  GLN GLN A . n 
C 2 68  GLN 68  69  69  GLN GLN A . n 
C 2 69  ASN 69  70  70  ASN ASN A . n 
C 2 70  HIS 70  71  71  HIS HIS A . n 
C 2 71  TYR 71  72  72  TYR TYR A . n 
C 2 72  PRO 72  73  73  PRO PRO A . n 
C 2 73  ASP 73  74  74  ASP ASP A . n 
C 2 74  PHE 74  75  75  PHE PHE A . n 
C 2 75  THR 75  76  76  THR THR A . n 
C 2 76  LEU 76  77  77  LEU LEU A . n 
C 2 77  TYR 77  78  78  TYR TYR A . n 
C 2 78  LYS 78  79  79  LYS LYS A . n 
C 2 79  PRO 79  80  80  PRO PRO A . n 
C 2 80  SER 80  81  81  SER SER A . n 
C 2 81  GLU 81  82  82  GLU GLU A . n 
C 2 82  PRO 82  83  83  PRO PRO A . n 
C 2 83  ASN 83  84  84  ASN ASN A . n 
C 2 84  LYS 84  85  85  LYS LYS A . n 
C 2 85  LYS 85  86  86  LYS LYS A . n 
C 2 86  ILE 86  87  87  ILE ILE A . n 
C 2 87  ALA 87  88  88  ALA ALA A . n 
C 2 88  ILE 88  89  89  ILE ILE A . n 
C 2 89  ASP 89  90  90  ASP ASP A . n 
C 2 90  ILE 90  91  91  ILE ILE A . n 
C 2 91  LYS 91  92  92  LYS LYS A . n 
C 2 92  THR 92  93  93  THR THR A . n 
C 2 93  THR 93  94  94  THR THR A . n 
C 2 94  TYR 94  95  95  TYR TYR A . n 
C 2 95  THR 95  96  96  THR THR A . n 
C 2 96  ASN 96  97  97  ASN ASN A . n 
C 2 97  LYS 97  98  98  LYS LYS A . n 
C 2 98  GLU 98  99  99  GLU GLU A . n 
C 2 99  ASN 99  100 100 ASN ASN A . n 
C 2 100 GLU 100 101 101 GLU GLU A . n 
C 2 101 LYS 101 102 102 LYS LYS A . n 
C 2 102 ILE 102 103 103 ILE ILE A . n 
C 2 103 LYS 103 104 104 LYS LYS A . n 
C 2 104 PHE 104 105 105 PHE PHE A . n 
C 2 105 THR 105 106 106 THR THR A . n 
C 2 106 LEU 106 107 107 LEU LEU A . n 
C 2 107 GLY 107 108 108 GLY GLY A . n 
C 2 108 GLY 108 109 109 GLY GLY A . n 
C 2 109 TYR 109 110 110 TYR TYR A . n 
C 2 110 THR 110 111 111 THR THR A . n 
C 2 111 SER 111 112 112 SER SER A . n 
C 2 112 PHE 112 113 113 PHE PHE A . n 
C 2 113 ILE 113 114 114 ILE ILE A . n 
C 2 114 ARG 114 115 115 ARG ARG A . n 
C 2 115 ASN 115 116 116 ASN ASN A . n 
C 2 116 ASN 116 117 117 ASN ASN A . n 
C 2 117 THR 117 118 118 THR THR A . n 
C 2 118 LYS 118 119 119 LYS LYS A . n 
C 2 119 ASN 119 120 120 ASN ASN A . n 
C 2 120 ILE 120 121 121 ILE ILE A . n 
C 2 121 VAL 121 122 122 VAL VAL A . n 
C 2 122 TYR 122 123 123 TYR TYR A . n 
C 2 123 PRO 123 124 124 PRO PRO A . n 
C 2 124 PHE 124 125 125 PHE PHE A . n 
C 2 125 ASP 125 126 126 ASP ASP A . n 
C 2 126 GLN 126 127 127 GLN GLN A . n 
C 2 127 TYR 127 128 128 TYR TYR A . n 
C 2 128 ILE 128 129 129 ILE ILE A . n 
C 2 129 ALA 129 130 130 ALA ALA A . n 
C 2 130 HIS 130 131 131 HIS HIS A . n 
C 2 131 TRP 131 132 132 TRP TRP A . n 
C 2 132 ILE 132 133 133 ILE ILE A . n 
C 2 133 ILE 133 134 134 ILE ILE A . n 
C 2 134 GLY 134 135 135 GLY GLY A . n 
C 2 135 TYR 135 136 136 TYR TYR A . n 
C 2 136 VAL 136 137 137 VAL VAL A . n 
C 2 137 TYR 137 138 138 TYR TYR A . n 
C 2 138 THR 138 139 139 THR THR A . n 
C 2 139 ARG 139 140 140 ARG ARG A . n 
C 2 140 VAL 140 141 141 VAL VAL A . n 
C 2 141 ALA 141 142 ?   ?   ?   A . n 
C 2 142 THR 142 143 ?   ?   ?   A . n 
C 2 143 ARG 143 144 ?   ?   ?   A . n 
C 2 144 LYS 144 145 ?   ?   ?   A . n 
C 2 145 SER 145 146 146 SER SER A . n 
C 2 146 SER 146 147 147 SER SER A . n 
C 2 147 LEU 147 148 148 LEU LEU A . n 
C 2 148 LYS 148 149 149 LYS LYS A . n 
C 2 149 THR 149 150 150 THR THR A . n 
C 2 150 TYR 150 151 151 TYR TYR A . n 
C 2 151 ASN 151 152 152 ASN ASN A . n 
C 2 152 ILE 152 153 153 ILE ILE A . n 
C 2 153 ASN 153 154 154 ASN ASN A . n 
C 2 154 GLU 154 155 155 GLU GLU A . n 
C 2 155 LEU 155 156 156 LEU LEU A . n 
C 2 156 ASN 156 157 157 ASN ASN A . n 
C 2 157 GLU 157 158 158 GLU GLU A . n 
C 2 158 ILE 158 159 159 ILE ILE A . n 
C 2 159 PRO 159 160 160 PRO PRO A . n 
C 2 160 LYS 160 161 161 LYS LYS A . n 
C 2 161 PRO 161 162 162 PRO PRO A . n 
C 2 162 TYR 162 163 163 TYR TYR A . n 
C 2 163 LYS 163 164 164 LYS LYS A . n 
C 2 164 GLY 164 165 165 GLY GLY A . n 
C 2 165 VAL 165 166 166 VAL VAL A . n 
C 2 166 LYS 166 167 167 LYS LYS A . n 
C 2 167 VAL 167 168 168 VAL VAL A . n 
C 2 168 PHE 168 169 169 PHE PHE A . n 
C 2 169 LEU 169 170 170 LEU LEU A . n 
C 2 170 GLN 170 171 171 GLN GLN A . n 
C 2 171 ASP 171 172 172 ASP ASP A . n 
C 2 172 LYS 172 173 173 LYS LYS A . n 
C 2 173 TRP 173 174 174 TRP TRP A . n 
C 2 174 VAL 174 175 175 VAL VAL A . n 
C 2 175 ILE 175 176 176 ILE ILE A . n 
C 2 176 ALA 176 177 177 ALA ALA A . n 
C 2 177 GLY 177 178 178 GLY GLY A . n 
C 2 178 ASP 178 179 179 ASP ASP A . n 
C 2 179 LEU 179 180 180 LEU LEU A . n 
C 2 180 ALA 180 181 181 ALA ALA A . n 
C 2 181 GLY 181 182 182 GLY GLY A . n 
C 2 182 SER 182 183 183 SER SER A . n 
C 2 183 GLY 183 184 184 GLY GLY A . n 
C 2 184 ASN 184 185 185 ASN ASN A . n 
C 2 185 THR 185 186 186 THR THR A . n 
C 2 186 THR 186 187 187 THR THR A . n 
C 2 187 ASN 187 188 188 ASN ASN A . n 
C 2 188 ILE 188 189 189 ILE ILE A . n 
C 2 189 GLY 189 190 190 GLY GLY A . n 
C 2 190 SER 190 191 191 SER SER A . n 
C 2 191 ILE 191 192 192 ILE ILE A . n 
C 2 192 HIS 192 193 193 HIS HIS A . n 
C 2 193 ALA 193 194 194 ALA ALA A . n 
C 2 194 HIS 194 195 195 HIS HIS A . n 
C 2 195 TYR 195 196 196 TYR TYR A . n 
C 2 196 LYS 196 197 197 LYS LYS A . n 
C 2 197 ASP 197 198 198 ASP ASP A . n 
C 2 198 PHE 198 199 199 PHE PHE A . n 
C 2 199 VAL 199 200 200 VAL VAL A . n 
C 2 200 GLU 200 201 201 GLU GLU A . n 
C 2 201 GLY 201 202 202 GLY GLY A . n 
C 2 202 LYS 202 203 203 LYS LYS A . n 
C 2 203 GLY 203 204 204 GLY GLY A . n 
C 2 204 ILE 204 205 205 ILE ILE A . n 
C 2 205 PHE 205 206 206 PHE PHE A . n 
C 2 206 ASP 206 207 207 ASP ASP A . n 
C 2 207 SER 207 208 208 SER SER A . n 
C 2 208 GLU 208 209 209 GLU GLU A . n 
C 2 209 ASP 209 210 210 ASP ASP A . n 
C 2 210 GLU 210 211 211 GLU GLU A . n 
C 2 211 PHE 211 212 212 PHE PHE A . n 
C 2 212 LEU 212 213 213 LEU LEU A . n 
C 2 213 ASP 213 214 214 ASP ASP A . n 
C 2 214 TYR 214 215 215 TYR TYR A . n 
C 2 215 TRP 215 216 216 TRP TRP A . n 
C 2 216 ARG 216 217 217 ARG ARG A . n 
C 2 217 ASN 217 218 218 ASN ASN A . n 
C 2 218 TYR 218 219 219 TYR TYR A . n 
C 2 219 GLU 219 220 220 GLU GLU A . n 
C 2 220 ARG 220 221 221 ARG ARG A . n 
C 2 221 THR 221 222 222 THR THR A . n 
C 2 222 SER 222 223 223 SER SER A . n 
C 2 223 GLN 223 224 224 GLN GLN A . n 
C 2 224 LEU 224 225 225 LEU LEU A . n 
C 2 225 ARG 225 226 226 ARG ARG A . n 
C 2 226 ASN 226 227 227 ASN ASN A . n 
C 2 227 ASP 227 228 228 ASP ASP A . n 
C 2 228 LYS 228 229 229 LYS LYS A . n 
C 2 229 TYR 229 230 230 TYR TYR A . n 
C 2 230 ASN 230 231 231 ASN ASN A . n 
C 2 231 ASN 231 232 232 ASN ASN A . n 
C 2 232 ILE 232 233 233 ILE ILE A . n 
C 2 233 SER 233 234 234 SER SER A . n 
C 2 234 GLU 234 235 235 GLU GLU A . n 
C 2 235 TYR 235 236 236 TYR TYR A . n 
C 2 236 ARG 236 237 237 ARG ARG A . n 
C 2 237 ASN 237 238 238 ASN ASN A . n 
C 2 238 TRP 238 239 239 TRP TRP A . n 
C 2 239 ILE 239 240 240 ILE ILE A . n 
C 2 240 TYR 240 241 241 TYR TYR A . n 
C 2 241 ARG 241 242 242 ARG ARG A . n 
C 2 242 GLY 242 243 243 GLY GLY A . n 
C 2 243 ARG 243 244 244 ARG ARG A . n 
C 2 244 LYS 244 245 245 LYS LYS A . n 
D 2 1   SER 1   2   2   SER SER B . n 
D 2 2   LEU 2   3   3   LEU LEU B . n 
D 2 3   ARG 3   4   4   ARG ARG B . n 
D 2 4   SER 4   5   5   SER SER B . n 
D 2 5   ASP 5   6   6   ASP ASP B . n 
D 2 6   LEU 6   7   7   LEU LEU B . n 
D 2 7   ILE 7   8   8   ILE ILE B . n 
D 2 8   ASN 8   9   9   ASN ASN B . n 
D 2 9   ALA 9   10  10  ALA ALA B . n 
D 2 10  LEU 10  11  11  LEU LEU B . n 
D 2 11  TYR 11  12  ?   ?   ?   B . n 
D 2 12  ASP 12  13  ?   ?   ?   B . n 
D 2 13  GLU 13  14  ?   ?   ?   B . n 
D 2 14  ASN 14  15  ?   ?   ?   B . n 
D 2 15  GLN 15  16  ?   ?   ?   B . n 
D 2 16  LYS 16  17  ?   ?   ?   B . n 
D 2 17  TYR 17  18  ?   ?   ?   B . n 
D 2 18  ASP 18  19  19  ASP ASP B . n 
D 2 19  VAL 19  20  20  VAL VAL B . n 
D 2 20  CYS 20  21  21  CYS CYS B . n 
D 2 21  GLY 21  22  22  GLY GLY B . n 
D 2 22  ILE 22  23  23  ILE ILE B . n 
D 2 23  ILE 23  24  24  ILE ILE B . n 
D 2 24  SER 24  25  25  SER SER B . n 
D 2 25  ALA 25  26  26  ALA ALA B . n 
D 2 26  GLU 26  27  27  GLU GLU B . n 
D 2 27  GLY 27  28  28  GLY GLY B . n 
D 2 28  LYS 28  29  29  LYS LYS B . n 
D 2 29  ILE 29  30  30  ILE ILE B . n 
D 2 30  TYR 30  31  31  TYR TYR B . n 
D 2 31  PRO 31  32  32  PRO PRO B . n 
D 2 32  LEU 32  33  33  LEU LEU B . n 
D 2 33  GLY 33  34  34  GLY GLY B . n 
D 2 34  SER 34  35  35  SER SER B . n 
D 2 35  ASP 35  36  36  ASP ASP B . n 
D 2 36  THR 36  37  37  THR THR B . n 
D 2 37  LYS 37  38  38  LYS LYS B . n 
D 2 38  VAL 38  39  39  VAL VAL B . n 
D 2 39  LEU 39  40  40  LEU LEU B . n 
D 2 40  SER 40  41  41  SER SER B . n 
D 2 41  THR 41  42  42  THR THR B . n 
D 2 42  ILE 42  43  43  ILE ILE B . n 
D 2 43  PHE 43  44  44  PHE PHE B . n 
D 2 44  GLU 44  45  45  GLU GLU B . n 
D 2 45  LEU 45  46  46  LEU LEU B . n 
D 2 46  PHE 46  47  47  PHE PHE B . n 
D 2 47  SER 47  48  48  SER SER B . n 
D 2 48  ARG 48  49  49  ARG ARG B . n 
D 2 49  PRO 49  50  50  PRO PRO B . n 
D 2 50  ILE 50  51  51  ILE ILE B . n 
D 2 51  ILE 51  52  52  ILE ILE B . n 
D 2 52  ASN 52  53  53  ASN ASN B . n 
D 2 53  LYS 53  54  54  LYS LYS B . n 
D 2 54  ILE 54  55  55  ILE ILE B . n 
D 2 55  ALA 55  56  56  ALA ALA B . n 
D 2 56  GLU 56  57  57  GLU GLU B . n 
D 2 57  LYS 57  58  58  LYS LYS B . n 
D 2 58  HIS 58  59  59  HIS HIS B . n 
D 2 59  GLY 59  60  60  GLY GLY B . n 
D 2 60  TYR 60  61  61  TYR TYR B . n 
D 2 61  ILE 61  62  62  ILE ILE B . n 
D 2 62  VAL 62  63  63  VAL VAL B . n 
D 2 63  GLU 63  64  64  GLU GLU B . n 
D 2 64  GLU 64  65  65  GLU GLU B . n 
D 2 65  PRO 65  66  66  PRO PRO B . n 
D 2 66  LYS 66  67  67  LYS LYS B . n 
D 2 67  GLN 67  68  68  GLN GLN B . n 
D 2 68  GLN 68  69  69  GLN GLN B . n 
D 2 69  ASN 69  70  70  ASN ASN B . n 
D 2 70  HIS 70  71  71  HIS HIS B . n 
D 2 71  TYR 71  72  72  TYR TYR B . n 
D 2 72  PRO 72  73  73  PRO PRO B . n 
D 2 73  ASP 73  74  74  ASP ASP B . n 
D 2 74  PHE 74  75  75  PHE PHE B . n 
D 2 75  THR 75  76  76  THR THR B . n 
D 2 76  LEU 76  77  77  LEU LEU B . n 
D 2 77  TYR 77  78  78  TYR TYR B . n 
D 2 78  LYS 78  79  79  LYS LYS B . n 
D 2 79  PRO 79  80  80  PRO PRO B . n 
D 2 80  SER 80  81  81  SER SER B . n 
D 2 81  GLU 81  82  82  GLU GLU B . n 
D 2 82  PRO 82  83  83  PRO PRO B . n 
D 2 83  ASN 83  84  84  ASN ASN B . n 
D 2 84  LYS 84  85  85  LYS LYS B . n 
D 2 85  LYS 85  86  86  LYS LYS B . n 
D 2 86  ILE 86  87  87  ILE ILE B . n 
D 2 87  ALA 87  88  88  ALA ALA B . n 
D 2 88  ILE 88  89  89  ILE ILE B . n 
D 2 89  ASP 89  90  90  ASP ASP B . n 
D 2 90  ILE 90  91  91  ILE ILE B . n 
D 2 91  LYS 91  92  92  LYS LYS B . n 
D 2 92  THR 92  93  93  THR THR B . n 
D 2 93  THR 93  94  94  THR THR B . n 
D 2 94  TYR 94  95  95  TYR TYR B . n 
D 2 95  THR 95  96  96  THR THR B . n 
D 2 96  ASN 96  97  97  ASN ASN B . n 
D 2 97  LYS 97  98  ?   ?   ?   B . n 
D 2 98  GLU 98  99  ?   ?   ?   B . n 
D 2 99  ASN 99  100 ?   ?   ?   B . n 
D 2 100 GLU 100 101 ?   ?   ?   B . n 
D 2 101 LYS 101 102 102 LYS LYS B . n 
D 2 102 ILE 102 103 103 ILE ILE B . n 
D 2 103 LYS 103 104 104 LYS LYS B . n 
D 2 104 PHE 104 105 105 PHE PHE B . n 
D 2 105 THR 105 106 106 THR THR B . n 
D 2 106 LEU 106 107 107 LEU LEU B . n 
D 2 107 GLY 107 108 108 GLY GLY B . n 
D 2 108 GLY 108 109 109 GLY GLY B . n 
D 2 109 TYR 109 110 110 TYR TYR B . n 
D 2 110 THR 110 111 111 THR THR B . n 
D 2 111 SER 111 112 112 SER SER B . n 
D 2 112 PHE 112 113 113 PHE PHE B . n 
D 2 113 ILE 113 114 114 ILE ILE B . n 
D 2 114 ARG 114 115 115 ARG ARG B . n 
D 2 115 ASN 115 116 116 ASN ASN B . n 
D 2 116 ASN 116 117 117 ASN ASN B . n 
D 2 117 THR 117 118 118 THR THR B . n 
D 2 118 LYS 118 119 119 LYS LYS B . n 
D 2 119 ASN 119 120 120 ASN ASN B . n 
D 2 120 ILE 120 121 121 ILE ILE B . n 
D 2 121 VAL 121 122 122 VAL VAL B . n 
D 2 122 TYR 122 123 123 TYR TYR B . n 
D 2 123 PRO 123 124 124 PRO PRO B . n 
D 2 124 PHE 124 125 125 PHE PHE B . n 
D 2 125 ASP 125 126 126 ASP ASP B . n 
D 2 126 GLN 126 127 127 GLN GLN B . n 
D 2 127 TYR 127 128 128 TYR TYR B . n 
D 2 128 ILE 128 129 129 ILE ILE B . n 
D 2 129 ALA 129 130 130 ALA ALA B . n 
D 2 130 HIS 130 131 131 HIS HIS B . n 
D 2 131 TRP 131 132 132 TRP TRP B . n 
D 2 132 ILE 132 133 133 ILE ILE B . n 
D 2 133 ILE 133 134 134 ILE ILE B . n 
D 2 134 GLY 134 135 135 GLY GLY B . n 
D 2 135 TYR 135 136 136 TYR TYR B . n 
D 2 136 VAL 136 137 137 VAL VAL B . n 
D 2 137 TYR 137 138 138 TYR TYR B . n 
D 2 138 THR 138 139 139 THR THR B . n 
D 2 139 ARG 139 140 140 ARG ARG B . n 
D 2 140 VAL 140 141 141 VAL VAL B . n 
D 2 141 ALA 141 142 ?   ?   ?   B . n 
D 2 142 THR 142 143 ?   ?   ?   B . n 
D 2 143 ARG 143 144 ?   ?   ?   B . n 
D 2 144 LYS 144 145 ?   ?   ?   B . n 
D 2 145 SER 145 146 ?   ?   ?   B . n 
D 2 146 SER 146 147 ?   ?   ?   B . n 
D 2 147 LEU 147 148 148 LEU LEU B . n 
D 2 148 LYS 148 149 149 LYS LYS B . n 
D 2 149 THR 149 150 150 THR THR B . n 
D 2 150 TYR 150 151 151 TYR TYR B . n 
D 2 151 ASN 151 152 152 ASN ASN B . n 
D 2 152 ILE 152 153 153 ILE ILE B . n 
D 2 153 ASN 153 154 154 ASN ASN B . n 
D 2 154 GLU 154 155 155 GLU GLU B . n 
D 2 155 LEU 155 156 156 LEU LEU B . n 
D 2 156 ASN 156 157 157 ASN ASN B . n 
D 2 157 GLU 157 158 158 GLU GLU B . n 
D 2 158 ILE 158 159 159 ILE ILE B . n 
D 2 159 PRO 159 160 160 PRO PRO B . n 
D 2 160 LYS 160 161 161 LYS LYS B . n 
D 2 161 PRO 161 162 162 PRO PRO B . n 
D 2 162 TYR 162 163 163 TYR TYR B . n 
D 2 163 LYS 163 164 164 LYS LYS B . n 
D 2 164 GLY 164 165 165 GLY GLY B . n 
D 2 165 VAL 165 166 166 VAL VAL B . n 
D 2 166 LYS 166 167 167 LYS LYS B . n 
D 2 167 VAL 167 168 168 VAL VAL B . n 
D 2 168 PHE 168 169 169 PHE PHE B . n 
D 2 169 LEU 169 170 170 LEU LEU B . n 
D 2 170 GLN 170 171 171 GLN GLN B . n 
D 2 171 ASP 171 172 172 ASP ASP B . n 
D 2 172 LYS 172 173 173 LYS LYS B . n 
D 2 173 TRP 173 174 174 TRP TRP B . n 
D 2 174 VAL 174 175 175 VAL VAL B . n 
D 2 175 ILE 175 176 176 ILE ILE B . n 
D 2 176 ALA 176 177 177 ALA ALA B . n 
D 2 177 GLY 177 178 178 GLY GLY B . n 
D 2 178 ASP 178 179 179 ASP ASP B . n 
D 2 179 LEU 179 180 180 LEU LEU B . n 
D 2 180 ALA 180 181 181 ALA ALA B . n 
D 2 181 GLY 181 182 182 GLY GLY B . n 
D 2 182 SER 182 183 183 SER SER B . n 
D 2 183 GLY 183 184 184 GLY GLY B . n 
D 2 184 ASN 184 185 185 ASN ASN B . n 
D 2 185 THR 185 186 186 THR THR B . n 
D 2 186 THR 186 187 187 THR THR B . n 
D 2 187 ASN 187 188 188 ASN ASN B . n 
D 2 188 ILE 188 189 189 ILE ILE B . n 
D 2 189 GLY 189 190 190 GLY GLY B . n 
D 2 190 SER 190 191 191 SER SER B . n 
D 2 191 ILE 191 192 192 ILE ILE B . n 
D 2 192 HIS 192 193 193 HIS HIS B . n 
D 2 193 ALA 193 194 194 ALA ALA B . n 
D 2 194 HIS 194 195 195 HIS HIS B . n 
D 2 195 TYR 195 196 196 TYR TYR B . n 
D 2 196 LYS 196 197 197 LYS LYS B . n 
D 2 197 ASP 197 198 198 ASP ASP B . n 
D 2 198 PHE 198 199 199 PHE PHE B . n 
D 2 199 VAL 199 200 200 VAL VAL B . n 
D 2 200 GLU 200 201 201 GLU GLU B . n 
D 2 201 GLY 201 202 202 GLY GLY B . n 
D 2 202 LYS 202 203 203 LYS LYS B . n 
D 2 203 GLY 203 204 204 GLY GLY B . n 
D 2 204 ILE 204 205 205 ILE ILE B . n 
D 2 205 PHE 205 206 206 PHE PHE B . n 
D 2 206 ASP 206 207 207 ASP ASP B . n 
D 2 207 SER 207 208 208 SER SER B . n 
D 2 208 GLU 208 209 209 GLU GLU B . n 
D 2 209 ASP 209 210 210 ASP ASP B . n 
D 2 210 GLU 210 211 211 GLU GLU B . n 
D 2 211 PHE 211 212 212 PHE PHE B . n 
D 2 212 LEU 212 213 213 LEU LEU B . n 
D 2 213 ASP 213 214 214 ASP ASP B . n 
D 2 214 TYR 214 215 215 TYR TYR B . n 
D 2 215 TRP 215 216 216 TRP TRP B . n 
D 2 216 ARG 216 217 217 ARG ARG B . n 
D 2 217 ASN 217 218 218 ASN ASN B . n 
D 2 218 TYR 218 219 219 TYR TYR B . n 
D 2 219 GLU 219 220 220 GLU GLU B . n 
D 2 220 ARG 220 221 221 ARG ARG B . n 
D 2 221 THR 221 222 222 THR THR B . n 
D 2 222 SER 222 223 223 SER SER B . n 
D 2 223 GLN 223 224 224 GLN GLN B . n 
D 2 224 LEU 224 225 225 LEU LEU B . n 
D 2 225 ARG 225 226 226 ARG ARG B . n 
D 2 226 ASN 226 227 227 ASN ASN B . n 
D 2 227 ASP 227 228 228 ASP ASP B . n 
D 2 228 LYS 228 229 229 LYS LYS B . n 
D 2 229 TYR 229 230 230 TYR TYR B . n 
D 2 230 ASN 230 231 231 ASN ASN B . n 
D 2 231 ASN 231 232 232 ASN ASN B . n 
D 2 232 ILE 232 233 233 ILE ILE B . n 
D 2 233 SER 233 234 234 SER SER B . n 
D 2 234 GLU 234 235 235 GLU GLU B . n 
D 2 235 TYR 235 236 236 TYR TYR B . n 
D 2 236 ARG 236 237 237 ARG ARG B . n 
D 2 237 ASN 237 238 238 ASN ASN B . n 
D 2 238 TRP 238 239 239 TRP TRP B . n 
D 2 239 ILE 239 240 240 ILE ILE B . n 
D 2 240 TYR 240 241 241 TYR TYR B . n 
D 2 241 ARG 241 242 242 ARG ARG B . n 
D 2 242 GLY 242 243 243 GLY GLY B . n 
D 2 243 ARG 243 244 244 ARG ARG B . n 
D 2 244 LYS 244 245 245 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  13  13  HOH HOH C . 
E 3 HOH 2  16  16  HOH HOH C . 
E 3 HOH 3  19  19  HOH HOH C . 
E 3 HOH 4  21  21  HOH HOH C . 
E 3 HOH 5  49  49  HOH HOH C . 
E 3 HOH 6  79  79  HOH HOH C . 
E 3 HOH 7  91  91  HOH HOH C . 
E 3 HOH 8  94  94  HOH HOH C . 
E 3 HOH 9  135 135 HOH HOH C . 
E 3 HOH 10 140 140 HOH HOH C . 
E 3 HOH 11 141 141 HOH HOH C . 
E 3 HOH 12 149 149 HOH HOH C . 
F 3 HOH 1  40  40  HOH HOH D . 
F 3 HOH 2  57  57  HOH HOH D . 
F 3 HOH 3  59  59  HOH HOH D . 
F 3 HOH 4  101 101 HOH HOH D . 
F 3 HOH 5  108 108 HOH HOH D . 
F 3 HOH 6  114 114 HOH HOH D . 
F 3 HOH 7  125 125 HOH HOH D . 
F 3 HOH 8  128 128 HOH HOH D . 
F 3 HOH 9  136 136 HOH HOH D . 
F 3 HOH 10 137 137 HOH HOH D . 
F 3 HOH 11 138 138 HOH HOH D . 
F 3 HOH 12 142 142 HOH HOH D . 
F 3 HOH 13 178 178 HOH HOH D . 
G 3 HOH 1  246 1   HOH HOH A . 
G 3 HOH 2  247 3   HOH HOH A . 
G 3 HOH 3  248 7   HOH HOH A . 
G 3 HOH 4  249 8   HOH HOH A . 
G 3 HOH 5  250 10  HOH HOH A . 
G 3 HOH 6  251 11  HOH HOH A . 
G 3 HOH 7  252 12  HOH HOH A . 
G 3 HOH 8  253 14  HOH HOH A . 
G 3 HOH 9  254 15  HOH HOH A . 
G 3 HOH 10 255 17  HOH HOH A . 
G 3 HOH 11 256 20  HOH HOH A . 
G 3 HOH 12 257 22  HOH HOH A . 
G 3 HOH 13 258 23  HOH HOH A . 
G 3 HOH 14 259 25  HOH HOH A . 
G 3 HOH 15 260 26  HOH HOH A . 
G 3 HOH 16 261 27  HOH HOH A . 
G 3 HOH 17 262 28  HOH HOH A . 
G 3 HOH 18 263 29  HOH HOH A . 
G 3 HOH 19 264 30  HOH HOH A . 
G 3 HOH 20 265 31  HOH HOH A . 
G 3 HOH 21 266 32  HOH HOH A . 
G 3 HOH 22 267 33  HOH HOH A . 
G 3 HOH 23 268 34  HOH HOH A . 
G 3 HOH 24 269 35  HOH HOH A . 
G 3 HOH 25 270 36  HOH HOH A . 
G 3 HOH 26 271 37  HOH HOH A . 
G 3 HOH 27 272 38  HOH HOH A . 
G 3 HOH 28 273 39  HOH HOH A . 
G 3 HOH 29 274 41  HOH HOH A . 
G 3 HOH 30 275 60  HOH HOH A . 
G 3 HOH 31 276 87  HOH HOH A . 
G 3 HOH 32 277 93  HOH HOH A . 
G 3 HOH 33 278 98  HOH HOH A . 
G 3 HOH 34 279 99  HOH HOH A . 
G 3 HOH 35 280 102 HOH HOH A . 
G 3 HOH 36 281 103 HOH HOH A . 
G 3 HOH 37 282 104 HOH HOH A . 
G 3 HOH 38 283 105 HOH HOH A . 
G 3 HOH 39 284 106 HOH HOH A . 
G 3 HOH 40 285 107 HOH HOH A . 
G 3 HOH 41 286 109 HOH HOH A . 
G 3 HOH 42 287 110 HOH HOH A . 
G 3 HOH 43 288 111 HOH HOH A . 
G 3 HOH 44 289 112 HOH HOH A . 
G 3 HOH 45 290 113 HOH HOH A . 
G 3 HOH 46 291 115 HOH HOH A . 
G 3 HOH 47 292 116 HOH HOH A . 
G 3 HOH 48 293 117 HOH HOH A . 
G 3 HOH 49 294 118 HOH HOH A . 
G 3 HOH 50 295 119 HOH HOH A . 
G 3 HOH 51 296 120 HOH HOH A . 
G 3 HOH 52 297 133 HOH HOH A . 
G 3 HOH 53 298 143 HOH HOH A . 
G 3 HOH 54 299 144 HOH HOH A . 
G 3 HOH 55 300 145 HOH HOH A . 
G 3 HOH 56 301 146 HOH HOH A . 
G 3 HOH 57 302 147 HOH HOH A . 
G 3 HOH 58 303 148 HOH HOH A . 
G 3 HOH 59 304 150 HOH HOH A . 
G 3 HOH 60 305 151 HOH HOH A . 
G 3 HOH 61 306 154 HOH HOH A . 
G 3 HOH 62 307 155 HOH HOH A . 
G 3 HOH 63 308 156 HOH HOH A . 
G 3 HOH 64 309 157 HOH HOH A . 
G 3 HOH 65 310 158 HOH HOH A . 
G 3 HOH 66 311 159 HOH HOH A . 
G 3 HOH 67 312 160 HOH HOH A . 
G 3 HOH 68 313 161 HOH HOH A . 
G 3 HOH 69 314 162 HOH HOH A . 
G 3 HOH 70 315 163 HOH HOH A . 
G 3 HOH 71 316 164 HOH HOH A . 
G 3 HOH 72 317 165 HOH HOH A . 
G 3 HOH 73 318 166 HOH HOH A . 
G 3 HOH 74 319 167 HOH HOH A . 
G 3 HOH 75 320 168 HOH HOH A . 
G 3 HOH 76 321 169 HOH HOH A . 
G 3 HOH 77 322 170 HOH HOH A . 
H 3 HOH 1  246 4   HOH HOH B . 
H 3 HOH 2  247 6   HOH HOH B . 
H 3 HOH 3  248 9   HOH HOH B . 
H 3 HOH 4  249 24  HOH HOH B . 
H 3 HOH 5  250 43  HOH HOH B . 
H 3 HOH 6  251 44  HOH HOH B . 
H 3 HOH 7  252 45  HOH HOH B . 
H 3 HOH 8  253 46  HOH HOH B . 
H 3 HOH 9  254 47  HOH HOH B . 
H 3 HOH 10 255 48  HOH HOH B . 
H 3 HOH 11 256 50  HOH HOH B . 
H 3 HOH 12 257 51  HOH HOH B . 
H 3 HOH 13 258 52  HOH HOH B . 
H 3 HOH 14 259 53  HOH HOH B . 
H 3 HOH 15 260 54  HOH HOH B . 
H 3 HOH 16 261 56  HOH HOH B . 
H 3 HOH 17 262 58  HOH HOH B . 
H 3 HOH 18 263 61  HOH HOH B . 
H 3 HOH 19 264 62  HOH HOH B . 
H 3 HOH 20 265 63  HOH HOH B . 
H 3 HOH 21 266 64  HOH HOH B . 
H 3 HOH 22 267 65  HOH HOH B . 
H 3 HOH 23 268 66  HOH HOH B . 
H 3 HOH 24 269 67  HOH HOH B . 
H 3 HOH 25 270 68  HOH HOH B . 
H 3 HOH 26 271 69  HOH HOH B . 
H 3 HOH 27 272 70  HOH HOH B . 
H 3 HOH 28 273 71  HOH HOH B . 
H 3 HOH 29 274 72  HOH HOH B . 
H 3 HOH 30 275 73  HOH HOH B . 
H 3 HOH 31 276 74  HOH HOH B . 
H 3 HOH 32 277 75  HOH HOH B . 
H 3 HOH 33 278 76  HOH HOH B . 
H 3 HOH 34 279 77  HOH HOH B . 
H 3 HOH 35 280 78  HOH HOH B . 
H 3 HOH 36 281 80  HOH HOH B . 
H 3 HOH 37 282 82  HOH HOH B . 
H 3 HOH 38 283 83  HOH HOH B . 
H 3 HOH 39 284 84  HOH HOH B . 
H 3 HOH 40 285 86  HOH HOH B . 
H 3 HOH 41 286 88  HOH HOH B . 
H 3 HOH 42 287 89  HOH HOH B . 
H 3 HOH 43 288 90  HOH HOH B . 
H 3 HOH 44 289 122 HOH HOH B . 
H 3 HOH 45 290 123 HOH HOH B . 
H 3 HOH 46 291 124 HOH HOH B . 
H 3 HOH 47 292 126 HOH HOH B . 
H 3 HOH 48 293 127 HOH HOH B . 
H 3 HOH 49 294 129 HOH HOH B . 
H 3 HOH 50 295 130 HOH HOH B . 
H 3 HOH 51 296 131 HOH HOH B . 
H 3 HOH 52 297 132 HOH HOH B . 
H 3 HOH 53 298 139 HOH HOH B . 
H 3 HOH 54 299 152 HOH HOH B . 
H 3 HOH 55 300 153 HOH HOH B . 
H 3 HOH 56 301 171 HOH HOH B . 
H 3 HOH 57 302 172 HOH HOH B . 
H 3 HOH 58 303 173 HOH HOH B . 
H 3 HOH 59 304 174 HOH HOH B . 
H 3 HOH 60 305 175 HOH HOH B . 
H 3 HOH 61 306 176 HOH HOH B . 
H 3 HOH 62 307 177 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-11 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HZ1   B LYS 173 ? ? H1  B HOH 274 ? ? 1.21 
2 1 HZ2   B LYS 86  ? ? H1  B HOH 258 ? ? 1.28 
3 1 H3    C DT  11  ? ? N1  D DA  2   ? ? 1.42 
4 1 OP2   D DT  6   ? ? H2  D HOH 59  ? ? 1.48 
5 1 OP2   C DT  11  ? ? H1  C HOH 135 ? ? 1.52 
6 1 "O3'" D DT  6   ? ? H1  D HOH 138 ? ? 1.55 
7 1 "O4'" C DC  9   ? ? H1  C HOH 49  ? ? 1.55 
8 1 OP2   C DG  4   ? ? H1  C HOH 79  ? ? 1.55 
9 1 O4    C DT  11  ? ? H62 D DA  2   ? ? 1.57 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" D DG 4 ? ? "C1'" D DG 4 ? ? N9 D DG 4 ? ? 110.97 108.30 2.67 0.30 N 
2 1 "O4'" D DT 8 ? ? "C1'" D DT 8 ? ? N1 D DT 8 ? ? 110.17 108.30 1.87 0.30 N 
3 1 "O4'" D DC 9 ? ? "C1'" D DC 9 ? ? N1 D DC 9 ? ? 110.40 108.30 2.10 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 35  ? ? -108.56 41.07   
2  1 ASN A 70  ? ? 101.00  23.66   
3  1 ASN A 84  ? ? -67.67  13.20   
4  1 ASN A 100 ? ? 90.90   -46.44  
5  1 SER A 112 ? ? -103.65 -112.56 
6  1 ASN A 117 ? ? -44.33  -19.44  
7  1 SER A 147 ? ? -67.96  3.94    
8  1 ASN A 154 ? ? -67.29  0.10    
9  1 THR A 187 ? ? 31.76   62.93   
10 1 ALA A 194 ? ? -165.02 -169.68 
11 1 LYS A 229 ? ? -118.87 -104.46 
12 1 SER B 112 ? ? -95.34  -122.89 
13 1 ASN B 117 ? ? -27.88  -32.53  
14 1 THR B 187 ? ? 26.32   74.27   
15 1 LYS B 229 ? ? -112.07 -89.22  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA  C 2  ? ? 0.055 'SIDE CHAIN' 
2 1 DA  C 5  ? ? 0.066 'SIDE CHAIN' 
3 1 DA  C 7  ? ? 0.067 'SIDE CHAIN' 
4 1 TYR B 95 ? ? 0.113 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DA  7   ? P   ? A DA  7   P   
2  1 Y 1 C DA  7   ? OP1 ? A DA  7   OP1 
3  1 Y 1 C DA  7   ? OP2 ? A DA  7   OP2 
4  1 Y 1 D DA  7   ? P   ? B DA  7   P   
5  1 Y 1 D DA  7   ? OP1 ? B DA  7   OP1 
6  1 Y 1 D DA  7   ? OP2 ? B DA  7   OP2 
7  1 Y 1 A LYS 17  ? CG  ? C LYS 16  CG  
8  1 Y 1 A LYS 17  ? CD  ? C LYS 16  CD  
9  1 Y 1 A LYS 17  ? CE  ? C LYS 16  CE  
10 1 Y 1 A LYS 17  ? NZ  ? C LYS 16  NZ  
11 1 Y 1 A LYS 29  ? CD  ? C LYS 28  CD  
12 1 Y 1 A LYS 29  ? CE  ? C LYS 28  CE  
13 1 Y 1 A LYS 29  ? NZ  ? C LYS 28  NZ  
14 1 Y 1 A LYS 38  ? CG  ? C LYS 37  CG  
15 1 Y 1 A LYS 38  ? CD  ? C LYS 37  CD  
16 1 Y 1 A LYS 38  ? CE  ? C LYS 37  CE  
17 1 Y 1 A LYS 38  ? NZ  ? C LYS 37  NZ  
18 1 Y 1 A LYS 54  ? CG  ? C LYS 53  CG  
19 1 Y 1 A LYS 54  ? CD  ? C LYS 53  CD  
20 1 Y 1 A LYS 54  ? CE  ? C LYS 53  CE  
21 1 Y 1 A LYS 54  ? NZ  ? C LYS 53  NZ  
22 1 Y 1 A LYS 67  ? CG  ? C LYS 66  CG  
23 1 Y 1 A LYS 67  ? CD  ? C LYS 66  CD  
24 1 Y 1 A LYS 67  ? CE  ? C LYS 66  CE  
25 1 Y 1 A LYS 67  ? NZ  ? C LYS 66  NZ  
26 1 Y 1 A ASN 70  ? CG  ? C ASN 69  CG  
27 1 Y 1 A ASN 70  ? OD1 ? C ASN 69  OD1 
28 1 Y 1 A ASN 70  ? ND2 ? C ASN 69  ND2 
29 1 Y 1 A GLU 82  ? CG  ? C GLU 81  CG  
30 1 Y 1 A GLU 82  ? CD  ? C GLU 81  CD  
31 1 Y 1 A GLU 82  ? OE1 ? C GLU 81  OE1 
32 1 Y 1 A GLU 82  ? OE2 ? C GLU 81  OE2 
33 1 Y 1 A LYS 85  ? CD  ? C LYS 84  CD  
34 1 Y 1 A LYS 85  ? CE  ? C LYS 84  CE  
35 1 Y 1 A LYS 85  ? NZ  ? C LYS 84  NZ  
36 1 Y 1 A LYS 98  ? CG  ? C LYS 97  CG  
37 1 Y 1 A LYS 98  ? CD  ? C LYS 97  CD  
38 1 Y 1 A LYS 98  ? CE  ? C LYS 97  CE  
39 1 Y 1 A LYS 98  ? NZ  ? C LYS 97  NZ  
40 1 Y 1 A GLU 99  ? CG  ? C GLU 98  CG  
41 1 Y 1 A GLU 99  ? CD  ? C GLU 98  CD  
42 1 Y 1 A GLU 99  ? OE1 ? C GLU 98  OE1 
43 1 Y 1 A GLU 99  ? OE2 ? C GLU 98  OE2 
44 1 Y 1 A ASN 100 ? CG  ? C ASN 99  CG  
45 1 Y 1 A ASN 100 ? OD1 ? C ASN 99  OD1 
46 1 Y 1 A ASN 100 ? ND2 ? C ASN 99  ND2 
47 1 Y 1 A LEU 148 ? CG  ? C LEU 147 CG  
48 1 Y 1 A LEU 148 ? CD1 ? C LEU 147 CD1 
49 1 Y 1 A LEU 148 ? CD2 ? C LEU 147 CD2 
50 1 Y 1 A LYS 149 ? CD  ? C LYS 148 CD  
51 1 Y 1 A LYS 149 ? CE  ? C LYS 148 CE  
52 1 Y 1 A LYS 149 ? NZ  ? C LYS 148 NZ  
53 1 Y 1 A LYS 197 ? CG  ? C LYS 196 CG  
54 1 Y 1 A LYS 197 ? CD  ? C LYS 196 CD  
55 1 Y 1 A LYS 197 ? CE  ? C LYS 196 CE  
56 1 Y 1 A LYS 197 ? NZ  ? C LYS 196 NZ  
57 1 Y 1 B LYS 38  ? CG  ? D LYS 37  CG  
58 1 Y 1 B LYS 38  ? CD  ? D LYS 37  CD  
59 1 Y 1 B LYS 38  ? CE  ? D LYS 37  CE  
60 1 Y 1 B LYS 38  ? NZ  ? D LYS 37  NZ  
61 1 Y 1 B GLU 57  ? CG  ? D GLU 56  CG  
62 1 Y 1 B GLU 57  ? CD  ? D GLU 56  CD  
63 1 Y 1 B GLU 57  ? OE1 ? D GLU 56  OE1 
64 1 Y 1 B GLU 57  ? OE2 ? D GLU 56  OE2 
65 1 Y 1 B LYS 119 ? CG  ? D LYS 118 CG  
66 1 Y 1 B LYS 119 ? CD  ? D LYS 118 CD  
67 1 Y 1 B LYS 119 ? CE  ? D LYS 118 CE  
68 1 Y 1 B LYS 119 ? NZ  ? D LYS 118 NZ  
69 1 Y 1 B ARG 140 ? CG  ? D ARG 139 CG  
70 1 Y 1 B ARG 140 ? CD  ? D ARG 139 CD  
71 1 Y 1 B ARG 140 ? NE  ? D ARG 139 NE  
72 1 Y 1 B ARG 140 ? CZ  ? D ARG 139 CZ  
73 1 Y 1 B ARG 140 ? NH1 ? D ARG 139 NH1 
74 1 Y 1 B ARG 140 ? NH2 ? D ARG 139 NH2 
75 1 Y 1 B LYS 203 ? CG  ? D LYS 202 CG  
76 1 Y 1 B LYS 203 ? CD  ? D LYS 202 CD  
77 1 Y 1 B LYS 203 ? CE  ? D LYS 202 CE  
78 1 Y 1 B LYS 203 ? NZ  ? D LYS 202 NZ  
79 1 Y 1 B LYS 245 ? CG  ? D LYS 244 CG  
80 1 Y 1 B LYS 245 ? CD  ? D LYS 244 CD  
81 1 Y 1 B LYS 245 ? CE  ? D LYS 244 CE  
82 1 Y 1 B LYS 245 ? NZ  ? D LYS 244 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 142 ? C ALA 141 
2  1 Y 1 A THR 143 ? C THR 142 
3  1 Y 1 A ARG 144 ? C ARG 143 
4  1 Y 1 A LYS 145 ? C LYS 144 
5  1 Y 1 B TYR 12  ? D TYR 11  
6  1 Y 1 B ASP 13  ? D ASP 12  
7  1 Y 1 B GLU 14  ? D GLU 13  
8  1 Y 1 B ASN 15  ? D ASN 14  
9  1 Y 1 B GLN 16  ? D GLN 15  
10 1 Y 1 B LYS 17  ? D LYS 16  
11 1 Y 1 B TYR 18  ? D TYR 17  
12 1 Y 1 B LYS 98  ? D LYS 97  
13 1 Y 1 B GLU 99  ? D GLU 98  
14 1 Y 1 B ASN 100 ? D ASN 99  
15 1 Y 1 B GLU 101 ? D GLU 100 
16 1 Y 1 B ALA 142 ? D ALA 141 
17 1 Y 1 B THR 143 ? D THR 142 
18 1 Y 1 B ARG 144 ? D ARG 143 
19 1 Y 1 B LYS 145 ? D LYS 144 
20 1 Y 1 B SER 146 ? D SER 145 
21 1 Y 1 B SER 147 ? D SER 146 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RV5 'double helix'        
1RV5 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 11 1_555 -0.716 -0.560 -0.285 -12.381 -9.121  6.653  1  C_DA2:DT11_D C 2  ? D 11 ? 20 1 
1 A DA 3  1_555 B DT 10 1_555 0.344  -0.123 0.373  4.246   -11.534 7.252  2  C_DA3:DT10_D C 3  ? D 10 ? 20 1 
1 A DG 4  1_555 B DC 9  1_555 0.191  -0.090 0.994  21.472  -7.599  0.936  3  C_DG4:DC9_D  C 4  ? D 9  ? 19 1 
1 A DA 5  1_555 B DT 8  1_555 -0.146 -0.012 0.640  8.418   3.920   1.533  4  C_DA5:DT8_D  C 5  ? D 8  ? 20 1 
1 A DT 6  1_555 B DA 7  1_555 -1.470 -0.167 -0.452 14.912  -13.846 7.227  5  C_DT6:DA7_D  C 6  ? D 7  ? 20 1 
1 A DA 7  1_555 B DT 6  1_555 1.006  -0.427 -0.267 -6.052  -7.574  -2.870 6  C_DA7:DT6_D  C 7  ? D 6  ? 20 1 
1 A DT 8  1_555 B DA 5  1_555 0.018  0.046  0.034  -2.295  -2.454  2.482  7  C_DT8:DA5_D  C 8  ? D 5  ? 20 1 
1 A DC 9  1_555 B DG 4  1_555 -0.177 -0.235 -0.046 -6.635  -14.415 2.317  8  C_DC9:DG4_D  C 9  ? D 4  ? 19 1 
1 A DT 10 1_555 B DA 3  1_555 -0.325 -0.106 -0.148 4.256   -13.176 6.792  9  C_DT10:DA3_D C 10 ? D 3  ? 20 1 
1 A DT 11 1_555 B DA 2  1_555 -0.227 -0.509 -0.219 12.041  -3.805  1.706  10 C_DT11:DA2_D C 11 ? D 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 11 1_555 A DA 3  1_555 B DT 10 1_555 0.227  0.630  2.927 -2.929 -4.682  34.558 1.669  -0.767 2.792 -7.819  
4.891  34.984 1 CC_DA2DA3:DT10DT11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 A DA 3  1_555 B DT 10 1_555 A DG 4  1_555 B DC 9  1_555 0.555  -0.265 3.058 -5.443 -0.385  31.862 -0.414 -1.885 2.929 -0.695  
9.824  32.314 2 CC_DA3DG4:DC9DT10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 A DG 4  1_555 B DC 9  1_555 A DA 5  1_555 B DT 8  1_555 -0.435 -0.983 3.646 0.304  -10.728 34.566 0.172  0.751  3.771 -17.539 
-0.498 36.145 3 CC_DG4DA5:DT8DC9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 A DA 5  1_555 B DT 8  1_555 A DT 6  1_555 B DA 7  1_555 -0.698 -1.468 3.548 -0.696 16.372  22.539 -6.788 1.294  2.050 36.350  
1.545  27.804 4 CC_DA5DT6:DA7DT8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 A DT 6  1_555 B DA 7  1_555 A DA 7  1_555 B DT 6  1_555 -0.164 -2.263 3.935 -1.410 20.083  35.485 -5.574 0.074  2.376 30.147  
2.117  40.637 5 CC_DT6DA7:DT6DA7_DD   C 6  ? D 7  ? C 7  ? D 6  ? 
1 A DA 7  1_555 B DT 6  1_555 A DT 8  1_555 B DA 5  1_555 0.833  -1.162 3.729 0.871  14.576  27.723 -5.091 -1.370 2.807 28.087  
-1.679 31.267 6 CC_DA7DT8:DA5DT6_DD   C 7  ? D 6  ? C 8  ? D 5  ? 
1 A DT 8  1_555 B DA 5  1_555 A DC 9  1_555 B DG 4  1_555 0.274  -0.538 3.586 4.428  -8.075  38.622 0.261  0.174  3.631 -12.002 
-6.581 39.664 7 CC_DT8DC9:DG4DA5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 A DC 9  1_555 B DG 4  1_555 A DT 10 1_555 B DA 3  1_555 -0.355 0.113  3.199 0.818  5.449   27.199 -1.053 0.933  3.149 11.437  
-1.718 27.741 8 CC_DC9DT10:DA3DG4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 A DT 10 1_555 B DA 3  1_555 A DT 11 1_555 B DA 2  1_555 -0.484 0.682  3.259 -2.307 7.695   25.986 -0.548 0.430  3.348 16.614  
4.981  27.178 9 CC_DT10DT11:DA2DA3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#