data_1RVA
# 
_entry.id   1RVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RVA         
RCSB  PDE014       
WWPDB D_1000176240 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RVA 
_pdbx_database_status.recvd_initial_deposition_date   1994-10-21 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kostrewa, D.'  1 
'Winkler, F.K.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Mg2+ binding to the active site of EcoRV endonuclease: a crystallographic study of complexes with substrate and product DNA at 2 A resolution.
;
Biochemistry           34 683  696 1995 BICHAW US 0006-2960 0033 ? 7819264 10.1021/bi00002a036 
1       'The Crystal Structure of EcoRV Endonuclease and of its Complexes with Cognate and Noncognate DNA Fragments' 'Embo J.' 12 
1781 ?   1993 EMJODG UK 0261-4189 0897 ? ?       ?                   
2       'Structure and Function of Restriction Endonucleases' Curr.Opin.Struct.Biol. 2  93   ?   1992 COSBEF UK 0959-440X 0801 ? ? 
?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kostrewa, D.'   1  
primary 'Winkler, F.K.'  2  
1       'Winkler, F.K.'  3  
1       'Banner, D.W.'   4  
1       'Oefner, C.'     5  
1       'Tsernoglou, D.' 6  
1       'Brown, R.S.'    7  
1       'Heathman, S.P.' 8  
1       'Bryan, R.K.'    9  
1       'Martin, P.D.'   10 
1       'Petratos, K.'   11 
1       'Wilson, K.S.'   12 
2       'Winkler, F.K.'  13 
# 
_cell.entry_id           1RVA 
_cell.length_a           49.440 
_cell.length_b           50.150 
_cell.length_c           63.950 
_cell.angle_alpha        96.54 
_cell.angle_beta         109.05 
_cell.angle_gamma        108.11 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RVA 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*AP*AP*AP*GP*AP*TP*AP*TP*CP*TP*T)-3')
;
3356.235  2   ? ? ? ? 
2 polymer man 'PROTEIN (ECO RV (E.C.3.1.21.4))'                 28559.158 2   ? ? ? ? 
3 water   nat water                                             18.015    266 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DG)(DA)(DT)(DA)(DT)(DC)(DT)(DT)' AAAGATATCTT C,D ? 
2 'polypeptide(L)'        no no 
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DT  n 
1 11  DT  n 
2 1   SER n 
2 2   LEU n 
2 3   ARG n 
2 4   SER n 
2 5   ASP n 
2 6   LEU n 
2 7   ILE n 
2 8   ASN n 
2 9   ALA n 
2 10  LEU n 
2 11  TYR n 
2 12  ASP n 
2 13  GLU n 
2 14  ASN n 
2 15  GLN n 
2 16  LYS n 
2 17  TYR n 
2 18  ASP n 
2 19  VAL n 
2 20  CYS n 
2 21  GLY n 
2 22  ILE n 
2 23  ILE n 
2 24  SER n 
2 25  ALA n 
2 26  GLU n 
2 27  GLY n 
2 28  LYS n 
2 29  ILE n 
2 30  TYR n 
2 31  PRO n 
2 32  LEU n 
2 33  GLY n 
2 34  SER n 
2 35  ASP n 
2 36  THR n 
2 37  LYS n 
2 38  VAL n 
2 39  LEU n 
2 40  SER n 
2 41  THR n 
2 42  ILE n 
2 43  PHE n 
2 44  GLU n 
2 45  LEU n 
2 46  PHE n 
2 47  SER n 
2 48  ARG n 
2 49  PRO n 
2 50  ILE n 
2 51  ILE n 
2 52  ASN n 
2 53  LYS n 
2 54  ILE n 
2 55  ALA n 
2 56  GLU n 
2 57  LYS n 
2 58  HIS n 
2 59  GLY n 
2 60  TYR n 
2 61  ILE n 
2 62  VAL n 
2 63  GLU n 
2 64  GLU n 
2 65  PRO n 
2 66  LYS n 
2 67  GLN n 
2 68  GLN n 
2 69  ASN n 
2 70  HIS n 
2 71  TYR n 
2 72  PRO n 
2 73  ASP n 
2 74  PHE n 
2 75  THR n 
2 76  LEU n 
2 77  TYR n 
2 78  LYS n 
2 79  PRO n 
2 80  SER n 
2 81  GLU n 
2 82  PRO n 
2 83  ASN n 
2 84  LYS n 
2 85  LYS n 
2 86  ILE n 
2 87  ALA n 
2 88  ILE n 
2 89  ASP n 
2 90  ILE n 
2 91  LYS n 
2 92  THR n 
2 93  THR n 
2 94  TYR n 
2 95  THR n 
2 96  ASN n 
2 97  LYS n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 LYS n 
2 102 ILE n 
2 103 LYS n 
2 104 PHE n 
2 105 THR n 
2 106 LEU n 
2 107 GLY n 
2 108 GLY n 
2 109 TYR n 
2 110 THR n 
2 111 SER n 
2 112 PHE n 
2 113 ILE n 
2 114 ARG n 
2 115 ASN n 
2 116 ASN n 
2 117 THR n 
2 118 LYS n 
2 119 ASN n 
2 120 ILE n 
2 121 VAL n 
2 122 TYR n 
2 123 PRO n 
2 124 PHE n 
2 125 ASP n 
2 126 GLN n 
2 127 TYR n 
2 128 ILE n 
2 129 ALA n 
2 130 HIS n 
2 131 TRP n 
2 132 ILE n 
2 133 ILE n 
2 134 GLY n 
2 135 TYR n 
2 136 VAL n 
2 137 TYR n 
2 138 THR n 
2 139 ARG n 
2 140 VAL n 
2 141 ALA n 
2 142 THR n 
2 143 ARG n 
2 144 LYS n 
2 145 SER n 
2 146 SER n 
2 147 LEU n 
2 148 LYS n 
2 149 THR n 
2 150 TYR n 
2 151 ASN n 
2 152 ILE n 
2 153 ASN n 
2 154 GLU n 
2 155 LEU n 
2 156 ASN n 
2 157 GLU n 
2 158 ILE n 
2 159 PRO n 
2 160 LYS n 
2 161 PRO n 
2 162 TYR n 
2 163 LYS n 
2 164 GLY n 
2 165 VAL n 
2 166 LYS n 
2 167 VAL n 
2 168 PHE n 
2 169 LEU n 
2 170 GLN n 
2 171 ASP n 
2 172 LYS n 
2 173 TRP n 
2 174 VAL n 
2 175 ILE n 
2 176 ALA n 
2 177 GLY n 
2 178 ASP n 
2 179 LEU n 
2 180 ALA n 
2 181 GLY n 
2 182 SER n 
2 183 GLY n 
2 184 ASN n 
2 185 THR n 
2 186 THR n 
2 187 ASN n 
2 188 ILE n 
2 189 GLY n 
2 190 SER n 
2 191 ILE n 
2 192 HIS n 
2 193 ALA n 
2 194 HIS n 
2 195 TYR n 
2 196 LYS n 
2 197 ASP n 
2 198 PHE n 
2 199 VAL n 
2 200 GLU n 
2 201 GLY n 
2 202 LYS n 
2 203 GLY n 
2 204 ILE n 
2 205 PHE n 
2 206 ASP n 
2 207 SER n 
2 208 GLU n 
2 209 ASP n 
2 210 GLU n 
2 211 PHE n 
2 212 LEU n 
2 213 ASP n 
2 214 TYR n 
2 215 TRP n 
2 216 ARG n 
2 217 ASN n 
2 218 TYR n 
2 219 GLU n 
2 220 ARG n 
2 221 THR n 
2 222 SER n 
2 223 GLN n 
2 224 LEU n 
2 225 ARG n 
2 226 ASN n 
2 227 ASP n 
2 228 LYS n 
2 229 TYR n 
2 230 ASN n 
2 231 ASN n 
2 232 ILE n 
2 233 SER n 
2 234 GLU n 
2 235 TYR n 
2 236 ARG n 
2 237 ASN n 
2 238 TRP n 
2 239 ILE n 
2 240 TYR n 
2 241 ARG n 
2 242 GLY n 
2 243 ARG n 
2 244 LYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E5_ECOLI 2 ? ? P04390 ? 
2 PDB 1RVA       1 ? ? 1RVA   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RVA A 1 ? 244 ? P04390 1 ? 244 ? 2 245 
2 1 1RVA B 1 ? 244 ? P04390 1 ? 244 ? 2 245 
3 2 1RVA C 1 ? 11  ? 1RVA   1 ? 11  ? 1 11  
4 2 1RVA D 1 ? 11  ? 1RVA   1 ? 11  ? 1 11  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   43.01 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 1RVA 
_refine.ls_number_reflns_obs                     33333 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.000 
_refine.ls_d_res_high                            2.000 
_refine.ls_percent_reflns_obs                    99.900 
_refine.ls_R_factor_obs                          0.1620000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1620000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4046 
_refine_hist.pdbx_number_atoms_nucleic_acid   446 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             266 
_refine_hist.number_atoms_total               4758 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.86  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RVA 
_struct.title                     
;MG2+ BINDING TO THE ACTIVE SITE OF ECO RV ENDONUCLEASE: A CRYSTALLOGRAPHIC STUDY OF COMPLEXES WITH SUBSTRATE AND PRODUCT DNA AT 2 ANGSTROMS RESOLUTION
;
_struct.pdbx_descriptor           'ECO RV (E.C.3.1.21.4)/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RVA 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER C 1   ? TYR C 17  ? SER A 2   TYR A 18  1 ? 17 
HELX_P HELX_P2  2  ASP C 35  ? HIS C 58  ? ASP A 36  HIS A 59  1 ? 24 
HELX_P HELX_P3  3  PRO C 123 ? ASP C 125 ? PRO A 124 ASP A 126 5 ? 3  
HELX_P HELX_P4  4  ARG C 143 ? LYS C 148 ? ARG A 144 LYS A 149 5 ? 6  
HELX_P HELX_P5  5  ASN C 151 ? ILE C 158 ? ASN A 152 ILE A 159 5 ? 8  
HELX_P HELX_P6  6  LYS C 172 ? ILE C 175 ? LYS A 173 ILE A 176 1 ? 4  
HELX_P HELX_P7  7  HIS C 194 ? GLY C 201 ? HIS A 195 GLY A 202 1 ? 8  
HELX_P HELX_P8  8  SER C 207 ? ASN C 217 ? SER A 208 ASN A 218 1 ? 11 
HELX_P HELX_P9  9  THR C 221 ? ASN C 226 ? THR A 222 ASN A 227 1 ? 6  
HELX_P HELX_P10 10 ASN C 231 ? ARG C 241 ? ASN A 232 ARG A 242 1 ? 11 
HELX_P HELX_P11 11 SER D 1   ? TYR D 17  ? SER B 2   TYR B 18  1 ? 17 
HELX_P HELX_P12 12 ASP D 35  ? HIS D 58  ? ASP B 36  HIS B 59  1 ? 24 
HELX_P HELX_P13 13 PRO D 123 ? ASP D 125 ? PRO B 124 ASP B 126 5 ? 3  
HELX_P HELX_P14 14 ASN D 153 ? ILE D 158 ? ASN B 154 ILE B 159 5 ? 6  
HELX_P HELX_P15 15 LYS D 172 ? ILE D 175 ? LYS B 173 ILE B 176 1 ? 4  
HELX_P HELX_P16 16 HIS D 194 ? GLY D 201 ? HIS B 195 GLY B 202 1 ? 8  
HELX_P HELX_P17 17 SER D 207 ? ASN D 217 ? SER B 208 ASN B 218 1 ? 11 
HELX_P HELX_P18 18 THR D 221 ? ASN D 226 ? THR B 222 ASN B 227 1 ? 6  
HELX_P HELX_P19 19 ASN D 231 ? ARG D 241 ? ASN B 232 ARG B 242 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 11 N3 ? ? C DA 2  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 2  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 10 N3 ? ? C DA 3  D DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 10 O4 ? ? C DA 3  D DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 9  N3 ? ? C DG 4  D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 9  O2 ? ? C DG 4  D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 9  N4 ? ? C DG 4  D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 8  N3 ? ? C DA 5  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 8  O4 ? ? C DA 5  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 7  N1 ? ? C DT 6  D DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 7  N6 ? ? C DT 6  D DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 6  N3 ? ? C DA 7  D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 6  O4 ? ? C DA 7  D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 8  D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 8  D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 4  N1 ? ? C DC 9  D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 4  O6 ? ? C DC 9  D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 4  N2 ? ? C DC 9  D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 3  N1 ? ? C DT 10 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 3  N6 ? ? C DT 10 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 2  N1 ? ? C DT 11 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 2  N6 ? ? C DT 11 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 71 C . ? TYR 72 A PRO 72 C ? PRO 73 A 1 -1.12 
2 TYR 71 D . ? TYR 72 B PRO 72 D ? PRO 73 B 1 -0.99 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 3 ? 
D ? 5 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 29  ? PRO C 31  ? ILE A 30  PRO A 32  
A 2 VAL C 19  ? SER C 24  ? VAL A 20  SER A 25  
A 3 VAL D 19  ? SER D 24  ? VAL B 20  SER B 25  
A 4 LYS D 28  ? PRO D 31  ? LYS B 29  PRO B 32  
A 5 TYR D 150 ? ASN D 151 ? TYR B 151 ASN B 152 
B 1 ILE C 61  ? GLU C 63  ? ILE A 62  GLU A 64  
B 2 PHE C 74  ? TYR C 77  ? PHE A 75  TYR A 78  
B 3 LYS C 85  ? THR C 95  ? LYS A 86  THR A 96  
B 4 TYR C 127 ? ARG C 139 ? TYR A 128 ARG A 140 
B 5 TYR C 162 ? ASP C 171 ? TYR A 163 ASP A 172 
C 1 THR C 105 ? GLY C 108 ? THR A 106 GLY A 109 
C 2 ASN C 187 ? SER C 190 ? ASN A 188 SER A 191 
C 3 ALA C 176 ? SER C 182 ? ALA A 177 SER A 183 
D 1 ILE D 61  ? GLU D 63  ? ILE B 62  GLU B 64  
D 2 PHE D 74  ? TYR D 77  ? PHE B 75  TYR B 78  
D 3 LYS D 85  ? THR D 95  ? LYS B 86  THR B 96  
D 4 TYR D 127 ? ARG D 139 ? TYR B 128 ARG B 140 
D 5 TYR D 162 ? ASP D 171 ? TYR B 163 ASP B 172 
E 1 THR D 105 ? GLY D 108 ? THR B 106 GLY B 109 
E 2 ASN D 187 ? SER D 190 ? ASN B 188 SER B 191 
E 3 ALA D 176 ? ALA D 180 ? ALA B 177 ALA B 181 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR C 30  ? N TYR A 31  O ILE C 22  ? O ILE A 23  
A 2 3 O ILE C 23  ? O ILE A 24  N CYS D 20  ? N CYS B 21  
A 3 4 N SER D 24  ? N SER B 25  O LYS D 28  ? O LYS B 29  
A 4 5 N ILE D 29  ? N ILE B 30  O TYR D 150 ? O TYR B 151 
B 1 2 O GLU C 63  ? O GLU A 64  N THR C 75  ? N THR A 76  
B 2 3 O LEU C 76  ? O LEU A 77  N ILE C 86  ? N ILE A 87  
B 3 4 O LYS C 85  ? O LYS A 86  N ILE C 128 ? N ILE A 129 
B 4 5 O THR C 138 ? O THR A 139 N LYS C 163 ? N LYS A 164 
C 1 2 N LEU C 106 ? N LEU A 107 O ILE C 188 ? O ILE A 189 
C 2 3 O GLY C 189 ? O GLY A 190 N GLY C 177 ? N GLY A 178 
D 1 2 O GLU D 63  ? O GLU B 64  N THR D 75  ? N THR B 76  
D 2 3 O LEU D 76  ? O LEU B 77  N ILE D 86  ? N ILE B 87  
D 3 4 O LYS D 85  ? O LYS B 86  N ILE D 128 ? N ILE B 129 
D 4 5 O THR D 138 ? O THR B 139 N LYS D 163 ? N LYS B 164 
E 1 2 O GLY D 107 ? O GLY B 108 N ILE D 188 ? N ILE B 189 
E 2 3 O GLY D 189 ? O GLY B 190 N GLY D 177 ? N GLY B 178 
# 
_database_PDB_matrix.entry_id          1RVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RVA 
_atom_sites.fract_transf_matrix[1][1]   0.020227 
_atom_sites.fract_transf_matrix[1][2]   0.006615 
_atom_sites.fract_transf_matrix[1][3]   0.008827 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020979 
_atom_sites.fract_transf_matrix[2][3]   0.005180 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017040 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO A 73' 
2 'CIS PROLINE - PRO B 73' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 0.680   -20.183 -12.234 1.00 63.57 ? 1   DA  C "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 0.272   -21.183 -13.204 1.00 64.42 ? 1   DA  C "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? -1.058  -21.915 -12.862 1.00 64.94 ? 1   DA  C "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? -0.934  -22.612 -11.591 1.00 65.58 ? 1   DA  C "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? -2.210  -20.921 -12.646 1.00 61.02 ? 1   DA  C "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? -3.461  -21.596 -12.820 1.00 52.91 ? 1   DA  C "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? -2.019  -20.597 -11.179 1.00 60.86 ? 1   DA  C "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? -1.825  -21.983 -10.641 1.00 59.77 ? 1   DA  C "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? -1.160  -22.074 -9.333  1.00 53.75 ? 1   DA  C N9    1 
ATOM   10   C C8    . DA  A 1 1   ? -1.713  -22.728 -8.249  1.00 52.45 ? 1   DA  C C8    1 
ATOM   11   N N7    . DA  A 1 1   ? -0.932  -22.722 -7.196  1.00 48.92 ? 1   DA  C N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 0.220   -22.019 -7.596  1.00 44.15 ? 1   DA  C C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 1.412   -21.690 -6.906  1.00 48.78 ? 1   DA  C C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 1.614   -22.068 -5.628  1.00 48.38 ? 1   DA  C N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 2.361   -20.989 -7.576  1.00 51.64 ? 1   DA  C N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 2.121   -20.651 -8.844  1.00 50.67 ? 1   DA  C C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 1.042   -20.905 -9.599  1.00 49.41 ? 1   DA  C N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 0.104   -21.610 -8.904  1.00 47.13 ? 1   DA  C C4    1 
ATOM   19   P P     . DA  A 1 2   ? -4.834  -20.739 -12.729 1.00 62.65 ? 2   DA  C P     1 
ATOM   20   O OP1   . DA  A 1 2   ? -5.873  -21.411 -13.570 1.00 63.96 ? 2   DA  C OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? -4.504  -19.287 -12.911 1.00 56.53 ? 2   DA  C OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? -5.253  -20.946 -11.184 1.00 56.58 ? 2   DA  C "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? -5.907  -22.103 -10.676 1.00 46.42 ? 2   DA  C "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? -6.213  -21.887 -9.196  1.00 37.32 ? 2   DA  C "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? -5.048  -21.437 -8.461  1.00 34.84 ? 2   DA  C "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? -7.268  -20.833 -9.062  1.00 33.73 ? 2   DA  C "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? -8.182  -21.460 -8.193  1.00 31.96 ? 2   DA  C "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? -6.535  -19.608 -8.502  1.00 31.80 ? 2   DA  C "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? -5.331  -20.183 -7.773  1.00 31.52 ? 2   DA  C "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? -4.054  -19.441 -7.905  1.00 30.43 ? 2   DA  C N9    1 
ATOM   31   C C8    . DA  A 1 2   ? -3.600  -18.639 -8.937  1.00 32.68 ? 2   DA  C C8    1 
ATOM   32   N N7    . DA  A 1 2   ? -2.382  -18.168 -8.762  1.00 33.64 ? 2   DA  C N7    1 
ATOM   33   C C5    . DA  A 1 2   ? -2.000  -18.693 -7.523  1.00 25.98 ? 2   DA  C C5    1 
ATOM   34   C C6    . DA  A 1 2   ? -0.823  -18.571 -6.773  1.00 26.94 ? 2   DA  C C6    1 
ATOM   35   N N6    . DA  A 1 2   ? 0.251   -17.878 -7.158  1.00 30.65 ? 2   DA  C N6    1 
ATOM   36   N N1    . DA  A 1 2   ? -0.791  -19.208 -5.609  1.00 30.18 ? 2   DA  C N1    1 
ATOM   37   C C2    . DA  A 1 2   ? -1.852  -19.923 -5.218  1.00 34.17 ? 2   DA  C C2    1 
ATOM   38   N N3    . DA  A 1 2   ? -3.007  -20.124 -5.817  1.00 31.05 ? 2   DA  C N3    1 
ATOM   39   C C4    . DA  A 1 2   ? -3.012  -19.463 -6.994  1.00 28.35 ? 2   DA  C C4    1 
ATOM   40   P P     . DA  A 1 3   ? -9.531  -20.790 -7.690  1.00 43.99 ? 3   DA  C P     1 
ATOM   41   O OP1   . DA  A 1 3   ? -10.537 -21.859 -7.448  1.00 40.97 ? 3   DA  C OP1   1 
ATOM   42   O OP2   . DA  A 1 3   ? -9.896  -19.668 -8.591  1.00 43.10 ? 3   DA  C OP2   1 
ATOM   43   O "O5'" . DA  A 1 3   ? -9.038  -20.181 -6.241  1.00 38.25 ? 3   DA  C "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3   ? -8.553  -21.060 -5.196  1.00 30.88 ? 3   DA  C "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3   ? -7.885  -20.285 -4.046  1.00 29.57 ? 3   DA  C "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3   ? -6.650  -19.670 -4.472  1.00 27.10 ? 3   DA  C "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3   ? -8.843  -19.156 -3.575  1.00 31.07 ? 3   DA  C "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3   ? -9.161  -19.501 -2.216  1.00 25.98 ? 3   DA  C "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3   ? -8.013  -17.875 -3.733  1.00 22.60 ? 3   DA  C "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3   ? -6.598  -18.384 -3.819  1.00 22.74 ? 3   DA  C "C1'" 1 
ATOM   51   N N9    . DA  A 1 3   ? -5.737  -17.565 -4.643  1.00 22.03 ? 3   DA  C N9    1 
ATOM   52   C C8    . DA  A 1 3   ? -5.996  -17.008 -5.868  1.00 19.75 ? 3   DA  C C8    1 
ATOM   53   N N7    . DA  A 1 3   ? -4.976  -16.342 -6.338  1.00 20.86 ? 3   DA  C N7    1 
ATOM   54   C C5    . DA  A 1 3   ? -3.981  -16.464 -5.365  1.00 15.58 ? 3   DA  C C5    1 
ATOM   55   C C6    . DA  A 1 3   ? -2.673  -15.977 -5.280  1.00 17.62 ? 3   DA  C C6    1 
ATOM   56   N N6    . DA  A 1 3   ? -2.106  -15.212 -6.225  1.00 21.05 ? 3   DA  C N6    1 
ATOM   57   N N1    . DA  A 1 3   ? -1.980  -16.292 -4.179  1.00 18.25 ? 3   DA  C N1    1 
ATOM   58   C C2    . DA  A 1 3   ? -2.532  -17.034 -3.218  1.00 18.29 ? 3   DA  C C2    1 
ATOM   59   N N3    . DA  A 1 3   ? -3.744  -17.543 -3.184  1.00 20.42 ? 3   DA  C N3    1 
ATOM   60   C C4    . DA  A 1 3   ? -4.435  -17.214 -4.314  1.00 21.03 ? 3   DA  C C4    1 
ATOM   61   P P     . DG  A 1 4   ? -10.119 -18.778 -1.203  1.00 27.39 ? 4   DG  C P     1 
ATOM   62   O OP1   . DG  A 1 4   ? -10.691 -19.855 -0.359  1.00 35.60 ? 4   DG  C OP1   1 
ATOM   63   O OP2   . DG  A 1 4   ? -11.040 -17.826 -1.848  1.00 25.44 ? 4   DG  C OP2   1 
ATOM   64   O "O5'" . DG  A 1 4   ? -9.036  -17.897 -0.373  1.00 20.96 ? 4   DG  C "O5'" 1 
ATOM   65   C "C5'" . DG  A 1 4   ? -7.959  -18.519 0.321   1.00 15.78 ? 4   DG  C "C5'" 1 
ATOM   66   C "C4'" . DG  A 1 4   ? -6.962  -17.511 0.818   1.00 18.35 ? 4   DG  C "C4'" 1 
ATOM   67   O "O4'" . DG  A 1 4   ? -6.247  -17.038 -0.331  1.00 19.20 ? 4   DG  C "O4'" 1 
ATOM   68   C "C3'" . DG  A 1 4   ? -7.618  -16.261 1.510   1.00 18.30 ? 4   DG  C "C3'" 1 
ATOM   69   O "O3'" . DG  A 1 4   ? -6.721  -15.832 2.513   1.00 17.51 ? 4   DG  C "O3'" 1 
ATOM   70   C "C2'" . DG  A 1 4   ? -7.637  -15.212 0.383   1.00 13.93 ? 4   DG  C "C2'" 1 
ATOM   71   C "C1'" . DG  A 1 4   ? -6.255  -15.592 -0.202  1.00 21.09 ? 4   DG  C "C1'" 1 
ATOM   72   N N9    . DG  A 1 4   ? -6.027  -14.881 -1.509  1.00 19.65 ? 4   DG  C N9    1 
ATOM   73   C C8    . DG  A 1 4   ? -6.901  -14.567 -2.525  1.00 16.29 ? 4   DG  C C8    1 
ATOM   74   N N7    . DG  A 1 4   ? -6.335  -13.894 -3.509  1.00 22.12 ? 4   DG  C N7    1 
ATOM   75   C C5    . DG  A 1 4   ? -4.996  -13.765 -3.096  1.00 17.23 ? 4   DG  C C5    1 
ATOM   76   C C6    . DG  A 1 4   ? -3.910  -13.137 -3.733  1.00 16.33 ? 4   DG  C C6    1 
ATOM   77   O O6    . DG  A 1 4   ? -3.931  -12.553 -4.808  1.00 15.54 ? 4   DG  C O6    1 
ATOM   78   N N1    . DG  A 1 4   ? -2.750  -13.242 -2.978  1.00 15.84 ? 4   DG  C N1    1 
ATOM   79   C C2    . DG  A 1 4   ? -2.647  -13.877 -1.751  1.00 14.68 ? 4   DG  C C2    1 
ATOM   80   N N2    . DG  A 1 4   ? -1.461  -13.917 -1.137  1.00 13.22 ? 4   DG  C N2    1 
ATOM   81   N N3    . DG  A 1 4   ? -3.671  -14.459 -1.163  1.00 13.47 ? 4   DG  C N3    1 
ATOM   82   C C4    . DG  A 1 4   ? -4.807  -14.368 -1.879  1.00 16.20 ? 4   DG  C C4    1 
ATOM   83   P P     . DA  A 1 5   ? -6.887  -16.217 4.086   1.00 16.77 ? 5   DA  C P     1 
ATOM   84   O OP1   . DA  A 1 5   ? -6.553  -17.623 4.146   1.00 18.63 ? 5   DA  C OP1   1 
ATOM   85   O OP2   . DA  A 1 5   ? -8.204  -15.723 4.502   1.00 14.30 ? 5   DA  C OP2   1 
ATOM   86   O "O5'" . DA  A 1 5   ? -5.633  -15.340 4.686   1.00 18.21 ? 5   DA  C "O5'" 1 
ATOM   87   C "C5'" . DA  A 1 5   ? -5.473  -13.889 4.599   1.00 20.00 ? 5   DA  C "C5'" 1 
ATOM   88   C "C4'" . DA  A 1 5   ? -4.004  -13.571 4.341   1.00 20.50 ? 5   DA  C "C4'" 1 
ATOM   89   O "O4'" . DA  A 1 5   ? -3.710  -13.839 2.990   1.00 19.08 ? 5   DA  C "O4'" 1 
ATOM   90   C "C3'" . DA  A 1 5   ? -3.661  -12.123 4.589   1.00 20.01 ? 5   DA  C "C3'" 1 
ATOM   91   O "O3'" . DA  A 1 5   ? -3.397  -12.034 5.993   1.00 22.51 ? 5   DA  C "O3'" 1 
ATOM   92   C "C2'" . DA  A 1 5   ? -2.401  -11.985 3.720   1.00 10.55 ? 5   DA  C "C2'" 1 
ATOM   93   C "C1'" . DA  A 1 5   ? -2.807  -12.816 2.524   1.00 19.88 ? 5   DA  C "C1'" 1 
ATOM   94   N N9    . DA  A 1 5   ? -3.612  -12.154 1.444   1.00 15.67 ? 5   DA  C N9    1 
ATOM   95   C C8    . DA  A 1 5   ? -4.942  -12.272 1.131   1.00 13.34 ? 5   DA  C C8    1 
ATOM   96   N N7    . DA  A 1 5   ? -5.323  -11.604 0.069   1.00 15.76 ? 5   DA  C N7    1 
ATOM   97   C C5    . DA  A 1 5   ? -4.141  -10.993 -0.349  1.00 14.31 ? 5   DA  C C5    1 
ATOM   98   C C6    . DA  A 1 5   ? -3.853  -10.136 -1.436  1.00 14.66 ? 5   DA  C C6    1 
ATOM   99   N N6    . DA  A 1 5   ? -4.788  -9.763  -2.351  1.00 13.46 ? 5   DA  C N6    1 
ATOM   100  N N1    . DA  A 1 5   ? -2.563  -9.718  -1.535  1.00 16.63 ? 5   DA  C N1    1 
ATOM   101  C C2    . DA  A 1 5   ? -1.616  -10.095 -0.659  1.00 16.00 ? 5   DA  C C2    1 
ATOM   102  N N3    . DA  A 1 5   ? -1.773  -10.899 0.394   1.00 19.84 ? 5   DA  C N3    1 
ATOM   103  C C4    . DA  A 1 5   ? -3.089  -11.317 0.486   1.00 16.48 ? 5   DA  C C4    1 
ATOM   104  P P     . DT  A 1 6   ? -3.567  -10.632 6.731   1.00 19.67 ? 6   DT  C P     1 
ATOM   105  O OP1   . DT  A 1 6   ? -3.268  -10.815 8.155   1.00 22.59 ? 6   DT  C OP1   1 
ATOM   106  O OP2   . DT  A 1 6   ? -4.847  -10.046 6.348   1.00 18.25 ? 6   DT  C OP2   1 
ATOM   107  O "O5'" . DT  A 1 6   ? -2.463  -9.728  6.047   1.00 22.11 ? 6   DT  C "O5'" 1 
ATOM   108  C "C5'" . DT  A 1 6   ? -1.041  -9.789  6.308   1.00 19.55 ? 6   DT  C "C5'" 1 
ATOM   109  C "C4'" . DT  A 1 6   ? -0.351  -8.664  5.542   1.00 18.73 ? 6   DT  C "C4'" 1 
ATOM   110  O "O4'" . DT  A 1 6   ? -0.555  -8.951  4.180   1.00 22.47 ? 6   DT  C "O4'" 1 
ATOM   111  C "C3'" . DT  A 1 6   ? -1.029  -7.294  5.651   1.00 19.90 ? 6   DT  C "C3'" 1 
ATOM   112  O "O3'" . DT  A 1 6   ? -0.541  -6.629  6.838   1.00 22.20 ? 6   DT  C "O3'" 1 
ATOM   113  C "C2'" . DT  A 1 6   ? -0.589  -6.614  4.384   1.00 21.25 ? 6   DT  C "C2'" 1 
ATOM   114  C "C1'" . DT  A 1 6   ? -0.636  -7.753  3.412   1.00 22.45 ? 6   DT  C "C1'" 1 
ATOM   115  N N1    . DT  A 1 6   ? -1.897  -7.712  2.612   1.00 22.00 ? 6   DT  C N1    1 
ATOM   116  C C2    . DT  A 1 6   ? -1.780  -7.044  1.412   1.00 25.28 ? 6   DT  C C2    1 
ATOM   117  O O2    . DT  A 1 6   ? -0.717  -6.551  1.048   1.00 24.67 ? 6   DT  C O2    1 
ATOM   118  N N3    . DT  A 1 6   ? -2.926  -6.963  0.639   1.00 20.54 ? 6   DT  C N3    1 
ATOM   119  C C4    . DT  A 1 6   ? -4.168  -7.493  0.968   1.00 19.29 ? 6   DT  C C4    1 
ATOM   120  O O4    . DT  A 1 6   ? -5.126  -7.356  0.213   1.00 18.41 ? 6   DT  C O4    1 
ATOM   121  C C5    . DT  A 1 6   ? -4.198  -8.174  2.231   1.00 16.72 ? 6   DT  C C5    1 
ATOM   122  C C7    . DT  A 1 6   ? -5.505  -8.799  2.670   1.00 19.47 ? 6   DT  C C7    1 
ATOM   123  C C6    . DT  A 1 6   ? -3.096  -8.262  2.995   1.00 18.60 ? 6   DT  C C6    1 
ATOM   124  P P     . DA  A 1 7   ? -1.518  -5.641  7.664   1.00 23.17 ? 7   DA  C P     1 
ATOM   125  O OP1   . DA  A 1 7   ? -0.791  -5.336  8.913   1.00 26.60 ? 7   DA  C OP1   1 
ATOM   126  O OP2   . DA  A 1 7   ? -2.890  -6.226  7.716   1.00 17.63 ? 7   DA  C OP2   1 
ATOM   127  O "O5'" . DA  A 1 7   ? -1.612  -4.333  6.752   1.00 29.13 ? 7   DA  C "O5'" 1 
ATOM   128  C "C5'" . DA  A 1 7   ? -0.520  -3.396  6.547   1.00 24.49 ? 7   DA  C "C5'" 1 
ATOM   129  C "C4'" . DA  A 1 7   ? -1.098  -2.173  5.876   1.00 19.17 ? 7   DA  C "C4'" 1 
ATOM   130  O "O4'" . DA  A 1 7   ? -1.645  -2.575  4.619   1.00 22.70 ? 7   DA  C "O4'" 1 
ATOM   131  C "C3'" . DA  A 1 7   ? -2.304  -1.614  6.612   1.00 19.69 ? 7   DA  C "C3'" 1 
ATOM   132  O "O3'" . DA  A 1 7   ? -2.064  -0.217  6.706   1.00 22.56 ? 7   DA  C "O3'" 1 
ATOM   133  C "C2'" . DA  A 1 7   ? -3.528  -1.941  5.744   1.00 15.69 ? 7   DA  C "C2'" 1 
ATOM   134  C "C1'" . DA  A 1 7   ? -2.922  -1.985  4.330   1.00 21.85 ? 7   DA  C "C1'" 1 
ATOM   135  N N9    . DA  A 1 7   ? -3.730  -2.873  3.432   1.00 25.10 ? 7   DA  C N9    1 
ATOM   136  C C8    . DA  A 1 7   ? -4.045  -4.194  3.615   1.00 24.07 ? 7   DA  C C8    1 
ATOM   137  N N7    . DA  A 1 7   ? -4.790  -4.695  2.674   1.00 21.96 ? 7   DA  C N7    1 
ATOM   138  C C5    . DA  A 1 7   ? -4.980  -3.645  1.809   1.00 21.49 ? 7   DA  C C5    1 
ATOM   139  C C6    . DA  A 1 7   ? -5.689  -3.543  0.609   1.00 18.88 ? 7   DA  C C6    1 
ATOM   140  N N6    . DA  A 1 7   ? -6.334  -4.559  0.089   1.00 20.22 ? 7   DA  C N6    1 
ATOM   141  N N1    . DA  A 1 7   ? -5.706  -2.376  -0.027  1.00 23.20 ? 7   DA  C N1    1 
ATOM   142  C C2    . DA  A 1 7   ? -5.033  -1.360  0.527   1.00 24.91 ? 7   DA  C C2    1 
ATOM   143  N N3    . DA  A 1 7   ? -4.322  -1.327  1.657   1.00 24.06 ? 7   DA  C N3    1 
ATOM   144  C C4    . DA  A 1 7   ? -4.337  -2.526  2.260   1.00 22.72 ? 7   DA  C C4    1 
ATOM   145  P P     . DT  A 1 8   ? -3.068  0.811   7.404   1.00 20.35 ? 8   DT  C P     1 
ATOM   146  O OP1   . DT  A 1 8   ? -2.153  1.926   7.778   1.00 17.16 ? 8   DT  C OP1   1 
ATOM   147  O OP2   . DT  A 1 8   ? -3.893  0.113   8.405   1.00 18.98 ? 8   DT  C OP2   1 
ATOM   148  O "O5'" . DT  A 1 8   ? -4.148  1.293   6.295   1.00 23.71 ? 8   DT  C "O5'" 1 
ATOM   149  C "C5'" . DT  A 1 8   ? -3.850  2.122   5.160   1.00 18.31 ? 8   DT  C "C5'" 1 
ATOM   150  C "C4'" . DT  A 1 8   ? -5.088  2.333   4.292   1.00 15.98 ? 8   DT  C "C4'" 1 
ATOM   151  O "O4'" . DT  A 1 8   ? -5.492  1.068   3.772   1.00 15.53 ? 8   DT  C "O4'" 1 
ATOM   152  C "C3'" . DT  A 1 8   ? -6.276  2.855   5.055   1.00 16.66 ? 8   DT  C "C3'" 1 
ATOM   153  O "O3'" . DT  A 1 8   ? -6.314  4.224   4.669   1.00 17.56 ? 8   DT  C "O3'" 1 
ATOM   154  C "C2'" . DT  A 1 8   ? -7.449  2.005   4.592   1.00 12.70 ? 8   DT  C "C2'" 1 
ATOM   155  C "C1'" . DT  A 1 8   ? -6.845  1.281   3.436   1.00 10.63 ? 8   DT  C "C1'" 1 
ATOM   156  N N1    . DT  A 1 8   ? -7.374  -0.061  3.158   1.00 15.86 ? 8   DT  C N1    1 
ATOM   157  C C2    . DT  A 1 8   ? -8.082  -0.202  1.944   1.00 22.60 ? 8   DT  C C2    1 
ATOM   158  O O2    . DT  A 1 8   ? -8.246  0.718   1.129   1.00 22.13 ? 8   DT  C O2    1 
ATOM   159  N N3    . DT  A 1 8   ? -8.579  -1.468  1.693   1.00 13.75 ? 8   DT  C N3    1 
ATOM   160  C C4    . DT  A 1 8   ? -8.425  -2.568  2.526   1.00 18.23 ? 8   DT  C C4    1 
ATOM   161  O O4    . DT  A 1 8   ? -8.917  -3.624  2.176   1.00 16.91 ? 8   DT  C O4    1 
ATOM   162  C C5    . DT  A 1 8   ? -7.678  -2.344  3.760   1.00 22.05 ? 8   DT  C C5    1 
ATOM   163  C C7    . DT  A 1 8   ? -7.416  -3.493  4.776   1.00 13.42 ? 8   DT  C C7    1 
ATOM   164  C C6    . DT  A 1 8   ? -7.190  -1.118  4.026   1.00 20.40 ? 8   DT  C C6    1 
ATOM   165  P P     . DC  A 1 9   ? -7.505  5.286   4.770   1.00 19.21 ? 9   DC  C P     1 
ATOM   166  O OP1   . DC  A 1 9   ? -6.817  6.560   4.739   1.00 18.78 ? 9   DC  C OP1   1 
ATOM   167  O OP2   . DC  A 1 9   ? -8.358  5.012   5.937   1.00 20.35 ? 9   DC  C OP2   1 
ATOM   168  O "O5'" . DC  A 1 9   ? -8.447  5.169   3.502   1.00 22.24 ? 9   DC  C "O5'" 1 
ATOM   169  C "C5'" . DC  A 1 9   ? -7.922  5.402   2.176   1.00 19.04 ? 9   DC  C "C5'" 1 
ATOM   170  C "C4'" . DC  A 1 9   ? -8.951  5.010   1.131   1.00 19.03 ? 9   DC  C "C4'" 1 
ATOM   171  O "O4'" . DC  A 1 9   ? -9.206  3.635   1.244   1.00 15.61 ? 9   DC  C "O4'" 1 
ATOM   172  C "C3'" . DC  A 1 9   ? -10.242 5.768   1.300   1.00 18.79 ? 9   DC  C "C3'" 1 
ATOM   173  O "O3'" . DC  A 1 9   ? -10.327 6.602   0.170   1.00 21.04 ? 9   DC  C "O3'" 1 
ATOM   174  C "C2'" . DC  A 1 9   ? -11.290 4.730   1.339   1.00 19.59 ? 9   DC  C "C2'" 1 
ATOM   175  C "C1'" . DC  A 1 9   ? -10.576 3.478   0.907   1.00 19.08 ? 9   DC  C "C1'" 1 
ATOM   176  N N1    . DC  A 1 9   ? -11.071 2.274   1.606   1.00 19.01 ? 9   DC  C N1    1 
ATOM   177  C C2    . DC  A 1 9   ? -11.840 1.381   0.865   1.00 18.74 ? 9   DC  C C2    1 
ATOM   178  O O2    . DC  A 1 9   ? -12.108 1.586   -0.319  1.00 19.24 ? 9   DC  C O2    1 
ATOM   179  N N3    . DC  A 1 9   ? -12.306 0.239   1.485   1.00 14.62 ? 9   DC  C N3    1 
ATOM   180  C C4    . DC  A 1 9   ? -12.036 -0.026  2.777   1.00 19.35 ? 9   DC  C C4    1 
ATOM   181  N N4    . DC  A 1 9   ? -12.530 -1.151  3.304   1.00 17.48 ? 9   DC  C N4    1 
ATOM   182  C C5    . DC  A 1 9   ? -11.233 0.898   3.564   1.00 19.45 ? 9   DC  C C5    1 
ATOM   183  C C6    . DC  A 1 9   ? -10.783 2.020   2.939   1.00 17.06 ? 9   DC  C C6    1 
ATOM   184  P P     . DT  A 1 10  ? -11.425 7.759   0.060   1.00 26.92 ? 10  DT  C P     1 
ATOM   185  O OP1   . DT  A 1 10  ? -10.823 8.780   -0.827  1.00 31.32 ? 10  DT  C OP1   1 
ATOM   186  O OP2   . DT  A 1 10  ? -11.971 8.065   1.377   1.00 26.31 ? 10  DT  C OP2   1 
ATOM   187  O "O5'" . DT  A 1 10  ? -12.627 7.039   -0.706  1.00 27.47 ? 10  DT  C "O5'" 1 
ATOM   188  C "C5'" . DT  A 1 10  ? -12.383 6.364   -1.919  1.00 25.08 ? 10  DT  C "C5'" 1 
ATOM   189  C "C4'" . DT  A 1 10  ? -13.666 5.785   -2.422  1.00 27.03 ? 10  DT  C "C4'" 1 
ATOM   190  O "O4'" . DT  A 1 10  ? -13.937 4.645   -1.679  1.00 24.48 ? 10  DT  C "O4'" 1 
ATOM   191  C "C3'" . DT  A 1 10  ? -14.860 6.732   -2.251  1.00 32.85 ? 10  DT  C "C3'" 1 
ATOM   192  O "O3'" . DT  A 1 10  ? -15.570 6.729   -3.526  1.00 48.30 ? 10  DT  C "O3'" 1 
ATOM   193  C "C2'" . DT  A 1 10  ? -15.664 6.123   -1.131  1.00 27.93 ? 10  DT  C "C2'" 1 
ATOM   194  C "C1'" . DT  A 1 10  ? -15.328 4.655   -1.308  1.00 20.53 ? 10  DT  C "C1'" 1 
ATOM   195  N N1    . DT  A 1 10  ? -15.298 3.803   -0.116  1.00 24.13 ? 10  DT  C N1    1 
ATOM   196  C C2    . DT  A 1 10  ? -15.759 2.493   -0.245  1.00 21.34 ? 10  DT  C C2    1 
ATOM   197  O O2    . DT  A 1 10  ? -16.197 2.028   -1.294  1.00 23.88 ? 10  DT  C O2    1 
ATOM   198  N N3    . DT  A 1 10  ? -15.689 1.712   0.909   1.00 21.34 ? 10  DT  C N3    1 
ATOM   199  C C4    . DT  A 1 10  ? -15.204 2.146   2.134   1.00 19.72 ? 10  DT  C C4    1 
ATOM   200  O O4    . DT  A 1 10  ? -15.204 1.357   3.042   1.00 25.25 ? 10  DT  C O4    1 
ATOM   201  C C5    . DT  A 1 10  ? -14.737 3.524   2.199   1.00 22.02 ? 10  DT  C C5    1 
ATOM   202  C C7    . DT  A 1 10  ? -14.160 4.125   3.503   1.00 21.01 ? 10  DT  C C7    1 
ATOM   203  C C6    . DT  A 1 10  ? -14.800 4.293   1.093   1.00 23.51 ? 10  DT  C C6    1 
ATOM   204  P P     . DT  A 1 11  ? -16.603 7.917   -3.994  1.00 55.47 ? 11  DT  C P     1 
ATOM   205  O OP1   . DT  A 1 11  ? -16.148 8.245   -5.381  1.00 51.76 ? 11  DT  C OP1   1 
ATOM   206  O OP2   . DT  A 1 11  ? -16.728 8.985   -2.938  1.00 52.18 ? 11  DT  C OP2   1 
ATOM   207  O "O5'" . DT  A 1 11  ? -18.042 7.119   -3.998  1.00 55.87 ? 11  DT  C "O5'" 1 
ATOM   208  C "C5'" . DT  A 1 11  ? -18.329 5.925   -4.757  1.00 55.38 ? 11  DT  C "C5'" 1 
ATOM   209  C "C4'" . DT  A 1 11  ? -19.516 5.077   -4.177  1.00 59.79 ? 11  DT  C "C4'" 1 
ATOM   210  O "O4'" . DT  A 1 11  ? -19.147 4.517   -2.894  1.00 55.60 ? 11  DT  C "O4'" 1 
ATOM   211  C "C3'" . DT  A 1 11  ? -20.799 5.942   -3.879  1.00 62.16 ? 11  DT  C "C3'" 1 
ATOM   212  O "O3'" . DT  A 1 11  ? -21.948 5.172   -4.386  1.00 66.54 ? 11  DT  C "O3'" 1 
ATOM   213  C "C2'" . DT  A 1 11  ? -20.810 6.074   -2.316  1.00 53.47 ? 11  DT  C "C2'" 1 
ATOM   214  C "C1'" . DT  A 1 11  ? -20.274 4.673   -1.971  1.00 51.63 ? 11  DT  C "C1'" 1 
ATOM   215  N N1    . DT  A 1 11  ? -19.689 4.456   -0.596  1.00 42.63 ? 11  DT  C N1    1 
ATOM   216  C C2    . DT  A 1 11  ? -19.674 3.135   -0.108  1.00 35.75 ? 11  DT  C C2    1 
ATOM   217  O O2    . DT  A 1 11  ? -20.107 2.143   -0.701  1.00 35.22 ? 11  DT  C O2    1 
ATOM   218  N N3    . DT  A 1 11  ? -19.126 2.956   1.136   1.00 34.70 ? 11  DT  C N3    1 
ATOM   219  C C4    . DT  A 1 11  ? -18.595 3.937   1.940   1.00 35.57 ? 11  DT  C C4    1 
ATOM   220  O O4    . DT  A 1 11  ? -18.149 3.597   3.039   1.00 39.91 ? 11  DT  C O4    1 
ATOM   221  C C5    . DT  A 1 11  ? -18.643 5.278   1.374   1.00 35.54 ? 11  DT  C C5    1 
ATOM   222  C C7    . DT  A 1 11  ? -18.088 6.500   2.134   1.00 41.42 ? 11  DT  C C7    1 
ATOM   223  C C6    . DT  A 1 11  ? -19.175 5.482   0.158   1.00 42.37 ? 11  DT  C C6    1 
ATOM   224  O "O5'" . DA  B 1 1   ? -21.741 0.794   8.577   1.00 47.17 ? 1   DA  D "O5'" 1 
ATOM   225  C "C5'" . DA  B 1 1   ? -23.040 0.352   9.090   1.00 42.03 ? 1   DA  D "C5'" 1 
ATOM   226  C "C4'" . DA  B 1 1   ? -23.685 -0.861  8.332   1.00 38.68 ? 1   DA  D "C4'" 1 
ATOM   227  O "O4'" . DA  B 1 1   ? -24.115 -0.482  7.014   1.00 32.45 ? 1   DA  D "O4'" 1 
ATOM   228  C "C3'" . DA  B 1 1   ? -22.628 -1.992  8.111   1.00 36.49 ? 1   DA  D "C3'" 1 
ATOM   229  O "O3'" . DA  B 1 1   ? -23.326 -3.243  8.066   1.00 31.59 ? 1   DA  D "O3'" 1 
ATOM   230  C "C2'" . DA  B 1 1   ? -22.038 -1.641  6.744   1.00 30.66 ? 1   DA  D "C2'" 1 
ATOM   231  C "C1'" . DA  B 1 1   ? -23.325 -1.207  6.046   1.00 32.51 ? 1   DA  D "C1'" 1 
ATOM   232  N N9    . DA  B 1 1   ? -23.187 -0.261  4.910   1.00 30.22 ? 1   DA  D N9    1 
ATOM   233  C C8    . DA  B 1 1   ? -23.783 -0.390  3.664   1.00 30.45 ? 1   DA  D C8    1 
ATOM   234  N N7    . DA  B 1 1   ? -23.540 0.609   2.852   1.00 31.59 ? 1   DA  D N7    1 
ATOM   235  C C5    . DA  B 1 1   ? -22.732 1.453   3.599   1.00 29.59 ? 1   DA  D C5    1 
ATOM   236  C C6    . DA  B 1 1   ? -22.144 2.689   3.292   1.00 33.84 ? 1   DA  D C6    1 
ATOM   237  N N6    . DA  B 1 1   ? -22.319 3.298   2.118   1.00 37.96 ? 1   DA  D N6    1 
ATOM   238  N N1    . DA  B 1 1   ? -21.399 3.260   4.260   1.00 35.61 ? 1   DA  D N1    1 
ATOM   239  C C2    . DA  B 1 1   ? -21.245 2.661   5.449   1.00 27.38 ? 1   DA  D C2    1 
ATOM   240  N N3    . DA  B 1 1   ? -21.747 1.504   5.861   1.00 25.75 ? 1   DA  D N3    1 
ATOM   241  C C4    . DA  B 1 1   ? -22.498 0.942   4.862   1.00 27.53 ? 1   DA  D C4    1 
ATOM   242  P P     . DA  B 1 2   ? -22.593 -4.676  7.959   1.00 36.83 ? 2   DA  D P     1 
ATOM   243  O OP1   . DA  B 1 2   ? -23.592 -5.542  8.622   1.00 34.90 ? 2   DA  D OP1   1 
ATOM   244  O OP2   . DA  B 1 2   ? -21.175 -4.555  8.419   1.00 32.52 ? 2   DA  D OP2   1 
ATOM   245  O "O5'" . DA  B 1 2   ? -22.544 -5.010  6.326   1.00 29.68 ? 2   DA  D "O5'" 1 
ATOM   246  C "C5'" . DA  B 1 2   ? -23.749 -5.119  5.558   1.00 24.48 ? 2   DA  D "C5'" 1 
ATOM   247  C "C4'" . DA  B 1 2   ? -23.496 -5.163  4.051   1.00 26.36 ? 2   DA  D "C4'" 1 
ATOM   248  O "O4'" . DA  B 1 2   ? -22.841 -3.984  3.586   1.00 24.92 ? 2   DA  D "O4'" 1 
ATOM   249  C "C3'" . DA  B 1 2   ? -22.566 -6.313  3.716   1.00 25.93 ? 2   DA  D "C3'" 1 
ATOM   250  O "O3'" . DA  B 1 2   ? -23.130 -6.923  2.539   1.00 21.98 ? 2   DA  D "O3'" 1 
ATOM   251  C "C2'" . DA  B 1 2   ? -21.191 -5.708  3.469   1.00 24.19 ? 2   DA  D "C2'" 1 
ATOM   252  C "C1'" . DA  B 1 2   ? -21.551 -4.308  2.978   1.00 27.32 ? 2   DA  D "C1'" 1 
ATOM   253  N N9    . DA  B 1 2   ? -20.637 -3.213  3.442   1.00 30.43 ? 2   DA  D N9    1 
ATOM   254  C C8    . DA  B 1 2   ? -19.876 -3.133  4.593   1.00 27.28 ? 2   DA  D C8    1 
ATOM   255  N N7    . DA  B 1 2   ? -19.217 -2.009  4.727   1.00 27.76 ? 2   DA  D N7    1 
ATOM   256  C C5    . DA  B 1 2   ? -19.551 -1.284  3.592   1.00 24.69 ? 2   DA  D C5    1 
ATOM   257  C C6    . DA  B 1 2   ? -19.174 0.006   3.139   1.00 29.94 ? 2   DA  D C6    1 
ATOM   258  N N6    . DA  B 1 2   ? -18.347 0.817   3.821   1.00 26.17 ? 2   DA  D N6    1 
ATOM   259  N N1    . DA  B 1 2   ? -19.698 0.407   1.961   1.00 27.24 ? 2   DA  D N1    1 
ATOM   260  C C2    . DA  B 1 2   ? -20.525 -0.404  1.295   1.00 27.17 ? 2   DA  D C2    1 
ATOM   261  N N3    . DA  B 1 2   ? -20.947 -1.616  1.614   1.00 22.81 ? 2   DA  D N3    1 
ATOM   262  C C4    . DA  B 1 2   ? -20.415 -2.005  2.795   1.00 29.44 ? 2   DA  D C4    1 
ATOM   263  P P     . DA  B 1 3   ? -22.620 -8.242  1.846   1.00 24.61 ? 3   DA  D P     1 
ATOM   264  O OP1   . DA  B 1 3   ? -23.827 -8.888  1.241   1.00 26.50 ? 3   DA  D OP1   1 
ATOM   265  O OP2   . DA  B 1 3   ? -21.723 -9.034  2.721   1.00 22.49 ? 3   DA  D OP2   1 
ATOM   266  O "O5'" . DA  B 1 3   ? -21.694 -7.687  0.612   1.00 26.77 ? 3   DA  D "O5'" 1 
ATOM   267  C "C5'" . DA  B 1 3   ? -22.247 -6.956  -0.536  1.00 21.71 ? 3   DA  D "C5'" 1 
ATOM   268  C "C4'" . DA  B 1 3   ? -21.142 -6.180  -1.196  1.00 21.74 ? 3   DA  D "C4'" 1 
ATOM   269  O "O4'" . DA  B 1 3   ? -20.529 -5.258  -0.294  1.00 21.41 ? 3   DA  D "O4'" 1 
ATOM   270  C "C3'" . DA  B 1 3   ? -20.042 -7.141  -1.576  1.00 21.43 ? 3   DA  D "C3'" 1 
ATOM   271  O "O3'" . DA  B 1 3   ? -20.247 -7.207  -2.964  1.00 27.39 ? 3   DA  D "O3'" 1 
ATOM   272  C "C2'" . DA  B 1 3   ? -18.729 -6.543  -1.120  1.00 20.55 ? 3   DA  D "C2'" 1 
ATOM   273  C "C1'" . DA  B 1 3   ? -19.212 -5.162  -0.781  1.00 19.74 ? 3   DA  D "C1'" 1 
ATOM   274  N N9    . DA  B 1 3   ? -18.467 -4.533  0.275   1.00 22.61 ? 3   DA  D N9    1 
ATOM   275  C C8    . DA  B 1 3   ? -18.108 -5.064  1.469   1.00 21.35 ? 3   DA  D C8    1 
ATOM   276  N N7    . DA  B 1 3   ? -17.427 -4.242  2.212   1.00 21.13 ? 3   DA  D N7    1 
ATOM   277  C C5    . DA  B 1 3   ? -17.324 -3.075  1.455   1.00 21.57 ? 3   DA  D C5    1 
ATOM   278  C C6    . DA  B 1 3   ? -16.712 -1.827  1.692   1.00 20.86 ? 3   DA  D C6    1 
ATOM   279  N N6    . DA  B 1 3   ? -16.039 -1.535  2.810   1.00 17.30 ? 3   DA  D N6    1 
ATOM   280  N N1    . DA  B 1 3   ? -16.810 -0.901  0.721   1.00 19.48 ? 3   DA  D N1    1 
ATOM   281  C C2    . DA  B 1 3   ? -17.456 -1.175  -0.400  1.00 21.20 ? 3   DA  D C2    1 
ATOM   282  N N3    . DA  B 1 3   ? -18.061 -2.297  -0.734  1.00 21.36 ? 3   DA  D N3    1 
ATOM   283  C C4    . DA  B 1 3   ? -17.960 -3.232  0.257   1.00 22.83 ? 3   DA  D C4    1 
ATOM   284  P P     . DG  B 1 4   ? -19.372 -7.958  -4.058  1.00 25.99 ? 4   DG  D P     1 
ATOM   285  O OP1   . DG  B 1 4   ? -20.383 -8.296  -5.107  1.00 34.32 ? 4   DG  D OP1   1 
ATOM   286  O OP2   . DG  B 1 4   ? -18.564 -9.013  -3.435  1.00 22.40 ? 4   DG  D OP2   1 
ATOM   287  O "O5'" . DG  B 1 4   ? -18.291 -6.869  -4.612  1.00 24.82 ? 4   DG  D "O5'" 1 
ATOM   288  C "C5'" . DG  B 1 4   ? -18.662 -5.602  -5.188  1.00 18.21 ? 4   DG  D "C5'" 1 
ATOM   289  C "C4'" . DG  B 1 4   ? -17.467 -4.683  -5.176  1.00 19.52 ? 4   DG  D "C4'" 1 
ATOM   290  O "O4'" . DG  B 1 4   ? -17.106 -4.434  -3.777  1.00 16.46 ? 4   DG  D "O4'" 1 
ATOM   291  C "C3'" . DG  B 1 4   ? -16.195 -5.331  -5.801  1.00 16.80 ? 4   DG  D "C3'" 1 
ATOM   292  O "O3'" . DG  B 1 4   ? -15.505 -4.362  -6.572  1.00 20.00 ? 4   DG  D "O3'" 1 
ATOM   293  C "C2'" . DG  B 1 4   ? -15.282 -5.665  -4.589  1.00 20.56 ? 4   DG  D "C2'" 1 
ATOM   294  C "C1'" . DG  B 1 4   ? -15.707 -4.467  -3.752  1.00 18.24 ? 4   DG  D "C1'" 1 
ATOM   295  N N9    . DG  B 1 4   ? -15.252 -4.576  -2.384  1.00 22.10 ? 4   DG  D N9    1 
ATOM   296  C C8    . DG  B 1 4   ? -15.221 -5.654  -1.528  1.00 22.70 ? 4   DG  D C8    1 
ATOM   297  N N7    . DG  B 1 4   ? -14.692 -5.363  -0.372  1.00 15.12 ? 4   DG  D N7    1 
ATOM   298  C C5    . DG  B 1 4   ? -14.359 -3.992  -0.486  1.00 21.58 ? 4   DG  D C5    1 
ATOM   299  C C6    . DG  B 1 4   ? -13.743 -3.076  0.445   1.00 19.36 ? 4   DG  D C6    1 
ATOM   300  O O6    . DG  B 1 4   ? -13.343 -3.296  1.577   1.00 16.00 ? 4   DG  D O6    1 
ATOM   301  N N1    . DG  B 1 4   ? -13.595 -1.786  -0.080  1.00 12.83 ? 4   DG  D N1    1 
ATOM   302  C C2    . DG  B 1 4   ? -13.980 -1.398  -1.334  1.00 18.41 ? 4   DG  D C2    1 
ATOM   303  N N2    . DG  B 1 4   ? -13.757 -0.116  -1.650  1.00 13.80 ? 4   DG  D N2    1 
ATOM   304  N N3    . DG  B 1 4   ? -14.550 -2.248  -2.207  1.00 16.64 ? 4   DG  D N3    1 
ATOM   305  C C4    . DG  B 1 4   ? -14.706 -3.514  -1.720  1.00 19.56 ? 4   DG  D C4    1 
ATOM   306  P P     . DA  B 1 5   ? -15.578 -4.257  -8.193  1.00 16.02 ? 5   DA  D P     1 
ATOM   307  O OP1   . DA  B 1 5   ? -16.918 -3.786  -8.505  1.00 16.21 ? 5   DA  D OP1   1 
ATOM   308  O OP2   . DA  B 1 5   ? -14.989 -5.513  -8.700  1.00 15.93 ? 5   DA  D OP2   1 
ATOM   309  O "O5'" . DA  B 1 5   ? -14.514 -3.075  -8.370  1.00 14.97 ? 5   DA  D "O5'" 1 
ATOM   310  C "C5'" . DA  B 1 5   ? -13.132 -3.171  -8.059  1.00 12.82 ? 5   DA  D "C5'" 1 
ATOM   311  C "C4'" . DA  B 1 5   ? -12.717 -1.777  -7.487  1.00 13.50 ? 5   DA  D "C4'" 1 
ATOM   312  O "O4'" . DA  B 1 5   ? -13.208 -1.579  -6.194  1.00 18.32 ? 5   DA  D "O4'" 1 
ATOM   313  C "C3'" . DA  B 1 5   ? -11.211 -1.667  -7.380  1.00 14.72 ? 5   DA  D "C3'" 1 
ATOM   314  O "O3'" . DA  B 1 5   ? -10.804 -1.161  -8.663  1.00 17.68 ? 5   DA  D "O3'" 1 
ATOM   315  C "C2'" . DA  B 1 5   ? -10.968 -0.690  -6.250  1.00 12.16 ? 5   DA  D "C2'" 1 
ATOM   316  C "C1'" . DA  B 1 5   ? -12.152 -1.007  -5.370  1.00 16.80 ? 5   DA  D "C1'" 1 
ATOM   317  N N9    . DA  B 1 5   ? -11.804 -2.004  -4.280  1.00 22.52 ? 5   DA  D N9    1 
ATOM   318  C C8    . DA  B 1 5   ? -12.146 -3.340  -4.197  1.00 21.19 ? 5   DA  D C8    1 
ATOM   319  N N7    . DA  B 1 5   ? -11.742 -3.943  -3.123  1.00 22.36 ? 5   DA  D N7    1 
ATOM   320  C C5    . DA  B 1 5   ? -11.072 -2.950  -2.419  1.00 19.13 ? 5   DA  D C5    1 
ATOM   321  C C6    . DA  B 1 5   ? -10.416 -2.975  -1.182  1.00 18.10 ? 5   DA  D C6    1 
ATOM   322  N N6    . DA  B 1 5   ? -10.354 -4.079  -0.400  1.00 11.57 ? 5   DA  D N6    1 
ATOM   323  N N1    . DA  B 1 5   ? -9.865  -1.805  -0.806  1.00 17.76 ? 5   DA  D N1    1 
ATOM   324  C C2    . DA  B 1 5   ? -9.940  -0.699  -1.554  1.00 20.29 ? 5   DA  D C2    1 
ATOM   325  N N3    . DA  B 1 5   ? -10.534 -0.553  -2.733  1.00 17.99 ? 5   DA  D N3    1 
ATOM   326  C C4    . DA  B 1 5   ? -11.093 -1.751  -3.110  1.00 23.22 ? 5   DA  D C4    1 
ATOM   327  P P     . DT  B 1 6   ? -9.312  -1.379  -9.183  1.00 19.38 ? 6   DT  D P     1 
ATOM   328  O OP1   . DT  B 1 6   ? -9.280  -0.846  -10.563 1.00 23.41 ? 6   DT  D OP1   1 
ATOM   329  O OP2   . DT  B 1 6   ? -8.824  -2.772  -8.918  1.00 18.40 ? 6   DT  D OP2   1 
ATOM   330  O "O5'" . DT  B 1 6   ? -8.374  -0.448  -8.224  1.00 23.40 ? 6   DT  D "O5'" 1 
ATOM   331  C "C5'" . DT  B 1 6   ? -8.252  0.985   -8.328  1.00 20.37 ? 6   DT  D "C5'" 1 
ATOM   332  C "C4'" . DT  B 1 6   ? -7.259  1.432   -7.234  1.00 21.74 ? 6   DT  D "C4'" 1 
ATOM   333  O "O4'" . DT  B 1 6   ? -7.806  1.093   -5.961  1.00 18.06 ? 6   DT  D "O4'" 1 
ATOM   334  C "C3'" . DT  B 1 6   ? -5.965  0.625   -7.221  1.00 19.91 ? 6   DT  D "C3'" 1 
ATOM   335  O "O3'" . DT  B 1 6   ? -5.114  1.157   -8.243  1.00 23.67 ? 6   DT  D "O3'" 1 
ATOM   336  C "C2'" . DT  B 1 6   ? -5.453  0.867   -5.844  1.00 17.94 ? 6   DT  D "C2'" 1 
ATOM   337  C "C1'" . DT  B 1 6   ? -6.760  0.817   -5.051  1.00 17.32 ? 6   DT  D "C1'" 1 
ATOM   338  N N1    . DT  B 1 6   ? -6.991  -0.536  -4.440  1.00 27.01 ? 6   DT  D N1    1 
ATOM   339  C C2    . DT  B 1 6   ? -6.522  -0.708  -3.114  1.00 22.55 ? 6   DT  D C2    1 
ATOM   340  O O2    . DT  B 1 6   ? -5.961  0.163   -2.441  1.00 21.40 ? 6   DT  D O2    1 
ATOM   341  N N3    . DT  B 1 6   ? -6.724  -1.958  -2.590  1.00 20.88 ? 6   DT  D N3    1 
ATOM   342  C C4    . DT  B 1 6   ? -7.333  -3.058  -3.214  1.00 20.29 ? 6   DT  D C4    1 
ATOM   343  O O4    . DT  B 1 6   ? -7.425  -4.131  -2.618  1.00 17.13 ? 6   DT  D O4    1 
ATOM   344  C C5    . DT  B 1 6   ? -7.794  -2.816  -4.563  1.00 19.90 ? 6   DT  D C5    1 
ATOM   345  C C7    . DT  B 1 6   ? -8.472  -3.955  -5.320  1.00 15.74 ? 6   DT  D C7    1 
ATOM   346  C C6    . DT  B 1 6   ? -7.615  -1.591  -5.127  1.00 18.97 ? 6   DT  D C6    1 
ATOM   347  P P     . DA  B 1 7   ? -4.058  0.266   -9.072  1.00 22.64 ? 7   DA  D P     1 
ATOM   348  O OP1   . DA  B 1 7   ? -3.471  1.170   -10.135 1.00 28.81 ? 7   DA  D OP1   1 
ATOM   349  O OP2   . DA  B 1 7   ? -4.785  -0.965  -9.521  1.00 32.34 ? 7   DA  D OP2   1 
ATOM   350  O "O5'" . DA  B 1 7   ? -3.012  -0.145  -7.935  1.00 22.73 ? 7   DA  D "O5'" 1 
ATOM   351  C "C5'" . DA  B 1 7   ? -2.092  0.765   -7.303  1.00 20.78 ? 7   DA  D "C5'" 1 
ATOM   352  C "C4'" . DA  B 1 7   ? -1.040  0.079   -6.461  1.00 17.46 ? 7   DA  D "C4'" 1 
ATOM   353  O "O4'" . DA  B 1 7   ? -1.699  -0.578  -5.366  1.00 22.50 ? 7   DA  D "O4'" 1 
ATOM   354  C "C3'" . DA  B 1 7   ? -0.288  -1.019  -7.234  1.00 19.01 ? 7   DA  D "C3'" 1 
ATOM   355  O "O3'" . DA  B 1 7   ? 1.095   -1.007  -6.851  1.00 19.92 ? 7   DA  D "O3'" 1 
ATOM   356  C "C2'" . DA  B 1 7   ? -0.921  -2.343  -6.753  1.00 22.90 ? 7   DA  D "C2'" 1 
ATOM   357  C "C1'" . DA  B 1 7   ? -1.247  -1.961  -5.274  1.00 23.04 ? 7   DA  D "C1'" 1 
ATOM   358  N N9    . DA  B 1 7   ? -2.357  -2.821  -4.743  1.00 20.29 ? 7   DA  D N9    1 
ATOM   359  C C8    . DA  B 1 7   ? -3.617  -2.914  -5.227  1.00 17.57 ? 7   DA  D C8    1 
ATOM   360  N N7    . DA  B 1 7   ? -4.365  -3.740  -4.570  1.00 18.04 ? 7   DA  D N7    1 
ATOM   361  C C5    . DA  B 1 7   ? -3.558  -4.242  -3.575  1.00 19.49 ? 7   DA  D C5    1 
ATOM   362  C C6    . DA  B 1 7   ? -3.796  -5.186  -2.535  1.00 15.67 ? 7   DA  D C6    1 
ATOM   363  N N6    . DA  B 1 7   ? -4.974  -5.799  -2.363  1.00 20.94 ? 7   DA  D N6    1 
ATOM   364  N N1    . DA  B 1 7   ? -2.772  -5.448  -1.725  1.00 19.72 ? 7   DA  D N1    1 
ATOM   365  C C2    . DA  B 1 7   ? -1.598  -4.838  -1.913  1.00 19.99 ? 7   DA  D C2    1 
ATOM   366  N N3    . DA  B 1 7   ? -1.252  -3.943  -2.844  1.00 24.24 ? 7   DA  D N3    1 
ATOM   367  C C4    . DA  B 1 7   ? -2.311  -3.683  -3.666  1.00 19.87 ? 7   DA  D C4    1 
ATOM   368  P P     . DT  B 1 8   ? 2.159   -1.985  -7.561  1.00 23.19 ? 8   DT  D P     1 
ATOM   369  O OP1   . DT  B 1 8   ? 3.409   -1.204  -7.511  1.00 21.94 ? 8   DT  D OP1   1 
ATOM   370  O OP2   . DT  B 1 8   ? 1.615   -2.506  -8.819  1.00 19.95 ? 8   DT  D OP2   1 
ATOM   371  O "O5'" . DT  B 1 8   ? 2.329   -3.326  -6.658  1.00 25.30 ? 8   DT  D "O5'" 1 
ATOM   372  C "C5'" . DT  B 1 8   ? 2.956   -3.349  -5.361  1.00 20.18 ? 8   DT  D "C5'" 1 
ATOM   373  C "C4'" . DT  B 1 8   ? 2.890   -4.760  -4.777  1.00 15.02 ? 8   DT  D "C4'" 1 
ATOM   374  O "O4'" . DT  B 1 8   ? 1.524   -5.115  -4.585  1.00 16.67 ? 8   DT  D "O4'" 1 
ATOM   375  C "C3'" . DT  B 1 8   ? 3.421   -5.815  -5.707  1.00 18.11 ? 8   DT  D "C3'" 1 
ATOM   376  O "O3'" . DT  B 1 8   ? 4.613   -6.140  -5.040  1.00 17.02 ? 8   DT  D "O3'" 1 
ATOM   377  C "C2'" . DT  B 1 8   ? 2.351   -6.901  -5.786  1.00 18.98 ? 8   DT  D "C2'" 1 
ATOM   378  C "C1'" . DT  B 1 8   ? 1.508   -6.538  -4.581  1.00 15.01 ? 8   DT  D "C1'" 1 
ATOM   379  N N1    . DT  B 1 8   ? 0.067   -6.893  -4.644  1.00 20.66 ? 8   DT  D N1    1 
ATOM   380  C C2    . DT  B 1 8   ? -0.415  -7.733  -3.632  1.00 19.71 ? 8   DT  D C2    1 
ATOM   381  O O2    . DT  B 1 8   ? 0.278   -8.137  -2.726  1.00 17.80 ? 8   DT  D O2    1 
ATOM   382  N N3    . DT  B 1 8   ? -1.743  -8.081  -3.681  1.00 13.43 ? 8   DT  D N3    1 
ATOM   383  C C4    . DT  B 1 8   ? -2.659  -7.662  -4.657  1.00 17.35 ? 8   DT  D C4    1 
ATOM   384  O O4    . DT  B 1 8   ? -3.834  -8.038  -4.591  1.00 19.58 ? 8   DT  D O4    1 
ATOM   385  C C5    . DT  B 1 8   ? -2.093  -6.783  -5.683  1.00 17.83 ? 8   DT  D C5    1 
ATOM   386  C C7    . DT  B 1 8   ? -2.989  -6.239  -6.808  1.00 12.77 ? 8   DT  D C7    1 
ATOM   387  C C6    . DT  B 1 8   ? -0.781  -6.434  -5.649  1.00 19.35 ? 8   DT  D C6    1 
ATOM   388  P P     . DC  B 1 9   ? 5.643   -7.291  -5.277  1.00 18.43 ? 9   DC  D P     1 
ATOM   389  O OP1   . DC  B 1 9   ? 6.972   -6.762  -4.979  1.00 19.41 ? 9   DC  D OP1   1 
ATOM   390  O OP2   . DC  B 1 9   ? 5.436   -7.929  -6.605  1.00 25.02 ? 9   DC  D OP2   1 
ATOM   391  O "O5'" . DC  B 1 9   ? 5.188   -8.339  -4.157  1.00 26.49 ? 9   DC  D "O5'" 1 
ATOM   392  C "C5'" . DC  B 1 9   ? 5.152   -8.105  -2.731  1.00 22.52 ? 9   DC  D "C5'" 1 
ATOM   393  C "C4'" . DC  B 1 9   ? 4.513   -9.270  -2.060  1.00 21.37 ? 9   DC  D "C4'" 1 
ATOM   394  O "O4'" . DC  B 1 9   ? 3.193   -9.406  -2.529  1.00 24.83 ? 9   DC  D "O4'" 1 
ATOM   395  C "C3'" . DC  B 1 9   ? 5.206   -10.533 -2.416  1.00 23.06 ? 9   DC  D "C3'" 1 
ATOM   396  O "O3'" . DC  B 1 9   ? 5.879   -10.999 -1.244  1.00 26.03 ? 9   DC  D "O3'" 1 
ATOM   397  C "C2'" . DC  B 1 9   ? 4.105   -11.452 -2.864  1.00 23.67 ? 9   DC  D "C2'" 1 
ATOM   398  C "C1'" . DC  B 1 9   ? 2.843   -10.773 -2.473  1.00 25.41 ? 9   DC  D "C1'" 1 
ATOM   399  N N1    . DC  B 1 9   ? 1.729   -10.987 -3.437  1.00 23.94 ? 9   DC  D N1    1 
ATOM   400  C C2    . DC  B 1 9   ? 0.635   -11.734 -3.007  1.00 21.64 ? 9   DC  D C2    1 
ATOM   401  O O2    . DC  B 1 9   ? 0.585   -12.229 -1.878  1.00 24.51 ? 9   DC  D O2    1 
ATOM   402  N N3    . DC  B 1 9   ? -0.393  -11.926 -3.879  1.00 17.89 ? 9   DC  D N3    1 
ATOM   403  C C4    . DC  B 1 9   ? -0.353  -11.414 -5.122  1.00 19.62 ? 9   DC  D C4    1 
ATOM   404  N N4    . DC  B 1 9   ? -1.395  -11.647 -5.929  1.00 18.43 ? 9   DC  D N4    1 
ATOM   405  C C5    . DC  B 1 9   ? 0.772   -10.642 -5.586  1.00 19.30 ? 9   DC  D C5    1 
ATOM   406  C C6    . DC  B 1 9   ? 1.782   -10.453 -4.716  1.00 22.30 ? 9   DC  D C6    1 
ATOM   407  P P     . DT  B 1 10  ? 6.906   -12.284 -1.285  1.00 30.54 ? 10  DT  D P     1 
ATOM   408  O OP1   . DT  B 1 10  ? 8.044   -11.972 -0.411  1.00 34.61 ? 10  DT  D OP1   1 
ATOM   409  O OP2   . DT  B 1 10  ? 7.111   -12.752 -2.668  1.00 27.80 ? 10  DT  D OP2   1 
ATOM   410  O "O5'" . DT  B 1 10  ? 5.981   -13.436 -0.613  1.00 32.59 ? 10  DT  D "O5'" 1 
ATOM   411  C "C5'" . DT  B 1 10  ? 5.093   -13.250 0.514   1.00 32.49 ? 10  DT  D "C5'" 1 
ATOM   412  C "C4'" . DT  B 1 10  ? 4.155   -14.440 0.695   1.00 33.86 ? 10  DT  D "C4'" 1 
ATOM   413  O "O4'" . DT  B 1 10  ? 3.116   -14.507 -0.275  1.00 32.19 ? 10  DT  D "O4'" 1 
ATOM   414  C "C3'" . DT  B 1 10  ? 4.949   -15.719 0.458   1.00 35.62 ? 10  DT  D "C3'" 1 
ATOM   415  O "O3'" . DT  B 1 10  ? 4.632   -16.560 1.567   1.00 51.53 ? 10  DT  D "O3'" 1 
ATOM   416  C "C2'" . DT  B 1 10  ? 4.502   -16.312 -0.868  1.00 29.26 ? 10  DT  D "C2'" 1 
ATOM   417  C "C1'" . DT  B 1 10  ? 3.075   -15.815 -0.891  1.00 23.78 ? 10  DT  D "C1'" 1 
ATOM   418  N N1    . DT  B 1 10  ? 2.501   -15.529 -2.215  1.00 25.82 ? 10  DT  D N1    1 
ATOM   419  C C2    . DT  B 1 10  ? 1.172   -15.868 -2.412  1.00 25.54 ? 10  DT  D C2    1 
ATOM   420  O O2    . DT  B 1 10  ? 0.486   -16.406 -1.549  1.00 24.66 ? 10  DT  D O2    1 
ATOM   421  N N3    . DT  B 1 10  ? 0.645   -15.554 -3.666  1.00 23.99 ? 10  DT  D N3    1 
ATOM   422  C C4    . DT  B 1 10  ? 1.307   -14.947 -4.718  1.00 25.06 ? 10  DT  D C4    1 
ATOM   423  O O4    . DT  B 1 10  ? 0.689   -14.715 -5.754  1.00 31.33 ? 10  DT  D O4    1 
ATOM   424  C C5    . DT  B 1 10  ? 2.697   -14.625 -4.442  1.00 28.98 ? 10  DT  D C5    1 
ATOM   425  C C7    . DT  B 1 10  ? 3.584   -13.946 -5.525  1.00 31.00 ? 10  DT  D C7    1 
ATOM   426  C C6    . DT  B 1 10  ? 3.236   -14.922 -3.225  1.00 25.84 ? 10  DT  D C6    1 
ATOM   427  P P     . DT  B 1 11  ? 5.474   -17.883 2.016   1.00 56.06 ? 11  DT  D P     1 
ATOM   428  O OP1   . DT  B 1 11  ? 5.762   -17.644 3.466   1.00 51.95 ? 11  DT  D OP1   1 
ATOM   429  O OP2   . DT  B 1 11  ? 6.541   -18.216 0.992   1.00 50.91 ? 11  DT  D OP2   1 
ATOM   430  O "O5'" . DT  B 1 11  ? 4.309   -18.982 1.893   1.00 53.64 ? 11  DT  D "O5'" 1 
ATOM   431  C "C5'" . DT  B 1 11  ? 3.031   -18.884 2.556   1.00 60.62 ? 11  DT  D "C5'" 1 
ATOM   432  C "C4'" . DT  B 1 11  ? 2.080   -19.805 1.810   1.00 68.85 ? 11  DT  D "C4'" 1 
ATOM   433  O "O4'" . DT  B 1 11  ? 1.795   -19.310 0.469   1.00 67.32 ? 11  DT  D "O4'" 1 
ATOM   434  C "C3'" . DT  B 1 11  ? 2.803   -21.191 1.623   1.00 74.20 ? 11  DT  D "C3'" 1 
ATOM   435  O "O3'" . DT  B 1 11  ? 1.835   -22.212 1.991   1.00 80.54 ? 11  DT  D "O3'" 1 
ATOM   436  C "C2'" . DT  B 1 11  ? 3.186   -21.213 0.100   1.00 68.11 ? 11  DT  D "C2'" 1 
ATOM   437  C "C1'" . DT  B 1 11  ? 1.982   -20.406 -0.461  1.00 62.37 ? 11  DT  D "C1'" 1 
ATOM   438  N N1    . DT  B 1 11  ? 2.186   -19.790 -1.823  1.00 54.22 ? 11  DT  D N1    1 
ATOM   439  C C2    . DT  B 1 11  ? 1.025   -19.614 -2.603  1.00 49.62 ? 11  DT  D C2    1 
ATOM   440  O O2    . DT  B 1 11  ? -0.115  -19.933 -2.234  1.00 47.49 ? 11  DT  D O2    1 
ATOM   441  N N3    . DT  B 1 11  ? 1.226   -19.040 -3.858  1.00 40.59 ? 11  DT  D N3    1 
ATOM   442  C C4    . DT  B 1 11  ? 2.437   -18.635 -4.395  1.00 40.46 ? 11  DT  D C4    1 
ATOM   443  O O4    . DT  B 1 11  ? 2.459   -18.140 -5.523  1.00 41.58 ? 11  DT  D O4    1 
ATOM   444  C C5    . DT  B 1 11  ? 3.590   -18.845 -3.532  1.00 42.52 ? 11  DT  D C5    1 
ATOM   445  C C7    . DT  B 1 11  ? 5.015   -18.417 -4.012  1.00 44.74 ? 11  DT  D C7    1 
ATOM   446  C C6    . DT  B 1 11  ? 3.433   -19.405 -2.301  1.00 50.42 ? 11  DT  D C6    1 
ATOM   447  N N     . SER C 2 1   ? 7.045   2.966   32.280  1.00 26.33 ? 2   SER A N     1 
ATOM   448  C CA    . SER C 2 1   ? 7.014   1.612   31.656  1.00 26.86 ? 2   SER A CA    1 
ATOM   449  C C     . SER C 2 1   ? 7.441   1.766   30.206  1.00 28.10 ? 2   SER A C     1 
ATOM   450  O O     . SER C 2 1   ? 7.636   2.894   29.733  1.00 28.68 ? 2   SER A O     1 
ATOM   451  C CB    . SER C 2 1   ? 5.587   1.049   31.698  1.00 26.86 ? 2   SER A CB    1 
ATOM   452  O OG    . SER C 2 1   ? 4.655   1.934   31.086  1.00 28.12 ? 2   SER A OG    1 
ATOM   453  N N     . LEU C 2 2   ? 7.586   0.641   29.510  1.00 28.66 ? 3   LEU A N     1 
ATOM   454  C CA    . LEU C 2 2   ? 7.945   0.637   28.093  1.00 27.83 ? 3   LEU A CA    1 
ATOM   455  C C     . LEU C 2 2   ? 6.848   1.411   27.356  1.00 25.76 ? 3   LEU A C     1 
ATOM   456  O O     . LEU C 2 2   ? 7.116   2.285   26.535  1.00 25.38 ? 3   LEU A O     1 
ATOM   457  C CB    . LEU C 2 2   ? 7.995   -0.804  27.576  1.00 26.73 ? 3   LEU A CB    1 
ATOM   458  C CG    . LEU C 2 2   ? 8.088   -1.032  26.065  1.00 32.26 ? 3   LEU A CG    1 
ATOM   459  C CD1   . LEU C 2 2   ? 9.477   -0.679  25.569  1.00 33.52 ? 3   LEU A CD1   1 
ATOM   460  C CD2   . LEU C 2 2   ? 7.781   -2.479  25.756  1.00 27.17 ? 3   LEU A CD2   1 
ATOM   461  N N     . ARG C 2 3   ? 5.607   1.085   27.688  1.00 24.81 ? 4   ARG A N     1 
ATOM   462  C CA    . ARG C 2 3   ? 4.450   1.708   27.076  1.00 25.89 ? 4   ARG A CA    1 
ATOM   463  C C     . ARG C 2 3   ? 4.356   3.221   27.280  1.00 25.84 ? 4   ARG A C     1 
ATOM   464  O O     . ARG C 2 3   ? 4.144   3.951   26.310  1.00 24.94 ? 4   ARG A O     1 
ATOM   465  C CB    . ARG C 2 3   ? 3.185   1.014   27.572  1.00 25.70 ? 4   ARG A CB    1 
ATOM   466  C CG    . ARG C 2 3   ? 1.920   1.516   26.955  1.00 28.42 ? 4   ARG A CG    1 
ATOM   467  C CD    . ARG C 2 3   ? 0.755   0.705   27.435  1.00 24.51 ? 4   ARG A CD    1 
ATOM   468  N NE    . ARG C 2 3   ? -0.505  1.235   26.933  1.00 25.57 ? 4   ARG A NE    1 
ATOM   469  C CZ    . ARG C 2 3   ? -1.488  0.472   26.474  1.00 23.70 ? 4   ARG A CZ    1 
ATOM   470  N NH1   . ARG C 2 3   ? -1.349  -0.847  26.449  1.00 28.15 ? 4   ARG A NH1   1 
ATOM   471  N NH2   . ARG C 2 3   ? -2.604  1.025   26.041  1.00 21.88 ? 4   ARG A NH2   1 
ATOM   472  N N     . SER C 2 4   ? 4.511   3.698   28.518  1.00 24.46 ? 5   SER A N     1 
ATOM   473  C CA    . SER C 2 4   ? 4.425   5.142   28.788  1.00 25.72 ? 5   SER A CA    1 
ATOM   474  C C     . SER C 2 4   ? 5.539   5.907   28.067  1.00 23.28 ? 5   SER A C     1 
ATOM   475  O O     . SER C 2 4   ? 5.309   6.986   27.511  1.00 24.07 ? 5   SER A O     1 
ATOM   476  C CB    . SER C 2 4   ? 4.470   5.431   30.305  1.00 24.18 ? 5   SER A CB    1 
ATOM   477  O OG    . SER C 2 4   ? 5.719   5.058   30.888  1.00 33.80 ? 5   SER A OG    1 
ATOM   478  N N     . ASP C 2 5   ? 6.741   5.336   28.080  1.00 23.17 ? 6   ASP A N     1 
ATOM   479  C CA    . ASP C 2 5   ? 7.898   5.936   27.426  1.00 24.92 ? 6   ASP A CA    1 
ATOM   480  C C     . ASP C 2 5   ? 7.735   5.978   25.909  1.00 24.65 ? 6   ASP A C     1 
ATOM   481  O O     . ASP C 2 5   ? 8.066   6.978   25.264  1.00 25.73 ? 6   ASP A O     1 
ATOM   482  C CB    . ASP C 2 5   ? 9.169   5.158   27.774  1.00 27.44 ? 6   ASP A CB    1 
ATOM   483  C CG    . ASP C 2 5   ? 9.723   5.517   29.141  1.00 30.88 ? 6   ASP A CG    1 
ATOM   484  O OD1   . ASP C 2 5   ? 9.256   6.502   29.747  1.00 29.73 ? 6   ASP A OD1   1 
ATOM   485  O OD2   . ASP C 2 5   ? 10.632  4.805   29.602  1.00 31.22 ? 6   ASP A OD2   1 
ATOM   486  N N     . LEU C 2 6   ? 7.231   4.886   25.346  1.00 23.68 ? 7   LEU A N     1 
ATOM   487  C CA    . LEU C 2 6   ? 7.022   4.806   23.912  1.00 24.36 ? 7   LEU A CA    1 
ATOM   488  C C     . LEU C 2 6   ? 6.046   5.892   23.454  1.00 23.69 ? 7   LEU A C     1 
ATOM   489  O O     . LEU C 2 6   ? 6.334   6.623   22.504  1.00 25.19 ? 7   LEU A O     1 
ATOM   490  C CB    . LEU C 2 6   ? 6.500   3.416   23.527  1.00 24.74 ? 7   LEU A CB    1 
ATOM   491  C CG    . LEU C 2 6   ? 6.318   3.151   22.037  1.00 28.49 ? 7   LEU A CG    1 
ATOM   492  C CD1   . LEU C 2 6   ? 7.614   3.444   21.293  1.00 26.68 ? 7   LEU A CD1   1 
ATOM   493  C CD2   . LEU C 2 6   ? 5.891   1.710   21.844  1.00 25.24 ? 7   LEU A CD2   1 
ATOM   494  N N     . ILE C 2 7   ? 4.901   6.018   24.121  1.00 23.50 ? 8   ILE A N     1 
ATOM   495  C CA    . ILE C 2 7   ? 3.943   7.037   23.715  1.00 26.46 ? 8   ILE A CA    1 
ATOM   496  C C     . ILE C 2 7   ? 4.458   8.466   23.956  1.00 24.77 ? 8   ILE A C     1 
ATOM   497  O O     . ILE C 2 7   ? 4.155   9.373   23.178  1.00 26.50 ? 8   ILE A O     1 
ATOM   498  C CB    . ILE C 2 7   ? 2.530   6.818   24.343  1.00 31.87 ? 8   ILE A CB    1 
ATOM   499  C CG1   . ILE C 2 7   ? 1.518   7.738   23.653  1.00 42.94 ? 8   ILE A CG1   1 
ATOM   500  C CG2   . ILE C 2 7   ? 2.538   7.113   25.823  1.00 31.87 ? 8   ILE A CG2   1 
ATOM   501  C CD1   . ILE C 2 7   ? 1.544   7.672   22.117  1.00 40.89 ? 8   ILE A CD1   1 
ATOM   502  N N     . ASN C 2 8   ? 5.239   8.670   25.012  1.00 23.15 ? 9   ASN A N     1 
ATOM   503  C CA    . ASN C 2 8   ? 5.794   10.000  25.274  1.00 21.84 ? 9   ASN A CA    1 
ATOM   504  C C     . ASN C 2 8   ? 6.764   10.361  24.151  1.00 19.42 ? 9   ASN A C     1 
ATOM   505  O O     . ASN C 2 8   ? 6.775   11.500  23.676  1.00 17.20 ? 9   ASN A O     1 
ATOM   506  C CB    . ASN C 2 8   ? 6.536   10.049  26.614  1.00 22.40 ? 9   ASN A CB    1 
ATOM   507  C CG    . ASN C 2 8   ? 5.622   10.368  27.788  1.00 28.69 ? 9   ASN A CG    1 
ATOM   508  O OD1   . ASN C 2 8   ? 4.394   10.334  27.676  1.00 25.80 ? 9   ASN A OD1   1 
ATOM   509  N ND2   . ASN C 2 8   ? 6.222   10.685  28.922  1.00 27.16 ? 9   ASN A ND2   1 
ATOM   510  N N     . ALA C 2 9   ? 7.571   9.388   23.731  1.00 19.14 ? 10  ALA A N     1 
ATOM   511  C CA    . ALA C 2 9   ? 8.545   9.594   22.658  1.00 22.53 ? 10  ALA A CA    1 
ATOM   512  C C     . ALA C 2 9   ? 7.871   9.867   21.303  1.00 24.47 ? 10  ALA A C     1 
ATOM   513  O O     . ALA C 2 9   ? 8.296   10.767  20.562  1.00 26.87 ? 10  ALA A O     1 
ATOM   514  C CB    . ALA C 2 9   ? 9.479   8.396   22.555  1.00 14.66 ? 10  ALA A CB    1 
ATOM   515  N N     . LEU C 2 10  ? 6.824   9.101   20.985  1.00 24.17 ? 11  LEU A N     1 
ATOM   516  C CA    . LEU C 2 10  ? 6.095   9.273   19.724  1.00 24.28 ? 11  LEU A CA    1 
ATOM   517  C C     . LEU C 2 10  ? 5.423   10.643  19.682  1.00 24.63 ? 11  LEU A C     1 
ATOM   518  O O     . LEU C 2 10  ? 5.509   11.356  18.679  1.00 23.29 ? 11  LEU A O     1 
ATOM   519  C CB    . LEU C 2 10  ? 5.039   8.165   19.540  1.00 25.15 ? 11  LEU A CB    1 
ATOM   520  C CG    . LEU C 2 10  ? 5.533   6.724   19.313  1.00 26.65 ? 11  LEU A CG    1 
ATOM   521  C CD1   . LEU C 2 10  ? 4.358   5.768   19.375  1.00 26.98 ? 11  LEU A CD1   1 
ATOM   522  C CD2   . LEU C 2 10  ? 6.254   6.604   17.982  1.00 26.71 ? 11  LEU A CD2   1 
ATOM   523  N N     . TYR C 2 11  ? 4.762   11.006  20.777  1.00 24.64 ? 12  TYR A N     1 
ATOM   524  C CA    . TYR C 2 11  ? 4.065   12.285  20.883  1.00 26.94 ? 12  TYR A CA    1 
ATOM   525  C C     . TYR C 2 11  ? 5.058   13.443  20.761  1.00 29.19 ? 12  TYR A C     1 
ATOM   526  O O     . TYR C 2 11  ? 4.773   14.458  20.110  1.00 29.69 ? 12  TYR A O     1 
ATOM   527  C CB    . TYR C 2 11  ? 3.340   12.357  22.228  1.00 24.29 ? 12  TYR A CB    1 
ATOM   528  C CG    . TYR C 2 11  ? 2.408   13.535  22.408  1.00 29.87 ? 12  TYR A CG    1 
ATOM   529  C CD1   . TYR C 2 11  ? 1.060   13.439  22.058  1.00 30.09 ? 12  TYR A CD1   1 
ATOM   530  C CD2   . TYR C 2 11  ? 2.862   14.736  22.965  1.00 33.98 ? 12  TYR A CD2   1 
ATOM   531  C CE1   . TYR C 2 11  ? 0.183   14.508  22.263  1.00 31.59 ? 12  TYR A CE1   1 
ATOM   532  C CE2   . TYR C 2 11  ? 1.993   15.812  23.175  1.00 30.03 ? 12  TYR A CE2   1 
ATOM   533  C CZ    . TYR C 2 11  ? 0.656   15.690  22.823  1.00 33.67 ? 12  TYR A CZ    1 
ATOM   534  O OH    . TYR C 2 11  ? -0.217  16.735  23.038  1.00 40.27 ? 12  TYR A OH    1 
ATOM   535  N N     . ASP C 2 12  ? 6.219   13.281  21.390  1.00 30.12 ? 13  ASP A N     1 
ATOM   536  C CA    . ASP C 2 12  ? 7.261   14.298  21.365  1.00 30.78 ? 13  ASP A CA    1 
ATOM   537  C C     . ASP C 2 12  ? 7.824   14.450  19.954  1.00 31.00 ? 13  ASP A C     1 
ATOM   538  O O     . ASP C 2 12  ? 7.844   15.549  19.404  1.00 31.23 ? 13  ASP A O     1 
ATOM   539  C CB    . ASP C 2 12  ? 8.393   13.932  22.338  1.00 29.99 ? 13  ASP A CB    1 
ATOM   540  C CG    . ASP C 2 12  ? 9.432   15.042  22.474  1.00 34.90 ? 13  ASP A CG    1 
ATOM   541  O OD1   . ASP C 2 12  ? 9.049   16.179  22.828  1.00 33.12 ? 13  ASP A OD1   1 
ATOM   542  O OD2   . ASP C 2 12  ? 10.628  14.776  22.224  1.00 37.56 ? 13  ASP A OD2   1 
ATOM   543  N N     . GLU C 2 13  ? 8.274   13.342  19.376  1.00 31.06 ? 14  GLU A N     1 
ATOM   544  C CA    . GLU C 2 13  ? 8.853   13.349  18.037  1.00 31.94 ? 14  GLU A CA    1 
ATOM   545  C C     . GLU C 2 13  ? 7.919   13.959  16.988  1.00 31.96 ? 14  GLU A C     1 
ATOM   546  O O     . GLU C 2 13  ? 8.358   14.706  16.111  1.00 32.52 ? 14  GLU A O     1 
ATOM   547  C CB    . GLU C 2 13  ? 9.218   11.926  17.620  1.00 33.01 ? 14  GLU A CB    1 
ATOM   548  C CG    . GLU C 2 13  ? 10.158  11.855  16.430  1.00 37.03 ? 14  GLU A CG    1 
ATOM   549  C CD    . GLU C 2 13  ? 11.612  12.112  16.792  1.00 43.51 ? 14  GLU A CD    1 
ATOM   550  O OE1   . GLU C 2 13  ? 11.931  12.305  17.989  1.00 41.19 ? 14  GLU A OE1   1 
ATOM   551  O OE2   . GLU C 2 13  ? 12.443  12.116  15.860  1.00 46.26 ? 14  GLU A OE2   1 
ATOM   552  N N     . ASN C 2 14  ? 6.633   13.639  17.091  1.00 31.54 ? 15  ASN A N     1 
ATOM   553  C CA    . ASN C 2 14  ? 5.626   14.129  16.156  1.00 33.39 ? 15  ASN A CA    1 
ATOM   554  C C     . ASN C 2 14  ? 5.450   15.647  16.210  1.00 36.09 ? 15  ASN A C     1 
ATOM   555  O O     . ASN C 2 14  ? 5.181   16.292  15.195  1.00 36.75 ? 15  ASN A O     1 
ATOM   556  C CB    . ASN C 2 14  ? 4.290   13.444  16.435  1.00 30.17 ? 15  ASN A CB    1 
ATOM   557  C CG    . ASN C 2 14  ? 3.261   13.734  15.373  1.00 37.51 ? 15  ASN A CG    1 
ATOM   558  O OD1   . ASN C 2 14  ? 3.446   13.378  14.210  1.00 43.73 ? 15  ASN A OD1   1 
ATOM   559  N ND2   . ASN C 2 14  ? 2.167   14.378  15.761  1.00 32.66 ? 15  ASN A ND2   1 
ATOM   560  N N     . GLN C 2 15  ? 5.607   16.218  17.397  1.00 37.37 ? 16  GLN A N     1 
ATOM   561  C CA    . GLN C 2 15  ? 5.457   17.656  17.559  1.00 39.30 ? 16  GLN A CA    1 
ATOM   562  C C     . GLN C 2 15  ? 6.670   18.466  17.118  1.00 39.78 ? 16  GLN A C     1 
ATOM   563  O O     . GLN C 2 15  ? 6.528   19.602  16.679  1.00 43.51 ? 16  GLN A O     1 
ATOM   564  C CB    . GLN C 2 15  ? 5.134   17.991  19.008  1.00 39.22 ? 16  GLN A CB    1 
ATOM   565  C CG    . GLN C 2 15  ? 3.794   17.473  19.459  1.00 51.46 ? 16  GLN A CG    1 
ATOM   566  C CD    . GLN C 2 15  ? 3.297   18.195  20.685  1.00 63.49 ? 16  GLN A CD    1 
ATOM   567  O OE1   . GLN C 2 15  ? 4.081   18.768  21.445  1.00 68.71 ? 16  GLN A OE1   1 
ATOM   568  N NE2   . GLN C 2 15  ? 1.988   18.177  20.888  1.00 66.63 ? 16  GLN A NE2   1 
ATOM   569  N N     . LYS C 2 16  ? 7.858   17.886  17.230  1.00 40.06 ? 17  LYS A N     1 
ATOM   570  C CA    . LYS C 2 16  ? 9.079   18.592  16.865  1.00 42.85 ? 17  LYS A CA    1 
ATOM   571  C C     . LYS C 2 16  ? 9.606   18.334  15.454  1.00 43.79 ? 17  LYS A C     1 
ATOM   572  O O     . LYS C 2 16  ? 10.534  19.017  14.998  1.00 43.25 ? 17  LYS A O     1 
ATOM   573  C CB    . LYS C 2 16  ? 10.176  18.284  17.892  1.00 44.45 ? 17  LYS A CB    1 
ATOM   574  C CG    . LYS C 2 16  ? 9.895   18.851  19.275  1.00 51.09 ? 17  LYS A CG    1 
ATOM   575  C CD    . LYS C 2 16  ? 10.949  18.421  20.281  1.00 62.01 ? 17  LYS A CD    1 
ATOM   576  C CE    . LYS C 2 16  ? 10.642  18.986  21.665  1.00 64.26 ? 17  LYS A CE    1 
ATOM   577  N NZ    . LYS C 2 16  ? 11.587  18.479  22.704  1.00 63.01 ? 17  LYS A NZ    1 
ATOM   578  N N     . TYR C 2 17  ? 9.031   17.357  14.758  1.00 43.25 ? 18  TYR A N     1 
ATOM   579  C CA    . TYR C 2 17  ? 9.490   17.027  13.411  1.00 41.53 ? 18  TYR A CA    1 
ATOM   580  C C     . TYR C 2 17  ? 8.362   16.897  12.397  1.00 39.82 ? 18  TYR A C     1 
ATOM   581  O O     . TYR C 2 17  ? 7.270   16.421  12.719  1.00 40.21 ? 18  TYR A O     1 
ATOM   582  C CB    . TYR C 2 17  ? 10.342  15.744  13.435  1.00 43.84 ? 18  TYR A CB    1 
ATOM   583  C CG    . TYR C 2 17  ? 11.655  15.904  14.181  1.00 47.08 ? 18  TYR A CG    1 
ATOM   584  C CD1   . TYR C 2 17  ? 12.800  16.364  13.524  1.00 49.28 ? 18  TYR A CD1   1 
ATOM   585  C CD2   . TYR C 2 17  ? 11.747  15.624  15.548  1.00 44.25 ? 18  TYR A CD2   1 
ATOM   586  C CE1   . TYR C 2 17  ? 14.006  16.545  14.208  1.00 52.63 ? 18  TYR A CE1   1 
ATOM   587  C CE2   . TYR C 2 17  ? 12.949  15.803  16.242  1.00 49.47 ? 18  TYR A CE2   1 
ATOM   588  C CZ    . TYR C 2 17  ? 14.074  16.264  15.566  1.00 51.54 ? 18  TYR A CZ    1 
ATOM   589  O OH    . TYR C 2 17  ? 15.263  16.456  16.240  1.00 56.90 ? 18  TYR A OH    1 
ATOM   590  N N     . ASP C 2 18  ? 8.643   17.336  11.173  1.00 36.55 ? 19  ASP A N     1 
ATOM   591  C CA    . ASP C 2 18  ? 7.691   17.280  10.074  1.00 33.35 ? 19  ASP A CA    1 
ATOM   592  C C     . ASP C 2 18  ? 8.367   16.697  8.850   1.00 31.59 ? 19  ASP A C     1 
ATOM   593  O O     . ASP C 2 18  ? 9.307   17.295  8.324   1.00 29.61 ? 19  ASP A O     1 
ATOM   594  C CB    . ASP C 2 18  ? 7.195   18.677  9.723   1.00 35.18 ? 19  ASP A CB    1 
ATOM   595  C CG    . ASP C 2 18  ? 5.955   19.068  10.485  1.00 45.26 ? 19  ASP A CG    1 
ATOM   596  O OD1   . ASP C 2 18  ? 5.558   18.341  11.421  1.00 52.53 ? 19  ASP A OD1   1 
ATOM   597  O OD2   . ASP C 2 18  ? 5.368   20.114  10.141  1.00 55.96 ? 19  ASP A OD2   1 
ATOM   598  N N     . VAL C 2 19  ? 7.902   15.537  8.399   1.00 28.46 ? 20  VAL A N     1 
ATOM   599  C CA    . VAL C 2 19  ? 8.478   14.912  7.208   1.00 26.84 ? 20  VAL A CA    1 
ATOM   600  C C     . VAL C 2 19  ? 8.001   15.702  5.978   1.00 24.85 ? 20  VAL A C     1 
ATOM   601  O O     . VAL C 2 19  ? 6.814   16.019  5.857   1.00 23.01 ? 20  VAL A O     1 
ATOM   602  C CB    . VAL C 2 19  ? 8.066   13.421  7.086   1.00 24.82 ? 20  VAL A CB    1 
ATOM   603  C CG1   . VAL C 2 19  ? 8.613   12.830  5.789   1.00 26.39 ? 20  VAL A CG1   1 
ATOM   604  C CG2   . VAL C 2 19  ? 8.611   12.633  8.279   1.00 23.33 ? 20  VAL A CG2   1 
ATOM   605  N N     . CYS C 2 20  ? 8.915   16.025  5.070   1.00 22.08 ? 21  CYS A N     1 
ATOM   606  C CA    . CYS C 2 20  ? 8.516   16.798  3.905   1.00 23.84 ? 21  CYS A CA    1 
ATOM   607  C C     . CYS C 2 20  ? 8.982   16.258  2.558   1.00 24.42 ? 21  CYS A C     1 
ATOM   608  O O     . CYS C 2 20  ? 8.729   16.878  1.526   1.00 25.82 ? 21  CYS A O     1 
ATOM   609  C CB    . CYS C 2 20  ? 8.953   18.255  4.074   1.00 26.11 ? 21  CYS A CB    1 
ATOM   610  S SG    . CYS C 2 20  ? 10.721  18.473  4.241   1.00 28.75 ? 21  CYS A SG    1 
ATOM   611  N N     . GLY C 2 21  ? 9.657   15.115  2.554   1.00 23.22 ? 22  GLY A N     1 
ATOM   612  C CA    . GLY C 2 21  ? 10.088  14.547  1.290   1.00 23.96 ? 22  GLY A CA    1 
ATOM   613  C C     . GLY C 2 21  ? 11.101  13.436  1.428   1.00 24.17 ? 22  GLY A C     1 
ATOM   614  O O     . GLY C 2 21  ? 11.583  13.168  2.528   1.00 25.14 ? 22  GLY A O     1 
ATOM   615  N N     . ILE C 2 22  ? 11.413  12.778  0.317   1.00 21.31 ? 23  ILE A N     1 
ATOM   616  C CA    . ILE C 2 22  ? 12.409  11.722  0.311   1.00 19.82 ? 23  ILE A CA    1 
ATOM   617  C C     . ILE C 2 22  ? 13.681  12.349  -0.244  1.00 19.06 ? 23  ILE A C     1 
ATOM   618  O O     . ILE C 2 22  ? 13.627  13.255  -1.075  1.00 20.53 ? 23  ILE A O     1 
ATOM   619  C CB    . ILE C 2 22  ? 11.969  10.480  -0.530  1.00 24.83 ? 23  ILE A CB    1 
ATOM   620  C CG1   . ILE C 2 22  ? 11.696  10.861  -1.982  1.00 24.23 ? 23  ILE A CG1   1 
ATOM   621  C CG2   . ILE C 2 22  ? 10.727  9.850   0.095   1.00 28.03 ? 23  ILE A CG2   1 
ATOM   622  C CD1   . ILE C 2 22  ? 11.506  9.661   -2.898  1.00 34.22 ? 23  ILE A CD1   1 
ATOM   623  N N     . ILE C 2 23  ? 14.827  11.885  0.216   1.00 18.85 ? 24  ILE A N     1 
ATOM   624  C CA    . ILE C 2 23  ? 16.079  12.456  -0.229  1.00 20.10 ? 24  ILE A CA    1 
ATOM   625  C C     . ILE C 2 23  ? 16.974  11.404  -0.867  1.00 21.10 ? 24  ILE A C     1 
ATOM   626  O O     . ILE C 2 23  ? 16.974  10.240  -0.442  1.00 20.06 ? 24  ILE A O     1 
ATOM   627  C CB    . ILE C 2 23  ? 16.814  13.150  0.962   1.00 22.55 ? 24  ILE A CB    1 
ATOM   628  C CG1   . ILE C 2 23  ? 18.048  13.909  0.464   1.00 20.69 ? 24  ILE A CG1   1 
ATOM   629  C CG2   . ILE C 2 23  ? 17.214  12.116  2.018   1.00 19.74 ? 24  ILE A CG2   1 
ATOM   630  C CD1   . ILE C 2 23  ? 18.622  14.877  1.496   1.00 26.89 ? 24  ILE A CD1   1 
ATOM   631  N N     . SER C 2 24  ? 17.722  11.811  -1.895  1.00 20.48 ? 25  SER A N     1 
ATOM   632  C CA    . SER C 2 24  ? 18.648  10.914  -2.574  1.00 23.61 ? 25  SER A CA    1 
ATOM   633  C C     . SER C 2 24  ? 20.048  11.158  -1.991  1.00 25.11 ? 25  SER A C     1 
ATOM   634  O O     . SER C 2 24  ? 20.296  12.209  -1.387  1.00 21.48 ? 25  SER A O     1 
ATOM   635  C CB    . SER C 2 24  ? 18.617  11.152  -4.094  1.00 25.61 ? 25  SER A CB    1 
ATOM   636  O OG    . SER C 2 24  ? 19.095  12.434  -4.451  1.00 28.15 ? 25  SER A OG    1 
ATOM   637  N N     . ALA C 2 25  ? 20.954  10.197  -2.162  1.00 27.05 ? 26  ALA A N     1 
ATOM   638  C CA    . ALA C 2 25  ? 22.316  10.320  -1.634  1.00 31.57 ? 26  ALA A CA    1 
ATOM   639  C C     . ALA C 2 25  ? 23.061  11.507  -2.254  1.00 33.99 ? 26  ALA A C     1 
ATOM   640  O O     . ALA C 2 25  ? 24.075  11.973  -1.721  1.00 35.66 ? 26  ALA A O     1 
ATOM   641  C CB    . ALA C 2 25  ? 23.097  9.014   -1.861  1.00 30.97 ? 26  ALA A CB    1 
ATOM   642  N N     . GLU C 2 26  ? 22.539  11.987  -3.379  1.00 34.50 ? 27  GLU A N     1 
ATOM   643  C CA    . GLU C 2 26  ? 23.109  13.115  -4.106  1.00 35.59 ? 27  GLU A CA    1 
ATOM   644  C C     . GLU C 2 26  ? 22.575  14.449  -3.571  1.00 35.22 ? 27  GLU A C     1 
ATOM   645  O O     . GLU C 2 26  ? 22.992  15.512  -4.022  1.00 37.27 ? 27  GLU A O     1 
ATOM   646  C CB    . GLU C 2 26  ? 22.799  12.981  -5.602  1.00 39.23 ? 27  GLU A CB    1 
ATOM   647  C CG    . GLU C 2 26  ? 23.435  11.750  -6.288  1.00 43.63 ? 27  GLU A CG    1 
ATOM   648  C CD    . GLU C 2 26  ? 22.826  10.396  -5.872  1.00 46.09 ? 27  GLU A CD    1 
ATOM   649  O OE1   . GLU C 2 26  ? 21.638  10.340  -5.469  1.00 45.37 ? 27  GLU A OE1   1 
ATOM   650  O OE2   . GLU C 2 26  ? 23.550  9.377   -5.954  1.00 42.52 ? 27  GLU A OE2   1 
ATOM   651  N N     . GLY C 2 27  ? 21.646  14.387  -2.620  1.00 32.17 ? 28  GLY A N     1 
ATOM   652  C CA    . GLY C 2 27  ? 21.106  15.597  -2.026  1.00 29.72 ? 28  GLY A CA    1 
ATOM   653  C C     . GLY C 2 27  ? 19.866  16.203  -2.659  1.00 29.22 ? 28  GLY A C     1 
ATOM   654  O O     . GLY C 2 27  ? 19.467  17.310  -2.292  1.00 29.09 ? 28  GLY A O     1 
ATOM   655  N N     . LYS C 2 28  ? 19.247  15.501  -3.602  1.00 28.10 ? 29  LYS A N     1 
ATOM   656  C CA    . LYS C 2 28  ? 18.043  16.018  -4.250  1.00 30.03 ? 29  LYS A CA    1 
ATOM   657  C C     . LYS C 2 28  ? 16.827  15.568  -3.431  1.00 29.26 ? 29  LYS A C     1 
ATOM   658  O O     . LYS C 2 28  ? 16.751  14.411  -3.003  1.00 29.43 ? 29  LYS A O     1 
ATOM   659  C CB    . LYS C 2 28  ? 17.948  15.485  -5.680  1.00 34.74 ? 29  LYS A CB    1 
ATOM   660  C CG    . LYS C 2 28  ? 17.564  16.510  -6.731  1.00 46.51 ? 29  LYS A CG    1 
ATOM   661  C CD    . LYS C 2 28  ? 17.380  15.812  -8.071  1.00 56.14 ? 29  LYS A CD    1 
ATOM   662  C CE    . LYS C 2 28  ? 16.932  16.772  -9.160  1.00 64.30 ? 29  LYS A CE    1 
ATOM   663  N NZ    . LYS C 2 28  ? 16.585  16.060  -10.430 1.00 62.60 ? 29  LYS A NZ    1 
ATOM   664  N N     . ILE C 2 29  ? 15.884  16.473  -3.212  1.00 25.19 ? 30  ILE A N     1 
ATOM   665  C CA    . ILE C 2 29  ? 14.701  16.148  -2.429  1.00 25.69 ? 30  ILE A CA    1 
ATOM   666  C C     . ILE C 2 29  ? 13.444  16.118  -3.296  1.00 24.58 ? 30  ILE A C     1 
ATOM   667  O O     . ILE C 2 29  ? 13.237  17.003  -4.126  1.00 22.73 ? 30  ILE A O     1 
ATOM   668  C CB    . ILE C 2 29  ? 14.515  17.171  -1.285  1.00 27.83 ? 30  ILE A CB    1 
ATOM   669  C CG1   . ILE C 2 29  ? 15.816  17.286  -0.484  1.00 31.48 ? 30  ILE A CG1   1 
ATOM   670  C CG2   . ILE C 2 29  ? 13.348  16.760  -0.379  1.00 25.29 ? 30  ILE A CG2   1 
ATOM   671  C CD1   . ILE C 2 29  ? 15.837  18.472  0.467   1.00 36.54 ? 30  ILE A CD1   1 
ATOM   672  N N     . TYR C 2 30  ? 12.614  15.095  -3.100  1.00 21.95 ? 31  TYR A N     1 
ATOM   673  C CA    . TYR C 2 30  ? 11.366  14.943  -3.842  1.00 22.09 ? 31  TYR A CA    1 
ATOM   674  C C     . TYR C 2 30  ? 10.241  15.097  -2.834  1.00 22.29 ? 31  TYR A C     1 
ATOM   675  O O     . TYR C 2 30  ? 10.259  14.460  -1.782  1.00 24.14 ? 31  TYR A O     1 
ATOM   676  C CB    . TYR C 2 30  ? 11.287  13.557  -4.512  1.00 20.42 ? 31  TYR A CB    1 
ATOM   677  C CG    . TYR C 2 30  ? 12.433  13.270  -5.447  1.00 19.93 ? 31  TYR A CG    1 
ATOM   678  C CD1   . TYR C 2 30  ? 13.699  12.974  -4.946  1.00 20.32 ? 31  TYR A CD1   1 
ATOM   679  C CD2   . TYR C 2 30  ? 12.267  13.336  -6.836  1.00 22.96 ? 31  TYR A CD2   1 
ATOM   680  C CE1   . TYR C 2 30  ? 14.779  12.755  -5.792  1.00 20.45 ? 31  TYR A CE1   1 
ATOM   681  C CE2   . TYR C 2 30  ? 13.343  13.118  -7.697  1.00 20.48 ? 31  TYR A CE2   1 
ATOM   682  C CZ    . TYR C 2 30  ? 14.597  12.830  -7.163  1.00 23.89 ? 31  TYR A CZ    1 
ATOM   683  O OH    . TYR C 2 30  ? 15.677  12.628  -7.984  1.00 27.94 ? 31  TYR A OH    1 
ATOM   684  N N     . PRO C 2 31  ? 9.250   15.949  -3.134  1.00 23.41 ? 32  PRO A N     1 
ATOM   685  C CA    . PRO C 2 31  ? 8.097   16.200  -2.257  1.00 21.55 ? 32  PRO A CA    1 
ATOM   686  C C     . PRO C 2 31  ? 7.195   14.984  -2.065  1.00 21.35 ? 32  PRO A C     1 
ATOM   687  O O     . PRO C 2 31  ? 7.296   13.988  -2.787  1.00 20.04 ? 32  PRO A O     1 
ATOM   688  C CB    . PRO C 2 31  ? 7.346   17.327  -2.974  1.00 24.17 ? 32  PRO A CB    1 
ATOM   689  C CG    . PRO C 2 31  ? 8.399   17.961  -3.840  1.00 27.69 ? 32  PRO A CG    1 
ATOM   690  C CD    . PRO C 2 31  ? 9.157   16.771  -4.349  1.00 25.08 ? 32  PRO A CD    1 
ATOM   691  N N     . LEU C 2 32  ? 6.302   15.086  -1.089  1.00 22.87 ? 33  LEU A N     1 
ATOM   692  C CA    . LEU C 2 32  ? 5.370   14.017  -0.759  1.00 26.11 ? 33  LEU A CA    1 
ATOM   693  C C     . LEU C 2 32  ? 4.005   14.195  -1.435  1.00 28.49 ? 33  LEU A C     1 
ATOM   694  O O     . LEU C 2 32  ? 3.599   15.315  -1.747  1.00 31.18 ? 33  LEU A O     1 
ATOM   695  C CB    . LEU C 2 32  ? 5.181   13.943  0.768   1.00 23.86 ? 33  LEU A CB    1 
ATOM   696  C CG    . LEU C 2 32  ? 6.409   13.761  1.674   1.00 24.54 ? 33  LEU A CG    1 
ATOM   697  C CD1   . LEU C 2 32  ? 5.957   13.731  3.124   1.00 31.56 ? 33  LEU A CD1   1 
ATOM   698  C CD2   . LEU C 2 32  ? 7.169   12.486  1.324   1.00 25.16 ? 33  LEU A CD2   1 
ATOM   699  N N     . GLY C 2 33  ? 3.317   13.074  -1.662  1.00 30.65 ? 34  GLY A N     1 
ATOM   700  C CA    . GLY C 2 33  ? 1.984   13.079  -2.253  1.00 32.64 ? 34  GLY A CA    1 
ATOM   701  C C     . GLY C 2 33  ? 0.955   13.131  -1.128  1.00 33.82 ? 34  GLY A C     1 
ATOM   702  O O     . GLY C 2 33  ? 1.306   12.937  0.036   1.00 31.88 ? 34  GLY A O     1 
ATOM   703  N N     . SER C 2 34  ? -0.310  13.367  -1.461  1.00 38.25 ? 35  SER A N     1 
ATOM   704  C CA    . SER C 2 34  ? -1.363  13.511  -0.444  1.00 42.96 ? 35  SER A CA    1 
ATOM   705  C C     . SER C 2 34  ? -2.244  12.321  -0.025  1.00 42.68 ? 35  SER A C     1 
ATOM   706  O O     . SER C 2 34  ? -3.160  12.499  0.782   1.00 45.94 ? 35  SER A O     1 
ATOM   707  C CB    . SER C 2 34  ? -2.284  14.677  -0.841  1.00 46.92 ? 35  SER A CB    1 
ATOM   708  O OG    . SER C 2 34  ? -2.789  14.502  -2.162  1.00 51.79 ? 35  SER A OG    1 
ATOM   709  N N     . ASP C 2 35  ? -1.993  11.126  -0.551  1.00 39.81 ? 36  ASP A N     1 
ATOM   710  C CA    . ASP C 2 35  ? -2.820  9.977   -0.188  1.00 38.51 ? 36  ASP A CA    1 
ATOM   711  C C     . ASP C 2 35  ? -2.241  9.108   0.945   1.00 36.34 ? 36  ASP A C     1 
ATOM   712  O O     . ASP C 2 35  ? -1.047  9.193   1.271   1.00 36.32 ? 36  ASP A O     1 
ATOM   713  C CB    . ASP C 2 35  ? -3.141  9.128   -1.432  1.00 43.92 ? 36  ASP A CB    1 
ATOM   714  C CG    . ASP C 2 35  ? -1.901  8.691   -2.185  1.00 48.30 ? 36  ASP A CG    1 
ATOM   715  O OD1   . ASP C 2 35  ? -1.282  9.546   -2.845  1.00 50.68 ? 36  ASP A OD1   1 
ATOM   716  O OD2   . ASP C 2 35  ? -1.547  7.494   -2.122  1.00 53.62 ? 36  ASP A OD2   1 
ATOM   717  N N     . THR C 2 36  ? -3.089  8.268   1.538   1.00 31.80 ? 37  THR A N     1 
ATOM   718  C CA    . THR C 2 36  ? -2.676  7.411   2.645   1.00 28.03 ? 37  THR A CA    1 
ATOM   719  C C     . THR C 2 36  ? -1.637  6.382   2.246   1.00 24.96 ? 37  THR A C     1 
ATOM   720  O O     . THR C 2 36  ? -0.769  6.061   3.051   1.00 23.71 ? 37  THR A O     1 
ATOM   721  C CB    . THR C 2 36  ? -3.887  6.716   3.326   1.00 30.48 ? 37  THR A CB    1 
ATOM   722  O OG1   . THR C 2 36  ? -4.852  7.710   3.700   1.00 20.35 ? 37  THR A OG1   1 
ATOM   723  C CG2   . THR C 2 36  ? -3.452  5.975   4.595   1.00 25.09 ? 37  THR A CG2   1 
ATOM   724  N N     . LYS C 2 37  ? -1.695  5.870   1.020   1.00 24.46 ? 38  LYS A N     1 
ATOM   725  C CA    . LYS C 2 37  ? -0.694  4.891   0.602   1.00 25.88 ? 38  LYS A CA    1 
ATOM   726  C C     . LYS C 2 37  ? 0.701   5.487   0.825   1.00 26.33 ? 38  LYS A C     1 
ATOM   727  O O     . LYS C 2 37  ? 1.635   4.779   1.186   1.00 29.71 ? 38  LYS A O     1 
ATOM   728  C CB    . LYS C 2 37  ? -0.869  4.509   -0.871  1.00 31.18 ? 38  LYS A CB    1 
ATOM   729  C CG    . LYS C 2 37  ? 0.021   3.348   -1.302  1.00 46.62 ? 38  LYS A CG    1 
ATOM   730  C CD    . LYS C 2 37  ? 0.143   3.263   -2.818  1.00 63.07 ? 38  LYS A CD    1 
ATOM   731  C CE    . LYS C 2 37  ? 1.219   2.260   -3.228  1.00 70.33 ? 38  LYS A CE    1 
ATOM   732  N NZ    . LYS C 2 37  ? 1.667   2.480   -4.639  1.00 74.59 ? 38  LYS A NZ    1 
ATOM   733  N N     . VAL C 2 38  ? 0.829   6.796   0.621   1.00 24.73 ? 39  VAL A N     1 
ATOM   734  C CA    . VAL C 2 38  ? 2.104   7.482   0.799   1.00 23.72 ? 39  VAL A CA    1 
ATOM   735  C C     . VAL C 2 38  ? 2.406   7.796   2.269   1.00 22.22 ? 39  VAL A C     1 
ATOM   736  O O     . VAL C 2 38  ? 3.480   7.466   2.779   1.00 20.69 ? 39  VAL A O     1 
ATOM   737  C CB    . VAL C 2 38  ? 2.146   8.794   -0.041  1.00 27.48 ? 39  VAL A CB    1 
ATOM   738  C CG1   . VAL C 2 38  ? 3.338   9.667   0.368   1.00 24.97 ? 39  VAL A CG1   1 
ATOM   739  C CG2   . VAL C 2 38  ? 2.235   8.446   -1.526  1.00 26.96 ? 39  VAL A CG2   1 
ATOM   740  N N     . LEU C 2 39  ? 1.457   8.428   2.949   1.00 21.79 ? 40  LEU A N     1 
ATOM   741  C CA    . LEU C 2 39  ? 1.648   8.802   4.344   1.00 22.53 ? 40  LEU A CA    1 
ATOM   742  C C     . LEU C 2 39  ? 1.775   7.619   5.300   1.00 21.21 ? 40  LEU A C     1 
ATOM   743  O O     . LEU C 2 39  ? 2.492   7.704   6.297   1.00 22.53 ? 40  LEU A O     1 
ATOM   744  C CB    . LEU C 2 39  ? 0.556   9.784   4.776   1.00 23.06 ? 40  LEU A CB    1 
ATOM   745  C CG    . LEU C 2 39  ? 0.783   11.107  4.028   1.00 33.56 ? 40  LEU A CG    1 
ATOM   746  C CD1   . LEU C 2 39  ? -0.361  12.055  4.232   1.00 24.17 ? 40  LEU A CD1   1 
ATOM   747  C CD2   . LEU C 2 39  ? 2.093   11.733  4.499   1.00 36.46 ? 40  LEU A CD2   1 
ATOM   748  N N     . SER C 2 40  ? 1.095   6.519   4.995   1.00 18.35 ? 41  SER A N     1 
ATOM   749  C CA    . SER C 2 40  ? 1.187   5.305   5.808   1.00 17.47 ? 41  SER A CA    1 
ATOM   750  C C     . SER C 2 40  ? 2.661   4.860   5.838   1.00 17.57 ? 41  SER A C     1 
ATOM   751  O O     . SER C 2 40  ? 3.210   4.546   6.887   1.00 18.21 ? 41  SER A O     1 
ATOM   752  C CB    . SER C 2 40  ? 0.317   4.205   5.199   1.00 20.89 ? 41  SER A CB    1 
ATOM   753  O OG    . SER C 2 40  ? 0.545   2.962   5.836   1.00 41.78 ? 41  SER A OG    1 
ATOM   754  N N     . THR C 2 41  ? 3.296   4.846   4.670   1.00 18.33 ? 42  THR A N     1 
ATOM   755  C CA    . THR C 2 41  ? 4.699   4.472   4.529   1.00 19.00 ? 42  THR A CA    1 
ATOM   756  C C     . THR C 2 41  ? 5.613   5.437   5.293   1.00 18.66 ? 42  THR A C     1 
ATOM   757  O O     . THR C 2 41  ? 6.548   5.012   5.976   1.00 18.26 ? 42  THR A O     1 
ATOM   758  C CB    . THR C 2 41  ? 5.084   4.470   3.032   1.00 21.75 ? 42  THR A CB    1 
ATOM   759  O OG1   . THR C 2 41  ? 4.353   3.433   2.369   1.00 28.81 ? 42  THR A OG1   1 
ATOM   760  C CG2   . THR C 2 41  ? 6.573   4.258   2.837   1.00 21.59 ? 42  THR A CG2   1 
ATOM   761  N N     . ILE C 2 42  ? 5.335   6.733   5.172   1.00 18.61 ? 43  ILE A N     1 
ATOM   762  C CA    . ILE C 2 42  ? 6.126   7.762   5.845   1.00 20.77 ? 43  ILE A CA    1 
ATOM   763  C C     . ILE C 2 42  ? 6.062   7.620   7.375   1.00 20.22 ? 43  ILE A C     1 
ATOM   764  O O     . ILE C 2 42  ? 7.097   7.658   8.037   1.00 19.28 ? 43  ILE A O     1 
ATOM   765  C CB    . ILE C 2 42  ? 5.700   9.205   5.364   1.00 22.48 ? 43  ILE A CB    1 
ATOM   766  C CG1   . ILE C 2 42  ? 6.647   9.697   4.263   1.00 25.17 ? 43  ILE A CG1   1 
ATOM   767  C CG2   . ILE C 2 42  ? 5.769   10.219  6.502   1.00 24.87 ? 43  ILE A CG2   1 
ATOM   768  C CD1   . ILE C 2 42  ? 6.932   8.697   3.166   1.00 20.46 ? 43  ILE A CD1   1 
ATOM   769  N N     . PHE C 2 43  ? 4.861   7.445   7.925   1.00 17.86 ? 44  PHE A N     1 
ATOM   770  C CA    . PHE C 2 43  ? 4.693   7.294   9.368   1.00 19.41 ? 44  PHE A CA    1 
ATOM   771  C C     . PHE C 2 43  ? 5.338   6.009   9.901   1.00 20.86 ? 44  PHE A C     1 
ATOM   772  O O     . PHE C 2 43  ? 5.842   5.987   11.025  1.00 19.62 ? 44  PHE A O     1 
ATOM   773  C CB    . PHE C 2 43  ? 3.214   7.389   9.738   1.00 20.24 ? 44  PHE A CB    1 
ATOM   774  C CG    . PHE C 2 43  ? 2.605   8.736   9.438   1.00 21.31 ? 44  PHE A CG    1 
ATOM   775  C CD1   . PHE C 2 43  ? 3.344   9.902   9.617   1.00 19.52 ? 44  PHE A CD1   1 
ATOM   776  C CD2   . PHE C 2 43  ? 1.301   8.837   8.959   1.00 21.94 ? 44  PHE A CD2   1 
ATOM   777  C CE1   . PHE C 2 43  ? 2.794   11.151  9.319   1.00 19.74 ? 44  PHE A CE1   1 
ATOM   778  C CE2   . PHE C 2 43  ? 0.737   10.078  8.656   1.00 22.73 ? 44  PHE A CE2   1 
ATOM   779  C CZ    . PHE C 2 43  ? 1.486   11.239  8.836   1.00 25.43 ? 44  PHE A CZ    1 
ATOM   780  N N     . GLU C 2 44  ? 5.327   4.947   9.097   1.00 18.86 ? 45  GLU A N     1 
ATOM   781  C CA    . GLU C 2 44  ? 5.973   3.687   9.466   1.00 19.69 ? 45  GLU A CA    1 
ATOM   782  C C     . GLU C 2 44  ? 7.460   3.967   9.644   1.00 20.76 ? 45  GLU A C     1 
ATOM   783  O O     . GLU C 2 44  ? 8.040   3.652   10.683  1.00 20.35 ? 45  GLU A O     1 
ATOM   784  C CB    . GLU C 2 44  ? 5.852   2.651   8.342   1.00 27.90 ? 45  GLU A CB    1 
ATOM   785  C CG    . GLU C 2 44  ? 4.501   1.994   8.188   1.00 36.77 ? 45  GLU A CG    1 
ATOM   786  C CD    . GLU C 2 44  ? 4.368   0.715   8.991   1.00 44.17 ? 45  GLU A CD    1 
ATOM   787  O OE1   . GLU C 2 44  ? 5.340   0.323   9.683   1.00 47.45 ? 45  GLU A OE1   1 
ATOM   788  O OE2   . GLU C 2 44  ? 3.279   0.100   8.924   1.00 44.20 ? 45  GLU A OE2   1 
ATOM   789  N N     . LEU C 2 45  ? 8.066   4.560   8.613   1.00 16.77 ? 46  LEU A N     1 
ATOM   790  C CA    . LEU C 2 45  ? 9.494   4.879   8.613   1.00 18.82 ? 46  LEU A CA    1 
ATOM   791  C C     . LEU C 2 45  ? 9.900   5.868   9.713   1.00 18.21 ? 46  LEU A C     1 
ATOM   792  O O     . LEU C 2 45  ? 10.973  5.751   10.308  1.00 19.40 ? 46  LEU A O     1 
ATOM   793  C CB    . LEU C 2 45  ? 9.920   5.424   7.242   1.00 17.63 ? 46  LEU A CB    1 
ATOM   794  C CG    . LEU C 2 45  ? 9.763   4.495   6.036   1.00 25.11 ? 46  LEU A CG    1 
ATOM   795  C CD1   . LEU C 2 45  ? 10.307  5.194   4.804   1.00 21.48 ? 46  LEU A CD1   1 
ATOM   796  C CD2   . LEU C 2 45  ? 10.497  3.184   6.273   1.00 21.23 ? 46  LEU A CD2   1 
ATOM   797  N N     . PHE C 2 46  ? 9.034   6.840   9.963   1.00 17.15 ? 47  PHE A N     1 
ATOM   798  C CA    . PHE C 2 46  ? 9.235   7.854   10.988  1.00 20.16 ? 47  PHE A CA    1 
ATOM   799  C C     . PHE C 2 46  ? 9.296   7.202   12.390  1.00 20.79 ? 47  PHE A C     1 
ATOM   800  O O     . PHE C 2 46  ? 10.115  7.576   13.232  1.00 21.62 ? 47  PHE A O     1 
ATOM   801  C CB    . PHE C 2 46  ? 8.065   8.836   10.906  1.00 19.31 ? 47  PHE A CB    1 
ATOM   802  C CG    . PHE C 2 46  ? 8.125   9.960   11.893  1.00 24.98 ? 47  PHE A CG    1 
ATOM   803  C CD1   . PHE C 2 46  ? 9.037   10.994  11.734  1.00 25.49 ? 47  PHE A CD1   1 
ATOM   804  C CD2   . PHE C 2 46  ? 7.240   10.003  12.965  1.00 26.68 ? 47  PHE A CD2   1 
ATOM   805  C CE1   . PHE C 2 46  ? 9.062   12.058  12.629  1.00 33.17 ? 47  PHE A CE1   1 
ATOM   806  C CE2   . PHE C 2 46  ? 7.259   11.062  13.862  1.00 27.56 ? 47  PHE A CE2   1 
ATOM   807  C CZ    . PHE C 2 46  ? 8.169   12.089  13.693  1.00 31.62 ? 47  PHE A CZ    1 
ATOM   808  N N     . SER C 2 47  ? 8.426   6.226   12.619  1.00 19.12 ? 48  SER A N     1 
ATOM   809  C CA    . SER C 2 47  ? 8.334   5.520   13.891  1.00 19.32 ? 48  SER A CA    1 
ATOM   810  C C     . SER C 2 47  ? 9.446   4.521   14.217  1.00 21.06 ? 48  SER A C     1 
ATOM   811  O O     . SER C 2 47  ? 9.770   4.332   15.392  1.00 18.09 ? 48  SER A O     1 
ATOM   812  C CB    . SER C 2 47  ? 6.997   4.783   13.963  1.00 14.37 ? 48  SER A CB    1 
ATOM   813  O OG    . SER C 2 47  ? 5.924   5.673   13.755  1.00 15.91 ? 48  SER A OG    1 
ATOM   814  N N     . ARG C 2 48  ? 10.024  3.886   13.198  1.00 20.95 ? 49  ARG A N     1 
ATOM   815  C CA    . ARG C 2 48  ? 11.054  2.868   13.408  1.00 21.27 ? 49  ARG A CA    1 
ATOM   816  C C     . ARG C 2 48  ? 12.176  3.185   14.403  1.00 22.24 ? 49  ARG A C     1 
ATOM   817  O O     . ARG C 2 48  ? 12.350  2.444   15.382  1.00 19.96 ? 49  ARG A O     1 
ATOM   818  C CB    . ARG C 2 48  ? 11.649  2.405   12.068  1.00 20.58 ? 49  ARG A CB    1 
ATOM   819  C CG    . ARG C 2 48  ? 10.645  1.752   11.144  1.00 23.97 ? 49  ARG A CG    1 
ATOM   820  C CD    . ARG C 2 48  ? 11.234  1.478   9.768   1.00 30.63 ? 49  ARG A CD    1 
ATOM   821  N NE    . ARG C 2 48  ? 12.223  0.398   9.763   1.00 27.94 ? 49  ARG A NE    1 
ATOM   822  C CZ    . ARG C 2 48  ? 13.535  0.575   9.627   1.00 33.52 ? 49  ARG A CZ    1 
ATOM   823  N NH1   . ARG C 2 48  ? 14.041  1.794   9.497   1.00 35.07 ? 49  ARG A NH1   1 
ATOM   824  N NH2   . ARG C 2 48  ? 14.348  -0.471  9.624   1.00 33.89 ? 49  ARG A NH2   1 
ATOM   825  N N     . PRO C 2 49  ? 12.957  4.270   14.179  1.00 23.92 ? 50  PRO A N     1 
ATOM   826  C CA    . PRO C 2 49  ? 14.042  4.587   15.124  1.00 23.37 ? 50  PRO A CA    1 
ATOM   827  C C     . PRO C 2 49  ? 13.594  4.893   16.562  1.00 21.67 ? 50  PRO A C     1 
ATOM   828  O O     . PRO C 2 49  ? 14.319  4.592   17.505  1.00 23.48 ? 50  PRO A O     1 
ATOM   829  C CB    . PRO C 2 49  ? 14.750  5.776   14.462  1.00 21.54 ? 50  PRO A CB    1 
ATOM   830  C CG    . PRO C 2 49  ? 13.657  6.429   13.681  1.00 30.29 ? 50  PRO A CG    1 
ATOM   831  C CD    . PRO C 2 49  ? 12.927  5.253   13.078  1.00 24.01 ? 50  PRO A CD    1 
ATOM   832  N N     . ILE C 2 50  ? 12.411  5.485   16.719  1.00 21.42 ? 51  ILE A N     1 
ATOM   833  C CA    . ILE C 2 50  ? 11.851  5.819   18.031  1.00 23.89 ? 51  ILE A CA    1 
ATOM   834  C C     . ILE C 2 50  ? 11.530  4.538   18.795  1.00 23.03 ? 51  ILE A C     1 
ATOM   835  O O     . ILE C 2 50  ? 11.899  4.400   19.958  1.00 21.98 ? 51  ILE A O     1 
ATOM   836  C CB    . ILE C 2 50  ? 10.555  6.640   17.890  1.00 27.36 ? 51  ILE A CB    1 
ATOM   837  C CG1   . ILE C 2 50  ? 10.851  7.967   17.203  1.00 33.33 ? 51  ILE A CG1   1 
ATOM   838  C CG2   . ILE C 2 50  ? 9.928   6.886   19.245  1.00 26.78 ? 51  ILE A CG2   1 
ATOM   839  C CD1   . ILE C 2 50  ? 9.613   8.582   16.585  1.00 42.88 ? 51  ILE A CD1   1 
ATOM   840  N N     . ILE C 2 51  ? 10.839  3.612   18.130  1.00 23.43 ? 52  ILE A N     1 
ATOM   841  C CA    . ILE C 2 51  ? 10.478  2.322   18.721  1.00 23.41 ? 52  ILE A CA    1 
ATOM   842  C C     . ILE C 2 51  ? 11.746  1.572   19.140  1.00 23.43 ? 52  ILE A C     1 
ATOM   843  O O     . ILE C 2 51  ? 11.842  1.061   20.254  1.00 22.16 ? 52  ILE A O     1 
ATOM   844  C CB    . ILE C 2 51  ? 9.636   1.473   17.718  1.00 24.04 ? 52  ILE A CB    1 
ATOM   845  C CG1   . ILE C 2 51  ? 8.225   2.068   17.619  1.00 22.04 ? 52  ILE A CG1   1 
ATOM   846  C CG2   . ILE C 2 51  ? 9.621   -0.001  18.123  1.00 20.98 ? 52  ILE A CG2   1 
ATOM   847  C CD1   . ILE C 2 51  ? 7.349   1.431   16.587  1.00 21.85 ? 52  ILE A CD1   1 
ATOM   848  N N     . ASN C 2 52  ? 12.726  1.518   18.249  1.00 23.71 ? 53  ASN A N     1 
ATOM   849  C CA    . ASN C 2 52  ? 13.979  0.836   18.545  1.00 25.15 ? 53  ASN A CA    1 
ATOM   850  C C     . ASN C 2 52  ? 14.757  1.476   19.713  1.00 24.86 ? 53  ASN A C     1 
ATOM   851  O O     . ASN C 2 52  ? 15.326  0.775   20.553  1.00 23.69 ? 53  ASN A O     1 
ATOM   852  C CB    . ASN C 2 52  ? 14.862  0.793   17.300  1.00 24.45 ? 53  ASN A CB    1 
ATOM   853  C CG    . ASN C 2 52  ? 16.153  0.064   17.545  1.00 31.14 ? 53  ASN A CG    1 
ATOM   854  O OD1   . ASN C 2 52  ? 16.173  -1.161  17.633  1.00 35.10 ? 53  ASN A OD1   1 
ATOM   855  N ND2   . ASN C 2 52  ? 17.246  0.813   17.662  1.00 32.22 ? 53  ASN A ND2   1 
ATOM   856  N N     . LYS C 2 53  ? 14.781  2.802   19.758  1.00 22.92 ? 54  LYS A N     1 
ATOM   857  C CA    . LYS C 2 53  ? 15.472  3.523   20.820  1.00 26.93 ? 54  LYS A CA    1 
ATOM   858  C C     . LYS C 2 53  ? 14.842  3.199   22.190  1.00 27.02 ? 54  LYS A C     1 
ATOM   859  O O     . LYS C 2 53  ? 15.546  2.809   23.124  1.00 27.92 ? 54  LYS A O     1 
ATOM   860  C CB    . LYS C 2 53  ? 15.413  5.036   20.545  1.00 28.34 ? 54  LYS A CB    1 
ATOM   861  C CG    . LYS C 2 53  ? 15.914  5.925   21.674  1.00 40.32 ? 54  LYS A CG    1 
ATOM   862  C CD    . LYS C 2 53  ? 15.409  7.357   21.508  1.00 54.99 ? 54  LYS A CD    1 
ATOM   863  C CE    . LYS C 2 53  ? 15.538  8.144   22.810  1.00 63.86 ? 54  LYS A CE    1 
ATOM   864  N NZ    . LYS C 2 53  ? 14.972  9.524   22.716  1.00 67.42 ? 54  LYS A NZ    1 
ATOM   865  N N     . ILE C 2 54  ? 13.525  3.351   22.305  1.00 24.76 ? 55  ILE A N     1 
ATOM   866  C CA    . ILE C 2 54  ? 12.832  3.089   23.563  1.00 25.57 ? 55  ILE A CA    1 
ATOM   867  C C     . ILE C 2 54  ? 12.886  1.609   23.964  1.00 27.18 ? 55  ILE A C     1 
ATOM   868  O O     . ILE C 2 54  ? 12.988  1.286   25.152  1.00 28.04 ? 55  ILE A O     1 
ATOM   869  C CB    . ILE C 2 54  ? 11.356  3.583   23.516  1.00 27.43 ? 55  ILE A CB    1 
ATOM   870  C CG1   . ILE C 2 54  ? 11.316  5.104   23.322  1.00 29.23 ? 55  ILE A CG1   1 
ATOM   871  C CG2   . ILE C 2 54  ? 10.611  3.189   24.799  1.00 29.56 ? 55  ILE A CG2   1 
ATOM   872  C CD1   . ILE C 2 54  ? 12.123  5.896   24.340  1.00 25.94 ? 55  ILE A CD1   1 
ATOM   873  N N     . ALA C 2 55  ? 12.825  0.712   22.986  1.00 25.61 ? 56  ALA A N     1 
ATOM   874  C CA    . ALA C 2 55  ? 12.886  -0.717  23.264  1.00 26.93 ? 56  ALA A CA    1 
ATOM   875  C C     . ALA C 2 55  ? 14.228  -1.104  23.888  1.00 29.92 ? 56  ALA A C     1 
ATOM   876  O O     . ALA C 2 55  ? 14.271  -1.849  24.871  1.00 28.35 ? 56  ALA A O     1 
ATOM   877  C CB    . ALA C 2 55  ? 12.661  -1.504  21.995  1.00 25.07 ? 56  ALA A CB    1 
ATOM   878  N N     . GLU C 2 56  ? 15.318  -0.595  23.318  1.00 30.85 ? 57  GLU A N     1 
ATOM   879  C CA    . GLU C 2 56  ? 16.665  -0.885  23.816  1.00 33.92 ? 57  GLU A CA    1 
ATOM   880  C C     . GLU C 2 56  ? 16.856  -0.407  25.262  1.00 32.77 ? 57  GLU A C     1 
ATOM   881  O O     . GLU C 2 56  ? 17.476  -1.092  26.069  1.00 33.48 ? 57  GLU A O     1 
ATOM   882  C CB    . GLU C 2 56  ? 17.715  -0.237  22.915  1.00 34.23 ? 57  GLU A CB    1 
ATOM   883  C CG    . GLU C 2 56  ? 19.145  -0.573  23.298  1.00 58.47 ? 57  GLU A CG    1 
ATOM   884  C CD    . GLU C 2 56  ? 20.159  0.402   22.716  1.00 73.42 ? 57  GLU A CD    1 
ATOM   885  O OE1   . GLU C 2 56  ? 19.888  0.993   21.645  1.00 77.41 ? 57  GLU A OE1   1 
ATOM   886  O OE2   . GLU C 2 56  ? 21.232  0.577   23.338  1.00 79.31 ? 57  GLU A OE2   1 
ATOM   887  N N     . LYS C 2 57  ? 16.319  0.767   25.574  1.00 31.29 ? 58  LYS A N     1 
ATOM   888  C CA    . LYS C 2 57  ? 16.396  1.353   26.909  1.00 33.34 ? 58  LYS A CA    1 
ATOM   889  C C     . LYS C 2 57  ? 15.739  0.434   27.952  1.00 34.38 ? 58  LYS A C     1 
ATOM   890  O O     . LYS C 2 57  ? 16.112  0.445   29.128  1.00 35.72 ? 58  LYS A O     1 
ATOM   891  C CB    . LYS C 2 57  ? 15.704  2.721   26.894  1.00 36.78 ? 58  LYS A CB    1 
ATOM   892  C CG    . LYS C 2 57  ? 15.499  3.376   28.250  1.00 48.86 ? 58  LYS A CG    1 
ATOM   893  C CD    . LYS C 2 57  ? 14.592  4.593   28.126  1.00 54.65 ? 58  LYS A CD    1 
ATOM   894  C CE    . LYS C 2 57  ? 14.312  5.222   29.479  1.00 58.19 ? 58  LYS A CE    1 
ATOM   895  N NZ    . LYS C 2 57  ? 13.349  6.364   29.380  1.00 60.01 ? 58  LYS A NZ    1 
ATOM   896  N N     . HIS C 2 58  ? 14.762  -0.362  27.522  1.00 31.98 ? 59  HIS A N     1 
ATOM   897  C CA    . HIS C 2 58  ? 14.072  -1.277  28.427  1.00 29.83 ? 59  HIS A CA    1 
ATOM   898  C C     . HIS C 2 58  ? 14.505  -2.728  28.263  1.00 28.42 ? 59  HIS A C     1 
ATOM   899  O O     . HIS C 2 58  ? 13.846  -3.631  28.772  1.00 30.96 ? 59  HIS A O     1 
ATOM   900  C CB    . HIS C 2 58  ? 12.550  -1.165  28.262  1.00 29.91 ? 59  HIS A CB    1 
ATOM   901  C CG    . HIS C 2 58  ? 11.989  0.140   28.723  1.00 28.57 ? 59  HIS A CG    1 
ATOM   902  N ND1   . HIS C 2 58  ? 11.231  0.265   29.868  1.00 30.13 ? 59  HIS A ND1   1 
ATOM   903  C CD2   . HIS C 2 58  ? 12.083  1.385   28.200  1.00 32.17 ? 59  HIS A CD2   1 
ATOM   904  C CE1   . HIS C 2 58  ? 10.884  1.530   30.029  1.00 33.39 ? 59  HIS A CE1   1 
ATOM   905  N NE2   . HIS C 2 58  ? 11.389  2.229   29.029  1.00 31.48 ? 59  HIS A NE2   1 
ATOM   906  N N     . GLY C 2 59  ? 15.605  -2.948  27.549  1.00 26.45 ? 60  GLY A N     1 
ATOM   907  C CA    . GLY C 2 59  ? 16.119  -4.295  27.349  1.00 27.13 ? 60  GLY A CA    1 
ATOM   908  C C     . GLY C 2 59  ? 15.409  -5.220  26.372  1.00 28.08 ? 60  GLY A C     1 
ATOM   909  O O     . GLY C 2 59  ? 15.605  -6.439  26.406  1.00 28.42 ? 60  GLY A O     1 
ATOM   910  N N     . TYR C 2 60  ? 14.589  -4.662  25.492  1.00 28.60 ? 61  TYR A N     1 
ATOM   911  C CA    . TYR C 2 60  ? 13.878  -5.482  24.526  1.00 27.82 ? 61  TYR A CA    1 
ATOM   912  C C     . TYR C 2 60  ? 14.606  -5.551  23.193  1.00 29.05 ? 61  TYR A C     1 
ATOM   913  O O     . TYR C 2 60  ? 15.291  -4.608  22.789  1.00 32.52 ? 61  TYR A O     1 
ATOM   914  C CB    . TYR C 2 60  ? 12.472  -4.932  24.278  1.00 23.73 ? 61  TYR A CB    1 
ATOM   915  C CG    . TYR C 2 60  ? 11.481  -5.188  25.379  1.00 22.42 ? 61  TYR A CG    1 
ATOM   916  C CD1   . TYR C 2 60  ? 11.417  -4.354  26.495  1.00 19.44 ? 61  TYR A CD1   1 
ATOM   917  C CD2   . TYR C 2 60  ? 10.586  -6.252  25.294  1.00 24.40 ? 61  TYR A CD2   1 
ATOM   918  C CE1   . TYR C 2 60  ? 10.483  -4.570  27.497  1.00 28.95 ? 61  TYR A CE1   1 
ATOM   919  C CE2   . TYR C 2 60  ? 9.644   -6.482  26.292  1.00 27.62 ? 61  TYR A CE2   1 
ATOM   920  C CZ    . TYR C 2 60  ? 9.596   -5.637  27.390  1.00 32.01 ? 61  TYR A CZ    1 
ATOM   921  O OH    . TYR C 2 60  ? 8.653   -5.851  28.372  1.00 32.82 ? 61  TYR A OH    1 
ATOM   922  N N     . ILE C 2 61  ? 14.454  -6.680  22.518  1.00 29.09 ? 62  ILE A N     1 
ATOM   923  C CA    . ILE C 2 61  ? 15.024  -6.876  21.196  1.00 30.88 ? 62  ILE A CA    1 
ATOM   924  C C     . ILE C 2 61  ? 13.870  -6.434  20.289  1.00 29.72 ? 62  ILE A C     1 
ATOM   925  O O     . ILE C 2 61  ? 12.701  -6.654  20.635  1.00 27.32 ? 62  ILE A O     1 
ATOM   926  C CB    . ILE C 2 61  ? 15.313  -8.384  20.907  1.00 36.43 ? 62  ILE A CB    1 
ATOM   927  C CG1   . ILE C 2 61  ? 16.306  -8.940  21.926  1.00 42.04 ? 62  ILE A CG1   1 
ATOM   928  C CG2   . ILE C 2 61  ? 15.863  -8.569  19.490  1.00 38.83 ? 62  ILE A CG2   1 
ATOM   929  C CD1   . ILE C 2 61  ? 16.572  -10.420 21.750  1.00 44.70 ? 62  ILE A CD1   1 
ATOM   930  N N     . VAL C 2 62  ? 14.187  -5.807  19.156  1.00 28.17 ? 63  VAL A N     1 
ATOM   931  C CA    . VAL C 2 62  ? 13.166  -5.383  18.203  1.00 25.67 ? 63  VAL A CA    1 
ATOM   932  C C     . VAL C 2 62  ? 13.408  -6.149  16.908  1.00 27.33 ? 63  VAL A C     1 
ATOM   933  O O     . VAL C 2 62  ? 14.526  -6.169  16.388  1.00 29.05 ? 63  VAL A O     1 
ATOM   934  C CB    . VAL C 2 62  ? 13.226  -3.870  17.913  1.00 26.15 ? 63  VAL A CB    1 
ATOM   935  C CG1   . VAL C 2 62  ? 12.160  -3.480  16.882  1.00 29.20 ? 63  VAL A CG1   1 
ATOM   936  C CG2   . VAL C 2 62  ? 12.998  -3.102  19.179  1.00 24.84 ? 63  VAL A CG2   1 
ATOM   937  N N     . GLU C 2 63  ? 12.364  -6.787  16.395  1.00 26.17 ? 64  GLU A N     1 
ATOM   938  C CA    . GLU C 2 63  ? 12.468  -7.536  15.154  1.00 25.23 ? 64  GLU A CA    1 
ATOM   939  C C     . GLU C 2 63  ? 11.350  -7.179  14.189  1.00 24.84 ? 64  GLU A C     1 
ATOM   940  O O     . GLU C 2 63  ? 10.175  -7.101  14.569  1.00 23.68 ? 64  GLU A O     1 
ATOM   941  C CB    . GLU C 2 63  ? 12.445  -9.038  15.427  1.00 28.20 ? 64  GLU A CB    1 
ATOM   942  C CG    . GLU C 2 63  ? 13.666  -9.549  16.174  1.00 33.20 ? 64  GLU A CG    1 
ATOM   943  C CD    . GLU C 2 63  ? 13.716  -11.066 16.268  1.00 35.61 ? 64  GLU A CD    1 
ATOM   944  O OE1   . GLU C 2 63  ? 12.875  -11.745 15.633  1.00 32.95 ? 64  GLU A OE1   1 
ATOM   945  O OE2   . GLU C 2 63  ? 14.607  -11.578 16.979  1.00 35.91 ? 64  GLU A OE2   1 
ATOM   946  N N     . GLU C 2 64  ? 11.731  -6.957  12.936  1.00 24.26 ? 65  GLU A N     1 
ATOM   947  C CA    . GLU C 2 64  ? 10.791  -6.628  11.868  1.00 25.42 ? 65  GLU A CA    1 
ATOM   948  C C     . GLU C 2 64  ? 10.581  -7.908  11.061  1.00 23.61 ? 65  GLU A C     1 
ATOM   949  O O     . GLU C 2 64  ? 11.423  -8.805  11.103  1.00 23.59 ? 65  GLU A O     1 
ATOM   950  C CB    . GLU C 2 64  ? 11.372  -5.524  10.986  1.00 24.05 ? 65  GLU A CB    1 
ATOM   951  C CG    . GLU C 2 64  ? 11.760  -4.271  11.764  1.00 23.92 ? 65  GLU A CG    1 
ATOM   952  C CD    . GLU C 2 64  ? 12.253  -3.167  10.860  1.00 21.89 ? 65  GLU A CD    1 
ATOM   953  O OE1   . GLU C 2 64  ? 13.464  -3.133  10.556  1.00 31.38 ? 65  GLU A OE1   1 
ATOM   954  O OE2   . GLU C 2 64  ? 11.420  -2.336  10.451  1.00 30.32 ? 65  GLU A OE2   1 
ATOM   955  N N     . PRO C 2 65  ? 9.465   -8.013  10.319  1.00 25.48 ? 66  PRO A N     1 
ATOM   956  C CA    . PRO C 2 65  ? 9.207   -9.223  9.533   1.00 28.43 ? 66  PRO A CA    1 
ATOM   957  C C     . PRO C 2 65  ? 10.338  -9.574  8.570   1.00 33.80 ? 66  PRO A C     1 
ATOM   958  O O     . PRO C 2 65  ? 10.923  -8.690  7.945   1.00 34.85 ? 66  PRO A O     1 
ATOM   959  C CB    . PRO C 2 65  ? 7.912   -8.884  8.796   1.00 29.42 ? 66  PRO A CB    1 
ATOM   960  C CG    . PRO C 2 65  ? 7.241   -7.913  9.707   1.00 27.08 ? 66  PRO A CG    1 
ATOM   961  C CD    . PRO C 2 65  ? 8.374   -7.040  10.144  1.00 24.23 ? 66  PRO A CD    1 
ATOM   962  N N     . LYS C 2 66  ? 10.646  -10.866 8.465   1.00 37.90 ? 67  LYS A N     1 
ATOM   963  C CA    . LYS C 2 66  ? 11.694  -11.339 7.560   1.00 40.66 ? 67  LYS A CA    1 
ATOM   964  C C     . LYS C 2 66  ? 11.063  -11.576 6.190   1.00 40.35 ? 67  LYS A C     1 
ATOM   965  O O     . LYS C 2 66  ? 11.749  -11.596 5.166   1.00 42.09 ? 67  LYS A O     1 
ATOM   966  C CB    . LYS C 2 66  ? 12.325  -12.638 8.081   1.00 46.63 ? 67  LYS A CB    1 
ATOM   967  C CG    . LYS C 2 66  ? 13.182  -12.463 9.331   1.00 56.49 ? 67  LYS A CG    1 
ATOM   968  C CD    . LYS C 2 66  ? 13.851  -13.771 9.736   1.00 66.40 ? 67  LYS A CD    1 
ATOM   969  C CE    . LYS C 2 66  ? 14.751  -13.580 10.958  1.00 76.76 ? 67  LYS A CE    1 
ATOM   970  N NZ    . LYS C 2 66  ? 15.458  -14.838 11.367  1.00 78.17 ? 67  LYS A NZ    1 
ATOM   971  N N     . GLN C 2 67  ? 9.745   -11.752 6.188   1.00 39.16 ? 68  GLN A N     1 
ATOM   972  C CA    . GLN C 2 67  ? 8.993   -11.986 4.967   1.00 36.01 ? 68  GLN A CA    1 
ATOM   973  C C     . GLN C 2 67  ? 7.903   -10.940 4.837   1.00 34.25 ? 68  GLN A C     1 
ATOM   974  O O     . GLN C 2 67  ? 7.342   -10.502 5.842   1.00 34.67 ? 68  GLN A O     1 
ATOM   975  C CB    . GLN C 2 67  ? 8.331   -13.350 5.013   1.00 40.59 ? 68  GLN A CB    1 
ATOM   976  C CG    . GLN C 2 67  ? 9.262   -14.497 5.239   1.00 50.61 ? 68  GLN A CG    1 
ATOM   977  C CD    . GLN C 2 67  ? 8.517   -15.797 5.174   1.00 62.79 ? 68  GLN A CD    1 
ATOM   978  O OE1   . GLN C 2 67  ? 8.390   -16.503 6.175   1.00 68.10 ? 68  GLN A OE1   1 
ATOM   979  N NE2   . GLN C 2 67  ? 8.001   -16.124 3.991   1.00 61.04 ? 68  GLN A NE2   1 
ATOM   980  N N     . GLN C 2 68  ? 7.595   -10.551 3.605   1.00 31.86 ? 69  GLN A N     1 
ATOM   981  C CA    . GLN C 2 68  ? 6.554   -9.565  3.360   1.00 31.19 ? 69  GLN A CA    1 
ATOM   982  C C     . GLN C 2 68  ? 5.199   -10.174 3.668   1.00 30.94 ? 69  GLN A C     1 
ATOM   983  O O     . GLN C 2 68  ? 5.034   -11.394 3.604   1.00 32.98 ? 69  GLN A O     1 
ATOM   984  C CB    . GLN C 2 68  ? 6.584   -9.075  1.901   1.00 30.45 ? 69  GLN A CB    1 
ATOM   985  C CG    . GLN C 2 68  ? 7.665   -8.031  1.609   1.00 39.82 ? 69  GLN A CG    1 
ATOM   986  C CD    . GLN C 2 68  ? 7.506   -7.341  0.251   1.00 48.30 ? 69  GLN A CD    1 
ATOM   987  O OE1   . GLN C 2 68  ? 8.320   -7.545  -0.655  1.00 50.58 ? 69  GLN A OE1   1 
ATOM   988  N NE2   . GLN C 2 68  ? 6.462   -6.515  0.108   1.00 42.70 ? 69  GLN A NE2   1 
ATOM   989  N N     . ASN C 2 69  ? 4.237   -9.322  4.008   1.00 29.54 ? 70  ASN A N     1 
ATOM   990  C CA    . ASN C 2 69  ? 2.867   -9.747  4.304   1.00 30.41 ? 70  ASN A CA    1 
ATOM   991  C C     . ASN C 2 69  ? 2.725   -10.613 5.565   1.00 27.26 ? 70  ASN A C     1 
ATOM   992  O O     . ASN C 2 69  ? 1.874   -11.505 5.661   1.00 28.21 ? 70  ASN A O     1 
ATOM   993  C CB    . ASN C 2 69  ? 2.255   -10.416 3.059   1.00 32.73 ? 70  ASN A CB    1 
ATOM   994  C CG    . ASN C 2 69  ? 2.216   -9.464  1.846   1.00 44.61 ? 70  ASN A CG    1 
ATOM   995  O OD1   . ASN C 2 69  ? 2.714   -8.330  1.912   1.00 42.35 ? 70  ASN A OD1   1 
ATOM   996  N ND2   . ASN C 2 69  ? 1.630   -9.917  0.746   1.00 49.69 ? 70  ASN A ND2   1 
ATOM   997  N N     . HIS C 2 70  ? 3.585   -10.328 6.533   1.00 25.30 ? 71  HIS A N     1 
ATOM   998  C CA    . HIS C 2 70  ? 3.594   -10.994 7.822   1.00 25.58 ? 71  HIS A CA    1 
ATOM   999  C C     . HIS C 2 70  ? 3.399   -9.914  8.884   1.00 27.29 ? 71  HIS A C     1 
ATOM   1000 O O     . HIS C 2 70  ? 4.082   -8.882  8.871   1.00 28.18 ? 71  HIS A O     1 
ATOM   1001 C CB    . HIS C 2 70  ? 4.936   -11.683 8.076   1.00 25.82 ? 71  HIS A CB    1 
ATOM   1002 C CG    . HIS C 2 70  ? 4.995   -13.101 7.594   1.00 35.64 ? 71  HIS A CG    1 
ATOM   1003 N ND1   . HIS C 2 70  ? 4.253   -13.562 6.528   1.00 41.79 ? 71  HIS A ND1   1 
ATOM   1004 C CD2   . HIS C 2 70  ? 5.709   -14.160 8.040   1.00 36.69 ? 71  HIS A CD2   1 
ATOM   1005 C CE1   . HIS C 2 70  ? 4.503   -14.844 6.336   1.00 40.92 ? 71  HIS A CE1   1 
ATOM   1006 N NE2   . HIS C 2 70  ? 5.386   -15.232 7.242   1.00 43.94 ? 71  HIS A NE2   1 
ATOM   1007 N N     . TYR C 2 71  ? 2.461   -10.155 9.789   1.00 24.04 ? 72  TYR A N     1 
ATOM   1008 C CA    . TYR C 2 71  ? 2.177   -9.253  10.894  1.00 20.17 ? 72  TYR A CA    1 
ATOM   1009 C C     . TYR C 2 71  ? 3.113   -9.726  12.023  1.00 19.63 ? 72  TYR A C     1 
ATOM   1010 O O     . TYR C 2 71  ? 3.469   -10.902 12.061  1.00 18.48 ? 72  TYR A O     1 
ATOM   1011 C CB    . TYR C 2 71  ? 0.696   -9.419  11.264  1.00 23.12 ? 72  TYR A CB    1 
ATOM   1012 C CG    . TYR C 2 71  ? 0.272   -8.912  12.634  1.00 24.56 ? 72  TYR A CG    1 
ATOM   1013 C CD1   . TYR C 2 71  ? 0.321   -9.749  13.756  1.00 20.90 ? 72  TYR A CD1   1 
ATOM   1014 C CD2   . TYR C 2 71  ? -0.214  -7.615  12.801  1.00 16.96 ? 72  TYR A CD2   1 
ATOM   1015 C CE1   . TYR C 2 71  ? -0.107  -9.309  15.013  1.00 16.65 ? 72  TYR A CE1   1 
ATOM   1016 C CE2   . TYR C 2 71  ? -0.646  -7.163  14.053  1.00 20.52 ? 72  TYR A CE2   1 
ATOM   1017 C CZ    . TYR C 2 71  ? -0.590  -8.017  15.153  1.00 20.91 ? 72  TYR A CZ    1 
ATOM   1018 O OH    . TYR C 2 71  ? -1.022  -7.587  16.382  1.00 18.42 ? 72  TYR A OH    1 
ATOM   1019 N N     . PRO C 2 72  ? 3.555   -8.825  12.929  1.00 20.66 ? 73  PRO A N     1 
ATOM   1020 C CA    . PRO C 2 72  ? 3.321   -7.381  13.049  1.00 20.10 ? 73  PRO A CA    1 
ATOM   1021 C C     . PRO C 2 72  ? 4.527   -6.582  12.524  1.00 18.03 ? 73  PRO A C     1 
ATOM   1022 O O     . PRO C 2 72  ? 5.570   -7.166  12.196  1.00 17.60 ? 73  PRO A O     1 
ATOM   1023 C CB    . PRO C 2 72  ? 3.156   -7.211  14.562  1.00 15.97 ? 73  PRO A CB    1 
ATOM   1024 C CG    . PRO C 2 72  ? 4.219   -8.144  15.103  1.00 16.07 ? 73  PRO A CG    1 
ATOM   1025 C CD    . PRO C 2 72  ? 4.353   -9.295  14.081  1.00 18.19 ? 73  PRO A CD    1 
ATOM   1026 N N     . ASP C 2 73  ? 4.385   -5.257  12.458  1.00 16.99 ? 74  ASP A N     1 
ATOM   1027 C CA    . ASP C 2 73  ? 5.471   -4.378  11.997  1.00 16.79 ? 74  ASP A CA    1 
ATOM   1028 C C     . ASP C 2 73  ? 6.690   -4.507  12.887  1.00 17.23 ? 74  ASP A C     1 
ATOM   1029 O O     . ASP C 2 73  ? 7.818   -4.494  12.405  1.00 18.62 ? 74  ASP A O     1 
ATOM   1030 C CB    . ASP C 2 73  ? 5.033   -2.903  11.976  1.00 13.23 ? 74  ASP A CB    1 
ATOM   1031 C CG    . ASP C 2 73  ? 3.988   -2.609  10.904  1.00 18.55 ? 74  ASP A CG    1 
ATOM   1032 O OD1   . ASP C 2 73  ? 3.904   -3.347  9.897   1.00 18.64 ? 74  ASP A OD1   1 
ATOM   1033 O OD2   . ASP C 2 73  ? 3.237   -1.630  11.068  1.00 18.76 ? 74  ASP A OD2   1 
ATOM   1034 N N     . PHE C 2 74  ? 6.461   -4.628  14.192  1.00 17.66 ? 75  PHE A N     1 
ATOM   1035 C CA    . PHE C 2 74  ? 7.554   -4.763  15.146  1.00 17.34 ? 75  PHE A CA    1 
ATOM   1036 C C     . PHE C 2 74  ? 7.193   -5.786  16.204  1.00 18.04 ? 75  PHE A C     1 
ATOM   1037 O O     . PHE C 2 74  ? 6.080   -5.774  16.721  1.00 17.12 ? 75  PHE A O     1 
ATOM   1038 C CB    . PHE C 2 74  ? 7.843   -3.424  15.845  1.00 19.36 ? 75  PHE A CB    1 
ATOM   1039 C CG    . PHE C 2 74  ? 8.072   -2.278  14.897  1.00 28.25 ? 75  PHE A CG    1 
ATOM   1040 C CD1   . PHE C 2 74  ? 9.345   -2.022  14.382  1.00 30.04 ? 75  PHE A CD1   1 
ATOM   1041 C CD2   . PHE C 2 74  ? 7.009   -1.456  14.508  1.00 27.47 ? 75  PHE A CD2   1 
ATOM   1042 C CE1   . PHE C 2 74  ? 9.553   -0.964  13.490  1.00 26.34 ? 75  PHE A CE1   1 
ATOM   1043 C CE2   . PHE C 2 74  ? 7.206   -0.397  13.618  1.00 25.66 ? 75  PHE A CE2   1 
ATOM   1044 C CZ    . PHE C 2 74  ? 8.477   -0.151  13.110  1.00 22.42 ? 75  PHE A CZ    1 
ATOM   1045 N N     . THR C 2 75  ? 8.139   -6.668  16.506  1.00 20.19 ? 76  THR A N     1 
ATOM   1046 C CA    . THR C 2 75  ? 7.984   -7.687  17.543  1.00 21.47 ? 76  THR A CA    1 
ATOM   1047 C C     . THR C 2 75  ? 9.056   -7.359  18.594  1.00 21.67 ? 76  THR A C     1 
ATOM   1048 O O     . THR C 2 75  ? 10.250  -7.321  18.281  1.00 19.63 ? 76  THR A O     1 
ATOM   1049 C CB    . THR C 2 75  ? 8.225   -9.122  16.991  1.00 21.29 ? 76  THR A CB    1 
ATOM   1050 O OG1   . THR C 2 75  ? 7.189   -9.464  16.064  1.00 20.97 ? 76  THR A OG1   1 
ATOM   1051 C CG2   . THR C 2 75  ? 8.226   -10.153 18.124  1.00 22.55 ? 76  THR A CG2   1 
ATOM   1052 N N     . LEU C 2 76  ? 8.627   -7.099  19.824  1.00 22.30 ? 77  LEU A N     1 
ATOM   1053 C CA    . LEU C 2 76  ? 9.554   -6.794  20.918  1.00 25.09 ? 77  LEU A CA    1 
ATOM   1054 C C     . LEU C 2 76  ? 9.515   -7.932  21.938  1.00 26.48 ? 77  LEU A C     1 
ATOM   1055 O O     . LEU C 2 76  ? 8.446   -8.506  22.198  1.00 23.79 ? 77  LEU A O     1 
ATOM   1056 C CB    . LEU C 2 76  ? 9.179   -5.474  21.622  1.00 23.53 ? 77  LEU A CB    1 
ATOM   1057 C CG    . LEU C 2 76  ? 9.504   -4.125  20.976  1.00 27.48 ? 77  LEU A CG    1 
ATOM   1058 C CD1   . LEU C 2 76  ? 8.818   -3.996  19.633  1.00 27.47 ? 77  LEU A CD1   1 
ATOM   1059 C CD2   . LEU C 2 76  ? 9.058   -3.010  21.908  1.00 20.65 ? 77  LEU A CD2   1 
ATOM   1060 N N     . TYR C 2 77  ? 10.673  -8.259  22.505  1.00 29.31 ? 78  TYR A N     1 
ATOM   1061 C CA    . TYR C 2 77  ? 10.763  -9.305  23.525  1.00 32.08 ? 78  TYR A CA    1 
ATOM   1062 C C     . TYR C 2 77  ? 12.121  -9.315  24.211  1.00 33.40 ? 78  TYR A C     1 
ATOM   1063 O O     . TYR C 2 77  ? 13.136  -8.956  23.610  1.00 32.05 ? 78  TYR A O     1 
ATOM   1064 C CB    . TYR C 2 77  ? 10.477  -10.691 22.933  1.00 32.88 ? 78  TYR A CB    1 
ATOM   1065 C CG    . TYR C 2 77  ? 11.558  -11.238 22.031  1.00 42.00 ? 78  TYR A CG    1 
ATOM   1066 C CD1   . TYR C 2 77  ? 11.556  -10.969 20.664  1.00 42.92 ? 78  TYR A CD1   1 
ATOM   1067 C CD2   . TYR C 2 77  ? 12.573  -12.047 22.542  1.00 43.44 ? 78  TYR A CD2   1 
ATOM   1068 C CE1   . TYR C 2 77  ? 12.535  -11.494 19.832  1.00 45.64 ? 78  TYR A CE1   1 
ATOM   1069 C CE2   . TYR C 2 77  ? 13.556  -12.574 21.718  1.00 40.84 ? 78  TYR A CE2   1 
ATOM   1070 C CZ    . TYR C 2 77  ? 13.530  -12.296 20.366  1.00 45.30 ? 78  TYR A CZ    1 
ATOM   1071 O OH    . TYR C 2 77  ? 14.494  -12.832 19.547  1.00 48.79 ? 78  TYR A OH    1 
ATOM   1072 N N     . LYS C 2 78  ? 12.131  -9.714  25.478  1.00 35.71 ? 79  LYS A N     1 
ATOM   1073 C CA    . LYS C 2 78  ? 13.367  -9.805  26.235  1.00 36.64 ? 79  LYS A CA    1 
ATOM   1074 C C     . LYS C 2 78  ? 13.929  -11.192 25.954  1.00 38.48 ? 79  LYS A C     1 
ATOM   1075 O O     . LYS C 2 78  ? 13.177  -12.174 25.895  1.00 37.39 ? 79  LYS A O     1 
ATOM   1076 C CB    . LYS C 2 78  ? 13.095  -9.625  27.723  1.00 35.37 ? 79  LYS A CB    1 
ATOM   1077 C CG    . LYS C 2 78  ? 12.761  -8.198  28.101  1.00 37.93 ? 79  LYS A CG    1 
ATOM   1078 C CD    . LYS C 2 78  ? 12.619  -8.057  29.603  1.00 47.28 ? 79  LYS A CD    1 
ATOM   1079 C CE    . LYS C 2 78  ? 12.420  -6.606  29.988  1.00 53.32 ? 79  LYS A CE    1 
ATOM   1080 N NZ    . LYS C 2 78  ? 12.023  -6.450  31.414  1.00 59.69 ? 79  LYS A NZ    1 
ATOM   1081 N N     . PRO C 2 79  ? 15.257  -11.300 25.776  1.00 39.81 ? 80  PRO A N     1 
ATOM   1082 C CA    . PRO C 2 79  ? 15.921  -12.581 25.492  1.00 39.19 ? 80  PRO A CA    1 
ATOM   1083 C C     . PRO C 2 79  ? 15.592  -13.652 26.534  1.00 40.23 ? 80  PRO A C     1 
ATOM   1084 O O     . PRO C 2 79  ? 15.488  -14.837 26.214  1.00 39.37 ? 80  PRO A O     1 
ATOM   1085 C CB    . PRO C 2 79  ? 17.402  -12.213 25.518  1.00 41.99 ? 80  PRO A CB    1 
ATOM   1086 C CG    . PRO C 2 79  ? 17.403  -10.779 25.091  1.00 46.29 ? 80  PRO A CG    1 
ATOM   1087 C CD    . PRO C 2 79  ? 16.239  -10.203 25.846  1.00 42.70 ? 80  PRO A CD    1 
ATOM   1088 N N     . SER C 2 80  ? 15.429  -13.208 27.779  1.00 39.61 ? 81  SER A N     1 
ATOM   1089 C CA    . SER C 2 80  ? 15.118  -14.074 28.911  1.00 41.00 ? 81  SER A CA    1 
ATOM   1090 C C     . SER C 2 80  ? 13.663  -14.559 28.997  1.00 42.34 ? 81  SER A C     1 
ATOM   1091 O O     . SER C 2 80  ? 13.348  -15.435 29.808  1.00 45.38 ? 81  SER A O     1 
ATOM   1092 C CB    . SER C 2 80  ? 15.489  -13.340 30.195  1.00 39.29 ? 81  SER A CB    1 
ATOM   1093 O OG    . SER C 2 80  ? 14.972  -12.017 30.178  1.00 47.18 ? 81  SER A OG    1 
ATOM   1094 N N     . GLU C 2 81  ? 12.781  -13.991 28.174  1.00 41.22 ? 82  GLU A N     1 
ATOM   1095 C CA    . GLU C 2 81  ? 11.366  -14.366 28.170  1.00 39.64 ? 82  GLU A CA    1 
ATOM   1096 C C     . GLU C 2 81  ? 10.795  -14.380 26.753  1.00 38.34 ? 82  GLU A C     1 
ATOM   1097 O O     . GLU C 2 81  ? 9.964   -13.540 26.402  1.00 37.02 ? 82  GLU A O     1 
ATOM   1098 C CB    . GLU C 2 81  ? 10.544  -13.390 29.012  1.00 41.58 ? 82  GLU A CB    1 
ATOM   1099 C CG    . GLU C 2 81  ? 10.955  -13.278 30.456  1.00 49.11 ? 82  GLU A CG    1 
ATOM   1100 C CD    . GLU C 2 81  ? 10.121  -12.256 31.195  1.00 58.88 ? 82  GLU A CD    1 
ATOM   1101 O OE1   . GLU C 2 81  ? 10.432  -11.049 31.094  1.00 64.69 ? 82  GLU A OE1   1 
ATOM   1102 O OE2   . GLU C 2 81  ? 9.152   -12.659 31.876  1.00 64.34 ? 82  GLU A OE2   1 
ATOM   1103 N N     . PRO C 2 82  ? 11.225  -15.339 25.922  1.00 37.96 ? 83  PRO A N     1 
ATOM   1104 C CA    . PRO C 2 82  ? 10.739  -15.439 24.546  1.00 37.43 ? 83  PRO A CA    1 
ATOM   1105 C C     . PRO C 2 82  ? 9.230   -15.599 24.382  1.00 35.73 ? 83  PRO A C     1 
ATOM   1106 O O     . PRO C 2 82  ? 8.690   -15.241 23.346  1.00 36.13 ? 83  PRO A O     1 
ATOM   1107 C CB    . PRO C 2 82  ? 11.502  -16.648 23.996  1.00 41.76 ? 83  PRO A CB    1 
ATOM   1108 C CG    . PRO C 2 82  ? 11.780  -17.472 25.222  1.00 38.72 ? 83  PRO A CG    1 
ATOM   1109 C CD    . PRO C 2 82  ? 12.199  -16.408 26.202  1.00 38.56 ? 83  PRO A CD    1 
ATOM   1110 N N     . ASN C 2 83  ? 8.540   -16.122 25.387  1.00 34.70 ? 84  ASN A N     1 
ATOM   1111 C CA    . ASN C 2 83  ? 7.098   -16.312 25.254  1.00 34.49 ? 84  ASN A CA    1 
ATOM   1112 C C     . ASN C 2 83  ? 6.214   -15.176 25.742  1.00 32.80 ? 84  ASN A C     1 
ATOM   1113 O O     . ASN C 2 83  ? 5.018   -15.355 25.959  1.00 34.30 ? 84  ASN A O     1 
ATOM   1114 C CB    . ASN C 2 83  ? 6.665   -17.639 25.882  1.00 41.33 ? 84  ASN A CB    1 
ATOM   1115 C CG    . ASN C 2 83  ? 6.807   -18.802 24.918  1.00 52.10 ? 84  ASN A CG    1 
ATOM   1116 O OD1   . ASN C 2 83  ? 7.914   -19.134 24.485  1.00 54.12 ? 84  ASN A OD1   1 
ATOM   1117 N ND2   . ASN C 2 83  ? 5.683   -19.426 24.570  1.00 59.08 ? 84  ASN A ND2   1 
ATOM   1118 N N     . LYS C 2 84  ? 6.806   -14.006 25.922  1.00 29.89 ? 85  LYS A N     1 
ATOM   1119 C CA    . LYS C 2 84  ? 6.057   -12.835 26.337  1.00 29.56 ? 85  LYS A CA    1 
ATOM   1120 C C     . LYS C 2 84  ? 6.407   -11.718 25.352  1.00 29.83 ? 85  LYS A C     1 
ATOM   1121 O O     . LYS C 2 84  ? 6.953   -10.679 25.732  1.00 33.58 ? 85  LYS A O     1 
ATOM   1122 C CB    . LYS C 2 84  ? 6.412   -12.439 27.771  1.00 30.67 ? 85  LYS A CB    1 
ATOM   1123 C CG    . LYS C 2 84  ? 5.997   -13.473 28.801  1.00 38.41 ? 85  LYS A CG    1 
ATOM   1124 C CD    . LYS C 2 84  ? 6.086   -12.889 30.197  1.00 54.36 ? 85  LYS A CD    1 
ATOM   1125 C CE    . LYS C 2 84  ? 5.688   -13.911 31.247  1.00 65.32 ? 85  LYS A CE    1 
ATOM   1126 N NZ    . LYS C 2 84  ? 5.592   -13.278 32.601  1.00 73.04 ? 85  LYS A NZ    1 
ATOM   1127 N N     . LYS C 2 85  ? 6.094   -11.951 24.080  1.00 25.97 ? 86  LYS A N     1 
ATOM   1128 C CA    . LYS C 2 85  ? 6.362   -10.990 23.022  1.00 24.42 ? 86  LYS A CA    1 
ATOM   1129 C C     . LYS C 2 85  ? 5.263   -9.942  22.928  1.00 22.93 ? 86  LYS A C     1 
ATOM   1130 O O     . LYS C 2 85  ? 4.108   -10.200 23.278  1.00 21.09 ? 86  LYS A O     1 
ATOM   1131 C CB    . LYS C 2 85  ? 6.500   -11.707 21.678  1.00 24.82 ? 86  LYS A CB    1 
ATOM   1132 C CG    . LYS C 2 85  ? 7.656   -12.675 21.625  1.00 21.68 ? 86  LYS A CG    1 
ATOM   1133 C CD    . LYS C 2 85  ? 7.766   -13.315 20.270  1.00 17.26 ? 86  LYS A CD    1 
ATOM   1134 C CE    . LYS C 2 85  ? 9.132   -13.961 20.119  1.00 20.39 ? 86  LYS A CE    1 
ATOM   1135 N NZ    . LYS C 2 85  ? 9.141   -15.378 20.556  1.00 24.46 ? 86  LYS A NZ    1 
ATOM   1136 N N     . ILE C 2 86  ? 5.643   -8.756  22.462  1.00 22.07 ? 87  ILE A N     1 
ATOM   1137 C CA    . ILE C 2 86  ? 4.723   -7.639  22.280  1.00 21.15 ? 87  ILE A CA    1 
ATOM   1138 C C     . ILE C 2 86  ? 4.702   -7.337  20.776  1.00 19.41 ? 87  ILE A C     1 
ATOM   1139 O O     . ILE C 2 86  ? 5.763   -7.239  20.154  1.00 18.02 ? 87  ILE A O     1 
ATOM   1140 C CB    . ILE C 2 86  ? 5.207   -6.365  23.034  1.00 23.87 ? 87  ILE A CB    1 
ATOM   1141 C CG1   . ILE C 2 86  ? 5.271   -6.628  24.539  1.00 22.94 ? 87  ILE A CG1   1 
ATOM   1142 C CG2   . ILE C 2 86  ? 4.269   -5.178  22.741  1.00 17.36 ? 87  ILE A CG2   1 
ATOM   1143 C CD1   . ILE C 2 86  ? 5.732   -5.424  25.326  1.00 28.83 ? 87  ILE A CD1   1 
ATOM   1144 N N     . ALA C 2 87  ? 3.506   -7.205  20.203  1.00 17.95 ? 88  ALA A N     1 
ATOM   1145 C CA    . ALA C 2 87  ? 3.349   -6.903  18.779  1.00 17.78 ? 88  ALA A CA    1 
ATOM   1146 C C     . ALA C 2 87  ? 2.942   -5.446  18.639  1.00 18.96 ? 88  ALA A C     1 
ATOM   1147 O O     . ALA C 2 87  ? 2.035   -4.986  19.330  1.00 19.30 ? 88  ALA A O     1 
ATOM   1148 C CB    . ALA C 2 87  ? 2.276   -7.797  18.155  1.00 16.54 ? 88  ALA A CB    1 
ATOM   1149 N N     . ILE C 2 88  ? 3.613   -4.713  17.759  1.00 20.21 ? 89  ILE A N     1 
ATOM   1150 C CA    . ILE C 2 88  ? 3.272   -3.317  17.530  1.00 18.49 ? 89  ILE A CA    1 
ATOM   1151 C C     . ILE C 2 88  ? 3.012   -3.149  16.036  1.00 19.42 ? 89  ILE A C     1 
ATOM   1152 O O     . ILE C 2 88  ? 3.852   -3.498  15.204  1.00 18.46 ? 89  ILE A O     1 
ATOM   1153 C CB    . ILE C 2 88  ? 4.402   -2.353  17.968  1.00 20.43 ? 89  ILE A CB    1 
ATOM   1154 C CG1   . ILE C 2 88  ? 4.715   -2.539  19.456  1.00 22.01 ? 89  ILE A CG1   1 
ATOM   1155 C CG2   . ILE C 2 88  ? 3.973   -0.907  17.720  1.00 16.54 ? 89  ILE A CG2   1 
ATOM   1156 C CD1   . ILE C 2 88  ? 5.775   -1.598  19.984  1.00 22.36 ? 89  ILE A CD1   1 
ATOM   1157 N N     . ASP C 2 89  ? 1.839   -2.629  15.706  1.00 17.89 ? 90  ASP A N     1 
ATOM   1158 C CA    . ASP C 2 89  ? 1.459   -2.402  14.327  1.00 15.56 ? 90  ASP A CA    1 
ATOM   1159 C C     . ASP C 2 89  ? 1.142   -0.917  14.169  1.00 15.99 ? 90  ASP A C     1 
ATOM   1160 O O     . ASP C 2 89  ? 0.476   -0.319  15.024  1.00 14.75 ? 90  ASP A O     1 
ATOM   1161 C CB    . ASP C 2 89  ? 0.228   -3.240  13.978  1.00 14.53 ? 90  ASP A CB    1 
ATOM   1162 C CG    . ASP C 2 89  ? 0.334   -3.895  12.613  1.00 19.35 ? 90  ASP A CG    1 
ATOM   1163 O OD1   . ASP C 2 89  ? 1.453   -4.292  12.230  1.00 17.36 ? 90  ASP A OD1   1 
ATOM   1164 O OD2   . ASP C 2 89  ? -0.702  -4.016  11.928  1.00 21.97 ? 90  ASP A OD2   1 
ATOM   1165 N N     . ILE C 2 90  ? 1.626   -0.323  13.084  1.00 12.87 ? 91  ILE A N     1 
ATOM   1166 C CA    . ILE C 2 90  ? 1.378   1.085   12.821  1.00 14.77 ? 91  ILE A CA    1 
ATOM   1167 C C     . ILE C 2 90  ? 0.264   1.220   11.778  1.00 17.83 ? 91  ILE A C     1 
ATOM   1168 O O     . ILE C 2 90  ? 0.349   0.651   10.679  1.00 15.30 ? 91  ILE A O     1 
ATOM   1169 C CB    . ILE C 2 90  ? 2.679   1.788   12.367  1.00 20.56 ? 91  ILE A CB    1 
ATOM   1170 C CG1   . ILE C 2 90  ? 3.736   1.638   13.468  1.00 20.45 ? 91  ILE A CG1   1 
ATOM   1171 C CG2   . ILE C 2 90  ? 2.419   3.275   12.075  1.00 17.51 ? 91  ILE A CG2   1 
ATOM   1172 C CD1   . ILE C 2 90  ? 5.055   2.201   13.122  1.00 36.88 ? 91  ILE A CD1   1 
ATOM   1173 N N     . LYS C 2 91  ? -0.778  1.966   12.134  1.00 14.50 ? 92  LYS A N     1 
ATOM   1174 C CA    . LYS C 2 91  ? -1.923  2.171   11.262  1.00 17.84 ? 92  LYS A CA    1 
ATOM   1175 C C     . LYS C 2 91  ? -2.214  3.651   11.028  1.00 18.49 ? 92  LYS A C     1 
ATOM   1176 O O     . LYS C 2 91  ? -2.083  4.466   11.936  1.00 18.19 ? 92  LYS A O     1 
ATOM   1177 C CB    . LYS C 2 91  ? -3.139  1.433   11.832  1.00 16.93 ? 92  LYS A CB    1 
ATOM   1178 C CG    . LYS C 2 91  ? -2.849  -0.055  11.895  1.00 20.16 ? 92  LYS A CG    1 
ATOM   1179 C CD    . LYS C 2 91  ? -4.059  -0.891  12.079  1.00 25.00 ? 92  LYS A CD    1 
ATOM   1180 C CE    . LYS C 2 91  ? -3.730  -2.312  11.659  1.00 21.66 ? 92  LYS A CE    1 
ATOM   1181 N NZ    . LYS C 2 91  ? -3.479  -2.396  10.197  1.00 24.67 ? 92  LYS A NZ    1 
ATOM   1182 N N     . THR C 2 92  ? -2.603  3.988   9.801   1.00 16.71 ? 93  THR A N     1 
ATOM   1183 C CA    . THR C 2 92  ? -2.876  5.370   9.429   1.00 15.15 ? 93  THR A CA    1 
ATOM   1184 C C     . THR C 2 92  ? -4.230  5.553   8.758   1.00 15.39 ? 93  THR A C     1 
ATOM   1185 O O     . THR C 2 92  ? -4.741  4.652   8.083   1.00 15.50 ? 93  THR A O     1 
ATOM   1186 C CB    . THR C 2 92  ? -1.776  5.883   8.453   1.00 17.30 ? 93  THR A CB    1 
ATOM   1187 O OG1   . THR C 2 92  ? -0.484  5.684   9.037   1.00 15.37 ? 93  THR A OG1   1 
ATOM   1188 C CG2   . THR C 2 92  ? -1.952  7.363   8.139   1.00 15.58 ? 93  THR A CG2   1 
ATOM   1189 N N     . THR C 2 93  ? -4.809  6.728   8.972   1.00 15.28 ? 94  THR A N     1 
ATOM   1190 C CA    . THR C 2 93  ? -6.061  7.122   8.337   1.00 15.52 ? 94  THR A CA    1 
ATOM   1191 C C     . THR C 2 93  ? -6.062  8.653   8.266   1.00 18.67 ? 94  THR A C     1 
ATOM   1192 O O     . THR C 2 93  ? -5.223  9.322   8.882   1.00 15.02 ? 94  THR A O     1 
ATOM   1193 C CB    . THR C 2 93  ? -7.327  6.585   9.048   1.00 15.51 ? 94  THR A CB    1 
ATOM   1194 O OG1   . THR C 2 93  ? -8.440  6.683   8.141   1.00 12.72 ? 94  THR A OG1   1 
ATOM   1195 C CG2   . THR C 2 93  ? -7.644  7.379   10.326  1.00 14.20 ? 94  THR A CG2   1 
ATOM   1196 N N     . TYR C 2 94  ? -6.997  9.206   7.510   1.00 20.73 ? 95  TYR A N     1 
ATOM   1197 C CA    . TYR C 2 94  ? -7.051  10.643  7.329   1.00 21.30 ? 95  TYR A CA    1 
ATOM   1198 C C     . TYR C 2 94  ? -8.376  11.233  7.760   1.00 24.06 ? 95  TYR A C     1 
ATOM   1199 O O     . TYR C 2 94  ? -9.334  10.513  8.034   1.00 23.44 ? 95  TYR A O     1 
ATOM   1200 C CB    . TYR C 2 94  ? -6.791  10.986  5.853   1.00 25.75 ? 95  TYR A CB    1 
ATOM   1201 C CG    . TYR C 2 94  ? -7.989  10.811  4.931   1.00 31.96 ? 95  TYR A CG    1 
ATOM   1202 C CD1   . TYR C 2 94  ? -8.396  9.547   4.500   1.00 32.66 ? 95  TYR A CD1   1 
ATOM   1203 C CD2   . TYR C 2 94  ? -8.726  11.918  4.501   1.00 35.96 ? 95  TYR A CD2   1 
ATOM   1204 C CE1   . TYR C 2 94  ? -9.505  9.394   3.672   1.00 37.20 ? 95  TYR A CE1   1 
ATOM   1205 C CE2   . TYR C 2 94  ? -9.830  11.774  3.676   1.00 35.66 ? 95  TYR A CE2   1 
ATOM   1206 C CZ    . TYR C 2 94  ? -10.217 10.514  3.266   1.00 42.33 ? 95  TYR A CZ    1 
ATOM   1207 O OH    . TYR C 2 94  ? -11.323 10.379  2.464   1.00 37.33 ? 95  TYR A OH    1 
ATOM   1208 N N     . THR C 2 95  ? -8.412  12.557  7.806   1.00 25.90 ? 96  THR A N     1 
ATOM   1209 C CA    . THR C 2 95  ? -9.603  13.291  8.169   1.00 28.76 ? 96  THR A CA    1 
ATOM   1210 C C     . THR C 2 95  ? -9.588  14.531  7.262   1.00 32.78 ? 96  THR A C     1 
ATOM   1211 O O     . THR C 2 95  ? -8.511  15.047  6.935   1.00 31.61 ? 96  THR A O     1 
ATOM   1212 C CB    . THR C 2 95  ? -9.562  13.647  9.671   1.00 27.82 ? 96  THR A CB    1 
ATOM   1213 O OG1   . THR C 2 95  ? -10.892 13.866  10.148  1.00 36.30 ? 96  THR A OG1   1 
ATOM   1214 C CG2   . THR C 2 95  ? -8.715  14.875  9.927   1.00 21.90 ? 96  THR A CG2   1 
ATOM   1215 N N     . ASN C 2 96  ? -10.765 14.993  6.833   1.00 35.98 ? 97  ASN A N     1 
ATOM   1216 C CA    . ASN C 2 96  ? -10.843 16.169  5.955   1.00 40.46 ? 97  ASN A CA    1 
ATOM   1217 C C     . ASN C 2 96  ? -10.796 17.483  6.721   1.00 44.36 ? 97  ASN A C     1 
ATOM   1218 O O     . ASN C 2 96  ? -10.374 18.514  6.194   1.00 45.00 ? 97  ASN A O     1 
ATOM   1219 C CB    . ASN C 2 96  ? -12.083 16.114  5.062   1.00 39.63 ? 97  ASN A CB    1 
ATOM   1220 C CG    . ASN C 2 96  ? -11.877 15.239  3.836   1.00 41.66 ? 97  ASN A CG    1 
ATOM   1221 O OD1   . ASN C 2 96  ? -12.699 14.369  3.534   1.00 44.71 ? 97  ASN A OD1   1 
ATOM   1222 N ND2   . ASN C 2 96  ? -10.776 15.467  3.119   1.00 44.51 ? 97  ASN A ND2   1 
ATOM   1223 N N     . LYS C 2 97  ? -11.237 17.437  7.969   1.00 47.22 ? 98  LYS A N     1 
ATOM   1224 C CA    . LYS C 2 97  ? -11.199 18.590  8.853   1.00 50.69 ? 98  LYS A CA    1 
ATOM   1225 C C     . LYS C 2 97  ? -10.971 17.953  10.218  1.00 51.50 ? 98  LYS A C     1 
ATOM   1226 O O     . LYS C 2 97  ? -11.422 16.827  10.460  1.00 49.36 ? 98  LYS A O     1 
ATOM   1227 C CB    . LYS C 2 97  ? -12.515 19.384  8.804   1.00 55.29 ? 98  LYS A CB    1 
ATOM   1228 C CG    . LYS C 2 97  ? -13.693 18.757  9.511   1.00 61.75 ? 98  LYS A CG    1 
ATOM   1229 C CD    . LYS C 2 97  ? -14.908 19.669  9.461   1.00 73.53 ? 98  LYS A CD    1 
ATOM   1230 C CE    . LYS C 2 97  ? -16.070 19.096  10.262  1.00 80.89 ? 98  LYS A CE    1 
ATOM   1231 N NZ    . LYS C 2 97  ? -17.312 19.909  10.097  1.00 86.61 ? 98  LYS A NZ    1 
ATOM   1232 N N     . GLU C 2 98  ? -10.265 18.649  11.099  1.00 53.70 ? 99  GLU A N     1 
ATOM   1233 C CA    . GLU C 2 98  ? -9.971  18.118  12.428  1.00 57.54 ? 99  GLU A CA    1 
ATOM   1234 C C     . GLU C 2 98  ? -11.245 17.855  13.240  1.00 56.38 ? 99  GLU A C     1 
ATOM   1235 O O     . GLU C 2 98  ? -12.246 18.561  13.091  1.00 54.98 ? 99  GLU A O     1 
ATOM   1236 C CB    . GLU C 2 98  ? -9.053  19.095  13.183  1.00 67.22 ? 99  GLU A CB    1 
ATOM   1237 C CG    . GLU C 2 98  ? -7.710  19.367  12.480  1.00 75.90 ? 99  GLU A CG    1 
ATOM   1238 C CD    . GLU C 2 98  ? -6.998  20.622  12.988  1.00 83.94 ? 99  GLU A CD    1 
ATOM   1239 O OE1   . GLU C 2 98  ? -7.602  21.396  13.773  1.00 82.56 ? 99  GLU A OE1   1 
ATOM   1240 O OE2   . GLU C 2 98  ? -5.827  20.830  12.593  1.00 83.41 ? 99  GLU A OE2   1 
ATOM   1241 N N     . ASN C 2 99  ? -11.191 16.833  14.091  1.00 55.81 ? 100 ASN A N     1 
ATOM   1242 C CA    . ASN C 2 99  ? -12.305 16.455  14.965  1.00 57.01 ? 100 ASN A CA    1 
ATOM   1243 C C     . ASN C 2 99  ? -13.507 15.717  14.357  1.00 54.45 ? 100 ASN A C     1 
ATOM   1244 O O     . ASN C 2 99  ? -14.594 15.694  14.951  1.00 55.85 ? 100 ASN A O     1 
ATOM   1245 C CB    . ASN C 2 99  ? -12.789 17.667  15.771  1.00 65.59 ? 100 ASN A CB    1 
ATOM   1246 C CG    . ASN C 2 99  ? -11.707 18.218  16.685  1.00 77.99 ? 100 ASN A CG    1 
ATOM   1247 O OD1   . ASN C 2 99  ? -11.137 17.486  17.500  1.00 83.76 ? 100 ASN A OD1   1 
ATOM   1248 N ND2   . ASN C 2 99  ? -11.412 19.509  16.551  1.00 81.59 ? 100 ASN A ND2   1 
ATOM   1249 N N     . GLU C 2 100 ? -13.329 15.114  13.184  1.00 49.54 ? 101 GLU A N     1 
ATOM   1250 C CA    . GLU C 2 100 ? -14.401 14.323  12.571  1.00 44.44 ? 101 GLU A CA    1 
ATOM   1251 C C     . GLU C 2 100 ? -14.212 12.896  13.103  1.00 37.21 ? 101 GLU A C     1 
ATOM   1252 O O     . GLU C 2 100 ? -13.219 12.607  13.773  1.00 31.21 ? 101 GLU A O     1 
ATOM   1253 C CB    . GLU C 2 100 ? -14.272 14.297  11.044  1.00 49.33 ? 101 GLU A CB    1 
ATOM   1254 C CG    . GLU C 2 100 ? -14.637 15.584  10.326  1.00 56.54 ? 101 GLU A CG    1 
ATOM   1255 C CD    . GLU C 2 100 ? -14.519 15.470  8.801   1.00 65.48 ? 101 GLU A CD    1 
ATOM   1256 O OE1   . GLU C 2 100 ? -13.698 14.661  8.302   1.00 64.16 ? 101 GLU A OE1   1 
ATOM   1257 O OE2   . GLU C 2 100 ? -15.256 16.199  8.099   1.00 70.99 ? 101 GLU A OE2   1 
ATOM   1258 N N     . LYS C 2 101 ? -15.156 12.007  12.814  1.00 34.60 ? 102 LYS A N     1 
ATOM   1259 C CA    . LYS C 2 101 ? -15.030 10.620  13.260  1.00 30.28 ? 102 LYS A CA    1 
ATOM   1260 C C     . LYS C 2 101 ? -14.050 9.895   12.342  1.00 27.25 ? 102 LYS A C     1 
ATOM   1261 O O     . LYS C 2 101 ? -14.010 10.156  11.138  1.00 26.11 ? 102 LYS A O     1 
ATOM   1262 C CB    . LYS C 2 101 ? -16.389 9.901   13.249  1.00 28.68 ? 102 LYS A CB    1 
ATOM   1263 C CG    . LYS C 2 101 ? -17.323 10.365  14.352  1.00 39.11 ? 102 LYS A CG    1 
ATOM   1264 C CD    . LYS C 2 101 ? -18.576 9.522   14.455  1.00 47.51 ? 102 LYS A CD    1 
ATOM   1265 C CE    . LYS C 2 101 ? -19.342 9.900   15.717  1.00 57.55 ? 102 LYS A CE    1 
ATOM   1266 N NZ    . LYS C 2 101 ? -20.592 9.114   15.898  1.00 61.95 ? 102 LYS A NZ    1 
ATOM   1267 N N     . ILE C 2 102 ? -13.261 8.994   12.916  1.00 23.74 ? 103 ILE A N     1 
ATOM   1268 C CA    . ILE C 2 102 ? -12.288 8.211   12.159  1.00 22.93 ? 103 ILE A CA    1 
ATOM   1269 C C     . ILE C 2 102 ? -12.500 6.725   12.449  1.00 20.08 ? 103 ILE A C     1 
ATOM   1270 O O     . ILE C 2 102 ? -13.217 6.364   13.383  1.00 19.27 ? 103 ILE A O     1 
ATOM   1271 C CB    . ILE C 2 102 ? -10.824 8.602   12.526  1.00 23.75 ? 103 ILE A CB    1 
ATOM   1272 C CG1   . ILE C 2 102 ? -10.608 8.522   14.037  1.00 28.94 ? 103 ILE A CG1   1 
ATOM   1273 C CG2   . ILE C 2 102 ? -10.521 10.008  12.058  1.00 25.51 ? 103 ILE A CG2   1 
ATOM   1274 C CD1   . ILE C 2 102 ? -9.189  8.798   14.463  1.00 29.70 ? 103 ILE A CD1   1 
ATOM   1275 N N     . LYS C 2 103 ? -11.897 5.871   11.634  1.00 18.76 ? 104 LYS A N     1 
ATOM   1276 C CA    . LYS C 2 103 ? -11.971 4.422   11.817  1.00 18.72 ? 104 LYS A CA    1 
ATOM   1277 C C     . LYS C 2 103 ? -10.741 3.850   11.151  1.00 19.40 ? 104 LYS A C     1 
ATOM   1278 O O     . LYS C 2 103 ? -10.184 4.458   10.233  1.00 19.45 ? 104 LYS A O     1 
ATOM   1279 C CB    . LYS C 2 103 ? -13.258 3.818   11.229  1.00 23.90 ? 104 LYS A CB    1 
ATOM   1280 C CG    . LYS C 2 103 ? -13.516 4.071   9.756   1.00 28.36 ? 104 LYS A CG    1 
ATOM   1281 C CD    . LYS C 2 103 ? -14.949 3.670   9.404   1.00 40.11 ? 104 LYS A CD    1 
ATOM   1282 C CE    . LYS C 2 103 ? -15.242 3.808   7.907   1.00 47.74 ? 104 LYS A CE    1 
ATOM   1283 N NZ    . LYS C 2 103 ? -15.115 5.200   7.393   1.00 50.32 ? 104 LYS A NZ    1 
ATOM   1284 N N     . PHE C 2 104 ? -10.309 2.691   11.624  1.00 18.26 ? 105 PHE A N     1 
ATOM   1285 C CA    . PHE C 2 104 ? -9.117  2.031   11.114  1.00 16.31 ? 105 PHE A CA    1 
ATOM   1286 C C     . PHE C 2 104 ? -9.457  0.598   10.723  1.00 17.46 ? 105 PHE A C     1 
ATOM   1287 O O     . PHE C 2 104 ? -10.469 0.051   11.168  1.00 18.31 ? 105 PHE A O     1 
ATOM   1288 C CB    . PHE C 2 104 ? -8.042  1.952   12.213  1.00 13.21 ? 105 PHE A CB    1 
ATOM   1289 C CG    . PHE C 2 104 ? -7.494  3.287   12.662  1.00 13.60 ? 105 PHE A CG    1 
ATOM   1290 C CD1   . PHE C 2 104 ? -8.118  4.009   13.681  1.00 12.11 ? 105 PHE A CD1   1 
ATOM   1291 C CD2   . PHE C 2 104 ? -6.334  3.812   12.080  1.00 15.37 ? 105 PHE A CD2   1 
ATOM   1292 C CE1   . PHE C 2 104 ? -7.599  5.226   14.112  1.00 14.45 ? 105 PHE A CE1   1 
ATOM   1293 C CE2   . PHE C 2 104 ? -5.804  5.037   12.506  1.00 19.53 ? 105 PHE A CE2   1 
ATOM   1294 C CZ    . PHE C 2 104 ? -6.438  5.744   13.524  1.00 13.29 ? 105 PHE A CZ    1 
ATOM   1295 N N     . THR C 2 105 ? -8.619  -0.001  9.885   1.00 15.51 ? 106 THR A N     1 
ATOM   1296 C CA    . THR C 2 105 ? -8.787  -1.406  9.547   1.00 17.02 ? 106 THR A CA    1 
ATOM   1297 C C     . THR C 2 105 ? -7.754  -1.974  10.523  1.00 14.92 ? 106 THR A C     1 
ATOM   1298 O O     . THR C 2 105 ? -6.633  -1.489  10.579  1.00 17.80 ? 106 THR A O     1 
ATOM   1299 C CB    . THR C 2 105 ? -8.431  -1.728  8.070   1.00 15.20 ? 106 THR A CB    1 
ATOM   1300 O OG1   . THR C 2 105 ? -7.202  -1.088  7.702   1.00 21.06 ? 106 THR A OG1   1 
ATOM   1301 C CG2   . THR C 2 105 ? -9.544  -1.270  7.148   1.00 14.92 ? 106 THR A CG2   1 
ATOM   1302 N N     . LEU C 2 106 ? -8.136  -2.980  11.303  1.00 15.27 ? 107 LEU A N     1 
ATOM   1303 C CA    . LEU C 2 106 ? -7.248  -3.546  12.309  1.00 15.68 ? 107 LEU A CA    1 
ATOM   1304 C C     . LEU C 2 106 ? -6.634  -4.916  12.015  1.00 17.07 ? 107 LEU A C     1 
ATOM   1305 O O     . LEU C 2 106 ? -6.354  -5.681  12.938  1.00 19.68 ? 107 LEU A O     1 
ATOM   1306 C CB    . LEU C 2 106 ? -7.975  -3.563  13.665  1.00 17.75 ? 107 LEU A CB    1 
ATOM   1307 C CG    . LEU C 2 106 ? -8.366  -2.185  14.225  1.00 17.98 ? 107 LEU A CG    1 
ATOM   1308 C CD1   . LEU C 2 106 ? -9.195  -2.337  15.494  1.00 16.10 ? 107 LEU A CD1   1 
ATOM   1309 C CD2   . LEU C 2 106 ? -7.105  -1.369  14.495  1.00 18.66 ? 107 LEU A CD2   1 
ATOM   1310 N N     . GLY C 2 107 ? -6.417  -5.231  10.743  1.00 14.96 ? 108 GLY A N     1 
ATOM   1311 C CA    . GLY C 2 107 ? -5.824  -6.517  10.414  1.00 15.71 ? 108 GLY A CA    1 
ATOM   1312 C C     . GLY C 2 107 ? -6.859  -7.565  10.052  1.00 13.72 ? 108 GLY A C     1 
ATOM   1313 O O     . GLY C 2 107 ? -8.048  -7.384  10.305  1.00 13.10 ? 108 GLY A O     1 
ATOM   1314 N N     . GLY C 2 108 ? -6.414  -8.666  9.461   1.00 14.07 ? 109 GLY A N     1 
ATOM   1315 C CA    . GLY C 2 108 ? -7.351  -9.694  9.054   1.00 15.39 ? 109 GLY A CA    1 
ATOM   1316 C C     . GLY C 2 108 ? -7.983  -10.462 10.196  1.00 19.02 ? 109 GLY A C     1 
ATOM   1317 O O     . GLY C 2 108 ? -7.440  -10.522 11.302  1.00 18.06 ? 109 GLY A O     1 
ATOM   1318 N N     . TYR C 2 109 ? -9.146  -11.047 9.944   1.00 16.98 ? 110 TYR A N     1 
ATOM   1319 C CA    . TYR C 2 109 ? -9.774  -11.847 10.971  1.00 18.82 ? 110 TYR A CA    1 
ATOM   1320 C C     . TYR C 2 109 ? -9.781  -13.320 10.589  1.00 20.36 ? 110 TYR A C     1 
ATOM   1321 O O     . TYR C 2 109 ? -10.343 -14.136 11.304  1.00 20.83 ? 110 TYR A O     1 
ATOM   1322 C CB    . TYR C 2 109 ? -11.187 -11.347 11.312  1.00 17.03 ? 110 TYR A CB    1 
ATOM   1323 C CG    . TYR C 2 109 ? -12.222 -11.310 10.202  1.00 21.43 ? 110 TYR A CG    1 
ATOM   1324 C CD1   . TYR C 2 109 ? -12.859 -12.480 9.762   1.00 16.28 ? 110 TYR A CD1   1 
ATOM   1325 C CD2   . TYR C 2 109 ? -12.609 -10.091 9.630   1.00 15.83 ? 110 TYR A CD2   1 
ATOM   1326 C CE1   . TYR C 2 109 ? -13.863 -12.436 8.780   1.00 14.11 ? 110 TYR A CE1   1 
ATOM   1327 C CE2   . TYR C 2 109 ? -13.611 -10.033 8.648   1.00 19.64 ? 110 TYR A CE2   1 
ATOM   1328 C CZ    . TYR C 2 109 ? -14.233 -11.211 8.232   1.00 19.03 ? 110 TYR A CZ    1 
ATOM   1329 O OH    . TYR C 2 109 ? -15.230 -11.157 7.287   1.00 20.24 ? 110 TYR A OH    1 
ATOM   1330 N N     . THR C 2 110 ? -9.148  -13.665 9.467   1.00 18.14 ? 111 THR A N     1 
ATOM   1331 C CA    . THR C 2 110 ? -9.119  -15.063 9.039   1.00 18.69 ? 111 THR A CA    1 
ATOM   1332 C C     . THR C 2 110 ? -7.711  -15.640 8.987   1.00 19.62 ? 111 THR A C     1 
ATOM   1333 O O     . THR C 2 110 ? -7.527  -16.785 8.575   1.00 20.98 ? 111 THR A O     1 
ATOM   1334 C CB    . THR C 2 110 ? -9.811  -15.278 7.653   1.00 19.48 ? 111 THR A CB    1 
ATOM   1335 O OG1   . THR C 2 110 ? -9.055  -14.638 6.622   1.00 19.57 ? 111 THR A OG1   1 
ATOM   1336 C CG2   . THR C 2 110 ? -11.217 -14.709 7.653   1.00 13.68 ? 111 THR A CG2   1 
ATOM   1337 N N     . SER C 2 111 ? -6.717  -14.855 9.400   1.00 18.27 ? 112 SER A N     1 
ATOM   1338 C CA    . SER C 2 111 ? -5.340  -15.333 9.384   1.00 19.53 ? 112 SER A CA    1 
ATOM   1339 C C     . SER C 2 111 ? -4.861  -15.802 10.775  1.00 21.38 ? 112 SER A C     1 
ATOM   1340 O O     . SER C 2 111 ? -5.402  -16.766 11.314  1.00 20.48 ? 112 SER A O     1 
ATOM   1341 C CB    . SER C 2 111 ? -4.399  -14.265 8.794   1.00 22.65 ? 112 SER A CB    1 
ATOM   1342 O OG    . SER C 2 111 ? -4.493  -13.034 9.497   1.00 23.27 ? 112 SER A OG    1 
ATOM   1343 N N     . PHE C 2 112 ? -3.872  -15.122 11.355  1.00 19.75 ? 113 PHE A N     1 
ATOM   1344 C CA    . PHE C 2 112 ? -3.320  -15.504 12.650  1.00 21.07 ? 113 PHE A CA    1 
ATOM   1345 C C     . PHE C 2 112 ? -4.282  -15.618 13.830  1.00 21.57 ? 113 PHE A C     1 
ATOM   1346 O O     . PHE C 2 112 ? -3.973  -16.342 14.775  1.00 24.33 ? 113 PHE A O     1 
ATOM   1347 C CB    . PHE C 2 112 ? -2.129  -14.607 13.023  1.00 22.20 ? 113 PHE A CB    1 
ATOM   1348 C CG    . PHE C 2 112 ? -2.414  -13.136 12.910  1.00 23.29 ? 113 PHE A CG    1 
ATOM   1349 C CD1   . PHE C 2 112 ? -3.087  -12.461 13.925  1.00 19.54 ? 113 PHE A CD1   1 
ATOM   1350 C CD2   . PHE C 2 112 ? -2.022  -12.428 11.779  1.00 23.10 ? 113 PHE A CD2   1 
ATOM   1351 C CE1   . PHE C 2 112 ? -3.368  -11.103 13.812  1.00 23.29 ? 113 PHE A CE1   1 
ATOM   1352 C CE2   . PHE C 2 112 ? -2.298  -11.072 11.657  1.00 23.39 ? 113 PHE A CE2   1 
ATOM   1353 C CZ    . PHE C 2 112 ? -2.971  -10.408 12.673  1.00 25.16 ? 113 PHE A CZ    1 
ATOM   1354 N N     . ILE C 2 113 ? -5.428  -14.932 13.818  1.00 20.99 ? 114 ILE A N     1 
ATOM   1355 C CA    . ILE C 2 113 ? -6.325  -15.106 14.960  1.00 24.83 ? 114 ILE A CA    1 
ATOM   1356 C C     . ILE C 2 113 ? -7.091  -16.433 14.863  1.00 24.58 ? 114 ILE A C     1 
ATOM   1357 O O     . ILE C 2 113 ? -7.626  -16.902 15.856  1.00 22.03 ? 114 ILE A O     1 
ATOM   1358 C CB    . ILE C 2 113 ? -7.331  -13.927 15.204  1.00 27.37 ? 114 ILE A CB    1 
ATOM   1359 C CG1   . ILE C 2 113 ? -8.460  -13.941 14.182  1.00 29.45 ? 114 ILE A CG1   1 
ATOM   1360 C CG2   . ILE C 2 113 ? -6.597  -12.590 15.245  1.00 27.60 ? 114 ILE A CG2   1 
ATOM   1361 C CD1   . ILE C 2 113 ? -9.705  -13.220 14.670  1.00 22.16 ? 114 ILE A CD1   1 
ATOM   1362 N N     . ARG C 2 114 ? -7.142  -17.037 13.676  1.00 21.21 ? 115 ARG A N     1 
ATOM   1363 C CA    . ARG C 2 114 ? -7.830  -18.321 13.518  1.00 24.29 ? 115 ARG A CA    1 
ATOM   1364 C C     . ARG C 2 114 ? -6.850  -19.479 13.333  1.00 25.51 ? 115 ARG A C     1 
ATOM   1365 O O     . ARG C 2 114 ? -7.175  -20.630 13.606  1.00 26.42 ? 115 ARG A O     1 
ATOM   1366 C CB    . ARG C 2 114 ? -8.808  -18.284 12.341  1.00 21.40 ? 115 ARG A CB    1 
ATOM   1367 C CG    . ARG C 2 114 ? -9.985  -17.370 12.568  1.00 20.48 ? 115 ARG A CG    1 
ATOM   1368 C CD    . ARG C 2 114 ? -11.061 -17.533 11.506  1.00 17.28 ? 115 ARG A CD    1 
ATOM   1369 N NE    . ARG C 2 114 ? -12.026 -16.447 11.625  1.00 19.48 ? 115 ARG A NE    1 
ATOM   1370 C CZ    . ARG C 2 114 ? -13.316 -16.539 11.332  1.00 18.50 ? 115 ARG A CZ    1 
ATOM   1371 N NH1   . ARG C 2 114 ? -13.830 -17.678 10.889  1.00 22.00 ? 115 ARG A NH1   1 
ATOM   1372 N NH2   . ARG C 2 114 ? -14.097 -15.479 11.487  1.00 16.62 ? 115 ARG A NH2   1 
ATOM   1373 N N     . ASN C 2 115 ? -5.650  -19.161 12.866  1.00 27.80 ? 116 ASN A N     1 
ATOM   1374 C CA    . ASN C 2 115 ? -4.600  -20.146 12.630  1.00 30.41 ? 116 ASN A CA    1 
ATOM   1375 C C     . ASN C 2 115 ? -3.315  -19.582 13.240  1.00 30.35 ? 116 ASN A C     1 
ATOM   1376 O O     . ASN C 2 115 ? -2.711  -18.653 12.709  1.00 31.73 ? 116 ASN A O     1 
ATOM   1377 C CB    . ASN C 2 115 ? -4.434  -20.374 11.120  1.00 36.56 ? 116 ASN A CB    1 
ATOM   1378 C CG    . ASN C 2 115 ? -3.306  -21.353 10.782  1.00 48.33 ? 116 ASN A CG    1 
ATOM   1379 O OD1   . ASN C 2 115 ? -2.433  -21.653 11.606  1.00 51.17 ? 116 ASN A OD1   1 
ATOM   1380 N ND2   . ASN C 2 115 ? -3.323  -21.848 9.554   1.00 51.95 ? 116 ASN A ND2   1 
ATOM   1381 N N     . ASN C 2 116 ? -2.914  -20.165 14.359  1.00 29.70 ? 117 ASN A N     1 
ATOM   1382 C CA    . ASN C 2 116 ? -1.738  -19.761 15.126  1.00 28.09 ? 117 ASN A CA    1 
ATOM   1383 C C     . ASN C 2 116 ? -0.450  -19.318 14.395  1.00 28.77 ? 117 ASN A C     1 
ATOM   1384 O O     . ASN C 2 116 ? 0.263   -18.442 14.892  1.00 27.15 ? 117 ASN A O     1 
ATOM   1385 C CB    . ASN C 2 116 ? -1.407  -20.885 16.116  1.00 34.47 ? 117 ASN A CB    1 
ATOM   1386 C CG    . ASN C 2 116 ? -0.545  -20.422 17.276  1.00 35.49 ? 117 ASN A CG    1 
ATOM   1387 O OD1   . ASN C 2 116 ? -0.937  -19.534 18.033  1.00 40.79 ? 117 ASN A OD1   1 
ATOM   1388 N ND2   . ASN C 2 116 ? 0.635   -21.022 17.425  1.00 31.07 ? 117 ASN A ND2   1 
ATOM   1389 N N     . THR C 2 117 ? -0.134  -19.902 13.240  1.00 27.70 ? 118 THR A N     1 
ATOM   1390 C CA    . THR C 2 117 ? 1.102   -19.529 12.539  1.00 27.69 ? 118 THR A CA    1 
ATOM   1391 C C     . THR C 2 117 ? 0.930   -18.931 11.148  1.00 26.92 ? 118 THR A C     1 
ATOM   1392 O O     . THR C 2 117 ? 1.886   -18.862 10.378  1.00 27.02 ? 118 THR A O     1 
ATOM   1393 C CB    . THR C 2 117 ? 2.045   -20.735 12.408  1.00 30.83 ? 118 THR A CB    1 
ATOM   1394 O OG1   . THR C 2 117 ? 1.310   -21.855 11.905  1.00 32.16 ? 118 THR A OG1   1 
ATOM   1395 C CG2   . THR C 2 117 ? 2.659   -21.088 13.753  1.00 30.73 ? 118 THR A CG2   1 
ATOM   1396 N N     . LYS C 2 118 ? -0.280  -18.494 10.829  1.00 25.98 ? 119 LYS A N     1 
ATOM   1397 C CA    . LYS C 2 118 ? -0.576  -17.925 9.520   1.00 25.87 ? 119 LYS A CA    1 
ATOM   1398 C C     . LYS C 2 118 ? -0.329  -16.411 9.425   1.00 26.24 ? 119 LYS A C     1 
ATOM   1399 O O     . LYS C 2 118 ? -0.935  -15.629 10.164  1.00 25.39 ? 119 LYS A O     1 
ATOM   1400 C CB    . LYS C 2 118 ? -2.026  -18.226 9.179   1.00 26.41 ? 119 LYS A CB    1 
ATOM   1401 C CG    . LYS C 2 118 ? -2.418  -17.971 7.755   1.00 39.94 ? 119 LYS A CG    1 
ATOM   1402 C CD    . LYS C 2 118 ? -3.870  -18.307 7.648   1.00 43.75 ? 119 LYS A CD    1 
ATOM   1403 C CE    . LYS C 2 118 ? -4.360  -18.314 6.246   1.00 41.61 ? 119 LYS A CE    1 
ATOM   1404 N NZ    . LYS C 2 118 ? -5.794  -18.661 6.367   1.00 41.14 ? 119 LYS A NZ    1 
ATOM   1405 N N     . ASN C 2 119 ? 0.559   -16.024 8.507   1.00 23.07 ? 120 ASN A N     1 
ATOM   1406 C CA    . ASN C 2 119 ? 0.924   -14.622 8.244   1.00 23.86 ? 120 ASN A CA    1 
ATOM   1407 C C     . ASN C 2 119 ? 1.397   -13.839 9.464   1.00 21.92 ? 120 ASN A C     1 
ATOM   1408 O O     . ASN C 2 119 ? 1.112   -12.649 9.606   1.00 18.53 ? 120 ASN A O     1 
ATOM   1409 C CB    . ASN C 2 119 ? -0.241  -13.873 7.573   1.00 23.50 ? 120 ASN A CB    1 
ATOM   1410 C CG    . ASN C 2 119 ? -0.522  -14.378 6.176   1.00 25.85 ? 120 ASN A CG    1 
ATOM   1411 O OD1   . ASN C 2 119 ? -1.413  -15.199 5.978   1.00 25.92 ? 120 ASN A OD1   1 
ATOM   1412 N ND2   . ASN C 2 119 ? 0.237   -13.892 5.202   1.00 21.67 ? 120 ASN A ND2   1 
ATOM   1413 N N     . ILE C 2 120 ? 2.138   -14.504 10.336  1.00 20.84 ? 121 ILE A N     1 
ATOM   1414 C CA    . ILE C 2 120 ? 2.621   -13.850 11.537  1.00 20.86 ? 121 ILE A CA    1 
ATOM   1415 C C     . ILE C 2 120 ? 4.075   -14.278 11.721  1.00 19.47 ? 121 ILE A C     1 
ATOM   1416 O O     . ILE C 2 120 ? 4.441   -15.402 11.372  1.00 21.91 ? 121 ILE A O     1 
ATOM   1417 C CB    . ILE C 2 120 ? 1.669   -14.197 12.742  1.00 19.52 ? 121 ILE A CB    1 
ATOM   1418 C CG1   . ILE C 2 120 ? 2.062   -13.415 14.004  1.00 19.71 ? 121 ILE A CG1   1 
ATOM   1419 C CG2   . ILE C 2 120 ? 1.603   -15.705 12.944  1.00 17.26 ? 121 ILE A CG2   1 
ATOM   1420 C CD1   . ILE C 2 120 ? 0.964   -13.377 15.070  1.00 14.54 ? 121 ILE A CD1   1 
ATOM   1421 N N     . VAL C 2 121 ? 4.905   -13.378 12.241  1.00 19.75 ? 122 VAL A N     1 
ATOM   1422 C CA    . VAL C 2 121 ? 6.325   -13.659 12.422  1.00 20.93 ? 122 VAL A CA    1 
ATOM   1423 C C     . VAL C 2 121 ? 6.571   -14.794 13.407  1.00 24.21 ? 122 VAL A C     1 
ATOM   1424 O O     . VAL C 2 121 ? 7.371   -15.688 13.134  1.00 26.39 ? 122 VAL A O     1 
ATOM   1425 C CB    . VAL C 2 121 ? 7.105   -12.386 12.851  1.00 22.41 ? 122 VAL A CB    1 
ATOM   1426 C CG1   . VAL C 2 121 ? 8.598   -12.680 12.921  1.00 22.48 ? 122 VAL A CG1   1 
ATOM   1427 C CG2   . VAL C 2 121 ? 6.852   -11.256 11.849  1.00 21.83 ? 122 VAL A CG2   1 
ATOM   1428 N N     . TYR C 2 122 ? 5.888   -14.758 14.545  1.00 23.00 ? 123 TYR A N     1 
ATOM   1429 C CA    . TYR C 2 122 ? 6.023   -15.803 15.556  1.00 23.77 ? 123 TYR A CA    1 
ATOM   1430 C C     . TYR C 2 122 ? 4.632   -16.330 15.832  1.00 23.05 ? 123 TYR A C     1 
ATOM   1431 O O     . TYR C 2 122 ? 3.655   -15.611 15.625  1.00 23.29 ? 123 TYR A O     1 
ATOM   1432 C CB    . TYR C 2 122 ? 6.606   -15.239 16.856  1.00 23.75 ? 123 TYR A CB    1 
ATOM   1433 C CG    . TYR C 2 122 ? 8.084   -14.984 16.794  1.00 24.42 ? 123 TYR A CG    1 
ATOM   1434 C CD1   . TYR C 2 122 ? 8.987   -16.033 16.944  1.00 26.01 ? 123 TYR A CD1   1 
ATOM   1435 C CD2   . TYR C 2 122 ? 8.589   -13.696 16.579  1.00 20.45 ? 123 TYR A CD2   1 
ATOM   1436 C CE1   . TYR C 2 122 ? 10.361  -15.819 16.883  1.00 25.94 ? 123 TYR A CE1   1 
ATOM   1437 C CE2   . TYR C 2 122 ? 9.971   -13.467 16.514  1.00 20.99 ? 123 TYR A CE2   1 
ATOM   1438 C CZ    . TYR C 2 122 ? 10.846  -14.540 16.668  1.00 26.50 ? 123 TYR A CZ    1 
ATOM   1439 O OH    . TYR C 2 122 ? 12.205  -14.350 16.613  1.00 27.65 ? 123 TYR A OH    1 
ATOM   1440 N N     . PRO C 2 123 ? 4.515   -17.591 16.292  1.00 24.24 ? 124 PRO A N     1 
ATOM   1441 C CA    . PRO C 2 123 ? 3.182   -18.135 16.580  1.00 22.20 ? 124 PRO A CA    1 
ATOM   1442 C C     . PRO C 2 123 ? 2.388   -17.140 17.446  1.00 19.49 ? 124 PRO A C     1 
ATOM   1443 O O     . PRO C 2 123 ? 2.931   -16.552 18.386  1.00 18.02 ? 124 PRO A O     1 
ATOM   1444 C CB    . PRO C 2 123 ? 3.505   -19.438 17.309  1.00 24.87 ? 124 PRO A CB    1 
ATOM   1445 C CG    . PRO C 2 123 ? 4.783   -19.883 16.623  1.00 21.90 ? 124 PRO A CG    1 
ATOM   1446 C CD    . PRO C 2 123 ? 5.569   -18.590 16.560  1.00 20.14 ? 124 PRO A CD    1 
ATOM   1447 N N     . PHE C 2 124 ? 1.112   -16.958 17.118  1.00 17.61 ? 125 PHE A N     1 
ATOM   1448 C CA    . PHE C 2 124 ? 0.216   -16.022 17.807  1.00 19.76 ? 125 PHE A CA    1 
ATOM   1449 C C     . PHE C 2 124 ? 0.183   -16.146 19.333  1.00 23.33 ? 125 PHE A C     1 
ATOM   1450 O O     . PHE C 2 124 ? 0.045   -15.142 20.042  1.00 21.38 ? 125 PHE A O     1 
ATOM   1451 C CB    . PHE C 2 124 ? -1.205  -16.188 17.248  1.00 16.14 ? 125 PHE A CB    1 
ATOM   1452 C CG    . PHE C 2 124 ? -2.204  -15.184 17.770  1.00 20.08 ? 125 PHE A CG    1 
ATOM   1453 C CD1   . PHE C 2 124 ? -2.199  -13.866 17.308  1.00 20.59 ? 125 PHE A CD1   1 
ATOM   1454 C CD2   . PHE C 2 124 ? -3.172  -15.563 18.700  1.00 22.11 ? 125 PHE A CD2   1 
ATOM   1455 C CE1   . PHE C 2 124 ? -3.146  -12.941 17.762  1.00 21.93 ? 125 PHE A CE1   1 
ATOM   1456 C CE2   . PHE C 2 124 ? -4.124  -14.647 19.161  1.00 24.90 ? 125 PHE A CE2   1 
ATOM   1457 C CZ    . PHE C 2 124 ? -4.110  -13.331 18.689  1.00 24.65 ? 125 PHE A CZ    1 
ATOM   1458 N N     . ASP C 2 125 ? 0.306   -17.372 19.837  1.00 24.40 ? 126 ASP A N     1 
ATOM   1459 C CA    . ASP C 2 125 ? 0.267   -17.586 21.274  1.00 27.73 ? 126 ASP A CA    1 
ATOM   1460 C C     . ASP C 2 125 ? 1.509   -17.128 22.045  1.00 26.24 ? 126 ASP A C     1 
ATOM   1461 O O     . ASP C 2 125 ? 1.518   -17.167 23.273  1.00 29.31 ? 126 ASP A O     1 
ATOM   1462 C CB    . ASP C 2 125 ? -0.104  -19.046 21.609  1.00 29.55 ? 126 ASP A CB    1 
ATOM   1463 C CG    . ASP C 2 125 ? 0.802   -20.075 20.941  1.00 34.85 ? 126 ASP A CG    1 
ATOM   1464 O OD1   . ASP C 2 125 ? 1.889   -19.724 20.438  1.00 42.05 ? 126 ASP A OD1   1 
ATOM   1465 O OD2   . ASP C 2 125 ? 0.413   -21.261 20.925  1.00 44.12 ? 126 ASP A OD2   1 
ATOM   1466 N N     . GLN C 2 126 ? 2.548   -16.695 21.337  1.00 23.55 ? 127 GLN A N     1 
ATOM   1467 C CA    . GLN C 2 126 ? 3.758   -16.197 21.998  1.00 23.71 ? 127 GLN A CA    1 
ATOM   1468 C C     . GLN C 2 126 ? 3.682   -14.692 22.252  1.00 22.21 ? 127 GLN A C     1 
ATOM   1469 O O     . GLN C 2 126 ? 4.599   -14.115 22.826  1.00 24.59 ? 127 GLN A O     1 
ATOM   1470 C CB    . GLN C 2 126 ? 5.015   -16.511 21.181  1.00 23.31 ? 127 GLN A CB    1 
ATOM   1471 C CG    . GLN C 2 126 ? 5.338   -17.988 21.103  1.00 26.91 ? 127 GLN A CG    1 
ATOM   1472 C CD    . GLN C 2 126 ? 6.509   -18.287 20.205  1.00 29.68 ? 127 GLN A CD    1 
ATOM   1473 O OE1   . GLN C 2 126 ? 7.296   -17.406 19.867  1.00 31.43 ? 127 GLN A OE1   1 
ATOM   1474 N NE2   . GLN C 2 126 ? 6.635   -19.543 19.809  1.00 31.84 ? 127 GLN A NE2   1 
ATOM   1475 N N     . TYR C 2 127 ? 2.594   -14.055 21.825  1.00 21.74 ? 128 TYR A N     1 
ATOM   1476 C CA    . TYR C 2 127 ? 2.417   -12.616 22.031  1.00 20.04 ? 128 TYR A CA    1 
ATOM   1477 C C     . TYR C 2 127 ? 1.462   -12.375 23.187  1.00 20.07 ? 128 TYR A C     1 
ATOM   1478 O O     . TYR C 2 127 ? 0.365   -12.926 23.207  1.00 21.13 ? 128 TYR A O     1 
ATOM   1479 C CB    . TYR C 2 127 ? 1.847   -11.939 20.774  1.00 16.07 ? 128 TYR A CB    1 
ATOM   1480 C CG    . TYR C 2 127 ? 2.806   -11.897 19.608  1.00 17.17 ? 128 TYR A CG    1 
ATOM   1481 C CD1   . TYR C 2 127 ? 2.848   -12.940 18.675  1.00 14.74 ? 128 TYR A CD1   1 
ATOM   1482 C CD2   . TYR C 2 127 ? 3.679   -10.818 19.437  1.00 18.01 ? 128 TYR A CD2   1 
ATOM   1483 C CE1   . TYR C 2 127 ? 3.739   -12.914 17.595  1.00 14.19 ? 128 TYR A CE1   1 
ATOM   1484 C CE2   . TYR C 2 127 ? 4.577   -10.778 18.361  1.00 16.59 ? 128 TYR A CE2   1 
ATOM   1485 C CZ    . TYR C 2 127 ? 4.600   -11.829 17.446  1.00 15.33 ? 128 TYR A CZ    1 
ATOM   1486 O OH    . TYR C 2 127 ? 5.484   -11.799 16.394  1.00 19.57 ? 128 TYR A OH    1 
ATOM   1487 N N     . ILE C 2 128 ? 1.875   -11.554 24.144  1.00 18.57 ? 129 ILE A N     1 
ATOM   1488 C CA    . ILE C 2 128 ? 1.023   -11.244 25.281  1.00 20.92 ? 129 ILE A CA    1 
ATOM   1489 C C     . ILE C 2 128 ? 0.294   -9.926  25.074  1.00 20.53 ? 129 ILE A C     1 
ATOM   1490 O O     . ILE C 2 128 ? -0.678  -9.634  25.774  1.00 21.65 ? 129 ILE A O     1 
ATOM   1491 C CB    . ILE C 2 128 ? 1.824   -11.190 26.608  1.00 23.84 ? 129 ILE A CB    1 
ATOM   1492 C CG1   . ILE C 2 128 ? 2.953   -10.165 26.516  1.00 23.25 ? 129 ILE A CG1   1 
ATOM   1493 C CG2   . ILE C 2 128 ? 2.378   -12.567 26.925  1.00 32.57 ? 129 ILE A CG2   1 
ATOM   1494 C CD1   . ILE C 2 128 ? 3.420   -9.674  27.848  1.00 32.59 ? 129 ILE A CD1   1 
ATOM   1495 N N     . ALA C 2 129 ? 0.760   -9.127  24.114  1.00 18.31 ? 130 ALA A N     1 
ATOM   1496 C CA    . ALA C 2 129 ? 0.142   -7.835  23.822  1.00 17.70 ? 130 ALA A CA    1 
ATOM   1497 C C     . ALA C 2 129 ? 0.200   -7.483  22.335  1.00 17.64 ? 130 ALA A C     1 
ATOM   1498 O O     . ALA C 2 129 ? 1.145   -7.841  21.626  1.00 16.34 ? 130 ALA A O     1 
ATOM   1499 C CB    . ALA C 2 129 ? 0.812   -6.726  24.635  1.00 16.57 ? 130 ALA A CB    1 
ATOM   1500 N N     . HIS C 2 130 ? -0.828  -6.786  21.876  1.00 16.81 ? 131 HIS A N     1 
ATOM   1501 C CA    . HIS C 2 130 ? -0.921  -6.328  20.493  1.00 17.32 ? 131 HIS A CA    1 
ATOM   1502 C C     . HIS C 2 130 ? -1.292  -4.856  20.588  1.00 15.73 ? 131 HIS A C     1 
ATOM   1503 O O     . HIS C 2 130 ? -2.433  -4.509  20.910  1.00 15.58 ? 131 HIS A O     1 
ATOM   1504 C CB    . HIS C 2 130 ? -1.992  -7.114  19.721  1.00 14.09 ? 131 HIS A CB    1 
ATOM   1505 C CG    . HIS C 2 130 ? -1.692  -8.575  19.613  1.00 19.98 ? 131 HIS A CG    1 
ATOM   1506 N ND1   . HIS C 2 130 ? -0.912  -9.104  18.606  1.00 21.93 ? 131 HIS A ND1   1 
ATOM   1507 C CD2   . HIS C 2 130 ? -2.034  -9.617  20.410  1.00 17.85 ? 131 HIS A CD2   1 
ATOM   1508 C CE1   . HIS C 2 130 ? -0.783  -10.404 18.788  1.00 22.25 ? 131 HIS A CE1   1 
ATOM   1509 N NE2   . HIS C 2 130 ? -1.453  -10.741 19.875  1.00 18.22 ? 131 HIS A NE2   1 
ATOM   1510 N N     . TRP C 2 131 ? -0.307  -4.001  20.323  1.00 15.64 ? 132 TRP A N     1 
ATOM   1511 C CA    . TRP C 2 131 ? -0.473  -2.558  20.374  1.00 15.72 ? 132 TRP A CA    1 
ATOM   1512 C C     . TRP C 2 131 ? -0.606  -1.956  18.981  1.00 15.83 ? 132 TRP A C     1 
ATOM   1513 O O     . TRP C 2 131 ? 0.074   -2.375  18.043  1.00 17.88 ? 132 TRP A O     1 
ATOM   1514 C CB    . TRP C 2 131 ? 0.736   -1.907  21.048  1.00 15.64 ? 132 TRP A CB    1 
ATOM   1515 C CG    . TRP C 2 131 ? 0.906   -2.222  22.493  1.00 23.27 ? 132 TRP A CG    1 
ATOM   1516 C CD1   . TRP C 2 131 ? -0.031  -2.750  23.343  1.00 20.96 ? 132 TRP A CD1   1 
ATOM   1517 C CD2   . TRP C 2 131 ? 2.089   -2.021  23.270  1.00 22.37 ? 132 TRP A CD2   1 
ATOM   1518 N NE1   . TRP C 2 131 ? 0.506   -2.888  24.599  1.00 23.49 ? 132 TRP A NE1   1 
ATOM   1519 C CE2   . TRP C 2 131 ? 1.803   -2.450  24.585  1.00 22.26 ? 132 TRP A CE2   1 
ATOM   1520 C CE3   . TRP C 2 131 ? 3.367   -1.518  22.985  1.00 20.32 ? 132 TRP A CE3   1 
ATOM   1521 C CZ2   . TRP C 2 131 ? 2.751   -2.391  25.616  1.00 23.83 ? 132 TRP A CZ2   1 
ATOM   1522 C CZ3   . TRP C 2 131 ? 4.309   -1.459  24.010  1.00 21.38 ? 132 TRP A CZ3   1 
ATOM   1523 C CH2   . TRP C 2 131 ? 3.994   -1.894  25.308  1.00 18.11 ? 132 TRP A CH2   1 
ATOM   1524 N N     . ILE C 2 132 ? -1.480  -0.969  18.862  1.00 12.98 ? 133 ILE A N     1 
ATOM   1525 C CA    . ILE C 2 132 ? -1.683  -0.260  17.613  1.00 15.47 ? 133 ILE A CA    1 
ATOM   1526 C C     . ILE C 2 132 ? -1.195  1.171   17.832  1.00 15.99 ? 133 ILE A C     1 
ATOM   1527 O O     . ILE C 2 132 ? -1.631  1.843   18.779  1.00 14.46 ? 133 ILE A O     1 
ATOM   1528 C CB    . ILE C 2 132 ? -3.189  -0.169  17.222  1.00 14.85 ? 133 ILE A CB    1 
ATOM   1529 C CG1   . ILE C 2 132 ? -3.785  -1.566  16.980  1.00 15.89 ? 133 ILE A CG1   1 
ATOM   1530 C CG2   . ILE C 2 132 ? -3.355  0.754   16.015  1.00 11.54 ? 133 ILE A CG2   1 
ATOM   1531 C CD1   . ILE C 2 132 ? -3.119  -2.354  15.890  1.00 18.17 ? 133 ILE A CD1   1 
ATOM   1532 N N     . ILE C 2 133 ? -0.281  1.625   16.980  1.00 16.74 ? 134 ILE A N     1 
ATOM   1533 C CA    . ILE C 2 133 ? 0.170   3.010   17.019  1.00 14.05 ? 134 ILE A CA    1 
ATOM   1534 C C     . ILE C 2 133 ? -0.607  3.590   15.832  1.00 15.89 ? 134 ILE A C     1 
ATOM   1535 O O     . ILE C 2 133 ? -0.350  3.232   14.679  1.00 14.27 ? 134 ILE A O     1 
ATOM   1536 C CB    . ILE C 2 133 ? 1.690   3.172   16.778  1.00 12.76 ? 134 ILE A CB    1 
ATOM   1537 C CG1   . ILE C 2 133 ? 2.482   2.529   17.919  1.00 19.27 ? 134 ILE A CG1   1 
ATOM   1538 C CG2   . ILE C 2 133 ? 2.044   4.657   16.702  1.00 13.28 ? 134 ILE A CG2   1 
ATOM   1539 C CD1   . ILE C 2 133 ? 3.978   2.580   17.716  1.00 21.05 ? 134 ILE A CD1   1 
ATOM   1540 N N     . GLY C 2 134 ? -1.568  4.457   16.113  1.00 13.75 ? 135 GLY A N     1 
ATOM   1541 C CA    . GLY C 2 134 ? -2.361  5.041   15.056  1.00 16.61 ? 135 GLY A CA    1 
ATOM   1542 C C     . GLY C 2 134 ? -2.027  6.492   14.779  1.00 20.03 ? 135 GLY A C     1 
ATOM   1543 O O     . GLY C 2 134 ? -1.864  7.284   15.716  1.00 20.70 ? 135 GLY A O     1 
ATOM   1544 N N     . TYR C 2 135 ? -1.915  6.834   13.493  1.00 18.37 ? 136 TYR A N     1 
ATOM   1545 C CA    . TYR C 2 135 ? -1.641  8.199   13.041  1.00 16.08 ? 136 TYR A CA    1 
ATOM   1546 C C     . TYR C 2 135 ? -2.891  8.674   12.300  1.00 17.68 ? 136 TYR A C     1 
ATOM   1547 O O     . TYR C 2 135 ? -3.491  7.916   11.517  1.00 16.63 ? 136 TYR A O     1 
ATOM   1548 C CB    . TYR C 2 135 ? -0.442  8.250   12.081  1.00 13.73 ? 136 TYR A CB    1 
ATOM   1549 C CG    . TYR C 2 135 ? 0.905   8.119   12.746  1.00 18.35 ? 136 TYR A CG    1 
ATOM   1550 C CD1   . TYR C 2 135 ? 1.471   6.862   13.001  1.00 14.30 ? 136 TYR A CD1   1 
ATOM   1551 C CD2   . TYR C 2 135 ? 1.617   9.254   13.134  1.00 18.47 ? 136 TYR A CD2   1 
ATOM   1552 C CE1   . TYR C 2 135 ? 2.717   6.744   13.633  1.00 14.88 ? 136 TYR A CE1   1 
ATOM   1553 C CE2   . TYR C 2 135 ? 2.858   9.148   13.763  1.00 16.13 ? 136 TYR A CE2   1 
ATOM   1554 C CZ    . TYR C 2 135 ? 3.403   7.900   14.012  1.00 18.58 ? 136 TYR A CZ    1 
ATOM   1555 O OH    . TYR C 2 135 ? 4.618   7.824   14.654  1.00 18.29 ? 136 TYR A OH    1 
ATOM   1556 N N     . VAL C 2 136 ? -3.289  9.918   12.559  1.00 16.74 ? 137 VAL A N     1 
ATOM   1557 C CA    . VAL C 2 136 ? -4.449  10.519  11.905  1.00 18.06 ? 137 VAL A CA    1 
ATOM   1558 C C     . VAL C 2 136 ? -3.944  11.839  11.343  1.00 21.09 ? 137 VAL A C     1 
ATOM   1559 O O     . VAL C 2 136 ? -3.410  12.667  12.088  1.00 17.84 ? 137 VAL A O     1 
ATOM   1560 C CB    . VAL C 2 136 ? -5.586  10.841  12.893  1.00 19.31 ? 137 VAL A CB    1 
ATOM   1561 C CG1   . VAL C 2 136 ? -6.829  11.245  12.126  1.00 23.85 ? 137 VAL A CG1   1 
ATOM   1562 C CG2   . VAL C 2 136 ? -5.874  9.659   13.775  1.00 28.03 ? 137 VAL A CG2   1 
ATOM   1563 N N     . TYR C 2 137 ? -4.092  12.043  10.039  1.00 20.58 ? 138 TYR A N     1 
ATOM   1564 C CA    . TYR C 2 137 ? -3.639  13.293  9.442   1.00 21.11 ? 138 TYR A CA    1 
ATOM   1565 C C     . TYR C 2 137 ? -4.798  13.989  8.735   1.00 21.65 ? 138 TYR A C     1 
ATOM   1566 O O     . TYR C 2 137 ? -5.720  13.340  8.232   1.00 20.65 ? 138 TYR A O     1 
ATOM   1567 C CB    . TYR C 2 137 ? -2.466  13.046  8.472   1.00 20.15 ? 138 TYR A CB    1 
ATOM   1568 C CG    . TYR C 2 137 ? -2.859  12.341  7.195   1.00 25.62 ? 138 TYR A CG    1 
ATOM   1569 C CD1   . TYR C 2 137 ? -2.923  10.945  7.132   1.00 21.02 ? 138 TYR A CD1   1 
ATOM   1570 C CD2   . TYR C 2 137 ? -3.203  13.071  6.056   1.00 25.79 ? 138 TYR A CD2   1 
ATOM   1571 C CE1   . TYR C 2 137 ? -3.324  10.295  5.968   1.00 22.18 ? 138 TYR A CE1   1 
ATOM   1572 C CE2   . TYR C 2 137 ? -3.605  12.433  4.890   1.00 26.71 ? 138 TYR A CE2   1 
ATOM   1573 C CZ    . TYR C 2 137 ? -3.667  11.045  4.852   1.00 28.62 ? 138 TYR A CZ    1 
ATOM   1574 O OH    . TYR C 2 137 ? -4.099  10.418  3.705   1.00 28.36 ? 138 TYR A OH    1 
ATOM   1575 N N     . THR C 2 138 ? -4.762  15.314  8.717   1.00 23.85 ? 139 THR A N     1 
ATOM   1576 C CA    . THR C 2 138 ? -5.790  16.081  8.033   1.00 26.62 ? 139 THR A CA    1 
ATOM   1577 C C     . THR C 2 138 ? -5.230  16.271  6.624   1.00 26.83 ? 139 THR A C     1 
ATOM   1578 O O     . THR C 2 138 ? -4.146  16.846  6.453   1.00 22.46 ? 139 THR A O     1 
ATOM   1579 C CB    . THR C 2 138 ? -6.030  17.443  8.710   1.00 30.46 ? 139 THR A CB    1 
ATOM   1580 O OG1   . THR C 2 138 ? -6.439  17.235  10.067  1.00 34.65 ? 139 THR A OG1   1 
ATOM   1581 C CG2   . THR C 2 138 ? -7.123  18.195  7.989   1.00 29.91 ? 139 THR A CG2   1 
ATOM   1582 N N     . ARG C 2 139 ? -5.960  15.771  5.629   1.00 28.13 ? 140 ARG A N     1 
ATOM   1583 C CA    . ARG C 2 139 ? -5.538  15.853  4.231   1.00 31.92 ? 140 ARG A CA    1 
ATOM   1584 C C     . ARG C 2 139 ? -5.531  17.292  3.701   1.00 33.93 ? 140 ARG A C     1 
ATOM   1585 O O     . ARG C 2 139 ? -6.407  18.090  4.041   1.00 32.84 ? 140 ARG A O     1 
ATOM   1586 C CB    . ARG C 2 139 ? -6.457  14.982  3.368   1.00 37.16 ? 140 ARG A CB    1 
ATOM   1587 C CG    . ARG C 2 139 ? -5.851  14.558  2.049   1.00 43.10 ? 140 ARG A CG    1 
ATOM   1588 C CD    . ARG C 2 139 ? -6.752  13.571  1.327   1.00 52.57 ? 140 ARG A CD    1 
ATOM   1589 N NE    . ARG C 2 139 ? -6.065  12.943  0.194   1.00 60.11 ? 140 ARG A NE    1 
ATOM   1590 C CZ    . ARG C 2 139 ? -6.673  12.469  -0.894  1.00 58.51 ? 140 ARG A CZ    1 
ATOM   1591 N NH1   . ARG C 2 139 ? -7.995  12.547  -1.014  1.00 55.19 ? 140 ARG A NH1   1 
ATOM   1592 N NH2   . ARG C 2 139 ? -5.957  11.915  -1.868  1.00 57.62 ? 140 ARG A NH2   1 
ATOM   1593 N N     . VAL C 2 140 ? -4.533  17.609  2.878   1.00 36.16 ? 141 VAL A N     1 
ATOM   1594 C CA    . VAL C 2 140 ? -4.392  18.934  2.262   1.00 40.46 ? 141 VAL A CA    1 
ATOM   1595 C C     . VAL C 2 140 ? -4.239  18.771  0.739   1.00 44.31 ? 141 VAL A C     1 
ATOM   1596 O O     . VAL C 2 140 ? -3.560  17.855  0.272   1.00 44.10 ? 141 VAL A O     1 
ATOM   1597 C CB    . VAL C 2 140 ? -3.172  19.708  2.851   1.00 37.38 ? 141 VAL A CB    1 
ATOM   1598 C CG1   . VAL C 2 140 ? -2.809  20.890  1.974   1.00 37.91 ? 141 VAL A CG1   1 
ATOM   1599 C CG2   . VAL C 2 140 ? -3.510  20.218  4.240   1.00 38.37 ? 141 VAL A CG2   1 
ATOM   1600 N N     . ALA C 2 141 ? -4.881  19.662  -0.020  1.00 49.67 ? 142 ALA A N     1 
ATOM   1601 C CA    . ALA C 2 141 ? -4.845  19.636  -1.487  1.00 53.43 ? 142 ALA A CA    1 
ATOM   1602 C C     . ALA C 2 141 ? -3.461  19.924  -2.090  1.00 55.11 ? 142 ALA A C     1 
ATOM   1603 O O     . ALA C 2 141 ? -2.831  20.942  -1.779  1.00 53.83 ? 142 ALA A O     1 
ATOM   1604 C CB    . ALA C 2 141 ? -5.877  20.620  -2.047  1.00 55.40 ? 142 ALA A CB    1 
ATOM   1605 N N     . THR C 2 142 ? -3.009  19.012  -2.951  1.00 57.83 ? 143 THR A N     1 
ATOM   1606 C CA    . THR C 2 142 ? -1.721  19.117  -3.638  1.00 61.93 ? 143 THR A CA    1 
ATOM   1607 C C     . THR C 2 142 ? -1.654  20.384  -4.508  1.00 63.25 ? 143 THR A C     1 
ATOM   1608 O O     . THR C 2 142 ? -2.593  20.684  -5.250  1.00 64.14 ? 143 THR A O     1 
ATOM   1609 C CB    . THR C 2 142 ? -1.487  17.868  -4.553  1.00 66.00 ? 143 THR A CB    1 
ATOM   1610 O OG1   . THR C 2 142 ? -1.420  16.683  -3.744  1.00 69.88 ? 143 THR A OG1   1 
ATOM   1611 C CG2   . THR C 2 142 ? -0.203  18.009  -5.361  1.00 64.84 ? 143 THR A CG2   1 
ATOM   1612 N N     . ARG C 2 143 ? -0.547  21.118  -4.414  1.00 64.90 ? 144 ARG A N     1 
ATOM   1613 C CA    . ARG C 2 143 ? -0.352  22.342  -5.200  1.00 65.97 ? 144 ARG A CA    1 
ATOM   1614 C C     . ARG C 2 143 ? 0.741   22.117  -6.250  1.00 65.57 ? 144 ARG A C     1 
ATOM   1615 O O     . ARG C 2 143 ? 1.469   21.129  -6.174  1.00 65.96 ? 144 ARG A O     1 
ATOM   1616 C CB    . ARG C 2 143 ? 0.031   23.505  -4.274  1.00 70.16 ? 144 ARG A CB    1 
ATOM   1617 C CG    . ARG C 2 143 ? -1.032  23.818  -3.228  1.00 78.21 ? 144 ARG A CG    1 
ATOM   1618 C CD    . ARG C 2 143 ? -0.628  24.967  -2.310  1.00 85.21 ? 144 ARG A CD    1 
ATOM   1619 N NE    . ARG C 2 143 ? -1.676  25.261  -1.328  1.00 91.85 ? 144 ARG A NE    1 
ATOM   1620 C CZ    . ARG C 2 143 ? -1.635  26.253  -0.435  1.00 92.48 ? 144 ARG A CZ    1 
ATOM   1621 N NH1   . ARG C 2 143 ? -0.594  27.072  -0.381  1.00 91.07 ? 144 ARG A NH1   1 
ATOM   1622 N NH2   . ARG C 2 143 ? -2.644  26.432  0.412   1.00 91.81 ? 144 ARG A NH2   1 
ATOM   1623 N N     . LYS C 2 144 ? 0.857   23.024  -7.219  1.00 65.09 ? 145 LYS A N     1 
ATOM   1624 C CA    . LYS C 2 144 ? 1.863   22.902  -8.283  1.00 63.38 ? 145 LYS A CA    1 
ATOM   1625 C C     . LYS C 2 144 ? 3.308   22.784  -7.781  1.00 61.07 ? 145 LYS A C     1 
ATOM   1626 O O     . LYS C 2 144 ? 4.117   22.068  -8.376  1.00 59.81 ? 145 LYS A O     1 
ATOM   1627 C CB    . LYS C 2 144 ? 1.759   24.086  -9.248  1.00 68.83 ? 145 LYS A CB    1 
ATOM   1628 C CG    . LYS C 2 144 ? 2.720   24.014  -10.433 1.00 76.74 ? 145 LYS A CG    1 
ATOM   1629 C CD    . LYS C 2 144 ? 2.879   25.367  -11.132 1.00 83.14 ? 145 LYS A CD    1 
ATOM   1630 C CE    . LYS C 2 144 ? 3.902   25.280  -12.268 1.00 86.79 ? 145 LYS A CE    1 
ATOM   1631 N NZ    . LYS C 2 144 ? 4.338   26.617  -12.782 1.00 87.39 ? 145 LYS A NZ    1 
ATOM   1632 N N     . SER C 2 145 ? 3.627   23.484  -6.694  1.00 59.58 ? 146 SER A N     1 
ATOM   1633 C CA    . SER C 2 145 ? 4.978   23.463  -6.120  1.00 57.94 ? 146 SER A CA    1 
ATOM   1634 C C     . SER C 2 145 ? 5.474   22.072  -5.695  1.00 56.28 ? 146 SER A C     1 
ATOM   1635 O O     . SER C 2 145 ? 6.676   21.806  -5.709  1.00 56.62 ? 146 SER A O     1 
ATOM   1636 C CB    . SER C 2 145 ? 5.068   24.442  -4.934  1.00 58.83 ? 146 SER A CB    1 
ATOM   1637 O OG    . SER C 2 145 ? 3.945   24.339  -4.071  1.00 57.19 ? 146 SER A OG    1 
ATOM   1638 N N     . SER C 2 146 ? 4.557   21.185  -5.321  1.00 53.46 ? 147 SER A N     1 
ATOM   1639 C CA    . SER C 2 146 ? 4.949   19.841  -4.902  1.00 51.98 ? 147 SER A CA    1 
ATOM   1640 C C     . SER C 2 146 ? 5.414   18.949  -6.067  1.00 49.89 ? 147 SER A C     1 
ATOM   1641 O O     . SER C 2 146 ? 5.804   17.799  -5.847  1.00 49.08 ? 147 SER A O     1 
ATOM   1642 C CB    . SER C 2 146 ? 3.795   19.158  -4.149  1.00 51.20 ? 147 SER A CB    1 
ATOM   1643 O OG    . SER C 2 146 ? 2.653   18.995  -4.970  1.00 52.27 ? 147 SER A OG    1 
ATOM   1644 N N     . LEU C 2 147 ? 5.383   19.476  -7.294  1.00 46.67 ? 148 LEU A N     1 
ATOM   1645 C CA    . LEU C 2 147 ? 5.782   18.693  -8.462  1.00 43.24 ? 148 LEU A CA    1 
ATOM   1646 C C     . LEU C 2 147 ? 7.166   18.980  -9.043  1.00 40.32 ? 148 LEU A C     1 
ATOM   1647 O O     . LEU C 2 147 ? 7.432   18.666  -10.204 1.00 41.04 ? 148 LEU A O     1 
ATOM   1648 C CB    . LEU C 2 147 ? 4.707   18.805  -9.545  1.00 44.83 ? 148 LEU A CB    1 
ATOM   1649 C CG    . LEU C 2 147 ? 3.400   18.101  -9.165  1.00 49.71 ? 148 LEU A CG    1 
ATOM   1650 C CD1   . LEU C 2 147 ? 2.274   18.524  -10.091 1.00 54.06 ? 148 LEU A CD1   1 
ATOM   1651 C CD2   . LEU C 2 147 ? 3.610   16.595  -9.209  1.00 52.56 ? 148 LEU A CD2   1 
ATOM   1652 N N     . LYS C 2 148 ? 8.045   19.566  -8.236  1.00 36.24 ? 149 LYS A N     1 
ATOM   1653 C CA    . LYS C 2 148 ? 9.413   19.864  -8.652  1.00 35.53 ? 149 LYS A CA    1 
ATOM   1654 C C     . LYS C 2 148 ? 10.351  19.325  -7.575  1.00 32.84 ? 149 LYS A C     1 
ATOM   1655 O O     . LYS C 2 148 ? 9.922   19.071  -6.458  1.00 32.59 ? 149 LYS A O     1 
ATOM   1656 C CB    . LYS C 2 148 ? 9.614   21.379  -8.804  1.00 39.10 ? 149 LYS A CB    1 
ATOM   1657 C CG    . LYS C 2 148 ? 9.379   22.184  -7.520  1.00 43.54 ? 149 LYS A CG    1 
ATOM   1658 C CD    . LYS C 2 148 ? 9.485   23.697  -7.732  1.00 45.30 ? 149 LYS A CD    1 
ATOM   1659 C CE    . LYS C 2 148 ? 10.902  24.134  -8.087  1.00 52.23 ? 149 LYS A CE    1 
ATOM   1660 N NZ    . LYS C 2 148 ? 11.879  23.898  -6.985  1.00 52.98 ? 149 LYS A NZ    1 
ATOM   1661 N N     . THR C 2 149 ? 11.620  19.133  -7.903  1.00 31.61 ? 150 THR A N     1 
ATOM   1662 C CA    . THR C 2 149 ? 12.576  18.665  -6.907  1.00 31.33 ? 150 THR A CA    1 
ATOM   1663 C C     . THR C 2 149 ? 13.112  19.889  -6.149  1.00 32.06 ? 150 THR A C     1 
ATOM   1664 O O     . THR C 2 149 ? 12.965  21.021  -6.604  1.00 33.92 ? 150 THR A O     1 
ATOM   1665 C CB    . THR C 2 149 ? 13.737  17.884  -7.555  1.00 30.78 ? 150 THR A CB    1 
ATOM   1666 O OG1   . THR C 2 149 ? 14.382  18.696  -8.543  1.00 34.43 ? 150 THR A OG1   1 
ATOM   1667 C CG2   . THR C 2 149 ? 13.212  16.621  -8.219  1.00 33.26 ? 150 THR A CG2   1 
ATOM   1668 N N     . TYR C 2 150 ? 13.724  19.662  -4.995  1.00 32.14 ? 151 TYR A N     1 
ATOM   1669 C CA    . TYR C 2 150 ? 14.263  20.742  -4.180  1.00 28.95 ? 151 TYR A CA    1 
ATOM   1670 C C     . TYR C 2 150 ? 15.670  20.407  -3.729  1.00 31.25 ? 151 TYR A C     1 
ATOM   1671 O O     . TYR C 2 150 ? 16.140  19.282  -3.907  1.00 30.76 ? 151 TYR A O     1 
ATOM   1672 C CB    . TYR C 2 150 ? 13.409  20.949  -2.941  1.00 22.98 ? 151 TYR A CB    1 
ATOM   1673 C CG    . TYR C 2 150 ? 12.037  21.484  -3.211  1.00 22.32 ? 151 TYR A CG    1 
ATOM   1674 C CD1   . TYR C 2 150 ? 11.002  20.638  -3.613  1.00 21.33 ? 151 TYR A CD1   1 
ATOM   1675 C CD2   . TYR C 2 150 ? 11.767  22.845  -3.066  1.00 21.74 ? 151 TYR A CD2   1 
ATOM   1676 C CE1   . TYR C 2 150 ? 9.729   21.140  -3.862  1.00 22.71 ? 151 TYR A CE1   1 
ATOM   1677 C CE2   . TYR C 2 150 ? 10.502  23.354  -3.311  1.00 20.76 ? 151 TYR A CE2   1 
ATOM   1678 C CZ    . TYR C 2 150 ? 9.492   22.498  -3.708  1.00 20.48 ? 151 TYR A CZ    1 
ATOM   1679 O OH    . TYR C 2 150 ? 8.246   23.005  -3.940  1.00 25.30 ? 151 TYR A OH    1 
ATOM   1680 N N     . ASN C 2 151 ? 16.334  21.392  -3.133  1.00 33.78 ? 152 ASN A N     1 
ATOM   1681 C CA    . ASN C 2 151 ? 17.689  21.218  -2.632  1.00 31.52 ? 152 ASN A CA    1 
ATOM   1682 C C     . ASN C 2 151 ? 17.637  21.361  -1.125  1.00 31.49 ? 152 ASN A C     1 
ATOM   1683 O O     . ASN C 2 151 ? 16.646  21.842  -0.576  1.00 29.64 ? 152 ASN A O     1 
ATOM   1684 C CB    . ASN C 2 151 ? 18.629  22.262  -3.237  1.00 38.95 ? 152 ASN A CB    1 
ATOM   1685 C CG    . ASN C 2 151 ? 18.759  22.118  -4.744  1.00 46.43 ? 152 ASN A CG    1 
ATOM   1686 O OD1   . ASN C 2 151 ? 19.552  21.313  -5.238  1.00 50.35 ? 152 ASN A OD1   1 
ATOM   1687 N ND2   . ASN C 2 151 ? 17.976  22.897  -5.482  1.00 46.81 ? 152 ASN A ND2   1 
ATOM   1688 N N     . ILE C 2 152 ? 18.710  20.941  -0.465  1.00 33.79 ? 153 ILE A N     1 
ATOM   1689 C CA    . ILE C 2 152 ? 18.831  20.983  0.988   1.00 35.78 ? 153 ILE A CA    1 
ATOM   1690 C C     . ILE C 2 152 ? 18.587  22.369  1.590   1.00 37.45 ? 153 ILE A C     1 
ATOM   1691 O O     . ILE C 2 152 ? 17.998  22.493  2.668   1.00 37.72 ? 153 ILE A O     1 
ATOM   1692 C CB    . ILE C 2 152 ? 20.218  20.441  1.409   1.00 37.30 ? 153 ILE A CB    1 
ATOM   1693 C CG1   . ILE C 2 152 ? 20.314  18.957  1.038   1.00 39.66 ? 153 ILE A CG1   1 
ATOM   1694 C CG2   . ILE C 2 152 ? 20.444  20.633  2.898   1.00 38.64 ? 153 ILE A CG2   1 
ATOM   1695 C CD1   . ILE C 2 152 ? 21.730  18.422  0.971   1.00 46.41 ? 153 ILE A CD1   1 
ATOM   1696 N N     . ASN C 2 153 ? 19.026  23.411  0.893   1.00 38.29 ? 154 ASN A N     1 
ATOM   1697 C CA    . ASN C 2 153 ? 18.850  24.776  1.384   1.00 40.15 ? 154 ASN A CA    1 
ATOM   1698 C C     . ASN C 2 153 ? 17.409  25.282  1.265   1.00 40.34 ? 154 ASN A C     1 
ATOM   1699 O O     . ASN C 2 153 ? 17.115  26.414  1.651   1.00 40.80 ? 154 ASN A O     1 
ATOM   1700 C CB    . ASN C 2 153 ? 19.815  25.727  0.655   1.00 44.16 ? 154 ASN A CB    1 
ATOM   1701 C CG    . ASN C 2 153 ? 19.644  25.701  -0.869  1.00 51.41 ? 154 ASN A CG    1 
ATOM   1702 O OD1   . ASN C 2 153 ? 18.975  24.822  -1.429  1.00 51.09 ? 154 ASN A OD1   1 
ATOM   1703 N ND2   . ASN C 2 153 ? 20.258  26.667  -1.543  1.00 46.63 ? 154 ASN A ND2   1 
ATOM   1704 N N     . GLU C 2 154 ? 16.518  24.437  0.739   1.00 40.07 ? 155 GLU A N     1 
ATOM   1705 C CA    . GLU C 2 154 ? 15.107  24.788  0.545   1.00 37.80 ? 155 GLU A CA    1 
ATOM   1706 C C     . GLU C 2 154 ? 14.127  23.959  1.386   1.00 37.41 ? 155 GLU A C     1 
ATOM   1707 O O     . GLU C 2 154 ? 12.916  23.996  1.127   1.00 35.05 ? 155 GLU A O     1 
ATOM   1708 C CB    . GLU C 2 154 ? 14.710  24.614  -0.928  1.00 39.44 ? 155 GLU A CB    1 
ATOM   1709 C CG    . GLU C 2 154 ? 15.563  25.341  -1.949  1.00 44.38 ? 155 GLU A CG    1 
ATOM   1710 C CD    . GLU C 2 154 ? 15.054  25.118  -3.359  1.00 53.29 ? 155 GLU A CD    1 
ATOM   1711 O OE1   . GLU C 2 154 ? 15.485  24.135  -3.999  1.00 55.71 ? 155 GLU A OE1   1 
ATOM   1712 O OE2   . GLU C 2 154 ? 14.219  25.926  -3.826  1.00 56.78 ? 155 GLU A OE2   1 
ATOM   1713 N N     . LEU C 2 155 ? 14.631  23.223  2.380   1.00 37.78 ? 156 LEU A N     1 
ATOM   1714 C CA    . LEU C 2 155 ? 13.781  22.377  3.231   1.00 36.44 ? 156 LEU A CA    1 
ATOM   1715 C C     . LEU C 2 155 ? 12.509  23.026  3.754   1.00 36.41 ? 156 LEU A C     1 
ATOM   1716 O O     . LEU C 2 155 ? 11.436  22.429  3.675   1.00 36.87 ? 156 LEU A O     1 
ATOM   1717 C CB    . LEU C 2 155 ? 14.565  21.815  4.418   1.00 37.58 ? 156 LEU A CB    1 
ATOM   1718 C CG    . LEU C 2 155 ? 15.409  20.563  4.173   1.00 43.52 ? 156 LEU A CG    1 
ATOM   1719 C CD1   . LEU C 2 155 ? 15.994  20.093  5.493   1.00 43.60 ? 156 LEU A CD1   1 
ATOM   1720 C CD2   . LEU C 2 155 ? 14.556  19.462  3.555   1.00 46.16 ? 156 LEU A CD2   1 
ATOM   1721 N N     . ASN C 2 156 ? 12.624  24.244  4.277   1.00 37.67 ? 157 ASN A N     1 
ATOM   1722 C CA    . ASN C 2 156 ? 11.473  24.966  4.834   1.00 39.21 ? 157 ASN A CA    1 
ATOM   1723 C C     . ASN C 2 156 ? 10.468  25.456  3.796   1.00 39.57 ? 157 ASN A C     1 
ATOM   1724 O O     . ASN C 2 156 ? 9.363   25.880  4.147   1.00 40.18 ? 157 ASN A O     1 
ATOM   1725 C CB    . ASN C 2 156 ? 11.940  26.166  5.663   1.00 44.06 ? 157 ASN A CB    1 
ATOM   1726 C CG    . ASN C 2 156 ? 12.913  25.780  6.756   1.00 54.97 ? 157 ASN A CG    1 
ATOM   1727 O OD1   . ASN C 2 156 ? 14.092  26.134  6.693   1.00 58.09 ? 157 ASN A OD1   1 
ATOM   1728 N ND2   . ASN C 2 156 ? 12.431  25.054  7.765   1.00 50.40 ? 157 ASN A ND2   1 
ATOM   1729 N N     . GLU C 2 157 ? 10.848  25.398  2.525   1.00 39.08 ? 158 GLU A N     1 
ATOM   1730 C CA    . GLU C 2 157 ? 9.977   25.853  1.451   1.00 39.52 ? 158 GLU A CA    1 
ATOM   1731 C C     . GLU C 2 157 ? 9.110   24.763  0.848   1.00 36.47 ? 158 GLU A C     1 
ATOM   1732 O O     . GLU C 2 157 ? 8.123   25.063  0.189   1.00 35.99 ? 158 GLU A O     1 
ATOM   1733 C CB    . GLU C 2 157 ? 10.800  26.483  0.335   1.00 46.47 ? 158 GLU A CB    1 
ATOM   1734 C CG    . GLU C 2 157 ? 11.550  27.739  0.727   1.00 55.99 ? 158 GLU A CG    1 
ATOM   1735 C CD    . GLU C 2 157 ? 12.193  28.394  -0.474  1.00 63.06 ? 158 GLU A CD    1 
ATOM   1736 O OE1   . GLU C 2 157 ? 11.446  28.936  -1.320  1.00 65.32 ? 158 GLU A OE1   1 
ATOM   1737 O OE2   . GLU C 2 157 ? 13.439  28.364  -0.575  1.00 67.59 ? 158 GLU A OE2   1 
ATOM   1738 N N     . ILE C 2 158 ? 9.481   23.505  1.066   1.00 34.10 ? 159 ILE A N     1 
ATOM   1739 C CA    . ILE C 2 158 ? 8.728   22.380  0.514   1.00 30.38 ? 159 ILE A CA    1 
ATOM   1740 C C     . ILE C 2 158 ? 7.359   22.252  1.182   1.00 31.49 ? 159 ILE A C     1 
ATOM   1741 O O     . ILE C 2 158 ? 7.262   22.147  2.405   1.00 33.44 ? 159 ILE A O     1 
ATOM   1742 C CB    . ILE C 2 158 ? 9.487   21.052  0.708   1.00 26.25 ? 159 ILE A CB    1 
ATOM   1743 C CG1   . ILE C 2 158 ? 10.927  21.190  0.216   1.00 22.46 ? 159 ILE A CG1   1 
ATOM   1744 C CG2   . ILE C 2 158 ? 8.776   19.934  -0.036  1.00 23.26 ? 159 ILE A CG2   1 
ATOM   1745 C CD1   . ILE C 2 158 ? 11.771  19.956  0.455   1.00 24.73 ? 159 ILE A CD1   1 
ATOM   1746 N N     . PRO C 2 159 ? 6.280   22.272  0.387   1.00 31.21 ? 160 PRO A N     1 
ATOM   1747 C CA    . PRO C 2 159 ? 4.931   22.148  0.950   1.00 32.09 ? 160 PRO A CA    1 
ATOM   1748 C C     . PRO C 2 159 ? 4.620   20.717  1.426   1.00 34.70 ? 160 PRO A C     1 
ATOM   1749 O O     . PRO C 2 159 ? 4.937   19.735  0.738   1.00 34.40 ? 160 PRO A O     1 
ATOM   1750 C CB    . PRO C 2 159 ? 4.039   22.569  -0.215  1.00 28.75 ? 160 PRO A CB    1 
ATOM   1751 C CG    . PRO C 2 159 ? 4.790   22.062  -1.396  1.00 34.04 ? 160 PRO A CG    1 
ATOM   1752 C CD    . PRO C 2 159 ? 6.230   22.430  -1.077  1.00 30.25 ? 160 PRO A CD    1 
ATOM   1753 N N     . LYS C 2 160 ? 4.006   20.613  2.602   1.00 36.36 ? 161 LYS A N     1 
ATOM   1754 C CA    . LYS C 2 160 ? 3.627   19.328  3.198   1.00 37.29 ? 161 LYS A CA    1 
ATOM   1755 C C     . LYS C 2 160 ? 2.204   18.968  2.769   1.00 37.81 ? 161 LYS A C     1 
ATOM   1756 O O     . LYS C 2 160 ? 1.345   19.845  2.666   1.00 37.09 ? 161 LYS A O     1 
ATOM   1757 C CB    . LYS C 2 160 ? 3.716   19.416  4.725   1.00 37.09 ? 161 LYS A CB    1 
ATOM   1758 C CG    . LYS C 2 160 ? 5.131   19.604  5.224   1.00 38.12 ? 161 LYS A CG    1 
ATOM   1759 C CD    . LYS C 2 160 ? 5.183   20.472  6.462   1.00 40.18 ? 161 LYS A CD    1 
ATOM   1760 C CE    . LYS C 2 160 ? 6.614   20.880  6.744   1.00 47.40 ? 161 LYS A CE    1 
ATOM   1761 N NZ    . LYS C 2 160 ? 6.681   21.898  7.814   1.00 53.83 ? 161 LYS A NZ    1 
ATOM   1762 N N     . PRO C 2 161 ? 1.937   17.670  2.521   1.00 41.03 ? 162 PRO A N     1 
ATOM   1763 C CA    . PRO C 2 161 ? 0.628   17.154  2.095   1.00 42.02 ? 162 PRO A CA    1 
ATOM   1764 C C     . PRO C 2 161 ? -0.374  16.918  3.229   1.00 40.57 ? 162 PRO A C     1 
ATOM   1765 O O     . PRO C 2 161 ? -1.445  16.341  3.011   1.00 42.75 ? 162 PRO A O     1 
ATOM   1766 C CB    . PRO C 2 161 ? 1.003   15.851  1.407   1.00 44.32 ? 162 PRO A CB    1 
ATOM   1767 C CG    . PRO C 2 161 ? 2.073   15.330  2.325   1.00 46.56 ? 162 PRO A CG    1 
ATOM   1768 C CD    . PRO C 2 161 ? 2.916   16.569  2.632   1.00 45.19 ? 162 PRO A CD    1 
ATOM   1769 N N     . TYR C 2 162 ? -0.025  17.363  4.431   1.00 36.39 ? 163 TYR A N     1 
ATOM   1770 C CA    . TYR C 2 162 ? -0.885  17.194  5.596   1.00 35.81 ? 163 TYR A CA    1 
ATOM   1771 C C     . TYR C 2 162 ? -0.929  18.489  6.409   1.00 35.99 ? 163 TYR A C     1 
ATOM   1772 O O     . TYR C 2 162 ? 0.056   19.225  6.463   1.00 33.28 ? 163 TYR A O     1 
ATOM   1773 C CB    . TYR C 2 162 ? -0.379  16.031  6.460   1.00 32.11 ? 163 TYR A CB    1 
ATOM   1774 C CG    . TYR C 2 162 ? 1.071   16.156  6.900   1.00 38.05 ? 163 TYR A CG    1 
ATOM   1775 C CD1   . TYR C 2 162 ? 1.413   16.838  8.076   1.00 33.10 ? 163 TYR A CD1   1 
ATOM   1776 C CD2   . TYR C 2 162 ? 2.102   15.591  6.140   1.00 39.25 ? 163 TYR A CD2   1 
ATOM   1777 C CE1   . TYR C 2 162 ? 2.738   16.953  8.479   1.00 32.66 ? 163 TYR A CE1   1 
ATOM   1778 C CE2   . TYR C 2 162 ? 3.432   15.702  6.537   1.00 39.41 ? 163 TYR A CE2   1 
ATOM   1779 C CZ    . TYR C 2 162 ? 3.740   16.384  7.705   1.00 37.39 ? 163 TYR A CZ    1 
ATOM   1780 O OH    . TYR C 2 162 ? 5.049   16.503  8.101   1.00 43.72 ? 163 TYR A OH    1 
ATOM   1781 N N     . LYS C 2 163 ? -2.070  18.758  7.035   1.00 39.42 ? 164 LYS A N     1 
ATOM   1782 C CA    . LYS C 2 163 ? -2.267  19.971  7.833   1.00 41.57 ? 164 LYS A CA    1 
ATOM   1783 C C     . LYS C 2 163 ? -1.923  19.746  9.303   1.00 44.08 ? 164 LYS A C     1 
ATOM   1784 O O     . LYS C 2 163 ? -1.370  20.628  9.966   1.00 46.71 ? 164 LYS A O     1 
ATOM   1785 C CB    . LYS C 2 163 ? -3.723  20.434  7.708   1.00 40.58 ? 164 LYS A CB    1 
ATOM   1786 C CG    . LYS C 2 163 ? -3.985  21.845  8.163   1.00 44.03 ? 164 LYS A CG    1 
ATOM   1787 C CD    . LYS C 2 163 ? -5.395  22.259  7.790   1.00 52.38 ? 164 LYS A CD    1 
ATOM   1788 C CE    . LYS C 2 163 ? -5.587  23.762  7.950   1.00 62.92 ? 164 LYS A CE    1 
ATOM   1789 N NZ    . LYS C 2 163 ? -6.906  24.212  7.402   1.00 65.90 ? 164 LYS A NZ    1 
ATOM   1790 N N     . GLY C 2 164 ? -2.259  18.564  9.807   1.00 42.11 ? 165 GLY A N     1 
ATOM   1791 C CA    . GLY C 2 164 ? -1.981  18.247  11.191  1.00 40.01 ? 165 GLY A CA    1 
ATOM   1792 C C     . GLY C 2 164 ? -1.867  16.746  11.306  1.00 40.52 ? 165 GLY A C     1 
ATOM   1793 O O     . GLY C 2 164 ? -2.398  16.025  10.450  1.00 41.98 ? 165 GLY A O     1 
ATOM   1794 N N     . VAL C 2 165 ? -1.174  16.279  12.341  1.00 32.52 ? 166 VAL A N     1 
ATOM   1795 C CA    . VAL C 2 165 ? -0.982  14.854  12.579  1.00 26.10 ? 166 VAL A CA    1 
ATOM   1796 C C     . VAL C 2 165 ? -1.134  14.587  14.071  1.00 24.71 ? 166 VAL A C     1 
ATOM   1797 O O     . VAL C 2 165 ? -0.529  15.272  14.898  1.00 23.17 ? 166 VAL A O     1 
ATOM   1798 C CB    . VAL C 2 165 ? 0.421   14.378  12.138  1.00 18.02 ? 166 VAL A CB    1 
ATOM   1799 C CG1   . VAL C 2 165 ? 0.580   12.906  12.409  1.00 21.29 ? 166 VAL A CG1   1 
ATOM   1800 C CG2   . VAL C 2 165 ? 0.628   14.625  10.660  1.00 24.76 ? 166 VAL A CG2   1 
ATOM   1801 N N     . LYS C 2 166 ? -1.956  13.599  14.407  1.00 22.33 ? 167 LYS A N     1 
ATOM   1802 C CA    . LYS C 2 166 ? -2.188  13.196  15.791  1.00 19.97 ? 167 LYS A CA    1 
ATOM   1803 C C     . LYS C 2 166 ? -1.758  11.733  15.872  1.00 19.35 ? 167 LYS A C     1 
ATOM   1804 O O     . LYS C 2 166 ? -1.903  10.984  14.896  1.00 17.12 ? 167 LYS A O     1 
ATOM   1805 C CB    . LYS C 2 166 ? -3.670  13.332  16.151  1.00 17.77 ? 167 LYS A CB    1 
ATOM   1806 C CG    . LYS C 2 166 ? -4.156  14.760  16.246  1.00 17.60 ? 167 LYS A CG    1 
ATOM   1807 C CD    . LYS C 2 166 ? -5.662  14.806  16.305  1.00 30.11 ? 167 LYS A CD    1 
ATOM   1808 C CE    . LYS C 2 166 ? -6.166  16.238  16.342  1.00 44.20 ? 167 LYS A CE    1 
ATOM   1809 N NZ    . LYS C 2 166 ? -7.659  16.301  16.229  1.00 54.57 ? 167 LYS A NZ    1 
ATOM   1810 N N     . VAL C 2 167 ? -1.222  11.327  17.017  1.00 17.03 ? 168 VAL A N     1 
ATOM   1811 C CA    . VAL C 2 167 ? -0.788  9.949   17.195  1.00 17.75 ? 168 VAL A CA    1 
ATOM   1812 C C     . VAL C 2 167 ? -1.280  9.397   18.539  1.00 21.57 ? 168 VAL A C     1 
ATOM   1813 O O     . VAL C 2 167 ? -1.402  10.150  19.515  1.00 20.77 ? 168 VAL A O     1 
ATOM   1814 C CB    . VAL C 2 167 ? 0.759   9.845   17.104  1.00 19.45 ? 168 VAL A CB    1 
ATOM   1815 C CG1   . VAL C 2 167 ? 1.425   10.644  18.236  1.00 21.44 ? 168 VAL A CG1   1 
ATOM   1816 C CG2   . VAL C 2 167 ? 1.198   8.378   17.117  1.00 19.62 ? 168 VAL A CG2   1 
ATOM   1817 N N     . PHE C 2 168 ? -1.579  8.098   18.581  1.00 18.44 ? 169 PHE A N     1 
ATOM   1818 C CA    . PHE C 2 168 ? -2.009  7.437   19.819  1.00 19.10 ? 169 PHE A CA    1 
ATOM   1819 C C     . PHE C 2 168 ? -1.456  6.014   19.863  1.00 18.64 ? 169 PHE A C     1 
ATOM   1820 O O     . PHE C 2 168 ? -1.075  5.459   18.822  1.00 16.49 ? 169 PHE A O     1 
ATOM   1821 C CB    . PHE C 2 168 ? -3.553  7.414   19.958  1.00 17.05 ? 169 PHE A CB    1 
ATOM   1822 C CG    . PHE C 2 168 ? -4.262  6.468   19.002  1.00 19.89 ? 169 PHE A CG    1 
ATOM   1823 C CD1   . PHE C 2 168 ? -4.220  5.085   19.192  1.00 19.23 ? 169 PHE A CD1   1 
ATOM   1824 C CD2   . PHE C 2 168 ? -4.978  6.964   17.924  1.00 16.43 ? 169 PHE A CD2   1 
ATOM   1825 C CE1   . PHE C 2 168 ? -4.873  4.218   18.325  1.00 18.54 ? 169 PHE A CE1   1 
ATOM   1826 C CE2   . PHE C 2 168 ? -5.638  6.099   17.050  1.00 20.56 ? 169 PHE A CE2   1 
ATOM   1827 C CZ    . PHE C 2 168 ? -5.581  4.724   17.256  1.00 13.50 ? 169 PHE A CZ    1 
ATOM   1828 N N     . LEU C 2 169 ? -1.401  5.433   21.061  1.00 16.49 ? 170 LEU A N     1 
ATOM   1829 C CA    . LEU C 2 169 ? -0.958  4.053   21.231  1.00 15.70 ? 170 LEU A CA    1 
ATOM   1830 C C     . LEU C 2 169 ? -2.074  3.398   22.059  1.00 18.78 ? 170 LEU A C     1 
ATOM   1831 O O     . LEU C 2 169 ? -2.478  3.914   23.099  1.00 17.82 ? 170 LEU A O     1 
ATOM   1832 C CB    . LEU C 2 169 ? 0.402   3.962   21.945  1.00 16.45 ? 170 LEU A CB    1 
ATOM   1833 C CG    . LEU C 2 169 ? 1.082   2.575   21.975  1.00 20.85 ? 170 LEU A CG    1 
ATOM   1834 C CD1   . LEU C 2 169 ? 2.556   2.718   22.246  1.00 26.71 ? 170 LEU A CD1   1 
ATOM   1835 C CD2   . LEU C 2 169 ? 0.461   1.683   23.033  1.00 23.62 ? 170 LEU A CD2   1 
ATOM   1836 N N     . GLN C 2 170 ? -2.582  2.267   21.592  1.00 16.86 ? 171 GLN A N     1 
ATOM   1837 C CA    . GLN C 2 170 ? -3.649  1.592   22.301  1.00 15.83 ? 171 GLN A CA    1 
ATOM   1838 C C     . GLN C 2 170 ? -3.667  0.092   21.953  1.00 19.06 ? 171 GLN A C     1 
ATOM   1839 O O     . GLN C 2 170 ? -3.172  -0.320  20.898  1.00 18.40 ? 171 GLN A O     1 
ATOM   1840 C CB    . GLN C 2 170 ? -4.976  2.269   21.940  1.00 12.21 ? 171 GLN A CB    1 
ATOM   1841 C CG    . GLN C 2 170 ? -6.179  1.838   22.771  1.00 15.89 ? 171 GLN A CG    1 
ATOM   1842 C CD    . GLN C 2 170 ? -5.969  2.060   24.265  1.00 12.47 ? 171 GLN A CD    1 
ATOM   1843 O OE1   . GLN C 2 170 ? -5.453  1.187   24.970  1.00 12.81 ? 171 GLN A OE1   1 
ATOM   1844 N NE2   . GLN C 2 170 ? -6.368  3.223   24.750  1.00 12.38 ? 171 GLN A NE2   1 
ATOM   1845 N N     . ASP C 2 171 ? -4.221  -0.725  22.845  1.00 18.25 ? 172 ASP A N     1 
ATOM   1846 C CA    . ASP C 2 171 ? -4.319  -2.163  22.603  1.00 15.35 ? 172 ASP A CA    1 
ATOM   1847 C C     . ASP C 2 171 ? -5.332  -2.379  21.485  1.00 15.24 ? 172 ASP A C     1 
ATOM   1848 O O     . ASP C 2 171 ? -6.364  -1.704  21.438  1.00 14.27 ? 172 ASP A O     1 
ATOM   1849 C CB    . ASP C 2 171 ? -4.793  -2.890  23.860  1.00 14.86 ? 172 ASP A CB    1 
ATOM   1850 C CG    . ASP C 2 171 ? -3.783  -2.824  24.978  1.00 18.07 ? 172 ASP A CG    1 
ATOM   1851 O OD1   . ASP C 2 171 ? -2.856  -3.650  24.983  1.00 21.23 ? 172 ASP A OD1   1 
ATOM   1852 O OD2   . ASP C 2 171 ? -3.912  -1.947  25.851  1.00 24.54 ? 172 ASP A OD2   1 
ATOM   1853 N N     . LYS C 2 172 ? -5.035  -3.314  20.591  1.00 16.15 ? 173 LYS A N     1 
ATOM   1854 C CA    . LYS C 2 172 ? -5.932  -3.611  19.481  1.00 14.51 ? 173 LYS A CA    1 
ATOM   1855 C C     . LYS C 2 172 ? -7.338  -3.991  19.940  1.00 14.10 ? 173 LYS A C     1 
ATOM   1856 O O     . LYS C 2 172 ? -8.319  -3.436  19.440  1.00 16.74 ? 173 LYS A O     1 
ATOM   1857 C CB    . LYS C 2 172 ? -5.370  -4.740  18.603  1.00 15.72 ? 173 LYS A CB    1 
ATOM   1858 C CG    . LYS C 2 172 ? -6.298  -5.096  17.448  1.00 20.67 ? 173 LYS A CG    1 
ATOM   1859 C CD    . LYS C 2 172 ? -5.880  -6.354  16.712  1.00 29.42 ? 173 LYS A CD    1 
ATOM   1860 C CE    . LYS C 2 172 ? -4.598  -6.158  15.955  1.00 34.99 ? 173 LYS A CE    1 
ATOM   1861 N NZ    . LYS C 2 172 ? -4.345  -7.317  15.059  1.00 36.85 ? 173 LYS A NZ    1 
ATOM   1862 N N     . TRP C 2 173 ? -7.450  -4.921  20.891  1.00 15.34 ? 174 TRP A N     1 
ATOM   1863 C CA    . TRP C 2 173 ? -8.775  -5.355  21.356  1.00 13.14 ? 174 TRP A CA    1 
ATOM   1864 C C     . TRP C 2 173 ? -9.629  -4.213  21.913  1.00 14.02 ? 174 TRP A C     1 
ATOM   1865 O O     . TRP C 2 173 ? -10.845 -4.216  21.749  1.00 14.52 ? 174 TRP A O     1 
ATOM   1866 C CB    . TRP C 2 173 ? -8.667  -6.513  22.385  1.00 13.09 ? 174 TRP A CB    1 
ATOM   1867 C CG    . TRP C 2 173 ? -8.320  -6.118  23.826  1.00 17.71 ? 174 TRP A CG    1 
ATOM   1868 C CD1   . TRP C 2 173 ? -7.069  -6.070  24.393  1.00 14.67 ? 174 TRP A CD1   1 
ATOM   1869 C CD2   . TRP C 2 173 ? -9.242  -5.728  24.863  1.00 12.87 ? 174 TRP A CD2   1 
ATOM   1870 N NE1   . TRP C 2 173 ? -7.160  -5.673  25.716  1.00 15.03 ? 174 TRP A NE1   1 
ATOM   1871 C CE2   . TRP C 2 173 ? -8.478  -5.458  26.028  1.00 16.14 ? 174 TRP A CE2   1 
ATOM   1872 C CE3   . TRP C 2 173 ? -10.638 -5.579  24.919  1.00 13.52 ? 174 TRP A CE3   1 
ATOM   1873 C CZ2   . TRP C 2 173 ? -9.064  -5.050  27.233  1.00 14.21 ? 174 TRP A CZ2   1 
ATOM   1874 C CZ3   . TRP C 2 173 ? -11.225 -5.172  26.122  1.00 15.97 ? 174 TRP A CZ3   1 
ATOM   1875 C CH2   . TRP C 2 173 ? -10.436 -4.913  27.260  1.00 14.19 ? 174 TRP A CH2   1 
ATOM   1876 N N     . VAL C 2 174 ? -8.987  -3.239  22.560  1.00 15.21 ? 175 VAL A N     1 
ATOM   1877 C CA    . VAL C 2 174 ? -9.684  -2.103  23.165  1.00 15.73 ? 175 VAL A CA    1 
ATOM   1878 C C     . VAL C 2 174 ? -10.372 -1.186  22.144  1.00 16.79 ? 175 VAL A C     1 
ATOM   1879 O O     . VAL C 2 174 ? -11.474 -0.683  22.399  1.00 15.14 ? 175 VAL A O     1 
ATOM   1880 C CB    . VAL C 2 174 ? -8.703  -1.252  24.054  1.00 21.29 ? 175 VAL A CB    1 
ATOM   1881 C CG1   . VAL C 2 174 ? -9.401  -0.022  24.600  1.00 14.43 ? 175 VAL A CG1   1 
ATOM   1882 C CG2   . VAL C 2 174 ? -8.180  -2.087  25.201  1.00 14.24 ? 175 VAL A CG2   1 
ATOM   1883 N N     . ILE C 2 175 ? -9.730  -0.970  20.996  1.00 16.19 ? 176 ILE A N     1 
ATOM   1884 C CA    . ILE C 2 175 ? -10.298 -0.098  19.962  1.00 18.86 ? 176 ILE A CA    1 
ATOM   1885 C C     . ILE C 2 175 ? -11.010 -0.852  18.831  1.00 20.27 ? 176 ILE A C     1 
ATOM   1886 O O     . ILE C 2 175 ? -11.497 -0.233  17.876  1.00 21.15 ? 176 ILE A O     1 
ATOM   1887 C CB    . ILE C 2 175 ? -9.225  0.847   19.351  1.00 18.02 ? 176 ILE A CB    1 
ATOM   1888 C CG1   . ILE C 2 175 ? -8.074  0.032   18.743  1.00 21.16 ? 176 ILE A CG1   1 
ATOM   1889 C CG2   . ILE C 2 175 ? -8.724  1.818   20.415  1.00 16.84 ? 176 ILE A CG2   1 
ATOM   1890 C CD1   . ILE C 2 175 ? -7.071  0.855   17.929  1.00 18.59 ? 176 ILE A CD1   1 
ATOM   1891 N N     . ALA C 2 176 ? -11.065 -2.178  18.943  1.00 19.25 ? 177 ALA A N     1 
ATOM   1892 C CA    . ALA C 2 176 ? -11.728 -3.027  17.955  1.00 19.00 ? 177 ALA A CA    1 
ATOM   1893 C C     . ALA C 2 176 ? -13.243 -2.813  18.007  1.00 18.19 ? 177 ALA A C     1 
ATOM   1894 O O     . ALA C 2 176 ? -13.822 -2.610  19.087  1.00 17.28 ? 177 ALA A O     1 
ATOM   1895 C CB    . ALA C 2 176 ? -11.394 -4.498  18.209  1.00 15.17 ? 177 ALA A CB    1 
ATOM   1896 N N     . GLY C 2 177 ? -13.872 -2.852  16.833  1.00 14.01 ? 178 GLY A N     1 
ATOM   1897 C CA    . GLY C 2 177 ? -15.309 -2.666  16.732  1.00 12.23 ? 178 GLY A CA    1 
ATOM   1898 C C     . GLY C 2 177 ? -15.970 -3.992  16.397  1.00 12.90 ? 178 GLY A C     1 
ATOM   1899 O O     . GLY C 2 177 ? -15.326 -5.039  16.443  1.00 11.91 ? 178 GLY A O     1 
ATOM   1900 N N     . ASP C 2 178 ? -17.253 -3.945  16.054  1.00 15.07 ? 179 ASP A N     1 
ATOM   1901 C CA    . ASP C 2 178 ? -18.012 -5.154  15.735  1.00 15.26 ? 179 ASP A CA    1 
ATOM   1902 C C     . ASP C 2 178 ? -18.406 -5.293  14.263  1.00 17.69 ? 179 ASP A C     1 
ATOM   1903 O O     . ASP C 2 178 ? -19.113 -6.236  13.893  1.00 15.74 ? 179 ASP A O     1 
ATOM   1904 C CB    . ASP C 2 178 ? -19.270 -5.247  16.624  1.00 10.95 ? 179 ASP A CB    1 
ATOM   1905 C CG    . ASP C 2 178 ? -20.183 -4.022  16.512  1.00 20.02 ? 179 ASP A CG    1 
ATOM   1906 O OD1   . ASP C 2 178 ? -19.782 -3.002  15.908  1.00 19.47 ? 179 ASP A OD1   1 
ATOM   1907 O OD2   . ASP C 2 178 ? -21.316 -4.083  17.041  1.00 19.53 ? 179 ASP A OD2   1 
ATOM   1908 N N     . LEU C 2 179 ? -17.965 -4.358  13.427  1.00 17.07 ? 180 LEU A N     1 
ATOM   1909 C CA    . LEU C 2 179 ? -18.268 -4.415  11.990  1.00 18.17 ? 180 LEU A CA    1 
ATOM   1910 C C     . LEU C 2 179 ? -16.934 -4.556  11.251  1.00 18.66 ? 180 LEU A C     1 
ATOM   1911 O O     . LEU C 2 179 ? -15.916 -4.009  11.689  1.00 19.12 ? 180 LEU A O     1 
ATOM   1912 C CB    . LEU C 2 179 ? -19.001 -3.144  11.536  1.00 16.59 ? 180 LEU A CB    1 
ATOM   1913 C CG    . LEU C 2 179 ? -20.274 -2.755  12.307  1.00 25.30 ? 180 LEU A CG    1 
ATOM   1914 C CD1   . LEU C 2 179 ? -20.819 -1.458  11.759  1.00 19.35 ? 180 LEU A CD1   1 
ATOM   1915 C CD2   . LEU C 2 179 ? -21.329 -3.855  12.226  1.00 18.78 ? 180 LEU A CD2   1 
ATOM   1916 N N     . ALA C 2 180 ? -16.927 -5.293  10.146  1.00 17.24 ? 181 ALA A N     1 
ATOM   1917 C CA    . ALA C 2 180 ? -15.706 -5.487  9.367   1.00 18.47 ? 181 ALA A CA    1 
ATOM   1918 C C     . ALA C 2 180 ? -15.165 -4.160  8.810   1.00 17.00 ? 181 ALA A C     1 
ATOM   1919 O O     . ALA C 2 180 ? -15.929 -3.247  8.517   1.00 17.33 ? 181 ALA A O     1 
ATOM   1920 C CB    . ALA C 2 180 ? -15.970 -6.461  8.230   1.00 16.82 ? 181 ALA A CB    1 
ATOM   1921 N N     . GLY C 2 181 ? -13.846 -4.064  8.680   1.00 19.37 ? 182 GLY A N     1 
ATOM   1922 C CA    . GLY C 2 181 ? -13.219 -2.867  8.141   1.00 16.35 ? 182 GLY A CA    1 
ATOM   1923 C C     . GLY C 2 181 ? -13.035 -2.950  6.630   1.00 17.51 ? 182 GLY A C     1 
ATOM   1924 O O     . GLY C 2 181 ? -12.733 -1.946  5.980   1.00 18.06 ? 182 GLY A O     1 
ATOM   1925 N N     . SER C 2 182 ? -13.199 -4.147  6.070   1.00 16.29 ? 183 SER A N     1 
ATOM   1926 C CA    . SER C 2 182 ? -13.106 -4.364  4.622   1.00 16.28 ? 183 SER A CA    1 
ATOM   1927 C C     . SER C 2 182 ? -13.871 -5.642  4.259   1.00 18.51 ? 183 SER A C     1 
ATOM   1928 O O     . SER C 2 182 ? -14.077 -6.517  5.111   1.00 17.16 ? 183 SER A O     1 
ATOM   1929 C CB    . SER C 2 182 ? -11.647 -4.442  4.149   1.00 12.90 ? 183 SER A CB    1 
ATOM   1930 O OG    . SER C 2 182 ? -10.966 -5.578  4.650   1.00 15.42 ? 183 SER A OG    1 
ATOM   1931 N N     . GLY C 2 183 ? -14.304 -5.745  3.004   1.00 17.55 ? 184 GLY A N     1 
ATOM   1932 C CA    . GLY C 2 183 ? -15.055 -6.910  2.571   1.00 12.44 ? 184 GLY A CA    1 
ATOM   1933 C C     . GLY C 2 183 ? -14.202 -8.035  2.018   1.00 16.23 ? 184 GLY A C     1 
ATOM   1934 O O     . GLY C 2 183 ? -13.909 -9.008  2.724   1.00 16.98 ? 184 GLY A O     1 
ATOM   1935 N N     . ASN C 2 184 ? -13.791 -7.915  0.758   1.00 15.23 ? 185 ASN A N     1 
ATOM   1936 C CA    . ASN C 2 184 ? -12.988 -8.956  0.119   1.00 17.09 ? 185 ASN A CA    1 
ATOM   1937 C C     . ASN C 2 184 ? -11.665 -9.273  0.812   1.00 16.42 ? 185 ASN A C     1 
ATOM   1938 O O     . ASN C 2 184 ? -11.140 -10.379 0.674   1.00 16.04 ? 185 ASN A O     1 
ATOM   1939 C CB    . ASN C 2 184 ? -12.769 -8.659  -1.387  1.00 18.70 ? 185 ASN A CB    1 
ATOM   1940 C CG    . ASN C 2 184 ? -12.096 -7.307  -1.659  1.00 22.16 ? 185 ASN A CG    1 
ATOM   1941 O OD1   . ASN C 2 184 ? -11.661 -6.602  -0.743  1.00 20.39 ? 185 ASN A OD1   1 
ATOM   1942 N ND2   . ASN C 2 184 ? -12.013 -6.946  -2.933  1.00 13.09 ? 185 ASN A ND2   1 
ATOM   1943 N N     . THR C 2 185 ? -11.125 -8.315  1.559   1.00 17.16 ? 186 THR A N     1 
ATOM   1944 C CA    . THR C 2 185 ? -9.865  -8.534  2.272   1.00 16.41 ? 186 THR A CA    1 
ATOM   1945 C C     . THR C 2 185 ? -10.085 -8.847  3.769   1.00 15.94 ? 186 THR A C     1 
ATOM   1946 O O     . THR C 2 185 ? -9.147  -8.806  4.573   1.00 15.65 ? 186 THR A O     1 
ATOM   1947 C CB    . THR C 2 185 ? -8.894  -7.329  2.081   1.00 15.24 ? 186 THR A CB    1 
ATOM   1948 O OG1   . THR C 2 185 ? -9.576  -6.107  2.390   1.00 15.58 ? 186 THR A OG1   1 
ATOM   1949 C CG2   . THR C 2 185 ? -8.401  -7.275  0.640   1.00 13.20 ? 186 THR A CG2   1 
ATOM   1950 N N     . THR C 2 186 ? -11.333 -9.149  4.123   1.00 13.05 ? 187 THR A N     1 
ATOM   1951 C CA    . THR C 2 186 ? -11.720 -9.553  5.481   1.00 14.97 ? 187 THR A CA    1 
ATOM   1952 C C     . THR C 2 186 ? -10.906 -8.948  6.649   1.00 14.80 ? 187 THR A C     1 
ATOM   1953 O O     . THR C 2 186 ? -10.155 -9.648  7.338   1.00 14.57 ? 187 THR A O     1 
ATOM   1954 C CB    . THR C 2 186 ? -11.699 -11.118 5.586   1.00 12.84 ? 187 THR A CB    1 
ATOM   1955 O OG1   . THR C 2 186 ? -10.408 -11.617 5.212   1.00 15.05 ? 187 THR A OG1   1 
ATOM   1956 C CG2   . THR C 2 186 ? -12.746 -11.747 4.639   1.00 13.61 ? 187 THR A CG2   1 
ATOM   1957 N N     . ASN C 2 187 ? -11.051 -7.650  6.869   1.00 15.05 ? 188 ASN A N     1 
ATOM   1958 C CA    . ASN C 2 187 ? -10.332 -6.998  7.952   1.00 15.84 ? 188 ASN A CA    1 
ATOM   1959 C C     . ASN C 2 187 ? -11.262 -6.658  9.103   1.00 16.55 ? 188 ASN A C     1 
ATOM   1960 O O     . ASN C 2 187 ? -12.461 -6.423  8.907   1.00 15.11 ? 188 ASN A O     1 
ATOM   1961 C CB    . ASN C 2 187 ? -9.674  -5.702  7.465   1.00 12.35 ? 188 ASN A CB    1 
ATOM   1962 C CG    . ASN C 2 187 ? -8.171  -5.827  7.284   1.00 14.64 ? 188 ASN A CG    1 
ATOM   1963 O OD1   . ASN C 2 187 ? -7.416  -5.078  7.893   1.00 13.52 ? 188 ASN A OD1   1 
ATOM   1964 N ND2   . ASN C 2 187 ? -7.730  -6.763  6.447   1.00 11.76 ? 188 ASN A ND2   1 
ATOM   1965 N N     . ILE C 2 188 ? -10.699 -6.640  10.308  1.00 17.59 ? 189 ILE A N     1 
ATOM   1966 C CA    . ILE C 2 188 ? -11.430 -6.252  11.503  1.00 15.27 ? 189 ILE A CA    1 
ATOM   1967 C C     . ILE C 2 188 ? -11.580 -4.720  11.391  1.00 17.26 ? 189 ILE A C     1 
ATOM   1968 O O     . ILE C 2 188 ? -10.638 -4.026  10.980  1.00 15.76 ? 189 ILE A O     1 
ATOM   1969 C CB    . ILE C 2 188 ? -10.600 -6.589  12.776  1.00 19.36 ? 189 ILE A CB    1 
ATOM   1970 C CG1   . ILE C 2 188 ? -10.556 -8.104  12.983  1.00 20.34 ? 189 ILE A CG1   1 
ATOM   1971 C CG2   . ILE C 2 188 ? -11.145 -5.845  14.001  1.00 14.25 ? 189 ILE A CG2   1 
ATOM   1972 C CD1   . ILE C 2 188 ? -9.502  -8.546  13.970  1.00 20.54 ? 189 ILE A CD1   1 
ATOM   1973 N N     . GLY C 2 189 ? -12.752 -4.196  11.730  1.00 14.79 ? 190 GLY A N     1 
ATOM   1974 C CA    . GLY C 2 189 ? -12.947 -2.756  11.695  1.00 14.89 ? 190 GLY A CA    1 
ATOM   1975 C C     . GLY C 2 189 ? -12.800 -2.224  13.119  1.00 19.10 ? 190 GLY A C     1 
ATOM   1976 O O     . GLY C 2 189 ? -13.090 -2.944  14.086  1.00 20.05 ? 190 GLY A O     1 
ATOM   1977 N N     . SER C 2 190 ? -12.339 -0.989  13.278  1.00 17.31 ? 191 SER A N     1 
ATOM   1978 C CA    . SER C 2 190 ? -12.206 -0.421  14.617  1.00 17.77 ? 191 SER A CA    1 
ATOM   1979 C C     . SER C 2 190 ? -13.518 0.284   14.936  1.00 18.36 ? 191 SER A C     1 
ATOM   1980 O O     . SER C 2 190 ? -14.435 0.305   14.109  1.00 16.97 ? 191 SER A O     1 
ATOM   1981 C CB    . SER C 2 190 ? -11.057 0.597   14.668  1.00 13.52 ? 191 SER A CB    1 
ATOM   1982 O OG    . SER C 2 190 ? -11.399 1.823   14.023  1.00 16.76 ? 191 SER A OG    1 
ATOM   1983 N N     . ILE C 2 191 ? -13.616 0.852   16.135  1.00 16.27 ? 192 ILE A N     1 
ATOM   1984 C CA    . ILE C 2 191 ? -14.800 1.621   16.494  1.00 15.14 ? 192 ILE A CA    1 
ATOM   1985 C C     . ILE C 2 191 ? -14.752 2.846   15.558  1.00 15.42 ? 192 ILE A C     1 
ATOM   1986 O O     . ILE C 2 191 ? -13.669 3.250   15.094  1.00 14.59 ? 192 ILE A O     1 
ATOM   1987 C CB    . ILE C 2 191 ? -14.748 2.126   17.993  1.00 21.67 ? 192 ILE A CB    1 
ATOM   1988 C CG1   . ILE C 2 191 ? -13.432 2.883   18.260  1.00 16.88 ? 192 ILE A CG1   1 
ATOM   1989 C CG2   . ILE C 2 191 ? -14.923 0.949   18.962  1.00 16.45 ? 192 ILE A CG2   1 
ATOM   1990 C CD1   . ILE C 2 191 ? -13.305 3.475   19.646  1.00 18.96 ? 192 ILE A CD1   1 
ATOM   1991 N N     . HIS C 2 192 ? -15.909 3.425   15.279  1.00 13.85 ? 193 HIS A N     1 
ATOM   1992 C CA    . HIS C 2 192 ? -15.995 4.601   14.426  1.00 18.45 ? 193 HIS A CA    1 
ATOM   1993 C C     . HIS C 2 192 ? -16.195 5.722   15.438  1.00 19.50 ? 193 HIS A C     1 
ATOM   1994 O O     . HIS C 2 192 ? -17.302 5.927   15.921  1.00 21.01 ? 193 HIS A O     1 
ATOM   1995 C CB    . HIS C 2 192 ? -17.199 4.459   13.486  1.00 22.86 ? 193 HIS A CB    1 
ATOM   1996 C CG    . HIS C 2 192 ? -17.281 5.515   12.425  1.00 37.88 ? 193 HIS A CG    1 
ATOM   1997 N ND1   . HIS C 2 192 ? -16.174 6.174   11.935  1.00 45.44 ? 193 HIS A ND1   1 
ATOM   1998 C CD2   . HIS C 2 192 ? -18.344 6.019   11.755  1.00 39.99 ? 193 HIS A CD2   1 
ATOM   1999 C CE1   . HIS C 2 192 ? -16.550 7.038   11.009  1.00 41.41 ? 193 HIS A CE1   1 
ATOM   2000 N NE2   . HIS C 2 192 ? -17.862 6.963   10.881  1.00 40.69 ? 193 HIS A NE2   1 
ATOM   2001 N N     . ALA C 2 193 ? -15.131 6.447   15.759  1.00 17.91 ? 194 ALA A N     1 
ATOM   2002 C CA    . ALA C 2 193 ? -15.234 7.477   16.778  1.00 20.21 ? 194 ALA A CA    1 
ATOM   2003 C C     . ALA C 2 193 ? -14.212 8.590   16.642  1.00 21.41 ? 194 ALA A C     1 
ATOM   2004 O O     . ALA C 2 193 ? -13.433 8.619   15.702  1.00 21.50 ? 194 ALA A O     1 
ATOM   2005 C CB    . ALA C 2 193 ? -15.091 6.821   18.150  1.00 19.30 ? 194 ALA A CB    1 
ATOM   2006 N N     . HIS C 2 194 ? -14.221 9.512   17.599  1.00 22.53 ? 195 HIS A N     1 
ATOM   2007 C CA    . HIS C 2 194 ? -13.275 10.625  17.594  1.00 23.12 ? 195 HIS A CA    1 
ATOM   2008 C C     . HIS C 2 194 ? -11.954 10.179  18.175  1.00 19.68 ? 195 HIS A C     1 
ATOM   2009 O O     . HIS C 2 194 ? -11.899 9.207   18.929  1.00 18.54 ? 195 HIS A O     1 
ATOM   2010 C CB    . HIS C 2 194 ? -13.820 11.802  18.400  1.00 26.73 ? 195 HIS A CB    1 
ATOM   2011 C CG    . HIS C 2 194 ? -15.066 12.388  17.821  1.00 35.51 ? 195 HIS A CG    1 
ATOM   2012 N ND1   . HIS C 2 194 ? -15.051 13.283  16.773  1.00 38.35 ? 195 HIS A ND1   1 
ATOM   2013 C CD2   . HIS C 2 194 ? -16.371 12.194  18.131  1.00 41.91 ? 195 HIS A CD2   1 
ATOM   2014 C CE1   . HIS C 2 194 ? -16.290 13.616  16.462  1.00 42.34 ? 195 HIS A CE1   1 
ATOM   2015 N NE2   . HIS C 2 194 ? -17.109 12.970  17.271  1.00 45.34 ? 195 HIS A NE2   1 
ATOM   2016 N N     . TYR C 2 195 ? -10.895 10.897  17.826  1.00 19.85 ? 196 TYR A N     1 
ATOM   2017 C CA    . TYR C 2 195 ? -9.543  10.597  18.291  1.00 19.68 ? 196 TYR A CA    1 
ATOM   2018 C C     . TYR C 2 195 ? -9.429  10.381  19.814  1.00 20.85 ? 196 TYR A C     1 
ATOM   2019 O O     . TYR C 2 195 ? -8.735  9.459   20.261  1.00 19.80 ? 196 TYR A O     1 
ATOM   2020 C CB    . TYR C 2 195 ? -8.601  11.718  17.837  1.00 17.59 ? 196 TYR A CB    1 
ATOM   2021 C CG    . TYR C 2 195 ? -7.231  11.728  18.489  1.00 16.52 ? 196 TYR A CG    1 
ATOM   2022 C CD1   . TYR C 2 195 ? -6.217  10.878  18.050  1.00 12.87 ? 196 TYR A CD1   1 
ATOM   2023 C CD2   . TYR C 2 195 ? -6.945  12.608  19.539  1.00 20.91 ? 196 TYR A CD2   1 
ATOM   2024 C CE1   . TYR C 2 195 ? -4.950  10.902  18.634  1.00 13.58 ? 196 TYR A CE1   1 
ATOM   2025 C CE2   . TYR C 2 195 ? -5.682  12.641  20.133  1.00 17.83 ? 196 TYR A CE2   1 
ATOM   2026 C CZ    . TYR C 2 195 ? -4.689  11.788  19.676  1.00 18.03 ? 196 TYR A CZ    1 
ATOM   2027 O OH    . TYR C 2 195 ? -3.442  11.833  20.262  1.00 17.24 ? 196 TYR A OH    1 
ATOM   2028 N N     . LYS C 2 196 ? -10.104 11.213  20.608  1.00 20.76 ? 197 LYS A N     1 
ATOM   2029 C CA    . LYS C 2 196 ? -10.028 11.085  22.070  1.00 24.61 ? 197 LYS A CA    1 
ATOM   2030 C C     . LYS C 2 196 ? -10.511 9.727   22.569  1.00 21.62 ? 197 LYS A C     1 
ATOM   2031 O O     . LYS C 2 196 ? -9.985  9.211   23.552  1.00 22.64 ? 197 LYS A O     1 
ATOM   2032 C CB    . LYS C 2 196 ? -10.793 12.217  22.782  1.00 28.66 ? 197 LYS A CB    1 
ATOM   2033 C CG    . LYS C 2 196 ? -12.309 12.073  22.805  1.00 38.48 ? 197 LYS A CG    1 
ATOM   2034 C CD    . LYS C 2 196 ? -12.948 13.136  23.693  1.00 48.00 ? 197 LYS A CD    1 
ATOM   2035 C CE    . LYS C 2 196 ? -14.375 12.761  24.059  1.00 52.68 ? 197 LYS A CE    1 
ATOM   2036 N NZ    . LYS C 2 196 ? -14.411 11.483  24.834  1.00 58.44 ? 197 LYS A NZ    1 
ATOM   2037 N N     . ASP C 2 197 ? -11.499 9.143   21.891  1.00 20.88 ? 198 ASP A N     1 
ATOM   2038 C CA    . ASP C 2 197 ? -12.019 7.828   22.276  1.00 20.52 ? 198 ASP A CA    1 
ATOM   2039 C C     . ASP C 2 197 ? -10.983 6.719   22.075  1.00 18.81 ? 198 ASP A C     1 
ATOM   2040 O O     . ASP C 2 197 ? -11.010 5.713   22.784  1.00 20.30 ? 198 ASP A O     1 
ATOM   2041 C CB    . ASP C 2 197 ? -13.303 7.499   21.509  1.00 25.08 ? 198 ASP A CB    1 
ATOM   2042 C CG    . ASP C 2 197 ? -14.403 8.511   21.764  1.00 32.55 ? 198 ASP A CG    1 
ATOM   2043 O OD1   . ASP C 2 197 ? -14.619 8.866   22.942  1.00 35.14 ? 198 ASP A OD1   1 
ATOM   2044 O OD2   . ASP C 2 197 ? -15.047 8.953   20.787  1.00 39.47 ? 198 ASP A OD2   1 
ATOM   2045 N N     . PHE C 2 198 ? -10.076 6.898   21.115  1.00 15.67 ? 199 PHE A N     1 
ATOM   2046 C CA    . PHE C 2 198 ? -9.022  5.924   20.866  1.00 14.76 ? 199 PHE A CA    1 
ATOM   2047 C C     . PHE C 2 198 ? -7.960  6.049   21.970  1.00 16.75 ? 199 PHE A C     1 
ATOM   2048 O O     . PHE C 2 198 ? -7.473  5.045   22.505  1.00 16.23 ? 199 PHE A O     1 
ATOM   2049 C CB    . PHE C 2 198 ? -8.386  6.160   19.488  1.00 15.42 ? 199 PHE A CB    1 
ATOM   2050 C CG    . PHE C 2 198 ? -9.277  5.790   18.344  1.00 15.72 ? 199 PHE A CG    1 
ATOM   2051 C CD1   . PHE C 2 198 ? -10.165 6.716   17.807  1.00 16.73 ? 199 PHE A CD1   1 
ATOM   2052 C CD2   . PHE C 2 198 ? -9.255  4.501   17.824  1.00 14.75 ? 199 PHE A CD2   1 
ATOM   2053 C CE1   . PHE C 2 198 ? -11.024 6.364   16.763  1.00 14.22 ? 199 PHE A CE1   1 
ATOM   2054 C CE2   . PHE C 2 198 ? -10.104 4.140   16.786  1.00 14.24 ? 199 PHE A CE2   1 
ATOM   2055 C CZ    . PHE C 2 198 ? -10.994 5.074   16.254  1.00 13.90 ? 199 PHE A CZ    1 
ATOM   2056 N N     . VAL C 2 199 ? -7.608  7.287   22.308  1.00 15.95 ? 200 VAL A N     1 
ATOM   2057 C CA    . VAL C 2 199 ? -6.624  7.554   23.361  1.00 17.73 ? 200 VAL A CA    1 
ATOM   2058 C C     . VAL C 2 199 ? -7.138  7.013   24.707  1.00 17.91 ? 200 VAL A C     1 
ATOM   2059 O O     . VAL C 2 199 ? -6.407  6.348   25.443  1.00 18.48 ? 200 VAL A O     1 
ATOM   2060 C CB    . VAL C 2 199 ? -6.343  9.085   23.502  1.00 21.00 ? 200 VAL A CB    1 
ATOM   2061 C CG1   . VAL C 2 199 ? -5.517  9.367   24.759  1.00 18.18 ? 200 VAL A CG1   1 
ATOM   2062 C CG2   . VAL C 2 199 ? -5.611  9.599   22.273  1.00 15.92 ? 200 VAL A CG2   1 
ATOM   2063 N N     . GLU C 2 200 ? -8.401  7.303   25.013  1.00 20.75 ? 201 GLU A N     1 
ATOM   2064 C CA    . GLU C 2 200 ? -9.029  6.861   26.259  1.00 23.27 ? 201 GLU A CA    1 
ATOM   2065 C C     . GLU C 2 200 ? -9.387  5.382   26.281  1.00 22.66 ? 201 GLU A C     1 
ATOM   2066 O O     . GLU C 2 200 ? -9.500  4.791   27.349  1.00 23.68 ? 201 GLU A O     1 
ATOM   2067 C CB    . GLU C 2 200 ? -10.274 7.700   26.551  1.00 25.54 ? 201 GLU A CB    1 
ATOM   2068 C CG    . GLU C 2 200 ? -9.951  9.152   26.903  1.00 34.86 ? 201 GLU A CG    1 
ATOM   2069 C CD    . GLU C 2 200 ? -11.186 10.001  27.130  1.00 38.67 ? 201 GLU A CD    1 
ATOM   2070 O OE1   . GLU C 2 200 ? -12.173 9.495   27.714  1.00 47.23 ? 201 GLU A OE1   1 
ATOM   2071 O OE2   . GLU C 2 200 ? -11.161 11.180  26.722  1.00 38.64 ? 201 GLU A OE2   1 
ATOM   2072 N N     . GLY C 2 201 ? -9.568  4.790   25.106  1.00 22.11 ? 202 GLY A N     1 
ATOM   2073 C CA    . GLY C 2 201 ? -9.899  3.377   25.031  1.00 20.54 ? 202 GLY A CA    1 
ATOM   2074 C C     . GLY C 2 201 ? -11.360 3.062   25.289  1.00 20.93 ? 202 GLY A C     1 
ATOM   2075 O O     . GLY C 2 201 ? -11.687 2.065   25.944  1.00 20.36 ? 202 GLY A O     1 
ATOM   2076 N N     . LYS C 2 202 ? -12.242 3.908   24.774  1.00 21.15 ? 203 LYS A N     1 
ATOM   2077 C CA    . LYS C 2 202 ? -13.670 3.712   24.944  1.00 24.22 ? 203 LYS A CA    1 
ATOM   2078 C C     . LYS C 2 202 ? -14.221 2.819   23.834  1.00 25.55 ? 203 LYS A C     1 
ATOM   2079 O O     . LYS C 2 202 ? -14.888 3.294   22.911  1.00 27.43 ? 203 LYS A O     1 
ATOM   2080 C CB    . LYS C 2 202 ? -14.368 5.067   24.979  1.00 25.38 ? 203 LYS A CB    1 
ATOM   2081 C CG    . LYS C 2 202 ? -13.962 5.862   26.214  1.00 44.79 ? 203 LYS A CG    1 
ATOM   2082 C CD    . LYS C 2 202 ? -14.895 7.020   26.496  1.00 59.37 ? 203 LYS A CD    1 
ATOM   2083 C CE    . LYS C 2 202 ? -14.742 7.483   27.939  1.00 65.75 ? 203 LYS A CE    1 
ATOM   2084 N NZ    . LYS C 2 202 ? -15.710 8.560   28.286  1.00 68.83 ? 203 LYS A NZ    1 
ATOM   2085 N N     . GLY C 2 203 ? -13.927 1.523   23.943  1.00 25.51 ? 204 GLY A N     1 
ATOM   2086 C CA    . GLY C 2 203 ? -14.364 0.555   22.951  1.00 25.88 ? 204 GLY A CA    1 
ATOM   2087 C C     . GLY C 2 203 ? -15.666 -0.129  23.307  1.00 26.42 ? 204 GLY A C     1 
ATOM   2088 O O     . GLY C 2 203 ? -16.420 0.368   24.148  1.00 26.59 ? 204 GLY A O     1 
ATOM   2089 N N     . ILE C 2 204 ? -15.936 -1.270  22.673  1.00 24.59 ? 205 ILE A N     1 
ATOM   2090 C CA    . ILE C 2 204 ? -17.166 -2.010  22.935  1.00 23.47 ? 205 ILE A CA    1 
ATOM   2091 C C     . ILE C 2 204 ? -16.977 -3.393  23.587  1.00 20.24 ? 205 ILE A C     1 
ATOM   2092 O O     . ILE C 2 204 ? -17.905 -3.906  24.212  1.00 19.19 ? 205 ILE A O     1 
ATOM   2093 C CB    . ILE C 2 204 ? -18.028 -2.187  21.655  1.00 25.82 ? 205 ILE A CB    1 
ATOM   2094 C CG1   . ILE C 2 204 ? -17.285 -3.029  20.623  1.00 26.32 ? 205 ILE A CG1   1 
ATOM   2095 C CG2   . ILE C 2 204 ? -18.406 -0.837  21.078  1.00 28.87 ? 205 ILE A CG2   1 
ATOM   2096 C CD1   . ILE C 2 204 ? -18.165 -3.459  19.493  1.00 30.52 ? 205 ILE A CD1   1 
ATOM   2097 N N     . PHE C 2 205 ? -15.800 -3.999  23.446  1.00 18.56 ? 206 PHE A N     1 
ATOM   2098 C CA    . PHE C 2 205 ? -15.566 -5.310  24.044  1.00 18.58 ? 206 PHE A CA    1 
ATOM   2099 C C     . PHE C 2 205 ? -15.214 -5.206  25.535  1.00 20.59 ? 206 PHE A C     1 
ATOM   2100 O O     . PHE C 2 205 ? -14.553 -4.256  25.962  1.00 20.19 ? 206 PHE A O     1 
ATOM   2101 C CB    . PHE C 2 205 ? -14.476 -6.071  23.271  1.00 15.82 ? 206 PHE A CB    1 
ATOM   2102 C CG    . PHE C 2 205 ? -14.913 -6.513  21.903  1.00 21.43 ? 206 PHE A CG    1 
ATOM   2103 C CD1   . PHE C 2 205 ? -15.852 -7.532  21.753  1.00 19.94 ? 206 PHE A CD1   1 
ATOM   2104 C CD2   . PHE C 2 205 ? -14.413 -5.892  20.763  1.00 18.47 ? 206 PHE A CD2   1 
ATOM   2105 C CE1   . PHE C 2 205 ? -16.289 -7.924  20.485  1.00 17.59 ? 206 PHE A CE1   1 
ATOM   2106 C CE2   . PHE C 2 205 ? -14.847 -6.280  19.490  1.00 18.96 ? 206 PHE A CE2   1 
ATOM   2107 C CZ    . PHE C 2 205 ? -15.785 -7.294  19.357  1.00 17.48 ? 206 PHE A CZ    1 
ATOM   2108 N N     . ASP C 2 206 ? -15.669 -6.189  26.314  1.00 21.78 ? 207 ASP A N     1 
ATOM   2109 C CA    . ASP C 2 206 ? -15.423 -6.235  27.760  1.00 23.94 ? 207 ASP A CA    1 
ATOM   2110 C C     . ASP C 2 206 ? -14.063 -6.815  28.115  1.00 23.81 ? 207 ASP A C     1 
ATOM   2111 O O     . ASP C 2 206 ? -13.468 -6.466  29.140  1.00 23.60 ? 207 ASP A O     1 
ATOM   2112 C CB    . ASP C 2 206 ? -16.519 -7.040  28.465  1.00 25.36 ? 207 ASP A CB    1 
ATOM   2113 C CG    . ASP C 2 206 ? -17.796 -6.238  28.676  1.00 33.27 ? 207 ASP A CG    1 
ATOM   2114 O OD1   . ASP C 2 206 ? -17.752 -4.990  28.607  1.00 35.79 ? 207 ASP A OD1   1 
ATOM   2115 O OD2   . ASP C 2 206 ? -18.854 -6.859  28.912  1.00 45.82 ? 207 ASP A OD2   1 
ATOM   2116 N N     . SER C 2 207 ? -13.573 -7.702  27.262  1.00 22.33 ? 208 SER A N     1 
ATOM   2117 C CA    . SER C 2 207 ? -12.284 -8.327  27.485  1.00 21.54 ? 208 SER A CA    1 
ATOM   2118 C C     . SER C 2 207 ? -11.671 -8.691  26.144  1.00 20.08 ? 208 SER A C     1 
ATOM   2119 O O     . SER C 2 207 ? -12.352 -8.681  25.112  1.00 20.38 ? 208 SER A O     1 
ATOM   2120 C CB    . SER C 2 207 ? -12.453 -9.599  28.312  1.00 18.78 ? 208 SER A CB    1 
ATOM   2121 O OG    . SER C 2 207 ? -13.205 -10.567 27.591  1.00 21.74 ? 208 SER A OG    1 
ATOM   2122 N N     . GLU C 2 208 ? -10.388 -9.017  26.172  1.00 18.12 ? 209 GLU A N     1 
ATOM   2123 C CA    . GLU C 2 208 ? -9.688  -9.413  24.977  1.00 20.86 ? 209 GLU A CA    1 
ATOM   2124 C C     . GLU C 2 208 ? -10.225 -10.766 24.516  1.00 22.75 ? 209 GLU A C     1 
ATOM   2125 O O     . GLU C 2 208 ? -10.202 -11.066 23.322  1.00 23.68 ? 209 GLU A O     1 
ATOM   2126 C CB    . GLU C 2 208 ? -8.198  -9.501  25.252  1.00 22.98 ? 209 GLU A CB    1 
ATOM   2127 C CG    . GLU C 2 208 ? -7.378  -9.790  24.014  1.00 22.81 ? 209 GLU A CG    1 
ATOM   2128 C CD    . GLU C 2 208 ? -5.905  -9.579  24.249  1.00 28.13 ? 209 GLU A CD    1 
ATOM   2129 O OE1   . GLU C 2 208 ? -5.477  -9.560  25.421  1.00 33.76 ? 209 GLU A OE1   1 
ATOM   2130 O OE2   . GLU C 2 208 ? -5.171  -9.427  23.259  1.00 30.74 ? 209 GLU A OE2   1 
ATOM   2131 N N     . ASP C 2 209 ? -10.706 -11.578 25.458  1.00 19.62 ? 210 ASP A N     1 
ATOM   2132 C CA    . ASP C 2 209 ? -11.271 -12.890 25.128  1.00 19.72 ? 210 ASP A CA    1 
ATOM   2133 C C     . ASP C 2 209 ? -12.592 -12.745 24.373  1.00 17.61 ? 210 ASP A C     1 
ATOM   2134 O O     . ASP C 2 209 ? -12.901 -13.559 23.516  1.00 18.94 ? 210 ASP A O     1 
ATOM   2135 C CB    . ASP C 2 209 ? -11.514 -13.733 26.390  1.00 27.43 ? 210 ASP A CB    1 
ATOM   2136 C CG    . ASP C 2 209 ? -10.223 -14.156 27.083  1.00 35.66 ? 210 ASP A CG    1 
ATOM   2137 O OD1   . ASP C 2 209 ? -9.205  -14.404 26.392  1.00 40.29 ? 210 ASP A OD1   1 
ATOM   2138 O OD2   . ASP C 2 209 ? -10.236 -14.238 28.331  1.00 44.06 ? 210 ASP A OD2   1 
ATOM   2139 N N     . GLU C 2 210 ? -13.372 -11.717 24.694  1.00 15.83 ? 211 GLU A N     1 
ATOM   2140 C CA    . GLU C 2 210 ? -14.639 -11.505 24.009  1.00 17.13 ? 211 GLU A CA    1 
ATOM   2141 C C     . GLU C 2 210 ? -14.325 -11.030 22.588  1.00 21.18 ? 211 GLU A C     1 
ATOM   2142 O O     . GLU C 2 210 ? -14.989 -11.426 21.622  1.00 19.99 ? 211 GLU A O     1 
ATOM   2143 C CB    . GLU C 2 210 ? -15.490 -10.459 24.729  1.00 13.38 ? 211 GLU A CB    1 
ATOM   2144 C CG    . GLU C 2 210 ? -16.902 -10.399 24.184  1.00 14.47 ? 211 GLU A CG    1 
ATOM   2145 C CD    . GLU C 2 210 ? -17.765 -9.331  24.818  1.00 20.56 ? 211 GLU A CD    1 
ATOM   2146 O OE1   . GLU C 2 210 ? -17.294 -8.197  25.044  1.00 20.30 ? 211 GLU A OE1   1 
ATOM   2147 O OE2   . GLU C 2 210 ? -18.941 -9.628  25.086  1.00 21.34 ? 211 GLU A OE2   1 
ATOM   2148 N N     . PHE C 2 211 ? -13.307 -10.176 22.484  1.00 20.10 ? 212 PHE A N     1 
ATOM   2149 C CA    . PHE C 2 211 ? -12.853 -9.638  21.211  1.00 19.00 ? 212 PHE A CA    1 
ATOM   2150 C C     . PHE C 2 211 ? -12.432 -10.792 20.302  1.00 18.50 ? 212 PHE A C     1 
ATOM   2151 O O     . PHE C 2 211 ? -12.874 -10.876 19.155  1.00 19.68 ? 212 PHE A O     1 
ATOM   2152 C CB    . PHE C 2 211 ? -11.678 -8.668  21.440  1.00 19.93 ? 212 PHE A CB    1 
ATOM   2153 C CG    . PHE C 2 211 ? -10.754 -8.535  20.259  1.00 13.75 ? 212 PHE A CG    1 
ATOM   2154 C CD1   . PHE C 2 211 ? -11.164 -7.871  19.105  1.00 18.22 ? 212 PHE A CD1   1 
ATOM   2155 C CD2   . PHE C 2 211 ? -9.480  -9.101  20.294  1.00 10.59 ? 212 PHE A CD2   1 
ATOM   2156 C CE1   . PHE C 2 211 ? -10.315 -7.775  17.995  1.00 16.18 ? 212 PHE A CE1   1 
ATOM   2157 C CE2   . PHE C 2 211 ? -8.623  -9.013  19.199  1.00 14.91 ? 212 PHE A CE2   1 
ATOM   2158 C CZ    . PHE C 2 211 ? -9.044  -8.345  18.040  1.00 18.04 ? 212 PHE A CZ    1 
ATOM   2159 N N     . LEU C 2 212 ? -11.584 -11.680 20.817  1.00 16.52 ? 213 LEU A N     1 
ATOM   2160 C CA    . LEU C 2 212 ? -11.116 -12.814 20.040  1.00 17.22 ? 213 LEU A CA    1 
ATOM   2161 C C     . LEU C 2 212 ? -12.251 -13.755 19.629  1.00 20.38 ? 213 LEU A C     1 
ATOM   2162 O O     . LEU C 2 212 ? -12.327 -14.176 18.473  1.00 19.89 ? 213 LEU A O     1 
ATOM   2163 C CB    . LEU C 2 212 ? -10.052 -13.574 20.815  1.00 16.54 ? 213 LEU A CB    1 
ATOM   2164 C CG    . LEU C 2 212 ? -8.679  -12.910 20.796  1.00 20.68 ? 213 LEU A CG    1 
ATOM   2165 C CD1   . LEU C 2 212 ? -7.714  -13.690 21.678  1.00 20.27 ? 213 LEU A CD1   1 
ATOM   2166 C CD2   . LEU C 2 212 ? -8.166  -12.856 19.361  1.00 19.65 ? 213 LEU A CD2   1 
ATOM   2167 N N     . ASP C 2 213 ? -13.137 -14.078 20.566  1.00 18.06 ? 214 ASP A N     1 
ATOM   2168 C CA    . ASP C 2 213 ? -14.250 -14.970 20.269  1.00 17.70 ? 214 ASP A CA    1 
ATOM   2169 C C     . ASP C 2 213 ? -15.174 -14.393 19.197  1.00 16.86 ? 214 ASP A C     1 
ATOM   2170 O O     . ASP C 2 213 ? -15.618 -15.117 18.299  1.00 17.56 ? 214 ASP A O     1 
ATOM   2171 C CB    . ASP C 2 213 ? -15.055 -15.282 21.543  1.00 18.19 ? 214 ASP A CB    1 
ATOM   2172 C CG    . ASP C 2 213 ? -16.054 -16.422 21.345  1.00 15.81 ? 214 ASP A CG    1 
ATOM   2173 O OD1   . ASP C 2 213 ? -15.647 -17.503 20.881  1.00 22.07 ? 214 ASP A OD1   1 
ATOM   2174 O OD2   . ASP C 2 213 ? -17.245 -16.245 21.652  1.00 23.49 ? 214 ASP A OD2   1 
ATOM   2175 N N     . TYR C 2 214 ? -15.460 -13.099 19.294  1.00 15.48 ? 215 TYR A N     1 
ATOM   2176 C CA    . TYR C 2 214 ? -16.333 -12.426 18.338  1.00 17.20 ? 215 TYR A CA    1 
ATOM   2177 C C     . TYR C 2 214 ? -15.768 -12.531 16.916  1.00 18.29 ? 215 TYR A C     1 
ATOM   2178 O O     . TYR C 2 214 ? -16.468 -12.936 15.984  1.00 15.42 ? 215 TYR A O     1 
ATOM   2179 C CB    . TYR C 2 214 ? -16.499 -10.940 18.714  1.00 16.53 ? 215 TYR A CB    1 
ATOM   2180 C CG    . TYR C 2 214 ? -17.455 -10.175 17.811  1.00 15.90 ? 215 TYR A CG    1 
ATOM   2181 C CD1   . TYR C 2 214 ? -17.042 -9.674  16.567  1.00 18.91 ? 215 TYR A CD1   1 
ATOM   2182 C CD2   . TYR C 2 214 ? -18.787 -9.983  18.184  1.00 18.28 ? 215 TYR A CD2   1 
ATOM   2183 C CE1   . TYR C 2 214 ? -17.943 -9.007  15.716  1.00 14.83 ? 215 TYR A CE1   1 
ATOM   2184 C CE2   . TYR C 2 214 ? -19.689 -9.322  17.350  1.00 16.42 ? 215 TYR A CE2   1 
ATOM   2185 C CZ    . TYR C 2 214 ? -19.264 -8.840  16.122  1.00 17.19 ? 215 TYR A CZ    1 
ATOM   2186 O OH    . TYR C 2 214 ? -20.177 -8.201  15.319  1.00 13.10 ? 215 TYR A OH    1 
ATOM   2187 N N     . TRP C 2 215 ? -14.501 -12.167 16.757  1.00 16.30 ? 216 TRP A N     1 
ATOM   2188 C CA    . TRP C 2 215 ? -13.886 -12.192 15.445  1.00 16.92 ? 216 TRP A CA    1 
ATOM   2189 C C     . TRP C 2 215 ? -13.503 -13.565 14.895  1.00 20.09 ? 216 TRP A C     1 
ATOM   2190 O O     . TRP C 2 215 ? -13.385 -13.736 13.675  1.00 20.17 ? 216 TRP A O     1 
ATOM   2191 C CB    . TRP C 2 215 ? -12.746 -11.183 15.409  1.00 15.52 ? 216 TRP A CB    1 
ATOM   2192 C CG    . TRP C 2 215 ? -13.325 -9.800  15.362  1.00 17.68 ? 216 TRP A CG    1 
ATOM   2193 C CD1   . TRP C 2 215 ? -13.387 -8.892  16.382  1.00 13.49 ? 216 TRP A CD1   1 
ATOM   2194 C CD2   . TRP C 2 215 ? -13.979 -9.189  14.238  1.00 19.82 ? 216 TRP A CD2   1 
ATOM   2195 N NE1   . TRP C 2 215 ? -14.041 -7.755  15.964  1.00 16.27 ? 216 TRP A NE1   1 
ATOM   2196 C CE2   . TRP C 2 215 ? -14.415 -7.910  14.654  1.00 19.82 ? 216 TRP A CE2   1 
ATOM   2197 C CE3   . TRP C 2 215 ? -14.240 -9.601  12.918  1.00 16.86 ? 216 TRP A CE3   1 
ATOM   2198 C CZ2   . TRP C 2 215 ? -15.099 -7.036  13.799  1.00 16.42 ? 216 TRP A CZ2   1 
ATOM   2199 C CZ3   . TRP C 2 215 ? -14.916 -8.738  12.072  1.00 13.88 ? 216 TRP A CZ3   1 
ATOM   2200 C CH2   . TRP C 2 215 ? -15.340 -7.465  12.518  1.00 17.68 ? 216 TRP A CH2   1 
ATOM   2201 N N     . ARG C 2 216 ? -13.325 -14.544 15.783  1.00 17.60 ? 217 ARG A N     1 
ATOM   2202 C CA    . ARG C 2 216 ? -13.025 -15.914 15.359  1.00 16.97 ? 217 ARG A CA    1 
ATOM   2203 C C     . ARG C 2 216 ? -14.283 -16.613 14.800  1.00 17.41 ? 217 ARG A C     1 
ATOM   2204 O O     . ARG C 2 216 ? -14.179 -17.598 14.081  1.00 19.60 ? 217 ARG A O     1 
ATOM   2205 C CB    . ARG C 2 216 ? -12.483 -16.728 16.531  1.00 13.53 ? 217 ARG A CB    1 
ATOM   2206 C CG    . ARG C 2 216 ? -11.012 -16.526 16.769  1.00 19.97 ? 217 ARG A CG    1 
ATOM   2207 C CD    . ARG C 2 216 ? -10.536 -17.225 18.019  1.00 15.34 ? 217 ARG A CD    1 
ATOM   2208 N NE    . ARG C 2 216 ? -9.087  -17.129 18.104  1.00 18.50 ? 217 ARG A NE    1 
ATOM   2209 C CZ    . ARG C 2 216 ? -8.386  -17.145 19.235  1.00 29.72 ? 217 ARG A CZ    1 
ATOM   2210 N NH1   . ARG C 2 216 ? -8.999  -17.248 20.409  1.00 22.01 ? 217 ARG A NH1   1 
ATOM   2211 N NH2   . ARG C 2 216 ? -7.062  -17.054 19.191  1.00 22.43 ? 217 ARG A NH2   1 
ATOM   2212 N N     . ASN C 2 217 ? -15.465 -16.095 15.130  1.00 17.27 ? 218 ASN A N     1 
ATOM   2213 C CA    . ASN C 2 217 ? -16.724 -16.691 14.683  1.00 17.98 ? 218 ASN A CA    1 
ATOM   2214 C C     . ASN C 2 217 ? -17.570 -15.765 13.816  1.00 17.59 ? 218 ASN A C     1 
ATOM   2215 O O     . ASN C 2 217 ? -18.734 -16.065 13.528  1.00 17.10 ? 218 ASN A O     1 
ATOM   2216 C CB    . ASN C 2 217 ? -17.545 -17.153 15.902  1.00 19.24 ? 218 ASN A CB    1 
ATOM   2217 C CG    . ASN C 2 217 ? -16.867 -18.280 16.663  1.00 22.86 ? 218 ASN A CG    1 
ATOM   2218 O OD1   . ASN C 2 217 ? -17.025 -19.451 16.332  1.00 28.39 ? 218 ASN A OD1   1 
ATOM   2219 N ND2   . ASN C 2 217 ? -16.100 -17.927 17.686  1.00 22.08 ? 218 ASN A ND2   1 
ATOM   2220 N N     . TYR C 2 218 ? -16.991 -14.636 13.411  1.00 15.49 ? 219 TYR A N     1 
ATOM   2221 C CA    . TYR C 2 218 ? -17.690 -13.662 12.565  1.00 17.45 ? 219 TYR A CA    1 
ATOM   2222 C C     . TYR C 2 218 ? -17.733 -14.246 11.144  1.00 17.06 ? 219 TYR A C     1 
ATOM   2223 O O     . TYR C 2 218 ? -16.697 -14.636 10.611  1.00 15.17 ? 219 TYR A O     1 
ATOM   2224 C CB    . TYR C 2 218 ? -16.902 -12.346 12.575  1.00 15.83 ? 219 TYR A CB    1 
ATOM   2225 C CG    . TYR C 2 218 ? -17.519 -11.175 11.836  1.00 15.53 ? 219 TYR A CG    1 
ATOM   2226 C CD1   . TYR C 2 218 ? -18.447 -10.345 12.465  1.00 15.98 ? 219 TYR A CD1   1 
ATOM   2227 C CD2   . TYR C 2 218 ? -17.138 -10.866 10.528  1.00 11.94 ? 219 TYR A CD2   1 
ATOM   2228 C CE1   . TYR C 2 218 ? -18.979 -9.230  11.819  1.00 18.90 ? 219 TYR A CE1   1 
ATOM   2229 C CE2   . TYR C 2 218 ? -17.664 -9.753  9.871   1.00 15.76 ? 219 TYR A CE2   1 
ATOM   2230 C CZ    . TYR C 2 218 ? -18.581 -8.939  10.524  1.00 17.71 ? 219 TYR A CZ    1 
ATOM   2231 O OH    . TYR C 2 218 ? -19.088 -7.821  9.907   1.00 16.06 ? 219 TYR A OH    1 
ATOM   2232 N N     . GLU C 2 219 ? -18.912 -14.326 10.536  1.00 16.42 ? 220 GLU A N     1 
ATOM   2233 C CA    . GLU C 2 219 ? -18.993 -14.865 9.179   1.00 20.48 ? 220 GLU A CA    1 
ATOM   2234 C C     . GLU C 2 219 ? -18.625 -13.788 8.135   1.00 22.84 ? 220 GLU A C     1 
ATOM   2235 O O     . GLU C 2 219 ? -18.885 -12.595 8.347   1.00 22.20 ? 220 GLU A O     1 
ATOM   2236 C CB    . GLU C 2 219 ? -20.389 -15.421 8.916   1.00 16.21 ? 220 GLU A CB    1 
ATOM   2237 C CG    . GLU C 2 219 ? -20.775 -16.577 9.818   1.00 24.56 ? 220 GLU A CG    1 
ATOM   2238 C CD    . GLU C 2 219 ? -20.002 -17.865 9.545   1.00 30.95 ? 220 GLU A CD    1 
ATOM   2239 O OE1   . GLU C 2 219 ? -19.397 -18.009 8.467   1.00 37.62 ? 220 GLU A OE1   1 
ATOM   2240 O OE2   . GLU C 2 219 ? -20.001 -18.750 10.423  1.00 37.32 ? 220 GLU A OE2   1 
ATOM   2241 N N     . ARG C 2 220 ? -18.033 -14.216 7.016   1.00 23.46 ? 221 ARG A N     1 
ATOM   2242 C CA    . ARG C 2 220 ? -17.586 -13.317 5.938   1.00 23.55 ? 221 ARG A CA    1 
ATOM   2243 C C     . ARG C 2 220 ? -18.619 -12.470 5.181   1.00 23.52 ? 221 ARG A C     1 
ATOM   2244 O O     . ARG C 2 220 ? -18.267 -11.413 4.652   1.00 26.17 ? 221 ARG A O     1 
ATOM   2245 C CB    . ARG C 2 220 ? -16.773 -14.103 4.913   1.00 24.16 ? 221 ARG A CB    1 
ATOM   2246 C CG    . ARG C 2 220 ? -15.494 -14.714 5.440   1.00 33.06 ? 221 ARG A CG    1 
ATOM   2247 C CD    . ARG C 2 220 ? -14.910 -15.632 4.390   1.00 37.53 ? 221 ARG A CD    1 
ATOM   2248 N NE    . ARG C 2 220 ? -13.630 -16.216 4.787   1.00 49.30 ? 221 ARG A NE    1 
ATOM   2249 C CZ    . ARG C 2 220 ? -12.483 -15.991 4.145   1.00 55.83 ? 221 ARG A CZ    1 
ATOM   2250 N NH1   . ARG C 2 220 ? -12.455 -15.179 3.090   1.00 52.86 ? 221 ARG A NH1   1 
ATOM   2251 N NH2   . ARG C 2 220 ? -11.358 -16.572 4.556   1.00 56.08 ? 221 ARG A NH2   1 
ATOM   2252 N N     . THR C 2 221 ? -19.872 -12.912 5.105   1.00 20.18 ? 222 THR A N     1 
ATOM   2253 C CA    . THR C 2 221 ? -20.894 -12.141 4.392   1.00 22.80 ? 222 THR A CA    1 
ATOM   2254 C C     . THR C 2 221 ? -22.146 -11.943 5.246   1.00 24.98 ? 222 THR A C     1 
ATOM   2255 O O     . THR C 2 221 ? -22.409 -12.732 6.156   1.00 25.00 ? 222 THR A O     1 
ATOM   2256 C CB    . THR C 2 221 ? -21.309 -12.837 3.064   1.00 24.73 ? 222 THR A CB    1 
ATOM   2257 O OG1   . THR C 2 221 ? -21.937 -14.096 3.358   1.00 22.75 ? 222 THR A OG1   1 
ATOM   2258 C CG2   . THR C 2 221 ? -20.082 -13.071 2.166   1.00 17.06 ? 222 THR A CG2   1 
ATOM   2259 N N     . SER C 2 222 ? -22.921 -10.897 4.950   1.00 26.13 ? 223 SER A N     1 
ATOM   2260 C CA    . SER C 2 222 ? -24.139 -10.619 5.706   1.00 28.89 ? 223 SER A CA    1 
ATOM   2261 C C     . SER C 2 222 ? -25.164 -11.743 5.558   1.00 30.94 ? 223 SER A C     1 
ATOM   2262 O O     . SER C 2 222 ? -25.980 -11.959 6.452   1.00 31.79 ? 223 SER A O     1 
ATOM   2263 C CB    . SER C 2 222 ? -24.756 -9.269  5.300   1.00 24.08 ? 223 SER A CB    1 
ATOM   2264 O OG    . SER C 2 222 ? -25.347 -9.315  4.020   1.00 36.80 ? 223 SER A OG    1 
ATOM   2265 N N     . GLN C 2 223 ? -25.118 -12.457 4.434   1.00 32.02 ? 224 GLN A N     1 
ATOM   2266 C CA    . GLN C 2 223 ? -26.030 -13.573 4.188   1.00 34.73 ? 224 GLN A CA    1 
ATOM   2267 C C     . GLN C 2 223 ? -25.764 -14.633 5.259   1.00 33.81 ? 224 GLN A C     1 
ATOM   2268 O O     . GLN C 2 223 ? -26.695 -15.143 5.883   1.00 32.53 ? 224 GLN A O     1 
ATOM   2269 C CB    . GLN C 2 223 ? -25.783 -14.162 2.794   1.00 41.68 ? 224 GLN A CB    1 
ATOM   2270 C CG    . GLN C 2 223 ? -26.750 -15.266 2.379   1.00 58.10 ? 224 GLN A CG    1 
ATOM   2271 C CD    . GLN C 2 223 ? -26.045 -16.473 1.755   1.00 71.17 ? 224 GLN A CD    1 
ATOM   2272 O OE1   . GLN C 2 223 ? -26.429 -17.618 1.997   1.00 77.13 ? 224 GLN A OE1   1 
ATOM   2273 N NE2   . GLN C 2 223 ? -25.013 -16.221 0.951   1.00 75.46 ? 224 GLN A NE2   1 
ATOM   2274 N N     . LEU C 2 224 ? -24.485 -14.945 5.465   1.00 31.81 ? 225 LEU A N     1 
ATOM   2275 C CA    . LEU C 2 224 ? -24.064 -15.923 6.459   1.00 33.09 ? 225 LEU A CA    1 
ATOM   2276 C C     . LEU C 2 224 ? -24.179 -15.388 7.892   1.00 35.13 ? 225 LEU A C     1 
ATOM   2277 O O     . LEU C 2 224 ? -24.323 -16.166 8.836   1.00 35.68 ? 225 LEU A O     1 
ATOM   2278 C CB    . LEU C 2 224 ? -22.624 -16.363 6.187   1.00 31.92 ? 225 LEU A CB    1 
ATOM   2279 C CG    . LEU C 2 224 ? -22.386 -17.163 4.906   1.00 34.72 ? 225 LEU A CG    1 
ATOM   2280 C CD1   . LEU C 2 224 ? -20.936 -17.589 4.833   1.00 30.69 ? 225 LEU A CD1   1 
ATOM   2281 C CD2   . LEU C 2 224 ? -23.295 -18.383 4.890   1.00 35.02 ? 225 LEU A CD2   1 
ATOM   2282 N N     . ARG C 2 225 ? -24.112 -14.069 8.059   1.00 34.19 ? 226 ARG A N     1 
ATOM   2283 C CA    . ARG C 2 225 ? -24.223 -13.470 9.385   1.00 33.99 ? 226 ARG A CA    1 
ATOM   2284 C C     . ARG C 2 225 ? -25.680 -13.311 9.829   1.00 37.48 ? 226 ARG A C     1 
ATOM   2285 O O     . ARG C 2 225 ? -25.958 -13.201 11.028  1.00 37.86 ? 226 ARG A O     1 
ATOM   2286 C CB    . ARG C 2 225 ? -23.526 -12.109 9.433   1.00 27.53 ? 226 ARG A CB    1 
ATOM   2287 C CG    . ARG C 2 225 ? -22.022 -12.170 9.349   1.00 23.51 ? 226 ARG A CG    1 
ATOM   2288 C CD    . ARG C 2 225 ? -21.391 -10.841 9.755   1.00 23.15 ? 226 ARG A CD    1 
ATOM   2289 N NE    . ARG C 2 225 ? -21.752 -9.731  8.869   1.00 22.91 ? 226 ARG A NE    1 
ATOM   2290 C CZ    . ARG C 2 225 ? -21.079 -9.392  7.767   1.00 26.38 ? 226 ARG A CZ    1 
ATOM   2291 N NH1   . ARG C 2 225 ? -20.001 -10.071 7.396   1.00 19.80 ? 226 ARG A NH1   1 
ATOM   2292 N NH2   . ARG C 2 225 ? -21.483 -8.367  7.027   1.00 22.85 ? 226 ARG A NH2   1 
ATOM   2293 N N     . ASN C 2 226 ? -26.601 -13.302 8.865   1.00 38.71 ? 227 ASN A N     1 
ATOM   2294 C CA    . ASN C 2 226 ? -28.039 -13.158 9.126   1.00 42.98 ? 227 ASN A CA    1 
ATOM   2295 C C     . ASN C 2 226 ? -28.572 -14.032 10.257  1.00 44.50 ? 227 ASN A C     1 
ATOM   2296 O O     . ASN C 2 226 ? -29.280 -13.564 11.144  1.00 45.91 ? 227 ASN A O     1 
ATOM   2297 C CB    . ASN C 2 226 ? -28.840 -13.481 7.860   1.00 46.49 ? 227 ASN A CB    1 
ATOM   2298 C CG    . ASN C 2 226 ? -29.323 -12.242 7.136   1.00 52.65 ? 227 ASN A CG    1 
ATOM   2299 O OD1   . ASN C 2 226 ? -29.362 -11.145 7.700   1.00 56.35 ? 227 ASN A OD1   1 
ATOM   2300 N ND2   . ASN C 2 226 ? -29.701 -12.410 5.872   1.00 58.80 ? 227 ASN A ND2   1 
ATOM   2301 N N     . ASP C 2 227 ? -28.226 -15.310 10.205  1.00 45.20 ? 228 ASP A N     1 
ATOM   2302 C CA    . ASP C 2 227 ? -28.668 -16.278 11.197  1.00 45.86 ? 228 ASP A CA    1 
ATOM   2303 C C     . ASP C 2 227 ? -27.701 -16.458 12.374  1.00 42.37 ? 228 ASP A C     1 
ATOM   2304 O O     . ASP C 2 227 ? -27.904 -17.330 13.216  1.00 42.70 ? 228 ASP A O     1 
ATOM   2305 C CB    . ASP C 2 227 ? -28.921 -17.633 10.509  1.00 55.91 ? 228 ASP A CB    1 
ATOM   2306 C CG    . ASP C 2 227 ? -27.671 -18.192 9.799   1.00 68.27 ? 228 ASP A CG    1 
ATOM   2307 O OD1   . ASP C 2 227 ? -26.773 -17.399 9.416   1.00 71.98 ? 228 ASP A OD1   1 
ATOM   2308 O OD2   . ASP C 2 227 ? -27.591 -19.434 9.625   1.00 75.35 ? 228 ASP A OD2   1 
ATOM   2309 N N     . LYS C 2 228 ? -26.650 -15.650 12.431  1.00 37.38 ? 229 LYS A N     1 
ATOM   2310 C CA    . LYS C 2 228 ? -25.678 -15.744 13.513  1.00 33.25 ? 229 LYS A CA    1 
ATOM   2311 C C     . LYS C 2 228 ? -25.676 -14.396 14.245  1.00 31.91 ? 229 LYS A C     1 
ATOM   2312 O O     . LYS C 2 228 ? -26.540 -14.151 15.091  1.00 34.26 ? 229 LYS A O     1 
ATOM   2313 C CB    . LYS C 2 228 ? -24.303 -16.079 12.937  1.00 33.12 ? 229 LYS A CB    1 
ATOM   2314 C CG    . LYS C 2 228 ? -23.565 -17.147 13.703  1.00 33.73 ? 229 LYS A CG    1 
ATOM   2315 C CD    . LYS C 2 228 ? -22.189 -17.332 13.142  1.00 33.27 ? 229 LYS A CD    1 
ATOM   2316 C CE    . LYS C 2 228 ? -21.456 -18.436 13.851  1.00 29.88 ? 229 LYS A CE    1 
ATOM   2317 N NZ    . LYS C 2 228 ? -20.070 -18.556 13.325  1.00 28.40 ? 229 LYS A NZ    1 
ATOM   2318 N N     . TYR C 2 229 ? -24.725 -13.520 13.932  1.00 25.53 ? 230 TYR A N     1 
ATOM   2319 C CA    . TYR C 2 229 ? -24.693 -12.196 14.546  1.00 23.05 ? 230 TYR A CA    1 
ATOM   2320 C C     . TYR C 2 229 ? -23.999 -11.195 13.625  1.00 20.66 ? 230 TYR A C     1 
ATOM   2321 O O     . TYR C 2 229 ? -23.037 -11.535 12.925  1.00 18.32 ? 230 TYR A O     1 
ATOM   2322 C CB    . TYR C 2 229 ? -24.027 -12.219 15.937  1.00 15.05 ? 230 TYR A CB    1 
ATOM   2323 C CG    . TYR C 2 229 ? -22.614 -12.746 15.975  1.00 15.60 ? 230 TYR A CG    1 
ATOM   2324 C CD1   . TYR C 2 229 ? -21.523 -11.907 15.739  1.00 16.02 ? 230 TYR A CD1   1 
ATOM   2325 C CD2   . TYR C 2 229 ? -22.360 -14.080 16.276  1.00 11.92 ? 230 TYR A CD2   1 
ATOM   2326 C CE1   . TYR C 2 229 ? -20.214 -12.389 15.805  1.00 12.22 ? 230 TYR A CE1   1 
ATOM   2327 C CE2   . TYR C 2 229 ? -21.050 -14.573 16.346  1.00 12.42 ? 230 TYR A CE2   1 
ATOM   2328 C CZ    . TYR C 2 229 ? -19.986 -13.725 16.113  1.00 15.65 ? 230 TYR A CZ    1 
ATOM   2329 O OH    . TYR C 2 229 ? -18.700 -14.208 16.210  1.00 11.66 ? 230 TYR A OH    1 
ATOM   2330 N N     . ASN C 2 230 ? -24.504 -9.967  13.647  1.00 18.90 ? 231 ASN A N     1 
ATOM   2331 C CA    . ASN C 2 230 ? -23.998 -8.874  12.827  1.00 22.90 ? 231 ASN A CA    1 
ATOM   2332 C C     . ASN C 2 230 ? -23.389 -7.749  13.647  1.00 22.45 ? 231 ASN A C     1 
ATOM   2333 O O     . ASN C 2 230 ? -22.795 -6.826  13.090  1.00 23.09 ? 231 ASN A O     1 
ATOM   2334 C CB    . ASN C 2 230 ? -25.134 -8.290  11.986  1.00 29.78 ? 231 ASN A CB    1 
ATOM   2335 C CG    . ASN C 2 230 ? -25.603 -9.239  10.922  1.00 38.17 ? 231 ASN A CG    1 
ATOM   2336 O OD1   . ASN C 2 230 ? -24.949 -9.396  9.894   1.00 47.71 ? 231 ASN A OD1   1 
ATOM   2337 N ND2   . ASN C 2 230 ? -26.739 -9.888  11.159  1.00 45.89 ? 231 ASN A ND2   1 
ATOM   2338 N N     . ASN C 2 231 ? -23.553 -7.821  14.963  1.00 19.60 ? 232 ASN A N     1 
ATOM   2339 C CA    . ASN C 2 231 ? -23.033 -6.807  15.867  1.00 20.43 ? 232 ASN A CA    1 
ATOM   2340 C C     . ASN C 2 231 ? -22.886 -7.376  17.281  1.00 22.18 ? 232 ASN A C     1 
ATOM   2341 O O     . ASN C 2 231 ? -23.285 -8.514  17.546  1.00 19.90 ? 232 ASN A O     1 
ATOM   2342 C CB    . ASN C 2 231 ? -23.939 -5.567  15.870  1.00 20.90 ? 232 ASN A CB    1 
ATOM   2343 C CG    . ASN C 2 231 ? -25.373 -5.878  16.276  1.00 24.97 ? 232 ASN A CG    1 
ATOM   2344 O OD1   . ASN C 2 231 ? -25.623 -6.594  17.239  1.00 25.41 ? 232 ASN A OD1   1 
ATOM   2345 N ND2   . ASN C 2 231 ? -26.319 -5.334  15.537  1.00 26.26 ? 232 ASN A ND2   1 
ATOM   2346 N N     . ILE C 2 232 ? -22.319 -6.577  18.184  1.00 23.86 ? 233 ILE A N     1 
ATOM   2347 C CA    . ILE C 2 232 ? -22.071 -6.994  19.562  1.00 21.12 ? 233 ILE A CA    1 
ATOM   2348 C C     . ILE C 2 232 ? -23.330 -7.397  20.351  1.00 20.50 ? 233 ILE A C     1 
ATOM   2349 O O     . ILE C 2 232 ? -23.281 -8.363  21.113  1.00 22.10 ? 233 ILE A O     1 
ATOM   2350 C CB    . ILE C 2 232 ? -21.242 -5.918  20.326  1.00 20.96 ? 233 ILE A CB    1 
ATOM   2351 C CG1   . ILE C 2 232 ? -20.679 -6.506  21.611  1.00 21.81 ? 233 ILE A CG1   1 
ATOM   2352 C CG2   . ILE C 2 232 ? -22.083 -4.681  20.608  1.00 20.52 ? 233 ILE A CG2   1 
ATOM   2353 C CD1   . ILE C 2 232 ? -19.760 -7.657  21.376  1.00 20.57 ? 233 ILE A CD1   1 
ATOM   2354 N N     . SER C 2 233 ? -24.445 -6.690  20.179  1.00 17.89 ? 234 SER A N     1 
ATOM   2355 C CA    . SER C 2 233 ? -25.671 -7.064  20.890  1.00 20.48 ? 234 SER A CA    1 
ATOM   2356 C C     . SER C 2 233 ? -26.125 -8.461  20.472  1.00 20.85 ? 234 SER A C     1 
ATOM   2357 O O     . SER C 2 233 ? -26.399 -9.303  21.320  1.00 21.79 ? 234 SER A O     1 
ATOM   2358 C CB    . SER C 2 233 ? -26.797 -6.075  20.611  1.00 22.45 ? 234 SER A CB    1 
ATOM   2359 O OG    . SER C 2 233 ? -26.429 -4.777  21.019  1.00 40.38 ? 234 SER A OG    1 
ATOM   2360 N N     . GLU C 2 234 ? -26.203 -8.704  19.165  1.00 19.20 ? 235 GLU A N     1 
ATOM   2361 C CA    . GLU C 2 234 ? -26.618 -10.003 18.645  1.00 18.08 ? 235 GLU A CA    1 
ATOM   2362 C C     . GLU C 2 234 ? -25.628 -11.105 19.034  1.00 18.53 ? 235 GLU A C     1 
ATOM   2363 O O     . GLU C 2 234 ? -26.020 -12.257 19.230  1.00 20.10 ? 235 GLU A O     1 
ATOM   2364 C CB    . GLU C 2 234 ? -26.770 -9.948  17.125  1.00 20.05 ? 235 GLU A CB    1 
ATOM   2365 C CG    . GLU C 2 234 ? -27.846 -8.989  16.650  1.00 21.46 ? 235 GLU A CG    1 
ATOM   2366 C CD    . GLU C 2 234 ? -28.067 -9.022  15.140  1.00 28.84 ? 235 GLU A CD    1 
ATOM   2367 O OE1   . GLU C 2 234 ? -27.297 -9.691  14.416  1.00 25.25 ? 235 GLU A OE1   1 
ATOM   2368 O OE2   . GLU C 2 234 ? -29.023 -8.371  14.672  1.00 31.20 ? 235 GLU A OE2   1 
ATOM   2369 N N     . TYR C 2 235 ? -24.348 -10.761 19.144  1.00 15.10 ? 236 TYR A N     1 
ATOM   2370 C CA    . TYR C 2 235 ? -23.350 -11.739 19.545  1.00 17.24 ? 236 TYR A CA    1 
ATOM   2371 C C     . TYR C 2 235 ? -23.599 -12.146 21.008  1.00 18.30 ? 236 TYR A C     1 
ATOM   2372 O O     . TYR C 2 235 ? -23.563 -13.331 21.338  1.00 19.24 ? 236 TYR A O     1 
ATOM   2373 C CB    . TYR C 2 235 ? -21.931 -11.178 19.374  1.00 16.80 ? 236 TYR A CB    1 
ATOM   2374 C CG    . TYR C 2 235 ? -20.876 -11.927 20.153  1.00 14.44 ? 236 TYR A CG    1 
ATOM   2375 C CD1   . TYR C 2 235 ? -20.327 -13.106 19.665  1.00 15.33 ? 236 TYR A CD1   1 
ATOM   2376 C CD2   . TYR C 2 235 ? -20.443 -11.459 21.399  1.00 17.59 ? 236 TYR A CD2   1 
ATOM   2377 C CE1   . TYR C 2 235 ? -19.368 -13.811 20.399  1.00 17.67 ? 236 TYR A CE1   1 
ATOM   2378 C CE2   . TYR C 2 235 ? -19.489 -12.151 22.142  1.00 13.04 ? 236 TYR A CE2   1 
ATOM   2379 C CZ    . TYR C 2 235 ? -18.958 -13.323 21.642  1.00 19.15 ? 236 TYR A CZ    1 
ATOM   2380 O OH    . TYR C 2 235 ? -18.032 -14.011 22.394  1.00 19.78 ? 236 TYR A OH    1 
ATOM   2381 N N     . ARG C 2 236 ? -23.849 -11.171 21.878  1.00 17.77 ? 237 ARG A N     1 
ATOM   2382 C CA    . ARG C 2 236 ? -24.105 -11.458 23.285  1.00 19.47 ? 237 ARG A CA    1 
ATOM   2383 C C     . ARG C 2 236 ? -25.386 -12.282 23.489  1.00 19.95 ? 237 ARG A C     1 
ATOM   2384 O O     . ARG C 2 236 ? -25.430 -13.147 24.360  1.00 19.90 ? 237 ARG A O     1 
ATOM   2385 C CB    . ARG C 2 236 ? -24.114 -10.157 24.087  1.00 15.09 ? 237 ARG A CB    1 
ATOM   2386 C CG    . ARG C 2 236 ? -22.704 -9.654  24.279  1.00 16.29 ? 237 ARG A CG    1 
ATOM   2387 C CD    . ARG C 2 236 ? -22.628 -8.287  24.895  1.00 18.14 ? 237 ARG A CD    1 
ATOM   2388 N NE    . ARG C 2 236 ? -21.226 -7.911  25.041  1.00 20.84 ? 237 ARG A NE    1 
ATOM   2389 C CZ    . ARG C 2 236 ? -20.774 -6.660  25.095  1.00 23.82 ? 237 ARG A CZ    1 
ATOM   2390 N NH1   . ARG C 2 236 ? -21.612 -5.637  25.023  1.00 19.20 ? 237 ARG A NH1   1 
ATOM   2391 N NH2   . ARG C 2 236 ? -19.473 -6.431  25.224  1.00 18.63 ? 237 ARG A NH2   1 
ATOM   2392 N N     . ASN C 2 237 ? -26.419 -12.029 22.688  1.00 20.45 ? 238 ASN A N     1 
ATOM   2393 C CA    . ASN C 2 237 ? -27.653 -12.812 22.772  1.00 22.35 ? 238 ASN A CA    1 
ATOM   2394 C C     . ASN C 2 237 ? -27.361 -14.240 22.312  1.00 23.07 ? 238 ASN A C     1 
ATOM   2395 O O     . ASN C 2 237 ? -27.838 -15.209 22.913  1.00 23.13 ? 238 ASN A O     1 
ATOM   2396 C CB    . ASN C 2 237 ? -28.756 -12.214 21.894  1.00 23.25 ? 238 ASN A CB    1 
ATOM   2397 C CG    . ASN C 2 237 ? -29.209 -10.859 22.383  1.00 36.58 ? 238 ASN A CG    1 
ATOM   2398 O OD1   . ASN C 2 237 ? -29.062 -10.532 23.562  1.00 37.88 ? 238 ASN A OD1   1 
ATOM   2399 N ND2   . ASN C 2 237 ? -29.761 -10.057 21.483  1.00 41.28 ? 238 ASN A ND2   1 
ATOM   2400 N N     . TRP C 2 238 ? -26.567 -14.353 21.247  1.00 20.32 ? 239 TRP A N     1 
ATOM   2401 C CA    . TRP C 2 238 ? -26.166 -15.633 20.662  1.00 19.78 ? 239 TRP A CA    1 
ATOM   2402 C C     . TRP C 2 238 ? -25.400 -16.480 21.697  1.00 21.96 ? 239 TRP A C     1 
ATOM   2403 O O     . TRP C 2 238 ? -25.599 -17.699 21.789  1.00 20.13 ? 239 TRP A O     1 
ATOM   2404 C CB    . TRP C 2 238 ? -25.307 -15.348 19.426  1.00 18.65 ? 239 TRP A CB    1 
ATOM   2405 C CG    . TRP C 2 238 ? -24.764 -16.544 18.709  1.00 16.67 ? 239 TRP A CG    1 
ATOM   2406 C CD1   . TRP C 2 238 ? -25.460 -17.401 17.910  1.00 16.20 ? 239 TRP A CD1   1 
ATOM   2407 C CD2   . TRP C 2 238 ? -23.394 -16.982 18.677  1.00 11.96 ? 239 TRP A CD2   1 
ATOM   2408 N NE1   . TRP C 2 238 ? -24.608 -18.343 17.377  1.00 17.45 ? 239 TRP A NE1   1 
ATOM   2409 C CE2   . TRP C 2 238 ? -23.336 -18.109 17.830  1.00 10.80 ? 239 TRP A CE2   1 
ATOM   2410 C CE3   . TRP C 2 238 ? -22.212 -16.529 19.281  1.00 14.12 ? 239 TRP A CE3   1 
ATOM   2411 C CZ2   . TRP C 2 238 ? -22.136 -18.794 17.567  1.00 16.12 ? 239 TRP A CZ2   1 
ATOM   2412 C CZ3   . TRP C 2 238 ? -21.021 -17.209 19.021  1.00 13.45 ? 239 TRP A CZ3   1 
ATOM   2413 C CH2   . TRP C 2 238 ? -20.995 -18.332 18.168  1.00 16.32 ? 239 TRP A CH2   1 
ATOM   2414 N N     . ILE C 2 239 ? -24.526 -15.822 22.467  1.00 21.38 ? 240 ILE A N     1 
ATOM   2415 C CA    . ILE C 2 239 ? -23.744 -16.462 23.533  1.00 20.88 ? 240 ILE A CA    1 
ATOM   2416 C C     . ILE C 2 239 ? -24.714 -16.904 24.649  1.00 20.54 ? 240 ILE A C     1 
ATOM   2417 O O     . ILE C 2 239 ? -24.627 -18.026 25.167  1.00 19.05 ? 240 ILE A O     1 
ATOM   2418 C CB    . ILE C 2 239 ? -22.677 -15.469 24.098  1.00 23.15 ? 240 ILE A CB    1 
ATOM   2419 C CG1   . ILE C 2 239 ? -21.509 -15.367 23.118  1.00 21.97 ? 240 ILE A CG1   1 
ATOM   2420 C CG2   . ILE C 2 239 ? -22.194 -15.886 25.486  1.00 22.54 ? 240 ILE A CG2   1 
ATOM   2421 C CD1   . ILE C 2 239 ? -20.816 -16.681 22.853  1.00 26.59 ? 240 ILE A CD1   1 
ATOM   2422 N N     . TYR C 2 240 ? -25.645 -16.020 24.994  1.00 20.97 ? 241 TYR A N     1 
ATOM   2423 C CA    . TYR C 2 240 ? -26.637 -16.295 26.027  1.00 22.31 ? 241 TYR A CA    1 
ATOM   2424 C C     . TYR C 2 240 ? -27.445 -17.568 25.743  1.00 23.59 ? 241 TYR A C     1 
ATOM   2425 O O     . TYR C 2 240 ? -27.693 -18.354 26.656  1.00 21.81 ? 241 TYR A O     1 
ATOM   2426 C CB    . TYR C 2 240 ? -27.596 -15.112 26.167  1.00 20.23 ? 241 TYR A CB    1 
ATOM   2427 C CG    . TYR C 2 240 ? -28.562 -15.262 27.316  1.00 21.42 ? 241 TYR A CG    1 
ATOM   2428 C CD1   . TYR C 2 240 ? -28.191 -14.876 28.603  1.00 23.19 ? 241 TYR A CD1   1 
ATOM   2429 C CD2   . TYR C 2 240 ? -29.836 -15.793 27.122  1.00 16.87 ? 241 TYR A CD2   1 
ATOM   2430 C CE1   . TYR C 2 240 ? -29.052 -15.010 29.669  1.00 23.49 ? 241 TYR A CE1   1 
ATOM   2431 C CE2   . TYR C 2 240 ? -30.717 -15.935 28.192  1.00 22.23 ? 241 TYR A CE2   1 
ATOM   2432 C CZ    . TYR C 2 240 ? -30.309 -15.537 29.464  1.00 25.97 ? 241 TYR A CZ    1 
ATOM   2433 O OH    . TYR C 2 240 ? -31.142 -15.656 30.545  1.00 32.02 ? 241 TYR A OH    1 
ATOM   2434 N N     . ARG C 2 241 ? -27.848 -17.752 24.484  1.00 23.18 ? 242 ARG A N     1 
ATOM   2435 C CA    . ARG C 2 241 ? -28.631 -18.913 24.047  1.00 24.46 ? 242 ARG A CA    1 
ATOM   2436 C C     . ARG C 2 241 ? -27.855 -20.213 23.818  1.00 23.54 ? 242 ARG A C     1 
ATOM   2437 O O     . ARG C 2 241 ? -28.453 -21.230 23.474  1.00 26.98 ? 242 ARG A O     1 
ATOM   2438 C CB    . ARG C 2 241 ? -29.375 -18.605 22.746  1.00 26.90 ? 242 ARG A CB    1 
ATOM   2439 C CG    . ARG C 2 241 ? -30.500 -17.604 22.830  1.00 37.14 ? 242 ARG A CG    1 
ATOM   2440 C CD    . ARG C 2 241 ? -31.296 -17.653 21.523  1.00 43.56 ? 242 ARG A CD    1 
ATOM   2441 N NE    . ARG C 2 241 ? -30.414 -17.608 20.357  1.00 50.31 ? 242 ARG A NE    1 
ATOM   2442 C CZ    . ARG C 2 241 ? -29.964 -16.485 19.798  1.00 56.81 ? 242 ARG A CZ    1 
ATOM   2443 N NH1   . ARG C 2 241 ? -30.324 -15.299 20.282  1.00 55.91 ? 242 ARG A NH1   1 
ATOM   2444 N NH2   . ARG C 2 241 ? -29.157 -16.545 18.746  1.00 55.20 ? 242 ARG A NH2   1 
ATOM   2445 N N     . GLY C 2 242 ? -26.540 -20.196 23.983  1.00 21.59 ? 243 GLY A N     1 
ATOM   2446 C CA    . GLY C 2 242 ? -25.782 -21.415 23.775  1.00 22.03 ? 243 GLY A CA    1 
ATOM   2447 C C     . GLY C 2 242 ? -25.118 -21.550 22.415  1.00 25.60 ? 243 GLY A C     1 
ATOM   2448 O O     . GLY C 2 242 ? -24.830 -22.668 21.981  1.00 23.63 ? 243 GLY A O     1 
ATOM   2449 N N     . ARG C 2 243 ? -24.868 -20.420 21.750  1.00 26.95 ? 244 ARG A N     1 
ATOM   2450 C CA    . ARG C 2 243 ? -24.212 -20.395 20.439  1.00 27.27 ? 244 ARG A CA    1 
ATOM   2451 C C     . ARG C 2 243 ? -25.009 -21.145 19.366  1.00 28.73 ? 244 ARG A C     1 
ATOM   2452 O O     . ARG C 2 243 ? -24.473 -21.963 18.621  1.00 29.22 ? 244 ARG A O     1 
ATOM   2453 C CB    . ARG C 2 243 ? -22.776 -20.930 20.564  1.00 22.84 ? 244 ARG A CB    1 
ATOM   2454 C CG    . ARG C 2 243 ? -21.964 -20.180 21.638  1.00 28.27 ? 244 ARG A CG    1 
ATOM   2455 C CD    . ARG C 2 243 ? -20.666 -20.887 22.019  1.00 30.55 ? 244 ARG A CD    1 
ATOM   2456 N NE    . ARG C 2 243 ? -19.590 -20.601 21.072  1.00 39.72 ? 244 ARG A NE    1 
ATOM   2457 C CZ    . ARG C 2 243 ? -18.679 -19.640 21.231  1.00 33.84 ? 244 ARG A CZ    1 
ATOM   2458 N NH1   . ARG C 2 243 ? -18.694 -18.865 22.311  1.00 25.71 ? 244 ARG A NH1   1 
ATOM   2459 N NH2   . ARG C 2 243 ? -17.747 -19.456 20.304  1.00 26.87 ? 244 ARG A NH2   1 
ATOM   2460 N N     . LYS C 2 244 ? -26.301 -20.831 19.309  1.00 33.12 ? 245 LYS A N     1 
ATOM   2461 C CA    . LYS C 2 244 ? -27.255 -21.414 18.370  1.00 39.98 ? 245 LYS A CA    1 
ATOM   2462 C C     . LYS C 2 244 ? -28.455 -20.455 18.218  1.00 44.26 ? 245 LYS A C     1 
ATOM   2463 O O     . LYS C 2 244 ? -29.431 -20.810 17.518  1.00 48.80 ? 245 LYS A O     1 
ATOM   2464 C CB    . LYS C 2 244 ? -27.729 -22.792 18.874  1.00 42.70 ? 245 LYS A CB    1 
ATOM   2465 C CG    . LYS C 2 244 ? -28.339 -22.785 20.280  1.00 50.37 ? 245 LYS A CG    1 
ATOM   2466 C CD    . LYS C 2 244 ? -28.849 -24.164 20.697  1.00 54.15 ? 245 LYS A CD    1 
ATOM   2467 C CE    . LYS C 2 244 ? -29.477 -24.124 22.093  1.00 60.63 ? 245 LYS A CE    1 
ATOM   2468 N NZ    . LYS C 2 244 ? -30.412 -22.959 22.282  1.00 63.81 ? 245 LYS A NZ    1 
ATOM   2469 O OXT   . LYS C 2 244 ? -28.410 -19.347 18.804  1.00 47.32 ? 245 LYS A OXT   1 
ATOM   2470 N N     . SER D 2 1   ? 9.139   12.760  -29.106 1.00 18.28 ? 2   SER B N     1 
ATOM   2471 C CA    . SER D 2 1   ? 7.708   12.861  -28.726 1.00 19.58 ? 2   SER B CA    1 
ATOM   2472 C C     . SER D 2 1   ? 7.648   12.865  -27.203 1.00 18.43 ? 2   SER B C     1 
ATOM   2473 O O     . SER D 2 1   ? 8.678   12.787  -26.539 1.00 20.53 ? 2   SER B O     1 
ATOM   2474 C CB    . SER D 2 1   ? 6.960   11.632  -29.250 1.00 21.13 ? 2   SER B CB    1 
ATOM   2475 O OG    . SER D 2 1   ? 7.554   10.438  -28.746 1.00 17.64 ? 2   SER B OG    1 
ATOM   2476 N N     . LEU D 2 2   ? 6.443   12.954  -26.658 1.00 18.82 ? 3   LEU B N     1 
ATOM   2477 C CA    . LEU D 2 2   ? 6.241   12.912  -25.215 1.00 21.01 ? 3   LEU B CA    1 
ATOM   2478 C C     . LEU D 2 2   ? 6.785   11.575  -24.704 1.00 20.72 ? 3   LEU B C     1 
ATOM   2479 O O     . LEU D 2 2   ? 7.586   11.537  -23.775 1.00 21.31 ? 3   LEU B O     1 
ATOM   2480 C CB    . LEU D 2 2   ? 4.743   13.021  -24.900 1.00 24.13 ? 3   LEU B CB    1 
ATOM   2481 C CG    . LEU D 2 2   ? 4.239   12.743  -23.477 1.00 32.27 ? 3   LEU B CG    1 
ATOM   2482 C CD1   . LEU D 2 2   ? 4.776   13.781  -22.495 1.00 32.54 ? 3   LEU B CD1   1 
ATOM   2483 C CD2   . LEU D 2 2   ? 2.717   12.761  -23.486 1.00 28.76 ? 3   LEU B CD2   1 
ATOM   2484 N N     . ARG D 2 3   ? 6.354   10.483  -25.333 1.00 18.89 ? 4   ARG B N     1 
ATOM   2485 C CA    . ARG D 2 3   ? 6.774   9.141   -24.935 1.00 19.95 ? 4   ARG B CA    1 
ATOM   2486 C C     . ARG D 2 3   ? 8.285   8.921   -24.947 1.00 20.77 ? 4   ARG B C     1 
ATOM   2487 O O     . ARG D 2 3   ? 8.841   8.384   -23.984 1.00 20.22 ? 4   ARG B O     1 
ATOM   2488 C CB    . ARG D 2 3   ? 6.092   8.086   -25.815 1.00 21.13 ? 4   ARG B CB    1 
ATOM   2489 C CG    . ARG D 2 3   ? 6.405   6.663   -25.408 1.00 20.07 ? 4   ARG B CG    1 
ATOM   2490 C CD    . ARG D 2 3   ? 5.881   5.681   -26.433 1.00 28.35 ? 4   ARG B CD    1 
ATOM   2491 N NE    . ARG D 2 3   ? 6.208   4.301   -26.093 1.00 23.92 ? 4   ARG B NE    1 
ATOM   2492 C CZ    . ARG D 2 3   ? 5.290   3.353   -25.924 1.00 26.94 ? 4   ARG B CZ    1 
ATOM   2493 N NH1   . ARG D 2 3   ? 4.005   3.651   -26.067 1.00 28.07 ? 4   ARG B NH1   1 
ATOM   2494 N NH2   . ARG D 2 3   ? 5.646   2.112   -25.615 1.00 18.52 ? 4   ARG B NH2   1 
ATOM   2495 N N     . SER D 2 4   ? 8.954   9.327   -26.027 1.00 19.41 ? 5   SER B N     1 
ATOM   2496 C CA    . SER D 2 4   ? 10.405  9.146   -26.125 1.00 20.22 ? 5   SER B CA    1 
ATOM   2497 C C     . SER D 2 4   ? 11.155  10.038  -25.124 1.00 18.43 ? 5   SER B C     1 
ATOM   2498 O O     . SER D 2 4   ? 12.183  9.635   -24.570 1.00 18.43 ? 5   SER B O     1 
ATOM   2499 C CB    . SER D 2 4   ? 10.896  9.412   -27.567 1.00 18.44 ? 5   SER B CB    1 
ATOM   2500 O OG    . SER D 2 4   ? 10.645  10.752  -27.972 1.00 18.33 ? 5   SER B OG    1 
ATOM   2501 N N     . ASP D 2 5   ? 10.643  11.245  -24.901 1.00 18.90 ? 6   ASP B N     1 
ATOM   2502 C CA    . ASP D 2 5   ? 11.265  12.168  -23.962 1.00 21.76 ? 6   ASP B CA    1 
ATOM   2503 C C     . ASP D 2 5   ? 11.124  11.636  -22.538 1.00 23.12 ? 6   ASP B C     1 
ATOM   2504 O O     . ASP D 2 5   ? 12.071  11.695  -21.753 1.00 22.58 ? 6   ASP B O     1 
ATOM   2505 C CB    . ASP D 2 5   ? 10.641  13.558  -24.076 1.00 23.65 ? 6   ASP B CB    1 
ATOM   2506 C CG    . ASP D 2 5   ? 11.213  14.363  -25.239 1.00 22.04 ? 6   ASP B CG    1 
ATOM   2507 O OD1   . ASP D 2 5   ? 12.242  13.948  -25.812 1.00 23.06 ? 6   ASP B OD1   1 
ATOM   2508 O OD2   . ASP D 2 5   ? 10.630  15.410  -25.572 1.00 21.83 ? 6   ASP B OD2   1 
ATOM   2509 N N     . LEU D 2 6   ? 9.946   11.109  -22.221 1.00 22.56 ? 7   LEU B N     1 
ATOM   2510 C CA    . LEU D 2 6   ? 9.685   10.541  -20.910 1.00 21.44 ? 7   LEU B CA    1 
ATOM   2511 C C     . LEU D 2 6   ? 10.611  9.343   -20.643 1.00 24.08 ? 7   LEU B C     1 
ATOM   2512 O O     . LEU D 2 6   ? 11.199  9.243   -19.558 1.00 24.21 ? 7   LEU B O     1 
ATOM   2513 C CB    . LEU D 2 6   ? 8.217   10.135  -20.802 1.00 22.10 ? 7   LEU B CB    1 
ATOM   2514 C CG    . LEU D 2 6   ? 7.751   9.759   -19.396 1.00 31.31 ? 7   LEU B CG    1 
ATOM   2515 C CD1   . LEU D 2 6   ? 8.232   10.803  -18.387 1.00 27.06 ? 7   LEU B CD1   1 
ATOM   2516 C CD2   . LEU D 2 6   ? 6.239   9.646   -19.388 1.00 26.99 ? 7   LEU B CD2   1 
ATOM   2517 N N     . ILE D 2 7   ? 10.751  8.448   -21.625 1.00 22.89 ? 8   ILE B N     1 
ATOM   2518 C CA    . ILE D 2 7   ? 11.623  7.271   -21.496 1.00 24.02 ? 8   ILE B CA    1 
ATOM   2519 C C     . ILE D 2 7   ? 13.091  7.656   -21.290 1.00 26.19 ? 8   ILE B C     1 
ATOM   2520 O O     . ILE D 2 7   ? 13.800  7.016   -20.514 1.00 27.24 ? 8   ILE B O     1 
ATOM   2521 C CB    . ILE D 2 7   ? 11.536  6.336   -22.739 1.00 26.37 ? 8   ILE B CB    1 
ATOM   2522 C CG1   . ILE D 2 7   ? 10.184  5.623   -22.788 1.00 29.65 ? 8   ILE B CG1   1 
ATOM   2523 C CG2   . ILE D 2 7   ? 12.647  5.300   -22.704 1.00 25.34 ? 8   ILE B CG2   1 
ATOM   2524 C CD1   . ILE D 2 7   ? 10.022  4.724   -24.004 1.00 31.75 ? 8   ILE B CD1   1 
ATOM   2525 N N     . ASN D 2 8   ? 13.551  8.692   -21.987 1.00 26.22 ? 9   ASN B N     1 
ATOM   2526 C CA    . ASN D 2 8   ? 14.940  9.134   -21.837 1.00 27.15 ? 9   ASN B CA    1 
ATOM   2527 C C     . ASN D 2 8   ? 15.128  9.729   -20.447 1.00 24.25 ? 9   ASN B C     1 
ATOM   2528 O O     . ASN D 2 8   ? 16.094  9.403   -19.758 1.00 25.07 ? 9   ASN B O     1 
ATOM   2529 C CB    . ASN D 2 8   ? 15.318  10.182  -22.894 1.00 31.46 ? 9   ASN B CB    1 
ATOM   2530 C CG    . ASN D 2 8   ? 15.433  9.595   -24.295 1.00 38.86 ? 9   ASN B CG    1 
ATOM   2531 O OD1   . ASN D 2 8   ? 15.741  8.416   -24.475 1.00 43.07 ? 9   ASN B OD1   1 
ATOM   2532 N ND2   . ASN D 2 8   ? 15.187  10.427  -25.298 1.00 46.13 ? 9   ASN B ND2   1 
ATOM   2533 N N     . ALA D 2 9   ? 14.197  10.594  -20.044 1.00 23.38 ? 10  ALA B N     1 
ATOM   2534 C CA    . ALA D 2 9   ? 14.234  11.237  -18.728 1.00 25.68 ? 10  ALA B CA    1 
ATOM   2535 C C     . ALA D 2 9   ? 14.224  10.200  -17.596 1.00 28.94 ? 10  ALA B C     1 
ATOM   2536 O O     . ALA D 2 9   ? 14.923  10.376  -16.596 1.00 31.46 ? 10  ALA B O     1 
ATOM   2537 C CB    . ALA D 2 9   ? 13.058  12.197  -18.575 1.00 20.33 ? 10  ALA B CB    1 
ATOM   2538 N N     . LEU D 2 10  ? 13.442  9.126   -17.755 1.00 30.61 ? 11  LEU B N     1 
ATOM   2539 C CA    . LEU D 2 10  ? 13.365  8.060   -16.747 1.00 31.20 ? 11  LEU B CA    1 
ATOM   2540 C C     . LEU D 2 10  ? 14.684  7.315   -16.595 1.00 33.08 ? 11  LEU B C     1 
ATOM   2541 O O     . LEU D 2 10  ? 15.129  7.089   -15.464 1.00 33.41 ? 11  LEU B O     1 
ATOM   2542 C CB    . LEU D 2 10  ? 12.237  7.061   -17.054 1.00 27.01 ? 11  LEU B CB    1 
ATOM   2543 C CG    . LEU D 2 10  ? 10.810  7.600   -16.893 1.00 33.42 ? 11  LEU B CG    1 
ATOM   2544 C CD1   . LEU D 2 10  ? 9.811   6.577   -17.417 1.00 35.75 ? 11  LEU B CD1   1 
ATOM   2545 C CD2   . LEU D 2 10  ? 10.528  7.947   -15.445 1.00 28.74 ? 11  LEU B CD2   1 
ATOM   2546 N N     . TYR D 2 11  ? 15.314  6.933   -17.708 1.00 34.61 ? 12  TYR B N     1 
ATOM   2547 C CA    . TYR D 2 11  ? 16.608  6.232   -17.647 1.00 40.18 ? 12  TYR B CA    1 
ATOM   2548 C C     . TYR D 2 11  ? 17.667  7.103   -16.961 1.00 41.14 ? 12  TYR B C     1 
ATOM   2549 O O     . TYR D 2 11  ? 18.355  6.663   -16.031 1.00 41.08 ? 12  TYR B O     1 
ATOM   2550 C CB    . TYR D 2 11  ? 17.135  5.872   -19.049 1.00 41.42 ? 12  TYR B CB    1 
ATOM   2551 C CG    . TYR D 2 11  ? 16.369  4.784   -19.767 1.00 51.75 ? 12  TYR B CG    1 
ATOM   2552 C CD1   . TYR D 2 11  ? 15.784  3.731   -19.062 1.00 52.85 ? 12  TYR B CD1   1 
ATOM   2553 C CD2   . TYR D 2 11  ? 16.216  4.814   -21.156 1.00 55.35 ? 12  TYR B CD2   1 
ATOM   2554 C CE1   . TYR D 2 11  ? 15.061  2.732   -19.723 1.00 53.57 ? 12  TYR B CE1   1 
ATOM   2555 C CE2   . TYR D 2 11  ? 15.496  3.822   -21.827 1.00 54.01 ? 12  TYR B CE2   1 
ATOM   2556 C CZ    . TYR D 2 11  ? 14.920  2.783   -21.104 1.00 55.64 ? 12  TYR B CZ    1 
ATOM   2557 O OH    . TYR D 2 11  ? 14.199  1.803   -21.757 1.00 52.02 ? 12  TYR B OH    1 
ATOM   2558 N N     . ASP D 2 12  ? 17.778  8.339   -17.435 1.00 41.67 ? 13  ASP B N     1 
ATOM   2559 C CA    . ASP D 2 12  ? 18.746  9.303   -16.940 1.00 43.87 ? 13  ASP B CA    1 
ATOM   2560 C C     . ASP D 2 12  ? 18.627  9.575   -15.442 1.00 43.91 ? 13  ASP B C     1 
ATOM   2561 O O     . ASP D 2 12  ? 19.588  9.388   -14.691 1.00 44.08 ? 13  ASP B O     1 
ATOM   2562 C CB    . ASP D 2 12  ? 18.597  10.608  -17.728 1.00 50.80 ? 13  ASP B CB    1 
ATOM   2563 C CG    . ASP D 2 12  ? 19.881  11.416  -17.771 1.00 63.09 ? 13  ASP B CG    1 
ATOM   2564 O OD1   . ASP D 2 12  ? 20.927  10.851  -18.176 1.00 70.64 ? 13  ASP B OD1   1 
ATOM   2565 O OD2   . ASP D 2 12  ? 19.840  12.615  -17.403 1.00 63.18 ? 13  ASP B OD2   1 
ATOM   2566 N N     . GLU D 2 13  ? 17.448  10.015  -15.014 1.00 44.21 ? 14  GLU B N     1 
ATOM   2567 C CA    . GLU D 2 13  ? 17.188  10.325  -13.609 1.00 43.45 ? 14  GLU B CA    1 
ATOM   2568 C C     . GLU D 2 13  ? 17.495  9.142   -12.683 1.00 43.30 ? 14  GLU B C     1 
ATOM   2569 O O     . GLU D 2 13  ? 18.111  9.305   -11.626 1.00 40.58 ? 14  GLU B O     1 
ATOM   2570 C CB    . GLU D 2 13  ? 15.726  10.750  -13.439 1.00 41.45 ? 14  GLU B CB    1 
ATOM   2571 C CG    . GLU D 2 13  ? 15.368  11.241  -12.039 1.00 48.02 ? 14  GLU B CG    1 
ATOM   2572 C CD    . GLU D 2 13  ? 15.798  12.678  -11.770 1.00 50.68 ? 14  GLU B CD    1 
ATOM   2573 O OE1   . GLU D 2 13  ? 16.636  13.215  -12.529 1.00 49.97 ? 14  GLU B OE1   1 
ATOM   2574 O OE2   . GLU D 2 13  ? 15.292  13.273  -10.793 1.00 51.00 ? 14  GLU B OE2   1 
ATOM   2575 N N     . ASN D 2 14  ? 17.063  7.956   -13.095 1.00 43.76 ? 15  ASN B N     1 
ATOM   2576 C CA    . ASN D 2 14  ? 17.264  6.735   -12.320 1.00 46.34 ? 15  ASN B CA    1 
ATOM   2577 C C     . ASN D 2 14  ? 18.742  6.347   -12.213 1.00 47.69 ? 15  ASN B C     1 
ATOM   2578 O O     . ASN D 2 14  ? 19.205  5.854   -11.178 1.00 48.29 ? 15  ASN B O     1 
ATOM   2579 C CB    . ASN D 2 14  ? 16.460  5.594   -12.952 1.00 45.45 ? 15  ASN B CB    1 
ATOM   2580 C CG    . ASN D 2 14  ? 16.340  4.399   -12.042 1.00 46.98 ? 15  ASN B CG    1 
ATOM   2581 O OD1   . ASN D 2 14  ? 15.694  4.467   -10.996 1.00 47.56 ? 15  ASN B OD1   1 
ATOM   2582 N ND2   . ASN D 2 14  ? 16.962  3.292   -12.432 1.00 45.54 ? 15  ASN B ND2   1 
ATOM   2583 N N     . GLN D 2 15  ? 19.477  6.572   -13.295 1.00 48.88 ? 16  GLN B N     1 
ATOM   2584 C CA    . GLN D 2 15  ? 20.898  6.257   -13.339 1.00 51.35 ? 16  GLN B CA    1 
ATOM   2585 C C     . GLN D 2 15  ? 21.722  7.241   -12.492 1.00 51.03 ? 16  GLN B C     1 
ATOM   2586 O O     . GLN D 2 15  ? 22.799  6.896   -12.006 1.00 50.84 ? 16  GLN B O     1 
ATOM   2587 C CB    . GLN D 2 15  ? 21.376  6.279   -14.787 1.00 53.16 ? 16  GLN B CB    1 
ATOM   2588 C CG    . GLN D 2 15  ? 22.817  5.914   -14.964 1.00 63.21 ? 16  GLN B CG    1 
ATOM   2589 C CD    . GLN D 2 15  ? 23.368  6.461   -16.245 1.00 72.61 ? 16  GLN B CD    1 
ATOM   2590 O OE1   . GLN D 2 15  ? 23.282  7.662   -16.507 1.00 74.24 ? 16  GLN B OE1   1 
ATOM   2591 N NE2   . GLN D 2 15  ? 23.942  5.588   -17.060 1.00 75.51 ? 16  GLN B NE2   1 
ATOM   2592 N N     . LYS D 2 16  ? 21.206  8.456   -12.322 1.00 50.30 ? 17  LYS B N     1 
ATOM   2593 C CA    . LYS D 2 16  ? 21.890  9.489   -11.546 1.00 50.98 ? 17  LYS B CA    1 
ATOM   2594 C C     . LYS D 2 16  ? 21.565  9.566   -10.049 1.00 51.24 ? 17  LYS B C     1 
ATOM   2595 O O     . LYS D 2 16  ? 22.437  9.902   -9.244  1.00 50.69 ? 17  LYS B O     1 
ATOM   2596 C CB    . LYS D 2 16  ? 21.633  10.863  -12.174 1.00 52.73 ? 17  LYS B CB    1 
ATOM   2597 C CG    . LYS D 2 16  ? 22.322  11.065  -13.508 1.00 63.84 ? 17  LYS B CG    1 
ATOM   2598 C CD    . LYS D 2 16  ? 21.774  12.278  -14.243 1.00 71.20 ? 17  LYS B CD    1 
ATOM   2599 C CE    . LYS D 2 16  ? 22.589  12.566  -15.508 1.00 77.41 ? 17  LYS B CE    1 
ATOM   2600 N NZ    . LYS D 2 16  ? 22.953  11.320  -16.258 1.00 79.44 ? 17  LYS B NZ    1 
ATOM   2601 N N     . TYR D 2 17  ? 20.324  9.260   -9.674  1.00 50.47 ? 18  TYR B N     1 
ATOM   2602 C CA    . TYR D 2 17  ? 19.917  9.367   -8.272  1.00 49.12 ? 18  TYR B CA    1 
ATOM   2603 C C     . TYR D 2 17  ? 19.445  8.099   -7.558  1.00 46.05 ? 18  TYR B C     1 
ATOM   2604 O O     . TYR D 2 17  ? 18.715  7.279   -8.125  1.00 46.35 ? 18  TYR B O     1 
ATOM   2605 C CB    . TYR D 2 17  ? 18.840  10.458  -8.138  1.00 52.58 ? 18  TYR B CB    1 
ATOM   2606 C CG    . TYR D 2 17  ? 19.279  11.815  -8.644  1.00 56.53 ? 18  TYR B CG    1 
ATOM   2607 C CD1   . TYR D 2 17  ? 20.225  12.566  -7.946  1.00 57.09 ? 18  TYR B CD1   1 
ATOM   2608 C CD2   . TYR D 2 17  ? 18.761  12.341  -9.828  1.00 58.82 ? 18  TYR B CD2   1 
ATOM   2609 C CE1   . TYR D 2 17  ? 20.646  13.804  -8.413  1.00 59.88 ? 18  TYR B CE1   1 
ATOM   2610 C CE2   . TYR D 2 17  ? 19.175  13.580  -10.306 1.00 60.83 ? 18  TYR B CE2   1 
ATOM   2611 C CZ    . TYR D 2 17  ? 20.119  14.306  -9.592  1.00 63.81 ? 18  TYR B CZ    1 
ATOM   2612 O OH    . TYR D 2 17  ? 20.536  15.536  -10.054 1.00 63.42 ? 18  TYR B OH    1 
ATOM   2613 N N     . ASP D 2 18  ? 19.875  7.965   -6.304  1.00 42.18 ? 19  ASP B N     1 
ATOM   2614 C CA    . ASP D 2 18  ? 19.512  6.837   -5.442  1.00 38.38 ? 19  ASP B CA    1 
ATOM   2615 C C     . ASP D 2 18  ? 18.868  7.372   -4.159  1.00 33.72 ? 19  ASP B C     1 
ATOM   2616 O O     . ASP D 2 18  ? 19.525  8.040   -3.358  1.00 32.14 ? 19  ASP B O     1 
ATOM   2617 C CB    . ASP D 2 18  ? 20.752  6.010   -5.082  1.00 43.56 ? 19  ASP B CB    1 
ATOM   2618 C CG    . ASP D 2 18  ? 21.233  5.135   -6.234  1.00 56.42 ? 19  ASP B CG    1 
ATOM   2619 O OD1   . ASP D 2 18  ? 20.403  4.771   -7.096  1.00 62.75 ? 19  ASP B OD1   1 
ATOM   2620 O OD2   . ASP D 2 18  ? 22.443  4.805   -6.279  1.00 58.71 ? 19  ASP B OD2   1 
ATOM   2621 N N     . VAL D 2 19  ? 17.582  7.088   -3.980  1.00 30.57 ? 20  VAL B N     1 
ATOM   2622 C CA    . VAL D 2 19  ? 16.829  7.522   -2.799  1.00 29.33 ? 20  VAL B CA    1 
ATOM   2623 C C     . VAL D 2 19  ? 17.343  6.736   -1.587  1.00 27.69 ? 20  VAL B C     1 
ATOM   2624 O O     . VAL D 2 19  ? 17.482  5.514   -1.659  1.00 25.90 ? 20  VAL B O     1 
ATOM   2625 C CB    . VAL D 2 19  ? 15.304  7.258   -2.980  1.00 29.56 ? 20  VAL B CB    1 
ATOM   2626 C CG1   . VAL D 2 19  ? 14.553  7.664   -1.740  1.00 37.26 ? 20  VAL B CG1   1 
ATOM   2627 C CG2   . VAL D 2 19  ? 14.771  8.039   -4.166  1.00 30.81 ? 20  VAL B CG2   1 
ATOM   2628 N N     . CYS D 2 20  ? 17.629  7.425   -0.482  1.00 25.23 ? 21  CYS B N     1 
ATOM   2629 C CA    . CYS D 2 20  ? 18.134  6.736   0.703   1.00 25.73 ? 21  CYS B CA    1 
ATOM   2630 C C     . CYS D 2 20  ? 17.400  7.018   2.017   1.00 23.46 ? 21  CYS B C     1 
ATOM   2631 O O     . CYS D 2 20  ? 17.738  6.447   3.046   1.00 26.71 ? 21  CYS B O     1 
ATOM   2632 C CB    . CYS D 2 20  ? 19.643  6.982   0.865   1.00 26.97 ? 21  CYS B CB    1 
ATOM   2633 S SG    . CYS D 2 20  ? 20.112  8.689   1.126   1.00 32.77 ? 21  CYS B SG    1 
ATOM   2634 N N     . GLY D 2 21  ? 16.396  7.883   1.998   1.00 21.63 ? 22  GLY B N     1 
ATOM   2635 C CA    . GLY D 2 21  ? 15.666  8.138   3.222   1.00 19.45 ? 22  GLY B CA    1 
ATOM   2636 C C     . GLY D 2 21  ? 14.586  9.179   3.067   1.00 20.49 ? 22  GLY B C     1 
ATOM   2637 O O     . GLY D 2 21  ? 14.403  9.732   1.977   1.00 18.53 ? 22  GLY B O     1 
ATOM   2638 N N     . ILE D 2 22  ? 13.847  9.426   4.146   1.00 16.47 ? 23  ILE B N     1 
ATOM   2639 C CA    . ILE D 2 22  ? 12.832  10.459  4.139   1.00 16.48 ? 23  ILE B CA    1 
ATOM   2640 C C     . ILE D 2 22  ? 13.471  11.539  5.009   1.00 18.19 ? 23  ILE B C     1 
ATOM   2641 O O     . ILE D 2 22  ? 14.227  11.236  5.934   1.00 16.91 ? 23  ILE B O     1 
ATOM   2642 C CB    . ILE D 2 22  ? 11.461  9.976   4.690   1.00 21.47 ? 23  ILE B CB    1 
ATOM   2643 C CG1   . ILE D 2 22  ? 11.567  9.549   6.151   1.00 31.35 ? 23  ILE B CG1   1 
ATOM   2644 C CG2   . ILE D 2 22  ? 10.933  8.819   3.828   1.00 25.82 ? 23  ILE B CG2   1 
ATOM   2645 C CD1   . ILE D 2 22  ? 10.220  9.251   6.783   1.00 35.49 ? 23  ILE B CD1   1 
ATOM   2646 N N     . ILE D 2 23  ? 13.197  12.796  4.715   1.00 19.51 ? 24  ILE B N     1 
ATOM   2647 C CA    . ILE D 2 23  ? 13.816  13.864  5.472   1.00 21.22 ? 24  ILE B CA    1 
ATOM   2648 C C     . ILE D 2 23  ? 12.777  14.784  6.065   1.00 20.96 ? 24  ILE B C     1 
ATOM   2649 O O     . ILE D 2 23  ? 11.717  14.996  5.479   1.00 20.73 ? 24  ILE B O     1 
ATOM   2650 C CB    . ILE D 2 23  ? 14.806  14.647  4.582   1.00 20.79 ? 24  ILE B CB    1 
ATOM   2651 C CG1   . ILE D 2 23  ? 15.498  15.738  5.394   1.00 21.87 ? 24  ILE B CG1   1 
ATOM   2652 C CG2   . ILE D 2 23  ? 14.084  15.234  3.381   1.00 18.24 ? 24  ILE B CG2   1 
ATOM   2653 C CD1   . ILE D 2 23  ? 16.717  16.294  4.726   1.00 22.14 ? 24  ILE B CD1   1 
ATOM   2654 N N     . SER D 2 24  ? 13.071  15.312  7.247   1.00 22.47 ? 25  SER B N     1 
ATOM   2655 C CA    . SER D 2 24  ? 12.153  16.219  7.906   1.00 26.33 ? 25  SER B CA    1 
ATOM   2656 C C     . SER D 2 24  ? 12.579  17.657  7.603   1.00 28.53 ? 25  SER B C     1 
ATOM   2657 O O     . SER D 2 24  ? 13.713  17.904  7.178   1.00 26.98 ? 25  SER B O     1 
ATOM   2658 C CB    . SER D 2 24  ? 12.141  15.965  9.416   1.00 25.04 ? 25  SER B CB    1 
ATOM   2659 O OG    . SER D 2 24  ? 13.368  16.339  10.016  1.00 29.69 ? 25  SER B OG    1 
ATOM   2660 N N     . ALA D 2 25  ? 11.667  18.597  7.826   1.00 30.66 ? 26  ALA B N     1 
ATOM   2661 C CA    . ALA D 2 25  ? 11.927  20.012  7.583   1.00 35.34 ? 26  ALA B CA    1 
ATOM   2662 C C     . ALA D 2 25  ? 13.091  20.529  8.439   1.00 36.39 ? 26  ALA B C     1 
ATOM   2663 O O     . ALA D 2 25  ? 13.746  21.519  8.096   1.00 39.70 ? 26  ALA B O     1 
ATOM   2664 C CB    . ALA D 2 25  ? 10.655  20.822  7.858   1.00 36.20 ? 26  ALA B CB    1 
ATOM   2665 N N     . GLU D 2 26  ? 13.343  19.834  9.543   1.00 34.85 ? 27  GLU B N     1 
ATOM   2666 C CA    . GLU D 2 26  ? 14.390  20.183  10.489  1.00 33.19 ? 27  GLU B CA    1 
ATOM   2667 C C     . GLU D 2 26  ? 15.743  19.572  10.123  1.00 32.00 ? 27  GLU B C     1 
ATOM   2668 O O     . GLU D 2 26  ? 16.721  19.774  10.832  1.00 33.13 ? 27  GLU B O     1 
ATOM   2669 C CB    . GLU D 2 26  ? 13.972  19.740  11.892  1.00 36.01 ? 27  GLU B CB    1 
ATOM   2670 C CG    . GLU D 2 26  ? 12.615  20.306  12.364  1.00 42.25 ? 27  GLU B CG    1 
ATOM   2671 C CD    . GLU D 2 26  ? 11.393  19.736  11.622  1.00 44.72 ? 27  GLU B CD    1 
ATOM   2672 O OE1   . GLU D 2 26  ? 11.465  18.613  11.074  1.00 45.56 ? 27  GLU B OE1   1 
ATOM   2673 O OE2   . GLU D 2 26  ? 10.345  20.415  11.590  1.00 42.66 ? 27  GLU B OE2   1 
ATOM   2674 N N     . GLY D 2 27  ? 15.800  18.823  9.023   1.00 29.75 ? 28  GLY B N     1 
ATOM   2675 C CA    . GLY D 2 27  ? 17.056  18.223  8.588   1.00 26.98 ? 28  GLY B CA    1 
ATOM   2676 C C     . GLY D 2 27  ? 17.424  16.831  9.091   1.00 27.44 ? 28  GLY B C     1 
ATOM   2677 O O     . GLY D 2 27  ? 18.544  16.367  8.855   1.00 27.31 ? 28  GLY B O     1 
ATOM   2678 N N     . LYS D 2 28  ? 16.501  16.159  9.777   1.00 27.00 ? 29  LYS B N     1 
ATOM   2679 C CA    . LYS D 2 28  ? 16.760  14.818  10.304  1.00 25.83 ? 29  LYS B CA    1 
ATOM   2680 C C     . LYS D 2 28  ? 16.314  13.791  9.255   1.00 23.18 ? 29  LYS B C     1 
ATOM   2681 O O     . LYS D 2 28  ? 15.213  13.889  8.732   1.00 23.72 ? 29  LYS B O     1 
ATOM   2682 C CB    . LYS D 2 28  ? 15.987  14.634  11.606  1.00 26.00 ? 29  LYS B CB    1 
ATOM   2683 C CG    . LYS D 2 28  ? 16.450  13.488  12.477  1.00 34.47 ? 29  LYS B CG    1 
ATOM   2684 C CD    . LYS D 2 28  ? 15.614  13.440  13.752  1.00 43.28 ? 29  LYS B CD    1 
ATOM   2685 C CE    . LYS D 2 28  ? 16.115  12.384  14.717  1.00 45.07 ? 29  LYS B CE    1 
ATOM   2686 N NZ    . LYS D 2 28  ? 15.251  12.309  15.921  1.00 45.51 ? 29  LYS B NZ    1 
ATOM   2687 N N     . ILE D 2 29  ? 17.168  12.819  8.958   1.00 22.43 ? 30  ILE B N     1 
ATOM   2688 C CA    . ILE D 2 29  ? 16.878  11.796  7.953   1.00 23.27 ? 30  ILE B CA    1 
ATOM   2689 C C     . ILE D 2 29  ? 16.593  10.413  8.554   1.00 24.47 ? 30  ILE B C     1 
ATOM   2690 O O     . ILE D 2 29  ? 17.356  9.924   9.381   1.00 24.86 ? 30  ILE B O     1 
ATOM   2691 C CB    . ILE D 2 29  ? 18.063  11.674  6.968   1.00 29.69 ? 30  ILE B CB    1 
ATOM   2692 C CG1   . ILE D 2 29  ? 18.318  13.032  6.299   1.00 26.93 ? 30  ILE B CG1   1 
ATOM   2693 C CG2   . ILE D 2 29  ? 17.805  10.567  5.938   1.00 24.41 ? 30  ILE B CG2   1 
ATOM   2694 C CD1   . ILE D 2 29  ? 19.616  13.091  5.512   1.00 33.09 ? 30  ILE B CD1   1 
ATOM   2695 N N     . TYR D 2 30  ? 15.494  9.795   8.127   1.00 21.44 ? 31  TYR B N     1 
ATOM   2696 C CA    . TYR D 2 30  ? 15.091  8.465   8.589   1.00 22.51 ? 31  TYR B CA    1 
ATOM   2697 C C     . TYR D 2 30  ? 15.308  7.481   7.424   1.00 21.29 ? 31  TYR B C     1 
ATOM   2698 O O     . TYR D 2 30  ? 14.829  7.717   6.313   1.00 18.68 ? 31  TYR B O     1 
ATOM   2699 C CB    . TYR D 2 30  ? 13.608  8.475   9.010   1.00 24.68 ? 31  TYR B CB    1 
ATOM   2700 C CG    . TYR D 2 30  ? 13.257  9.532   10.040  1.00 28.72 ? 31  TYR B CG    1 
ATOM   2701 C CD1   . TYR D 2 30  ? 13.237  10.886  9.696   1.00 24.92 ? 31  TYR B CD1   1 
ATOM   2702 C CD2   . TYR D 2 30  ? 12.966  9.182   11.368  1.00 26.08 ? 31  TYR B CD2   1 
ATOM   2703 C CE1   . TYR D 2 30  ? 12.941  11.868  10.642  1.00 26.61 ? 31  TYR B CE1   1 
ATOM   2704 C CE2   . TYR D 2 30  ? 12.668  10.160  12.324  1.00 25.87 ? 31  TYR B CE2   1 
ATOM   2705 C CZ    . TYR D 2 30  ? 12.660  11.499  11.951  1.00 31.42 ? 31  TYR B CZ    1 
ATOM   2706 O OH    . TYR D 2 30  ? 12.379  12.477  12.874  1.00 33.65 ? 31  TYR B OH    1 
ATOM   2707 N N     . PRO D 2 31  ? 16.036  6.374   7.659   1.00 21.72 ? 32  PRO B N     1 
ATOM   2708 C CA    . PRO D 2 31  ? 16.301  5.382   6.603   1.00 21.06 ? 32  PRO B CA    1 
ATOM   2709 C C     . PRO D 2 31  ? 15.072  4.626   6.061   1.00 20.69 ? 32  PRO B C     1 
ATOM   2710 O O     . PRO D 2 31  ? 13.987  4.660   6.650   1.00 19.40 ? 32  PRO B O     1 
ATOM   2711 C CB    . PRO D 2 31  ? 17.334  4.457   7.253   1.00 19.07 ? 32  PRO B CB    1 
ATOM   2712 C CG    . PRO D 2 31  ? 16.969  4.507   8.703   1.00 22.17 ? 32  PRO B CG    1 
ATOM   2713 C CD    . PRO D 2 31  ? 16.663  5.972   8.932   1.00 25.82 ? 32  PRO B CD    1 
ATOM   2714 N N     . LEU D 2 32  ? 15.249  3.949   4.932   1.00 23.99 ? 33  LEU B N     1 
ATOM   2715 C CA    . LEU D 2 32  ? 14.161  3.210   4.296   1.00 27.53 ? 33  LEU B CA    1 
ATOM   2716 C C     . LEU D 2 32  ? 14.072  1.755   4.766   1.00 29.54 ? 33  LEU B C     1 
ATOM   2717 O O     . LEU D 2 32  ? 15.051  1.184   5.247   1.00 30.08 ? 33  LEU B O     1 
ATOM   2718 C CB    . LEU D 2 32  ? 14.318  3.253   2.763   1.00 22.82 ? 33  LEU B CB    1 
ATOM   2719 C CG    . LEU D 2 32  ? 14.434  4.625   2.072   1.00 24.68 ? 33  LEU B CG    1 
ATOM   2720 C CD1   . LEU D 2 32  ? 14.743  4.429   0.598   1.00 28.47 ? 33  LEU B CD1   1 
ATOM   2721 C CD2   . LEU D 2 32  ? 13.161  5.441   2.244   1.00 23.96 ? 33  LEU B CD2   1 
ATOM   2722 N N     . GLY D 2 33  ? 12.882  1.176   4.622   1.00 34.11 ? 34  GLY B N     1 
ATOM   2723 C CA    . GLY D 2 33  ? 12.645  -0.214  4.985   1.00 36.31 ? 34  GLY B CA    1 
ATOM   2724 C C     . GLY D 2 33  ? 12.839  -1.099  3.757   1.00 39.30 ? 34  GLY B C     1 
ATOM   2725 O O     . GLY D 2 33  ? 12.989  -0.581  2.645   1.00 35.21 ? 34  GLY B O     1 
ATOM   2726 N N     . SER D 2 34  ? 12.818  -2.422  3.946   1.00 44.06 ? 35  SER B N     1 
ATOM   2727 C CA    . SER D 2 34  ? 13.049  -3.393  2.860   1.00 46.40 ? 35  SER B CA    1 
ATOM   2728 C C     . SER D 2 34  ? 11.896  -3.815  1.928   1.00 46.69 ? 35  SER B C     1 
ATOM   2729 O O     . SER D 2 34  ? 12.132  -4.151  0.762   1.00 48.86 ? 35  SER B O     1 
ATOM   2730 C CB    . SER D 2 34  ? 13.668  -4.671  3.451   1.00 48.86 ? 35  SER B CB    1 
ATOM   2731 O OG    . SER D 2 34  ? 14.854  -4.400  4.182   1.00 54.57 ? 35  SER B OG    1 
ATOM   2732 N N     . ASP D 2 35  ? 10.669  -3.809  2.443   1.00 45.16 ? 36  ASP B N     1 
ATOM   2733 C CA    . ASP D 2 35  ? 9.488   -4.242  1.680   1.00 45.49 ? 36  ASP B CA    1 
ATOM   2734 C C     . ASP D 2 35  ? 8.983   -3.372  0.520   1.00 43.71 ? 36  ASP B C     1 
ATOM   2735 O O     . ASP D 2 35  ? 9.110   -2.146  0.559   1.00 45.59 ? 36  ASP B O     1 
ATOM   2736 C CB    . ASP D 2 35  ? 8.324   -4.532  2.640   1.00 48.85 ? 36  ASP B CB    1 
ATOM   2737 C CG    . ASP D 2 35  ? 8.042   -3.382  3.604   1.00 55.63 ? 36  ASP B CG    1 
ATOM   2738 O OD1   . ASP D 2 35  ? 9.002   -2.806  4.168   1.00 54.37 ? 36  ASP B OD1   1 
ATOM   2739 O OD2   . ASP D 2 35  ? 6.850   -3.056  3.806   1.00 56.35 ? 36  ASP B OD2   1 
ATOM   2740 N N     . THR D 2 36  ? 8.402   -4.018  -0.503  1.00 39.84 ? 37  THR B N     1 
ATOM   2741 C CA    . THR D 2 36  ? 7.856   -3.331  -1.687  1.00 34.93 ? 37  THR B CA    1 
ATOM   2742 C C     . THR D 2 36  ? 6.824   -2.284  -1.271  1.00 32.66 ? 37  THR B C     1 
ATOM   2743 O O     . THR D 2 36  ? 6.577   -1.331  -2.003  1.00 33.06 ? 37  THR B O     1 
ATOM   2744 C CB    . THR D 2 36  ? 7.182   -4.319  -2.711  1.00 35.99 ? 37  THR B CB    1 
ATOM   2745 O OG1   . THR D 2 36  ? 8.106   -5.350  -3.075  1.00 31.70 ? 37  THR B OG1   1 
ATOM   2746 C CG2   . THR D 2 36  ? 6.757   -3.588  -3.988  1.00 33.53 ? 37  THR B CG2   1 
ATOM   2747 N N     . LYS D 2 37  ? 6.221   -2.458  -0.098  1.00 31.16 ? 38  LYS B N     1 
ATOM   2748 C CA    . LYS D 2 37  ? 5.243   -1.499  0.412   1.00 31.35 ? 38  LYS B CA    1 
ATOM   2749 C C     . LYS D 2 37  ? 5.936   -0.122  0.485   1.00 31.75 ? 38  LYS B C     1 
ATOM   2750 O O     . LYS D 2 37  ? 5.373   0.903   0.080   1.00 31.82 ? 38  LYS B O     1 
ATOM   2751 C CB    . LYS D 2 37  ? 4.779   -1.945  1.801   1.00 38.79 ? 38  LYS B CB    1 
ATOM   2752 C CG    . LYS D 2 37  ? 3.683   -1.108  2.427   1.00 41.58 ? 38  LYS B CG    1 
ATOM   2753 C CD    . LYS D 2 37  ? 2.337   -1.411  1.809   1.00 46.85 ? 38  LYS B CD    1 
ATOM   2754 C CE    . LYS D 2 37  ? 1.225   -0.936  2.729   1.00 55.08 ? 38  LYS B CE    1 
ATOM   2755 N NZ    . LYS D 2 37  ? -0.128  -1.108  2.126   1.00 59.40 ? 38  LYS B NZ    1 
ATOM   2756 N N     . VAL D 2 38  ? 7.170   -0.121  0.991   1.00 28.84 ? 39  VAL B N     1 
ATOM   2757 C CA    . VAL D 2 38  ? 7.978   1.090   1.112   1.00 27.95 ? 39  VAL B CA    1 
ATOM   2758 C C     . VAL D 2 38  ? 8.503   1.548   -0.257  1.00 24.45 ? 39  VAL B C     1 
ATOM   2759 O O     . VAL D 2 38  ? 8.374   2.716   -0.634  1.00 22.16 ? 39  VAL B O     1 
ATOM   2760 C CB    . VAL D 2 38  ? 9.182   0.846   2.075   1.00 29.47 ? 39  VAL B CB    1 
ATOM   2761 C CG1   . VAL D 2 38  ? 10.226  1.952   1.947   1.00 26.10 ? 39  VAL B CG1   1 
ATOM   2762 C CG2   . VAL D 2 38  ? 8.679   0.766   3.503   1.00 29.18 ? 39  VAL B CG2   1 
ATOM   2763 N N     . LEU D 2 39  ? 9.092   0.621   -1.002  1.00 22.14 ? 40  LEU B N     1 
ATOM   2764 C CA    . LEU D 2 39  ? 9.658   0.949   -2.304  1.00 21.64 ? 40  LEU B CA    1 
ATOM   2765 C C     . LEU D 2 39  ? 8.684   1.382   -3.411  1.00 20.83 ? 40  LEU B C     1 
ATOM   2766 O O     . LEU D 2 39  ? 9.043   2.222   -4.232  1.00 21.20 ? 40  LEU B O     1 
ATOM   2767 C CB    . LEU D 2 39  ? 10.605  -0.169  -2.763  1.00 22.89 ? 40  LEU B CB    1 
ATOM   2768 C CG    . LEU D 2 39  ? 11.824  -0.224  -1.826  1.00 32.20 ? 40  LEU B CG    1 
ATOM   2769 C CD1   . LEU D 2 39  ? 12.649  -1.464  -2.057  1.00 29.22 ? 40  LEU B CD1   1 
ATOM   2770 C CD2   . LEU D 2 39  ? 12.666  1.034   -2.015  1.00 35.14 ? 40  LEU B CD2   1 
ATOM   2771 N N     . SER D 2 40  ? 7.463   0.853   -3.458  1.00 19.40 ? 41  SER B N     1 
ATOM   2772 C CA    . SER D 2 40  ? 6.548   1.318   -4.501  1.00 21.75 ? 41  SER B CA    1 
ATOM   2773 C C     . SER D 2 40  ? 6.212   2.786   -4.224  1.00 22.93 ? 41  SER B C     1 
ATOM   2774 O O     . SER D 2 40  ? 6.063   3.589   -5.147  1.00 22.96 ? 41  SER B O     1 
ATOM   2775 C CB    . SER D 2 40  ? 5.274   0.464   -4.577  1.00 24.05 ? 41  SER B CB    1 
ATOM   2776 O OG    . SER D 2 40  ? 4.651   0.330   -3.320  1.00 34.49 ? 41  SER B OG    1 
ATOM   2777 N N     . THR D 2 41  ? 6.105   3.141   -2.946  1.00 22.99 ? 42  THR B N     1 
ATOM   2778 C CA    . THR D 2 41  ? 5.812   4.519   -2.553  1.00 22.25 ? 42  THR B CA    1 
ATOM   2779 C C     . THR D 2 41  ? 6.971   5.441   -2.961  1.00 19.66 ? 42  THR B C     1 
ATOM   2780 O O     . THR D 2 41  ? 6.758   6.526   -3.512  1.00 17.64 ? 42  THR B O     1 
ATOM   2781 C CB    . THR D 2 41  ? 5.564   4.613   -1.020  1.00 23.99 ? 42  THR B CB    1 
ATOM   2782 O OG1   . THR D 2 41  ? 4.313   3.981   -0.701  1.00 30.43 ? 42  THR B OG1   1 
ATOM   2783 C CG2   . THR D 2 41  ? 5.539   6.067   -0.557  1.00 19.98 ? 42  THR B CG2   1 
ATOM   2784 N N     . ILE D 2 42  ? 8.194   4.997   -2.699  1.00 18.42 ? 43  ILE B N     1 
ATOM   2785 C CA    . ILE D 2 42  ? 9.380   5.769   -3.036  1.00 20.56 ? 43  ILE B CA    1 
ATOM   2786 C C     . ILE D 2 42  ? 9.489   5.986   -4.558  1.00 21.24 ? 43  ILE B C     1 
ATOM   2787 O O     . ILE D 2 42  ? 9.775   7.096   -5.006  1.00 20.44 ? 43  ILE B O     1 
ATOM   2788 C CB    . ILE D 2 42  ? 10.656  5.094   -2.414  1.00 22.64 ? 43  ILE B CB    1 
ATOM   2789 C CG1   . ILE D 2 42  ? 10.972  5.746   -1.066  1.00 25.03 ? 43  ILE B CG1   1 
ATOM   2790 C CG2   . ILE D 2 42  ? 11.874  5.233   -3.311  1.00 22.45 ? 43  ILE B CG2   1 
ATOM   2791 C CD1   . ILE D 2 42  ? 9.801   5.889   -0.160  1.00 22.96 ? 43  ILE B CD1   1 
ATOM   2792 N N     . PHE D 2 43  ? 9.244   4.942   -5.346  1.00 20.61 ? 44  PHE B N     1 
ATOM   2793 C CA    . PHE D 2 43  ? 9.319   5.054   -6.803  1.00 21.17 ? 44  PHE B CA    1 
ATOM   2794 C C     . PHE D 2 43  ? 8.197   5.901   -7.408  1.00 21.59 ? 44  PHE B C     1 
ATOM   2795 O O     . PHE D 2 43  ? 8.387   6.535   -8.446  1.00 21.75 ? 44  PHE B O     1 
ATOM   2796 C CB    . PHE D 2 43  ? 9.412   3.665   -7.436  1.00 17.74 ? 44  PHE B CB    1 
ATOM   2797 C CG    . PHE D 2 43  ? 10.690  2.949   -7.103  1.00 17.57 ? 44  PHE B CG    1 
ATOM   2798 C CD1   . PHE D 2 43  ? 11.907  3.633   -7.127  1.00 18.29 ? 44  PHE B CD1   1 
ATOM   2799 C CD2   . PHE D 2 43  ? 10.683  1.602   -6.737  1.00 19.53 ? 44  PHE B CD2   1 
ATOM   2800 C CE1   . PHE D 2 43  ? 13.099  2.988   -6.792  1.00 23.19 ? 44  PHE B CE1   1 
ATOM   2801 C CE2   . PHE D 2 43  ? 11.869  0.942   -6.398  1.00 17.24 ? 44  PHE B CE2   1 
ATOM   2802 C CZ    . PHE D 2 43  ? 13.082  1.636   -6.423  1.00 24.51 ? 44  PHE B CZ    1 
ATOM   2803 N N     . GLU D 2 44  ? 7.034   5.916   -6.761  1.00 21.01 ? 45  GLU B N     1 
ATOM   2804 C CA    . GLU D 2 44  ? 5.922   6.758   -7.207  1.00 21.44 ? 45  GLU B CA    1 
ATOM   2805 C C     . GLU D 2 44  ? 6.357   8.225   -7.047  1.00 22.68 ? 45  GLU B C     1 
ATOM   2806 O O     . GLU D 2 44  ? 6.259   9.029   -7.982  1.00 20.09 ? 45  GLU B O     1 
ATOM   2807 C CB    . GLU D 2 44  ? 4.688   6.538   -6.327  1.00 26.53 ? 45  GLU B CB    1 
ATOM   2808 C CG    . GLU D 2 44  ? 3.977   5.212   -6.505  1.00 38.28 ? 45  GLU B CG    1 
ATOM   2809 C CD    . GLU D 2 44  ? 2.922   5.247   -7.595  1.00 47.01 ? 45  GLU B CD    1 
ATOM   2810 O OE1   . GLU D 2 44  ? 2.668   6.340   -8.151  1.00 48.99 ? 45  GLU B OE1   1 
ATOM   2811 O OE2   . GLU D 2 44  ? 2.344   4.175   -7.893  1.00 57.41 ? 45  GLU B OE2   1 
ATOM   2812 N N     . LEU D 2 45  ? 6.837   8.561   -5.847  1.00 18.61 ? 46  LEU B N     1 
ATOM   2813 C CA    . LEU D 2 45  ? 7.277   9.921   -5.532  1.00 20.77 ? 46  LEU B CA    1 
ATOM   2814 C C     . LEU D 2 45  ? 8.468   10.371  -6.379  1.00 17.61 ? 46  LEU B C     1 
ATOM   2815 O O     . LEU D 2 45  ? 8.553   11.530  -6.776  1.00 20.27 ? 46  LEU B O     1 
ATOM   2816 C CB    . LEU D 2 45  ? 7.632   10.037  -4.043  1.00 21.91 ? 46  LEU B CB    1 
ATOM   2817 C CG    . LEU D 2 45  ? 6.503   9.833   -3.035  1.00 24.82 ? 46  LEU B CG    1 
ATOM   2818 C CD1   . LEU D 2 45  ? 7.044   9.979   -1.613  1.00 23.64 ? 46  LEU B CD1   1 
ATOM   2819 C CD2   . LEU D 2 45  ? 5.397   10.829  -3.313  1.00 19.62 ? 46  LEU B CD2   1 
ATOM   2820 N N     . PHE D 2 46  ? 9.387   9.450   -6.642  1.00 17.64 ? 47  PHE B N     1 
ATOM   2821 C CA    . PHE D 2 46  ? 10.578  9.719   -7.449  1.00 19.59 ? 47  PHE B CA    1 
ATOM   2822 C C     . PHE D 2 46  ? 10.180  10.117  -8.881  1.00 20.51 ? 47  PHE B C     1 
ATOM   2823 O O     . PHE D 2 46  ? 10.806  10.983  -9.498  1.00 20.94 ? 47  PHE B O     1 
ATOM   2824 C CB    . PHE D 2 46  ? 11.449  8.456   -7.485  1.00 15.77 ? 47  PHE B CB    1 
ATOM   2825 C CG    . PHE D 2 46  ? 12.794  8.648   -8.121  1.00 21.77 ? 47  PHE B CG    1 
ATOM   2826 C CD1   . PHE D 2 46  ? 13.786  9.368   -7.471  1.00 25.74 ? 47  PHE B CD1   1 
ATOM   2827 C CD2   . PHE D 2 46  ? 13.074  8.099   -9.367  1.00 28.65 ? 47  PHE B CD2   1 
ATOM   2828 C CE1   . PHE D 2 46  ? 15.043  9.539   -8.052  1.00 31.58 ? 47  PHE B CE1   1 
ATOM   2829 C CE2   . PHE D 2 46  ? 14.326  8.265   -9.956  1.00 29.27 ? 47  PHE B CE2   1 
ATOM   2830 C CZ    . PHE D 2 46  ? 15.312  8.988   -9.293  1.00 29.69 ? 47  PHE B CZ    1 
ATOM   2831 N N     . SER D 2 47  ? 9.130   9.476   -9.389  1.00 19.44 ? 48  SER B N     1 
ATOM   2832 C CA    . SER D 2 47  ? 8.634   9.706   -10.742 1.00 19.91 ? 48  SER B CA    1 
ATOM   2833 C C     . SER D 2 47  ? 7.796   10.964  -10.996 1.00 20.45 ? 48  SER B C     1 
ATOM   2834 O O     . SER D 2 47  ? 7.824   11.489  -12.111 1.00 19.80 ? 48  SER B O     1 
ATOM   2835 C CB    . SER D 2 47  ? 7.821   8.489   -11.202 1.00 18.34 ? 48  SER B CB    1 
ATOM   2836 O OG    . SER D 2 47  ? 8.546   7.286   -11.061 1.00 20.35 ? 48  SER B OG    1 
ATOM   2837 N N     . ARG D 2 48  ? 7.057   11.448  -9.993  1.00 19.06 ? 49  ARG B N     1 
ATOM   2838 C CA    . ARG D 2 48  ? 6.187   12.619  -10.169 1.00 20.44 ? 49  ARG B CA    1 
ATOM   2839 C C     . ARG D 2 48  ? 6.855   13.834  -10.801 1.00 22.08 ? 49  ARG B C     1 
ATOM   2840 O O     . ARG D 2 48  ? 6.341   14.379  -11.784 1.00 18.97 ? 49  ARG B O     1 
ATOM   2841 C CB    . ARG D 2 48  ? 5.509   13.019  -8.851  1.00 25.20 ? 49  ARG B CB    1 
ATOM   2842 C CG    . ARG D 2 48  ? 4.598   11.949  -8.281  1.00 32.45 ? 49  ARG B CG    1 
ATOM   2843 C CD    . ARG D 2 48  ? 4.188   12.246  -6.847  1.00 33.79 ? 49  ARG B CD    1 
ATOM   2844 N NE    . ARG D 2 48  ? 3.161   13.278  -6.738  1.00 30.83 ? 49  ARG B NE    1 
ATOM   2845 C CZ    . ARG D 2 48  ? 3.355   14.482  -6.204  1.00 33.97 ? 49  ARG B CZ    1 
ATOM   2846 N NH1   . ARG D 2 48  ? 4.545   14.836  -5.743  1.00 36.18 ? 49  ARG B NH1   1 
ATOM   2847 N NH2   . ARG D 2 48  ? 2.357   15.344  -6.133  1.00 33.19 ? 49  ARG B NH2   1 
ATOM   2848 N N     . PRO D 2 49  ? 8.002   14.284  -10.253 1.00 23.27 ? 50  PRO B N     1 
ATOM   2849 C CA    . PRO D 2 49  ? 8.673   15.453  -10.841 1.00 23.47 ? 50  PRO B CA    1 
ATOM   2850 C C     . PRO D 2 49  ? 9.075   15.248  -12.316 1.00 21.06 ? 50  PRO B C     1 
ATOM   2851 O O     . PRO D 2 49  ? 8.893   16.146  -13.138 1.00 20.28 ? 50  PRO B O     1 
ATOM   2852 C CB    . PRO D 2 49  ? 9.897   15.647  -9.929  1.00 22.58 ? 50  PRO B CB    1 
ATOM   2853 C CG    . PRO D 2 49  ? 9.458   15.054  -8.623  1.00 26.93 ? 50  PRO B CG    1 
ATOM   2854 C CD    . PRO D 2 49  ? 8.750   13.799  -9.079  1.00 22.73 ? 50  PRO B CD    1 
ATOM   2855 N N     . ILE D 2 50  ? 9.618   14.073  -12.633 1.00 20.83 ? 51  ILE B N     1 
ATOM   2856 C CA    . ILE D 2 50  ? 10.046  13.741  -13.996 1.00 24.69 ? 51  ILE B CA    1 
ATOM   2857 C C     . ILE D 2 50  ? 8.876   13.839  -14.978 1.00 23.97 ? 51  ILE B C     1 
ATOM   2858 O O     . ILE D 2 50  ? 8.954   14.543  -15.984 1.00 25.81 ? 51  ILE B O     1 
ATOM   2859 C CB    . ILE D 2 50  ? 10.601  12.309  -14.081 1.00 26.47 ? 51  ILE B CB    1 
ATOM   2860 C CG1   . ILE D 2 50  ? 11.651  12.072  -12.997 1.00 36.60 ? 51  ILE B CG1   1 
ATOM   2861 C CG2   . ILE D 2 50  ? 11.209  12.079  -15.456 1.00 31.22 ? 51  ILE B CG2   1 
ATOM   2862 C CD1   . ILE D 2 50  ? 12.051  10.605  -12.858 1.00 38.65 ? 51  ILE B CD1   1 
ATOM   2863 N N     . ILE D 2 51  ? 7.796   13.128  -14.669 1.00 23.24 ? 52  ILE B N     1 
ATOM   2864 C CA    . ILE D 2 51  ? 6.589   13.113  -15.490 1.00 23.41 ? 52  ILE B CA    1 
ATOM   2865 C C     . ILE D 2 51  ? 6.068   14.529  -15.724 1.00 24.33 ? 52  ILE B C     1 
ATOM   2866 O O     . ILE D 2 51  ? 5.821   14.931  -16.858 1.00 22.62 ? 52  ILE B O     1 
ATOM   2867 C CB    . ILE D 2 51  ? 5.482   12.227  -14.827 1.00 23.36 ? 52  ILE B CB    1 
ATOM   2868 C CG1   . ILE D 2 51  ? 5.885   10.754  -14.940 1.00 21.56 ? 52  ILE B CG1   1 
ATOM   2869 C CG2   . ILE D 2 51  ? 4.102   12.493  -15.451 1.00 19.70 ? 52  ILE B CG2   1 
ATOM   2870 C CD1   . ILE D 2 51  ? 5.065   9.839   -14.087 1.00 30.20 ? 52  ILE B CD1   1 
ATOM   2871 N N     . ASN D 2 52  ? 5.915   15.293  -14.654 1.00 24.19 ? 53  ASN B N     1 
ATOM   2872 C CA    . ASN D 2 52  ? 5.408   16.650  -14.777 1.00 23.96 ? 53  ASN B CA    1 
ATOM   2873 C C     . ASN D 2 52  ? 6.309   17.584  -15.611 1.00 25.17 ? 53  ASN B C     1 
ATOM   2874 O O     . ASN D 2 52  ? 5.817   18.425  -16.363 1.00 25.82 ? 53  ASN B O     1 
ATOM   2875 C CB    . ASN D 2 52  ? 5.179   17.240  -13.390 1.00 26.85 ? 53  ASN B CB    1 
ATOM   2876 C CG    . ASN D 2 52  ? 4.469   18.553  -13.450 1.00 36.89 ? 53  ASN B CG    1 
ATOM   2877 O OD1   . ASN D 2 52  ? 3.246   18.602  -13.619 1.00 41.23 ? 53  ASN B OD1   1 
ATOM   2878 N ND2   . ASN D 2 52  ? 5.225   19.643  -13.319 1.00 37.95 ? 53  ASN B ND2   1 
ATOM   2879 N N     . LYS D 2 53  ? 7.621   17.433  -15.480 1.00 22.82 ? 54  LYS B N     1 
ATOM   2880 C CA    . LYS D 2 53  ? 8.567   18.257  -16.220 1.00 25.19 ? 54  LYS B CA    1 
ATOM   2881 C C     . LYS D 2 53  ? 8.434   18.004  -17.723 1.00 26.85 ? 54  LYS B C     1 
ATOM   2882 O O     . LYS D 2 53  ? 8.297   18.945  -18.510 1.00 26.06 ? 54  LYS B O     1 
ATOM   2883 C CB    . LYS D 2 53  ? 9.994   17.944  -15.774 1.00 24.26 ? 54  LYS B CB    1 
ATOM   2884 C CG    . LYS D 2 53  ? 11.051  18.830  -16.384 1.00 33.73 ? 54  LYS B CG    1 
ATOM   2885 C CD    . LYS D 2 53  ? 12.426  18.279  -16.091 1.00 39.42 ? 54  LYS B CD    1 
ATOM   2886 C CE    . LYS D 2 53  ? 13.506  19.144  -16.716 1.00 50.39 ? 54  LYS B CE    1 
ATOM   2887 N NZ    . LYS D 2 53  ? 14.846  18.488  -16.647 1.00 49.39 ? 54  LYS B NZ    1 
ATOM   2888 N N     . ILE D 2 54  ? 8.477   16.732  -18.112 1.00 25.62 ? 55  ILE B N     1 
ATOM   2889 C CA    . ILE D 2 54  ? 8.360   16.343  -19.513 1.00 24.82 ? 55  ILE B CA    1 
ATOM   2890 C C     . ILE D 2 54  ? 6.992   16.704  -20.089 1.00 24.55 ? 55  ILE B C     1 
ATOM   2891 O O     . ILE D 2 54  ? 6.895   17.135  -21.237 1.00 25.40 ? 55  ILE B O     1 
ATOM   2892 C CB    . ILE D 2 54  ? 8.615   14.834  -19.687 1.00 29.81 ? 55  ILE B CB    1 
ATOM   2893 C CG1   . ILE D 2 54  ? 10.028  14.498  -19.198 1.00 24.25 ? 55  ILE B CG1   1 
ATOM   2894 C CG2   . ILE D 2 54  ? 8.398   14.414  -21.154 1.00 30.19 ? 55  ILE B CG2   1 
ATOM   2895 C CD1   . ILE D 2 54  ? 11.124  15.288  -19.891 1.00 30.08 ? 55  ILE B CD1   1 
ATOM   2896 N N     . ALA D 2 55  ? 5.940   16.536  -19.295 1.00 23.50 ? 56  ALA B N     1 
ATOM   2897 C CA    . ALA D 2 55  ? 4.591   16.853  -19.747 1.00 26.13 ? 56  ALA B CA    1 
ATOM   2898 C C     . ALA D 2 55  ? 4.432   18.347  -20.035 1.00 28.14 ? 56  ALA B C     1 
ATOM   2899 O O     . ALA D 2 55  ? 3.836   18.728  -21.046 1.00 27.10 ? 56  ALA B O     1 
ATOM   2900 C CB    . ALA D 2 55  ? 3.569   16.395  -18.731 1.00 20.15 ? 56  ALA B CB    1 
ATOM   2901 N N     . GLU D 2 56  ? 4.960   19.195  -19.159 1.00 29.62 ? 57  GLU B N     1 
ATOM   2902 C CA    . GLU D 2 56  ? 4.880   20.637  -19.377 1.00 32.04 ? 57  GLU B CA    1 
ATOM   2903 C C     . GLU D 2 56  ? 5.604   21.016  -20.670 1.00 31.94 ? 57  GLU B C     1 
ATOM   2904 O O     . GLU D 2 56  ? 5.111   21.825  -21.449 1.00 33.55 ? 57  GLU B O     1 
ATOM   2905 C CB    . GLU D 2 56  ? 5.499   21.404  -18.215 1.00 32.17 ? 57  GLU B CB    1 
ATOM   2906 C CG    . GLU D 2 56  ? 4.554   21.649  -17.053 1.00 46.15 ? 57  GLU B CG    1 
ATOM   2907 C CD    . GLU D 2 56  ? 5.108   22.660  -16.052 1.00 56.03 ? 57  GLU B CD    1 
ATOM   2908 O OE1   . GLU D 2 56  ? 6.233   23.182  -16.269 1.00 56.70 ? 57  GLU B OE1   1 
ATOM   2909 O OE2   . GLU D 2 56  ? 4.412   22.931  -15.046 1.00 58.09 ? 57  GLU B OE2   1 
ATOM   2910 N N     . LYS D 2 57  ? 6.771   20.420  -20.891 1.00 30.76 ? 58  LYS B N     1 
ATOM   2911 C CA    . LYS D 2 57  ? 7.556   20.674  -22.086 1.00 32.61 ? 58  LYS B CA    1 
ATOM   2912 C C     . LYS D 2 57  ? 6.758   20.364  -23.368 1.00 33.71 ? 58  LYS B C     1 
ATOM   2913 O O     . LYS D 2 57  ? 7.107   20.837  -24.449 1.00 35.63 ? 58  LYS B O     1 
ATOM   2914 C CB    . LYS D 2 57  ? 8.841   19.842  -22.040 1.00 33.82 ? 58  LYS B CB    1 
ATOM   2915 C CG    . LYS D 2 57  ? 9.700   19.971  -23.277 1.00 47.21 ? 58  LYS B CG    1 
ATOM   2916 C CD    . LYS D 2 57  ? 10.713  18.853  -23.391 1.00 55.01 ? 58  LYS B CD    1 
ATOM   2917 C CE    . LYS D 2 57  ? 11.358  18.878  -24.770 1.00 58.37 ? 58  LYS B CE    1 
ATOM   2918 N NZ    . LYS D 2 57  ? 12.301  17.749  -25.001 1.00 59.79 ? 58  LYS B NZ    1 
ATOM   2919 N N     . HIS D 2 58  ? 5.692   19.573  -23.254 1.00 31.53 ? 59  HIS B N     1 
ATOM   2920 C CA    . HIS D 2 58  ? 4.869   19.229  -24.419 1.00 29.69 ? 59  HIS B CA    1 
ATOM   2921 C C     . HIS D 2 58  ? 3.464   19.819  -24.388 1.00 28.50 ? 59  HIS B C     1 
ATOM   2922 O O     . HIS D 2 58  ? 2.622   19.452  -25.201 1.00 31.48 ? 59  HIS B O     1 
ATOM   2923 C CB    . HIS D 2 58  ? 4.774   17.708  -24.600 1.00 25.16 ? 59  HIS B CB    1 
ATOM   2924 C CG    . HIS D 2 58  ? 6.069   17.066  -24.989 1.00 24.66 ? 59  HIS B CG    1 
ATOM   2925 N ND1   . HIS D 2 58  ? 6.465   16.919  -26.300 1.00 25.43 ? 59  HIS B ND1   1 
ATOM   2926 C CD2   . HIS D 2 58  ? 7.066   16.548  -24.234 1.00 27.95 ? 59  HIS B CD2   1 
ATOM   2927 C CE1   . HIS D 2 58  ? 7.651   16.337  -26.338 1.00 19.93 ? 59  HIS B CE1   1 
ATOM   2928 N NE2   . HIS D 2 58  ? 8.038   16.102  -25.097 1.00 22.81 ? 59  HIS B NE2   1 
ATOM   2929 N N     . GLY D 2 59  ? 3.203   20.729  -23.456 1.00 27.72 ? 60  GLY B N     1 
ATOM   2930 C CA    . GLY D 2 59  ? 1.889   21.346  -23.382 1.00 26.88 ? 60  GLY B CA    1 
ATOM   2931 C C     . GLY D 2 59  ? 0.781   20.462  -22.839 1.00 28.87 ? 60  GLY B C     1 
ATOM   2932 O O     . GLY D 2 59  ? -0.397  20.664  -23.151 1.00 29.58 ? 60  GLY B O     1 
ATOM   2933 N N     . TYR D 2 60  ? 1.158   19.482  -22.022 1.00 29.01 ? 61  TYR B N     1 
ATOM   2934 C CA    . TYR D 2 60  ? 0.201   18.565  -21.405 1.00 28.23 ? 61  TYR B CA    1 
ATOM   2935 C C     . TYR D 2 60  ? -0.059  18.914  -19.944 1.00 28.39 ? 61  TYR B C     1 
ATOM   2936 O O     . TYR D 2 60  ? 0.868   19.184  -19.174 1.00 27.57 ? 61  TYR B O     1 
ATOM   2937 C CB    . TYR D 2 60  ? 0.729   17.129  -21.450 1.00 24.54 ? 61  TYR B CB    1 
ATOM   2938 C CG    . TYR D 2 60  ? 0.476   16.387  -22.738 1.00 29.73 ? 61  TYR B CG    1 
ATOM   2939 C CD1   . TYR D 2 60  ? -0.698  15.654  -22.917 1.00 26.26 ? 61  TYR B CD1   1 
ATOM   2940 C CD2   . TYR D 2 60  ? 1.422   16.386  -23.767 1.00 30.07 ? 61  TYR B CD2   1 
ATOM   2941 C CE1   . TYR D 2 60  ? -0.926  14.935  -24.080 1.00 25.46 ? 61  TYR B CE1   1 
ATOM   2942 C CE2   . TYR D 2 60  ? 1.205   15.668  -24.941 1.00 30.72 ? 61  TYR B CE2   1 
ATOM   2943 C CZ    . TYR D 2 60  ? 0.028   14.944  -25.088 1.00 30.60 ? 61  TYR B CZ    1 
ATOM   2944 O OH    . TYR D 2 60  ? -0.189  14.220  -26.235 1.00 34.11 ? 61  TYR B OH    1 
ATOM   2945 N N     . ILE D 2 61  ? -1.326  18.910  -19.570 1.00 29.97 ? 62  ILE B N     1 
ATOM   2946 C CA    . ILE D 2 61  ? -1.722  19.149  -18.192 1.00 32.03 ? 62  ILE B CA    1 
ATOM   2947 C C     . ILE D 2 61  ? -1.559  17.778  -17.492 1.00 31.49 ? 62  ILE B C     1 
ATOM   2948 O O     . ILE D 2 61  ? -1.795  16.728  -18.111 1.00 29.16 ? 62  ILE B O     1 
ATOM   2949 C CB    . ILE D 2 61  ? -3.209  19.647  -18.130 1.00 37.02 ? 62  ILE B CB    1 
ATOM   2950 C CG1   . ILE D 2 61  ? -3.252  21.176  -18.034 1.00 43.34 ? 62  ILE B CG1   1 
ATOM   2951 C CG2   . ILE D 2 61  ? -3.949  19.043  -16.946 1.00 43.67 ? 62  ILE B CG2   1 
ATOM   2952 C CD1   . ILE D 2 61  ? -2.661  21.896  -19.225 1.00 55.56 ? 62  ILE B CD1   1 
ATOM   2953 N N     . VAL D 2 62  ? -1.144  17.785  -16.225 1.00 29.08 ? 63  VAL B N     1 
ATOM   2954 C CA    . VAL D 2 62  ? -0.977  16.552  -15.461 1.00 27.76 ? 63  VAL B CA    1 
ATOM   2955 C C     . VAL D 2 62  ? -1.927  16.578  -14.268 1.00 27.80 ? 63  VAL B C     1 
ATOM   2956 O O     . VAL D 2 62  ? -1.930  17.540  -13.497 1.00 28.26 ? 63  VAL B O     1 
ATOM   2957 C CB    . VAL D 2 62  ? 0.472   16.384  -14.943 1.00 29.22 ? 63  VAL B CB    1 
ATOM   2958 C CG1   . VAL D 2 62  ? 0.607   15.083  -14.141 1.00 27.93 ? 63  VAL B CG1   1 
ATOM   2959 C CG2   . VAL D 2 62  ? 1.435   16.379  -16.101 1.00 29.55 ? 63  VAL B CG2   1 
ATOM   2960 N N     . GLU D 2 63  ? -2.729  15.524  -14.129 1.00 26.01 ? 64  GLU B N     1 
ATOM   2961 C CA    . GLU D 2 63  ? -3.686  15.393  -13.032 1.00 25.40 ? 64  GLU B CA    1 
ATOM   2962 C C     . GLU D 2 63  ? -3.561  14.078  -12.269 1.00 25.36 ? 64  GLU B C     1 
ATOM   2963 O O     . GLU D 2 63  ? -3.443  13.008  -12.872 1.00 24.93 ? 64  GLU B O     1 
ATOM   2964 C CB    . GLU D 2 63  ? -5.117  15.483  -13.544 1.00 26.03 ? 64  GLU B CB    1 
ATOM   2965 C CG    . GLU D 2 63  ? -5.627  16.881  -13.740 1.00 37.85 ? 64  GLU B CG    1 
ATOM   2966 C CD    . GLU D 2 63  ? -7.084  16.898  -14.144 1.00 36.62 ? 64  GLU B CD    1 
ATOM   2967 O OE1   . GLU D 2 63  ? -7.854  16.030  -13.663 1.00 36.11 ? 64  GLU B OE1   1 
ATOM   2968 O OE2   . GLU D 2 63  ? -7.456  17.781  -14.944 1.00 39.81 ? 64  GLU B OE2   1 
ATOM   2969 N N     . GLU D 2 64  ? -3.594  14.172  -10.943 1.00 24.53 ? 65  GLU B N     1 
ATOM   2970 C CA    . GLU D 2 64  ? -3.517  13.013  -10.060 1.00 25.35 ? 65  GLU B CA    1 
ATOM   2971 C C     . GLU D 2 64  ? -4.949  12.833  -9.553  1.00 24.72 ? 65  GLU B C     1 
ATOM   2972 O O     . GLU D 2 64  ? -5.742  13.769  -9.631  1.00 24.99 ? 65  GLU B O     1 
ATOM   2973 C CB    . GLU D 2 64  ? -2.533  13.286  -8.913  1.00 25.97 ? 65  GLU B CB    1 
ATOM   2974 C CG    . GLU D 2 64  ? -1.115  13.579  -9.402  1.00 30.27 ? 65  GLU B CG    1 
ATOM   2975 C CD    . GLU D 2 64  ? -0.128  13.786  -8.273  1.00 31.78 ? 65  GLU B CD    1 
ATOM   2976 O OE1   . GLU D 2 64  ? 0.005   14.927  -7.796  1.00 36.98 ? 65  GLU B OE1   1 
ATOM   2977 O OE2   . GLU D 2 64  ? 0.517   12.803  -7.862  1.00 39.20 ? 65  GLU B OE2   1 
ATOM   2978 N N     . PRO D 2 65  ? -5.309  11.632  -9.055  1.00 25.82 ? 66  PRO B N     1 
ATOM   2979 C CA    . PRO D 2 65  ? -6.662  11.349  -8.546  1.00 27.59 ? 66  PRO B CA    1 
ATOM   2980 C C     . PRO D 2 65  ? -7.055  12.137  -7.291  1.00 30.25 ? 66  PRO B C     1 
ATOM   2981 O O     . PRO D 2 65  ? -6.197  12.622  -6.551  1.00 28.97 ? 66  PRO B O     1 
ATOM   2982 C CB    . PRO D 2 65  ? -6.617  9.843   -8.238  1.00 23.41 ? 66  PRO B CB    1 
ATOM   2983 C CG    . PRO D 2 65  ? -5.482  9.337   -9.050  1.00 26.94 ? 66  PRO B CG    1 
ATOM   2984 C CD    . PRO D 2 65  ? -4.464  10.432  -8.945  1.00 21.63 ? 66  PRO B CD    1 
ATOM   2985 N N     . LYS D 2 66  ? -8.359  12.266  -7.070  1.00 33.78 ? 67  LYS B N     1 
ATOM   2986 C CA    . LYS D 2 66  ? -8.883  12.942  -5.886  1.00 36.72 ? 67  LYS B CA    1 
ATOM   2987 C C     . LYS D 2 66  ? -9.241  11.808  -4.921  1.00 37.97 ? 67  LYS B C     1 
ATOM   2988 O O     . LYS D 2 66  ? -8.810  11.815  -3.768  1.00 39.97 ? 67  LYS B O     1 
ATOM   2989 C CB    . LYS D 2 66  ? -10.118 13.772  -6.234  1.00 44.74 ? 67  LYS B CB    1 
ATOM   2990 C CG    . LYS D 2 66  ? -9.839  14.905  -7.213  1.00 59.43 ? 67  LYS B CG    1 
ATOM   2991 C CD    . LYS D 2 66  ? -11.129 15.608  -7.625  1.00 72.20 ? 67  LYS B CD    1 
ATOM   2992 C CE    . LYS D 2 66  ? -10.868 16.777  -8.586  1.00 76.92 ? 67  LYS B CE    1 
ATOM   2993 N NZ    . LYS D 2 66  ? -12.122 17.515  -8.942  1.00 74.93 ? 67  LYS B NZ    1 
ATOM   2994 N N     . GLN D 2 67  ? -10.027 10.831  -5.383  1.00 35.05 ? 68  GLN B N     1 
ATOM   2995 C CA    . GLN D 2 67  ? -10.376 9.680   -4.545  1.00 36.84 ? 68  GLN B CA    1 
ATOM   2996 C C     . GLN D 2 67  ? -9.157  8.757   -4.535  1.00 34.49 ? 68  GLN B C     1 
ATOM   2997 O O     . GLN D 2 67  ? -8.499  8.594   -5.554  1.00 35.36 ? 68  GLN B O     1 
ATOM   2998 C CB    . GLN D 2 67  ? -11.592 8.918   -5.087  1.00 40.41 ? 68  GLN B CB    1 
ATOM   2999 C CG    . GLN D 2 67  ? -12.933 9.613   -4.865  1.00 49.02 ? 68  GLN B CG    1 
ATOM   3000 C CD    . GLN D 2 67  ? -13.364 10.445  -6.054  1.00 56.11 ? 68  GLN B CD    1 
ATOM   3001 O OE1   . GLN D 2 67  ? -12.671 11.374  -6.464  1.00 55.76 ? 68  GLN B OE1   1 
ATOM   3002 N NE2   . GLN D 2 67  ? -14.516 10.111  -6.620  1.00 59.17 ? 68  GLN B NE2   1 
ATOM   3003 N N     . GLN D 2 68  ? -8.882  8.143   -3.393  1.00 31.46 ? 69  GLN B N     1 
ATOM   3004 C CA    . GLN D 2 68  ? -7.717  7.285   -3.226  1.00 31.33 ? 69  GLN B CA    1 
ATOM   3005 C C     . GLN D 2 68  ? -7.662  5.881   -3.852  1.00 32.28 ? 69  GLN B C     1 
ATOM   3006 O O     . GLN D 2 68  ? -6.621  5.215   -3.815  1.00 35.36 ? 69  GLN B O     1 
ATOM   3007 C CB    . GLN D 2 68  ? -7.381  7.220   -1.740  1.00 28.63 ? 69  GLN B CB    1 
ATOM   3008 C CG    . GLN D 2 68  ? -7.127  8.592   -1.140  1.00 28.35 ? 69  GLN B CG    1 
ATOM   3009 C CD    . GLN D 2 68  ? -6.577  8.514   0.265   1.00 40.32 ? 69  GLN B CD    1 
ATOM   3010 O OE1   . GLN D 2 68  ? -5.659  7.737   0.543   1.00 37.54 ? 69  GLN B OE1   1 
ATOM   3011 N NE2   . GLN D 2 68  ? -7.131  9.320   1.164   1.00 43.98 ? 69  GLN B NE2   1 
ATOM   3012 N N     . ASN D 2 69  ? -8.765  5.419   -4.417  1.00 29.76 ? 70  ASN B N     1 
ATOM   3013 C CA    . ASN D 2 69  ? -8.755  4.116   -5.065  1.00 27.63 ? 70  ASN B CA    1 
ATOM   3014 C C     . ASN D 2 69  ? -9.244  4.289   -6.510  1.00 24.93 ? 70  ASN B C     1 
ATOM   3015 O O     . ASN D 2 69  ? -10.065 3.511   -7.011  1.00 21.77 ? 70  ASN B O     1 
ATOM   3016 C CB    . ASN D 2 69  ? -9.593  3.079   -4.275  1.00 30.61 ? 70  ASN B CB    1 
ATOM   3017 C CG    . ASN D 2 69  ? -11.016 3.547   -3.974  1.00 38.06 ? 70  ASN B CG    1 
ATOM   3018 O OD1   . ASN D 2 69  ? -11.484 4.562   -4.511  1.00 34.50 ? 70  ASN B OD1   1 
ATOM   3019 N ND2   . ASN D 2 69  ? -11.712 2.804   -3.107  1.00 31.84 ? 70  ASN B ND2   1 
ATOM   3020 N N     . HIS D 2 70  ? -8.724  5.337   -7.157  1.00 22.51 ? 71  HIS B N     1 
ATOM   3021 C CA    . HIS D 2 70  ? -9.051  5.690   -8.542  1.00 22.92 ? 71  HIS B CA    1 
ATOM   3022 C C     . HIS D 2 70  ? -7.812  5.608   -9.430  1.00 23.76 ? 71  HIS B C     1 
ATOM   3023 O O     . HIS D 2 70  ? -6.766  6.176   -9.110  1.00 24.57 ? 71  HIS B O     1 
ATOM   3024 C CB    . HIS D 2 70  ? -9.570  7.132   -8.640  1.00 22.71 ? 71  HIS B CB    1 
ATOM   3025 C CG    . HIS D 2 70  ? -11.052 7.280   -8.466  1.00 28.52 ? 71  HIS B CG    1 
ATOM   3026 N ND1   . HIS D 2 70  ? -11.776 6.583   -7.522  1.00 36.60 ? 71  HIS B ND1   1 
ATOM   3027 C CD2   . HIS D 2 70  ? -11.941 8.075   -9.107  1.00 32.66 ? 71  HIS B CD2   1 
ATOM   3028 C CE1   . HIS D 2 70  ? -13.045 6.942   -7.585  1.00 35.85 ? 71  HIS B CE1   1 
ATOM   3029 N NE2   . HIS D 2 70  ? -13.173 7.847   -8.540  1.00 35.71 ? 71  HIS B NE2   1 
ATOM   3030 N N     . TYR D 2 71  ? -7.940  4.903   -10.548 1.00 21.33 ? 72  TYR B N     1 
ATOM   3031 C CA    . TYR D 2 71  ? -6.869  4.771   -11.537 1.00 19.14 ? 72  TYR B CA    1 
ATOM   3032 C C     . TYR D 2 71  ? -7.014  5.973   -12.494 1.00 16.26 ? 72  TYR B C     1 
ATOM   3033 O O     . TYR D 2 71  ? -8.119  6.491   -12.672 1.00 16.30 ? 72  TYR B O     1 
ATOM   3034 C CB    . TYR D 2 71  ? -7.078  3.449   -12.302 1.00 15.77 ? 72  TYR B CB    1 
ATOM   3035 C CG    . TYR D 2 71  ? -6.342  3.299   -13.624 1.00 16.05 ? 72  TYR B CG    1 
ATOM   3036 C CD1   . TYR D 2 71  ? -6.927  3.717   -14.832 1.00 15.61 ? 72  TYR B CD1   1 
ATOM   3037 C CD2   . TYR D 2 71  ? -5.074  2.712   -13.674 1.00 15.35 ? 72  TYR B CD2   1 
ATOM   3038 C CE1   . TYR D 2 71  ? -6.260  3.548   -16.061 1.00 11.68 ? 72  TYR B CE1   1 
ATOM   3039 C CE2   . TYR D 2 71  ? -4.402  2.539   -14.885 1.00 14.94 ? 72  TYR B CE2   1 
ATOM   3040 C CZ    . TYR D 2 71  ? -5.001  2.958   -16.073 1.00 15.97 ? 72  TYR B CZ    1 
ATOM   3041 O OH    . TYR D 2 71  ? -4.337  2.769   -17.260 1.00 19.84 ? 72  TYR B OH    1 
ATOM   3042 N N     . PRO D 2 72  ? -5.910  6.461   -13.089 1.00 14.99 ? 73  PRO B N     1 
ATOM   3043 C CA    . PRO D 2 72  ? -4.504  6.065   -12.990 1.00 14.66 ? 73  PRO B CA    1 
ATOM   3044 C C     . PRO D 2 72  ? -3.729  7.058   -12.106 1.00 15.17 ? 73  PRO B C     1 
ATOM   3045 O O     . PRO D 2 72  ? -4.266  8.085   -11.686 1.00 16.06 ? 73  PRO B O     1 
ATOM   3046 C CB    . PRO D 2 72  ? -4.044  6.146   -14.441 1.00 12.09 ? 73  PRO B CB    1 
ATOM   3047 C CG    . PRO D 2 72  ? -4.762  7.410   -14.926 1.00 15.78 ? 73  PRO B CG    1 
ATOM   3048 C CD    . PRO D 2 72  ? -6.069  7.511   -14.120 1.00 14.34 ? 73  PRO B CD    1 
ATOM   3049 N N     . ASP D 2 73  ? -2.466  6.756   -11.835 1.00 17.23 ? 74  ASP B N     1 
ATOM   3050 C CA    . ASP D 2 73  ? -1.620  7.642   -11.029 1.00 18.14 ? 74  ASP B CA    1 
ATOM   3051 C C     . ASP D 2 73  ? -1.525  9.036   -11.653 1.00 18.59 ? 74  ASP B C     1 
ATOM   3052 O O     . ASP D 2 73  ? -1.592  10.052  -10.948 1.00 17.64 ? 74  ASP B O     1 
ATOM   3053 C CB    . ASP D 2 73  ? -0.208  7.052   -10.881 1.00 12.73 ? 74  ASP B CB    1 
ATOM   3054 C CG    . ASP D 2 73  ? -0.183  5.799   -10.015 1.00 14.11 ? 74  ASP B CG    1 
ATOM   3055 O OD1   . ASP D 2 73  ? -1.053  5.658   -9.133  1.00 16.82 ? 74  ASP B OD1   1 
ATOM   3056 O OD2   . ASP D 2 73  ? 0.711   4.950   -10.217 1.00 14.39 ? 74  ASP B OD2   1 
ATOM   3057 N N     . PHE D 2 74  ? -1.364  9.077   -12.975 1.00 17.85 ? 75  PHE B N     1 
ATOM   3058 C CA    . PHE D 2 74  ? -1.260  10.338  -13.701 1.00 17.90 ? 75  PHE B CA    1 
ATOM   3059 C C     . PHE D 2 74  ? -2.093  10.326  -14.975 1.00 18.11 ? 75  PHE B C     1 
ATOM   3060 O O     . PHE D 2 74  ? -2.033  9.372   -15.754 1.00 16.76 ? 75  PHE B O     1 
ATOM   3061 C CB    . PHE D 2 74  ? 0.204   10.631  -14.080 1.00 19.83 ? 75  PHE B CB    1 
ATOM   3062 C CG    . PHE D 2 74  ? 1.154   10.597  -12.916 1.00 25.33 ? 75  PHE B CG    1 
ATOM   3063 C CD1   . PHE D 2 74  ? 1.377   11.737  -12.149 1.00 30.57 ? 75  PHE B CD1   1 
ATOM   3064 C CD2   . PHE D 2 74  ? 1.808   9.418   -12.569 1.00 26.64 ? 75  PHE B CD2   1 
ATOM   3065 C CE1   . PHE D 2 74  ? 2.241   11.698  -11.048 1.00 29.98 ? 75  PHE B CE1   1 
ATOM   3066 C CE2   . PHE D 2 74  ? 2.670   9.374   -11.473 1.00 27.72 ? 75  PHE B CE2   1 
ATOM   3067 C CZ    . PHE D 2 74  ? 2.885   10.513  -10.715 1.00 23.79 ? 75  PHE B CZ    1 
ATOM   3068 N N     . THR D 2 75  ? -2.873  11.382  -15.169 1.00 15.66 ? 76  THR B N     1 
ATOM   3069 C CA    . THR D 2 75  ? -3.669  11.555  -16.376 1.00 19.68 ? 76  THR B CA    1 
ATOM   3070 C C     . THR D 2 75  ? -3.058  12.776  -17.084 1.00 22.60 ? 76  THR B C     1 
ATOM   3071 O O     . THR D 2 75  ? -3.009  13.866  -16.496 1.00 22.28 ? 76  THR B O     1 
ATOM   3072 C CB    . THR D 2 75  ? -5.148  11.853  -16.057 1.00 18.41 ? 76  THR B CB    1 
ATOM   3073 O OG1   . THR D 2 75  ? -5.768  10.679  -15.524 1.00 22.70 ? 76  THR B OG1   1 
ATOM   3074 C CG2   . THR D 2 75  ? -5.901  12.283  -17.322 1.00 21.00 ? 76  THR B CG2   1 
ATOM   3075 N N     . LEU D 2 76  ? -2.582  12.589  -18.317 1.00 20.45 ? 77  LEU B N     1 
ATOM   3076 C CA    . LEU D 2 76  ? -1.994  13.672  -19.110 1.00 22.62 ? 77  LEU B CA    1 
ATOM   3077 C C     . LEU D 2 76  ? -2.885  13.998  -20.304 1.00 27.19 ? 77  LEU B C     1 
ATOM   3078 O O     . LEU D 2 76  ? -3.434  13.092  -20.948 1.00 25.94 ? 77  LEU B O     1 
ATOM   3079 C CB    . LEU D 2 76  ? -0.611  13.287  -19.627 1.00 17.88 ? 77  LEU B CB    1 
ATOM   3080 C CG    . LEU D 2 76  ? 0.610   13.372  -18.712 1.00 24.15 ? 77  LEU B CG    1 
ATOM   3081 C CD1   . LEU D 2 76  ? 0.438   12.483  -17.490 1.00 25.45 ? 77  LEU B CD1   1 
ATOM   3082 C CD2   . LEU D 2 76  ? 1.837   12.951  -19.504 1.00 20.14 ? 77  LEU B CD2   1 
ATOM   3083 N N     . TYR D 2 77  ? -3.032  15.285  -20.601 1.00 30.32 ? 78  TYR B N     1 
ATOM   3084 C CA    . TYR D 2 77  ? -3.848  15.717  -21.736 1.00 34.87 ? 78  TYR B CA    1 
ATOM   3085 C C     . TYR D 2 77  ? -3.677  17.202  -22.068 1.00 36.36 ? 78  TYR B C     1 
ATOM   3086 O O     . TYR D 2 77  ? -3.304  18.006  -21.210 1.00 34.33 ? 78  TYR B O     1 
ATOM   3087 C CB    . TYR D 2 77  ? -5.336  15.428  -21.473 1.00 31.65 ? 78  TYR B CB    1 
ATOM   3088 C CG    . TYR D 2 77  ? -5.975  16.339  -20.445 1.00 33.17 ? 78  TYR B CG    1 
ATOM   3089 C CD1   . TYR D 2 77  ? -5.846  16.085  -19.082 1.00 34.52 ? 78  TYR B CD1   1 
ATOM   3090 C CD2   . TYR D 2 77  ? -6.703  17.461  -20.840 1.00 33.64 ? 78  TYR B CD2   1 
ATOM   3091 C CE1   . TYR D 2 77  ? -6.420  16.924  -18.140 1.00 40.57 ? 78  TYR B CE1   1 
ATOM   3092 C CE2   . TYR D 2 77  ? -7.280  18.306  -19.908 1.00 33.73 ? 78  TYR B CE2   1 
ATOM   3093 C CZ    . TYR D 2 77  ? -7.136  18.034  -18.560 1.00 42.22 ? 78  TYR B CZ    1 
ATOM   3094 O OH    . TYR D 2 77  ? -7.700  18.874  -17.630 1.00 38.81 ? 78  TYR B OH    1 
ATOM   3095 N N     . LYS D 2 78  ? -3.950  17.547  -23.323 1.00 37.69 ? 79  LYS B N     1 
ATOM   3096 C CA    . LYS D 2 78  ? -3.895  18.927  -23.792 1.00 37.32 ? 79  LYS B CA    1 
ATOM   3097 C C     . LYS D 2 78  ? -5.332  19.416  -23.666 1.00 37.91 ? 79  LYS B C     1 
ATOM   3098 O O     . LYS D 2 78  ? -6.267  18.689  -24.012 1.00 36.90 ? 79  LYS B O     1 
ATOM   3099 C CB    . LYS D 2 78  ? -3.449  18.971  -25.246 1.00 35.83 ? 79  LYS B CB    1 
ATOM   3100 C CG    . LYS D 2 78  ? -2.027  18.528  -25.452 1.00 35.13 ? 79  LYS B CG    1 
ATOM   3101 C CD    . LYS D 2 78  ? -1.681  18.519  -26.918 1.00 38.09 ? 79  LYS B CD    1 
ATOM   3102 C CE    . LYS D 2 78  ? -0.202  18.290  -27.108 1.00 40.59 ? 79  LYS B CE    1 
ATOM   3103 N NZ    . LYS D 2 78  ? 0.169   18.268  -28.541 1.00 45.29 ? 79  LYS B NZ    1 
ATOM   3104 N N     . PRO D 2 79  ? -5.538  20.644  -23.164 1.00 41.33 ? 80  PRO B N     1 
ATOM   3105 C CA    . PRO D 2 79  ? -6.894  21.193  -22.999 1.00 44.49 ? 80  PRO B CA    1 
ATOM   3106 C C     . PRO D 2 79  ? -7.747  21.159  -24.269 1.00 46.01 ? 80  PRO B C     1 
ATOM   3107 O O     . PRO D 2 79  ? -8.975  21.044  -24.206 1.00 46.46 ? 80  PRO B O     1 
ATOM   3108 C CB    . PRO D 2 79  ? -6.630  22.619  -22.515 1.00 46.18 ? 80  PRO B CB    1 
ATOM   3109 C CG    . PRO D 2 79  ? -5.328  22.483  -21.766 1.00 46.99 ? 80  PRO B CG    1 
ATOM   3110 C CD    . PRO D 2 79  ? -4.523  21.608  -22.701 1.00 43.38 ? 80  PRO B CD    1 
ATOM   3111 N N     . SER D 2 80  ? -7.077  21.254  -25.413 1.00 46.21 ? 81  SER B N     1 
ATOM   3112 C CA    . SER D 2 80  ? -7.726  21.236  -26.720 1.00 47.35 ? 81  SER B CA    1 
ATOM   3113 C C     . SER D 2 80  ? -8.096  19.827  -27.215 1.00 48.31 ? 81  SER B C     1 
ATOM   3114 O O     . SER D 2 80  ? -8.900  19.679  -28.141 1.00 49.73 ? 81  SER B O     1 
ATOM   3115 C CB    . SER D 2 80  ? -6.813  21.912  -27.745 1.00 43.81 ? 81  SER B CB    1 
ATOM   3116 O OG    . SER D 2 80  ? -5.515  21.328  -27.750 1.00 48.17 ? 81  SER B OG    1 
ATOM   3117 N N     . GLU D 2 81  ? -7.509  18.799  -26.602 1.00 46.90 ? 82  GLU B N     1 
ATOM   3118 C CA    . GLU D 2 81  ? -7.757  17.409  -26.986 1.00 45.78 ? 82  GLU B CA    1 
ATOM   3119 C C     . GLU D 2 81  ? -8.257  16.594  -25.786 1.00 45.20 ? 82  GLU B C     1 
ATOM   3120 O O     . GLU D 2 81  ? -7.562  15.698  -25.299 1.00 45.98 ? 82  GLU B O     1 
ATOM   3121 C CB    . GLU D 2 81  ? -6.461  16.789  -27.516 1.00 49.85 ? 82  GLU B CB    1 
ATOM   3122 C CG    . GLU D 2 81  ? -5.851  17.503  -28.712 1.00 58.57 ? 82  GLU B CG    1 
ATOM   3123 C CD    . GLU D 2 81  ? -6.318  16.932  -30.034 1.00 66.63 ? 82  GLU B CD    1 
ATOM   3124 O OE1   . GLU D 2 81  ? -7.547  16.862  -30.270 1.00 67.80 ? 82  GLU B OE1   1 
ATOM   3125 O OE2   . GLU D 2 81  ? -5.443  16.549  -30.840 1.00 71.70 ? 82  GLU B OE2   1 
ATOM   3126 N N     . PRO D 2 82  ? -9.475  16.878  -25.306 1.00 43.30 ? 83  PRO B N     1 
ATOM   3127 C CA    . PRO D 2 82  ? -10.019 16.152  -24.158 1.00 41.03 ? 83  PRO B CA    1 
ATOM   3128 C C     . PRO D 2 82  ? -10.186 14.644  -24.329 1.00 39.44 ? 83  PRO B C     1 
ATOM   3129 O O     . PRO D 2 82  ? -10.125 13.912  -23.350 1.00 40.96 ? 83  PRO B O     1 
ATOM   3130 C CB    . PRO D 2 82  ? -11.355 16.853  -23.910 1.00 44.02 ? 83  PRO B CB    1 
ATOM   3131 C CG    . PRO D 2 82  ? -11.750 17.314  -25.276 1.00 45.24 ? 83  PRO B CG    1 
ATOM   3132 C CD    . PRO D 2 82  ? -10.448 17.869  -25.794 1.00 43.16 ? 83  PRO B CD    1 
ATOM   3133 N N     . ASN D 2 83  ? -10.392 14.169  -25.552 1.00 34.21 ? 84  ASN B N     1 
ATOM   3134 C CA    . ASN D 2 83  ? -10.582 12.733  -25.749 1.00 32.53 ? 84  ASN B CA    1 
ATOM   3135 C C     . ASN D 2 83  ? -9.324  12.009  -26.187 1.00 28.58 ? 84  ASN B C     1 
ATOM   3136 O O     . ASN D 2 83  ? -9.382  10.921  -26.749 1.00 28.28 ? 84  ASN B O     1 
ATOM   3137 C CB    . ASN D 2 83  ? -11.735 12.459  -26.723 1.00 37.87 ? 84  ASN B CB    1 
ATOM   3138 C CG    . ASN D 2 83  ? -13.059 13.007  -26.218 1.00 45.71 ? 84  ASN B CG    1 
ATOM   3139 O OD1   . ASN D 2 83  ? -13.832 12.304  -25.559 1.00 55.13 ? 84  ASN B OD1   1 
ATOM   3140 N ND2   . ASN D 2 83  ? -13.327 14.273  -26.524 1.00 43.76 ? 84  ASN B ND2   1 
ATOM   3141 N N     . LYS D 2 84  ? -8.177  12.626  -25.926 1.00 27.99 ? 85  LYS B N     1 
ATOM   3142 C CA    . LYS D 2 84  ? -6.890  12.025  -26.252 1.00 28.08 ? 85  LYS B CA    1 
ATOM   3143 C C     . LYS D 2 84  ? -6.013  12.039  -24.997 1.00 26.82 ? 85  LYS B C     1 
ATOM   3144 O O     . LYS D 2 84  ? -4.867  12.499  -25.014 1.00 28.20 ? 85  LYS B O     1 
ATOM   3145 C CB    . LYS D 2 84  ? -6.222  12.770  -27.408 1.00 32.37 ? 85  LYS B CB    1 
ATOM   3146 C CG    . LYS D 2 84  ? -6.920  12.540  -28.739 1.00 41.87 ? 85  LYS B CG    1 
ATOM   3147 C CD    . LYS D 2 84  ? -6.211  13.231  -29.890 1.00 52.83 ? 85  LYS B CD    1 
ATOM   3148 C CE    . LYS D 2 84  ? -6.952  12.975  -31.201 1.00 63.79 ? 85  LYS B CE    1 
ATOM   3149 N NZ    . LYS D 2 84  ? -8.430  13.171  -31.042 1.00 66.74 ? 85  LYS B NZ    1 
ATOM   3150 N N     . LYS D 2 85  ? -6.582  11.528  -23.906 1.00 25.54 ? 86  LYS B N     1 
ATOM   3151 C CA    . LYS D 2 85  ? -5.900  11.461  -22.620 1.00 22.06 ? 86  LYS B CA    1 
ATOM   3152 C C     . LYS D 2 85  ? -4.965  10.264  -22.541 1.00 20.16 ? 86  LYS B C     1 
ATOM   3153 O O     . LYS D 2 85  ? -5.218  9.207   -23.135 1.00 17.57 ? 86  LYS B O     1 
ATOM   3154 C CB    . LYS D 2 85  ? -6.917  11.393  -21.479 1.00 19.60 ? 86  LYS B CB    1 
ATOM   3155 C CG    . LYS D 2 85  ? -7.854  12.580  -21.402 1.00 19.01 ? 86  LYS B CG    1 
ATOM   3156 C CD    . LYS D 2 85  ? -8.492  12.666  -20.030 1.00 21.63 ? 86  LYS B CD    1 
ATOM   3157 C CE    . LYS D 2 85  ? -9.128  14.022  -19.793 1.00 27.66 ? 86  LYS B CE    1 
ATOM   3158 N NZ    . LYS D 2 85  ? -10.449 14.138  -20.452 1.00 23.78 ? 86  LYS B NZ    1 
ATOM   3159 N N     . ILE D 2 86  ? -3.872  10.441  -21.815 1.00 17.72 ? 87  ILE B N     1 
ATOM   3160 C CA    . ILE D 2 86  ? -2.901  9.383   -21.633 1.00 18.44 ? 87  ILE B CA    1 
ATOM   3161 C C     . ILE D 2 86  ? -2.909  9.018   -20.143 1.00 19.06 ? 87  ILE B C     1 
ATOM   3162 O O     . ILE D 2 86  ? -2.880  9.903   -19.285 1.00 18.02 ? 87  ILE B O     1 
ATOM   3163 C CB    . ILE D 2 86  ? -1.506  9.854   -22.061 1.00 19.71 ? 87  ILE B CB    1 
ATOM   3164 C CG1   . ILE D 2 86  ? -1.536  10.267  -23.533 1.00 20.05 ? 87  ILE B CG1   1 
ATOM   3165 C CG2   . ILE D 2 86  ? -0.480  8.755   -21.833 1.00 16.05 ? 87  ILE B CG2   1 
ATOM   3166 C CD1   . ILE D 2 86  ? -0.335  11.048  -23.950 1.00 20.30 ? 87  ILE B CD1   1 
ATOM   3167 N N     . ALA D 2 87  ? -2.967  7.724   -19.845 1.00 19.24 ? 88  ALA B N     1 
ATOM   3168 C CA    . ALA D 2 87  ? -2.970  7.243   -18.465 1.00 18.28 ? 88  ALA B CA    1 
ATOM   3169 C C     . ALA D 2 87  ? -1.611  6.636   -18.172 1.00 18.55 ? 88  ALA B C     1 
ATOM   3170 O O     . ALA D 2 87  ? -1.091  5.853   -18.967 1.00 17.16 ? 88  ALA B O     1 
ATOM   3171 C CB    . ALA D 2 87  ? -4.058  6.202   -18.264 1.00 15.85 ? 88  ALA B CB    1 
ATOM   3172 N N     . ILE D 2 88  ? -1.030  7.010   -17.040 1.00 16.83 ? 89  ILE B N     1 
ATOM   3173 C CA    . ILE D 2 88  ? 0.260   6.479   -16.636 1.00 17.94 ? 89  ILE B CA    1 
ATOM   3174 C C     . ILE D 2 88  ? 0.112   5.898   -15.231 1.00 17.83 ? 89  ILE B C     1 
ATOM   3175 O O     . ILE D 2 88  ? -0.424  6.546   -14.322 1.00 16.75 ? 89  ILE B O     1 
ATOM   3176 C CB    . ILE D 2 88  ? 1.367   7.562   -16.639 1.00 19.38 ? 89  ILE B CB    1 
ATOM   3177 C CG1   . ILE D 2 88  ? 1.447   8.223   -18.016 1.00 23.86 ? 89  ILE B CG1   1 
ATOM   3178 C CG2   . ILE D 2 88  ? 2.714   6.931   -16.298 1.00 20.19 ? 89  ILE B CG2   1 
ATOM   3179 C CD1   . ILE D 2 88  ? 2.557   9.227   -18.132 1.00 26.27 ? 89  ILE B CD1   1 
ATOM   3180 N N     . ASP D 2 89  ? 0.577   4.666   -15.068 1.00 18.22 ? 90  ASP B N     1 
ATOM   3181 C CA    . ASP D 2 89  ? 0.518   3.980   -13.788 1.00 18.75 ? 90  ASP B CA    1 
ATOM   3182 C C     . ASP D 2 89  ? 1.930   3.495   -13.494 1.00 17.27 ? 90  ASP B C     1 
ATOM   3183 O O     . ASP D 2 89  ? 2.612   2.972   -14.381 1.00 16.95 ? 90  ASP B O     1 
ATOM   3184 C CB    . ASP D 2 89  ? -0.442  2.783   -13.877 1.00 19.26 ? 90  ASP B CB    1 
ATOM   3185 C CG    . ASP D 2 89  ? -1.412  2.703   -12.704 1.00 19.88 ? 90  ASP B CG    1 
ATOM   3186 O OD1   . ASP D 2 89  ? -1.753  3.742   -12.102 1.00 20.80 ? 90  ASP B OD1   1 
ATOM   3187 O OD2   . ASP D 2 89  ? -1.845  1.578   -12.387 1.00 22.93 ? 90  ASP B OD2   1 
ATOM   3188 N N     . ILE D 2 90  ? 2.370   3.681   -12.254 1.00 16.44 ? 91  ILE B N     1 
ATOM   3189 C CA    . ILE D 2 90  ? 3.693   3.235   -11.832 1.00 15.94 ? 91  ILE B CA    1 
ATOM   3190 C C     . ILE D 2 90  ? 3.508   1.925   -11.064 1.00 14.60 ? 91  ILE B C     1 
ATOM   3191 O O     . ILE D 2 90  ? 2.711   1.866   -10.123 1.00 14.35 ? 91  ILE B O     1 
ATOM   3192 C CB    . ILE D 2 90  ? 4.380   4.312   -10.965 1.00 18.62 ? 91  ILE B CB    1 
ATOM   3193 C CG1   . ILE D 2 90  ? 4.430   5.628   -11.758 1.00 22.20 ? 91  ILE B CG1   1 
ATOM   3194 C CG2   . ILE D 2 90  ? 5.797   3.860   -10.578 1.00 15.72 ? 91  ILE B CG2   1 
ATOM   3195 C CD1   . ILE D 2 90  ? 4.929   6.792   -10.981 1.00 35.84 ? 91  ILE B CD1   1 
ATOM   3196 N N     . LYS D 2 91  ? 4.234   0.887   -11.484 1.00 15.15 ? 92  LYS B N     1 
ATOM   3197 C CA    . LYS D 2 91  ? 4.157   -0.455  -10.900 1.00 15.11 ? 92  LYS B CA    1 
ATOM   3198 C C     . LYS D 2 91  ? 5.538   -0.895  -10.474 1.00 17.09 ? 92  LYS B C     1 
ATOM   3199 O O     . LYS D 2 91  ? 6.516   -0.667  -11.184 1.00 19.91 ? 92  LYS B O     1 
ATOM   3200 C CB    . LYS D 2 91  ? 3.640   -1.470  -11.924 1.00 18.60 ? 92  LYS B CB    1 
ATOM   3201 C CG    . LYS D 2 91  ? 2.270   -1.172  -12.511 1.00 18.57 ? 92  LYS B CG    1 
ATOM   3202 C CD    . LYS D 2 91  ? 1.209   -1.483  -11.521 1.00 28.83 ? 92  LYS B CD    1 
ATOM   3203 C CE    . LYS D 2 91  ? -0.160  -1.293  -12.083 1.00 23.66 ? 92  LYS B CE    1 
ATOM   3204 N NZ    . LYS D 2 91  ? -1.118  -1.559  -10.991 1.00 35.66 ? 92  LYS B NZ    1 
ATOM   3205 N N     . THR D 2 92  ? 5.613   -1.542  -9.318  1.00 18.01 ? 93  THR B N     1 
ATOM   3206 C CA    . THR D 2 92  ? 6.884   -2.006  -8.770  1.00 18.74 ? 93  THR B CA    1 
ATOM   3207 C C     . THR D 2 92  ? 6.859   -3.493  -8.418  1.00 16.75 ? 93  THR B C     1 
ATOM   3208 O O     . THR D 2 92  ? 5.818   -4.041  -8.059  1.00 17.63 ? 93  THR B O     1 
ATOM   3209 C CB    . THR D 2 92  ? 7.234   -1.203  -7.480  1.00 21.10 ? 93  THR B CB    1 
ATOM   3210 O OG1   . THR D 2 92  ? 7.211   0.201   -7.769  1.00 23.38 ? 93  THR B OG1   1 
ATOM   3211 C CG2   . THR D 2 92  ? 8.609   -1.589  -6.934  1.00 22.30 ? 93  THR B CG2   1 
ATOM   3212 N N     . THR D 2 93  ? 8.010   -4.137  -8.536  1.00 14.71 ? 94  THR B N     1 
ATOM   3213 C CA    . THR D 2 93  ? 8.158   -5.530  -8.165  1.00 16.08 ? 94  THR B CA    1 
ATOM   3214 C C     . THR D 2 93  ? 9.643   -5.726  -7.871  1.00 19.03 ? 94  THR B C     1 
ATOM   3215 O O     . THR D 2 93  ? 10.432  -4.800  -8.061  1.00 20.05 ? 94  THR B O     1 
ATOM   3216 C CB    . THR D 2 93  ? 7.651   -6.507  -9.252  1.00 18.03 ? 94  THR B CB    1 
ATOM   3217 O OG1   . THR D 2 93  ? 7.496   -7.805  -8.660  1.00 18.36 ? 94  THR B OG1   1 
ATOM   3218 C CG2   . THR D 2 93  ? 8.629   -6.599  -10.427 1.00 15.39 ? 94  THR B CG2   1 
ATOM   3219 N N     . TYR D 2 94  ? 10.028  -6.911  -7.414  1.00 21.62 ? 95  TYR B N     1 
ATOM   3220 C CA    . TYR D 2 94  ? 11.418  -7.176  -7.055  1.00 25.89 ? 95  TYR B CA    1 
ATOM   3221 C C     . TYR D 2 94  ? 11.941  -8.461  -7.685  1.00 27.84 ? 95  TYR B C     1 
ATOM   3222 O O     . TYR D 2 94  ? 11.176  -9.235  -8.267  1.00 27.96 ? 95  TYR B O     1 
ATOM   3223 C CB    . TYR D 2 94  ? 11.518  -7.340  -5.525  1.00 29.47 ? 95  TYR B CB    1 
ATOM   3224 C CG    . TYR D 2 94  ? 10.990  -8.691  -5.051  1.00 35.24 ? 95  TYR B CG    1 
ATOM   3225 C CD1   . TYR D 2 94  ? 9.635   -8.879  -4.780  1.00 34.81 ? 95  TYR B CD1   1 
ATOM   3226 C CD2   . TYR D 2 94  ? 11.839  -9.798  -4.953  1.00 38.85 ? 95  TYR B CD2   1 
ATOM   3227 C CE1   . TYR D 2 94  ? 9.136   -10.134 -4.433  1.00 38.84 ? 95  TYR B CE1   1 
ATOM   3228 C CE2   . TYR D 2 94  ? 11.356  -11.053 -4.609  1.00 42.24 ? 95  TYR B CE2   1 
ATOM   3229 C CZ    . TYR D 2 94  ? 10.005  -11.216 -4.353  1.00 44.29 ? 95  TYR B CZ    1 
ATOM   3230 O OH    . TYR D 2 94  ? 9.531   -12.466 -4.039  1.00 41.43 ? 95  TYR B OH    1 
ATOM   3231 N N     . THR D 2 95  ? 13.253  -8.660  -7.549  1.00 31.34 ? 96  THR B N     1 
ATOM   3232 C CA    . THR D 2 95  ? 13.972  -9.868  -7.972  1.00 38.33 ? 96  THR B CA    1 
ATOM   3233 C C     . THR D 2 95  ? 14.983  -10.101 -6.859  1.00 42.70 ? 96  THR B C     1 
ATOM   3234 O O     . THR D 2 95  ? 15.446  -9.144  -6.226  1.00 40.36 ? 96  THR B O     1 
ATOM   3235 C CB    . THR D 2 95  ? 14.807  -9.717  -9.263  1.00 40.76 ? 96  THR B CB    1 
ATOM   3236 O OG1   . THR D 2 95  ? 15.368  -8.400  -9.344  1.00 48.88 ? 96  THR B OG1   1 
ATOM   3237 C CG2   . THR D 2 95  ? 13.991  -10.045 -10.477 1.00 44.16 ? 96  THR B CG2   1 
ATOM   3238 N N     . ASN D 2 96  ? 15.314  -11.366 -6.610  1.00 47.07 ? 97  ASN B N     1 
ATOM   3239 C CA    . ASN D 2 96  ? 16.307  -11.709 -5.583  1.00 49.67 ? 97  ASN B CA    1 
ATOM   3240 C C     . ASN D 2 96  ? 17.673  -11.682 -6.271  1.00 53.24 ? 97  ASN B C     1 
ATOM   3241 O O     . ASN D 2 96  ? 18.685  -11.331 -5.663  1.00 52.97 ? 97  ASN B O     1 
ATOM   3242 C CB    . ASN D 2 96  ? 16.035  -13.094 -5.000  1.00 48.04 ? 97  ASN B CB    1 
ATOM   3243 C CG    . ASN D 2 96  ? 14.694  -13.172 -4.280  1.00 54.25 ? 97  ASN B CG    1 
ATOM   3244 O OD1   . ASN D 2 96  ? 14.472  -12.496 -3.278  1.00 53.42 ? 97  ASN B OD1   1 
ATOM   3245 N ND2   . ASN D 2 96  ? 13.792  -14.004 -4.792  1.00 56.92 ? 97  ASN B ND2   1 
ATOM   3246 N N     . LYS D 2 97  ? 17.675  -12.066 -7.546  1.00 56.84 ? 98  LYS B N     1 
ATOM   3247 C CA    . LYS D 2 97  ? 18.874  -12.082 -8.379  1.00 61.87 ? 98  LYS B CA    1 
ATOM   3248 C C     . LYS D 2 97  ? 18.536  -11.324 -9.655  1.00 64.02 ? 98  LYS B C     1 
ATOM   3249 O O     . LYS D 2 97  ? 17.388  -11.335 -10.094 1.00 63.86 ? 98  LYS B O     1 
ATOM   3250 C CB    . LYS D 2 97  ? 19.257  -13.530 -8.729  1.00 67.91 ? 98  LYS B CB    1 
ATOM   3251 C CG    . LYS D 2 97  ? 19.644  -14.357 -7.524  1.00 73.36 ? 98  LYS B CG    1 
ATOM   3252 C CD    . LYS D 2 97  ? 19.926  -15.805 -7.889  1.00 80.40 ? 98  LYS B CD    1 
ATOM   3253 C CE    . LYS D 2 97  ? 20.304  -16.613 -6.645  1.00 85.61 ? 98  LYS B CE    1 
ATOM   3254 N NZ    . LYS D 2 97  ? 20.731  -18.010 -6.961  1.00 85.67 ? 98  LYS B NZ    1 
ATOM   3255 N N     . GLU D 2 98  ? 19.536  -10.688 -10.250 1.00 66.48 ? 99  GLU B N     1 
ATOM   3256 C CA    . GLU D 2 98  ? 19.361  -9.881  -11.457 1.00 69.76 ? 99  GLU B CA    1 
ATOM   3257 C C     . GLU D 2 98  ? 18.645  -10.481 -12.672 1.00 69.67 ? 99  GLU B C     1 
ATOM   3258 O O     . GLU D 2 98  ? 17.791  -9.817  -13.273 1.00 71.22 ? 99  GLU B O     1 
ATOM   3259 C CB    . GLU D 2 98  ? 20.719  -9.317  -11.897 1.00 74.12 ? 99  GLU B CB    1 
ATOM   3260 C CG    . GLU D 2 98  ? 21.460  -8.524  -10.827 1.00 82.39 ? 99  GLU B CG    1 
ATOM   3261 C CD    . GLU D 2 98  ? 20.735  -7.248  -10.373 1.00 88.99 ? 99  GLU B CD    1 
ATOM   3262 O OE1   . GLU D 2 98  ? 19.691  -6.855  -10.960 1.00 92.08 ? 99  GLU B OE1   1 
ATOM   3263 O OE2   . GLU D 2 98  ? 21.238  -6.631  -9.406  1.00 89.35 ? 99  GLU B OE2   1 
ATOM   3264 N N     . ASN D 2 99  ? 18.970  -11.720 -13.036 1.00 68.02 ? 100 ASN B N     1 
ATOM   3265 C CA    . ASN D 2 99  ? 18.383  -12.346 -14.226 1.00 67.36 ? 100 ASN B CA    1 
ATOM   3266 C C     . ASN D 2 99  ? 17.191  -13.297 -14.038 1.00 65.63 ? 100 ASN B C     1 
ATOM   3267 O O     . ASN D 2 99  ? 16.995  -14.223 -14.837 1.00 66.91 ? 100 ASN B O     1 
ATOM   3268 C CB    . ASN D 2 99  ? 19.482  -13.067 -15.026 1.00 72.24 ? 100 ASN B CB    1 
ATOM   3269 C CG    . ASN D 2 99  ? 20.611  -12.138 -15.445 1.00 76.88 ? 100 ASN B CG    1 
ATOM   3270 O OD1   . ASN D 2 99  ? 20.375  -11.002 -15.859 1.00 78.39 ? 100 ASN B OD1   1 
ATOM   3271 N ND2   . ASN D 2 99  ? 21.849  -12.618 -15.338 1.00 77.17 ? 100 ASN B ND2   1 
ATOM   3272 N N     . GLU D 2 100 ? 16.393  -13.064 -13.002 1.00 61.47 ? 101 GLU B N     1 
ATOM   3273 C CA    . GLU D 2 100 ? 15.217  -13.900 -12.748 1.00 56.37 ? 101 GLU B CA    1 
ATOM   3274 C C     . GLU D 2 100 ? 14.025  -13.341 -13.525 1.00 51.82 ? 101 GLU B C     1 
ATOM   3275 O O     . GLU D 2 100 ? 14.077  -12.226 -14.051 1.00 49.82 ? 101 GLU B O     1 
ATOM   3276 C CB    . GLU D 2 100 ? 14.875  -13.905 -11.250 1.00 59.65 ? 101 GLU B CB    1 
ATOM   3277 C CG    . GLU D 2 100 ? 15.894  -14.572 -10.337 1.00 64.98 ? 101 GLU B CG    1 
ATOM   3278 C CD    . GLU D 2 100 ? 15.502  -14.507 -8.860  1.00 71.80 ? 101 GLU B CD    1 
ATOM   3279 O OE1   . GLU D 2 100 ? 14.537  -13.785 -8.518  1.00 72.62 ? 101 GLU B OE1   1 
ATOM   3280 O OE2   . GLU D 2 100 ? 16.162  -15.180 -8.036  1.00 76.07 ? 101 GLU B OE2   1 
ATOM   3281 N N     . LYS D 2 101 ? 12.956  -14.124 -13.599 1.00 47.58 ? 102 LYS B N     1 
ATOM   3282 C CA    . LYS D 2 101 ? 11.745  -13.674 -14.276 1.00 41.82 ? 102 LYS B CA    1 
ATOM   3283 C C     . LYS D 2 101 ? 10.936  -12.867 -13.265 1.00 38.43 ? 102 LYS B C     1 
ATOM   3284 O O     . LYS D 2 101 ? 10.962  -13.152 -12.059 1.00 36.82 ? 102 LYS B O     1 
ATOM   3285 C CB    . LYS D 2 101 ? 10.919  -14.866 -14.763 1.00 43.15 ? 102 LYS B CB    1 
ATOM   3286 C CG    . LYS D 2 101 ? 11.529  -15.617 -15.936 1.00 50.18 ? 102 LYS B CG    1 
ATOM   3287 C CD    . LYS D 2 101 ? 10.597  -16.719 -16.417 1.00 53.82 ? 102 LYS B CD    1 
ATOM   3288 C CE    . LYS D 2 101 ? 11.126  -17.395 -17.676 1.00 58.91 ? 102 LYS B CE    1 
ATOM   3289 N NZ    . LYS D 2 101 ? 10.129  -18.353 -18.241 1.00 57.52 ? 102 LYS B NZ    1 
ATOM   3290 N N     . ILE D 2 102 ? 10.226  -11.859 -13.755 1.00 34.21 ? 103 ILE B N     1 
ATOM   3291 C CA    . ILE D 2 102 ? 9.402   -11.004 -12.901 1.00 29.73 ? 103 ILE B CA    1 
ATOM   3292 C C     . ILE D 2 102 ? 7.988   -10.974 -13.463 1.00 25.99 ? 103 ILE B C     1 
ATOM   3293 O O     . ILE D 2 102 ? 7.726   -11.502 -14.544 1.00 23.74 ? 103 ILE B O     1 
ATOM   3294 C CB    . ILE D 2 102 ? 9.959   -9.550  -12.842 1.00 30.60 ? 103 ILE B CB    1 
ATOM   3295 C CG1   . ILE D 2 102 ? 9.991   -8.929  -14.239 1.00 31.37 ? 103 ILE B CG1   1 
ATOM   3296 C CG2   . ILE D 2 102 ? 11.362  -9.554  -12.287 1.00 27.79 ? 103 ILE B CG2   1 
ATOM   3297 C CD1   . ILE D 2 102 ? 10.682  -7.589  -14.303 1.00 32.85 ? 103 ILE B CD1   1 
ATOM   3298 N N     . LYS D 2 103 ? 7.076   -10.374 -12.723 1.00 22.41 ? 104 LYS B N     1 
ATOM   3299 C CA    . LYS D 2 103 ? 5.703   -10.245 -13.170 1.00 23.43 ? 104 LYS B CA    1 
ATOM   3300 C C     . LYS D 2 103 ? 5.090   -9.095  -12.392 1.00 21.79 ? 104 LYS B C     1 
ATOM   3301 O O     . LYS D 2 103 ? 5.540   -8.778  -11.287 1.00 22.35 ? 104 LYS B O     1 
ATOM   3302 C CB    . LYS D 2 103 ? 4.911   -11.546 -12.958 1.00 24.93 ? 104 LYS B CB    1 
ATOM   3303 C CG    . LYS D 2 103 ? 4.849   -12.042 -11.531 1.00 37.49 ? 104 LYS B CG    1 
ATOM   3304 C CD    . LYS D 2 103 ? 4.036   -13.324 -11.420 1.00 47.49 ? 104 LYS B CD    1 
ATOM   3305 C CE    . LYS D 2 103 ? 4.216   -13.949 -10.035 1.00 55.38 ? 104 LYS B CE    1 
ATOM   3306 N NZ    . LYS D 2 103 ? 3.435   -15.207 -9.851  1.00 60.71 ? 104 LYS B NZ    1 
ATOM   3307 N N     . PHE D 2 104 ? 4.078   -8.468  -12.981 1.00 19.00 ? 105 PHE B N     1 
ATOM   3308 C CA    . PHE D 2 104 ? 3.392   -7.343  -12.376 1.00 15.55 ? 105 PHE B CA    1 
ATOM   3309 C C     . PHE D 2 104 ? 1.892   -7.599  -12.317 1.00 17.38 ? 105 PHE B C     1 
ATOM   3310 O O     . PHE D 2 104 ? 1.353   -8.468  -13.024 1.00 17.09 ? 105 PHE B O     1 
ATOM   3311 C CB    . PHE D 2 104 ? 3.605   -6.066  -13.213 1.00 12.87 ? 105 PHE B CB    1 
ATOM   3312 C CG    . PHE D 2 104 ? 5.029   -5.597  -13.282 1.00 16.50 ? 105 PHE B CG    1 
ATOM   3313 C CD1   . PHE D 2 104 ? 5.902   -6.113  -14.233 1.00 14.85 ? 105 PHE B CD1   1 
ATOM   3314 C CD2   . PHE D 2 104 ? 5.500   -4.633  -12.390 1.00 21.02 ? 105 PHE B CD2   1 
ATOM   3315 C CE1   . PHE D 2 104 ? 7.226   -5.679  -14.296 1.00 17.89 ? 105 PHE B CE1   1 
ATOM   3316 C CE2   . PHE D 2 104 ? 6.820   -4.191  -12.443 1.00 16.31 ? 105 PHE B CE2   1 
ATOM   3317 C CZ    . PHE D 2 104 ? 7.687   -4.716  -13.399 1.00 22.03 ? 105 PHE B CZ    1 
ATOM   3318 N N     . THR D 2 105 ? 1.226   -6.835  -11.459 1.00 16.24 ? 106 THR B N     1 
ATOM   3319 C CA    . THR D 2 105 ? -0.221  -6.862  -11.361 1.00 20.18 ? 106 THR B CA    1 
ATOM   3320 C C     . THR D 2 105 ? -0.488  -5.610  -12.198 1.00 19.18 ? 106 THR B C     1 
ATOM   3321 O O     . THR D 2 105 ? 0.148   -4.577  -11.985 1.00 20.47 ? 106 THR B O     1 
ATOM   3322 C CB    . THR D 2 105 ? -0.720  -6.715  -9.903  1.00 20.96 ? 106 THR B CB    1 
ATOM   3323 O OG1   . THR D 2 105 ? -0.022  -5.653  -9.239  1.00 24.29 ? 106 THR B OG1   1 
ATOM   3324 C CG2   . THR D 2 105 ? -0.501  -8.017  -9.148  1.00 19.12 ? 106 THR B CG2   1 
ATOM   3325 N N     . LEU D 2 106 ? -1.402  -5.704  -13.156 1.00 18.03 ? 107 LEU B N     1 
ATOM   3326 C CA    . LEU D 2 106 ? -1.676  -4.588  -14.054 1.00 18.23 ? 107 LEU B CA    1 
ATOM   3327 C C     . LEU D 2 106 ? -3.035  -3.923  -13.877 1.00 19.35 ? 107 LEU B C     1 
ATOM   3328 O O     . LEU D 2 106 ? -3.575  -3.356  -14.819 1.00 21.71 ? 107 LEU B O     1 
ATOM   3329 C CB    . LEU D 2 106 ? -1.498  -5.048  -15.518 1.00 17.28 ? 107 LEU B CB    1 
ATOM   3330 C CG    . LEU D 2 106 ? -0.104  -5.572  -15.890 1.00 19.71 ? 107 LEU B CG    1 
ATOM   3331 C CD1   . LEU D 2 106 ? -0.090  -6.069  -17.332 1.00 17.86 ? 107 LEU B CD1   1 
ATOM   3332 C CD2   . LEU D 2 106 ? 0.941   -4.468  -15.685 1.00 16.45 ? 107 LEU B CD2   1 
ATOM   3333 N N     . GLY D 2 107 ? -3.591  -3.986  -12.674 1.00 19.66 ? 108 GLY B N     1 
ATOM   3334 C CA    . GLY D 2 107 ? -4.877  -3.353  -12.443 1.00 18.38 ? 108 GLY B CA    1 
ATOM   3335 C C     . GLY D 2 107 ? -6.049  -4.310  -12.478 1.00 18.37 ? 108 GLY B C     1 
ATOM   3336 O O     . GLY D 2 107 ? -5.943  -5.423  -12.987 1.00 16.81 ? 108 GLY B O     1 
ATOM   3337 N N     . GLY D 2 108 ? -7.175  -3.866  -11.938 1.00 16.65 ? 109 GLY B N     1 
ATOM   3338 C CA    . GLY D 2 108 ? -8.347  -4.709  -11.889 1.00 18.44 ? 109 GLY B CA    1 
ATOM   3339 C C     . GLY D 2 108 ? -8.936  -5.032  -13.249 1.00 20.39 ? 109 GLY B C     1 
ATOM   3340 O O     . GLY D 2 108 ? -8.771  -4.271  -14.208 1.00 19.34 ? 109 GLY B O     1 
ATOM   3341 N N     . TYR D 2 109 ? -9.621  -6.165  -13.348 1.00 16.50 ? 110 TYR B N     1 
ATOM   3342 C CA    . TYR D 2 109 ? -10.253 -6.510  -14.607 1.00 15.85 ? 110 TYR B CA    1 
ATOM   3343 C C     . TYR D 2 109 ? -11.769 -6.436  -14.502 1.00 16.86 ? 110 TYR B C     1 
ATOM   3344 O O     . TYR D 2 109 ? -12.478 -6.747  -15.459 1.00 16.14 ? 110 TYR B O     1 
ATOM   3345 C CB    . TYR D 2 109 ? -9.768  -7.870  -15.133 1.00 15.27 ? 110 TYR B CB    1 
ATOM   3346 C CG    . TYR D 2 109 ? -10.010 -9.076  -14.251 1.00 18.98 ? 110 TYR B CG    1 
ATOM   3347 C CD1   . TYR D 2 109 ? -11.283 -9.650  -14.148 1.00 21.23 ? 110 TYR B CD1   1 
ATOM   3348 C CD2   . TYR D 2 109 ? -8.957  -9.672  -13.551 1.00 14.41 ? 110 TYR B CD2   1 
ATOM   3349 C CE1   . TYR D 2 109 ? -11.502 -10.794 -13.371 1.00 21.21 ? 110 TYR B CE1   1 
ATOM   3350 C CE2   . TYR D 2 109 ? -9.162  -10.817 -12.770 1.00 16.64 ? 110 TYR B CE2   1 
ATOM   3351 C CZ    . TYR D 2 109 ? -10.440 -11.369 -12.689 1.00 23.36 ? 110 TYR B CZ    1 
ATOM   3352 O OH    . TYR D 2 109 ? -10.661 -12.496 -11.934 1.00 22.45 ? 110 TYR B OH    1 
ATOM   3353 N N     . THR D 2 110 ? -12.271 -6.010  -13.341 1.00 15.20 ? 111 THR B N     1 
ATOM   3354 C CA    . THR D 2 110 ? -13.712 -5.883  -13.141 1.00 16.92 ? 111 THR B CA    1 
ATOM   3355 C C     . THR D 2 110 ? -14.155 -4.436  -12.908 1.00 17.29 ? 111 THR B C     1 
ATOM   3356 O O     . THR D 2 110 ? -15.344 -4.181  -12.709 1.00 18.08 ? 111 THR B O     1 
ATOM   3357 C CB    . THR D 2 110 ? -14.212 -6.741  -11.945 1.00 21.75 ? 111 THR B CB    1 
ATOM   3358 O OG1   . THR D 2 110 ? -13.631 -6.253  -10.730 1.00 22.31 ? 111 THR B OG1   1 
ATOM   3359 C CG2   . THR D 2 110 ? -13.815 -8.207  -12.121 1.00 20.56 ? 111 THR B CG2   1 
ATOM   3360 N N     . SER D 2 111 ? -13.214 -3.492  -12.924 1.00 16.60 ? 112 SER B N     1 
ATOM   3361 C CA    . SER D 2 111 ? -13.566 -2.087  -12.706 1.00 19.03 ? 112 SER B CA    1 
ATOM   3362 C C     . SER D 2 111 ? -13.801 -1.296  -14.015 1.00 22.11 ? 112 SER B C     1 
ATOM   3363 O O     . SER D 2 111 ? -14.734 -1.607  -14.762 1.00 19.36 ? 112 SER B O     1 
ATOM   3364 C CB    . SER D 2 111 ? -12.515 -1.401  -11.827 1.00 15.88 ? 112 SER B CB    1 
ATOM   3365 O OG    . SER D 2 111 ? -11.214 -1.592  -12.353 1.00 20.92 ? 112 SER B OG    1 
ATOM   3366 N N     . PHE D 2 112 ? -12.964 -0.298  -14.305 1.00 19.61 ? 113 PHE B N     1 
ATOM   3367 C CA    . PHE D 2 112 ? -13.137 0.531   -15.500 1.00 20.98 ? 113 PHE B CA    1 
ATOM   3368 C C     . PHE D 2 112 ? -13.152 -0.159  -16.867 1.00 23.25 ? 113 PHE B C     1 
ATOM   3369 O O     . PHE D 2 112 ? -13.736 0.380   -17.809 1.00 22.58 ? 113 PHE B O     1 
ATOM   3370 C CB    . PHE D 2 112 ? -12.129 1.699   -15.523 1.00 16.89 ? 113 PHE B CB    1 
ATOM   3371 C CG    . PHE D 2 112 ? -10.708 1.288   -15.272 1.00 16.21 ? 113 PHE B CG    1 
ATOM   3372 C CD1   . PHE D 2 112 ? -9.906  0.836   -16.313 1.00 12.69 ? 113 PHE B CD1   1 
ATOM   3373 C CD2   . PHE D 2 112 ? -10.173 1.340   -13.986 1.00 14.93 ? 113 PHE B CD2   1 
ATOM   3374 C CE1   . PHE D 2 112 ? -8.595  0.437   -16.079 1.00 16.13 ? 113 PHE B CE1   1 
ATOM   3375 C CE2   . PHE D 2 112 ? -8.860  0.942   -13.742 1.00 15.63 ? 113 PHE B CE2   1 
ATOM   3376 C CZ    . PHE D 2 112 ? -8.071  0.490   -14.791 1.00 20.45 ? 113 PHE B CZ    1 
ATOM   3377 N N     . ILE D 2 113 ? -12.530 -1.329  -17.007 1.00 23.83 ? 114 ILE B N     1 
ATOM   3378 C CA    . ILE D 2 113 ? -12.570 -1.979  -18.314 1.00 24.05 ? 114 ILE B CA    1 
ATOM   3379 C C     . ILE D 2 113 ? -13.941 -2.609  -18.577 1.00 24.77 ? 114 ILE B C     1 
ATOM   3380 O O     . ILE D 2 113 ? -14.253 -2.927  -19.708 1.00 25.28 ? 114 ILE B O     1 
ATOM   3381 C CB    . ILE D 2 113 ? -11.431 -3.031  -18.537 1.00 26.60 ? 114 ILE B CB    1 
ATOM   3382 C CG1   . ILE D 2 113 ? -11.694 -4.315  -17.756 1.00 20.64 ? 114 ILE B CG1   1 
ATOM   3383 C CG2   . ILE D 2 113 ? -10.077 -2.437  -18.168 1.00 23.45 ? 114 ILE B CG2   1 
ATOM   3384 C CD1   . ILE D 2 113 ? -10.760 -5.428  -18.152 1.00 20.58 ? 114 ILE B CD1   1 
ATOM   3385 N N     . ARG D 2 114 ? -14.760 -2.788  -17.541 1.00 23.09 ? 115 ARG B N     1 
ATOM   3386 C CA    . ARG D 2 114 ? -16.095 -3.357  -17.727 1.00 23.56 ? 115 ARG B CA    1 
ATOM   3387 C C     . ARG D 2 114 ? -17.171 -2.308  -17.504 1.00 27.11 ? 115 ARG B C     1 
ATOM   3388 O O     . ARG D 2 114 ? -18.300 -2.447  -17.971 1.00 29.52 ? 115 ARG B O     1 
ATOM   3389 C CB    . ARG D 2 114 ? -16.337 -4.524  -16.778 1.00 20.42 ? 115 ARG B CB    1 
ATOM   3390 C CG    . ARG D 2 114 ? -15.425 -5.688  -17.018 1.00 16.84 ? 115 ARG B CG    1 
ATOM   3391 C CD    . ARG D 2 114 ? -15.836 -6.916  -16.213 1.00 20.03 ? 115 ARG B CD    1 
ATOM   3392 N NE    . ARG D 2 114 ? -14.808 -7.947  -16.351 1.00 16.24 ? 115 ARG B NE    1 
ATOM   3393 C CZ    . ARG D 2 114 ? -15.017 -9.252  -16.239 1.00 17.90 ? 115 ARG B CZ    1 
ATOM   3394 N NH1   . ARG D 2 114 ? -16.230 -9.723  -15.964 1.00 17.23 ? 115 ARG B NH1   1 
ATOM   3395 N NH2   . ARG D 2 114 ? -14.001 -10.089 -16.402 1.00 13.48 ? 115 ARG B NH2   1 
ATOM   3396 N N     . ASN D 2 115 ? -16.816 -1.259  -16.778 1.00 29.71 ? 116 ASN B N     1 
ATOM   3397 C CA    . ASN D 2 115 ? -17.736 -0.170  -16.484 1.00 32.43 ? 116 ASN B CA    1 
ATOM   3398 C C     . ASN D 2 115 ? -16.967 1.142   -16.672 1.00 32.40 ? 116 ASN B C     1 
ATOM   3399 O O     . ASN D 2 115 ? -16.156 1.548   -15.827 1.00 33.61 ? 116 ASN B O     1 
ATOM   3400 C CB    . ASN D 2 115 ? -18.264 -0.298  -15.056 1.00 35.73 ? 116 ASN B CB    1 
ATOM   3401 C CG    . ASN D 2 115 ? -19.206 0.828   -14.681 1.00 48.64 ? 116 ASN B CG    1 
ATOM   3402 O OD1   . ASN D 2 115 ? -19.220 1.893   -15.310 1.00 51.84 ? 116 ASN B OD1   1 
ATOM   3403 N ND2   . ASN D 2 115 ? -20.000 0.603   -13.647 1.00 53.46 ? 116 ASN B ND2   1 
ATOM   3404 N N     . ASN D 2 116 ? -17.249 1.788   -17.796 1.00 29.67 ? 117 ASN B N     1 
ATOM   3405 C CA    . ASN D 2 116 ? -16.625 3.039   -18.233 1.00 28.88 ? 117 ASN B CA    1 
ATOM   3406 C C     . ASN D 2 116 ? -16.221 4.102   -17.191 1.00 27.41 ? 117 ASN B C     1 
ATOM   3407 O O     . ASN D 2 116 ? -15.209 4.783   -17.368 1.00 24.33 ? 117 ASN B O     1 
ATOM   3408 C CB    . ASN D 2 116 ? -17.537 3.685   -19.284 1.00 31.79 ? 117 ASN B CB    1 
ATOM   3409 C CG    . ASN D 2 116 ? -16.814 4.677   -20.169 1.00 32.91 ? 117 ASN B CG    1 
ATOM   3410 O OD1   . ASN D 2 116 ? -15.706 4.419   -20.642 1.00 38.66 ? 117 ASN B OD1   1 
ATOM   3411 N ND2   . ASN D 2 116 ? -17.444 5.822   -20.407 1.00 32.36 ? 117 ASN B ND2   1 
ATOM   3412 N N     . THR D 2 117 ? -16.997 4.250   -16.121 1.00 25.94 ? 118 THR B N     1 
ATOM   3413 C CA    . THR D 2 117 ? -16.709 5.271   -15.120 1.00 25.58 ? 118 THR B CA    1 
ATOM   3414 C C     . THR D 2 117 ? -16.327 4.769   -13.728 1.00 25.49 ? 118 THR B C     1 
ATOM   3415 O O     . THR D 2 117 ? -16.117 5.573   -12.821 1.00 26.72 ? 118 THR B O     1 
ATOM   3416 C CB    . THR D 2 117 ? -17.912 6.221   -14.979 1.00 26.28 ? 118 THR B CB    1 
ATOM   3417 O OG1   . THR D 2 117 ? -19.110 5.451   -14.842 1.00 34.04 ? 118 THR B OG1   1 
ATOM   3418 C CG2   . THR D 2 117 ? -18.051 7.099   -16.204 1.00 29.35 ? 118 THR B CG2   1 
ATOM   3419 N N     . LYS D 2 118 ? -16.227 3.455   -13.558 1.00 24.82 ? 119 LYS B N     1 
ATOM   3420 C CA    . LYS D 2 118 ? -15.904 2.867   -12.259 1.00 26.13 ? 119 LYS B CA    1 
ATOM   3421 C C     . LYS D 2 118 ? -14.431 2.939   -11.845 1.00 23.84 ? 119 LYS B C     1 
ATOM   3422 O O     . LYS D 2 118 ? -13.561 2.349   -12.499 1.00 21.81 ? 119 LYS B O     1 
ATOM   3423 C CB    . LYS D 2 118 ? -16.362 1.400   -12.202 1.00 33.87 ? 119 LYS B CB    1 
ATOM   3424 C CG    . LYS D 2 118 ? -16.253 0.784   -10.807 1.00 43.68 ? 119 LYS B CG    1 
ATOM   3425 C CD    . LYS D 2 118 ? -16.245 -0.728  -10.827 1.00 49.98 ? 119 LYS B CD    1 
ATOM   3426 C CE    . LYS D 2 118 ? -17.555 -1.289  -11.345 1.00 57.62 ? 119 LYS B CE    1 
ATOM   3427 N NZ    . LYS D 2 118 ? -17.557 -2.781  -11.328 1.00 56.00 ? 119 LYS B NZ    1 
ATOM   3428 N N     . ASN D 2 119 ? -14.169 3.658   -10.752 1.00 21.84 ? 120 ASN B N     1 
ATOM   3429 C CA    . ASN D 2 119 ? -12.823 3.802   -10.180 1.00 22.59 ? 120 ASN B CA    1 
ATOM   3430 C C     . ASN D 2 119 ? -11.761 4.354   -11.128 1.00 20.69 ? 120 ASN B C     1 
ATOM   3431 O O     . ASN D 2 119 ? -10.607 3.914   -11.111 1.00 18.35 ? 120 ASN B O     1 
ATOM   3432 C CB    . ASN D 2 119 ? -12.342 2.458   -9.604  1.00 23.55 ? 120 ASN B CB    1 
ATOM   3433 C CG    . ASN D 2 119 ? -13.132 2.033   -8.378  1.00 30.89 ? 120 ASN B CG    1 
ATOM   3434 O OD1   . ASN D 2 119 ? -14.137 1.326   -8.483  1.00 29.76 ? 120 ASN B OD1   1 
ATOM   3435 N ND2   . ASN D 2 119 ? -12.682 2.464   -7.209  1.00 25.64 ? 120 ASN B ND2   1 
ATOM   3436 N N     . ILE D 2 120 ? -12.149 5.324   -11.946 1.00 18.96 ? 121 ILE B N     1 
ATOM   3437 C CA    . ILE D 2 120 ? -11.223 5.922   -12.900 1.00 20.05 ? 121 ILE B CA    1 
ATOM   3438 C C     . ILE D 2 120 ? -11.450 7.435   -12.848 1.00 19.20 ? 121 ILE B C     1 
ATOM   3439 O O     . ILE D 2 120 ? -12.585 7.883   -12.672 1.00 18.68 ? 121 ILE B O     1 
ATOM   3440 C CB    . ILE D 2 120 ? -11.427 5.293   -14.324 1.00 14.57 ? 121 ILE B CB    1 
ATOM   3441 C CG1   . ILE D 2 120 ? -10.360 5.803   -15.295 1.00 16.82 ? 121 ILE B CG1   1 
ATOM   3442 C CG2   . ILE D 2 120 ? -12.847 5.528   -14.819 1.00 14.66 ? 121 ILE B CG2   1 
ATOM   3443 C CD1   . ILE D 2 120 ? -10.255 4.977   -16.586 1.00 12.56 ? 121 ILE B CD1   1 
ATOM   3444 N N     . VAL D 2 121 ? -10.379 8.218   -12.967 1.00 20.08 ? 122 VAL B N     1 
ATOM   3445 C CA    . VAL D 2 121 ? -10.492 9.680   -12.880 1.00 21.77 ? 122 VAL B CA    1 
ATOM   3446 C C     . VAL D 2 121 ? -11.421 10.270  -13.937 1.00 21.78 ? 122 VAL B C     1 
ATOM   3447 O O     . VAL D 2 121 ? -12.273 11.104  -13.617 1.00 20.41 ? 122 VAL B O     1 
ATOM   3448 C CB    . VAL D 2 121 ? -9.102  10.353  -12.932 1.00 25.39 ? 122 VAL B CB    1 
ATOM   3449 C CG1   . VAL D 2 121 ? -9.238  11.865  -12.820 1.00 19.26 ? 122 VAL B CG1   1 
ATOM   3450 C CG2   . VAL D 2 121 ? -8.236  9.818   -11.799 1.00 23.81 ? 122 VAL B CG2   1 
ATOM   3451 N N     . TYR D 2 122 ? -11.248 9.831   -15.186 1.00 22.04 ? 123 TYR B N     1 
ATOM   3452 C CA    . TYR D 2 122 ? -12.087 10.249  -16.317 1.00 20.73 ? 123 TYR B CA    1 
ATOM   3453 C C     . TYR D 2 122 ? -12.634 8.977   -16.959 1.00 20.18 ? 123 TYR B C     1 
ATOM   3454 O O     . TYR D 2 122 ? -12.045 7.909   -16.806 1.00 18.21 ? 123 TYR B O     1 
ATOM   3455 C CB    . TYR D 2 122 ? -11.261 11.012  -17.361 1.00 20.64 ? 123 TYR B CB    1 
ATOM   3456 C CG    . TYR D 2 122 ? -10.902 12.411  -16.941 1.00 20.96 ? 123 TYR B CG    1 
ATOM   3457 C CD1   . TYR D 2 122 ? -11.820 13.443  -17.081 1.00 22.02 ? 123 TYR B CD1   1 
ATOM   3458 C CD2   . TYR D 2 122 ? -9.647  12.705  -16.392 1.00 20.05 ? 123 TYR B CD2   1 
ATOM   3459 C CE1   . TYR D 2 122 ? -11.517 14.725  -16.690 1.00 25.88 ? 123 TYR B CE1   1 
ATOM   3460 C CE2   . TYR D 2 122 ? -9.331  13.997  -15.994 1.00 19.50 ? 123 TYR B CE2   1 
ATOM   3461 C CZ    . TYR D 2 122 ? -10.280 15.001  -16.150 1.00 26.28 ? 123 TYR B CZ    1 
ATOM   3462 O OH    . TYR D 2 122 ? -10.016 16.289  -15.765 1.00 32.11 ? 123 TYR B OH    1 
ATOM   3463 N N     . PRO D 2 123 ? -13.776 9.063   -17.667 1.00 22.17 ? 124 PRO B N     1 
ATOM   3464 C CA    . PRO D 2 123 ? -14.338 7.868   -18.317 1.00 23.16 ? 124 PRO B CA    1 
ATOM   3465 C C     . PRO D 2 123 ? -13.265 7.149   -19.163 1.00 21.99 ? 124 PRO B C     1 
ATOM   3466 O O     . PRO D 2 123 ? -12.483 7.799   -19.869 1.00 22.67 ? 124 PRO B O     1 
ATOM   3467 C CB    . PRO D 2 123 ? -15.463 8.450   -19.176 1.00 19.78 ? 124 PRO B CB    1 
ATOM   3468 C CG    . PRO D 2 123 ? -15.944 9.596   -18.339 1.00 23.86 ? 124 PRO B CG    1 
ATOM   3469 C CD    . PRO D 2 123 ? -14.637 10.238  -17.894 1.00 21.77 ? 124 PRO B CD    1 
ATOM   3470 N N     . PHE D 2 124 ? -13.239 5.820   -19.088 1.00 19.21 ? 125 PHE B N     1 
ATOM   3471 C CA    . PHE D 2 124 ? -12.262 5.002   -19.803 1.00 20.79 ? 125 PHE B CA    1 
ATOM   3472 C C     . PHE D 2 124 ? -12.131 5.323   -21.292 1.00 22.05 ? 125 PHE B C     1 
ATOM   3473 O O     . PHE D 2 124 ? -11.032 5.270   -21.839 1.00 21.72 ? 125 PHE B O     1 
ATOM   3474 C CB    . PHE D 2 124 ? -12.602 3.516   -19.618 1.00 20.67 ? 125 PHE B CB    1 
ATOM   3475 C CG    . PHE D 2 124 ? -11.566 2.565   -20.175 1.00 17.72 ? 125 PHE B CG    1 
ATOM   3476 C CD1   . PHE D 2 124 ? -10.354 2.361   -19.513 1.00 12.64 ? 125 PHE B CD1   1 
ATOM   3477 C CD2   . PHE D 2 124 ? -11.814 1.856   -21.353 1.00 19.81 ? 125 PHE B CD2   1 
ATOM   3478 C CE1   . PHE D 2 124 ? -9.404  1.468   -20.010 1.00 16.73 ? 125 PHE B CE1   1 
ATOM   3479 C CE2   . PHE D 2 124 ? -10.869 0.956   -21.863 1.00 18.16 ? 125 PHE B CE2   1 
ATOM   3480 C CZ    . PHE D 2 124 ? -9.661  0.763   -21.187 1.00 19.86 ? 125 PHE B CZ    1 
ATOM   3481 N N     . ASP D 2 125 ? -13.241 5.654   -21.948 1.00 23.91 ? 126 ASP B N     1 
ATOM   3482 C CA    . ASP D 2 125 ? -13.198 5.956   -23.377 1.00 25.25 ? 126 ASP B CA    1 
ATOM   3483 C C     . ASP D 2 125 ? -12.460 7.242   -23.759 1.00 25.49 ? 126 ASP B C     1 
ATOM   3484 O O     . ASP D 2 125 ? -12.143 7.442   -24.933 1.00 25.43 ? 126 ASP B O     1 
ATOM   3485 C CB    . ASP D 2 125 ? -14.607 5.925   -23.999 1.00 26.82 ? 126 ASP B CB    1 
ATOM   3486 C CG    . ASP D 2 125 ? -15.601 6.844   -23.298 1.00 32.70 ? 126 ASP B CG    1 
ATOM   3487 O OD1   . ASP D 2 125 ? -15.196 7.784   -22.585 1.00 40.71 ? 126 ASP B OD1   1 
ATOM   3488 O OD2   . ASP D 2 125 ? -16.815 6.619   -23.471 1.00 41.44 ? 126 ASP B OD2   1 
ATOM   3489 N N     . GLN D 2 126 ? -12.178 8.107   -22.786 1.00 22.81 ? 127 GLN B N     1 
ATOM   3490 C CA    . GLN D 2 126 ? -11.448 9.341   -23.080 1.00 21.59 ? 127 GLN B CA    1 
ATOM   3491 C C     . GLN D 2 126 ? -9.936  9.133   -23.166 1.00 21.29 ? 127 GLN B C     1 
ATOM   3492 O O     . GLN D 2 126 ? -9.204  10.034  -23.589 1.00 22.07 ? 127 GLN B O     1 
ATOM   3493 C CB    . GLN D 2 126 ? -11.763 10.413  -22.052 1.00 21.20 ? 127 GLN B CB    1 
ATOM   3494 C CG    . GLN D 2 126 ? -13.206 10.849  -22.097 1.00 24.94 ? 127 GLN B CG    1 
ATOM   3495 C CD    . GLN D 2 126 ? -13.533 11.900  -21.061 1.00 28.64 ? 127 GLN B CD    1 
ATOM   3496 O OE1   . GLN D 2 126 ? -12.640 12.501  -20.461 1.00 30.44 ? 127 GLN B OE1   1 
ATOM   3497 N NE2   . GLN D 2 126 ? -14.823 12.129  -20.840 1.00 28.70 ? 127 GLN B NE2   1 
ATOM   3498 N N     . TYR D 2 127 ? -9.470  7.949   -22.772 1.00 19.10 ? 128 TYR B N     1 
ATOM   3499 C CA    . TYR D 2 127 ? -8.040  7.625   -22.813 1.00 21.70 ? 128 TYR B CA    1 
ATOM   3500 C C     . TYR D 2 127 ? -7.671  6.878   -24.095 1.00 21.95 ? 128 TYR B C     1 
ATOM   3501 O O     . TYR D 2 127 ? -8.335  5.910   -24.460 1.00 22.84 ? 128 TYR B O     1 
ATOM   3502 C CB    . TYR D 2 127 ? -7.628  6.764   -21.591 1.00 17.92 ? 128 TYR B CB    1 
ATOM   3503 C CG    . TYR D 2 127 ? -7.715  7.475   -20.246 1.00 16.93 ? 128 TYR B CG    1 
ATOM   3504 C CD1   . TYR D 2 127 ? -8.912  7.505   -19.520 1.00 12.82 ? 128 TYR B CD1   1 
ATOM   3505 C CD2   . TYR D 2 127 ? -6.600  8.121   -19.704 1.00 15.14 ? 128 TYR B CD2   1 
ATOM   3506 C CE1   . TYR D 2 127 ? -8.993  8.164   -18.286 1.00 14.54 ? 128 TYR B CE1   1 
ATOM   3507 C CE2   . TYR D 2 127 ? -6.671  8.786   -18.467 1.00 15.54 ? 128 TYR B CE2   1 
ATOM   3508 C CZ    . TYR D 2 127 ? -7.864  8.802   -17.768 1.00 17.39 ? 128 TYR B CZ    1 
ATOM   3509 O OH    . TYR D 2 127 ? -7.929  9.445   -16.554 1.00 18.35 ? 128 TYR B OH    1 
ATOM   3510 N N     . ILE D 2 128 ? -6.612  7.325   -24.765 1.00 22.44 ? 129 ILE B N     1 
ATOM   3511 C CA    . ILE D 2 128 ? -6.148  6.677   -25.997 1.00 24.03 ? 129 ILE B CA    1 
ATOM   3512 C C     . ILE D 2 128 ? -4.902  5.831   -25.763 1.00 22.00 ? 129 ILE B C     1 
ATOM   3513 O O     . ILE D 2 128 ? -4.485  5.076   -26.645 1.00 23.88 ? 129 ILE B O     1 
ATOM   3514 C CB    . ILE D 2 128 ? -5.815  7.708   -27.108 1.00 27.03 ? 129 ILE B CB    1 
ATOM   3515 C CG1   . ILE D 2 128 ? -4.685  8.640   -26.645 1.00 26.84 ? 129 ILE B CG1   1 
ATOM   3516 C CG2   . ILE D 2 128 ? -7.056  8.493   -27.459 1.00 29.45 ? 129 ILE B CG2   1 
ATOM   3517 C CD1   . ILE D 2 128 ? -4.046  9.445   -27.752 1.00 36.19 ? 129 ILE B CD1   1 
ATOM   3518 N N     . ALA D 2 129 ? -4.302  5.971   -24.582 1.00 20.17 ? 130 ALA B N     1 
ATOM   3519 C CA    . ALA D 2 129 ? -3.107  5.209   -24.225 1.00 19.45 ? 130 ALA B CA    1 
ATOM   3520 C C     . ALA D 2 129 ? -3.047  4.935   -22.726 1.00 16.76 ? 130 ALA B C     1 
ATOM   3521 O O     . ALA D 2 129 ? -3.480  5.755   -21.903 1.00 14.55 ? 130 ALA B O     1 
ATOM   3522 C CB    . ALA D 2 129 ? -1.851  5.946   -24.667 1.00 21.64 ? 130 ALA B CB    1 
ATOM   3523 N N     . HIS D 2 130 ? -2.519  3.766   -22.389 1.00 15.64 ? 131 HIS B N     1 
ATOM   3524 C CA    . HIS D 2 130 ? -2.364  3.343   -21.003 1.00 16.40 ? 131 HIS B CA    1 
ATOM   3525 C C     . HIS D 2 130 ? -0.936  2.846   -20.897 1.00 16.12 ? 131 HIS B C     1 
ATOM   3526 O O     . HIS D 2 130 ? -0.607  1.761   -21.369 1.00 18.40 ? 131 HIS B O     1 
ATOM   3527 C CB    . HIS D 2 130 ? -3.360  2.231   -20.643 1.00 12.82 ? 131 HIS B CB    1 
ATOM   3528 C CG    . HIS D 2 130 ? -4.793  2.657   -20.739 1.00 14.40 ? 131 HIS B CG    1 
ATOM   3529 N ND1   . HIS D 2 130 ? -5.468  3.250   -19.692 1.00 16.36 ? 131 HIS B ND1   1 
ATOM   3530 C CD2   . HIS D 2 130 ? -5.673  2.600   -21.767 1.00 17.68 ? 131 HIS B CD2   1 
ATOM   3531 C CE1   . HIS D 2 130 ? -6.699  3.541   -20.071 1.00 20.39 ? 131 HIS B CE1   1 
ATOM   3532 N NE2   . HIS D 2 130 ? -6.849  3.157   -21.325 1.00 22.67 ? 131 HIS B NE2   1 
ATOM   3533 N N     . TRP D 2 131 ? -0.080  3.661   -20.297 1.00 15.62 ? 132 TRP B N     1 
ATOM   3534 C CA    . TRP D 2 131 ? 1.316   3.297   -20.144 1.00 16.95 ? 132 TRP B CA    1 
ATOM   3535 C C     . TRP D 2 131 ? 1.607   2.822   -18.733 1.00 17.12 ? 132 TRP B C     1 
ATOM   3536 O O     . TRP D 2 131 ? 1.006   3.296   -17.758 1.00 18.66 ? 132 TRP B O     1 
ATOM   3537 C CB    . TRP D 2 131 ? 2.225   4.488   -20.445 1.00 18.26 ? 132 TRP B CB    1 
ATOM   3538 C CG    . TRP D 2 131 ? 2.125   5.033   -21.839 1.00 18.81 ? 132 TRP B CG    1 
ATOM   3539 C CD1   . TRP D 2 131 ? 1.633   4.399   -22.947 1.00 22.50 ? 132 TRP B CD1   1 
ATOM   3540 C CD2   . TRP D 2 131 ? 2.540   6.338   -22.270 1.00 22.76 ? 132 TRP B CD2   1 
ATOM   3541 N NE1   . TRP D 2 131 ? 1.718   5.232   -24.043 1.00 24.48 ? 132 TRP B NE1   1 
ATOM   3542 C CE2   . TRP D 2 131 ? 2.271   6.427   -23.655 1.00 24.27 ? 132 TRP B CE2   1 
ATOM   3543 C CE3   . TRP D 2 131 ? 3.114   7.444   -21.616 1.00 22.15 ? 132 TRP B CE3   1 
ATOM   3544 C CZ2   . TRP D 2 131 ? 2.558   7.580   -24.404 1.00 25.96 ? 132 TRP B CZ2   1 
ATOM   3545 C CZ3   . TRP D 2 131 ? 3.398   8.592   -22.362 1.00 24.47 ? 132 TRP B CZ3   1 
ATOM   3546 C CH2   . TRP D 2 131 ? 3.118   8.646   -23.742 1.00 23.10 ? 132 TRP B CH2   1 
ATOM   3547 N N     . ILE D 2 132 ? 2.540   1.889   -18.643 1.00 15.57 ? 133 ILE B N     1 
ATOM   3548 C CA    . ILE D 2 132 ? 2.979   1.328   -17.384 1.00 16.71 ? 133 ILE B CA    1 
ATOM   3549 C C     . ILE D 2 132 ? 4.446   1.711   -17.233 1.00 17.04 ? 133 ILE B C     1 
ATOM   3550 O O     . ILE D 2 132 ? 5.247   1.451   -18.136 1.00 16.24 ? 133 ILE B O     1 
ATOM   3551 C CB    . ILE D 2 132 ? 2.894   -0.236  -17.392 1.00 16.39 ? 133 ILE B CB    1 
ATOM   3552 C CG1   . ILE D 2 132 ? 1.436   -0.709  -17.380 1.00 15.25 ? 133 ILE B CG1   1 
ATOM   3553 C CG2   . ILE D 2 132 ? 3.689   -0.819  -16.231 1.00 16.99 ? 133 ILE B CG2   1 
ATOM   3554 C CD1   . ILE D 2 132 ? 0.640   -0.274  -16.181 1.00 20.79 ? 133 ILE B CD1   1 
ATOM   3555 N N     . ILE D 2 133 ? 4.798   2.346   -16.119 1.00 16.72 ? 134 ILE B N     1 
ATOM   3556 C CA    . ILE D 2 133 ? 6.198   2.653   -15.853 1.00 16.09 ? 134 ILE B CA    1 
ATOM   3557 C C     . ILE D 2 133 ? 6.505   1.609   -14.786 1.00 19.13 ? 134 ILE B C     1 
ATOM   3558 O O     . ILE D 2 133 ? 5.988   1.683   -13.663 1.00 16.34 ? 134 ILE B O     1 
ATOM   3559 C CB    . ILE D 2 133 ? 6.426   4.082   -15.298 1.00 18.89 ? 134 ILE B CB    1 
ATOM   3560 C CG1   . ILE D 2 133 ? 6.205   5.116   -16.403 1.00 17.52 ? 134 ILE B CG1   1 
ATOM   3561 C CG2   . ILE D 2 133 ? 7.848   4.212   -14.766 1.00 15.95 ? 134 ILE B CG2   1 
ATOM   3562 C CD1   . ILE D 2 133 ? 6.275   6.551   -15.920 1.00 19.41 ? 134 ILE B CD1   1 
ATOM   3563 N N     . GLY D 2 134 ? 7.319   0.624   -15.151 1.00 17.73 ? 135 GLY B N     1 
ATOM   3564 C CA    . GLY D 2 134 ? 7.655   -0.434  -14.226 1.00 17.59 ? 135 GLY B CA    1 
ATOM   3565 C C     . GLY D 2 134 ? 9.043   -0.318  -13.637 1.00 20.18 ? 135 GLY B C     1 
ATOM   3566 O O     . GLY D 2 134 ? 10.020  -0.121  -14.363 1.00 20.88 ? 135 GLY B O     1 
ATOM   3567 N N     . TYR D 2 135 ? 9.129   -0.437  -12.316 1.00 19.22 ? 136 TYR B N     1 
ATOM   3568 C CA    . TYR D 2 135 ? 10.403  -0.386  -11.618 1.00 17.12 ? 136 TYR B CA    1 
ATOM   3569 C C     . TYR D 2 135 ? 10.636  -1.777  -11.063 1.00 17.64 ? 136 TYR B C     1 
ATOM   3570 O O     . TYR D 2 135 ? 9.729   -2.370  -10.471 1.00 18.82 ? 136 TYR B O     1 
ATOM   3571 C CB    . TYR D 2 135 ? 10.357  0.601   -10.455 1.00 17.67 ? 136 TYR B CB    1 
ATOM   3572 C CG    . TYR D 2 135 ? 10.464  2.051   -10.841 1.00 15.50 ? 136 TYR B CG    1 
ATOM   3573 C CD1   . TYR D 2 135 ? 11.710  2.673   -10.924 1.00 20.55 ? 136 TYR B CD1   1 
ATOM   3574 C CD2   . TYR D 2 135 ? 9.321   2.814   -11.105 1.00 13.00 ? 136 TYR B CD2   1 
ATOM   3575 C CE1   . TYR D 2 135 ? 11.819  4.022   -11.259 1.00 20.06 ? 136 TYR B CE1   1 
ATOM   3576 C CE2   . TYR D 2 135 ? 9.418   4.167   -11.441 1.00 16.26 ? 136 TYR B CE2   1 
ATOM   3577 C CZ    . TYR D 2 135 ? 10.673  4.762   -11.516 1.00 18.29 ? 136 TYR B CZ    1 
ATOM   3578 O OH    . TYR D 2 135 ? 10.785  6.090   -11.855 1.00 17.28 ? 136 TYR B OH    1 
ATOM   3579 N N     . VAL D 2 136 ? 11.843  -2.295  -11.265 1.00 17.02 ? 137 VAL B N     1 
ATOM   3580 C CA    . VAL D 2 136 ? 12.223  -3.610  -10.768 1.00 18.52 ? 137 VAL B CA    1 
ATOM   3581 C C     . VAL D 2 136 ? 13.469  -3.362  -9.939  1.00 20.15 ? 137 VAL B C     1 
ATOM   3582 O O     . VAL D 2 136 ? 14.436  -2.798  -10.435 1.00 19.58 ? 137 VAL B O     1 
ATOM   3583 C CB    . VAL D 2 136 ? 12.624  -4.583  -11.906 1.00 19.78 ? 137 VAL B CB    1 
ATOM   3584 C CG1   . VAL D 2 136 ? 12.797  -5.997  -11.349 1.00 22.70 ? 137 VAL B CG1   1 
ATOM   3585 C CG2   . VAL D 2 136 ? 11.593  -4.559  -13.008 1.00 27.82 ? 137 VAL B CG2   1 
ATOM   3586 N N     . TYR D 2 137 ? 13.457  -3.768  -8.679  1.00 21.96 ? 138 TYR B N     1 
ATOM   3587 C CA    . TYR D 2 137 ? 14.638  -3.586  -7.851  1.00 23.26 ? 138 TYR B CA    1 
ATOM   3588 C C     . TYR D 2 137 ? 15.070  -4.949  -7.332  1.00 23.02 ? 138 TYR B C     1 
ATOM   3589 O O     . TYR D 2 137 ? 14.268  -5.883  -7.251  1.00 23.99 ? 138 TYR B O     1 
ATOM   3590 C CB    . TYR D 2 137 ? 14.358  -2.624  -6.685  1.00 18.38 ? 138 TYR B CB    1 
ATOM   3591 C CG    . TYR D 2 137 ? 13.368  -3.164  -5.676  1.00 24.82 ? 138 TYR B CG    1 
ATOM   3592 C CD1   . TYR D 2 137 ? 11.996  -3.001  -5.860  1.00 21.09 ? 138 TYR B CD1   1 
ATOM   3593 C CD2   . TYR D 2 137 ? 13.803  -3.861  -4.546  1.00 28.18 ? 138 TYR B CD2   1 
ATOM   3594 C CE1   . TYR D 2 137 ? 11.082  -3.516  -4.953  1.00 19.05 ? 138 TYR B CE1   1 
ATOM   3595 C CE2   . TYR D 2 137 ? 12.898  -4.382  -3.632  1.00 27.11 ? 138 TYR B CE2   1 
ATOM   3596 C CZ    . TYR D 2 137 ? 11.536  -4.205  -3.845  1.00 30.16 ? 138 TYR B CZ    1 
ATOM   3597 O OH    . TYR D 2 137 ? 10.622  -4.721  -2.953  1.00 33.72 ? 138 TYR B OH    1 
ATOM   3598 N N     . THR D 2 138 ? 16.344  -5.055  -6.990  1.00 24.82 ? 139 THR B N     1 
ATOM   3599 C CA    . THR D 2 138 ? 16.908  -6.276  -6.438  1.00 26.53 ? 139 THR B CA    1 
ATOM   3600 C C     . THR D 2 138 ? 17.019  -6.072  -4.923  1.00 26.60 ? 139 THR B C     1 
ATOM   3601 O O     . THR D 2 138 ? 17.663  -5.121  -4.475  1.00 25.30 ? 139 THR B O     1 
ATOM   3602 C CB    . THR D 2 138 ? 18.317  -6.542  -7.022  1.00 26.65 ? 139 THR B CB    1 
ATOM   3603 O OG1   . THR D 2 138 ? 18.252  -6.541  -8.454  1.00 29.43 ? 139 THR B OG1   1 
ATOM   3604 C CG2   . THR D 2 138 ? 18.835  -7.896  -6.563  1.00 27.88 ? 139 THR B CG2   1 
ATOM   3605 N N     . ARG D 2 139 ? 16.388  -6.945  -4.145  1.00 26.95 ? 140 ARG B N     1 
ATOM   3606 C CA    . ARG D 2 139 ? 16.460  -6.846  -2.691  1.00 35.25 ? 140 ARG B CA    1 
ATOM   3607 C C     . ARG D 2 139 ? 17.888  -7.120  -2.223  1.00 39.46 ? 140 ARG B C     1 
ATOM   3608 O O     . ARG D 2 139 ? 18.606  -7.894  -2.850  1.00 41.73 ? 140 ARG B O     1 
ATOM   3609 C CB    . ARG D 2 139 ? 15.556  -7.877  -2.020  1.00 39.53 ? 140 ARG B CB    1 
ATOM   3610 C CG    . ARG D 2 139 ? 14.074  -7.688  -2.173  1.00 47.98 ? 140 ARG B CG    1 
ATOM   3611 C CD    . ARG D 2 139 ? 13.386  -8.649  -1.230  1.00 59.47 ? 140 ARG B CD    1 
ATOM   3612 N NE    . ARG D 2 139 ? 11.962  -8.818  -1.493  1.00 71.85 ? 140 ARG B NE    1 
ATOM   3613 C CZ    . ARG D 2 139 ? 11.292  -9.942  -1.240  1.00 79.37 ? 140 ARG B CZ    1 
ATOM   3614 N NH1   . ARG D 2 139 ? 11.914  -10.995 -0.716  1.00 80.54 ? 140 ARG B NH1   1 
ATOM   3615 N NH2   . ARG D 2 139 ? 9.996   -10.018 -1.509  1.00 79.09 ? 140 ARG B NH2   1 
ATOM   3616 N N     . VAL D 2 140 ? 18.307  -6.485  -1.132  1.00 43.21 ? 141 VAL B N     1 
ATOM   3617 C CA    . VAL D 2 140 ? 19.646  -6.736  -0.588  1.00 46.30 ? 141 VAL B CA    1 
ATOM   3618 C C     . VAL D 2 140 ? 19.531  -8.016  0.250   1.00 49.62 ? 141 VAL B C     1 
ATOM   3619 O O     . VAL D 2 140 ? 18.446  -8.330  0.753   1.00 50.28 ? 141 VAL B O     1 
ATOM   3620 C CB    . VAL D 2 140 ? 20.145  -5.572  0.310   1.00 44.38 ? 141 VAL B CB    1 
ATOM   3621 C CG1   . VAL D 2 140 ? 20.441  -4.351  -0.537  1.00 39.11 ? 141 VAL B CG1   1 
ATOM   3622 C CG2   . VAL D 2 140 ? 19.108  -5.243  1.370   1.00 44.91 ? 141 VAL B CG2   1 
ATOM   3623 N N     . ALA D 2 141 ? 20.635  -8.749  0.397   1.00 52.98 ? 142 ALA B N     1 
ATOM   3624 C CA    . ALA D 2 141 ? 20.641  -10.001 1.165   1.00 56.29 ? 142 ALA B CA    1 
ATOM   3625 C C     . ALA D 2 141 ? 20.335  -9.816  2.658   1.00 58.55 ? 142 ALA B C     1 
ATOM   3626 O O     . ALA D 2 141 ? 19.667  -10.659 3.267   1.00 59.05 ? 142 ALA B O     1 
ATOM   3627 C CB    . ALA D 2 141 ? 21.978  -10.720 0.986   1.00 56.53 ? 142 ALA B CB    1 
ATOM   3628 N N     . THR D 2 142 ? 20.824  -8.722  3.241   1.00 60.46 ? 143 THR B N     1 
ATOM   3629 C CA    . THR D 2 142 ? 20.592  -8.441  4.654   1.00 62.34 ? 143 THR B CA    1 
ATOM   3630 C C     . THR D 2 142 ? 19.124  -8.087  4.930   1.00 62.80 ? 143 THR B C     1 
ATOM   3631 O O     . THR D 2 142 ? 18.584  -7.120  4.383   1.00 62.89 ? 143 THR B O     1 
ATOM   3632 C CB    . THR D 2 142 ? 21.559  -7.307  5.180   1.00 66.01 ? 143 THR B CB    1 
ATOM   3633 O OG1   . THR D 2 142 ? 21.188  -6.926  6.514   1.00 63.86 ? 143 THR B OG1   1 
ATOM   3634 C CG2   . THR D 2 142 ? 21.553  -6.083  4.258   1.00 62.26 ? 143 THR B CG2   1 
ATOM   3635 N N     . ARG D 2 143 ? 18.486  -8.887  5.778   1.00 64.51 ? 144 ARG B N     1 
ATOM   3636 C CA    . ARG D 2 143 ? 17.087  -8.680  6.149   1.00 68.46 ? 144 ARG B CA    1 
ATOM   3637 C C     . ARG D 2 143 ? 16.945  -7.620  7.253   1.00 69.01 ? 144 ARG B C     1 
ATOM   3638 O O     . ARG D 2 143 ? 15.827  -7.266  7.643   1.00 69.76 ? 144 ARG B O     1 
ATOM   3639 C CB    . ARG D 2 143 ? 16.459  -10.004 6.627   1.00 71.89 ? 144 ARG B CB    1 
ATOM   3640 C CG    . ARG D 2 143 ? 16.278  -11.065 5.535   1.00 78.10 ? 144 ARG B CG    1 
ATOM   3641 C CD    . ARG D 2 143 ? 15.734  -12.383 6.097   1.00 83.54 ? 144 ARG B CD    1 
ATOM   3642 N NE    . ARG D 2 143 ? 16.736  -13.146 6.855   1.00 88.83 ? 144 ARG B NE    1 
ATOM   3643 C CZ    . ARG D 2 143 ? 16.530  -14.356 7.384   1.00 90.31 ? 144 ARG B CZ    1 
ATOM   3644 N NH1   . ARG D 2 143 ? 15.355  -14.956 7.253   1.00 89.59 ? 144 ARG B NH1   1 
ATOM   3645 N NH2   . ARG D 2 143 ? 17.499  -14.977 8.052   1.00 87.05 ? 144 ARG B NH2   1 
ATOM   3646 N N     . LYS D 2 144 ? 18.076  -7.116  7.750   1.00 68.34 ? 145 LYS B N     1 
ATOM   3647 C CA    . LYS D 2 144 ? 18.078  -6.116  8.822   1.00 67.30 ? 145 LYS B CA    1 
ATOM   3648 C C     . LYS D 2 144 ? 18.526  -4.718  8.376   1.00 65.97 ? 145 LYS B C     1 
ATOM   3649 O O     . LYS D 2 144 ? 19.708  -4.473  8.104   1.00 65.37 ? 145 LYS B O     1 
ATOM   3650 C CB    . LYS D 2 144 ? 18.942  -6.610  9.990   1.00 68.48 ? 145 LYS B CB    1 
ATOM   3651 C CG    . LYS D 2 144 ? 18.420  -7.896  10.621  1.00 69.03 ? 145 LYS B CG    1 
ATOM   3652 C CD    . LYS D 2 144 ? 19.520  -8.662  11.332  1.00 74.45 ? 145 LYS B CD    1 
ATOM   3653 C CE    . LYS D 2 144 ? 19.030  -10.035 11.772  1.00 71.33 ? 145 LYS B CE    1 
ATOM   3654 N NZ    . LYS D 2 144 ? 20.135  -10.838 12.361  1.00 70.47 ? 145 LYS B NZ    1 
ATOM   3655 N N     . SER D 2 145 ? 17.559  -3.806  8.304   1.00 65.32 ? 146 SER B N     1 
ATOM   3656 C CA    . SER D 2 145 ? 17.802  -2.420  7.903   1.00 62.83 ? 146 SER B CA    1 
ATOM   3657 C C     . SER D 2 145 ? 18.302  -1.596  9.094   1.00 59.35 ? 146 SER B C     1 
ATOM   3658 O O     . SER D 2 145 ? 18.322  -2.084  10.233  1.00 58.93 ? 146 SER B O     1 
ATOM   3659 C CB    . SER D 2 145 ? 16.510  -1.805  7.349   1.00 62.99 ? 146 SER B CB    1 
ATOM   3660 O OG    . SER D 2 145 ? 15.943  -2.619  6.331   1.00 60.67 ? 146 SER B OG    1 
ATOM   3661 N N     . SER D 2 146 ? 18.708  -0.356  8.825   1.00 55.85 ? 147 SER B N     1 
ATOM   3662 C CA    . SER D 2 146 ? 19.207  0.532   9.872   1.00 51.32 ? 147 SER B CA    1 
ATOM   3663 C C     . SER D 2 146 ? 18.028  1.084   10.665  1.00 48.71 ? 147 SER B C     1 
ATOM   3664 O O     . SER D 2 146 ? 16.977  1.389   10.089  1.00 48.57 ? 147 SER B O     1 
ATOM   3665 C CB    . SER D 2 146 ? 20.005  1.685   9.266   1.00 50.27 ? 147 SER B CB    1 
ATOM   3666 O OG    . SER D 2 146 ? 20.595  2.470   10.285  1.00 42.95 ? 147 SER B OG    1 
ATOM   3667 N N     . LEU D 2 147 ? 18.209  1.210   11.979  1.00 44.04 ? 148 LEU B N     1 
ATOM   3668 C CA    . LEU D 2 147 ? 17.154  1.706   12.857  1.00 40.76 ? 148 LEU B CA    1 
ATOM   3669 C C     . LEU D 2 147 ? 17.513  2.994   13.608  1.00 37.68 ? 148 LEU B C     1 
ATOM   3670 O O     . LEU D 2 147 ? 16.941  3.295   14.659  1.00 37.42 ? 148 LEU B O     1 
ATOM   3671 C CB    . LEU D 2 147 ? 16.729  0.601   13.835  1.00 39.02 ? 148 LEU B CB    1 
ATOM   3672 C CG    . LEU D 2 147 ? 15.872  -0.506  13.210  1.00 42.00 ? 148 LEU B CG    1 
ATOM   3673 C CD1   . LEU D 2 147 ? 16.150  -1.842  13.862  1.00 44.89 ? 148 LEU B CD1   1 
ATOM   3674 C CD2   . LEU D 2 147 ? 14.409  -0.135  13.333  1.00 41.69 ? 148 LEU B CD2   1 
ATOM   3675 N N     . LYS D 2 148 ? 18.457  3.754   13.068  1.00 34.57 ? 149 LYS B N     1 
ATOM   3676 C CA    . LYS D 2 148 ? 18.849  5.016   13.681  1.00 34.60 ? 149 LYS B CA    1 
ATOM   3677 C C     . LYS D 2 148 ? 18.629  6.121   12.660  1.00 33.58 ? 149 LYS B C     1 
ATOM   3678 O O     . LYS D 2 148 ? 18.358  5.842   11.490  1.00 33.11 ? 149 LYS B O     1 
ATOM   3679 C CB    . LYS D 2 148 ? 20.313  4.988   14.128  1.00 37.55 ? 149 LYS B CB    1 
ATOM   3680 C CG    . LYS D 2 148 ? 21.322  4.792   13.016  1.00 44.46 ? 149 LYS B CG    1 
ATOM   3681 C CD    . LYS D 2 148 ? 22.736  4.909   13.553  1.00 53.05 ? 149 LYS B CD    1 
ATOM   3682 C CE    . LYS D 2 148 ? 23.754  4.623   12.466  1.00 58.45 ? 149 LYS B CE    1 
ATOM   3683 N NZ    . LYS D 2 148 ? 25.159  4.808   12.929  1.00 59.05 ? 149 LYS B NZ    1 
ATOM   3684 N N     . THR D 2 149 ? 18.735  7.369   13.102  1.00 31.49 ? 150 THR B N     1 
ATOM   3685 C CA    . THR D 2 149 ? 18.552  8.504   12.214  1.00 29.17 ? 150 THR B CA    1 
ATOM   3686 C C     . THR D 2 149 ? 19.902  9.052   11.783  1.00 29.78 ? 150 THR B C     1 
ATOM   3687 O O     . THR D 2 149 ? 20.936  8.717   12.367  1.00 31.03 ? 150 THR B O     1 
ATOM   3688 C CB    . THR D 2 149 ? 17.721  9.605   12.877  1.00 26.70 ? 150 THR B CB    1 
ATOM   3689 O OG1   . THR D 2 149 ? 18.322  9.983   14.123  1.00 33.41 ? 150 THR B OG1   1 
ATOM   3690 C CG2   . THR D 2 149 ? 16.311  9.104   13.122  1.00 23.17 ? 150 THR B CG2   1 
ATOM   3691 N N     . TYR D 2 150 ? 19.890  9.895   10.761  1.00 27.89 ? 151 TYR B N     1 
ATOM   3692 C CA    . TYR D 2 150 ? 21.110  10.472  10.225  1.00 26.73 ? 151 TYR B CA    1 
ATOM   3693 C C     . TYR D 2 150 ? 20.893  11.949  9.974   1.00 28.03 ? 151 TYR B C     1 
ATOM   3694 O O     . TYR D 2 150 ? 19.769  12.443  10.061  1.00 28.32 ? 151 TYR B O     1 
ATOM   3695 C CB    . TYR D 2 150 ? 21.462  9.804   8.896   1.00 23.50 ? 151 TYR B CB    1 
ATOM   3696 C CG    . TYR D 2 150 ? 21.693  8.316   8.977   1.00 23.49 ? 151 TYR B CG    1 
ATOM   3697 C CD1   . TYR D 2 150 ? 20.623  7.421   8.970   1.00 20.21 ? 151 TYR B CD1   1 
ATOM   3698 C CD2   . TYR D 2 150 ? 22.991  7.798   9.045   1.00 22.20 ? 151 TYR B CD2   1 
ATOM   3699 C CE1   . TYR D 2 150 ? 20.838  6.041   9.029   1.00 24.42 ? 151 TYR B CE1   1 
ATOM   3700 C CE2   . TYR D 2 150 ? 23.219  6.426   9.103   1.00 21.69 ? 151 TYR B CE2   1 
ATOM   3701 C CZ    . TYR D 2 150 ? 22.137  5.552   9.094   1.00 25.68 ? 151 TYR B CZ    1 
ATOM   3702 O OH    . TYR D 2 150 ? 22.357  4.194   9.152   1.00 27.51 ? 151 TYR B OH    1 
ATOM   3703 N N     . ASN D 2 151 ? 21.977  12.654  9.669   1.00 30.40 ? 152 ASN B N     1 
ATOM   3704 C CA    . ASN D 2 151 ? 21.891  14.076  9.361   1.00 32.68 ? 152 ASN B CA    1 
ATOM   3705 C C     . ASN D 2 151 ? 22.481  14.254  7.972   1.00 32.28 ? 152 ASN B C     1 
ATOM   3706 O O     . ASN D 2 151 ? 23.111  13.335  7.439   1.00 31.30 ? 152 ASN B O     1 
ATOM   3707 C CB    . ASN D 2 151 ? 22.610  14.946  10.409  1.00 37.87 ? 152 ASN B CB    1 
ATOM   3708 C CG    . ASN D 2 151 ? 24.097  14.677  10.486  1.00 48.06 ? 152 ASN B CG    1 
ATOM   3709 O OD1   . ASN D 2 151 ? 24.872  15.128  9.640   1.00 53.94 ? 152 ASN B OD1   1 
ATOM   3710 N ND2   . ASN D 2 151 ? 24.508  13.944  11.511  1.00 58.46 ? 152 ASN B ND2   1 
ATOM   3711 N N     . ILE D 2 152 ? 22.279  15.428  7.391   1.00 33.11 ? 153 ILE B N     1 
ATOM   3712 C CA    . ILE D 2 152 ? 22.750  15.718  6.040   1.00 36.17 ? 153 ILE B CA    1 
ATOM   3713 C C     . ILE D 2 152 ? 24.212  15.350  5.733   1.00 35.76 ? 153 ILE B C     1 
ATOM   3714 O O     . ILE D 2 152 ? 24.518  14.936  4.618   1.00 37.38 ? 153 ILE B O     1 
ATOM   3715 C CB    . ILE D 2 152 ? 22.481  17.203  5.684   1.00 38.45 ? 153 ILE B CB    1 
ATOM   3716 C CG1   . ILE D 2 152 ? 20.988  17.514  5.852   1.00 43.63 ? 153 ILE B CG1   1 
ATOM   3717 C CG2   . ILE D 2 152 ? 22.878  17.473  4.246   1.00 43.45 ? 153 ILE B CG2   1 
ATOM   3718 C CD1   . ILE D 2 152 ? 20.674  18.989  6.051   1.00 47.92 ? 153 ILE B CD1   1 
ATOM   3719 N N     . ASN D 2 153 ? 25.105  15.484  6.711   1.00 37.32 ? 154 ASN B N     1 
ATOM   3720 C CA    . ASN D 2 153 ? 26.530  15.172  6.515   1.00 40.23 ? 154 ASN B CA    1 
ATOM   3721 C C     . ASN D 2 153 ? 26.797  13.685  6.312   1.00 40.32 ? 154 ASN B C     1 
ATOM   3722 O O     . ASN D 2 153 ? 27.836  13.296  5.772   1.00 40.29 ? 154 ASN B O     1 
ATOM   3723 C CB    . ASN D 2 153 ? 27.355  15.635  7.723   1.00 46.51 ? 154 ASN B CB    1 
ATOM   3724 C CG    . ASN D 2 153 ? 27.145  17.094  8.046   1.00 56.73 ? 154 ASN B CG    1 
ATOM   3725 O OD1   . ASN D 2 153 ? 27.613  17.973  7.324   1.00 65.19 ? 154 ASN B OD1   1 
ATOM   3726 N ND2   . ASN D 2 153 ? 26.433  17.365  9.133   1.00 63.81 ? 154 ASN B ND2   1 
ATOM   3727 N N     . GLU D 2 154 ? 25.851  12.857  6.744   1.00 39.37 ? 155 GLU B N     1 
ATOM   3728 C CA    . GLU D 2 154 ? 25.995  11.409  6.664   1.00 38.69 ? 155 GLU B CA    1 
ATOM   3729 C C     . GLU D 2 154 ? 25.278  10.710  5.508   1.00 37.57 ? 155 GLU B C     1 
ATOM   3730 O O     . GLU D 2 154 ? 25.145  9.484   5.528   1.00 36.06 ? 155 GLU B O     1 
ATOM   3731 C CB    . GLU D 2 154 ? 25.537  10.797  7.989   1.00 37.46 ? 155 GLU B CB    1 
ATOM   3732 C CG    . GLU D 2 154 ? 26.189  11.438  9.200   1.00 40.63 ? 155 GLU B CG    1 
ATOM   3733 C CD    . GLU D 2 154 ? 25.594  10.967  10.503  1.00 43.36 ? 155 GLU B CD    1 
ATOM   3734 O OE1   . GLU D 2 154 ? 24.371  11.125  10.682  1.00 39.62 ? 155 GLU B OE1   1 
ATOM   3735 O OE2   . GLU D 2 154 ? 26.347  10.442  11.349  1.00 52.53 ? 155 GLU B OE2   1 
ATOM   3736 N N     . LEU D 2 155 ? 24.827  11.463  4.506   1.00 36.25 ? 156 LEU B N     1 
ATOM   3737 C CA    . LEU D 2 155 ? 24.109  10.877  3.373   1.00 36.77 ? 156 LEU B CA    1 
ATOM   3738 C C     . LEU D 2 155 ? 24.816  9.690   2.733   1.00 37.64 ? 156 LEU B C     1 
ATOM   3739 O O     . LEU D 2 155 ? 24.165  8.734   2.314   1.00 37.48 ? 156 LEU B O     1 
ATOM   3740 C CB    . LEU D 2 155 ? 23.813  11.937  2.304   1.00 35.85 ? 156 LEU B CB    1 
ATOM   3741 C CG    . LEU D 2 155 ? 22.561  12.789  2.516   1.00 37.75 ? 156 LEU B CG    1 
ATOM   3742 C CD1   . LEU D 2 155 ? 22.425  13.813  1.401   1.00 38.39 ? 156 LEU B CD1   1 
ATOM   3743 C CD2   . LEU D 2 155 ? 21.342  11.888  2.546   1.00 42.32 ? 156 LEU B CD2   1 
ATOM   3744 N N     . ASN D 2 156 ? 26.145  9.744   2.666   1.00 38.59 ? 157 ASN B N     1 
ATOM   3745 C CA    . ASN D 2 156 ? 26.925  8.666   2.049   1.00 39.81 ? 157 ASN B CA    1 
ATOM   3746 C C     . ASN D 2 156 ? 27.089  7.396   2.879   1.00 37.26 ? 157 ASN B C     1 
ATOM   3747 O O     . ASN D 2 156 ? 27.591  6.389   2.376   1.00 38.48 ? 157 ASN B O     1 
ATOM   3748 C CB    . ASN D 2 156 ? 28.307  9.178   1.631   1.00 46.70 ? 157 ASN B CB    1 
ATOM   3749 C CG    . ASN D 2 156 ? 28.243  10.142  0.453   1.00 59.75 ? 157 ASN B CG    1 
ATOM   3750 O OD1   . ASN D 2 156 ? 29.019  11.098  0.378   1.00 70.28 ? 157 ASN B OD1   1 
ATOM   3751 N ND2   . ASN D 2 156 ? 27.316  9.896   -0.473  1.00 62.42 ? 157 ASN B ND2   1 
ATOM   3752 N N     . GLU D 2 157 ? 26.669  7.449   4.140   1.00 35.40 ? 158 GLU B N     1 
ATOM   3753 C CA    . GLU D 2 157 ? 26.758  6.314   5.053   1.00 33.38 ? 158 GLU B CA    1 
ATOM   3754 C C     . GLU D 2 157 ? 25.416  5.590   5.269   1.00 30.52 ? 158 GLU B C     1 
ATOM   3755 O O     . GLU D 2 157 ? 25.363  4.577   5.968   1.00 28.60 ? 158 GLU B O     1 
ATOM   3756 C CB    . GLU D 2 157 ? 27.292  6.785   6.405   1.00 36.80 ? 158 GLU B CB    1 
ATOM   3757 C CG    . GLU D 2 157 ? 28.712  7.340   6.370   1.00 52.56 ? 158 GLU B CG    1 
ATOM   3758 C CD    . GLU D 2 157 ? 29.111  8.038   7.671   1.00 60.24 ? 158 GLU B CD    1 
ATOM   3759 O OE1   . GLU D 2 157 ? 28.477  7.778   8.724   1.00 56.77 ? 158 GLU B OE1   1 
ATOM   3760 O OE2   . GLU D 2 157 ? 30.063  8.852   7.637   1.00 63.77 ? 158 GLU B OE2   1 
ATOM   3761 N N     . ILE D 2 158 ? 24.337  6.102   4.681   1.00 27.39 ? 159 ILE B N     1 
ATOM   3762 C CA    . ILE D 2 158 ? 23.026  5.483   4.847   1.00 27.70 ? 159 ILE B CA    1 
ATOM   3763 C C     . ILE D 2 158 ? 22.851  4.252   3.957   1.00 29.04 ? 159 ILE B C     1 
ATOM   3764 O O     . ILE D 2 158 ? 22.937  4.343   2.728   1.00 28.15 ? 159 ILE B O     1 
ATOM   3765 C CB    . ILE D 2 158 ? 21.886  6.475   4.535   1.00 23.70 ? 159 ILE B CB    1 
ATOM   3766 C CG1   . ILE D 2 158 ? 22.011  7.706   5.425   1.00 20.25 ? 159 ILE B CG1   1 
ATOM   3767 C CG2   . ILE D 2 158 ? 20.527  5.805   4.750   1.00 20.12 ? 159 ILE B CG2   1 
ATOM   3768 C CD1   . ILE D 2 158 ? 20.928  8.736   5.186   1.00 26.48 ? 159 ILE B CD1   1 
ATOM   3769 N N     . PRO D 2 159 ? 22.617  3.081   4.567   1.00 29.79 ? 160 PRO B N     1 
ATOM   3770 C CA    . PRO D 2 159 ? 22.430  1.869   3.763   1.00 32.06 ? 160 PRO B CA    1 
ATOM   3771 C C     . PRO D 2 159 ? 21.126  1.925   2.938   1.00 32.47 ? 160 PRO B C     1 
ATOM   3772 O O     . PRO D 2 159 ? 20.084  2.371   3.431   1.00 30.93 ? 160 PRO B O     1 
ATOM   3773 C CB    . PRO D 2 159 ? 22.421  0.757   4.821   1.00 32.42 ? 160 PRO B CB    1 
ATOM   3774 C CG    . PRO D 2 159 ? 21.857  1.443   6.036   1.00 31.81 ? 160 PRO B CG    1 
ATOM   3775 C CD    . PRO D 2 159 ? 22.531  2.788   6.010   1.00 31.44 ? 160 PRO B CD    1 
ATOM   3776 N N     . LYS D 2 160 ? 21.201  1.489   1.680   1.00 35.47 ? 161 LYS B N     1 
ATOM   3777 C CA    . LYS D 2 160 ? 20.043  1.457   0.773   1.00 37.58 ? 161 LYS B CA    1 
ATOM   3778 C C     . LYS D 2 160 ? 19.407  0.066   0.853   1.00 37.00 ? 161 LYS B C     1 
ATOM   3779 O O     . LYS D 2 160 ? 20.114  -0.937  0.932   1.00 36.72 ? 161 LYS B O     1 
ATOM   3780 C CB    . LYS D 2 160 ? 20.491  1.776   -0.660  1.00 41.56 ? 161 LYS B CB    1 
ATOM   3781 C CG    . LYS D 2 160 ? 21.019  3.193   -0.804  1.00 50.74 ? 161 LYS B CG    1 
ATOM   3782 C CD    . LYS D 2 160 ? 21.925  3.388   -2.009  1.00 55.25 ? 161 LYS B CD    1 
ATOM   3783 C CE    . LYS D 2 160 ? 22.621  4.750   -1.898  1.00 59.78 ? 161 LYS B CE    1 
ATOM   3784 N NZ    . LYS D 2 160 ? 23.640  5.029   -2.952  1.00 58.73 ? 161 LYS B NZ    1 
ATOM   3785 N N     . PRO D 2 161 ? 18.065  -0.012  0.845   1.00 37.91 ? 162 PRO B N     1 
ATOM   3786 C CA    . PRO D 2 161 ? 17.332  -1.287  0.922   1.00 37.77 ? 162 PRO B CA    1 
ATOM   3787 C C     . PRO D 2 161 ? 17.255  -2.101  -0.393  1.00 35.75 ? 162 PRO B C     1 
ATOM   3788 O O     . PRO D 2 161 ? 16.629  -3.166  -0.445  1.00 36.04 ? 162 PRO B O     1 
ATOM   3789 C CB    . PRO D 2 161 ? 15.955  -0.839  1.396   1.00 38.18 ? 162 PRO B CB    1 
ATOM   3790 C CG    . PRO D 2 161 ? 15.774  0.440   0.635   1.00 39.93 ? 162 PRO B CG    1 
ATOM   3791 C CD    . PRO D 2 161 ? 17.128  1.126   0.779   1.00 39.76 ? 162 PRO B CD    1 
ATOM   3792 N N     . TYR D 2 162 ? 17.890  -1.593  -1.444  1.00 32.07 ? 163 TYR B N     1 
ATOM   3793 C CA    . TYR D 2 162 ? 17.905  -2.249  -2.750  1.00 30.39 ? 163 TYR B CA    1 
ATOM   3794 C C     . TYR D 2 162 ? 19.335  -2.240  -3.275  1.00 29.60 ? 163 TYR B C     1 
ATOM   3795 O O     . TYR D 2 162 ? 20.124  -1.359  -2.945  1.00 26.01 ? 163 TYR B O     1 
ATOM   3796 C CB    . TYR D 2 162 ? 16.956  -1.538  -3.737  1.00 32.06 ? 163 TYR B CB    1 
ATOM   3797 C CG    . TYR D 2 162 ? 17.173  -0.036  -3.858  1.00 34.49 ? 163 TYR B CG    1 
ATOM   3798 C CD1   . TYR D 2 162 ? 18.145  0.480   -4.717  1.00 33.44 ? 163 TYR B CD1   1 
ATOM   3799 C CD2   . TYR D 2 162 ? 16.422  0.865   -3.091  1.00 34.86 ? 163 TYR B CD2   1 
ATOM   3800 C CE1   . TYR D 2 162 ? 18.370  1.845   -4.806  1.00 36.53 ? 163 TYR B CE1   1 
ATOM   3801 C CE2   . TYR D 2 162 ? 16.640  2.239   -3.174  1.00 32.45 ? 163 TYR B CE2   1 
ATOM   3802 C CZ    . TYR D 2 162 ? 17.618  2.719   -4.032  1.00 38.85 ? 163 TYR B CZ    1 
ATOM   3803 O OH    . TYR D 2 162 ? 17.870  4.065   -4.121  1.00 47.43 ? 163 TYR B OH    1 
ATOM   3804 N N     . LYS D 2 163 ? 19.652  -3.230  -4.094  1.00 32.78 ? 164 LYS B N     1 
ATOM   3805 C CA    . LYS D 2 163 ? 20.981  -3.399  -4.663  1.00 35.86 ? 164 LYS B CA    1 
ATOM   3806 C C     . LYS D 2 163 ? 21.096  -2.731  -6.036  1.00 37.20 ? 164 LYS B C     1 
ATOM   3807 O O     . LYS D 2 163 ? 22.172  -2.268  -6.420  1.00 38.64 ? 164 LYS B O     1 
ATOM   3808 C CB    . LYS D 2 163 ? 21.265  -4.903  -4.773  1.00 38.95 ? 164 LYS B CB    1 
ATOM   3809 C CG    . LYS D 2 163 ? 22.715  -5.306  -4.882  1.00 50.47 ? 164 LYS B CG    1 
ATOM   3810 C CD    . LYS D 2 163 ? 22.843  -6.801  -4.602  1.00 59.32 ? 164 LYS B CD    1 
ATOM   3811 C CE    . LYS D 2 163 ? 24.299  -7.262  -4.589  1.00 68.91 ? 164 LYS B CE    1 
ATOM   3812 N NZ    . LYS D 2 163 ? 24.749  -7.841  -5.896  1.00 68.31 ? 164 LYS B NZ    1 
ATOM   3813 N N     . GLY D 2 164 ? 19.988  -2.684  -6.772  1.00 34.32 ? 165 GLY B N     1 
ATOM   3814 C CA    . GLY D 2 164 ? 19.994  -2.083  -8.094  1.00 31.03 ? 165 GLY B CA    1 
ATOM   3815 C C     . GLY D 2 164 ? 18.559  -1.855  -8.513  1.00 31.89 ? 165 GLY B C     1 
ATOM   3816 O O     . GLY D 2 164 ? 17.661  -2.467  -7.923  1.00 33.90 ? 165 GLY B O     1 
ATOM   3817 N N     . VAL D 2 165 ? 18.338  -0.991  -9.505  1.00 25.83 ? 166 VAL B N     1 
ATOM   3818 C CA    . VAL D 2 165 ? 16.994  -0.673  -9.981  1.00 23.57 ? 166 VAL B CA    1 
ATOM   3819 C C     . VAL D 2 165 ? 17.002  -0.542  -11.493 1.00 25.65 ? 166 VAL B C     1 
ATOM   3820 O O     . VAL D 2 165 ? 17.925  0.043   -12.059 1.00 27.32 ? 166 VAL B O     1 
ATOM   3821 C CB    . VAL D 2 165 ? 16.466  0.683   -9.400  1.00 22.04 ? 166 VAL B CB    1 
ATOM   3822 C CG1   . VAL D 2 165 ? 15.024  0.932   -9.837  1.00 21.30 ? 166 VAL B CG1   1 
ATOM   3823 C CG2   . VAL D 2 165 ? 16.541  0.689   -7.889  1.00 26.99 ? 166 VAL B CG2   1 
ATOM   3824 N N     . LYS D 2 166 ? 15.976  -1.096  -12.134 1.00 24.34 ? 167 LYS B N     1 
ATOM   3825 C CA    . LYS D 2 166 ? 15.796  -1.020  -13.578 1.00 22.31 ? 167 LYS B CA    1 
ATOM   3826 C C     . LYS D 2 166 ? 14.392  -0.472  -13.813 1.00 21.51 ? 167 LYS B C     1 
ATOM   3827 O O     . LYS D 2 166 ? 13.474  -0.762  -13.057 1.00 23.11 ? 167 LYS B O     1 
ATOM   3828 C CB    . LYS D 2 166 ? 15.991  -2.395  -14.222 1.00 19.50 ? 167 LYS B CB    1 
ATOM   3829 C CG    . LYS D 2 166 ? 17.462  -2.720  -14.434 1.00 26.73 ? 167 LYS B CG    1 
ATOM   3830 C CD    . LYS D 2 166 ? 17.694  -4.057  -15.112 1.00 39.95 ? 167 LYS B CD    1 
ATOM   3831 C CE    . LYS D 2 166 ? 17.686  -5.208  -14.117 1.00 49.63 ? 167 LYS B CE    1 
ATOM   3832 N NZ    . LYS D 2 166 ? 17.960  -6.516  -14.784 1.00 57.99 ? 167 LYS B NZ    1 
ATOM   3833 N N     . VAL D 2 167 ? 14.220  0.334   -14.848 1.00 21.60 ? 168 VAL B N     1 
ATOM   3834 C CA    . VAL D 2 167 ? 12.917  0.925   -15.131 1.00 20.28 ? 168 VAL B CA    1 
ATOM   3835 C C     . VAL D 2 167 ? 12.577  0.763   -16.618 1.00 21.29 ? 168 VAL B C     1 
ATOM   3836 O O     . VAL D 2 167 ? 13.471  0.581   -17.447 1.00 22.67 ? 168 VAL B O     1 
ATOM   3837 C CB    . VAL D 2 167 ? 12.916  2.442   -14.724 1.00 15.28 ? 168 VAL B CB    1 
ATOM   3838 C CG1   . VAL D 2 167 ? 13.923  3.219   -15.550 1.00 25.39 ? 168 VAL B CG1   1 
ATOM   3839 C CG2   . VAL D 2 167 ? 11.530  3.051   -14.868 1.00 14.96 ? 168 VAL B CG2   1 
ATOM   3840 N N     . PHE D 2 168 ? 11.294  0.807   -16.955 1.00 18.06 ? 169 PHE B N     1 
ATOM   3841 C CA    . PHE D 2 168 ? 10.872  0.723   -18.352 1.00 16.60 ? 169 PHE B CA    1 
ATOM   3842 C C     . PHE D 2 168 ? 9.513   1.397   -18.475 1.00 16.72 ? 169 PHE B C     1 
ATOM   3843 O O     . PHE D 2 168 ? 8.818   1.585   -17.466 1.00 16.55 ? 169 PHE B O     1 
ATOM   3844 C CB    . PHE D 2 168 ? 10.802  -0.746  -18.839 1.00 18.46 ? 169 PHE B CB    1 
ATOM   3845 C CG    . PHE D 2 168 ? 9.681   -1.570  -18.214 1.00 23.78 ? 169 PHE B CG    1 
ATOM   3846 C CD1   . PHE D 2 168 ? 8.346   -1.379  -18.593 1.00 20.10 ? 169 PHE B CD1   1 
ATOM   3847 C CD2   . PHE D 2 168 ? 9.966   -2.528  -17.242 1.00 22.82 ? 169 PHE B CD2   1 
ATOM   3848 C CE1   . PHE D 2 168 ? 7.316   -2.123  -18.010 1.00 22.43 ? 169 PHE B CE1   1 
ATOM   3849 C CE2   . PHE D 2 168 ? 8.942   -3.277  -16.655 1.00 24.62 ? 169 PHE B CE2   1 
ATOM   3850 C CZ    . PHE D 2 168 ? 7.618   -3.072  -17.039 1.00 16.61 ? 169 PHE B CZ    1 
ATOM   3851 N N     . LEU D 2 169 ? 9.147   1.780   -19.697 1.00 14.24 ? 170 LEU B N     1 
ATOM   3852 C CA    . LEU D 2 169 ? 7.837   2.364   -19.976 1.00 12.55 ? 170 LEU B CA    1 
ATOM   3853 C C     . LEU D 2 169 ? 7.297   1.467   -21.093 1.00 17.55 ? 170 LEU B C     1 
ATOM   3854 O O     . LEU D 2 169 ? 8.020   1.142   -22.041 1.00 17.79 ? 170 LEU B O     1 
ATOM   3855 C CB    . LEU D 2 169 ? 7.924   3.821   -20.450 1.00 12.58 ? 170 LEU B CB    1 
ATOM   3856 C CG    . LEU D 2 169 ? 6.570   4.548   -20.590 1.00 16.07 ? 170 LEU B CG    1 
ATOM   3857 C CD1   . LEU D 2 169 ? 6.762   6.034   -20.427 1.00 22.69 ? 170 LEU B CD1   1 
ATOM   3858 C CD2   . LEU D 2 169 ? 5.914   4.243   -21.919 1.00 21.85 ? 170 LEU B CD2   1 
ATOM   3859 N N     . GLN D 2 170 ? 6.042   1.057   -20.994 1.00 16.10 ? 171 GLN B N     1 
ATOM   3860 C CA    . GLN D 2 170 ? 5.487   0.185   -22.015 1.00 17.28 ? 171 GLN B CA    1 
ATOM   3861 C C     . GLN D 2 170 ? 3.973   0.266   -21.965 1.00 18.66 ? 171 GLN B C     1 
ATOM   3862 O O     . GLN D 2 170 ? 3.398   0.591   -20.921 1.00 18.12 ? 171 GLN B O     1 
ATOM   3863 C CB    . GLN D 2 170 ? 5.977   -1.255  -21.773 1.00 16.29 ? 171 GLN B CB    1 
ATOM   3864 C CG    . GLN D 2 170 ? 5.628   -2.278  -22.865 1.00 26.77 ? 171 GLN B CG    1 
ATOM   3865 C CD    . GLN D 2 170 ? 6.116   -1.868  -24.251 1.00 23.64 ? 171 GLN B CD    1 
ATOM   3866 O OE1   . GLN D 2 170 ? 5.401   -1.193  -24.992 1.00 18.16 ? 171 GLN B OE1   1 
ATOM   3867 N NE2   . GLN D 2 170 ? 7.327   -2.270  -24.600 1.00 16.96 ? 171 GLN B NE2   1 
ATOM   3868 N N     . ASP D 2 171 ? 3.322   -0.008  -23.093 1.00 17.33 ? 172 ASP B N     1 
ATOM   3869 C CA    . ASP D 2 171 ? 1.862   0.006   -23.134 1.00 16.54 ? 172 ASP B CA    1 
ATOM   3870 C C     . ASP D 2 171 ? 1.361   -1.199  -22.333 1.00 14.24 ? 172 ASP B C     1 
ATOM   3871 O O     . ASP D 2 171 ? 1.928   -2.290  -22.424 1.00 15.41 ? 172 ASP B O     1 
ATOM   3872 C CB    . ASP D 2 171 ? 1.361   -0.096  -24.578 1.00 18.83 ? 172 ASP B CB    1 
ATOM   3873 C CG    . ASP D 2 171 ? 1.710   1.126   -25.398 1.00 15.36 ? 172 ASP B CG    1 
ATOM   3874 O OD1   . ASP D 2 171 ? 0.930   2.084   -25.386 1.00 15.79 ? 172 ASP B OD1   1 
ATOM   3875 O OD2   . ASP D 2 171 ? 2.764   1.126   -26.049 1.00 24.91 ? 172 ASP B OD2   1 
ATOM   3876 N N     . LYS D 2 172 ? 0.301   -0.990  -21.560 1.00 13.92 ? 173 LYS B N     1 
ATOM   3877 C CA    . LYS D 2 172 ? -0.280  -2.042  -20.740 1.00 14.57 ? 173 LYS B CA    1 
ATOM   3878 C C     . LYS D 2 172 ? -0.636  -3.313  -21.518 1.00 15.45 ? 173 LYS B C     1 
ATOM   3879 O O     . LYS D 2 172 ? -0.250  -4.406  -21.113 1.00 15.69 ? 173 LYS B O     1 
ATOM   3880 C CB    . LYS D 2 172 ? -1.537  -1.533  -20.009 1.00 15.45 ? 173 LYS B CB    1 
ATOM   3881 C CG    . LYS D 2 172 ? -2.167  -2.590  -19.084 1.00 18.01 ? 173 LYS B CG    1 
ATOM   3882 C CD    . LYS D 2 172 ? -3.509  -2.173  -18.518 1.00 20.20 ? 173 LYS B CD    1 
ATOM   3883 C CE    . LYS D 2 172 ? -3.365  -1.157  -17.417 1.00 25.37 ? 173 LYS B CE    1 
ATOM   3884 N NZ    . LYS D 2 172 ? -4.652  -0.968  -16.672 1.00 23.27 ? 173 LYS B NZ    1 
ATOM   3885 N N     . TRP D 2 173 ? -1.359  -3.177  -22.630 1.00 15.75 ? 174 TRP B N     1 
ATOM   3886 C CA    . TRP D 2 173 ? -1.780  -4.353  -23.397 1.00 15.76 ? 174 TRP B CA    1 
ATOM   3887 C C     . TRP D 2 173 ? -0.642  -5.202  -23.929 1.00 16.72 ? 174 TRP B C     1 
ATOM   3888 O O     . TRP D 2 173 ? -0.778  -6.418  -24.053 1.00 18.93 ? 174 TRP B O     1 
ATOM   3889 C CB    . TRP D 2 173 ? -2.723  -3.947  -24.546 1.00 16.10 ? 174 TRP B CB    1 
ATOM   3890 C CG    . TRP D 2 173 ? -2.054  -3.393  -25.793 1.00 22.29 ? 174 TRP B CG    1 
ATOM   3891 C CD1   . TRP D 2 173 ? -1.860  -2.079  -26.107 1.00 16.92 ? 174 TRP B CD1   1 
ATOM   3892 C CD2   . TRP D 2 173 ? -1.540  -4.153  -26.906 1.00 21.13 ? 174 TRP B CD2   1 
ATOM   3893 N NE1   . TRP D 2 173 ? -1.263  -1.974  -27.344 1.00 19.17 ? 174 TRP B NE1   1 
ATOM   3894 C CE2   . TRP D 2 173 ? -1.057  -3.230  -27.855 1.00 21.27 ? 174 TRP B CE2   1 
ATOM   3895 C CE3   . TRP D 2 173 ? -1.445  -5.527  -27.190 1.00 19.96 ? 174 TRP B CE3   1 
ATOM   3896 C CZ2   . TRP D 2 173 ? -0.489  -3.633  -29.069 1.00 23.06 ? 174 TRP B CZ2   1 
ATOM   3897 C CZ3   . TRP D 2 173 ? -0.880  -5.927  -28.396 1.00 21.83 ? 174 TRP B CZ3   1 
ATOM   3898 C CH2   . TRP D 2 173 ? -0.410  -4.983  -29.319 1.00 23.00 ? 174 TRP B CH2   1 
ATOM   3899 N N     . VAL D 2 174 ? 0.482   -4.559  -24.233 1.00 16.76 ? 175 VAL B N     1 
ATOM   3900 C CA    . VAL D 2 174 ? 1.645   -5.244  -24.789 1.00 18.33 ? 175 VAL B CA    1 
ATOM   3901 C C     . VAL D 2 174 ? 2.305   -6.219  -23.817 1.00 21.24 ? 175 VAL B C     1 
ATOM   3902 O O     . VAL D 2 174 ? 2.843   -7.254  -24.233 1.00 18.70 ? 175 VAL B O     1 
ATOM   3903 C CB    . VAL D 2 174 ? 2.699   -4.211  -25.279 1.00 23.12 ? 175 VAL B CB    1 
ATOM   3904 C CG1   . VAL D 2 174 ? 3.947   -4.898  -25.747 1.00 18.68 ? 175 VAL B CG1   1 
ATOM   3905 C CG2   . VAL D 2 174 ? 2.125   -3.387  -26.407 1.00 25.03 ? 175 VAL B CG2   1 
ATOM   3906 N N     . ILE D 2 175 ? 2.264   -5.890  -22.525 1.00 21.15 ? 176 ILE B N     1 
ATOM   3907 C CA    . ILE D 2 175 ? 2.876   -6.738  -21.502 1.00 19.24 ? 176 ILE B CA    1 
ATOM   3908 C C     . ILE D 2 175 ? 1.887   -7.565  -20.675 1.00 17.01 ? 176 ILE B C     1 
ATOM   3909 O O     . ILE D 2 175 ? 2.286   -8.242  -19.736 1.00 18.06 ? 176 ILE B O     1 
ATOM   3910 C CB    . ILE D 2 175 ? 3.785   -5.905  -20.536 1.00 22.71 ? 176 ILE B CB    1 
ATOM   3911 C CG1   . ILE D 2 175 ? 2.985   -4.775  -19.871 1.00 22.08 ? 176 ILE B CG1   1 
ATOM   3912 C CG2   . ILE D 2 175 ? 4.985   -5.361  -21.297 1.00 22.82 ? 176 ILE B CG2   1 
ATOM   3913 C CD1   . ILE D 2 175 ? 3.762   -4.020  -18.805 1.00 17.84 ? 176 ILE B CD1   1 
ATOM   3914 N N     . ALA D 2 176 ? 0.609   -7.508  -21.026 1.00 17.37 ? 177 ALA B N     1 
ATOM   3915 C CA    . ALA D 2 176 ? -0.425  -8.257  -20.324 1.00 18.10 ? 177 ALA B CA    1 
ATOM   3916 C C     . ALA D 2 176 ? -0.318  -9.756  -20.616 1.00 19.81 ? 177 ALA B C     1 
ATOM   3917 O O     . ALA D 2 176 ? 0.032   -10.166 -21.728 1.00 20.69 ? 177 ALA B O     1 
ATOM   3918 C CB    . ALA D 2 176 ? -1.808  -7.740  -20.714 1.00 14.52 ? 177 ALA B CB    1 
ATOM   3919 N N     . GLY D 2 177 ? -0.611  -10.565 -19.600 1.00 16.94 ? 178 GLY B N     1 
ATOM   3920 C CA    . GLY D 2 177 ? -0.566  -12.009 -19.739 1.00 13.66 ? 178 GLY B CA    1 
ATOM   3921 C C     . GLY D 2 177 ? -1.990  -12.536 -19.789 1.00 14.57 ? 178 GLY B C     1 
ATOM   3922 O O     . GLY D 2 177 ? -2.943  -11.764 -19.938 1.00 13.94 ? 178 GLY B O     1 
ATOM   3923 N N     . ASP D 2 178 ? -2.149  -13.849 -19.665 1.00 16.29 ? 179 ASP B N     1 
ATOM   3924 C CA    . ASP D 2 178 ? -3.482  -14.450 -19.705 1.00 18.66 ? 179 ASP B CA    1 
ATOM   3925 C C     . ASP D 2 178 ? -3.930  -15.060 -18.375 1.00 17.89 ? 179 ASP B C     1 
ATOM   3926 O O     . ASP D 2 178 ? -5.016  -15.626 -18.288 1.00 16.61 ? 179 ASP B O     1 
ATOM   3927 C CB    . ASP D 2 178 ? -3.584  -15.491 -20.840 1.00 15.21 ? 179 ASP B CB    1 
ATOM   3928 C CG    . ASP D 2 178 ? -2.516  -16.581 -20.762 1.00 21.06 ? 179 ASP B CG    1 
ATOM   3929 O OD1   . ASP D 2 178 ? -1.567  -16.487 -19.954 1.00 22.61 ? 179 ASP B OD1   1 
ATOM   3930 O OD2   . ASP D 2 178 ? -2.631  -17.552 -21.532 1.00 19.15 ? 179 ASP B OD2   1 
ATOM   3931 N N     . LEU D 2 179 ? -3.092  -14.936 -17.347 1.00 17.66 ? 180 LEU B N     1 
ATOM   3932 C CA    . LEU D 2 179 ? -3.393  -15.461 -16.011 1.00 17.39 ? 180 LEU B CA    1 
ATOM   3933 C C     . LEU D 2 179 ? -3.557  -14.287 -15.039 1.00 18.79 ? 180 LEU B C     1 
ATOM   3934 O O     . LEU D 2 179 ? -2.812  -13.307 -15.129 1.00 20.60 ? 180 LEU B O     1 
ATOM   3935 C CB    . LEU D 2 179 ? -2.249  -16.359 -15.528 1.00 16.58 ? 180 LEU B CB    1 
ATOM   3936 C CG    . LEU D 2 179 ? -1.884  -17.582 -16.371 1.00 20.87 ? 180 LEU B CG    1 
ATOM   3937 C CD1   . LEU D 2 179 ? -0.722  -18.313 -15.711 1.00 23.58 ? 180 LEU B CD1   1 
ATOM   3938 C CD2   . LEU D 2 179 ? -3.089  -18.508 -16.529 1.00 25.74 ? 180 LEU B CD2   1 
ATOM   3939 N N     . ALA D 2 180 ? -4.519  -14.382 -14.122 1.00 16.50 ? 181 ALA B N     1 
ATOM   3940 C CA    . ALA D 2 180 ? -4.772  -13.322 -13.147 1.00 16.49 ? 181 ALA B CA    1 
ATOM   3941 C C     . ALA D 2 180 ? -3.544  -12.991 -12.297 1.00 16.16 ? 181 ALA B C     1 
ATOM   3942 O O     . ALA D 2 180 ? -2.727  -13.861 -12.005 1.00 16.48 ? 181 ALA B O     1 
ATOM   3943 C CB    . ALA D 2 180 ? -5.922  -13.713 -12.256 1.00 18.76 ? 181 ALA B CB    1 
ATOM   3944 N N     . GLY D 2 181 ? -3.420  -11.721 -11.917 1.00 17.70 ? 182 GLY B N     1 
ATOM   3945 C CA    . GLY D 2 181 ? -2.311  -11.268 -11.086 1.00 16.51 ? 182 GLY B CA    1 
ATOM   3946 C C     . GLY D 2 181 ? -2.605  -11.361 -9.592  1.00 15.81 ? 182 GLY B C     1 
ATOM   3947 O O     . GLY D 2 181 ? -1.690  -11.330 -8.770  1.00 15.21 ? 182 GLY B O     1 
ATOM   3948 N N     . SER D 2 182 ? -3.883  -11.462 -9.242  1.00 13.25 ? 183 SER B N     1 
ATOM   3949 C CA    . SER D 2 182 ? -4.310  -11.601 -7.849  1.00 13.72 ? 183 SER B CA    1 
ATOM   3950 C C     . SER D 2 182 ? -5.680  -12.280 -7.863  1.00 15.83 ? 183 SER B C     1 
ATOM   3951 O O     . SER D 2 182 ? -6.383  -12.251 -8.885  1.00 15.65 ? 183 SER B O     1 
ATOM   3952 C CB    . SER D 2 182 ? -4.379  -10.235 -7.151  1.00 10.97 ? 183 SER B CB    1 
ATOM   3953 O OG    . SER D 2 182 ? -5.407  -9.422  -7.687  1.00 13.56 ? 183 SER B OG    1 
ATOM   3954 N N     . GLY D 2 183 ? -6.065  -12.885 -6.741  1.00 15.76 ? 184 GLY B N     1 
ATOM   3955 C CA    . GLY D 2 183 ? -7.340  -13.574 -6.678  1.00 13.15 ? 184 GLY B CA    1 
ATOM   3956 C C     . GLY D 2 183 ? -8.498  -12.758 -6.154  1.00 16.29 ? 184 GLY B C     1 
ATOM   3957 O O     . GLY D 2 183 ? -9.371  -12.331 -6.923  1.00 16.71 ? 184 GLY B O     1 
ATOM   3958 N N     . ASN D 2 184 ? -8.522  -12.526 -4.844  1.00 14.81 ? 185 ASN B N     1 
ATOM   3959 C CA    . ASN D 2 184 ? -9.617  -11.771 -4.251  1.00 13.02 ? 185 ASN B CA    1 
ATOM   3960 C C     . ASN D 2 184 ? -9.703  -10.330 -4.737  1.00 13.39 ? 185 ASN B C     1 
ATOM   3961 O O     . ASN D 2 184 ? -10.774 -9.723  -4.685  1.00 15.12 ? 185 ASN B O     1 
ATOM   3962 C CB    . ASN D 2 184 ? -9.577  -11.837 -2.705  1.00 17.05 ? 185 ASN B CB    1 
ATOM   3963 C CG    . ASN D 2 184 ? -8.228  -11.426 -2.109  1.00 17.06 ? 185 ASN B CG    1 
ATOM   3964 O OD1   . ASN D 2 184 ? -7.327  -10.938 -2.808  1.00 14.02 ? 185 ASN B OD1   1 
ATOM   3965 N ND2   . ASN D 2 184 ? -8.082  -11.632 -0.800  1.00 14.32 ? 185 ASN B ND2   1 
ATOM   3966 N N     . THR D 2 185 ? -8.590  -9.773  -5.218  1.00 16.42 ? 186 THR B N     1 
ATOM   3967 C CA    . THR D 2 185 ? -8.593  -8.390  -5.706  1.00 16.71 ? 186 THR B CA    1 
ATOM   3968 C C     . THR D 2 185 ? -8.621  -8.288  -7.239  1.00 19.02 ? 186 THR B C     1 
ATOM   3969 O O     . THR D 2 185 ? -8.315  -7.233  -7.814  1.00 18.37 ? 186 THR B O     1 
ATOM   3970 C CB    . THR D 2 185 ? -7.398  -7.598  -5.140  1.00 14.32 ? 186 THR B CB    1 
ATOM   3971 O OG1   . THR D 2 185 ? -6.194  -8.343  -5.351  1.00 12.49 ? 186 THR B OG1   1 
ATOM   3972 C CG2   . THR D 2 185 ? -7.589  -7.356  -3.651  1.00 16.17 ? 186 THR B CG2   1 
ATOM   3973 N N     . THR D 2 186 ? -8.982  -9.403  -7.874  1.00 17.80 ? 187 THR B N     1 
ATOM   3974 C CA    . THR D 2 186 ? -9.152  -9.534  -9.320  1.00 14.23 ? 187 THR B CA    1 
ATOM   3975 C C     . THR D 2 186 ? -8.303  -8.638  -10.236 1.00 12.95 ? 187 THR B C     1 
ATOM   3976 O O     . THR D 2 186 ? -8.833  -7.784  -10.955 1.00 13.67 ? 187 THR B O     1 
ATOM   3977 C CB    . THR D 2 186 ? -10.649 -9.349  -9.678  1.00 14.09 ? 187 THR B CB    1 
ATOM   3978 O OG1   . THR D 2 186 ? -11.122 -8.100  -9.153  1.00 14.89 ? 187 THR B OG1   1 
ATOM   3979 C CG2   . THR D 2 186 ? -11.486 -10.483 -9.094  1.00 12.17 ? 187 THR B CG2   1 
ATOM   3980 N N     . ASN D 2 187 ? -6.992  -8.838  -10.213 1.00 12.88 ? 188 ASN B N     1 
ATOM   3981 C CA    . ASN D 2 187 ? -6.091  -8.046  -11.038 1.00 13.50 ? 188 ASN B CA    1 
ATOM   3982 C C     . ASN D 2 187 ? -5.627  -8.806  -12.256 1.00 17.62 ? 188 ASN B C     1 
ATOM   3983 O O     . ASN D 2 187 ? -5.502  -10.034 -12.231 1.00 16.33 ? 188 ASN B O     1 
ATOM   3984 C CB    . ASN D 2 187 ? -4.835  -7.639  -10.258 1.00 10.37 ? 188 ASN B CB    1 
ATOM   3985 C CG    . ASN D 2 187 ? -4.873  -6.199  -9.781  1.00 15.61 ? 188 ASN B CG    1 
ATOM   3986 O OD1   . ASN D 2 187 ? -3.965  -5.423  -10.077 1.00 14.03 ? 188 ASN B OD1   1 
ATOM   3987 N ND2   . ASN D 2 187 ? -5.916  -5.834  -9.037  1.00 9.62  ? 188 ASN B ND2   1 
ATOM   3988 N N     . ILE D 2 188 ? -5.363  -8.056  -13.319 1.00 19.19 ? 189 ILE B N     1 
ATOM   3989 C CA    . ILE D 2 188 ? -4.838  -8.594  -14.558 1.00 14.88 ? 189 ILE B CA    1 
ATOM   3990 C C     . ILE D 2 188 ? -3.372  -8.919  -14.247 1.00 16.13 ? 189 ILE B C     1 
ATOM   3991 O O     . ILE D 2 188 ? -2.689  -8.158  -13.544 1.00 15.67 ? 189 ILE B O     1 
ATOM   3992 C CB    . ILE D 2 188 ? -4.903  -7.521  -15.670 1.00 17.44 ? 189 ILE B CB    1 
ATOM   3993 C CG1   . ILE D 2 188 ? -6.363  -7.258  -16.052 1.00 17.78 ? 189 ILE B CG1   1 
ATOM   3994 C CG2   . ILE D 2 188 ? -4.074  -7.945  -16.875 1.00 14.55 ? 189 ILE B CG2   1 
ATOM   3995 C CD1   . ILE D 2 188 ? -6.554  -6.046  -16.947 1.00 21.02 ? 189 ILE B CD1   1 
ATOM   3996 N N     . GLY D 2 189 ? -2.888  -10.045 -14.748 1.00 13.73 ? 190 GLY B N     1 
ATOM   3997 C CA    . GLY D 2 189 ? -1.503  -10.399 -14.518 1.00 14.43 ? 190 GLY B CA    1 
ATOM   3998 C C     . GLY D 2 189 ? -0.706  -10.076 -15.767 1.00 16.13 ? 190 GLY B C     1 
ATOM   3999 O O     . GLY D 2 189 ? -1.248  -10.129 -16.871 1.00 16.25 ? 190 GLY B O     1 
ATOM   4000 N N     . SER D 2 190 ? 0.566   -9.728  -15.609 1.00 14.57 ? 191 SER B N     1 
ATOM   4001 C CA    . SER D 2 190 ? 1.416   -9.441  -16.760 1.00 15.65 ? 191 SER B CA    1 
ATOM   4002 C C     . SER D 2 190 ? 2.070   -10.753 -17.186 1.00 19.10 ? 191 SER B C     1 
ATOM   4003 O O     . SER D 2 190 ? 1.865   -11.795 -16.556 1.00 17.84 ? 191 SER B O     1 
ATOM   4004 C CB    . SER D 2 190 ? 2.514   -8.437  -16.384 1.00 11.57 ? 191 SER B CB    1 
ATOM   4005 O OG    . SER D 2 190 ? 3.550   -9.050  -15.627 1.00 15.12 ? 191 SER B OG    1 
ATOM   4006 N N     . ILE D 2 191 ? 2.858   -10.702 -18.254 1.00 17.62 ? 192 ILE B N     1 
ATOM   4007 C CA    . ILE D 2 191 ? 3.588   -11.877 -18.697 1.00 19.80 ? 192 ILE B CA    1 
ATOM   4008 C C     . ILE D 2 191 ? 4.601   -12.182 -17.587 1.00 21.35 ? 192 ILE B C     1 
ATOM   4009 O O     . ILE D 2 191 ? 4.980   -11.290 -16.814 1.00 22.59 ? 192 ILE B O     1 
ATOM   4010 C CB    . ILE D 2 191 ? 4.370   -11.598 -20.033 1.00 25.25 ? 192 ILE B CB    1 
ATOM   4011 C CG1   . ILE D 2 191 ? 5.215   -10.321 -19.897 1.00 22.93 ? 192 ILE B CG1   1 
ATOM   4012 C CG2   . ILE D 2 191 ? 3.392   -11.502 -21.219 1.00 18.88 ? 192 ILE B CG2   1 
ATOM   4013 C CD1   . ILE D 2 191 ? 6.040   -9.970  -21.117 1.00 22.45 ? 192 ILE B CD1   1 
ATOM   4014 N N     . HIS D 2 192 ? 5.032   -13.431 -17.491 1.00 21.74 ? 193 HIS B N     1 
ATOM   4015 C CA    . HIS D 2 192 ? 6.028   -13.811 -16.500 1.00 26.08 ? 193 HIS B CA    1 
ATOM   4016 C C     . HIS D 2 192 ? 7.293   -13.945 -17.336 1.00 28.40 ? 193 HIS B C     1 
ATOM   4017 O O     . HIS D 2 192 ? 7.503   -14.973 -17.978 1.00 27.77 ? 193 HIS B O     1 
ATOM   4018 C CB    . HIS D 2 192 ? 5.657   -15.146 -15.845 1.00 30.32 ? 193 HIS B CB    1 
ATOM   4019 C CG    . HIS D 2 192 ? 6.595   -15.566 -14.755 1.00 44.58 ? 193 HIS B CG    1 
ATOM   4020 N ND1   . HIS D 2 192 ? 7.118   -14.679 -13.836 1.00 49.69 ? 193 HIS B ND1   1 
ATOM   4021 C CD2   . HIS D 2 192 ? 7.109   -16.778 -14.437 1.00 49.47 ? 193 HIS B CD2   1 
ATOM   4022 C CE1   . HIS D 2 192 ? 7.911   -15.323 -13.001 1.00 48.29 ? 193 HIS B CE1   1 
ATOM   4023 N NE2   . HIS D 2 192 ? 7.923   -16.599 -13.344 1.00 53.76 ? 193 HIS B NE2   1 
ATOM   4024 N N     . ALA D 2 193 ? 8.133   -12.912 -17.331 1.00 27.82 ? 194 ALA B N     1 
ATOM   4025 C CA    . ALA D 2 193 ? 9.330   -12.924 -18.162 1.00 29.37 ? 194 ALA B CA    1 
ATOM   4026 C C     . ALA D 2 193 ? 10.475  -12.078 -17.629 1.00 29.62 ? 194 ALA B C     1 
ATOM   4027 O O     . ALA D 2 193 ? 10.388  -11.511 -16.549 1.00 29.51 ? 194 ALA B O     1 
ATOM   4028 C CB    . ALA D 2 193 ? 8.960   -12.451 -19.559 1.00 23.94 ? 194 ALA B CB    1 
ATOM   4029 N N     . HIS D 2 194 ? 11.556  -12.006 -18.401 1.00 29.42 ? 195 HIS B N     1 
ATOM   4030 C CA    . HIS D 2 194 ? 12.728  -11.211 -18.027 1.00 31.09 ? 195 HIS B CA    1 
ATOM   4031 C C     . HIS D 2 194 ? 12.506  -9.745  -18.371 1.00 28.75 ? 195 HIS B C     1 
ATOM   4032 O O     . HIS D 2 194 ? 11.719  -9.429  -19.261 1.00 29.49 ? 195 HIS B O     1 
ATOM   4033 C CB    . HIS D 2 194 ? 13.981  -11.702 -18.762 1.00 35.42 ? 195 HIS B CB    1 
ATOM   4034 C CG    . HIS D 2 194 ? 14.382  -13.095 -18.404 1.00 40.59 ? 195 HIS B CG    1 
ATOM   4035 N ND1   . HIS D 2 194 ? 14.915  -13.426 -17.174 1.00 43.43 ? 195 HIS B ND1   1 
ATOM   4036 C CD2   . HIS D 2 194 ? 14.322  -14.249 -19.109 1.00 44.71 ? 195 HIS B CD2   1 
ATOM   4037 C CE1   . HIS D 2 194 ? 15.162  -14.722 -17.138 1.00 44.20 ? 195 HIS B CE1   1 
ATOM   4038 N NE2   . HIS D 2 194 ? 14.811  -15.244 -18.299 1.00 50.95 ? 195 HIS B NE2   1 
ATOM   4039 N N     . TYR D 2 195 ? 13.211  -8.863  -17.669 1.00 27.83 ? 196 TYR B N     1 
ATOM   4040 C CA    . TYR D 2 195 ? 13.120  -7.420  -17.883 1.00 27.60 ? 196 TYR B CA    1 
ATOM   4041 C C     . TYR D 2 195 ? 13.183  -7.026  -19.373 1.00 27.87 ? 196 TYR B C     1 
ATOM   4042 O O     . TYR D 2 195 ? 12.396  -6.195  -19.829 1.00 28.22 ? 196 TYR B O     1 
ATOM   4043 C CB    . TYR D 2 195 ? 14.237  -6.731  -17.086 1.00 24.01 ? 196 TYR B CB    1 
ATOM   4044 C CG    . TYR D 2 195 ? 14.466  -5.274  -17.422 1.00 26.88 ? 196 TYR B CG    1 
ATOM   4045 C CD1   . TYR D 2 195 ? 13.596  -4.278  -16.968 1.00 24.99 ? 196 TYR B CD1   1 
ATOM   4046 C CD2   . TYR D 2 195 ? 15.557  -4.889  -18.198 1.00 26.89 ? 196 TYR B CD2   1 
ATOM   4047 C CE1   . TYR D 2 195 ? 13.809  -2.937  -17.280 1.00 20.34 ? 196 TYR B CE1   1 
ATOM   4048 C CE2   . TYR D 2 195 ? 15.778  -3.549  -18.514 1.00 25.66 ? 196 TYR B CE2   1 
ATOM   4049 C CZ    . TYR D 2 195 ? 14.904  -2.582  -18.055 1.00 25.29 ? 196 TYR B CZ    1 
ATOM   4050 O OH    . TYR D 2 195 ? 15.132  -1.268  -18.392 1.00 28.46 ? 196 TYR B OH    1 
ATOM   4051 N N     . LYS D 2 196 ? 14.111  -7.625  -20.120 1.00 29.33 ? 197 LYS B N     1 
ATOM   4052 C CA    . LYS D 2 196 ? 14.286  -7.354  -21.553 1.00 31.10 ? 197 LYS B CA    1 
ATOM   4053 C C     . LYS D 2 196 ? 12.977  -7.517  -22.345 1.00 31.44 ? 197 LYS B C     1 
ATOM   4054 O O     . LYS D 2 196 ? 12.672  -6.703  -23.229 1.00 32.34 ? 197 LYS B O     1 
ATOM   4055 C CB    . LYS D 2 196 ? 15.367  -8.288  -22.125 1.00 35.65 ? 197 LYS B CB    1 
ATOM   4056 C CG    . LYS D 2 196 ? 15.774  -8.028  -23.577 1.00 50.13 ? 197 LYS B CG    1 
ATOM   4057 C CD    . LYS D 2 196 ? 16.870  -9.015  -24.016 1.00 63.90 ? 197 LYS B CD    1 
ATOM   4058 C CE    . LYS D 2 196 ? 17.696  -8.514  -25.225 1.00 66.52 ? 197 LYS B CE    1 
ATOM   4059 N NZ    . LYS D 2 196 ? 17.141  -8.857  -26.574 1.00 63.94 ? 197 LYS B NZ    1 
ATOM   4060 N N     . ASP D 2 197 ? 12.206  -8.558  -22.021 1.00 29.29 ? 198 ASP B N     1 
ATOM   4061 C CA    . ASP D 2 197 ? 10.939  -8.827  -22.705 1.00 28.09 ? 198 ASP B CA    1 
ATOM   4062 C C     . ASP D 2 197 ? 9.904   -7.726  -22.504 1.00 27.28 ? 198 ASP B C     1 
ATOM   4063 O O     . ASP D 2 197 ? 9.093   -7.468  -23.391 1.00 26.55 ? 198 ASP B O     1 
ATOM   4064 C CB    . ASP D 2 197 ? 10.356  -10.177 -22.264 1.00 32.97 ? 198 ASP B CB    1 
ATOM   4065 C CG    . ASP D 2 197 ? 11.214  -11.355 -22.695 1.00 40.91 ? 198 ASP B CG    1 
ATOM   4066 O OD1   . ASP D 2 197 ? 11.890  -11.255 -23.739 1.00 42.55 ? 198 ASP B OD1   1 
ATOM   4067 O OD2   . ASP D 2 197 ? 11.215  -12.386 -21.988 1.00 50.34 ? 198 ASP B OD2   1 
ATOM   4068 N N     . PHE D 2 198 ? 9.927   -7.077  -21.343 1.00 26.73 ? 199 PHE B N     1 
ATOM   4069 C CA    . PHE D 2 198 ? 8.988   -5.990  -21.067 1.00 26.34 ? 199 PHE B CA    1 
ATOM   4070 C C     . PHE D 2 198 ? 9.412   -4.770  -21.887 1.00 27.39 ? 199 PHE B C     1 
ATOM   4071 O O     . PHE D 2 198 ? 8.570   -4.073  -22.477 1.00 25.59 ? 199 PHE B O     1 
ATOM   4072 C CB    . PHE D 2 198 ? 8.981   -5.644  -19.570 1.00 26.69 ? 199 PHE B CB    1 
ATOM   4073 C CG    . PHE D 2 198 ? 8.330   -6.688  -18.707 1.00 19.13 ? 199 PHE B CG    1 
ATOM   4074 C CD1   . PHE D 2 198 ? 9.067   -7.750  -18.205 1.00 19.43 ? 199 PHE B CD1   1 
ATOM   4075 C CD2   . PHE D 2 198 ? 6.976   -6.610  -18.405 1.00 19.78 ? 199 PHE B CD2   1 
ATOM   4076 C CE1   . PHE D 2 198 ? 8.466   -8.723  -17.415 1.00 21.48 ? 199 PHE B CE1   1 
ATOM   4077 C CE2   . PHE D 2 198 ? 6.367   -7.579  -17.616 1.00 18.36 ? 199 PHE B CE2   1 
ATOM   4078 C CZ    . PHE D 2 198 ? 7.118   -8.639  -17.121 1.00 14.56 ? 199 PHE B CZ    1 
ATOM   4079 N N     . VAL D 2 199 ? 10.721  -4.520  -21.924 1.00 27.09 ? 200 VAL B N     1 
ATOM   4080 C CA    . VAL D 2 199 ? 11.258  -3.391  -22.683 1.00 28.90 ? 200 VAL B CA    1 
ATOM   4081 C C     . VAL D 2 199 ? 10.904  -3.546  -24.165 1.00 30.12 ? 200 VAL B C     1 
ATOM   4082 O O     . VAL D 2 199 ? 10.379  -2.621  -24.782 1.00 31.61 ? 200 VAL B O     1 
ATOM   4083 C CB    . VAL D 2 199 ? 12.794  -3.299  -22.553 1.00 29.32 ? 200 VAL B CB    1 
ATOM   4084 C CG1   . VAL D 2 199 ? 13.318  -2.132  -23.373 1.00 23.97 ? 200 VAL B CG1   1 
ATOM   4085 C CG2   . VAL D 2 199 ? 13.189  -3.143  -21.092 1.00 29.73 ? 200 VAL B CG2   1 
ATOM   4086 N N     . GLU D 2 200 ? 11.183  -4.721  -24.721 1.00 32.41 ? 201 GLU B N     1 
ATOM   4087 C CA    . GLU D 2 200 ? 10.907  -4.995  -26.133 1.00 35.56 ? 201 GLU B CA    1 
ATOM   4088 C C     . GLU D 2 200 ? 9.457   -5.319  -26.471 1.00 34.45 ? 201 GLU B C     1 
ATOM   4089 O O     . GLU D 2 200 ? 9.110   -5.448  -27.642 1.00 34.77 ? 201 GLU B O     1 
ATOM   4090 C CB    . GLU D 2 200 ? 11.823  -6.106  -26.628 1.00 37.89 ? 201 GLU B CB    1 
ATOM   4091 C CG    . GLU D 2 200 ? 13.270  -5.672  -26.632 1.00 48.95 ? 201 GLU B CG    1 
ATOM   4092 C CD    . GLU D 2 200 ? 14.242  -6.805  -26.872 1.00 56.19 ? 201 GLU B CD    1 
ATOM   4093 O OE1   . GLU D 2 200 ? 13.801  -7.934  -27.192 1.00 53.71 ? 201 GLU B OE1   1 
ATOM   4094 O OE2   . GLU D 2 200 ? 15.461  -6.554  -26.736 1.00 58.86 ? 201 GLU B OE2   1 
ATOM   4095 N N     . GLY D 2 201 ? 8.625   -5.453  -25.443 1.00 32.54 ? 202 GLY B N     1 
ATOM   4096 C CA    . GLY D 2 201 ? 7.217   -5.734  -25.644 1.00 31.99 ? 202 GLY B CA    1 
ATOM   4097 C C     . GLY D 2 201 ? 6.851   -7.071  -26.262 1.00 32.71 ? 202 GLY B C     1 
ATOM   4098 O O     . GLY D 2 201 ? 6.030   -7.131  -27.183 1.00 34.24 ? 202 GLY B O     1 
ATOM   4099 N N     . LYS D 2 202 ? 7.446   -8.147  -25.765 1.00 31.81 ? 203 LYS B N     1 
ATOM   4100 C CA    . LYS D 2 202 ? 7.148   -9.478  -26.277 1.00 33.78 ? 203 LYS B CA    1 
ATOM   4101 C C     . LYS D 2 202 ? 5.981   -10.074 -25.491 1.00 32.67 ? 203 LYS B C     1 
ATOM   4102 O O     . LYS D 2 202 ? 6.173   -10.920 -24.615 1.00 33.46 ? 203 LYS B O     1 
ATOM   4103 C CB    . LYS D 2 202 ? 8.379   -10.380 -26.173 1.00 39.02 ? 203 LYS B CB    1 
ATOM   4104 C CG    . LYS D 2 202 ? 9.519   -9.984  -27.093 1.00 48.21 ? 203 LYS B CG    1 
ATOM   4105 C CD    . LYS D 2 202 ? 10.661  -10.969 -26.952 1.00 56.38 ? 203 LYS B CD    1 
ATOM   4106 C CE    . LYS D 2 202 ? 11.868  -10.558 -27.782 1.00 66.99 ? 203 LYS B CE    1 
ATOM   4107 N NZ    . LYS D 2 202 ? 13.049  -11.453 -27.527 1.00 66.10 ? 203 LYS B NZ    1 
ATOM   4108 N N     . GLY D 2 203 ? 4.773   -9.620  -25.811 1.00 32.93 ? 204 GLY B N     1 
ATOM   4109 C CA    . GLY D 2 203 ? 3.584   -10.097 -25.125 1.00 30.76 ? 204 GLY B CA    1 
ATOM   4110 C C     . GLY D 2 203 ? 2.913   -11.282 -25.790 1.00 28.06 ? 204 GLY B C     1 
ATOM   4111 O O     . GLY D 2 203 ? 3.474   -11.909 -26.688 1.00 27.28 ? 204 GLY B O     1 
ATOM   4112 N N     . ILE D 2 204 ? 1.701   -11.594 -25.350 1.00 26.62 ? 205 ILE B N     1 
ATOM   4113 C CA    . ILE D 2 204 ? 0.972   -12.719 -25.915 1.00 26.07 ? 205 ILE B CA    1 
ATOM   4114 C C     . ILE D 2 204 ? -0.272  -12.320 -26.714 1.00 24.57 ? 205 ILE B C     1 
ATOM   4115 O O     . ILE D 2 204 ? -0.757  -13.095 -27.543 1.00 23.86 ? 205 ILE B O     1 
ATOM   4116 C CB    . ILE D 2 204 ? 0.578   -13.747 -24.832 1.00 27.63 ? 205 ILE B CB    1 
ATOM   4117 C CG1   . ILE D 2 204 ? -0.423  -13.141 -23.861 1.00 27.36 ? 205 ILE B CG1   1 
ATOM   4118 C CG2   . ILE D 2 204 ? 1.814   -14.222 -24.088 1.00 34.84 ? 205 ILE B CG2   1 
ATOM   4119 C CD1   . ILE D 2 204 ? -0.887  -14.114 -22.831 1.00 33.66 ? 205 ILE B CD1   1 
ATOM   4120 N N     . PHE D 2 205 ? -0.792  -11.121 -26.474 1.00 19.41 ? 206 PHE B N     1 
ATOM   4121 C CA    . PHE D 2 205 ? -1.964  -10.677 -27.204 1.00 20.14 ? 206 PHE B CA    1 
ATOM   4122 C C     . PHE D 2 205 ? -1.589  -10.118 -28.576 1.00 20.53 ? 206 PHE B C     1 
ATOM   4123 O O     . PHE D 2 205 ? -0.546  -9.490  -28.729 1.00 18.62 ? 206 PHE B O     1 
ATOM   4124 C CB    . PHE D 2 205 ? -2.741  -9.647  -26.386 1.00 18.38 ? 206 PHE B CB    1 
ATOM   4125 C CG    . PHE D 2 205 ? -3.435  -10.240 -25.200 1.00 22.36 ? 206 PHE B CG    1 
ATOM   4126 C CD1   . PHE D 2 205 ? -4.530  -11.087 -25.376 1.00 18.53 ? 206 PHE B CD1   1 
ATOM   4127 C CD2   . PHE D 2 205 ? -2.986  -9.975  -23.909 1.00 19.58 ? 206 PHE B CD2   1 
ATOM   4128 C CE1   . PHE D 2 205 ? -5.169  -11.667 -24.278 1.00 21.47 ? 206 PHE B CE1   1 
ATOM   4129 C CE2   . PHE D 2 205 ? -3.618  -10.550 -22.807 1.00 18.01 ? 206 PHE B CE2   1 
ATOM   4130 C CZ    . PHE D 2 205 ? -4.710  -11.398 -22.992 1.00 17.55 ? 206 PHE B CZ    1 
ATOM   4131 N N     . ASP D 2 206 ? -2.452  -10.365 -29.564 1.00 22.73 ? 207 ASP B N     1 
ATOM   4132 C CA    . ASP D 2 206 ? -2.256  -9.901  -30.943 1.00 24.40 ? 207 ASP B CA    1 
ATOM   4133 C C     . ASP D 2 206 ? -2.623  -8.442  -31.134 1.00 24.50 ? 207 ASP B C     1 
ATOM   4134 O O     . ASP D 2 206 ? -2.186  -7.810  -32.093 1.00 25.38 ? 207 ASP B O     1 
ATOM   4135 C CB    . ASP D 2 206 ? -3.095  -10.730 -31.919 1.00 28.17 ? 207 ASP B CB    1 
ATOM   4136 C CG    . ASP D 2 206 ? -2.472  -12.080 -32.231 1.00 34.87 ? 207 ASP B CG    1 
ATOM   4137 O OD1   . ASP D 2 206 ? -1.238  -12.231 -32.076 1.00 42.62 ? 207 ASP B OD1   1 
ATOM   4138 O OD2   . ASP D 2 206 ? -3.225  -12.992 -32.634 1.00 42.24 ? 207 ASP B OD2   1 
ATOM   4139 N N     . SER D 2 207 ? -3.427  -7.910  -30.223 1.00 21.67 ? 208 SER B N     1 
ATOM   4140 C CA    . SER D 2 207 ? -3.854  -6.532  -30.318 1.00 18.62 ? 208 SER B CA    1 
ATOM   4141 C C     . SER D 2 207 ? -4.422  -6.086  -28.987 1.00 18.73 ? 208 SER B C     1 
ATOM   4142 O O     . SER D 2 207 ? -4.669  -6.906  -28.101 1.00 19.81 ? 208 SER B O     1 
ATOM   4143 C CB    . SER D 2 207 ? -4.937  -6.409  -31.388 1.00 17.82 ? 208 SER B CB    1 
ATOM   4144 O OG    . SER D 2 207 ? -6.108  -7.116  -31.010 1.00 19.54 ? 208 SER B OG    1 
ATOM   4145 N N     . GLU D 2 208 ? -4.630  -4.784  -28.853 1.00 17.56 ? 209 GLU B N     1 
ATOM   4146 C CA    . GLU D 2 208 ? -5.205  -4.228  -27.650 1.00 16.19 ? 209 GLU B CA    1 
ATOM   4147 C C     . GLU D 2 208 ? -6.681  -4.641  -27.594 1.00 17.08 ? 209 GLU B C     1 
ATOM   4148 O O     . GLU D 2 208 ? -7.243  -4.824  -26.515 1.00 14.84 ? 209 GLU B O     1 
ATOM   4149 C CB    . GLU D 2 208 ? -5.054  -2.716  -27.661 1.00 18.99 ? 209 GLU B CB    1 
ATOM   4150 C CG    . GLU D 2 208 ? -5.537  -2.037  -26.404 1.00 21.57 ? 209 GLU B CG    1 
ATOM   4151 C CD    . GLU D 2 208 ? -5.119  -0.588  -26.333 1.00 29.40 ? 209 GLU B CD    1 
ATOM   4152 O OE1   . GLU D 2 208 ? -4.779  0.000   -27.380 1.00 25.46 ? 209 GLU B OE1   1 
ATOM   4153 O OE2   . GLU D 2 208 ? -5.127  -0.028  -25.223 1.00 28.04 ? 209 GLU B OE2   1 
ATOM   4154 N N     . ASP D 2 209 ? -7.308  -4.796  -28.758 1.00 15.56 ? 210 ASP B N     1 
ATOM   4155 C CA    . ASP D 2 209 ? -8.706  -5.227  -28.820 1.00 15.62 ? 210 ASP B CA    1 
ATOM   4156 C C     . ASP D 2 209 ? -8.847  -6.640  -28.220 1.00 15.10 ? 210 ASP B C     1 
ATOM   4157 O O     . ASP D 2 209 ? -9.819  -6.928  -27.514 1.00 15.06 ? 210 ASP B O     1 
ATOM   4158 C CB    . ASP D 2 209 ? -9.201  -5.243  -30.271 1.00 19.67 ? 210 ASP B CB    1 
ATOM   4159 C CG    . ASP D 2 209 ? -10.669 -5.608  -30.381 1.00 27.67 ? 210 ASP B CG    1 
ATOM   4160 O OD1   . ASP D 2 209 ? -11.517 -4.818  -29.918 1.00 32.58 ? 210 ASP B OD1   1 
ATOM   4161 O OD2   . ASP D 2 209 ? -10.979 -6.686  -30.927 1.00 35.77 ? 210 ASP B OD2   1 
ATOM   4162 N N     . GLU D 2 210 ? -7.881  -7.513  -28.506 1.00 14.43 ? 211 GLU B N     1 
ATOM   4163 C CA    . GLU D 2 210 ? -7.904  -8.877  -27.985 1.00 16.30 ? 211 GLU B CA    1 
ATOM   4164 C C     . GLU D 2 210 ? -7.638  -8.877  -26.476 1.00 18.09 ? 211 GLU B C     1 
ATOM   4165 O O     . GLU D 2 210 ? -8.289  -9.605  -25.727 1.00 16.90 ? 211 GLU B O     1 
ATOM   4166 C CB    . GLU D 2 210 ? -6.871  -9.754  -28.684 1.00 13.60 ? 211 GLU B CB    1 
ATOM   4167 C CG    . GLU D 2 210 ? -7.062  -11.218 -28.348 1.00 14.22 ? 211 GLU B CG    1 
ATOM   4168 C CD    . GLU D 2 210 ? -6.087  -12.127 -29.045 1.00 21.40 ? 211 GLU B CD    1 
ATOM   4169 O OE1   . GLU D 2 210 ? -4.874  -11.828 -29.037 1.00 21.56 ? 211 GLU B OE1   1 
ATOM   4170 O OE2   . GLU D 2 210 ? -6.535  -13.154 -29.600 1.00 24.08 ? 211 GLU B OE2   1 
ATOM   4171 N N     . PHE D 2 211 ? -6.677  -8.059  -26.047 1.00 18.21 ? 212 PHE B N     1 
ATOM   4172 C CA    . PHE D 2 211 ? -6.342  -7.913  -24.635 1.00 14.97 ? 212 PHE B CA    1 
ATOM   4173 C C     . PHE D 2 211 ? -7.609  -7.528  -23.857 1.00 14.25 ? 212 PHE B C     1 
ATOM   4174 O O     . PHE D 2 211 ? -7.931  -8.141  -22.841 1.00 15.69 ? 212 PHE B O     1 
ATOM   4175 C CB    . PHE D 2 211 ? -5.245  -6.849  -24.479 1.00 16.61 ? 212 PHE B CB    1 
ATOM   4176 C CG    . PHE D 2 211 ? -5.239  -6.159  -23.139 1.00 15.00 ? 212 PHE B CG    1 
ATOM   4177 C CD1   . PHE D 2 211 ? -4.751  -6.802  -22.006 1.00 23.36 ? 212 PHE B CD1   1 
ATOM   4178 C CD2   . PHE D 2 211 ? -5.728  -4.866  -23.014 1.00 14.58 ? 212 PHE B CD2   1 
ATOM   4179 C CE1   . PHE D 2 211 ? -4.752  -6.162  -20.757 1.00 15.52 ? 212 PHE B CE1   1 
ATOM   4180 C CE2   . PHE D 2 211 ? -5.735  -4.218  -21.777 1.00 18.42 ? 212 PHE B CE2   1 
ATOM   4181 C CZ    . PHE D 2 211 ? -5.244  -4.872  -20.644 1.00 15.87 ? 212 PHE B CZ    1 
ATOM   4182 N N     . LEU D 2 212 ? -8.330  -6.522  -24.343 1.00 14.26 ? 213 LEU B N     1 
ATOM   4183 C CA    . LEU D 2 212 ? -9.552  -6.064  -23.689 1.00 15.82 ? 213 LEU B CA    1 
ATOM   4184 C C     . LEU D 2 212 ? -10.684 -7.095  -23.685 1.00 18.84 ? 213 LEU B C     1 
ATOM   4185 O O     . LEU D 2 212 ? -11.353 -7.285  -22.661 1.00 16.62 ? 213 LEU B O     1 
ATOM   4186 C CB    . LEU D 2 212 ? -10.041 -4.749  -24.310 1.00 17.28 ? 213 LEU B CB    1 
ATOM   4187 C CG    . LEU D 2 212 ? -9.327  -3.454  -23.906 1.00 19.44 ? 213 LEU B CG    1 
ATOM   4188 C CD1   . LEU D 2 212 ? -9.847  -2.313  -24.761 1.00 19.61 ? 213 LEU B CD1   1 
ATOM   4189 C CD2   . LEU D 2 212 ? -9.559  -3.161  -22.426 1.00 20.49 ? 213 LEU B CD2   1 
ATOM   4190 N N     . ASP D 2 213 ? -10.904 -7.764  -24.815 1.00 17.31 ? 214 ASP B N     1 
ATOM   4191 C CA    . ASP D 2 213 ? -11.959 -8.771  -24.901 1.00 17.39 ? 214 ASP B CA    1 
ATOM   4192 C C     . ASP D 2 213 ? -11.677 -9.936  -23.942 1.00 15.84 ? 214 ASP B C     1 
ATOM   4193 O O     . ASP D 2 213 ? -12.583 -10.428 -23.274 1.00 15.49 ? 214 ASP B O     1 
ATOM   4194 C CB    . ASP D 2 213 ? -12.091 -9.306  -26.330 1.00 18.83 ? 214 ASP B CB    1 
ATOM   4195 C CG    . ASP D 2 213 ? -13.352 -10.132 -26.525 1.00 19.27 ? 214 ASP B CG    1 
ATOM   4196 O OD1   . ASP D 2 213 ? -14.437 -9.617  -26.191 1.00 17.31 ? 214 ASP B OD1   1 
ATOM   4197 O OD2   . ASP D 2 213 ? -13.263 -11.280 -27.002 1.00 23.22 ? 214 ASP B OD2   1 
ATOM   4198 N N     . TYR D 2 214 ? -10.421 -10.366 -23.880 1.00 13.02 ? 215 TYR B N     1 
ATOM   4199 C CA    . TYR D 2 214 ? -10.018 -11.447 -23.002 1.00 14.26 ? 215 TYR B CA    1 
ATOM   4200 C C     . TYR D 2 214 ? -10.321 -11.105 -21.527 1.00 17.88 ? 215 TYR B C     1 
ATOM   4201 O O     . TYR D 2 214 ? -10.953 -11.888 -20.807 1.00 14.10 ? 215 TYR B O     1 
ATOM   4202 C CB    . TYR D 2 214 ? -8.521  -11.715 -23.160 1.00 14.71 ? 215 TYR B CB    1 
ATOM   4203 C CG    . TYR D 2 214 ? -8.027  -12.878 -22.332 1.00 22.55 ? 215 TYR B CG    1 
ATOM   4204 C CD1   . TYR D 2 214 ? -7.664  -12.709 -20.985 1.00 18.46 ? 215 TYR B CD1   1 
ATOM   4205 C CD2   . TYR D 2 214 ? -7.951  -14.159 -22.883 1.00 18.85 ? 215 TYR B CD2   1 
ATOM   4206 C CE1   . TYR D 2 214 ? -7.246  -13.788 -20.216 1.00 15.60 ? 215 TYR B CE1   1 
ATOM   4207 C CE2   . TYR D 2 214 ? -7.535  -15.240 -22.126 1.00 21.62 ? 215 TYR B CE2   1 
ATOM   4208 C CZ    . TYR D 2 214 ? -7.186  -15.054 -20.791 1.00 22.25 ? 215 TYR B CZ    1 
ATOM   4209 O OH    . TYR D 2 214 ? -6.802  -16.147 -20.047 1.00 15.25 ? 215 TYR B OH    1 
ATOM   4210 N N     . TRP D 2 215 ? -9.871  -9.936  -21.081 1.00 16.75 ? 216 TRP B N     1 
ATOM   4211 C CA    . TRP D 2 215 ? -10.079 -9.537  -19.696 1.00 18.30 ? 216 TRP B CA    1 
ATOM   4212 C C     . TRP D 2 215 ? -11.493 -9.108  -19.314 1.00 19.61 ? 216 TRP B C     1 
ATOM   4213 O O     . TRP D 2 215 ? -11.864 -9.160  -18.143 1.00 21.75 ? 216 TRP B O     1 
ATOM   4214 C CB    . TRP D 2 215 ? -9.008  -8.521  -19.298 1.00 11.76 ? 216 TRP B CB    1 
ATOM   4215 C CG    . TRP D 2 215 ? -7.688  -9.242  -19.143 1.00 10.64 ? 216 TRP B CG    1 
ATOM   4216 C CD1   . TRP D 2 215 ? -6.615  -9.185  -19.976 1.00 9.54  ? 216 TRP B CD1   1 
ATOM   4217 C CD2   . TRP D 2 215 ? -7.346  -10.191 -18.115 1.00 14.10 ? 216 TRP B CD2   1 
ATOM   4218 N NE1   . TRP D 2 215 ? -5.625  -10.038 -19.543 1.00 13.61 ? 216 TRP B NE1   1 
ATOM   4219 C CE2   . TRP D 2 215 ? -6.050  -10.668 -18.401 1.00 13.83 ? 216 TRP B CE2   1 
ATOM   4220 C CE3   . TRP D 2 215 ? -8.017  -10.684 -16.983 1.00 15.59 ? 216 TRP B CE3   1 
ATOM   4221 C CZ2   . TRP D 2 215 ? -5.403  -11.613 -17.603 1.00 11.34 ? 216 TRP B CZ2   1 
ATOM   4222 C CZ3   . TRP D 2 215 ? -7.376  -11.627 -16.187 1.00 12.32 ? 216 TRP B CZ3   1 
ATOM   4223 C CH2   . TRP D 2 215 ? -6.080  -12.081 -16.504 1.00 13.78 ? 216 TRP B CH2   1 
ATOM   4224 N N     . ARG D 2 216 ? -12.286 -8.702  -20.298 1.00 17.30 ? 217 ARG B N     1 
ATOM   4225 C CA    . ARG D 2 216 ? -13.664 -8.306  -20.049 1.00 18.47 ? 217 ARG B CA    1 
ATOM   4226 C C     . ARG D 2 216 ? -14.572 -9.522  -19.881 1.00 20.40 ? 217 ARG B C     1 
ATOM   4227 O O     . ARG D 2 216 ? -15.683 -9.402  -19.360 1.00 20.33 ? 217 ARG B O     1 
ATOM   4228 C CB    . ARG D 2 216 ? -14.199 -7.472  -21.212 1.00 18.98 ? 217 ARG B CB    1 
ATOM   4229 C CG    . ARG D 2 216 ? -13.791 -6.039  -21.173 1.00 20.61 ? 217 ARG B CG    1 
ATOM   4230 C CD    . ARG D 2 216 ? -14.222 -5.316  -22.424 1.00 21.29 ? 217 ARG B CD    1 
ATOM   4231 N NE    . ARG D 2 216 ? -14.001 -3.887  -22.272 1.00 19.81 ? 217 ARG B NE    1 
ATOM   4232 C CZ    . ARG D 2 216 ? -13.815 -3.037  -23.276 1.00 28.23 ? 217 ARG B CZ    1 
ATOM   4233 N NH1   . ARG D 2 216 ? -13.824 -3.465  -24.530 1.00 18.03 ? 217 ARG B NH1   1 
ATOM   4234 N NH2   . ARG D 2 216 ? -13.617 -1.753  -23.021 1.00 23.51 ? 217 ARG B NH2   1 
ATOM   4235 N N     . ASN D 2 217 ? -14.105 -10.685 -20.330 1.00 20.13 ? 218 ASN B N     1 
ATOM   4236 C CA    . ASN D 2 217 ? -14.905 -11.908 -20.251 1.00 23.28 ? 218 ASN B CA    1 
ATOM   4237 C C     . ASN D 2 217 ? -14.273 -13.017 -19.414 1.00 22.16 ? 218 ASN B C     1 
ATOM   4238 O O     . ASN D 2 217 ? -14.760 -14.147 -19.390 1.00 22.69 ? 218 ASN B O     1 
ATOM   4239 C CB    . ASN D 2 217 ? -15.232 -12.416 -21.672 1.00 20.84 ? 218 ASN B CB    1 
ATOM   4240 C CG    . ASN D 2 217 ? -16.137 -11.461 -22.430 1.00 25.98 ? 218 ASN B CG    1 
ATOM   4241 O OD1   . ASN D 2 217 ? -17.359 -11.529 -22.325 1.00 24.63 ? 218 ASN B OD1   1 
ATOM   4242 N ND2   . ASN D 2 217 ? -15.537 -10.556 -23.194 1.00 18.38 ? 218 ASN B ND2   1 
ATOM   4243 N N     . TYR D 2 218 ? -13.185 -12.685 -18.730 1.00 20.99 ? 219 TYR B N     1 
ATOM   4244 C CA    . TYR D 2 218 ? -12.471 -13.621 -17.859 1.00 22.78 ? 219 TYR B CA    1 
ATOM   4245 C C     . TYR D 2 218 ? -13.354 -13.851 -16.615 1.00 23.15 ? 219 TYR B C     1 
ATOM   4246 O O     . TYR D 2 218 ? -13.901 -12.892 -16.057 1.00 21.93 ? 219 TYR B O     1 
ATOM   4247 C CB    . TYR D 2 218 ? -11.135 -12.981 -17.453 1.00 18.70 ? 219 TYR B CB    1 
ATOM   4248 C CG    . TYR D 2 218 ? -10.159 -13.841 -16.666 1.00 15.88 ? 219 TYR B CG    1 
ATOM   4249 C CD1   . TYR D 2 218 ? -9.314  -14.738 -17.317 1.00 15.29 ? 219 TYR B CD1   1 
ATOM   4250 C CD2   . TYR D 2 218 ? -10.033 -13.706 -15.273 1.00 16.77 ? 219 TYR B CD2   1 
ATOM   4251 C CE1   . TYR D 2 218 ? -8.357  -15.478 -16.612 1.00 19.59 ? 219 TYR B CE1   1 
ATOM   4252 C CE2   . TYR D 2 218 ? -9.074  -14.445 -14.553 1.00 16.03 ? 219 TYR B CE2   1 
ATOM   4253 C CZ    . TYR D 2 218 ? -8.238  -15.325 -15.233 1.00 16.02 ? 219 TYR B CZ    1 
ATOM   4254 O OH    . TYR D 2 218 ? -7.265  -16.038 -14.567 1.00 18.94 ? 219 TYR B OH    1 
ATOM   4255 N N     . GLU D 2 219 ? -13.507 -15.107 -16.196 1.00 21.08 ? 220 GLU B N     1 
ATOM   4256 C CA    . GLU D 2 219 ? -14.311 -15.417 -15.008 1.00 25.08 ? 220 GLU B CA    1 
ATOM   4257 C C     . GLU D 2 219 ? -13.441 -15.366 -13.748 1.00 26.15 ? 220 GLU B C     1 
ATOM   4258 O O     . GLU D 2 219 ? -12.237 -15.628 -13.811 1.00 24.55 ? 220 GLU B O     1 
ATOM   4259 C CB    . GLU D 2 219 ? -14.972 -16.793 -15.146 1.00 27.19 ? 220 GLU B CB    1 
ATOM   4260 C CG    . GLU D 2 219 ? -16.027 -16.883 -16.245 1.00 28.53 ? 220 GLU B CG    1 
ATOM   4261 C CD    . GLU D 2 219 ? -17.268 -16.055 -15.956 1.00 35.35 ? 220 GLU B CD    1 
ATOM   4262 O OE1   . GLU D 2 219 ? -17.608 -15.864 -14.769 1.00 41.45 ? 220 GLU B OE1   1 
ATOM   4263 O OE2   . GLU D 2 219 ? -17.911 -15.591 -16.919 1.00 36.93 ? 220 GLU B OE2   1 
ATOM   4264 N N     . ARG D 2 220 ? -14.058 -15.041 -12.612 1.00 27.84 ? 221 ARG B N     1 
ATOM   4265 C CA    . ARG D 2 220 ? -13.355 -14.900 -11.333 1.00 29.39 ? 221 ARG B CA    1 
ATOM   4266 C C     . ARG D 2 220 ? -12.692 -16.123 -10.693 1.00 30.87 ? 221 ARG B C     1 
ATOM   4267 O O     . ARG D 2 220 ? -11.638 -16.001 -10.064 1.00 32.26 ? 221 ARG B O     1 
ATOM   4268 C CB    . ARG D 2 220 ? -14.284 -14.237 -10.311 1.00 30.70 ? 221 ARG B CB    1 
ATOM   4269 C CG    . ARG D 2 220 ? -14.625 -12.799 -10.649 1.00 34.63 ? 221 ARG B CG    1 
ATOM   4270 C CD    . ARG D 2 220 ? -15.660 -12.242 -9.692  1.00 35.69 ? 221 ARG B CD    1 
ATOM   4271 N NE    . ARG D 2 220 ? -16.115 -10.904 -10.071 1.00 44.13 ? 221 ARG B NE    1 
ATOM   4272 C CZ    . ARG D 2 220 ? -16.870 -10.631 -11.138 1.00 51.18 ? 221 ARG B CZ    1 
ATOM   4273 N NH1   . ARG D 2 220 ? -17.258 -11.597 -11.964 1.00 53.37 ? 221 ARG B NH1   1 
ATOM   4274 N NH2   . ARG D 2 220 ? -17.239 -9.382  -11.391 1.00 47.08 ? 221 ARG B NH2   1 
ATOM   4275 N N     . THR D 2 221 ? -13.296 -17.294 -10.833 1.00 32.56 ? 222 THR B N     1 
ATOM   4276 C CA    . THR D 2 221 ? -12.729 -18.504 -10.239 1.00 35.16 ? 222 THR B CA    1 
ATOM   4277 C C     . THR D 2 221 ? -12.493 -19.543 -11.316 1.00 36.75 ? 222 THR B C     1 
ATOM   4278 O O     . THR D 2 221 ? -13.165 -19.511 -12.353 1.00 34.23 ? 222 THR B O     1 
ATOM   4279 C CB    . THR D 2 221 ? -13.676 -19.115 -9.185  1.00 35.54 ? 222 THR B CB    1 
ATOM   4280 O OG1   . THR D 2 221 ? -14.957 -19.378 -9.781  1.00 41.42 ? 222 THR B OG1   1 
ATOM   4281 C CG2   . THR D 2 221 ? -13.837 -18.165 -8.006  1.00 31.33 ? 222 THR B CG2   1 
ATOM   4282 N N     . SER D 2 222 ? -11.554 -20.461 -11.077 1.00 36.77 ? 223 SER B N     1 
ATOM   4283 C CA    . SER D 2 222 ? -11.265 -21.511 -12.053 1.00 41.08 ? 223 SER B CA    1 
ATOM   4284 C C     . SER D 2 222 ? -12.512 -22.359 -12.337 1.00 40.81 ? 223 SER B C     1 
ATOM   4285 O O     . SER D 2 222 ? -12.685 -22.871 -13.444 1.00 41.09 ? 223 SER B O     1 
ATOM   4286 C CB    . SER D 2 222 ? -10.107 -22.391 -11.575 1.00 41.17 ? 223 SER B CB    1 
ATOM   4287 O OG    . SER D 2 222 ? -10.294 -22.755 -10.226 1.00 46.03 ? 223 SER B OG    1 
ATOM   4288 N N     . GLN D 2 223 ? -13.384 -22.490 -11.341 1.00 40.90 ? 224 GLN B N     1 
ATOM   4289 C CA    . GLN D 2 223 ? -14.609 -23.263 -11.497 1.00 43.06 ? 224 GLN B CA    1 
ATOM   4290 C C     . GLN D 2 223 ? -15.418 -22.692 -12.657 1.00 42.34 ? 224 GLN B C     1 
ATOM   4291 O O     . GLN D 2 223 ? -15.840 -23.425 -13.556 1.00 43.05 ? 224 GLN B O     1 
ATOM   4292 C CB    . GLN D 2 223 ? -15.441 -23.222 -10.206 1.00 49.73 ? 224 GLN B CB    1 
ATOM   4293 C CG    . GLN D 2 223 ? -16.650 -24.166 -10.209 1.00 58.48 ? 224 GLN B CG    1 
ATOM   4294 C CD    . GLN D 2 223 ? -17.605 -23.926 -9.043  1.00 70.03 ? 224 GLN B CD    1 
ATOM   4295 O OE1   . GLN D 2 223 ? -17.319 -24.295 -7.898  1.00 74.87 ? 224 GLN B OE1   1 
ATOM   4296 N NE2   . GLN D 2 223 ? -18.747 -23.303 -9.330  1.00 71.62 ? 224 GLN B NE2   1 
ATOM   4297 N N     . LEU D 2 224 ? -15.626 -21.379 -12.630 1.00 40.75 ? 225 LEU B N     1 
ATOM   4298 C CA    . LEU D 2 224 ? -16.379 -20.692 -13.671 1.00 39.77 ? 225 LEU B CA    1 
ATOM   4299 C C     . LEU D 2 224 ? -15.596 -20.627 -14.984 1.00 38.75 ? 225 LEU B C     1 
ATOM   4300 O O     . LEU D 2 224 ? -16.182 -20.646 -16.071 1.00 41.01 ? 225 LEU B O     1 
ATOM   4301 C CB    . LEU D 2 224 ? -16.739 -19.287 -13.201 1.00 40.40 ? 225 LEU B CB    1 
ATOM   4302 C CG    . LEU D 2 224 ? -17.704 -19.238 -12.020 1.00 44.66 ? 225 LEU B CG    1 
ATOM   4303 C CD1   . LEU D 2 224 ? -17.724 -17.845 -11.412 1.00 47.68 ? 225 LEU B CD1   1 
ATOM   4304 C CD2   . LEU D 2 224 ? -19.087 -19.660 -12.491 1.00 44.19 ? 225 LEU B CD2   1 
ATOM   4305 N N     . ARG D 2 225 ? -14.271 -20.555 -14.873 1.00 35.89 ? 226 ARG B N     1 
ATOM   4306 C CA    . ARG D 2 225 ? -13.395 -20.484 -16.031 1.00 35.32 ? 226 ARG B CA    1 
ATOM   4307 C C     . ARG D 2 225 ? -13.281 -21.793 -16.792 1.00 37.98 ? 226 ARG B C     1 
ATOM   4308 O O     . ARG D 2 225 ? -13.070 -21.782 -18.003 1.00 38.34 ? 226 ARG B O     1 
ATOM   4309 C CB    . ARG D 2 225 ? -11.996 -20.031 -15.625 1.00 30.29 ? 226 ARG B CB    1 
ATOM   4310 C CG    . ARG D 2 225 ? -11.915 -18.581 -15.226 1.00 25.97 ? 226 ARG B CG    1 
ATOM   4311 C CD    . ARG D 2 225 ? -10.512 -18.038 -15.396 1.00 23.86 ? 226 ARG B CD    1 
ATOM   4312 N NE    . ARG D 2 225 ? -9.525  -18.586 -14.463 1.00 26.17 ? 226 ARG B NE    1 
ATOM   4313 C CZ    . ARG D 2 225 ? -9.449  -18.277 -13.165 1.00 30.88 ? 226 ARG B CZ    1 
ATOM   4314 N NH1   . ARG D 2 225 ? -10.320 -17.441 -12.607 1.00 16.34 ? 226 ARG B NH1   1 
ATOM   4315 N NH2   . ARG D 2 225 ? -8.498  -18.818 -12.412 1.00 29.62 ? 226 ARG B NH2   1 
ATOM   4316 N N     . ASN D 2 226 ? -13.417 -22.918 -16.096 1.00 39.02 ? 227 ASN B N     1 
ATOM   4317 C CA    . ASN D 2 226 ? -13.310 -24.236 -16.728 1.00 42.35 ? 227 ASN B CA    1 
ATOM   4318 C C     . ASN D 2 226 ? -14.299 -24.505 -17.854 1.00 41.89 ? 227 ASN B C     1 
ATOM   4319 O O     . ASN D 2 226 ? -14.048 -25.346 -18.717 1.00 42.18 ? 227 ASN B O     1 
ATOM   4320 C CB    . ASN D 2 226 ? -13.412 -25.342 -15.680 1.00 47.30 ? 227 ASN B CB    1 
ATOM   4321 C CG    . ASN D 2 226 ? -12.072 -25.679 -15.070 1.00 51.43 ? 227 ASN B CG    1 
ATOM   4322 O OD1   . ASN D 2 226 ? -11.048 -25.076 -15.408 1.00 54.36 ? 227 ASN B OD1   1 
ATOM   4323 N ND2   . ASN D 2 226 ? -12.066 -26.648 -14.165 1.00 58.25 ? 227 ASN B ND2   1 
ATOM   4324 N N     . ASP D 2 227 ? -15.421 -23.796 -17.841 1.00 41.73 ? 228 ASP B N     1 
ATOM   4325 C CA    . ASP D 2 227 ? -16.425 -23.949 -18.882 1.00 44.19 ? 228 ASP B CA    1 
ATOM   4326 C C     . ASP D 2 227 ? -16.346 -22.812 -19.894 1.00 41.89 ? 228 ASP B C     1 
ATOM   4327 O O     . ASP D 2 227 ? -17.220 -22.674 -20.746 1.00 44.47 ? 228 ASP B O     1 
ATOM   4328 C CB    . ASP D 2 227 ? -17.819 -23.991 -18.262 1.00 52.54 ? 228 ASP B CB    1 
ATOM   4329 C CG    . ASP D 2 227 ? -18.034 -25.225 -17.421 1.00 64.32 ? 228 ASP B CG    1 
ATOM   4330 O OD1   . ASP D 2 227 ? -17.950 -26.344 -17.981 1.00 66.68 ? 228 ASP B OD1   1 
ATOM   4331 O OD2   . ASP D 2 227 ? -18.282 -25.074 -16.204 1.00 72.13 ? 228 ASP B OD2   1 
ATOM   4332 N N     . LYS D 2 228 ? -15.299 -21.997 -19.796 1.00 35.57 ? 229 LYS B N     1 
ATOM   4333 C CA    . LYS D 2 228 ? -15.119 -20.869 -20.697 1.00 29.84 ? 229 LYS B CA    1 
ATOM   4334 C C     . LYS D 2 228 ? -13.693 -20.936 -21.216 1.00 25.84 ? 229 LYS B C     1 
ATOM   4335 O O     . LYS D 2 228 ? -13.434 -21.555 -22.242 1.00 27.27 ? 229 LYS B O     1 
ATOM   4336 C CB    . LYS D 2 228 ? -15.362 -19.571 -19.939 1.00 29.19 ? 229 LYS B CB    1 
ATOM   4337 C CG    . LYS D 2 228 ? -16.107 -18.533 -20.718 1.00 26.39 ? 229 LYS B CG    1 
ATOM   4338 C CD    . LYS D 2 228 ? -16.348 -17.336 -19.848 1.00 28.59 ? 229 LYS B CD    1 
ATOM   4339 C CE    . LYS D 2 228 ? -17.068 -16.260 -20.599 1.00 27.37 ? 229 LYS B CE    1 
ATOM   4340 N NZ    . LYS D 2 228 ? -17.376 -15.144 -19.681 1.00 24.86 ? 229 LYS B NZ    1 
ATOM   4341 N N     . TYR D 2 229 ? -12.765 -20.306 -20.509 1.00 20.76 ? 230 TYR B N     1 
ATOM   4342 C CA    . TYR D 2 229 ? -11.359 -20.343 -20.899 1.00 21.26 ? 230 TYR B CA    1 
ATOM   4343 C C     . TYR D 2 229 ? -10.478 -19.975 -19.712 1.00 21.48 ? 230 TYR B C     1 
ATOM   4344 O O     . TYR D 2 229 ? -10.873 -19.170 -18.864 1.00 21.92 ? 230 TYR B O     1 
ATOM   4345 C CB    . TYR D 2 229 ? -11.072 -19.412 -22.101 1.00 18.95 ? 230 TYR B CB    1 
ATOM   4346 C CG    . TYR D 2 229 ? -11.434 -17.946 -21.931 1.00 10.77 ? 230 TYR B CG    1 
ATOM   4347 C CD1   . TYR D 2 229 ? -10.526 -17.031 -21.385 1.00 12.35 ? 230 TYR B CD1   1 
ATOM   4348 C CD2   . TYR D 2 229 ? -12.673 -17.475 -22.339 1.00 10.96 ? 230 TYR B CD2   1 
ATOM   4349 C CE1   . TYR D 2 229 ? -10.858 -15.666 -21.255 1.00 9.53  ? 230 TYR B CE1   1 
ATOM   4350 C CE2   . TYR D 2 229 ? -13.015 -16.130 -22.216 1.00 14.95 ? 230 TYR B CE2   1 
ATOM   4351 C CZ    . TYR D 2 229 ? -12.106 -15.231 -21.675 1.00 16.31 ? 230 TYR B CZ    1 
ATOM   4352 O OH    . TYR D 2 229 ? -12.468 -13.909 -21.572 1.00 15.56 ? 230 TYR B OH    1 
ATOM   4353 N N     . ASN D 2 230 ? -9.294  -20.572 -19.670 1.00 20.89 ? 231 ASN B N     1 
ATOM   4354 C CA    . ASN D 2 230 ? -8.330  -20.351 -18.602 1.00 23.10 ? 231 ASN B CA    1 
ATOM   4355 C C     . ASN D 2 230 ? -7.027  -19.743 -19.101 1.00 23.35 ? 231 ASN B C     1 
ATOM   4356 O O     . ASN D 2 230 ? -6.169  -19.354 -18.300 1.00 24.40 ? 231 ASN B O     1 
ATOM   4357 C CB    . ASN D 2 230 ? -8.013  -21.675 -17.893 1.00 30.69 ? 231 ASN B CB    1 
ATOM   4358 C CG    . ASN D 2 230 ? -8.994  -21.993 -16.779 1.00 44.20 ? 231 ASN B CG    1 
ATOM   4359 O OD1   . ASN D 2 230 ? -9.034  -21.304 -15.759 1.00 54.13 ? 231 ASN B OD1   1 
ATOM   4360 N ND2   . ASN D 2 230 ? -9.788  -23.042 -16.966 1.00 53.24 ? 231 ASN B ND2   1 
ATOM   4361 N N     . ASN D 2 231 ? -6.872  -19.669 -20.420 1.00 20.42 ? 232 ASN B N     1 
ATOM   4362 C CA    . ASN D 2 231 ? -5.660  -19.113 -21.015 1.00 20.23 ? 232 ASN B CA    1 
ATOM   4363 C C     . ASN D 2 231 ? -5.949  -18.629 -22.439 1.00 19.66 ? 232 ASN B C     1 
ATOM   4364 O O     . ASN D 2 231 ? -7.075  -18.765 -22.922 1.00 17.92 ? 232 ASN B O     1 
ATOM   4365 C CB    . ASN D 2 231 ? -4.524  -20.148 -21.000 1.00 21.17 ? 232 ASN B CB    1 
ATOM   4366 C CG    . ASN D 2 231 ? -4.894  -21.443 -21.707 1.00 27.04 ? 232 ASN B CG    1 
ATOM   4367 O OD1   . ASN D 2 231 ? -5.454  -21.433 -22.801 1.00 32.19 ? 232 ASN B OD1   1 
ATOM   4368 N ND2   . ASN D 2 231 ? -4.581  -22.563 -21.082 1.00 28.59 ? 232 ASN B ND2   1 
ATOM   4369 N N     . ILE D 2 232 ? -4.936  -18.074 -23.101 1.00 19.76 ? 233 ILE B N     1 
ATOM   4370 C CA    . ILE D 2 232 ? -5.080  -17.530 -24.452 1.00 20.64 ? 233 ILE B CA    1 
ATOM   4371 C C     . ILE D 2 232 ? -5.564  -18.576 -25.484 1.00 20.14 ? 233 ILE B C     1 
ATOM   4372 O O     . ILE D 2 232 ? -6.469  -18.295 -26.273 1.00 18.60 ? 233 ILE B O     1 
ATOM   4373 C CB    . ILE D 2 232 ? -3.742  -16.824 -24.912 1.00 22.16 ? 233 ILE B CB    1 
ATOM   4374 C CG1   . ILE D 2 232 ? -3.981  -15.987 -26.165 1.00 21.81 ? 233 ILE B CG1   1 
ATOM   4375 C CG2   . ILE D 2 232 ? -2.638  -17.832 -25.162 1.00 20.69 ? 233 ILE B CG2   1 
ATOM   4376 C CD1   . ILE D 2 232 ? -4.932  -14.849 -25.954 1.00 18.46 ? 233 ILE B CD1   1 
ATOM   4377 N N     . SER D 2 233 ? -4.975  -19.771 -25.465 1.00 19.27 ? 234 SER B N     1 
ATOM   4378 C CA    . SER D 2 233 ? -5.369  -20.841 -26.385 1.00 20.31 ? 234 SER B CA    1 
ATOM   4379 C C     . SER D 2 233 ? -6.851  -21.142 -26.244 1.00 19.16 ? 234 SER B C     1 
ATOM   4380 O O     . SER D 2 233 ? -7.587  -21.196 -27.233 1.00 19.13 ? 234 SER B O     1 
ATOM   4381 C CB    . SER D 2 233 ? -4.581  -22.123 -26.097 1.00 22.42 ? 234 SER B CB    1 
ATOM   4382 O OG    . SER D 2 233 ? -3.209  -21.965 -26.412 1.00 32.43 ? 234 SER B OG    1 
ATOM   4383 N N     . GLU D 2 234 ? -7.286  -21.328 -25.001 1.00 17.85 ? 235 GLU B N     1 
ATOM   4384 C CA    . GLU D 2 234 ? -8.674  -21.634 -24.716 1.00 15.59 ? 235 GLU B CA    1 
ATOM   4385 C C     . GLU D 2 234 ? -9.600  -20.477 -25.077 1.00 17.16 ? 235 GLU B C     1 
ATOM   4386 O O     . GLU D 2 234 ? -10.749 -20.688 -25.476 1.00 19.44 ? 235 GLU B O     1 
ATOM   4387 C CB    . GLU D 2 234 ? -8.822  -22.036 -23.249 1.00 19.98 ? 235 GLU B CB    1 
ATOM   4388 C CG    . GLU D 2 234 ? -8.074  -23.314 -22.920 1.00 20.25 ? 235 GLU B CG    1 
ATOM   4389 C CD    . GLU D 2 234 ? -8.307  -23.818 -21.504 1.00 30.42 ? 235 GLU B CD    1 
ATOM   4390 O OE1   . GLU D 2 234 ? -9.229  -23.334 -20.805 1.00 31.11 ? 235 GLU B OE1   1 
ATOM   4391 O OE2   . GLU D 2 234 ? -7.550  -24.719 -21.087 1.00 31.34 ? 235 GLU B OE2   1 
ATOM   4392 N N     . TYR D 2 235 ? -9.109  -19.252 -24.945 1.00 14.62 ? 236 TYR B N     1 
ATOM   4393 C CA    . TYR D 2 235 ? -9.911  -18.083 -25.292 1.00 15.40 ? 236 TYR B CA    1 
ATOM   4394 C C     . TYR D 2 235 ? -10.179 -18.069 -26.807 1.00 16.02 ? 236 TYR B C     1 
ATOM   4395 O O     . TYR D 2 235 ? -11.303 -17.803 -27.258 1.00 14.11 ? 236 TYR B O     1 
ATOM   4396 C CB    . TYR D 2 235 ? -9.171  -16.804 -24.873 1.00 15.15 ? 236 TYR B CB    1 
ATOM   4397 C CG    . TYR D 2 235 ? -9.656  -15.551 -25.557 1.00 12.45 ? 236 TYR B CG    1 
ATOM   4398 C CD1   . TYR D 2 235 ? -10.865 -14.954 -25.193 1.00 13.03 ? 236 TYR B CD1   1 
ATOM   4399 C CD2   . TYR D 2 235 ? -8.904  -14.961 -26.575 1.00 18.57 ? 236 TYR B CD2   1 
ATOM   4400 C CE1   . TYR D 2 235 ? -11.318 -13.799 -25.828 1.00 16.19 ? 236 TYR B CE1   1 
ATOM   4401 C CE2   . TYR D 2 235 ? -9.348  -13.803 -27.221 1.00 14.82 ? 236 TYR B CE2   1 
ATOM   4402 C CZ    . TYR D 2 235 ? -10.551 -13.228 -26.847 1.00 17.50 ? 236 TYR B CZ    1 
ATOM   4403 O OH    . TYR D 2 235 ? -10.994 -12.100 -27.501 1.00 13.39 ? 236 TYR B OH    1 
ATOM   4404 N N     . ARG D 2 236 ? -9.136  -18.350 -27.582 1.00 16.80 ? 237 ARG B N     1 
ATOM   4405 C CA    . ARG D 2 236 ? -9.244  -18.373 -29.035 1.00 21.65 ? 237 ARG B CA    1 
ATOM   4406 C C     . ARG D 2 236 ? -10.191 -19.482 -29.500 1.00 22.27 ? 237 ARG B C     1 
ATOM   4407 O O     . ARG D 2 236 ? -10.937 -19.303 -30.470 1.00 21.40 ? 237 ARG B O     1 
ATOM   4408 C CB    . ARG D 2 236 ? -7.849  -18.487 -29.662 1.00 19.79 ? 237 ARG B CB    1 
ATOM   4409 C CG    . ARG D 2 236 ? -7.126  -17.148 -29.592 1.00 20.64 ? 237 ARG B CG    1 
ATOM   4410 C CD    . ARG D 2 236 ? -5.656  -17.207 -29.954 1.00 25.05 ? 237 ARG B CD    1 
ATOM   4411 N NE    . ARG D 2 236 ? -5.056  -15.877 -29.804 1.00 26.28 ? 237 ARG B NE    1 
ATOM   4412 C CZ    . ARG D 2 236 ? -3.761  -15.646 -29.607 1.00 24.59 ? 237 ARG B CZ    1 
ATOM   4413 N NH1   . ARG D 2 236 ? -2.906  -16.655 -29.545 1.00 28.47 ? 237 ARG B NH1   1 
ATOM   4414 N NH2   . ARG D 2 236 ? -3.316  -14.404 -29.474 1.00 21.99 ? 237 ARG B NH2   1 
ATOM   4415 N N     . ASN D 2 237 ? -10.171 -20.616 -28.798 1.00 20.77 ? 238 ASN B N     1 
ATOM   4416 C CA    . ASN D 2 237 ? -11.068 -21.717 -29.117 1.00 20.22 ? 238 ASN B CA    1 
ATOM   4417 C C     . ASN D 2 237 ? -12.499 -21.288 -28.773 1.00 21.03 ? 238 ASN B C     1 
ATOM   4418 O O     . ASN D 2 237 ? -13.442 -21.620 -29.489 1.00 19.87 ? 238 ASN B O     1 
ATOM   4419 C CB    . ASN D 2 237 ? -10.677 -22.973 -28.348 1.00 16.98 ? 238 ASN B CB    1 
ATOM   4420 C CG    . ASN D 2 237 ? -11.286 -24.219 -28.946 1.00 27.81 ? 238 ASN B CG    1 
ATOM   4421 O OD1   . ASN D 2 237 ? -12.431 -24.573 -28.655 1.00 25.27 ? 238 ASN B OD1   1 
ATOM   4422 N ND2   . ASN D 2 237 ? -10.526 -24.893 -29.795 1.00 27.72 ? 238 ASN B ND2   1 
ATOM   4423 N N     . TRP D 2 238 ? -12.645 -20.534 -27.680 1.00 20.52 ? 239 TRP B N     1 
ATOM   4424 C CA    . TRP D 2 238 ? -13.937 -19.999 -27.224 1.00 20.39 ? 239 TRP B CA    1 
ATOM   4425 C C     . TRP D 2 238 ? -14.524 -19.028 -28.272 1.00 22.27 ? 239 TRP B C     1 
ATOM   4426 O O     . TRP D 2 238 ? -15.744 -18.975 -28.466 1.00 20.16 ? 239 TRP B O     1 
ATOM   4427 C CB    . TRP D 2 238 ? -13.743 -19.282 -25.873 1.00 21.10 ? 239 TRP B CB    1 
ATOM   4428 C CG    . TRP D 2 238 ? -14.973 -18.641 -25.287 1.00 16.67 ? 239 TRP B CG    1 
ATOM   4429 C CD1   . TRP D 2 238 ? -16.047 -19.278 -24.721 1.00 21.35 ? 239 TRP B CD1   1 
ATOM   4430 C CD2   . TRP D 2 238 ? -15.242 -17.237 -25.183 1.00 15.10 ? 239 TRP B CD2   1 
ATOM   4431 N NE1   . TRP D 2 238 ? -16.964 -18.352 -24.273 1.00 19.05 ? 239 TRP B NE1   1 
ATOM   4432 C CE2   . TRP D 2 238 ? -16.494 -17.094 -24.544 1.00 17.97 ? 239 TRP B CE2   1 
ATOM   4433 C CE3   . TRP D 2 238 ? -14.545 -16.086 -25.567 1.00 18.30 ? 239 TRP B CE3   1 
ATOM   4434 C CZ2   . TRP D 2 238 ? -17.059 -15.851 -24.281 1.00 20.49 ? 239 TRP B CZ2   1 
ATOM   4435 C CZ3   . TRP D 2 238 ? -15.108 -14.850 -25.305 1.00 21.13 ? 239 TRP B CZ3   1 
ATOM   4436 C CH2   . TRP D 2 238 ? -16.353 -14.743 -24.668 1.00 20.12 ? 239 TRP B CH2   1 
ATOM   4437 N N     . ILE D 2 239 ? -13.660 -18.255 -28.936 1.00 20.73 ? 240 ILE B N     1 
ATOM   4438 C CA    . ILE D 2 239 ? -14.107 -17.333 -29.987 1.00 21.75 ? 240 ILE B CA    1 
ATOM   4439 C C     . ILE D 2 239 ? -14.635 -18.189 -31.164 1.00 21.93 ? 240 ILE B C     1 
ATOM   4440 O O     . ILE D 2 239 ? -15.722 -17.934 -31.691 1.00 22.03 ? 240 ILE B O     1 
ATOM   4441 C CB    . ILE D 2 239 ? -12.950 -16.411 -30.485 1.00 22.24 ? 240 ILE B CB    1 
ATOM   4442 C CG1   . ILE D 2 239 ? -12.530 -15.435 -29.377 1.00 17.63 ? 240 ILE B CG1   1 
ATOM   4443 C CG2   . ILE D 2 239 ? -13.380 -15.638 -31.746 1.00 20.48 ? 240 ILE B CG2   1 
ATOM   4444 C CD1   . ILE D 2 239 ? -13.644 -14.553 -28.886 1.00 23.29 ? 240 ILE B CD1   1 
ATOM   4445 N N     . TYR D 2 240 ? -13.866 -19.205 -31.556 1.00 19.96 ? 241 TYR B N     1 
ATOM   4446 C CA    . TYR D 2 240 ? -14.264 -20.101 -32.636 1.00 20.62 ? 241 TYR B CA    1 
ATOM   4447 C C     . TYR D 2 240 ? -15.643 -20.717 -32.373 1.00 22.11 ? 241 TYR B C     1 
ATOM   4448 O O     . TYR D 2 240 ? -16.473 -20.795 -33.278 1.00 23.88 ? 241 TYR B O     1 
ATOM   4449 C CB    . TYR D 2 240 ? -13.226 -21.215 -32.817 1.00 21.79 ? 241 TYR B CB    1 
ATOM   4450 C CG    . TYR D 2 240 ? -13.784 -22.434 -33.525 1.00 27.67 ? 241 TYR B CG    1 
ATOM   4451 C CD1   . TYR D 2 240 ? -13.975 -22.435 -34.905 1.00 27.27 ? 241 TYR B CD1   1 
ATOM   4452 C CD2   . TYR D 2 240 ? -14.154 -23.576 -32.805 1.00 22.25 ? 241 TYR B CD2   1 
ATOM   4453 C CE1   . TYR D 2 240 ? -14.522 -23.539 -35.556 1.00 27.15 ? 241 TYR B CE1   1 
ATOM   4454 C CE2   . TYR D 2 240 ? -14.700 -24.682 -33.441 1.00 21.66 ? 241 TYR B CE2   1 
ATOM   4455 C CZ    . TYR D 2 240 ? -14.882 -24.656 -34.823 1.00 26.25 ? 241 TYR B CZ    1 
ATOM   4456 O OH    . TYR D 2 240 ? -15.411 -25.745 -35.476 1.00 17.06 ? 241 TYR B OH    1 
ATOM   4457 N N     . ARG D 2 241 ? -15.876 -21.153 -31.135 1.00 22.45 ? 242 ARG B N     1 
ATOM   4458 C CA    . ARG D 2 241 ? -17.141 -21.769 -30.731 1.00 21.58 ? 242 ARG B CA    1 
ATOM   4459 C C     . ARG D 2 241 ? -18.343 -20.834 -30.751 1.00 22.74 ? 242 ARG B C     1 
ATOM   4460 O O     . ARG D 2 241 ? -19.487 -21.282 -30.618 1.00 25.37 ? 242 ARG B O     1 
ATOM   4461 C CB    . ARG D 2 241 ? -16.997 -22.386 -29.341 1.00 20.94 ? 242 ARG B CB    1 
ATOM   4462 C CG    . ARG D 2 241 ? -16.554 -23.828 -29.354 1.00 27.90 ? 242 ARG B CG    1 
ATOM   4463 C CD    . ARG D 2 241 ? -15.672 -24.160 -28.162 1.00 37.77 ? 242 ARG B CD    1 
ATOM   4464 N NE    . ARG D 2 241 ? -16.111 -23.519 -26.921 1.00 37.45 ? 242 ARG B NE    1 
ATOM   4465 C CZ    . ARG D 2 241 ? -15.297 -23.256 -25.900 1.00 36.45 ? 242 ARG B CZ    1 
ATOM   4466 N NH1   . ARG D 2 241 ? -14.013 -23.586 -25.966 1.00 33.93 ? 242 ARG B NH1   1 
ATOM   4467 N NH2   . ARG D 2 241 ? -15.757 -22.665 -24.807 1.00 38.16 ? 242 ARG B NH2   1 
ATOM   4468 N N     . GLY D 2 242 ? -18.095 -19.539 -30.922 1.00 19.16 ? 243 GLY B N     1 
ATOM   4469 C CA    . GLY D 2 242 ? -19.193 -18.592 -30.954 1.00 21.13 ? 243 GLY B CA    1 
ATOM   4470 C C     . GLY D 2 242 ? -19.433 -17.891 -29.629 1.00 24.00 ? 243 GLY B C     1 
ATOM   4471 O O     . GLY D 2 242 ? -20.548 -17.445 -29.358 1.00 24.67 ? 243 GLY B O     1 
ATOM   4472 N N     . ARG D 2 243 ? -18.384 -17.797 -28.810 1.00 26.93 ? 244 ARG B N     1 
ATOM   4473 C CA    . ARG D 2 243 ? -18.433 -17.132 -27.502 1.00 29.68 ? 244 ARG B CA    1 
ATOM   4474 C C     . ARG D 2 243 ? -19.448 -17.785 -26.566 1.00 30.93 ? 244 ARG B C     1 
ATOM   4475 O O     . ARG D 2 243 ? -20.242 -17.115 -25.897 1.00 32.22 ? 244 ARG B O     1 
ATOM   4476 C CB    . ARG D 2 243 ? -18.706 -15.628 -27.681 1.00 26.16 ? 244 ARG B CB    1 
ATOM   4477 C CG    . ARG D 2 243 ? -17.698 -14.952 -28.623 1.00 26.73 ? 244 ARG B CG    1 
ATOM   4478 C CD    . ARG D 2 243 ? -18.098 -13.531 -28.983 1.00 27.71 ? 244 ARG B CD    1 
ATOM   4479 N NE    . ARG D 2 243 ? -17.944 -12.636 -27.842 1.00 31.75 ? 244 ARG B NE    1 
ATOM   4480 C CZ    . ARG D 2 243 ? -16.807 -12.017 -27.520 1.00 33.32 ? 244 ARG B CZ    1 
ATOM   4481 N NH1   . ARG D 2 243 ? -15.711 -12.179 -28.258 1.00 26.94 ? 244 ARG B NH1   1 
ATOM   4482 N NH2   . ARG D 2 243 ? -16.768 -11.230 -26.454 1.00 27.12 ? 244 ARG B NH2   1 
ATOM   4483 N N     . LYS D 2 244 ? -19.393 -19.113 -26.539 1.00 35.39 ? 245 LYS B N     1 
ATOM   4484 C CA    . LYS D 2 244 ? -20.257 -19.954 -25.710 1.00 38.40 ? 245 LYS B CA    1 
ATOM   4485 C C     . LYS D 2 244 ? -19.549 -21.306 -25.574 1.00 39.81 ? 245 LYS B C     1 
ATOM   4486 O O     . LYS D 2 244 ? -18.546 -21.528 -26.301 1.00 38.22 ? 245 LYS B O     1 
ATOM   4487 C CB    . LYS D 2 244 ? -21.638 -20.148 -26.366 1.00 41.31 ? 245 LYS B CB    1 
ATOM   4488 C CG    . LYS D 2 244 ? -21.654 -21.078 -27.584 1.00 43.51 ? 245 LYS B CG    1 
ATOM   4489 C CD    . LYS D 2 244 ? -23.007 -21.087 -28.286 1.00 52.44 ? 245 LYS B CD    1 
ATOM   4490 C CE    . LYS D 2 244 ? -23.328 -19.720 -28.874 1.00 62.85 ? 245 LYS B CE    1 
ATOM   4491 N NZ    . LYS D 2 244 ? -24.462 -19.767 -29.834 1.00 71.50 ? 245 LYS B NZ    1 
ATOM   4492 O OXT   . LYS D 2 244 ? -20.002 -22.124 -24.746 1.00 45.69 ? 245 LYS B OXT   1 
HETATM 4493 O O     . HOH E 3 .   ? -7.254  -10.779 5.187   1.00 19.80 ? 13  HOH C O     1 
HETATM 4494 O O     . HOH E 3 .   ? -6.194  1.686   9.081   1.00 19.69 ? 14  HOH C O     1 
HETATM 4495 O O     . HOH E 3 .   ? -3.505  -8.429  9.335   1.00 19.33 ? 17  HOH C O     1 
HETATM 4496 O O     . HOH E 3 .   ? -8.970  3.292   7.872   1.00 26.05 ? 54  HOH C O     1 
HETATM 4497 O O     . HOH E 3 .   ? -7.097  2.648   -0.627  1.00 30.88 ? 82  HOH C O     1 
HETATM 4498 O O     . HOH E 3 .   ? -10.237 -15.117 -2.756  1.00 35.94 ? 85  HOH C O     1 
HETATM 4499 O O     . HOH E 3 .   ? -4.566  -15.233 -8.828  1.00 32.34 ? 95  HOH C O     1 
HETATM 4500 O O     . HOH E 3 .   ? 1.847   -5.496  9.573   1.00 29.58 ? 97  HOH C O     1 
HETATM 4501 O O     . HOH E 3 .   ? -11.074 4.850   5.236   1.00 31.26 ? 106 HOH C O     1 
HETATM 4502 O O     . HOH E 3 .   ? -10.184 -15.756 -5.922  1.00 30.12 ? 110 HOH C O     1 
HETATM 4503 O O     . HOH E 3 .   ? -3.064  1.546   1.678   1.00 36.45 ? 127 HOH C O     1 
HETATM 4504 O O     . HOH E 3 .   ? -8.895  -17.148 -7.755  1.00 33.56 ? 154 HOH C O     1 
HETATM 4505 O O     . HOH E 3 .   ? -2.681  -16.317 1.485   1.00 40.41 ? 194 HOH C O     1 
HETATM 4506 O O     . HOH E 3 .   ? -12.349 -13.764 -4.030  1.00 45.53 ? 206 HOH C O     1 
HETATM 4507 O O     . HOH E 3 .   ? 1.385   -4.573  1.993   1.00 51.28 ? 212 HOH C O     1 
HETATM 4508 O O     . HOH E 3 .   ? -14.527 7.412   2.032   1.00 44.77 ? 216 HOH C O     1 
HETATM 4509 O O     . HOH E 3 .   ? -15.273 1.280   5.943   1.00 40.69 ? 220 HOH C O     1 
HETATM 4510 O O     . HOH E 3 .   ? 2.631   -6.443  6.881   1.00 51.21 ? 240 HOH C O     1 
HETATM 4511 O O     . HOH F 3 .   ? -9.984  -5.066  -8.377  1.00 14.45 ? 12  HOH D O     1 
HETATM 4512 O O     . HOH F 3 .   ? -6.841  -0.870  -11.591 1.00 21.12 ? 13  HOH D O     1 
HETATM 4513 O O     . HOH F 3 .   ? -16.147 -8.794  -1.793  1.00 26.29 ? 14  HOH D O     1 
HETATM 4514 O O     . HOH F 3 .   ? -19.050 -8.200  2.828   1.00 26.72 ? 15  HOH D O     1 
HETATM 4515 O O     . HOH F 3 .   ? -24.217 -11.600 1.643   1.00 25.40 ? 16  HOH D O     1 
HETATM 4516 O O     . HOH F 3 .   ? 1.749   -7.104  -0.622  1.00 30.39 ? 17  HOH D O     1 
HETATM 4517 O O     . HOH F 3 .   ? -3.508  3.934   -9.802  1.00 27.24 ? 18  HOH D O     1 
HETATM 4518 O O     . HOH F 3 .   ? -17.039 -5.013  4.833   1.00 33.01 ? 19  HOH D O     1 
HETATM 4519 O O     . HOH F 3 .   ? 5.009   -10.757 -6.661  1.00 31.88 ? 20  HOH D O     1 
HETATM 4520 O O     . HOH F 3 .   ? -19.827 -2.573  -3.264  1.00 43.22 ? 21  HOH D O     1 
HETATM 4521 O O     . HOH F 3 .   ? 3.950   -7.548  -9.025  1.00 28.61 ? 22  HOH D O     1 
HETATM 4522 O O     . HOH F 3 .   ? 4.207   1.371   -7.547  1.00 34.76 ? 23  HOH D O     1 
HETATM 4523 O O     . HOH F 3 .   ? -16.068 -0.845  -4.681  1.00 30.95 ? 24  HOH D O     1 
HETATM 4524 O O     . HOH F 3 .   ? -22.606 -2.836  -0.313  1.00 45.46 ? 25  HOH D O     1 
HETATM 4525 O O     . HOH F 3 .   ? -17.020 -7.340  -9.359  1.00 33.47 ? 26  HOH D O     1 
HETATM 4526 O O     . HOH F 3 .   ? -16.334 -2.572  5.344   1.00 32.35 ? 27  HOH D O     1 
HETATM 4527 O O     . HOH F 3 .   ? 9.239   -12.298 1.901   1.00 44.35 ? 28  HOH D O     1 
HETATM 4528 O O     . HOH F 3 .   ? -26.174 -7.431  0.946   1.00 45.36 ? 29  HOH D O     1 
HETATM 4529 O O     . HOH F 3 .   ? 3.312   -4.851  -1.075  1.00 39.97 ? 30  HOH D O     1 
HETATM 4530 O O     . HOH F 3 .   ? -24.677 -7.692  7.699   1.00 44.19 ? 31  HOH D O     1 
HETATM 4531 O O     . HOH F 3 .   ? -17.532 -9.583  0.993   1.00 42.20 ? 32  HOH D O     1 
HETATM 4532 O O     . HOH F 3 .   ? 1.558   -2.832  -1.941  1.00 40.26 ? 33  HOH D O     1 
HETATM 4533 O O     . HOH F 3 .   ? 2.749   -9.795  -8.423  1.00 39.77 ? 34  HOH D O     1 
HETATM 4534 O O     . HOH F 3 .   ? -22.465 -5.970  -5.331  1.00 56.13 ? 35  HOH D O     1 
HETATM 4535 O O     . HOH F 3 .   ? -3.425  1.876   -2.743  1.00 49.85 ? 36  HOH D O     1 
HETATM 4536 O O     . HOH G 3 .   ? -3.191  -6.211  23.693  1.00 17.21 ? 246 HOH A O     1 
HETATM 4537 O O     . HOH G 3 .   ? -15.477 -8.862  5.687   1.00 17.18 ? 247 HOH A O     1 
HETATM 4538 O O     . HOH G 3 .   ? -5.019  -6.648  21.726  1.00 16.39 ? 248 HOH A O     1 
HETATM 4539 O O     . HOH G 3 .   ? -6.062  -12.849 11.674  1.00 16.53 ? 249 HOH A O     1 
HETATM 4540 O O     . HOH G 3 .   ? -13.585 -2.651  21.772  1.00 18.49 ? 250 HOH A O     1 
HETATM 4541 O O     . HOH G 3 .   ? -9.903  -13.692 3.511   1.00 16.83 ? 251 HOH A O     1 
HETATM 4542 O O     . HOH G 3 .   ? -4.970  -7.176  6.047   1.00 18.86 ? 252 HOH A O     1 
HETATM 4543 O O     . HOH G 3 .   ? -21.281 -13.796 12.581  1.00 19.78 ? 253 HOH A O     1 
HETATM 4544 O O     . HOH G 3 .   ? -7.787  -12.331 7.263   1.00 18.80 ? 254 HOH A O     1 
HETATM 4545 O O     . HOH G 3 .   ? -1.591  -13.285 21.198  1.00 17.80 ? 255 HOH A O     1 
HETATM 4546 O O     . HOH G 3 .   ? -16.026 -11.028 2.865   1.00 19.32 ? 256 HOH A O     1 
HETATM 4547 O O     . HOH G 3 .   ? -11.522 -5.946  -6.067  1.00 20.05 ? 257 HOH A O     1 
HETATM 4548 O O     . HOH G 3 .   ? -17.699 -17.115 6.792   1.00 19.82 ? 258 HOH A O     1 
HETATM 4549 O O     . HOH G 3 .   ? 13.072  4.473   9.308   1.00 20.25 ? 259 HOH A O     1 
HETATM 4550 O O     . HOH G 3 .   ? 7.732   -8.339  13.499  1.00 20.92 ? 260 HOH A O     1 
HETATM 4551 O O     . HOH G 3 .   ? 6.195   17.280  0.779   1.00 21.03 ? 261 HOH A O     1 
HETATM 4552 O O     . HOH G 3 .   ? -13.007 0.384   9.828   1.00 27.90 ? 262 HOH A O     1 
HETATM 4553 O O     . HOH G 3 .   ? -11.950 -16.166 23.526  1.00 24.67 ? 263 HOH A O     1 
HETATM 4554 O O     . HOH G 3 .   ? -4.849  -3.964  8.170   1.00 24.25 ? 264 HOH A O     1 
HETATM 4555 O O     . HOH G 3 .   ? -16.539 -4.015  31.215  1.00 23.27 ? 265 HOH A O     1 
HETATM 4556 O O     . HOH G 3 .   ? -22.612 -19.826 25.402  1.00 22.56 ? 266 HOH A O     1 
HETATM 4557 O O     . HOH G 3 .   ? -2.817  -10.476 23.699  1.00 24.61 ? 267 HOH A O     1 
HETATM 4558 O O     . HOH G 3 .   ? -8.818  -8.636  28.647  1.00 25.92 ? 268 HOH A O     1 
HETATM 4559 O O     . HOH G 3 .   ? -6.074  -8.699  13.104  1.00 27.32 ? 269 HOH A O     1 
HETATM 4560 O O     . HOH G 3 .   ? -11.603 -17.648 21.120  1.00 24.74 ? 270 HOH A O     1 
HETATM 4561 O O     . HOH G 3 .   ? -21.391 -6.918  10.756  1.00 23.23 ? 271 HOH A O     1 
HETATM 4562 O O     . HOH G 3 .   ? 10.224  8.731   26.294  1.00 27.12 ? 272 HOH A O     1 
HETATM 4563 O O     . HOH G 3 .   ? -24.676 -12.833 27.036  1.00 25.22 ? 273 HOH A O     1 
HETATM 4564 O O     . HOH G 3 .   ? -16.507 -1.701  13.634  1.00 28.02 ? 274 HOH A O     1 
HETATM 4565 O O     . HOH G 3 .   ? -10.999 7.217   9.026   1.00 25.30 ? 275 HOH A O     1 
HETATM 4566 O O     . HOH G 3 .   ? -1.081  -4.293  27.060  1.00 30.46 ? 276 HOH A O     1 
HETATM 4567 O O     . HOH G 3 .   ? -12.946 0.620   7.174   1.00 28.31 ? 277 HOH A O     1 
HETATM 4568 O O     . HOH G 3 .   ? -17.727 -14.029 25.223  1.00 30.30 ? 278 HOH A O     1 
HETATM 4569 O O     . HOH G 3 .   ? 8.410   -2.890  9.997   1.00 38.24 ? 279 HOH A O     1 
HETATM 4570 O O     . HOH G 3 .   ? -3.566  -9.326  16.911  1.00 27.69 ? 280 HOH A O     1 
HETATM 4571 O O     . HOH G 3 .   ? -5.584  -10.763 20.993  1.00 28.31 ? 281 HOH A O     1 
HETATM 4572 O O     . HOH G 3 .   ? -3.373  -19.169 18.761  1.00 30.48 ? 282 HOH A O     1 
HETATM 4573 O O     . HOH G 3 .   ? 0.815   -12.441 1.036   1.00 32.21 ? 283 HOH A O     1 
HETATM 4574 O O     . HOH G 3 .   ? -3.222  -7.747  25.815  1.00 29.05 ? 284 HOH A O     1 
HETATM 4575 O O     . HOH G 3 .   ? -31.247 -13.725 32.574  1.00 25.94 ? 285 HOH A O     1 
HETATM 4576 O O     . HOH G 3 .   ? -13.117 -1.963  25.176  1.00 29.02 ? 286 HOH A O     1 
HETATM 4577 O O     . HOH G 3 .   ? -19.578 -12.338 26.138  1.00 31.45 ? 287 HOH A O     1 
HETATM 4578 O O     . HOH G 3 .   ? -4.939  -18.091 16.786  1.00 33.57 ? 288 HOH A O     1 
HETATM 4579 O O     . HOH G 3 .   ? -11.090 13.785  19.673  1.00 29.14 ? 289 HOH A O     1 
HETATM 4580 O O     . HOH G 3 .   ? 8.781   -13.117 9.035   1.00 29.23 ? 290 HOH A O     1 
HETATM 4581 O O     . HOH G 3 .   ? -0.802  13.681  18.819  1.00 27.29 ? 291 HOH A O     1 
HETATM 4582 O O     . HOH G 3 .   ? -11.571 -0.994  27.111  1.00 33.44 ? 292 HOH A O     1 
HETATM 4583 O O     . HOH G 3 .   ? -18.284 2.344   16.448  1.00 29.41 ? 293 HOH A O     1 
HETATM 4584 O O     . HOH G 3 .   ? -3.069  -5.192  13.449  1.00 38.70 ? 294 HOH A O     1 
HETATM 4585 O O     . HOH G 3 .   ? -28.553 -13.015 18.180  1.00 30.64 ? 295 HOH A O     1 
HETATM 4586 O O     . HOH G 3 .   ? -1.205  -4.830  16.816  1.00 31.99 ? 296 HOH A O     1 
HETATM 4587 O O     . HOH G 3 .   ? 4.702   -1.520  29.214  1.00 33.61 ? 297 HOH A O     1 
HETATM 4588 O O     . HOH G 3 .   ? 14.631  -6.980  12.149  1.00 33.26 ? 298 HOH A O     1 
HETATM 4589 O O     . HOH G 3 .   ? -20.414 -2.809  24.541  1.00 31.93 ? 299 HOH A O     1 
HETATM 4590 O O     . HOH G 3 .   ? -15.432 -0.591  10.176  1.00 38.34 ? 300 HOH A O     1 
HETATM 4591 O O     . HOH G 3 .   ? -4.071  -12.792 22.145  1.00 32.34 ? 301 HOH A O     1 
HETATM 4592 O O     . HOH G 3 .   ? -5.161  -8.954  19.066  1.00 37.04 ? 302 HOH A O     1 
HETATM 4593 O O     . HOH G 3 .   ? -22.776 -2.026  18.175  1.00 32.32 ? 303 HOH A O     1 
HETATM 4594 O O     . HOH G 3 .   ? -15.142 -14.753 25.935  1.00 39.91 ? 304 HOH A O     1 
HETATM 4595 O O     . HOH G 3 .   ? 9.586   -10.683 26.532  1.00 33.14 ? 305 HOH A O     1 
HETATM 4596 O O     . HOH G 3 .   ? 6.517   13.795  25.214  1.00 38.27 ? 306 HOH A O     1 
HETATM 4597 O O     . HOH G 3 .   ? -5.238  6.844   28.113  1.00 34.56 ? 307 HOH A O     1 
HETATM 4598 O O     . HOH G 3 .   ? 0.369   2.948   8.654   1.00 37.44 ? 308 HOH A O     1 
HETATM 4599 O O     . HOH G 3 .   ? 0.580   -2.057  9.538   1.00 45.59 ? 309 HOH A O     1 
HETATM 4600 O O     . HOH G 3 .   ? 9.011   21.886  4.816   1.00 45.03 ? 310 HOH A O     1 
HETATM 4601 O O     . HOH G 3 .   ? -11.194 2.520   6.691   1.00 42.16 ? 311 HOH A O     1 
HETATM 4602 O O     . HOH G 3 .   ? -33.382 -17.305 30.449  1.00 47.29 ? 312 HOH A O     1 
HETATM 4603 O O     . HOH G 3 .   ? -18.574 -8.105  5.520   1.00 35.92 ? 313 HOH A O     1 
HETATM 4604 O O     . HOH G 3 .   ? -11.471 13.084  15.965  1.00 33.53 ? 314 HOH A O     1 
HETATM 4605 O O     . HOH G 3 .   ? -13.620 -18.942 19.995  1.00 37.41 ? 315 HOH A O     1 
HETATM 4606 O O     . HOH G 3 .   ? -28.651 -11.399 26.411  1.00 36.08 ? 316 HOH A O     1 
HETATM 4607 O O     . HOH G 3 .   ? -24.996 -3.766  18.880  1.00 41.18 ? 317 HOH A O     1 
HETATM 4608 O O     . HOH G 3 .   ? -33.756 -14.124 33.663  1.00 40.86 ? 318 HOH A O     1 
HETATM 4609 O O     . HOH G 3 .   ? -18.832 -20.715 14.599  1.00 38.29 ? 319 HOH A O     1 
HETATM 4610 O O     . HOH G 3 .   ? 8.965   9.478   28.930  1.00 43.56 ? 320 HOH A O     1 
HETATM 4611 O O     . HOH G 3 .   ? 9.056   19.334  -12.455 1.00 40.03 ? 321 HOH A O     1 
HETATM 4612 O O     . HOH G 3 .   ? 5.607   -7.548  6.394   1.00 48.90 ? 322 HOH A O     1 
HETATM 4613 O O     . HOH G 3 .   ? 0.679   10.783  -4.101  1.00 42.86 ? 323 HOH A O     1 
HETATM 4614 O O     . HOH G 3 .   ? 1.858   14.703  18.728  1.00 39.03 ? 324 HOH A O     1 
HETATM 4615 O O     . HOH G 3 .   ? -5.797  -17.125 22.002  1.00 42.97 ? 325 HOH A O     1 
HETATM 4616 O O     . HOH G 3 .   ? -9.647  -11.508 28.270  1.00 55.29 ? 326 HOH A O     1 
HETATM 4617 O O     . HOH G 3 .   ? 9.661   3.909   32.216  1.00 43.70 ? 327 HOH A O     1 
HETATM 4618 O O     . HOH G 3 .   ? 3.959   -21.694 20.068  1.00 40.72 ? 328 HOH A O     1 
HETATM 4619 O O     . HOH G 3 .   ? -10.228 -12.955 0.722   1.00 47.07 ? 329 HOH A O     1 
HETATM 4620 O O     . HOH G 3 .   ? 12.121  -16.119 20.545  1.00 41.43 ? 330 HOH A O     1 
HETATM 4621 O O     . HOH G 3 .   ? -19.888 -9.331  27.861  1.00 45.26 ? 331 HOH A O     1 
HETATM 4622 O O     . HOH G 3 .   ? -4.706  -5.594  27.363  1.00 40.14 ? 332 HOH A O     1 
HETATM 4623 O O     . HOH G 3 .   ? -0.063  -2.340  28.725  1.00 38.40 ? 333 HOH A O     1 
HETATM 4624 O O     . HOH G 3 .   ? 0.184   -14.729 2.394   1.00 39.56 ? 334 HOH A O     1 
HETATM 4625 O O     . HOH G 3 .   ? -21.799 -1.218  15.585  1.00 48.89 ? 335 HOH A O     1 
HETATM 4626 O O     . HOH G 3 .   ? -10.405 -8.457  31.134  1.00 42.93 ? 336 HOH A O     1 
HETATM 4627 O O     . HOH G 3 .   ? -5.924  -0.314  27.755  1.00 47.10 ? 337 HOH A O     1 
HETATM 4628 O O     . HOH G 3 .   ? 4.315   15.942  12.578  1.00 41.45 ? 338 HOH A O     1 
HETATM 4629 O O     . HOH G 3 .   ? -9.268  -16.541 24.608  1.00 40.71 ? 339 HOH A O     1 
HETATM 4630 O O     . HOH G 3 .   ? 0.643   21.781  4.792   1.00 42.39 ? 340 HOH A O     1 
HETATM 4631 O O     . HOH G 3 .   ? -12.957 -19.766 8.717   1.00 46.61 ? 341 HOH A O     1 
HETATM 4632 O O     . HOH G 3 .   ? 3.166   23.229  3.750   1.00 41.18 ? 342 HOH A O     1 
HETATM 4633 O O     . HOH G 3 .   ? -8.838  14.023  14.632  1.00 37.70 ? 343 HOH A O     1 
HETATM 4634 O O     . HOH G 3 .   ? 20.595  19.868  -2.305  1.00 46.24 ? 344 HOH A O     1 
HETATM 4635 O O     . HOH G 3 .   ? -5.090  15.362  12.328  1.00 46.15 ? 345 HOH A O     1 
HETATM 4636 O O     . HOH G 3 .   ? -7.297  8.363   28.934  1.00 53.26 ? 346 HOH A O     1 
HETATM 4637 O O     . HOH G 3 .   ? 10.649  11.256  25.371  1.00 48.43 ? 347 HOH A O     1 
HETATM 4638 O O     . HOH G 3 .   ? -21.668 -5.770  28.837  1.00 56.77 ? 348 HOH A O     1 
HETATM 4639 O O     . HOH G 3 .   ? 8.909   13.291  26.517  1.00 49.65 ? 349 HOH A O     1 
HETATM 4640 O O     . HOH G 3 .   ? 4.917   -5.601  8.238   1.00 54.33 ? 350 HOH A O     1 
HETATM 4641 O O     . HOH G 3 .   ? -25.769 -10.368 27.851  1.00 45.74 ? 351 HOH A O     1 
HETATM 4642 O O     . HOH G 3 .   ? -1.289  14.035  -4.868  1.00 46.15 ? 352 HOH A O     1 
HETATM 4643 O O     . HOH G 3 .   ? 1.526   2.087   1.961   1.00 43.82 ? 353 HOH A O     1 
HETATM 4644 O O     . HOH G 3 .   ? -0.392  1.080   4.049   1.00 47.24 ? 354 HOH A O     1 
HETATM 4645 O O     . HOH G 3 .   ? 18.365  3.522   23.471  1.00 41.48 ? 355 HOH A O     1 
HETATM 4646 O O     . HOH G 3 .   ? 8.805   -16.391 28.470  1.00 43.11 ? 356 HOH A O     1 
HETATM 4647 O O     . HOH G 3 .   ? -10.559 13.950  0.668   1.00 56.15 ? 357 HOH A O     1 
HETATM 4648 O O     . HOH G 3 .   ? 2.352   -17.262 6.111   1.00 59.07 ? 358 HOH A O     1 
HETATM 4649 O O     . HOH G 3 .   ? -29.130 -5.702  17.102  1.00 47.18 ? 359 HOH A O     1 
HETATM 4650 O O     . HOH G 3 .   ? -19.750 -19.108 25.225  1.00 40.70 ? 360 HOH A O     1 
HETATM 4651 O O     . HOH G 3 .   ? -8.678  -0.228  28.403  1.00 40.71 ? 361 HOH A O     1 
HETATM 4652 O O     . HOH H 3 .   ? -10.892 -2.645  -14.765 1.00 13.82 ? 246 HOH B O     1 
HETATM 4653 O O     . HOH H 3 .   ? -2.826  -0.461  -23.250 1.00 14.11 ? 247 HOH B O     1 
HETATM 4654 O O     . HOH H 3 .   ? -12.979 -17.097 -18.524 1.00 17.90 ? 248 HOH B O     1 
HETATM 4655 O O     . HOH H 3 .   ? -8.701  -13.378 -10.167 1.00 16.78 ? 249 HOH B O     1 
HETATM 4656 O O     . HOH H 3 .   ? 0.387   -9.160  -24.461 1.00 17.74 ? 250 HOH B O     1 
HETATM 4657 O O     . HOH H 3 .   ? -9.074  3.744   -22.939 1.00 15.06 ? 251 HOH B O     1 
HETATM 4658 O O     . HOH H 3 .   ? -6.075  -3.159  -8.154  1.00 18.89 ? 252 HOH B O     1 
HETATM 4659 O O     . HOH H 3 .   ? -2.691  -3.036  -9.657  1.00 19.21 ? 253 HOH B O     1 
HETATM 4660 O O     . HOH H 3 .   ? 17.651  3.835   3.460   1.00 18.45 ? 254 HOH B O     1 
HETATM 4661 O O     . HOH H 3 .   ? -5.239  10.479  -12.869 1.00 17.39 ? 255 HOH B O     1 
HETATM 4662 O O     . HOH H 3 .   ? -6.865  -0.588  -23.303 1.00 21.27 ? 256 HOH B O     1 
HETATM 4663 O O     . HOH H 3 .   ? -16.775 -27.467 -33.896 1.00 18.22 ? 257 HOH B O     1 
HETATM 4664 O O     . HOH H 3 .   ? -13.397 -7.545  -7.680  1.00 17.53 ? 258 HOH B O     1 
HETATM 4665 O O     . HOH H 3 .   ? -3.207  -3.075  -30.586 1.00 21.56 ? 259 HOH B O     1 
HETATM 4666 O O     . HOH H 3 .   ? 8.043   -10.219 -9.648  1.00 20.16 ? 260 HOH B O     1 
HETATM 4667 O O     . HOH H 3 .   ? -5.715  2.586   -25.251 1.00 23.32 ? 261 HOH B O     1 
HETATM 4668 O O     . HOH H 3 .   ? -3.472  -0.529  -29.925 1.00 19.11 ? 262 HOH B O     1 
HETATM 4669 O O     . HOH H 3 .   ? -7.851  -11.604 2.484   1.00 22.56 ? 263 HOH B O     1 
HETATM 4670 O O     . HOH H 3 .   ? 11.492  1.452   -21.433 1.00 24.07 ? 264 HOH B O     1 
HETATM 4671 O O     . HOH H 3 .   ? -6.568  -2.579  -15.383 1.00 26.49 ? 265 HOH B O     1 
HETATM 4672 O O     . HOH H 3 .   ? -11.224 -5.139  -10.729 1.00 22.92 ? 266 HOH B O     1 
HETATM 4673 O O     . HOH H 3 .   ? -1.908  1.857   -24.453 1.00 19.81 ? 267 HOH B O     1 
HETATM 4674 O O     . HOH H 3 .   ? 7.394   13.590  -5.563  1.00 21.59 ? 268 HOH B O     1 
HETATM 4675 O O     . HOH H 3 .   ? 1.172   -11.234 -12.127 1.00 24.44 ? 269 HOH B O     1 
HETATM 4676 O O     . HOH H 3 .   ? -6.381  -18.249 -15.810 1.00 27.16 ? 270 HOH B O     1 
HETATM 4677 O O     . HOH H 3 .   ? -16.818 -19.976 -35.712 1.00 26.29 ? 271 HOH B O     1 
HETATM 4678 O O     . HOH H 3 .   ? -2.816  2.106   -26.970 1.00 25.84 ? 272 HOH B O     1 
HETATM 4679 O O     . HOH H 3 .   ? -5.555  -0.662  -20.991 1.00 24.62 ? 273 HOH B O     1 
HETATM 4680 O O     . HOH H 3 .   ? -11.421 -14.194 -7.798  1.00 24.83 ? 274 HOH B O     1 
HETATM 4681 O O     . HOH H 3 .   ? -8.239  1.351   -24.394 1.00 29.26 ? 275 HOH B O     1 
HETATM 4682 O O     . HOH H 3 .   ? -1.521  2.119   -17.236 1.00 25.77 ? 276 HOH B O     1 
HETATM 4683 O O     . HOH H 3 .   ? -10.679 -11.554 -30.142 1.00 27.61 ? 277 HOH B O     1 
HETATM 4684 O O     . HOH H 3 .   ? 2.962   -5.202  -9.692  1.00 25.56 ? 278 HOH B O     1 
HETATM 4685 O O     . HOH H 3 .   ? -4.777  15.404  -25.050 1.00 27.37 ? 279 HOH B O     1 
HETATM 4686 O O     . HOH H 3 .   ? -16.759 -14.377 -12.680 1.00 31.64 ? 280 HOH B O     1 
HETATM 4687 O O     . HOH H 3 .   ? -0.329  -13.744 -16.803 1.00 29.65 ? 281 HOH B O     1 
HETATM 4688 O O     . HOH H 3 .   ? -2.288  -20.993 -23.927 1.00 30.17 ? 282 HOH B O     1 
HETATM 4689 O O     . HOH H 3 .   ? -16.073 4.882   -9.027  1.00 30.33 ? 283 HOH B O     1 
HETATM 4690 O O     . HOH H 3 .   ? -15.016 0.205   -20.532 1.00 32.97 ? 284 HOH B O     1 
HETATM 4691 O O     . HOH H 3 .   ? 0.988   -11.535 -9.419  1.00 33.20 ? 285 HOH B O     1 
HETATM 4692 O O     . HOH H 3 .   ? -0.096  1.854   -9.660  1.00 33.37 ? 286 HOH B O     1 
HETATM 4693 O O     . HOH H 3 .   ? -0.752  4.099   -6.570  1.00 36.07 ? 287 HOH B O     1 
HETATM 4694 O O     . HOH H 3 .   ? -2.868  -0.476  -14.382 1.00 35.15 ? 288 HOH B O     1 
HETATM 4695 O O     . HOH H 3 .   ? -6.148  0.371   -18.678 1.00 31.06 ? 289 HOH B O     1 
HETATM 4696 O O     . HOH H 3 .   ? 0.306   4.256   -27.171 1.00 36.00 ? 290 HOH B O     1 
HETATM 4697 O O     . HOH H 3 .   ? -15.504 2.166   -22.366 1.00 33.72 ? 291 HOH B O     1 
HETATM 4698 O O     . HOH H 3 .   ? 4.235   -15.289 -19.331 1.00 32.97 ? 292 HOH B O     1 
HETATM 4699 O O     . HOH H 3 .   ? -0.817  0.476   -28.992 1.00 32.14 ? 293 HOH B O     1 
HETATM 4700 O O     . HOH H 3 .   ? 10.181  15.141  -28.305 1.00 30.17 ? 294 HOH B O     1 
HETATM 4701 O O     . HOH H 3 .   ? -0.426  9.949   -8.364  1.00 31.47 ? 295 HOH B O     1 
HETATM 4702 O O     . HOH H 3 .   ? 8.345   1.744   -25.123 1.00 38.90 ? 296 HOH B O     1 
HETATM 4703 O O     . HOH H 3 .   ? -10.413 11.093  -9.057  1.00 34.98 ? 297 HOH B O     1 
HETATM 4704 O O     . HOH H 3 .   ? -5.919  6.991   -6.527  1.00 39.70 ? 298 HOH B O     1 
HETATM 4705 O O     . HOH H 3 .   ? -9.968  -9.237  -31.220 1.00 39.07 ? 299 HOH B O     1 
HETATM 4706 O O     . HOH H 3 .   ? -8.024  -16.263 -10.126 1.00 34.97 ? 300 HOH B O     1 
HETATM 4707 O O     . HOH H 3 .   ? -13.221 -8.858  -5.044  1.00 31.98 ? 301 HOH B O     1 
HETATM 4708 O O     . HOH H 3 .   ? -10.008 15.273  -28.278 1.00 36.27 ? 302 HOH B O     1 
HETATM 4709 O O     . HOH H 3 .   ? -4.140  5.718   -0.377  1.00 27.20 ? 303 HOH B O     1 
HETATM 4710 O O     . HOH H 3 .   ? -18.965 -13.839 -21.500 1.00 33.24 ? 304 HOH B O     1 
HETATM 4711 O O     . HOH H 3 .   ? 13.068  12.017  -27.618 1.00 36.59 ? 305 HOH B O     1 
HETATM 4712 O O     . HOH H 3 .   ? -14.331 1.619   -4.571  1.00 36.06 ? 306 HOH B O     1 
HETATM 4713 O O     . HOH H 3 .   ? 17.203  4.225   17.345  1.00 40.84 ? 307 HOH B O     1 
HETATM 4714 O O     . HOH H 3 .   ? -4.011  16.981  -9.736  1.00 34.40 ? 308 HOH B O     1 
HETATM 4715 O O     . HOH H 3 .   ? -13.512 -12.964 -6.716  1.00 37.97 ? 309 HOH B O     1 
HETATM 4716 O O     . HOH H 3 .   ? 25.247  3.784   8.604   1.00 41.35 ? 310 HOH B O     1 
HETATM 4717 O O     . HOH H 3 .   ? 0.206   -15.865 -28.047 1.00 36.58 ? 311 HOH B O     1 
HETATM 4718 O O     . HOH H 3 .   ? 1.487   -8.264  -27.077 1.00 46.76 ? 312 HOH B O     1 
HETATM 4719 O O     . HOH H 3 .   ? 16.762  1.082   -16.219 1.00 34.51 ? 313 HOH B O     1 
HETATM 4720 O O     . HOH H 3 .   ? -6.861  -9.168  -32.504 1.00 38.03 ? 314 HOH B O     1 
HETATM 4721 O O     . HOH H 3 .   ? 16.481  -9.129  -19.186 1.00 37.12 ? 315 HOH B O     1 
HETATM 4722 O O     . HOH H 3 .   ? -4.890  4.497   -7.276  1.00 40.32 ? 316 HOH B O     1 
HETATM 4723 O O     . HOH H 3 .   ? -19.606 -19.765 -34.704 1.00 43.14 ? 317 HOH B O     1 
HETATM 4724 O O     . HOH H 3 .   ? 14.163  13.622  -21.835 1.00 34.78 ? 318 HOH B O     1 
HETATM 4725 O O     . HOH H 3 .   ? -11.887 -23.174 -24.156 1.00 46.97 ? 319 HOH B O     1 
HETATM 4726 O O     . HOH H 3 .   ? 0.193   20.170  -15.126 1.00 41.04 ? 320 HOH B O     1 
HETATM 4727 O O     . HOH H 3 .   ? 17.071  -4.764  -10.628 1.00 46.11 ? 321 HOH B O     1 
HETATM 4728 O O     . HOH H 3 .   ? 23.526  6.408   0.658   1.00 45.21 ? 322 HOH B O     1 
HETATM 4729 O O     . HOH H 3 .   ? -16.957 -12.539 -16.497 1.00 39.35 ? 323 HOH B O     1 
HETATM 4730 O O     . HOH H 3 .   ? -9.039  -25.477 -25.698 1.00 55.99 ? 324 HOH B O     1 
HETATM 4731 O O     . HOH H 3 .   ? 18.088  3.635   -15.661 1.00 42.25 ? 325 HOH B O     1 
HETATM 4732 O O     . HOH H 3 .   ? -12.310 -5.965  -27.216 1.00 38.35 ? 326 HOH B O     1 
HETATM 4733 O O     . HOH H 3 .   ? -15.391 14.389  -18.561 1.00 37.88 ? 327 HOH B O     1 
HETATM 4734 O O     . HOH H 3 .   ? 13.570  7.322   -26.331 1.00 39.71 ? 328 HOH B O     1 
HETATM 4735 O O     . HOH H 3 .   ? -16.544 -0.063  -7.596  1.00 38.28 ? 329 HOH B O     1 
HETATM 4736 O O     . HOH H 3 .   ? 8.893   21.817  -18.350 1.00 43.74 ? 330 HOH B O     1 
HETATM 4737 O O     . HOH H 3 .   ? 14.923  -9.850  -15.515 1.00 45.59 ? 331 HOH B O     1 
HETATM 4738 O O     . HOH H 3 .   ? -0.807  -19.332 -22.368 1.00 39.67 ? 332 HOH B O     1 
HETATM 4739 O O     . HOH H 3 .   ? 18.065  1.107   5.736   1.00 53.85 ? 333 HOH B O     1 
HETATM 4740 O O     . HOH H 3 .   ? 2.839   5.410   -27.979 1.00 48.84 ? 334 HOH B O     1 
HETATM 4741 O O     . HOH H 3 .   ? -4.272  22.396  -25.585 1.00 42.80 ? 335 HOH B O     1 
HETATM 4742 O O     . HOH H 3 .   ? 4.367   13.822  -28.453 1.00 36.08 ? 336 HOH B O     1 
HETATM 4743 O O     . HOH H 3 .   ? 18.072  4.657   -8.601  1.00 49.84 ? 337 HOH B O     1 
HETATM 4744 O O     . HOH H 3 .   ? -21.305 -21.001 -32.840 1.00 50.26 ? 338 HOH B O     1 
HETATM 4745 O O     . HOH H 3 .   ? -13.668 -3.844  -31.391 1.00 42.43 ? 339 HOH B O     1 
HETATM 4746 O O     . HOH H 3 .   ? -6.059  2.585   -28.152 1.00 44.66 ? 340 HOH B O     1 
HETATM 4747 O O     . HOH H 3 .   ? -12.758 16.580  -20.279 1.00 51.13 ? 341 HOH B O     1 
HETATM 4748 O O     . HOH H 3 .   ? -3.333  3.563   -5.283  1.00 57.82 ? 342 HOH B O     1 
HETATM 4749 O O     . HOH H 3 .   ? 10.931  -11.922 -8.915  1.00 56.16 ? 343 HOH B O     1 
HETATM 4750 O O     . HOH H 3 .   ? 8.556   -0.270  6.929   1.00 46.96 ? 344 HOH B O     1 
HETATM 4751 O O     . HOH H 3 .   ? -1.986  7.252   -6.924  1.00 45.52 ? 345 HOH B O     1 
HETATM 4752 O O     . HOH H 3 .   ? -15.461 -9.268  -7.851  1.00 46.98 ? 346 HOH B O     1 
HETATM 4753 O O     . HOH H 3 .   ? -15.055 9.136   -14.278 1.00 47.14 ? 347 HOH B O     1 
HETATM 4754 O O     . HOH H 3 .   ? -9.999  5.077   -26.538 1.00 41.80 ? 348 HOH B O     1 
HETATM 4755 O O     . HOH H 3 .   ? 20.505  -0.138  12.667  1.00 41.01 ? 349 HOH B O     1 
HETATM 4756 O O     . HOH H 3 .   ? 21.026  17.529  9.269   1.00 48.39 ? 350 HOH B O     1 
HETATM 4757 O O     . HOH H 3 .   ? 4.945   -0.810  -27.687 1.00 38.52 ? 351 HOH B O     1 
HETATM 4758 O O     . HOH H 3 .   ? 15.637  -7.884  -13.612 1.00 47.00 ? 352 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DG  4   4   4   DG  G   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DT  8   8   8   DT  T   C . n 
A 1 9   DC  9   9   9   DC  C   C . n 
A 1 10  DT  10  10  10  DT  T   C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
B 1 1   DA  1   1   1   DA  A   D . n 
B 1 2   DA  2   2   2   DA  A   D . n 
B 1 3   DA  3   3   3   DA  A   D . n 
B 1 4   DG  4   4   4   DG  G   D . n 
B 1 5   DA  5   5   5   DA  A   D . n 
B 1 6   DT  6   6   6   DT  T   D . n 
B 1 7   DA  7   7   7   DA  A   D . n 
B 1 8   DT  8   8   8   DT  T   D . n 
B 1 9   DC  9   9   9   DC  C   D . n 
B 1 10  DT  10  10  10  DT  T   D . n 
B 1 11  DT  11  11  11  DT  T   D . n 
C 2 1   SER 1   2   2   SER SER A . n 
C 2 2   LEU 2   3   3   LEU LEU A . n 
C 2 3   ARG 3   4   4   ARG ARG A . n 
C 2 4   SER 4   5   5   SER SER A . n 
C 2 5   ASP 5   6   6   ASP ASP A . n 
C 2 6   LEU 6   7   7   LEU LEU A . n 
C 2 7   ILE 7   8   8   ILE ILE A . n 
C 2 8   ASN 8   9   9   ASN ASN A . n 
C 2 9   ALA 9   10  10  ALA ALA A . n 
C 2 10  LEU 10  11  11  LEU LEU A . n 
C 2 11  TYR 11  12  12  TYR TYR A . n 
C 2 12  ASP 12  13  13  ASP ASP A . n 
C 2 13  GLU 13  14  14  GLU GLU A . n 
C 2 14  ASN 14  15  15  ASN ASN A . n 
C 2 15  GLN 15  16  16  GLN GLN A . n 
C 2 16  LYS 16  17  17  LYS LYS A . n 
C 2 17  TYR 17  18  18  TYR TYR A . n 
C 2 18  ASP 18  19  19  ASP ASP A . n 
C 2 19  VAL 19  20  20  VAL VAL A . n 
C 2 20  CYS 20  21  21  CYS CYS A . n 
C 2 21  GLY 21  22  22  GLY GLY A . n 
C 2 22  ILE 22  23  23  ILE ILE A . n 
C 2 23  ILE 23  24  24  ILE ILE A . n 
C 2 24  SER 24  25  25  SER SER A . n 
C 2 25  ALA 25  26  26  ALA ALA A . n 
C 2 26  GLU 26  27  27  GLU GLU A . n 
C 2 27  GLY 27  28  28  GLY GLY A . n 
C 2 28  LYS 28  29  29  LYS LYS A . n 
C 2 29  ILE 29  30  30  ILE ILE A . n 
C 2 30  TYR 30  31  31  TYR TYR A . n 
C 2 31  PRO 31  32  32  PRO PRO A . n 
C 2 32  LEU 32  33  33  LEU LEU A . n 
C 2 33  GLY 33  34  34  GLY GLY A . n 
C 2 34  SER 34  35  35  SER SER A . n 
C 2 35  ASP 35  36  36  ASP ASP A . n 
C 2 36  THR 36  37  37  THR THR A . n 
C 2 37  LYS 37  38  38  LYS LYS A . n 
C 2 38  VAL 38  39  39  VAL VAL A . n 
C 2 39  LEU 39  40  40  LEU LEU A . n 
C 2 40  SER 40  41  41  SER SER A . n 
C 2 41  THR 41  42  42  THR THR A . n 
C 2 42  ILE 42  43  43  ILE ILE A . n 
C 2 43  PHE 43  44  44  PHE PHE A . n 
C 2 44  GLU 44  45  45  GLU GLU A . n 
C 2 45  LEU 45  46  46  LEU LEU A . n 
C 2 46  PHE 46  47  47  PHE PHE A . n 
C 2 47  SER 47  48  48  SER SER A . n 
C 2 48  ARG 48  49  49  ARG ARG A . n 
C 2 49  PRO 49  50  50  PRO PRO A . n 
C 2 50  ILE 50  51  51  ILE ILE A . n 
C 2 51  ILE 51  52  52  ILE ILE A . n 
C 2 52  ASN 52  53  53  ASN ASN A . n 
C 2 53  LYS 53  54  54  LYS LYS A . n 
C 2 54  ILE 54  55  55  ILE ILE A . n 
C 2 55  ALA 55  56  56  ALA ALA A . n 
C 2 56  GLU 56  57  57  GLU GLU A . n 
C 2 57  LYS 57  58  58  LYS LYS A . n 
C 2 58  HIS 58  59  59  HIS HIS A . n 
C 2 59  GLY 59  60  60  GLY GLY A . n 
C 2 60  TYR 60  61  61  TYR TYR A . n 
C 2 61  ILE 61  62  62  ILE ILE A . n 
C 2 62  VAL 62  63  63  VAL VAL A . n 
C 2 63  GLU 63  64  64  GLU GLU A . n 
C 2 64  GLU 64  65  65  GLU GLU A . n 
C 2 65  PRO 65  66  66  PRO PRO A . n 
C 2 66  LYS 66  67  67  LYS LYS A . n 
C 2 67  GLN 67  68  68  GLN GLN A . n 
C 2 68  GLN 68  69  69  GLN GLN A . n 
C 2 69  ASN 69  70  70  ASN ASN A . n 
C 2 70  HIS 70  71  71  HIS HIS A . n 
C 2 71  TYR 71  72  72  TYR TYR A . n 
C 2 72  PRO 72  73  73  PRO PRO A . n 
C 2 73  ASP 73  74  74  ASP ASP A . n 
C 2 74  PHE 74  75  75  PHE PHE A . n 
C 2 75  THR 75  76  76  THR THR A . n 
C 2 76  LEU 76  77  77  LEU LEU A . n 
C 2 77  TYR 77  78  78  TYR TYR A . n 
C 2 78  LYS 78  79  79  LYS LYS A . n 
C 2 79  PRO 79  80  80  PRO PRO A . n 
C 2 80  SER 80  81  81  SER SER A . n 
C 2 81  GLU 81  82  82  GLU GLU A . n 
C 2 82  PRO 82  83  83  PRO PRO A . n 
C 2 83  ASN 83  84  84  ASN ASN A . n 
C 2 84  LYS 84  85  85  LYS LYS A . n 
C 2 85  LYS 85  86  86  LYS LYS A . n 
C 2 86  ILE 86  87  87  ILE ILE A . n 
C 2 87  ALA 87  88  88  ALA ALA A . n 
C 2 88  ILE 88  89  89  ILE ILE A . n 
C 2 89  ASP 89  90  90  ASP ASP A . n 
C 2 90  ILE 90  91  91  ILE ILE A . n 
C 2 91  LYS 91  92  92  LYS LYS A . n 
C 2 92  THR 92  93  93  THR THR A . n 
C 2 93  THR 93  94  94  THR THR A . n 
C 2 94  TYR 94  95  95  TYR TYR A . n 
C 2 95  THR 95  96  96  THR THR A . n 
C 2 96  ASN 96  97  97  ASN ASN A . n 
C 2 97  LYS 97  98  98  LYS LYS A . n 
C 2 98  GLU 98  99  99  GLU GLU A . n 
C 2 99  ASN 99  100 100 ASN ASN A . n 
C 2 100 GLU 100 101 101 GLU GLU A . n 
C 2 101 LYS 101 102 102 LYS LYS A . n 
C 2 102 ILE 102 103 103 ILE ILE A . n 
C 2 103 LYS 103 104 104 LYS LYS A . n 
C 2 104 PHE 104 105 105 PHE PHE A . n 
C 2 105 THR 105 106 106 THR THR A . n 
C 2 106 LEU 106 107 107 LEU LEU A . n 
C 2 107 GLY 107 108 108 GLY GLY A . n 
C 2 108 GLY 108 109 109 GLY GLY A . n 
C 2 109 TYR 109 110 110 TYR TYR A . n 
C 2 110 THR 110 111 111 THR THR A . n 
C 2 111 SER 111 112 112 SER SER A . n 
C 2 112 PHE 112 113 113 PHE PHE A . n 
C 2 113 ILE 113 114 114 ILE ILE A . n 
C 2 114 ARG 114 115 115 ARG ARG A . n 
C 2 115 ASN 115 116 116 ASN ASN A . n 
C 2 116 ASN 116 117 117 ASN ASN A . n 
C 2 117 THR 117 118 118 THR THR A . n 
C 2 118 LYS 118 119 119 LYS LYS A . n 
C 2 119 ASN 119 120 120 ASN ASN A . n 
C 2 120 ILE 120 121 121 ILE ILE A . n 
C 2 121 VAL 121 122 122 VAL VAL A . n 
C 2 122 TYR 122 123 123 TYR TYR A . n 
C 2 123 PRO 123 124 124 PRO PRO A . n 
C 2 124 PHE 124 125 125 PHE PHE A . n 
C 2 125 ASP 125 126 126 ASP ASP A . n 
C 2 126 GLN 126 127 127 GLN GLN A . n 
C 2 127 TYR 127 128 128 TYR TYR A . n 
C 2 128 ILE 128 129 129 ILE ILE A . n 
C 2 129 ALA 129 130 130 ALA ALA A . n 
C 2 130 HIS 130 131 131 HIS HIS A . n 
C 2 131 TRP 131 132 132 TRP TRP A . n 
C 2 132 ILE 132 133 133 ILE ILE A . n 
C 2 133 ILE 133 134 134 ILE ILE A . n 
C 2 134 GLY 134 135 135 GLY GLY A . n 
C 2 135 TYR 135 136 136 TYR TYR A . n 
C 2 136 VAL 136 137 137 VAL VAL A . n 
C 2 137 TYR 137 138 138 TYR TYR A . n 
C 2 138 THR 138 139 139 THR THR A . n 
C 2 139 ARG 139 140 140 ARG ARG A . n 
C 2 140 VAL 140 141 141 VAL VAL A . n 
C 2 141 ALA 141 142 142 ALA ALA A . n 
C 2 142 THR 142 143 143 THR THR A . n 
C 2 143 ARG 143 144 144 ARG ARG A . n 
C 2 144 LYS 144 145 145 LYS LYS A . n 
C 2 145 SER 145 146 146 SER SER A . n 
C 2 146 SER 146 147 147 SER SER A . n 
C 2 147 LEU 147 148 148 LEU LEU A . n 
C 2 148 LYS 148 149 149 LYS LYS A . n 
C 2 149 THR 149 150 150 THR THR A . n 
C 2 150 TYR 150 151 151 TYR TYR A . n 
C 2 151 ASN 151 152 152 ASN ASN A . n 
C 2 152 ILE 152 153 153 ILE ILE A . n 
C 2 153 ASN 153 154 154 ASN ASN A . n 
C 2 154 GLU 154 155 155 GLU GLU A . n 
C 2 155 LEU 155 156 156 LEU LEU A . n 
C 2 156 ASN 156 157 157 ASN ASN A . n 
C 2 157 GLU 157 158 158 GLU GLU A . n 
C 2 158 ILE 158 159 159 ILE ILE A . n 
C 2 159 PRO 159 160 160 PRO PRO A . n 
C 2 160 LYS 160 161 161 LYS LYS A . n 
C 2 161 PRO 161 162 162 PRO PRO A . n 
C 2 162 TYR 162 163 163 TYR TYR A . n 
C 2 163 LYS 163 164 164 LYS LYS A . n 
C 2 164 GLY 164 165 165 GLY GLY A . n 
C 2 165 VAL 165 166 166 VAL VAL A . n 
C 2 166 LYS 166 167 167 LYS LYS A . n 
C 2 167 VAL 167 168 168 VAL VAL A . n 
C 2 168 PHE 168 169 169 PHE PHE A . n 
C 2 169 LEU 169 170 170 LEU LEU A . n 
C 2 170 GLN 170 171 171 GLN GLN A . n 
C 2 171 ASP 171 172 172 ASP ASP A . n 
C 2 172 LYS 172 173 173 LYS LYS A . n 
C 2 173 TRP 173 174 174 TRP TRP A . n 
C 2 174 VAL 174 175 175 VAL VAL A . n 
C 2 175 ILE 175 176 176 ILE ILE A . n 
C 2 176 ALA 176 177 177 ALA ALA A . n 
C 2 177 GLY 177 178 178 GLY GLY A . n 
C 2 178 ASP 178 179 179 ASP ASP A . n 
C 2 179 LEU 179 180 180 LEU LEU A . n 
C 2 180 ALA 180 181 181 ALA ALA A . n 
C 2 181 GLY 181 182 182 GLY GLY A . n 
C 2 182 SER 182 183 183 SER SER A . n 
C 2 183 GLY 183 184 184 GLY GLY A . n 
C 2 184 ASN 184 185 185 ASN ASN A . n 
C 2 185 THR 185 186 186 THR THR A . n 
C 2 186 THR 186 187 187 THR THR A . n 
C 2 187 ASN 187 188 188 ASN ASN A . n 
C 2 188 ILE 188 189 189 ILE ILE A . n 
C 2 189 GLY 189 190 190 GLY GLY A . n 
C 2 190 SER 190 191 191 SER SER A . n 
C 2 191 ILE 191 192 192 ILE ILE A . n 
C 2 192 HIS 192 193 193 HIS HIS A . n 
C 2 193 ALA 193 194 194 ALA ALA A . n 
C 2 194 HIS 194 195 195 HIS HIS A . n 
C 2 195 TYR 195 196 196 TYR TYR A . n 
C 2 196 LYS 196 197 197 LYS LYS A . n 
C 2 197 ASP 197 198 198 ASP ASP A . n 
C 2 198 PHE 198 199 199 PHE PHE A . n 
C 2 199 VAL 199 200 200 VAL VAL A . n 
C 2 200 GLU 200 201 201 GLU GLU A . n 
C 2 201 GLY 201 202 202 GLY GLY A . n 
C 2 202 LYS 202 203 203 LYS LYS A . n 
C 2 203 GLY 203 204 204 GLY GLY A . n 
C 2 204 ILE 204 205 205 ILE ILE A . n 
C 2 205 PHE 205 206 206 PHE PHE A . n 
C 2 206 ASP 206 207 207 ASP ASP A . n 
C 2 207 SER 207 208 208 SER SER A . n 
C 2 208 GLU 208 209 209 GLU GLU A . n 
C 2 209 ASP 209 210 210 ASP ASP A . n 
C 2 210 GLU 210 211 211 GLU GLU A . n 
C 2 211 PHE 211 212 212 PHE PHE A . n 
C 2 212 LEU 212 213 213 LEU LEU A . n 
C 2 213 ASP 213 214 214 ASP ASP A . n 
C 2 214 TYR 214 215 215 TYR TYR A . n 
C 2 215 TRP 215 216 216 TRP TRP A . n 
C 2 216 ARG 216 217 217 ARG ARG A . n 
C 2 217 ASN 217 218 218 ASN ASN A . n 
C 2 218 TYR 218 219 219 TYR TYR A . n 
C 2 219 GLU 219 220 220 GLU GLU A . n 
C 2 220 ARG 220 221 221 ARG ARG A . n 
C 2 221 THR 221 222 222 THR THR A . n 
C 2 222 SER 222 223 223 SER SER A . n 
C 2 223 GLN 223 224 224 GLN GLN A . n 
C 2 224 LEU 224 225 225 LEU LEU A . n 
C 2 225 ARG 225 226 226 ARG ARG A . n 
C 2 226 ASN 226 227 227 ASN ASN A . n 
C 2 227 ASP 227 228 228 ASP ASP A . n 
C 2 228 LYS 228 229 229 LYS LYS A . n 
C 2 229 TYR 229 230 230 TYR TYR A . n 
C 2 230 ASN 230 231 231 ASN ASN A . n 
C 2 231 ASN 231 232 232 ASN ASN A . n 
C 2 232 ILE 232 233 233 ILE ILE A . n 
C 2 233 SER 233 234 234 SER SER A . n 
C 2 234 GLU 234 235 235 GLU GLU A . n 
C 2 235 TYR 235 236 236 TYR TYR A . n 
C 2 236 ARG 236 237 237 ARG ARG A . n 
C 2 237 ASN 237 238 238 ASN ASN A . n 
C 2 238 TRP 238 239 239 TRP TRP A . n 
C 2 239 ILE 239 240 240 ILE ILE A . n 
C 2 240 TYR 240 241 241 TYR TYR A . n 
C 2 241 ARG 241 242 242 ARG ARG A . n 
C 2 242 GLY 242 243 243 GLY GLY A . n 
C 2 243 ARG 243 244 244 ARG ARG A . n 
C 2 244 LYS 244 245 245 LYS LYS A . n 
D 2 1   SER 1   2   2   SER SER B . n 
D 2 2   LEU 2   3   3   LEU LEU B . n 
D 2 3   ARG 3   4   4   ARG ARG B . n 
D 2 4   SER 4   5   5   SER SER B . n 
D 2 5   ASP 5   6   6   ASP ASP B . n 
D 2 6   LEU 6   7   7   LEU LEU B . n 
D 2 7   ILE 7   8   8   ILE ILE B . n 
D 2 8   ASN 8   9   9   ASN ASN B . n 
D 2 9   ALA 9   10  10  ALA ALA B . n 
D 2 10  LEU 10  11  11  LEU LEU B . n 
D 2 11  TYR 11  12  12  TYR TYR B . n 
D 2 12  ASP 12  13  13  ASP ASP B . n 
D 2 13  GLU 13  14  14  GLU GLU B . n 
D 2 14  ASN 14  15  15  ASN ASN B . n 
D 2 15  GLN 15  16  16  GLN GLN B . n 
D 2 16  LYS 16  17  17  LYS LYS B . n 
D 2 17  TYR 17  18  18  TYR TYR B . n 
D 2 18  ASP 18  19  19  ASP ASP B . n 
D 2 19  VAL 19  20  20  VAL VAL B . n 
D 2 20  CYS 20  21  21  CYS CYS B . n 
D 2 21  GLY 21  22  22  GLY GLY B . n 
D 2 22  ILE 22  23  23  ILE ILE B . n 
D 2 23  ILE 23  24  24  ILE ILE B . n 
D 2 24  SER 24  25  25  SER SER B . n 
D 2 25  ALA 25  26  26  ALA ALA B . n 
D 2 26  GLU 26  27  27  GLU GLU B . n 
D 2 27  GLY 27  28  28  GLY GLY B . n 
D 2 28  LYS 28  29  29  LYS LYS B . n 
D 2 29  ILE 29  30  30  ILE ILE B . n 
D 2 30  TYR 30  31  31  TYR TYR B . n 
D 2 31  PRO 31  32  32  PRO PRO B . n 
D 2 32  LEU 32  33  33  LEU LEU B . n 
D 2 33  GLY 33  34  34  GLY GLY B . n 
D 2 34  SER 34  35  35  SER SER B . n 
D 2 35  ASP 35  36  36  ASP ASP B . n 
D 2 36  THR 36  37  37  THR THR B . n 
D 2 37  LYS 37  38  38  LYS LYS B . n 
D 2 38  VAL 38  39  39  VAL VAL B . n 
D 2 39  LEU 39  40  40  LEU LEU B . n 
D 2 40  SER 40  41  41  SER SER B . n 
D 2 41  THR 41  42  42  THR THR B . n 
D 2 42  ILE 42  43  43  ILE ILE B . n 
D 2 43  PHE 43  44  44  PHE PHE B . n 
D 2 44  GLU 44  45  45  GLU GLU B . n 
D 2 45  LEU 45  46  46  LEU LEU B . n 
D 2 46  PHE 46  47  47  PHE PHE B . n 
D 2 47  SER 47  48  48  SER SER B . n 
D 2 48  ARG 48  49  49  ARG ARG B . n 
D 2 49  PRO 49  50  50  PRO PRO B . n 
D 2 50  ILE 50  51  51  ILE ILE B . n 
D 2 51  ILE 51  52  52  ILE ILE B . n 
D 2 52  ASN 52  53  53  ASN ASN B . n 
D 2 53  LYS 53  54  54  LYS LYS B . n 
D 2 54  ILE 54  55  55  ILE ILE B . n 
D 2 55  ALA 55  56  56  ALA ALA B . n 
D 2 56  GLU 56  57  57  GLU GLU B . n 
D 2 57  LYS 57  58  58  LYS LYS B . n 
D 2 58  HIS 58  59  59  HIS HIS B . n 
D 2 59  GLY 59  60  60  GLY GLY B . n 
D 2 60  TYR 60  61  61  TYR TYR B . n 
D 2 61  ILE 61  62  62  ILE ILE B . n 
D 2 62  VAL 62  63  63  VAL VAL B . n 
D 2 63  GLU 63  64  64  GLU GLU B . n 
D 2 64  GLU 64  65  65  GLU GLU B . n 
D 2 65  PRO 65  66  66  PRO PRO B . n 
D 2 66  LYS 66  67  67  LYS LYS B . n 
D 2 67  GLN 67  68  68  GLN GLN B . n 
D 2 68  GLN 68  69  69  GLN GLN B . n 
D 2 69  ASN 69  70  70  ASN ASN B . n 
D 2 70  HIS 70  71  71  HIS HIS B . n 
D 2 71  TYR 71  72  72  TYR TYR B . n 
D 2 72  PRO 72  73  73  PRO PRO B . n 
D 2 73  ASP 73  74  74  ASP ASP B . n 
D 2 74  PHE 74  75  75  PHE PHE B . n 
D 2 75  THR 75  76  76  THR THR B . n 
D 2 76  LEU 76  77  77  LEU LEU B . n 
D 2 77  TYR 77  78  78  TYR TYR B . n 
D 2 78  LYS 78  79  79  LYS LYS B . n 
D 2 79  PRO 79  80  80  PRO PRO B . n 
D 2 80  SER 80  81  81  SER SER B . n 
D 2 81  GLU 81  82  82  GLU GLU B . n 
D 2 82  PRO 82  83  83  PRO PRO B . n 
D 2 83  ASN 83  84  84  ASN ASN B . n 
D 2 84  LYS 84  85  85  LYS LYS B . n 
D 2 85  LYS 85  86  86  LYS LYS B . n 
D 2 86  ILE 86  87  87  ILE ILE B . n 
D 2 87  ALA 87  88  88  ALA ALA B . n 
D 2 88  ILE 88  89  89  ILE ILE B . n 
D 2 89  ASP 89  90  90  ASP ASP B . n 
D 2 90  ILE 90  91  91  ILE ILE B . n 
D 2 91  LYS 91  92  92  LYS LYS B . n 
D 2 92  THR 92  93  93  THR THR B . n 
D 2 93  THR 93  94  94  THR THR B . n 
D 2 94  TYR 94  95  95  TYR TYR B . n 
D 2 95  THR 95  96  96  THR THR B . n 
D 2 96  ASN 96  97  97  ASN ASN B . n 
D 2 97  LYS 97  98  98  LYS LYS B . n 
D 2 98  GLU 98  99  99  GLU GLU B . n 
D 2 99  ASN 99  100 100 ASN ASN B . n 
D 2 100 GLU 100 101 101 GLU GLU B . n 
D 2 101 LYS 101 102 102 LYS LYS B . n 
D 2 102 ILE 102 103 103 ILE ILE B . n 
D 2 103 LYS 103 104 104 LYS LYS B . n 
D 2 104 PHE 104 105 105 PHE PHE B . n 
D 2 105 THR 105 106 106 THR THR B . n 
D 2 106 LEU 106 107 107 LEU LEU B . n 
D 2 107 GLY 107 108 108 GLY GLY B . n 
D 2 108 GLY 108 109 109 GLY GLY B . n 
D 2 109 TYR 109 110 110 TYR TYR B . n 
D 2 110 THR 110 111 111 THR THR B . n 
D 2 111 SER 111 112 112 SER SER B . n 
D 2 112 PHE 112 113 113 PHE PHE B . n 
D 2 113 ILE 113 114 114 ILE ILE B . n 
D 2 114 ARG 114 115 115 ARG ARG B . n 
D 2 115 ASN 115 116 116 ASN ASN B . n 
D 2 116 ASN 116 117 117 ASN ASN B . n 
D 2 117 THR 117 118 118 THR THR B . n 
D 2 118 LYS 118 119 119 LYS LYS B . n 
D 2 119 ASN 119 120 120 ASN ASN B . n 
D 2 120 ILE 120 121 121 ILE ILE B . n 
D 2 121 VAL 121 122 122 VAL VAL B . n 
D 2 122 TYR 122 123 123 TYR TYR B . n 
D 2 123 PRO 123 124 124 PRO PRO B . n 
D 2 124 PHE 124 125 125 PHE PHE B . n 
D 2 125 ASP 125 126 126 ASP ASP B . n 
D 2 126 GLN 126 127 127 GLN GLN B . n 
D 2 127 TYR 127 128 128 TYR TYR B . n 
D 2 128 ILE 128 129 129 ILE ILE B . n 
D 2 129 ALA 129 130 130 ALA ALA B . n 
D 2 130 HIS 130 131 131 HIS HIS B . n 
D 2 131 TRP 131 132 132 TRP TRP B . n 
D 2 132 ILE 132 133 133 ILE ILE B . n 
D 2 133 ILE 133 134 134 ILE ILE B . n 
D 2 134 GLY 134 135 135 GLY GLY B . n 
D 2 135 TYR 135 136 136 TYR TYR B . n 
D 2 136 VAL 136 137 137 VAL VAL B . n 
D 2 137 TYR 137 138 138 TYR TYR B . n 
D 2 138 THR 138 139 139 THR THR B . n 
D 2 139 ARG 139 140 140 ARG ARG B . n 
D 2 140 VAL 140 141 141 VAL VAL B . n 
D 2 141 ALA 141 142 142 ALA ALA B . n 
D 2 142 THR 142 143 143 THR THR B . n 
D 2 143 ARG 143 144 144 ARG ARG B . n 
D 2 144 LYS 144 145 145 LYS LYS B . n 
D 2 145 SER 145 146 146 SER SER B . n 
D 2 146 SER 146 147 147 SER SER B . n 
D 2 147 LEU 147 148 148 LEU LEU B . n 
D 2 148 LYS 148 149 149 LYS LYS B . n 
D 2 149 THR 149 150 150 THR THR B . n 
D 2 150 TYR 150 151 151 TYR TYR B . n 
D 2 151 ASN 151 152 152 ASN ASN B . n 
D 2 152 ILE 152 153 153 ILE ILE B . n 
D 2 153 ASN 153 154 154 ASN ASN B . n 
D 2 154 GLU 154 155 155 GLU GLU B . n 
D 2 155 LEU 155 156 156 LEU LEU B . n 
D 2 156 ASN 156 157 157 ASN ASN B . n 
D 2 157 GLU 157 158 158 GLU GLU B . n 
D 2 158 ILE 158 159 159 ILE ILE B . n 
D 2 159 PRO 159 160 160 PRO PRO B . n 
D 2 160 LYS 160 161 161 LYS LYS B . n 
D 2 161 PRO 161 162 162 PRO PRO B . n 
D 2 162 TYR 162 163 163 TYR TYR B . n 
D 2 163 LYS 163 164 164 LYS LYS B . n 
D 2 164 GLY 164 165 165 GLY GLY B . n 
D 2 165 VAL 165 166 166 VAL VAL B . n 
D 2 166 LYS 166 167 167 LYS LYS B . n 
D 2 167 VAL 167 168 168 VAL VAL B . n 
D 2 168 PHE 168 169 169 PHE PHE B . n 
D 2 169 LEU 169 170 170 LEU LEU B . n 
D 2 170 GLN 170 171 171 GLN GLN B . n 
D 2 171 ASP 171 172 172 ASP ASP B . n 
D 2 172 LYS 172 173 173 LYS LYS B . n 
D 2 173 TRP 173 174 174 TRP TRP B . n 
D 2 174 VAL 174 175 175 VAL VAL B . n 
D 2 175 ILE 175 176 176 ILE ILE B . n 
D 2 176 ALA 176 177 177 ALA ALA B . n 
D 2 177 GLY 177 178 178 GLY GLY B . n 
D 2 178 ASP 178 179 179 ASP ASP B . n 
D 2 179 LEU 179 180 180 LEU LEU B . n 
D 2 180 ALA 180 181 181 ALA ALA B . n 
D 2 181 GLY 181 182 182 GLY GLY B . n 
D 2 182 SER 182 183 183 SER SER B . n 
D 2 183 GLY 183 184 184 GLY GLY B . n 
D 2 184 ASN 184 185 185 ASN ASN B . n 
D 2 185 THR 185 186 186 THR THR B . n 
D 2 186 THR 186 187 187 THR THR B . n 
D 2 187 ASN 187 188 188 ASN ASN B . n 
D 2 188 ILE 188 189 189 ILE ILE B . n 
D 2 189 GLY 189 190 190 GLY GLY B . n 
D 2 190 SER 190 191 191 SER SER B . n 
D 2 191 ILE 191 192 192 ILE ILE B . n 
D 2 192 HIS 192 193 193 HIS HIS B . n 
D 2 193 ALA 193 194 194 ALA ALA B . n 
D 2 194 HIS 194 195 195 HIS HIS B . n 
D 2 195 TYR 195 196 196 TYR TYR B . n 
D 2 196 LYS 196 197 197 LYS LYS B . n 
D 2 197 ASP 197 198 198 ASP ASP B . n 
D 2 198 PHE 198 199 199 PHE PHE B . n 
D 2 199 VAL 199 200 200 VAL VAL B . n 
D 2 200 GLU 200 201 201 GLU GLU B . n 
D 2 201 GLY 201 202 202 GLY GLY B . n 
D 2 202 LYS 202 203 203 LYS LYS B . n 
D 2 203 GLY 203 204 204 GLY GLY B . n 
D 2 204 ILE 204 205 205 ILE ILE B . n 
D 2 205 PHE 205 206 206 PHE PHE B . n 
D 2 206 ASP 206 207 207 ASP ASP B . n 
D 2 207 SER 207 208 208 SER SER B . n 
D 2 208 GLU 208 209 209 GLU GLU B . n 
D 2 209 ASP 209 210 210 ASP ASP B . n 
D 2 210 GLU 210 211 211 GLU GLU B . n 
D 2 211 PHE 211 212 212 PHE PHE B . n 
D 2 212 LEU 212 213 213 LEU LEU B . n 
D 2 213 ASP 213 214 214 ASP ASP B . n 
D 2 214 TYR 214 215 215 TYR TYR B . n 
D 2 215 TRP 215 216 216 TRP TRP B . n 
D 2 216 ARG 216 217 217 ARG ARG B . n 
D 2 217 ASN 217 218 218 ASN ASN B . n 
D 2 218 TYR 218 219 219 TYR TYR B . n 
D 2 219 GLU 219 220 220 GLU GLU B . n 
D 2 220 ARG 220 221 221 ARG ARG B . n 
D 2 221 THR 221 222 222 THR THR B . n 
D 2 222 SER 222 223 223 SER SER B . n 
D 2 223 GLN 223 224 224 GLN GLN B . n 
D 2 224 LEU 224 225 225 LEU LEU B . n 
D 2 225 ARG 225 226 226 ARG ARG B . n 
D 2 226 ASN 226 227 227 ASN ASN B . n 
D 2 227 ASP 227 228 228 ASP ASP B . n 
D 2 228 LYS 228 229 229 LYS LYS B . n 
D 2 229 TYR 229 230 230 TYR TYR B . n 
D 2 230 ASN 230 231 231 ASN ASN B . n 
D 2 231 ASN 231 232 232 ASN ASN B . n 
D 2 232 ILE 232 233 233 ILE ILE B . n 
D 2 233 SER 233 234 234 SER SER B . n 
D 2 234 GLU 234 235 235 GLU GLU B . n 
D 2 235 TYR 235 236 236 TYR TYR B . n 
D 2 236 ARG 236 237 237 ARG ARG B . n 
D 2 237 ASN 237 238 238 ASN ASN B . n 
D 2 238 TRP 238 239 239 TRP TRP B . n 
D 2 239 ILE 239 240 240 ILE ILE B . n 
D 2 240 TYR 240 241 241 TYR TYR B . n 
D 2 241 ARG 241 242 242 ARG ARG B . n 
D 2 242 GLY 242 243 243 GLY GLY B . n 
D 2 243 ARG 243 244 244 ARG ARG B . n 
D 2 244 LYS 244 245 245 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   13  13  HOH HOH C . 
E 3 HOH 2   14  14  HOH HOH C . 
E 3 HOH 3   17  17  HOH HOH C . 
E 3 HOH 4   54  54  HOH HOH C . 
E 3 HOH 5   82  82  HOH HOH C . 
E 3 HOH 6   85  85  HOH HOH C . 
E 3 HOH 7   95  95  HOH HOH C . 
E 3 HOH 8   97  97  HOH HOH C . 
E 3 HOH 9   106 106 HOH HOH C . 
E 3 HOH 10  110 110 HOH HOH C . 
E 3 HOH 11  127 127 HOH HOH C . 
E 3 HOH 12  154 154 HOH HOH C . 
E 3 HOH 13  194 194 HOH HOH C . 
E 3 HOH 14  206 206 HOH HOH C . 
E 3 HOH 15  212 212 HOH HOH C . 
E 3 HOH 16  216 216 HOH HOH C . 
E 3 HOH 17  220 220 HOH HOH C . 
E 3 HOH 18  240 240 HOH HOH C . 
F 3 HOH 1   12  2   HOH HOH D . 
F 3 HOH 2   13  38  HOH HOH D . 
F 3 HOH 3   14  57  HOH HOH D . 
F 3 HOH 4   15  62  HOH HOH D . 
F 3 HOH 5   16  63  HOH HOH D . 
F 3 HOH 6   17  64  HOH HOH D . 
F 3 HOH 7   18  66  HOH HOH D . 
F 3 HOH 8   19  90  HOH HOH D . 
F 3 HOH 9   20  120 HOH HOH D . 
F 3 HOH 10  21  134 HOH HOH D . 
F 3 HOH 11  22  135 HOH HOH D . 
F 3 HOH 12  23  151 HOH HOH D . 
F 3 HOH 13  24  157 HOH HOH D . 
F 3 HOH 14  25  162 HOH HOH D . 
F 3 HOH 15  26  171 HOH HOH D . 
F 3 HOH 16  27  181 HOH HOH D . 
F 3 HOH 17  28  183 HOH HOH D . 
F 3 HOH 18  29  185 HOH HOH D . 
F 3 HOH 19  30  186 HOH HOH D . 
F 3 HOH 20  31  188 HOH HOH D . 
F 3 HOH 21  32  189 HOH HOH D . 
F 3 HOH 22  33  197 HOH HOH D . 
F 3 HOH 23  34  208 HOH HOH D . 
F 3 HOH 24  35  274 HOH HOH D . 
F 3 HOH 25  36  275 HOH HOH D . 
G 3 HOH 1   246 4   HOH HOH A . 
G 3 HOH 2   247 5   HOH HOH A . 
G 3 HOH 3   248 8   HOH HOH A . 
G 3 HOH 4   249 10  HOH HOH A . 
G 3 HOH 5   250 15  HOH HOH A . 
G 3 HOH 6   251 16  HOH HOH A . 
G 3 HOH 7   252 21  HOH HOH A . 
G 3 HOH 8   253 22  HOH HOH A . 
G 3 HOH 9   254 25  HOH HOH A . 
G 3 HOH 10  255 26  HOH HOH A . 
G 3 HOH 11  256 28  HOH HOH A . 
G 3 HOH 12  257 29  HOH HOH A . 
G 3 HOH 13  258 30  HOH HOH A . 
G 3 HOH 14  259 31  HOH HOH A . 
G 3 HOH 15  260 34  HOH HOH A . 
G 3 HOH 16  261 35  HOH HOH A . 
G 3 HOH 17  262 43  HOH HOH A . 
G 3 HOH 18  263 45  HOH HOH A . 
G 3 HOH 19  264 46  HOH HOH A . 
G 3 HOH 20  265 47  HOH HOH A . 
G 3 HOH 21  266 49  HOH HOH A . 
G 3 HOH 22  267 50  HOH HOH A . 
G 3 HOH 23  268 51  HOH HOH A . 
G 3 HOH 24  269 52  HOH HOH A . 
G 3 HOH 25  270 53  HOH HOH A . 
G 3 HOH 26  271 55  HOH HOH A . 
G 3 HOH 27  272 58  HOH HOH A . 
G 3 HOH 28  273 61  HOH HOH A . 
G 3 HOH 29  274 65  HOH HOH A . 
G 3 HOH 30  275 68  HOH HOH A . 
G 3 HOH 31  276 69  HOH HOH A . 
G 3 HOH 32  277 70  HOH HOH A . 
G 3 HOH 33  278 78  HOH HOH A . 
G 3 HOH 34  279 79  HOH HOH A . 
G 3 HOH 35  280 81  HOH HOH A . 
G 3 HOH 36  281 83  HOH HOH A . 
G 3 HOH 37  282 84  HOH HOH A . 
G 3 HOH 38  283 86  HOH HOH A . 
G 3 HOH 39  284 91  HOH HOH A . 
G 3 HOH 40  285 92  HOH HOH A . 
G 3 HOH 41  286 93  HOH HOH A . 
G 3 HOH 42  287 96  HOH HOH A . 
G 3 HOH 43  288 98  HOH HOH A . 
G 3 HOH 44  289 99  HOH HOH A . 
G 3 HOH 45  290 100 HOH HOH A . 
G 3 HOH 46  291 102 HOH HOH A . 
G 3 HOH 47  292 103 HOH HOH A . 
G 3 HOH 48  293 104 HOH HOH A . 
G 3 HOH 49  294 108 HOH HOH A . 
G 3 HOH 50  295 114 HOH HOH A . 
G 3 HOH 51  296 115 HOH HOH A . 
G 3 HOH 52  297 117 HOH HOH A . 
G 3 HOH 53  298 123 HOH HOH A . 
G 3 HOH 54  299 124 HOH HOH A . 
G 3 HOH 55  300 132 HOH HOH A . 
G 3 HOH 56  301 136 HOH HOH A . 
G 3 HOH 57  302 139 HOH HOH A . 
G 3 HOH 58  303 140 HOH HOH A . 
G 3 HOH 59  304 141 HOH HOH A . 
G 3 HOH 60  305 142 HOH HOH A . 
G 3 HOH 61  306 144 HOH HOH A . 
G 3 HOH 62  307 146 HOH HOH A . 
G 3 HOH 63  308 147 HOH HOH A . 
G 3 HOH 64  309 153 HOH HOH A . 
G 3 HOH 65  310 155 HOH HOH A . 
G 3 HOH 66  311 156 HOH HOH A . 
G 3 HOH 67  312 158 HOH HOH A . 
G 3 HOH 68  313 159 HOH HOH A . 
G 3 HOH 69  314 160 HOH HOH A . 
G 3 HOH 70  315 167 HOH HOH A . 
G 3 HOH 71  316 169 HOH HOH A . 
G 3 HOH 72  317 174 HOH HOH A . 
G 3 HOH 73  318 177 HOH HOH A . 
G 3 HOH 74  319 178 HOH HOH A . 
G 3 HOH 75  320 180 HOH HOH A . 
G 3 HOH 76  321 182 HOH HOH A . 
G 3 HOH 77  322 184 HOH HOH A . 
G 3 HOH 78  323 195 HOH HOH A . 
G 3 HOH 79  324 196 HOH HOH A . 
G 3 HOH 80  325 198 HOH HOH A . 
G 3 HOH 81  326 199 HOH HOH A . 
G 3 HOH 82  327 201 HOH HOH A . 
G 3 HOH 83  328 202 HOH HOH A . 
G 3 HOH 84  329 203 HOH HOH A . 
G 3 HOH 85  330 204 HOH HOH A . 
G 3 HOH 86  331 205 HOH HOH A . 
G 3 HOH 87  332 210 HOH HOH A . 
G 3 HOH 88  333 211 HOH HOH A . 
G 3 HOH 89  334 213 HOH HOH A . 
G 3 HOH 90  335 215 HOH HOH A . 
G 3 HOH 91  336 217 HOH HOH A . 
G 3 HOH 92  337 219 HOH HOH A . 
G 3 HOH 93  338 221 HOH HOH A . 
G 3 HOH 94  339 223 HOH HOH A . 
G 3 HOH 95  340 224 HOH HOH A . 
G 3 HOH 96  341 225 HOH HOH A . 
G 3 HOH 97  342 226 HOH HOH A . 
G 3 HOH 98  343 227 HOH HOH A . 
G 3 HOH 99  344 228 HOH HOH A . 
G 3 HOH 100 345 229 HOH HOH A . 
G 3 HOH 101 346 232 HOH HOH A . 
G 3 HOH 102 347 236 HOH HOH A . 
G 3 HOH 103 348 237 HOH HOH A . 
G 3 HOH 104 349 241 HOH HOH A . 
G 3 HOH 105 350 242 HOH HOH A . 
G 3 HOH 106 351 248 HOH HOH A . 
G 3 HOH 107 352 255 HOH HOH A . 
G 3 HOH 108 353 257 HOH HOH A . 
G 3 HOH 109 354 258 HOH HOH A . 
G 3 HOH 110 355 261 HOH HOH A . 
G 3 HOH 111 356 262 HOH HOH A . 
G 3 HOH 112 357 263 HOH HOH A . 
G 3 HOH 113 358 266 HOH HOH A . 
G 3 HOH 114 359 267 HOH HOH A . 
G 3 HOH 115 360 268 HOH HOH A . 
G 3 HOH 116 361 276 HOH HOH A . 
H 3 HOH 1   246 1   HOH HOH B . 
H 3 HOH 2   247 3   HOH HOH B . 
H 3 HOH 3   248 6   HOH HOH B . 
H 3 HOH 4   249 7   HOH HOH B . 
H 3 HOH 5   250 9   HOH HOH B . 
H 3 HOH 6   251 11  HOH HOH B . 
H 3 HOH 7   252 12  HOH HOH B . 
H 3 HOH 8   253 18  HOH HOH B . 
H 3 HOH 9   254 19  HOH HOH B . 
H 3 HOH 10  255 20  HOH HOH B . 
H 3 HOH 11  256 23  HOH HOH B . 
H 3 HOH 12  257 24  HOH HOH B . 
H 3 HOH 13  258 27  HOH HOH B . 
H 3 HOH 14  259 32  HOH HOH B . 
H 3 HOH 15  260 33  HOH HOH B . 
H 3 HOH 16  261 36  HOH HOH B . 
H 3 HOH 17  262 37  HOH HOH B . 
H 3 HOH 18  263 39  HOH HOH B . 
H 3 HOH 19  264 40  HOH HOH B . 
H 3 HOH 20  265 41  HOH HOH B . 
H 3 HOH 21  266 42  HOH HOH B . 
H 3 HOH 22  267 44  HOH HOH B . 
H 3 HOH 23  268 48  HOH HOH B . 
H 3 HOH 24  269 56  HOH HOH B . 
H 3 HOH 25  270 59  HOH HOH B . 
H 3 HOH 26  271 60  HOH HOH B . 
H 3 HOH 27  272 67  HOH HOH B . 
H 3 HOH 28  273 71  HOH HOH B . 
H 3 HOH 29  274 72  HOH HOH B . 
H 3 HOH 30  275 73  HOH HOH B . 
H 3 HOH 31  276 74  HOH HOH B . 
H 3 HOH 32  277 75  HOH HOH B . 
H 3 HOH 33  278 76  HOH HOH B . 
H 3 HOH 34  279 77  HOH HOH B . 
H 3 HOH 35  280 80  HOH HOH B . 
H 3 HOH 36  281 87  HOH HOH B . 
H 3 HOH 37  282 88  HOH HOH B . 
H 3 HOH 38  283 89  HOH HOH B . 
H 3 HOH 39  284 94  HOH HOH B . 
H 3 HOH 40  285 101 HOH HOH B . 
H 3 HOH 41  286 105 HOH HOH B . 
H 3 HOH 42  287 107 HOH HOH B . 
H 3 HOH 43  288 109 HOH HOH B . 
H 3 HOH 44  289 111 HOH HOH B . 
H 3 HOH 45  290 112 HOH HOH B . 
H 3 HOH 46  291 113 HOH HOH B . 
H 3 HOH 47  292 116 HOH HOH B . 
H 3 HOH 48  293 118 HOH HOH B . 
H 3 HOH 49  294 119 HOH HOH B . 
H 3 HOH 50  295 121 HOH HOH B . 
H 3 HOH 51  296 122 HOH HOH B . 
H 3 HOH 52  297 125 HOH HOH B . 
H 3 HOH 53  298 126 HOH HOH B . 
H 3 HOH 54  299 128 HOH HOH B . 
H 3 HOH 55  300 129 HOH HOH B . 
H 3 HOH 56  301 130 HOH HOH B . 
H 3 HOH 57  302 131 HOH HOH B . 
H 3 HOH 58  303 133 HOH HOH B . 
H 3 HOH 59  304 137 HOH HOH B . 
H 3 HOH 60  305 138 HOH HOH B . 
H 3 HOH 61  306 143 HOH HOH B . 
H 3 HOH 62  307 145 HOH HOH B . 
H 3 HOH 63  308 148 HOH HOH B . 
H 3 HOH 64  309 149 HOH HOH B . 
H 3 HOH 65  310 150 HOH HOH B . 
H 3 HOH 66  311 152 HOH HOH B . 
H 3 HOH 67  312 161 HOH HOH B . 
H 3 HOH 68  313 163 HOH HOH B . 
H 3 HOH 69  314 164 HOH HOH B . 
H 3 HOH 70  315 165 HOH HOH B . 
H 3 HOH 71  316 168 HOH HOH B . 
H 3 HOH 72  317 170 HOH HOH B . 
H 3 HOH 73  318 172 HOH HOH B . 
H 3 HOH 74  319 173 HOH HOH B . 
H 3 HOH 75  320 175 HOH HOH B . 
H 3 HOH 76  321 179 HOH HOH B . 
H 3 HOH 77  322 187 HOH HOH B . 
H 3 HOH 78  323 190 HOH HOH B . 
H 3 HOH 79  324 191 HOH HOH B . 
H 3 HOH 80  325 192 HOH HOH B . 
H 3 HOH 81  326 193 HOH HOH B . 
H 3 HOH 82  327 200 HOH HOH B . 
H 3 HOH 83  328 207 HOH HOH B . 
H 3 HOH 84  329 209 HOH HOH B . 
H 3 HOH 85  330 214 HOH HOH B . 
H 3 HOH 86  331 218 HOH HOH B . 
H 3 HOH 87  332 222 HOH HOH B . 
H 3 HOH 88  333 230 HOH HOH B . 
H 3 HOH 89  334 231 HOH HOH B . 
H 3 HOH 90  335 233 HOH HOH B . 
H 3 HOH 91  336 235 HOH HOH B . 
H 3 HOH 92  337 239 HOH HOH B . 
H 3 HOH 93  338 244 HOH HOH B . 
H 3 HOH 94  339 246 HOH HOH B . 
H 3 HOH 95  340 251 HOH HOH B . 
H 3 HOH 96  341 252 HOH HOH B . 
H 3 HOH 97  342 254 HOH HOH B . 
H 3 HOH 98  343 256 HOH HOH B . 
H 3 HOH 99  344 260 HOH HOH B . 
H 3 HOH 100 345 264 HOH HOH B . 
H 3 HOH 101 346 265 HOH HOH B . 
H 3 HOH 102 347 269 HOH HOH B . 
H 3 HOH 103 348 270 HOH HOH B . 
H 3 HOH 104 349 271 HOH HOH B . 
H 3 HOH 105 350 272 HOH HOH B . 
H 3 HOH 106 351 273 HOH HOH B . 
H 3 HOH 107 352 277 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-01-26 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "C5'" C DA 1  ? ? "C4'" C DA 1  ? ? 1.556 1.512 0.044 0.007 N 
2  1 N9    C DA 1  ? ? C4    C DA 1  ? ? 1.413 1.374 0.039 0.006 N 
3  1 N3    C DA 5  ? ? C4    C DA 5  ? ? 1.384 1.344 0.040 0.006 N 
4  1 C5    C DT 8  ? ? C7    C DT 8  ? ? 1.556 1.496 0.060 0.006 N 
5  1 C5    C DT 10 ? ? C7    C DT 10 ? ? 1.547 1.496 0.051 0.006 N 
6  1 "C5'" C DT 11 ? ? "C4'" C DT 11 ? ? 1.570 1.512 0.058 0.007 N 
7  1 C5    C DT 11 ? ? C7    C DT 11 ? ? 1.542 1.496 0.046 0.006 N 
8  1 "C5'" D DA 1  ? ? "C4'" D DA 1  ? ? 1.569 1.512 0.057 0.007 N 
9  1 P     D DA 2  ? ? "O5'" D DA 2  ? ? 1.668 1.593 0.075 0.010 N 
10 1 "C5'" D DA 5  ? ? "C4'" D DA 5  ? ? 1.563 1.512 0.051 0.007 N 
11 1 C5    D DT 8  ? ? C7    D DT 8  ? ? 1.538 1.496 0.042 0.006 N 
12 1 C5    D DT 10 ? ? C7    D DT 10 ? ? 1.556 1.496 0.060 0.006 N 
13 1 C5    D DT 11 ? ? C7    D DT 11 ? ? 1.563 1.496 0.067 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DA 2  ? ? "C1'" C DA 2  ? ? N9    C DA 2  ? ? 102.78 108.00 -5.22 0.70 N 
2  1 "C3'" C DA 3  ? ? "O3'" C DA 3  ? ? P     C DG 4  ? ? 129.36 119.70 9.66  1.20 Y 
3  1 "C3'" C DG 4  ? ? "C2'" C DG 4  ? ? "C1'" C DG 4  ? ? 95.64  102.40 -6.76 0.80 N 
4  1 "O4'" C DG 4  ? ? "C1'" C DG 4  ? ? N9    C DG 4  ? ? 113.11 108.30 4.81  0.30 N 
5  1 "O4'" C DA 5  ? ? "C1'" C DA 5  ? ? N9    C DA 5  ? ? 102.10 108.00 -5.90 0.70 N 
6  1 C6    C DA 5  ? ? N1    C DA 5  ? ? C2    C DA 5  ? ? 122.33 118.60 3.73  0.60 N 
7  1 "O4'" C DT 6  ? ? "C4'" C DT 6  ? ? "C3'" C DT 6  ? ? 100.78 104.50 -3.72 0.40 N 
8  1 "O4'" C DT 6  ? ? "C1'" C DT 6  ? ? N1    C DT 6  ? ? 111.07 108.30 2.77  0.30 N 
9  1 "O4'" C DA 7  ? ? "C1'" C DA 7  ? ? "C2'" C DA 7  ? ? 100.19 105.90 -5.71 0.80 N 
10 1 "O4'" C DA 7  ? ? "C1'" C DA 7  ? ? N9    C DA 7  ? ? 110.88 108.30 2.58  0.30 N 
11 1 "C1'" C DT 8  ? ? "O4'" C DT 8  ? ? "C4'" C DT 8  ? ? 102.98 110.10 -7.12 1.00 N 
12 1 C6    C DT 8  ? ? C5    C DT 8  ? ? C7    C DT 8  ? ? 118.85 122.90 -4.05 0.60 N 
13 1 "C3'" C DT 8  ? ? "O3'" C DT 8  ? ? P     C DC 9  ? ? 129.93 119.70 10.23 1.20 Y 
14 1 "O4'" C DT 10 ? ? "C1'" C DT 10 ? ? N1    C DT 10 ? ? 100.71 108.00 -7.29 0.70 N 
15 1 C6    C DT 10 ? ? C5    C DT 10 ? ? C7    C DT 10 ? ? 119.15 122.90 -3.75 0.60 N 
16 1 N3    C DT 11 ? ? C2    C DT 11 ? ? O2    C DT 11 ? ? 118.11 122.30 -4.19 0.60 N 
17 1 C6    C DT 11 ? ? C5    C DT 11 ? ? C7    C DT 11 ? ? 117.93 122.90 -4.97 0.60 N 
18 1 "C1'" D DA 3  ? ? "O4'" D DA 3  ? ? "C4'" D DA 3  ? ? 103.13 110.10 -6.97 1.00 N 
19 1 "C3'" D DA 3  ? ? "O3'" D DA 3  ? ? P     D DG 4  ? ? 128.46 119.70 8.76  1.20 Y 
20 1 "C3'" D DG 4  ? ? "C2'" D DG 4  ? ? "C1'" D DG 4  ? ? 95.49  102.40 -6.91 0.80 N 
21 1 C6    D DA 5  ? ? N1    D DA 5  ? ? C2    D DA 5  ? ? 122.64 118.60 4.04  0.60 N 
22 1 "O4'" D DT 6  ? ? "C4'" D DT 6  ? ? "C3'" D DT 6  ? ? 101.07 104.50 -3.43 0.40 N 
23 1 "C3'" D DT 8  ? ? "O3'" D DT 8  ? ? P     D DC 9  ? ? 131.15 119.70 11.45 1.20 Y 
24 1 "O4'" D DT 10 ? ? "C1'" D DT 10 ? ? N1    D DT 10 ? ? 102.62 108.00 -5.38 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 112 ? ? -99.93  -115.37 
2 1 ASN A 117 ? ? -38.62  -34.16  
3 1 THR A 187 ? ? 31.62   68.56   
4 1 LYS A 229 ? ? -119.50 -98.18  
5 1 SER B 112 ? ? -94.46  -115.31 
6 1 ASN B 117 ? ? -34.81  -35.14  
7 1 THR B 187 ? ? 29.40   65.21   
8 1 LYS B 229 ? ? -130.89 -89.43  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RVA 'double helix'        
1RVA 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 11 1_555 0.103  -0.272 -0.389 -7.787  -13.715 1.773  1  C_DA2:DT11_D C 2  ? D 11 ? 20 1 
1 A DA 3  1_555 B DT 10 1_555 0.154  -0.167 -0.011 -2.554  -7.579  1.144  2  C_DA3:DT10_D C 3  ? D 10 ? 20 1 
1 A DG 4  1_555 B DC 9  1_555 -0.025 -0.156 0.270  9.824   -10.713 0.017  3  C_DG4:DC9_D  C 4  ? D 9  ? 19 1 
1 A DA 5  1_555 B DT 8  1_555 -0.089 -0.122 0.095  -0.395  -1.347  2.166  4  C_DA5:DT8_D  C 5  ? D 8  ? 20 1 
1 A DT 6  1_555 B DA 7  1_555 -0.090 -0.098 -0.064 10.801  -2.894  2.161  5  C_DT6:DA7_D  C 6  ? D 7  ? 20 1 
1 A DA 7  1_555 B DT 6  1_555 0.063  -0.140 -0.031 -9.641  -1.035  0.462  6  C_DA7:DT6_D  C 7  ? D 6  ? 20 1 
1 A DT 8  1_555 B DA 5  1_555 -0.028 -0.121 0.148  -0.379  0.869   1.481  7  C_DT8:DA5_D  C 8  ? D 5  ? 20 1 
1 A DC 9  1_555 B DG 4  1_555 -0.023 -0.105 0.376  -10.484 -10.820 -0.391 8  C_DC9:DG4_D  C 9  ? D 4  ? 19 1 
1 A DT 10 1_555 B DA 3  1_555 -0.045 -0.065 -0.069 3.243   -9.093  1.614  9  C_DT10:DA3_D C 10 ? D 3  ? 20 1 
1 A DT 11 1_555 B DA 2  1_555 0.312  -0.216 -0.237 11.511  -12.005 3.240  10 C_DT11:DA2_D C 11 ? D 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 11 1_555 A DA 3  1_555 B DT 10 1_555 0.105  0.483  3.225 -3.567 0.380   32.129 0.802  -0.810 3.201 0.683   
6.420  32.324 1 CC_DA2DA3:DT10DT11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 A DA 3  1_555 B DT 10 1_555 A DG 4  1_555 B DC 9  1_555 0.519  -0.110 3.175 -1.638 -0.274  29.547 -0.160 -1.351 3.143 -0.537  
3.209  29.593 2 CC_DA3DG4:DC9DT10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 A DG 4  1_555 B DC 9  1_555 A DA 5  1_555 B DT 8  1_555 -0.068 -0.693 3.812 -1.818 -11.894 39.420 0.558  -0.139 3.854 -17.154 
2.621  41.145 3 CC_DG4DA5:DT8DC9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 A DA 5  1_555 B DT 8  1_555 A DT 6  1_555 B DA 7  1_555 -0.199 -1.387 3.268 1.104  3.198   28.239 -3.539 0.652  3.085 6.525   
-2.253 28.436 4 CC_DA5DT6:DA7DT8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 A DT 6  1_555 B DA 7  1_555 A DA 7  1_555 B DT 6  1_555 -0.074 -1.412 4.084 -0.180 46.739  27.970 -4.632 0.070  0.976 60.783  
0.234  54.063 5 CC_DT6DA7:DT6DA7_DD   C 6  ? D 7  ? C 7  ? D 6  ? 
1 A DA 7  1_555 B DT 6  1_555 A DT 8  1_555 B DA 5  1_555 0.410  -1.361 3.350 -1.895 2.093   28.615 -3.213 -1.253 3.211 4.221   
3.822  28.751 6 CC_DA7DT8:DA5DT6_DD   C 7  ? D 6  ? C 8  ? D 5  ? 
1 A DT 8  1_555 B DA 5  1_555 A DC 9  1_555 B DG 4  1_555 0.114  -0.843 3.765 2.802  -10.966 39.248 0.228  0.204  3.854 -15.927 
-4.070 40.786 7 CC_DT8DC9:DG4DA5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 A DC 9  1_555 B DG 4  1_555 A DT 10 1_555 B DA 3  1_555 -0.547 -0.118 3.118 2.676  1.770   30.291 -0.558 1.547  3.048 3.375   
-5.103 30.457 8 CC_DC9DT10:DA3DG4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 A DT 10 1_555 B DA 3  1_555 A DT 11 1_555 B DA 2  1_555 -0.107 0.632  3.194 3.763  6.791   30.350 -0.107 0.906  3.220 12.711  
-7.043 31.305 9 CC_DT10DT11:DA2DA3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#