data_1RVB
# 
_entry.id   1RVB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RVB         
RCSB  PDE015       
WWPDB D_1000176241 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RVB 
_pdbx_database_status.recvd_initial_deposition_date   1994-10-21 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kostrewa, D.'  1 
'Winkler, F.K.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Mg2+ binding to the active site of EcoRV endonuclease: a crystallographic study of complexes with substrate and product DNA at 2 A resolution.
;
Biochemistry           34 683  696 1995 BICHAW US 0006-2960 0033 ? 7819264 10.1021/bi00002a036 
1       'The Crystal Structure of EcoRV Endonuclease and of its Complexes with Cognate and Noncognate DNA Fragments' 'Embo J.' 12 
1781 ?   1993 EMJODG UK 0261-4189 0897 ? ?       ?                   
2       'Structure and Function of Restriction Endonucleases' Curr.Opin.Struct.Biol. 2  93   ?   1992 COSBEF UK 0959-440X 0801 ? ? 
?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kostrewa, D.'   1  
primary 'Winkler, F.K.'  2  
1       'Winkler, F.K.'  3  
1       'Banner, D.W.'   4  
1       'Oefner, C.'     5  
1       'Tsernoglou, D.' 6  
1       'Brown, R.S.'    7  
1       'Heathman, S.P.' 8  
1       'Bryan, R.K.'    9  
1       'Martin, P.D.'   10 
1       'Petratos, K.'   11 
1       'Wilson, K.S.'   12 
2       'Winkler, F.K.'  13 
# 
_cell.entry_id           1RVB 
_cell.length_a           49.160 
_cell.length_b           50.420 
_cell.length_c           64.060 
_cell.angle_alpha        96.35 
_cell.angle_beta         108.85 
_cell.angle_gamma        108.45 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RVB 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*AP*AP*AP*GP*AP*TP*AP*TP*CP*TP*T)-3')
;
3356.235  2   ? ? ? ? 
2 polymer     man 'PROTEIN (ECO RV (E.C.3.1.21.4))'                 28559.158 2   ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                   24.305    2   ? ? ? ? 
4 water       nat water                                             18.015    185 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DG)(DA)(DT)(DA)(DT)(DC)(DT)(DT)' AAAGATATCTT C,D ? 
2 'polypeptide(L)'        no no 
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DT  n 
1 11  DT  n 
2 1   SER n 
2 2   LEU n 
2 3   ARG n 
2 4   SER n 
2 5   ASP n 
2 6   LEU n 
2 7   ILE n 
2 8   ASN n 
2 9   ALA n 
2 10  LEU n 
2 11  TYR n 
2 12  ASP n 
2 13  GLU n 
2 14  ASN n 
2 15  GLN n 
2 16  LYS n 
2 17  TYR n 
2 18  ASP n 
2 19  VAL n 
2 20  CYS n 
2 21  GLY n 
2 22  ILE n 
2 23  ILE n 
2 24  SER n 
2 25  ALA n 
2 26  GLU n 
2 27  GLY n 
2 28  LYS n 
2 29  ILE n 
2 30  TYR n 
2 31  PRO n 
2 32  LEU n 
2 33  GLY n 
2 34  SER n 
2 35  ASP n 
2 36  THR n 
2 37  LYS n 
2 38  VAL n 
2 39  LEU n 
2 40  SER n 
2 41  THR n 
2 42  ILE n 
2 43  PHE n 
2 44  GLU n 
2 45  LEU n 
2 46  PHE n 
2 47  SER n 
2 48  ARG n 
2 49  PRO n 
2 50  ILE n 
2 51  ILE n 
2 52  ASN n 
2 53  LYS n 
2 54  ILE n 
2 55  ALA n 
2 56  GLU n 
2 57  LYS n 
2 58  HIS n 
2 59  GLY n 
2 60  TYR n 
2 61  ILE n 
2 62  VAL n 
2 63  GLU n 
2 64  GLU n 
2 65  PRO n 
2 66  LYS n 
2 67  GLN n 
2 68  GLN n 
2 69  ASN n 
2 70  HIS n 
2 71  TYR n 
2 72  PRO n 
2 73  ASP n 
2 74  PHE n 
2 75  THR n 
2 76  LEU n 
2 77  TYR n 
2 78  LYS n 
2 79  PRO n 
2 80  SER n 
2 81  GLU n 
2 82  PRO n 
2 83  ASN n 
2 84  LYS n 
2 85  LYS n 
2 86  ILE n 
2 87  ALA n 
2 88  ILE n 
2 89  ASP n 
2 90  ILE n 
2 91  LYS n 
2 92  THR n 
2 93  THR n 
2 94  TYR n 
2 95  THR n 
2 96  ASN n 
2 97  LYS n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 LYS n 
2 102 ILE n 
2 103 LYS n 
2 104 PHE n 
2 105 THR n 
2 106 LEU n 
2 107 GLY n 
2 108 GLY n 
2 109 TYR n 
2 110 THR n 
2 111 SER n 
2 112 PHE n 
2 113 ILE n 
2 114 ARG n 
2 115 ASN n 
2 116 ASN n 
2 117 THR n 
2 118 LYS n 
2 119 ASN n 
2 120 ILE n 
2 121 VAL n 
2 122 TYR n 
2 123 PRO n 
2 124 PHE n 
2 125 ASP n 
2 126 GLN n 
2 127 TYR n 
2 128 ILE n 
2 129 ALA n 
2 130 HIS n 
2 131 TRP n 
2 132 ILE n 
2 133 ILE n 
2 134 GLY n 
2 135 TYR n 
2 136 VAL n 
2 137 TYR n 
2 138 THR n 
2 139 ARG n 
2 140 VAL n 
2 141 ALA n 
2 142 THR n 
2 143 ARG n 
2 144 LYS n 
2 145 SER n 
2 146 SER n 
2 147 LEU n 
2 148 LYS n 
2 149 THR n 
2 150 TYR n 
2 151 ASN n 
2 152 ILE n 
2 153 ASN n 
2 154 GLU n 
2 155 LEU n 
2 156 ASN n 
2 157 GLU n 
2 158 ILE n 
2 159 PRO n 
2 160 LYS n 
2 161 PRO n 
2 162 TYR n 
2 163 LYS n 
2 164 GLY n 
2 165 VAL n 
2 166 LYS n 
2 167 VAL n 
2 168 PHE n 
2 169 LEU n 
2 170 GLN n 
2 171 ASP n 
2 172 LYS n 
2 173 TRP n 
2 174 VAL n 
2 175 ILE n 
2 176 ALA n 
2 177 GLY n 
2 178 ASP n 
2 179 LEU n 
2 180 ALA n 
2 181 GLY n 
2 182 SER n 
2 183 GLY n 
2 184 ASN n 
2 185 THR n 
2 186 THR n 
2 187 ASN n 
2 188 ILE n 
2 189 GLY n 
2 190 SER n 
2 191 ILE n 
2 192 HIS n 
2 193 ALA n 
2 194 HIS n 
2 195 TYR n 
2 196 LYS n 
2 197 ASP n 
2 198 PHE n 
2 199 VAL n 
2 200 GLU n 
2 201 GLY n 
2 202 LYS n 
2 203 GLY n 
2 204 ILE n 
2 205 PHE n 
2 206 ASP n 
2 207 SER n 
2 208 GLU n 
2 209 ASP n 
2 210 GLU n 
2 211 PHE n 
2 212 LEU n 
2 213 ASP n 
2 214 TYR n 
2 215 TRP n 
2 216 ARG n 
2 217 ASN n 
2 218 TYR n 
2 219 GLU n 
2 220 ARG n 
2 221 THR n 
2 222 SER n 
2 223 GLN n 
2 224 LEU n 
2 225 ARG n 
2 226 ASN n 
2 227 ASP n 
2 228 LYS n 
2 229 TYR n 
2 230 ASN n 
2 231 ASN n 
2 232 ILE n 
2 233 SER n 
2 234 GLU n 
2 235 TYR n 
2 236 ARG n 
2 237 ASN n 
2 238 TRP n 
2 239 ILE n 
2 240 TYR n 
2 241 ARG n 
2 242 GLY n 
2 243 ARG n 
2 244 LYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E5_ECOLI 2 ? ? P04390 ? 
2 PDB 1RVB       1 ? ? 1RVB   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RVB A 1 ? 244 ? P04390 1 ? 244 ? 2 245 
2 1 1RVB B 1 ? 244 ? P04390 1 ? 244 ? 2 245 
3 2 1RVB C 1 ? 11  ? 1RVB   1 ? 11  ? 1 11  
4 2 1RVB D 1 ? 11  ? 1RVB   1 ? 11  ? 1 11  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RVB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.09 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1RVB 
_refine.ls_number_reflns_obs                     26254 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.000 
_refine.ls_d_res_high                            2.100 
_refine.ls_percent_reflns_obs                    99.900 
_refine.ls_R_factor_obs                          0.1650000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1650000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4046 
_refine_hist.pdbx_number_atoms_nucleic_acid   446 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             185 
_refine_hist.number_atoms_total               4679 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.88  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RVB 
_struct.title                     
;MG2+ BINDING TO THE ACTIVE SITE OF ECO RV ENDONUCLEASE: A CRYSTALLOGRAPHIC STUDY OF COMPLEXES WITH SUBSTRATE AND PRODUCT DNA AT 2 ANGSTROMS RESOLUTION
;
_struct.pdbx_descriptor           'ECO RV (E.C.3.1.21.4)/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RVB 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER C 1   ? TYR C 17  ? SER A 2   TYR A 18  1 ? 17 
HELX_P HELX_P2  2  ASP C 35  ? HIS C 58  ? ASP A 36  HIS A 59  1 ? 24 
HELX_P HELX_P3  3  PRO C 123 ? ASP C 125 ? PRO A 124 ASP A 126 5 ? 3  
HELX_P HELX_P4  4  ARG C 143 ? LYS C 148 ? ARG A 144 LYS A 149 5 ? 6  
HELX_P HELX_P5  5  ASN C 151 ? ILE C 158 ? ASN A 152 ILE A 159 5 ? 8  
HELX_P HELX_P6  6  LYS C 172 ? ILE C 175 ? LYS A 173 ILE A 176 1 ? 4  
HELX_P HELX_P7  7  HIS C 194 ? GLY C 201 ? HIS A 195 GLY A 202 1 ? 8  
HELX_P HELX_P8  8  SER C 207 ? ASN C 217 ? SER A 208 ASN A 218 1 ? 11 
HELX_P HELX_P9  9  THR C 221 ? ASP C 227 ? THR A 222 ASP A 228 1 ? 7  
HELX_P HELX_P10 10 ASN C 231 ? ARG C 241 ? ASN A 232 ARG A 242 1 ? 11 
HELX_P HELX_P11 11 SER D 1   ? TYR D 17  ? SER B 2   TYR B 18  1 ? 17 
HELX_P HELX_P12 12 ASP D 35  ? LYS D 57  ? ASP B 36  LYS B 58  1 ? 23 
HELX_P HELX_P13 13 PRO D 123 ? ASP D 125 ? PRO B 124 ASP B 126 5 ? 3  
HELX_P HELX_P14 14 ASN D 153 ? ILE D 158 ? ASN B 154 ILE B 159 5 ? 6  
HELX_P HELX_P15 15 LYS D 172 ? ILE D 175 ? LYS B 173 ILE B 176 1 ? 4  
HELX_P HELX_P16 16 HIS D 194 ? GLY D 201 ? HIS B 195 GLY B 202 1 ? 8  
HELX_P HELX_P17 17 SER D 207 ? ASN D 217 ? SER B 208 ASN B 218 1 ? 11 
HELX_P HELX_P18 18 THR D 221 ? ASN D 226 ? THR B 222 ASN B 227 1 ? 6  
HELX_P HELX_P19 19 ASN D 231 ? ARG D 241 ? ASN B 232 ARG B 242 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG .  MG ? ? ? 1_555 B DA  7  OP1 ? ? B MG 301 D DA  7   1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc2  metalc ? ? E MG .  MG ? ? ? 1_555 D ASP 73 OD2 ? ? B MG 301 B ASP 74  1_555 ? ? ? ? ? ? ?            3.054 ? 
metalc3  metalc ? ? E MG .  MG ? ? ? 1_555 D ASP 89 OD1 ? ? B MG 301 B ASP 90  1_555 ? ? ? ? ? ? ?            2.100 ? 
metalc4  metalc ? ? E MG .  MG ? ? ? 1_555 H HOH .  O   ? ? B MG 301 D HOH 16  1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc5  metalc ? ? E MG .  MG ? ? ? 1_555 J HOH .  O   ? ? B MG 301 B HOH 341 1_555 ? ? ? ? ? ? ?            2.119 ? 
metalc6  metalc ? ? E MG .  MG ? ? ? 1_555 J HOH .  O   ? ? B MG 301 B HOH 342 1_555 ? ? ? ? ? ? ?            2.089 ? 
metalc7  metalc ? ? E MG .  MG ? ? ? 1_555 D ASP 73 OD1 ? ? B MG 301 B ASP 74  1_555 ? ? ? ? ? ? ?            2.881 ? 
metalc8  metalc ? ? F MG .  MG ? ? ? 1_555 D GLU 44 OE2 ? ? B MG 302 B GLU 45  1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc9  metalc ? ? F MG .  MG ? ? ? 1_555 J HOH .  O   ? ? B MG 302 B HOH 349 1_555 ? ? ? ? ? ? ?            2.192 ? 
metalc10 metalc ? ? F MG .  MG ? ? ? 1_555 J HOH .  O   ? ? B MG 302 B HOH 379 1_555 ? ? ? ? ? ? ?            1.979 ? 
metalc11 metalc ? ? F MG .  MG ? ? ? 1_555 D ASP 73 OD1 ? ? B MG 302 B ASP 74  1_555 ? ? ? ? ? ? ?            2.744 ? 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT  11 N3  ? ? C DA 2   D DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT  11 O4  ? ? C DA 2   D DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT  10 N3  ? ? C DA 3   D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT  10 O4  ? ? C DA 3   D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  9  N3  ? ? C DG 4   D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  9  O2  ? ? C DG 4   D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  9  N4  ? ? C DG 4   D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT  8  N3  ? ? C DA 5   D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT  8  O4  ? ? C DA 5   D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA  7  N1  ? ? C DT 6   D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA  7  N6  ? ? C DT 6   D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  6  N3  ? ? C DA 7   D DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  6  O4  ? ? C DA 7   D DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA  5  N1  ? ? C DT 8   D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA  5  N6  ? ? C DT 8   D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG  4  N1  ? ? C DC 9   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG  4  O6  ? ? C DC 9   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG  4  N2  ? ? C DC 9   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA  3  N1  ? ? C DT 10  D DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA  3  N6  ? ? C DT 10  D DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA  2  N1  ? ? C DT 11  D DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA  2  N6  ? ? C DT 11  D DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 71 C . ? TYR 72 A PRO 72 C ? PRO 73 A 1 -0.27 
2 TYR 71 D . ? TYR 72 B PRO 72 D ? PRO 73 B 1 -0.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 3 ? 
D ? 5 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 29  ? PRO C 31  ? ILE A 30  PRO A 32  
A 2 VAL C 19  ? SER C 24  ? VAL A 20  SER A 25  
A 3 VAL D 19  ? SER D 24  ? VAL B 20  SER B 25  
A 4 LYS D 28  ? PRO D 31  ? LYS B 29  PRO B 32  
A 5 TYR D 150 ? ASN D 151 ? TYR B 151 ASN B 152 
B 1 ILE C 61  ? GLU C 63  ? ILE A 62  GLU A 64  
B 2 PHE C 74  ? TYR C 77  ? PHE A 75  TYR A 78  
B 3 LYS C 85  ? THR C 95  ? LYS A 86  THR A 96  
B 4 TYR C 127 ? THR C 138 ? TYR A 128 THR A 139 
B 5 LYS C 166 ? ASP C 171 ? LYS A 167 ASP A 172 
C 1 THR C 105 ? GLY C 108 ? THR A 106 GLY A 109 
C 2 ASN C 187 ? SER C 190 ? ASN A 188 SER A 191 
C 3 ALA C 176 ? SER C 182 ? ALA A 177 SER A 183 
D 1 ILE D 61  ? GLU D 63  ? ILE B 62  GLU B 64  
D 2 PHE D 74  ? TYR D 77  ? PHE B 75  TYR B 78  
D 3 LYS D 85  ? THR D 95  ? LYS B 86  THR B 96  
D 4 TYR D 127 ? ARG D 139 ? TYR B 128 ARG B 140 
D 5 TYR D 162 ? ASP D 171 ? TYR B 163 ASP B 172 
E 1 THR D 105 ? GLY D 108 ? THR B 106 GLY B 109 
E 2 ASN D 187 ? SER D 190 ? ASN B 188 SER B 191 
E 3 ALA D 176 ? ALA D 180 ? ALA B 177 ALA B 181 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR C 30  ? N TYR A 31  O ILE C 22  ? O ILE A 23  
A 2 3 O ILE C 23  ? O ILE A 24  N CYS D 20  ? N CYS B 21  
A 3 4 N SER D 24  ? N SER B 25  O LYS D 28  ? O LYS B 29  
A 4 5 N ILE D 29  ? N ILE B 30  O TYR D 150 ? O TYR B 151 
B 1 2 O GLU C 63  ? O GLU A 64  N THR C 75  ? N THR A 76  
B 2 3 O LEU C 76  ? O LEU A 77  N ILE C 86  ? N ILE A 87  
B 3 4 O LYS C 85  ? O LYS A 86  N ILE C 128 ? N ILE A 129 
B 4 5 O VAL C 136 ? O VAL A 137 N LYS C 166 ? N LYS A 167 
C 1 2 N LEU C 106 ? N LEU A 107 O ILE C 188 ? O ILE A 189 
C 2 3 O GLY C 189 ? O GLY A 190 N GLY C 177 ? N GLY A 178 
D 1 2 O GLU D 63  ? O GLU B 64  N THR D 75  ? N THR B 76  
D 2 3 O LEU D 76  ? O LEU B 77  N ILE D 86  ? N ILE B 87  
D 3 4 O LYS D 85  ? O LYS B 86  N ILE D 128 ? N ILE B 129 
D 4 5 O THR D 138 ? O THR B 139 N LYS D 163 ? N LYS B 164 
E 1 2 O GLY D 107 ? O GLY B 108 N ILE D 188 ? N ILE B 189 
E 2 3 O GLY D 189 ? O GLY B 190 N GLY D 177 ? N GLY B 178 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 301' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP D 73 ? ASP B 74  . ? 1_555 ? 
2  AC1 6 ASP D 89 ? ASP B 90  . ? 1_555 ? 
3  AC1 6 HOH J .  ? HOH B 341 . ? 1_555 ? 
4  AC1 6 HOH J .  ? HOH B 342 . ? 1_555 ? 
5  AC1 6 DA  B 7  ? DA  D 7   . ? 1_555 ? 
6  AC1 6 HOH H .  ? HOH D 16  . ? 1_555 ? 
7  AC2 4 GLU D 44 ? GLU B 45  . ? 1_555 ? 
8  AC2 4 ASP D 73 ? ASP B 74  . ? 1_555 ? 
9  AC2 4 HOH J .  ? HOH B 349 . ? 1_555 ? 
10 AC2 4 HOH J .  ? HOH B 379 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RVB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RVB 
_atom_sites.fract_transf_matrix[1][1]   0.020342 
_atom_sites.fract_transf_matrix[1][2]   0.006787 
_atom_sites.fract_transf_matrix[1][3]   0.008805 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020908 
_atom_sites.fract_transf_matrix[2][3]   0.005103 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016979 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO A 73' 
2 'CIS PROLINE - PRO B 73' 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DA  A 1 1   ? 0.868   -20.230 -12.131 1.00 62.94 ? 1   DA  C "O5'" 1 
ATOM   2    C  "C5'" . DA  A 1 1   ? 0.468   -21.257 -13.075 1.00 74.17 ? 1   DA  C "C5'" 1 
ATOM   3    C  "C4'" . DA  A 1 1   ? -0.852  -22.014 -12.718 1.00 75.70 ? 1   DA  C "C4'" 1 
ATOM   4    O  "O4'" . DA  A 1 1   ? -0.699  -22.694 -11.438 1.00 75.79 ? 1   DA  C "O4'" 1 
ATOM   5    C  "C3'" . DA  A 1 1   ? -2.031  -21.046 -12.523 1.00 71.30 ? 1   DA  C "C3'" 1 
ATOM   6    O  "O3'" . DA  A 1 1   ? -3.284  -21.730 -12.726 1.00 66.34 ? 1   DA  C "O3'" 1 
ATOM   7    C  "C2'" . DA  A 1 1   ? -1.853  -20.762 -11.043 1.00 69.87 ? 1   DA  C "C2'" 1 
ATOM   8    C  "C1'" . DA  A 1 1   ? -1.573  -22.113 -10.451 1.00 66.86 ? 1   DA  C "C1'" 1 
ATOM   9    N  N9    . DA  A 1 1   ? -0.832  -22.102 -9.147  1.00 63.49 ? 1   DA  C N9    1 
ATOM   10   C  C8    . DA  A 1 1   ? -1.292  -22.658 -7.960  1.00 63.08 ? 1   DA  C C8    1 
ATOM   11   N  N7    . DA  A 1 1   ? -0.446  -22.551 -6.951  1.00 58.32 ? 1   DA  C N7    1 
ATOM   12   C  C5    . DA  A 1 1   ? 0.663   -21.874 -7.495  1.00 58.29 ? 1   DA  C C5    1 
ATOM   13   C  C6    . DA  A 1 1   ? 1.909   -21.454 -6.929  1.00 59.74 ? 1   DA  C C6    1 
ATOM   14   N  N6    . DA  A 1 1   ? 2.249   -21.682 -5.644  1.00 51.17 ? 1   DA  C N6    1 
ATOM   15   N  N1    . DA  A 1 1   ? 2.781   -20.809 -7.744  1.00 63.68 ? 1   DA  C N1    1 
ATOM   16   C  C2    . DA  A 1 1   ? 2.443   -20.597 -9.017  1.00 63.29 ? 1   DA  C C2    1 
ATOM   17   N  N3    . DA  A 1 1   ? 1.321   -20.939 -9.655  1.00 60.60 ? 1   DA  C N3    1 
ATOM   18   C  C4    . DA  A 1 1   ? 0.447   -21.588 -8.832  1.00 59.01 ? 1   DA  C C4    1 
ATOM   19   P  P     . DA  A 1 2   ? -4.696  -20.909 -12.575 1.00 74.92 ? 2   DA  C P     1 
ATOM   20   O  OP1   . DA  A 1 2   ? -5.828  -21.631 -13.241 1.00 77.41 ? 2   DA  C OP1   1 
ATOM   21   O  OP2   . DA  A 1 2   ? -4.398  -19.470 -12.877 1.00 67.40 ? 2   DA  C OP2   1 
ATOM   22   O  "O5'" . DA  A 1 2   ? -4.960  -21.068 -10.993 1.00 69.58 ? 2   DA  C "O5'" 1 
ATOM   23   C  "C5'" . DA  A 1 2   ? -5.503  -22.242 -10.402 1.00 60.18 ? 2   DA  C "C5'" 1 
ATOM   24   C  "C4'" . DA  A 1 2   ? -5.824  -21.937 -8.935  1.00 54.12 ? 2   DA  C "C4'" 1 
ATOM   25   O  "O4'" . DA  A 1 2   ? -4.646  -21.484 -8.230  1.00 51.27 ? 2   DA  C "O4'" 1 
ATOM   26   C  "C3'" . DA  A 1 2   ? -6.872  -20.850 -8.859  1.00 49.33 ? 2   DA  C "C3'" 1 
ATOM   27   O  "O3'" . DA  A 1 2   ? -7.856  -21.410 -8.005  1.00 46.31 ? 2   DA  C "O3'" 1 
ATOM   28   C  "C2'" . DA  A 1 2   ? -6.117  -19.649 -8.283  1.00 46.98 ? 2   DA  C "C2'" 1 
ATOM   29   C  "C1'" . DA  A 1 2   ? -4.888  -20.211 -7.581  1.00 48.19 ? 2   DA  C "C1'" 1 
ATOM   30   N  N9    . DA  A 1 2   ? -3.620  -19.441 -7.781  1.00 41.53 ? 2   DA  C N9    1 
ATOM   31   C  C8    . DA  A 1 2   ? -3.224  -18.668 -8.850  1.00 42.90 ? 2   DA  C C8    1 
ATOM   32   N  N7    . DA  A 1 2   ? -2.011  -18.151 -8.729  1.00 43.03 ? 2   DA  C N7    1 
ATOM   33   C  C5    . DA  A 1 2   ? -1.571  -18.614 -7.491  1.00 33.52 ? 2   DA  C C5    1 
ATOM   34   C  C6    . DA  A 1 2   ? -0.375  -18.422 -6.787  1.00 31.71 ? 2   DA  C C6    1 
ATOM   35   N  N6    . DA  A 1 2   ? 0.654   -17.713 -7.235  1.00 36.37 ? 2   DA  C N6    1 
ATOM   36   N  N1    . DA  A 1 2   ? -0.272  -19.009 -5.601  1.00 34.60 ? 2   DA  C N1    1 
ATOM   37   C  C2    . DA  A 1 2   ? -1.297  -19.744 -5.147  1.00 39.32 ? 2   DA  C C2    1 
ATOM   38   N  N3    . DA  A 1 2   ? -2.467  -20.009 -5.698  1.00 38.90 ? 2   DA  C N3    1 
ATOM   39   C  C4    . DA  A 1 2   ? -2.541  -19.397 -6.901  1.00 36.04 ? 2   DA  C C4    1 
ATOM   40   P  P     . DA  A 1 3   ? -9.208  -20.667 -7.522  1.00 58.42 ? 3   DA  C P     1 
ATOM   41   O  OP1   . DA  A 1 3   ? -10.291 -21.678 -7.316  1.00 53.65 ? 3   DA  C OP1   1 
ATOM   42   O  OP2   . DA  A 1 3   ? -9.483  -19.474 -8.391  1.00 63.34 ? 3   DA  C OP2   1 
ATOM   43   O  "O5'" . DA  A 1 3   ? -8.738  -20.161 -6.062  1.00 45.07 ? 3   DA  C "O5'" 1 
ATOM   44   C  "C5'" . DA  A 1 3   ? -8.299  -21.061 -5.043  1.00 41.78 ? 3   DA  C "C5'" 1 
ATOM   45   C  "C4'" . DA  A 1 3   ? -7.618  -20.254 -3.901  1.00 41.72 ? 3   DA  C "C4'" 1 
ATOM   46   O  "O4'" . DA  A 1 3   ? -6.402  -19.623 -4.317  1.00 33.75 ? 3   DA  C "O4'" 1 
ATOM   47   C  "C3'" . DA  A 1 3   ? -8.583  -19.104 -3.438  1.00 37.76 ? 3   DA  C "C3'" 1 
ATOM   48   O  "O3'" . DA  A 1 3   ? -8.825  -19.486 -2.093  1.00 35.00 ? 3   DA  C "O3'" 1 
ATOM   49   C  "C2'" . DA  A 1 3   ? -7.800  -17.807 -3.633  1.00 29.98 ? 3   DA  C "C2'" 1 
ATOM   50   C  "C1'" . DA  A 1 3   ? -6.384  -18.295 -3.726  1.00 27.75 ? 3   DA  C "C1'" 1 
ATOM   51   N  N9    . DA  A 1 3   ? -5.565  -17.500 -4.611  1.00 29.66 ? 3   DA  C N9    1 
ATOM   52   C  C8    . DA  A 1 3   ? -5.862  -16.991 -5.874  1.00 26.03 ? 3   DA  C C8    1 
ATOM   53   N  N7    . DA  A 1 3   ? -4.867  -16.331 -6.401  1.00 22.65 ? 3   DA  C N7    1 
ATOM   54   C  C5    . DA  A 1 3   ? -3.849  -16.410 -5.420  1.00 21.43 ? 3   DA  C C5    1 
ATOM   55   C  C6    . DA  A 1 3   ? -2.552  -15.921 -5.351  1.00 17.28 ? 3   DA  C C6    1 
ATOM   56   N  N6    . DA  A 1 3   ? -1.994  -15.209 -6.334  1.00 27.06 ? 3   DA  C N6    1 
ATOM   57   N  N1    . DA  A 1 3   ? -1.831  -16.186 -4.234  1.00 21.91 ? 3   DA  C N1    1 
ATOM   58   C  C2    . DA  A 1 3   ? -2.359  -16.890 -3.243  1.00 21.96 ? 3   DA  C C2    1 
ATOM   59   N  N3    . DA  A 1 3   ? -3.570  -17.403 -3.193  1.00 28.31 ? 3   DA  C N3    1 
ATOM   60   C  C4    . DA  A 1 3   ? -4.271  -17.122 -4.325  1.00 23.79 ? 3   DA  C C4    1 
ATOM   61   P  P     . DG  A 1 4   ? -9.746  -18.794 -1.040  1.00 36.52 ? 4   DG  C P     1 
ATOM   62   O  OP1   . DG  A 1 4   ? -10.208 -19.877 -0.121  1.00 41.61 ? 4   DG  C OP1   1 
ATOM   63   O  OP2   . DG  A 1 4   ? -10.724 -17.944 -1.761  1.00 32.28 ? 4   DG  C OP2   1 
ATOM   64   O  "O5'" . DG  A 1 4   ? -8.633  -17.855 -0.334  1.00 27.19 ? 4   DG  C "O5'" 1 
ATOM   65   C  "C5'" . DG  A 1 4   ? -7.512  -18.434 0.327   1.00 22.06 ? 4   DG  C "C5'" 1 
ATOM   66   C  "C4'" . DG  A 1 4   ? -6.542  -17.405 0.886   1.00 19.15 ? 4   DG  C "C4'" 1 
ATOM   67   O  "O4'" . DG  A 1 4   ? -5.749  -16.890 -0.193  1.00 21.30 ? 4   DG  C "O4'" 1 
ATOM   68   C  "C3'" . DG  A 1 4   ? -7.284  -16.208 1.583   1.00 22.08 ? 4   DG  C "C3'" 1 
ATOM   69   O  "O3'" . DG  A 1 4   ? -6.445  -15.736 2.634   1.00 20.64 ? 4   DG  C "O3'" 1 
ATOM   70   C  "C2'" . DG  A 1 4   ? -7.299  -15.147 0.441   1.00 21.28 ? 4   DG  C "C2'" 1 
ATOM   71   C  "C1'" . DG  A 1 4   ? -5.881  -15.427 -0.076  1.00 23.87 ? 4   DG  C "C1'" 1 
ATOM   72   N  N9    . DG  A 1 4   ? -5.680  -14.732 -1.375  1.00 17.32 ? 4   DG  C N9    1 
ATOM   73   C  C8    . DG  A 1 4   ? -6.575  -14.469 -2.377  1.00 11.63 ? 4   DG  C C8    1 
ATOM   74   N  N7    . DG  A 1 4   ? -6.023  -13.817 -3.382  1.00 20.02 ? 4   DG  C N7    1 
ATOM   75   C  C5    . DG  A 1 4   ? -4.690  -13.650 -3.000  1.00 12.14 ? 4   DG  C C5    1 
ATOM   76   C  C6    . DG  A 1 4   ? -3.647  -13.029 -3.669  1.00 13.29 ? 4   DG  C C6    1 
ATOM   77   O  O6    . DG  A 1 4   ? -3.689  -12.477 -4.765  1.00 18.37 ? 4   DG  C O6    1 
ATOM   78   N  N1    . DG  A 1 4   ? -2.503  -13.086 -2.941  1.00 15.47 ? 4   DG  C N1    1 
ATOM   79   C  C2    . DG  A 1 4   ? -2.360  -13.676 -1.700  1.00 19.77 ? 4   DG  C C2    1 
ATOM   80   N  N2    . DG  A 1 4   ? -1.169  -13.671 -1.107  1.00 16.70 ? 4   DG  C N2    1 
ATOM   81   N  N3    . DG  A 1 4   ? -3.340  -14.257 -1.069  1.00 16.68 ? 4   DG  C N3    1 
ATOM   82   C  C4    . DG  A 1 4   ? -4.475  -14.206 -1.778  1.00 15.59 ? 4   DG  C C4    1 
ATOM   83   P  P     . DA  A 1 5   ? -6.651  -16.169 4.177   1.00 18.85 ? 5   DA  C P     1 
ATOM   84   O  OP1   . DA  A 1 5   ? -6.287  -17.586 4.199   1.00 28.35 ? 5   DA  C OP1   1 
ATOM   85   O  OP2   . DA  A 1 5   ? -7.999  -15.698 4.581   1.00 16.45 ? 5   DA  C OP2   1 
ATOM   86   O  "O5'" . DA  A 1 5   ? -5.433  -15.304 4.870   1.00 21.39 ? 5   DA  C "O5'" 1 
ATOM   87   C  "C5'" . DA  A 1 5   ? -5.288  -13.869 4.788   1.00 20.63 ? 5   DA  C "C5'" 1 
ATOM   88   C  "C4'" . DA  A 1 5   ? -3.808  -13.547 4.511   1.00 24.44 ? 5   DA  C "C4'" 1 
ATOM   89   O  "O4'" . DA  A 1 5   ? -3.499  -13.770 3.147   1.00 24.07 ? 5   DA  C "O4'" 1 
ATOM   90   C  "C3'" . DA  A 1 5   ? -3.494  -12.068 4.752   1.00 23.03 ? 5   DA  C "C3'" 1 
ATOM   91   O  "O3'" . DA  A 1 5   ? -3.239  -11.933 6.136   1.00 24.19 ? 5   DA  C "O3'" 1 
ATOM   92   C  "C2'" . DA  A 1 5   ? -2.224  -11.914 3.924   1.00 17.60 ? 5   DA  C "C2'" 1 
ATOM   93   C  "C1'" . DA  A 1 5   ? -2.605  -12.704 2.720   1.00 20.11 ? 5   DA  C "C1'" 1 
ATOM   94   N  N9    . DA  A 1 5   ? -3.420  -12.043 1.673   1.00 15.44 ? 5   DA  C N9    1 
ATOM   95   C  C8    . DA  A 1 5   ? -4.769  -12.143 1.417   1.00 14.42 ? 5   DA  C C8    1 
ATOM   96   N  N7    . DA  A 1 5   ? -5.157  -11.488 0.363   1.00 15.12 ? 5   DA  C N7    1 
ATOM   97   C  C5    . DA  A 1 5   ? -3.975  -10.912 -0.110  1.00 14.52 ? 5   DA  C C5    1 
ATOM   98   C  C6    . DA  A 1 5   ? -3.691  -10.086 -1.228  1.00 11.10 ? 5   DA  C C6    1 
ATOM   99   N  N6    . DA  A 1 5   ? -4.620  -9.723  -2.133  1.00 11.52 ? 5   DA  C N6    1 
ATOM   100  N  N1    . DA  A 1 5   ? -2.415  -9.700  -1.387  1.00 18.05 ? 5   DA  C N1    1 
ATOM   101  C  C2    . DA  A 1 5   ? -1.470  -10.093 -0.524  1.00 18.19 ? 5   DA  C C2    1 
ATOM   102  N  N3    . DA  A 1 5   ? -1.620  -10.868 0.550   1.00 15.92 ? 5   DA  C N3    1 
ATOM   103  C  C4    . DA  A 1 5   ? -2.917  -11.242 0.693   1.00 12.22 ? 5   DA  C C4    1 
ATOM   104  P  P     . DT  A 1 6   ? -3.478  -10.582 6.899   1.00 20.42 ? 6   DT  C P     1 
ATOM   105  O  OP1   . DT  A 1 6   ? -3.225  -10.891 8.317   1.00 30.73 ? 6   DT  C OP1   1 
ATOM   106  O  OP2   . DT  A 1 6   ? -4.777  -10.027 6.499   1.00 15.66 ? 6   DT  C OP2   1 
ATOM   107  O  "O5'" . DT  A 1 6   ? -2.331  -9.636  6.358   1.00 18.53 ? 6   DT  C "O5'" 1 
ATOM   108  C  "C5'" . DT  A 1 6   ? -0.937  -9.697  6.736   1.00 26.49 ? 6   DT  C "C5'" 1 
ATOM   109  C  "C4'" . DT  A 1 6   ? -0.177  -8.654  5.889   1.00 26.77 ? 6   DT  C "C4'" 1 
ATOM   110  O  "O4'" . DT  A 1 6   ? -0.368  -8.994  4.499   1.00 23.26 ? 6   DT  C "O4'" 1 
ATOM   111  C  "C3'" . DT  A 1 6   ? -0.818  -7.263  5.926   1.00 29.47 ? 6   DT  C "C3'" 1 
ATOM   112  O  "O3'" . DT  A 1 6   ? -0.358  -6.569  7.115   1.00 26.60 ? 6   DT  C "O3'" 1 
ATOM   113  C  "C2'" . DT  A 1 6   ? -0.298  -6.654  4.631   1.00 25.36 ? 6   DT  C "C2'" 1 
ATOM   114  C  "C1'" . DT  A 1 6   ? -0.425  -7.847  3.667   1.00 19.38 ? 6   DT  C "C1'" 1 
ATOM   115  N  N1    . DT  A 1 6   ? -1.732  -7.776  2.902   1.00 16.22 ? 6   DT  C N1    1 
ATOM   116  C  C2    . DT  A 1 6   ? -1.645  -7.151  1.672   1.00 19.95 ? 6   DT  C C2    1 
ATOM   117  O  O2    . DT  A 1 6   ? -0.581  -6.724  1.243   1.00 17.92 ? 6   DT  C O2    1 
ATOM   118  N  N3    . DT  A 1 6   ? -2.795  -7.032  0.922   1.00 11.53 ? 6   DT  C N3    1 
ATOM   119  C  C4    . DT  A 1 6   ? -4.047  -7.478  1.271   1.00 17.06 ? 6   DT  C C4    1 
ATOM   120  O  O4    . DT  A 1 6   ? -5.007  -7.304  0.504   1.00 16.05 ? 6   DT  C O4    1 
ATOM   121  C  C5    . DT  A 1 6   ? -4.060  -8.130  2.582   1.00 15.51 ? 6   DT  C C5    1 
ATOM   122  C  C7    . DT  A 1 6   ? -5.392  -8.689  3.146   1.00 16.13 ? 6   DT  C C7    1 
ATOM   123  C  C6    . DT  A 1 6   ? -2.938  -8.253  3.328   1.00 16.70 ? 6   DT  C C6    1 
ATOM   124  P  P     . DA  A 1 7   ? -1.373  -5.589  7.923   1.00 26.54 ? 7   DA  C P     1 
ATOM   125  O  OP1   . DA  A 1 7   ? -0.660  -5.226  9.158   1.00 36.34 ? 7   DA  C OP1   1 
ATOM   126  O  OP2   . DA  A 1 7   ? -2.698  -6.254  7.984   1.00 19.06 ? 7   DA  C OP2   1 
ATOM   127  O  "O5'" . DA  A 1 7   ? -1.599  -4.318  7.043   1.00 28.54 ? 7   DA  C "O5'" 1 
ATOM   128  C  "C5'" . DA  A 1 7   ? -0.493  -3.442  6.774   1.00 25.64 ? 7   DA  C "C5'" 1 
ATOM   129  C  "C4'" . DA  A 1 7   ? -1.021  -2.202  6.094   1.00 21.68 ? 7   DA  C "C4'" 1 
ATOM   130  O  "O4'" . DA  A 1 7   ? -1.574  -2.595  4.828   1.00 24.36 ? 7   DA  C "O4'" 1 
ATOM   131  C  "C3'" . DA  A 1 7   ? -2.225  -1.581  6.821   1.00 25.75 ? 7   DA  C "C3'" 1 
ATOM   132  O  "O3'" . DA  A 1 7   ? -2.009  -0.154  6.859   1.00 24.98 ? 7   DA  C "O3'" 1 
ATOM   133  C  "C2'" . DA  A 1 7   ? -3.452  -1.948  5.935   1.00 21.97 ? 7   DA  C "C2'" 1 
ATOM   134  C  "C1'" . DA  A 1 7   ? -2.857  -1.973  4.530   1.00 20.19 ? 7   DA  C "C1'" 1 
ATOM   135  N  N9    . DA  A 1 7   ? -3.646  -2.851  3.624   1.00 23.51 ? 7   DA  C N9    1 
ATOM   136  C  C8    . DA  A 1 7   ? -3.931  -4.181  3.785   1.00 22.37 ? 7   DA  C C8    1 
ATOM   137  N  N7    . DA  A 1 7   ? -4.659  -4.702  2.833   1.00 20.28 ? 7   DA  C N7    1 
ATOM   138  C  C5    . DA  A 1 7   ? -4.874  -3.646  1.974   1.00 23.90 ? 7   DA  C C5    1 
ATOM   139  C  C6    . DA  A 1 7   ? -5.591  -3.556  0.750   1.00 23.07 ? 7   DA  C C6    1 
ATOM   140  N  N6    . DA  A 1 7   ? -6.225  -4.581  0.153   1.00 17.99 ? 7   DA  C N6    1 
ATOM   141  N  N1    . DA  A 1 7   ? -5.597  -2.345  0.167   1.00 19.56 ? 7   DA  C N1    1 
ATOM   142  C  C2    . DA  A 1 7   ? -4.943  -1.311  0.755   1.00 22.07 ? 7   DA  C C2    1 
ATOM   143  N  N3    . DA  A 1 7   ? -4.245  -1.282  1.887   1.00 17.21 ? 7   DA  C N3    1 
ATOM   144  C  C4    . DA  A 1 7   ? -4.251  -2.504  2.455   1.00 25.35 ? 7   DA  C C4    1 
ATOM   145  P  P     . DT  A 1 8   ? -3.078  0.808   7.545   1.00 21.33 ? 8   DT  C P     1 
ATOM   146  O  OP1   . DT  A 1 8   ? -2.276  2.001   7.898   1.00 27.88 ? 8   DT  C OP1   1 
ATOM   147  O  OP2   . DT  A 1 8   ? -3.861  0.101   8.581   1.00 22.41 ? 8   DT  C OP2   1 
ATOM   148  O  "O5'" . DT  A 1 8   ? -4.174  1.344   6.484   1.00 23.39 ? 8   DT  C "O5'" 1 
ATOM   149  C  "C5'" . DT  A 1 8   ? -3.747  2.178   5.400   1.00 20.93 ? 8   DT  C "C5'" 1 
ATOM   150  C  "C4'" . DT  A 1 8   ? -4.899  2.460   4.519   1.00 18.52 ? 8   DT  C "C4'" 1 
ATOM   151  O  "O4'" . DT  A 1 8   ? -5.252  1.202   3.949   1.00 18.48 ? 8   DT  C "O4'" 1 
ATOM   152  C  "C3'" . DT  A 1 8   ? -6.165  2.940   5.253   1.00 23.19 ? 8   DT  C "C3'" 1 
ATOM   153  O  "O3'" . DT  A 1 8   ? -6.244  4.292   4.868   1.00 18.27 ? 8   DT  C "O3'" 1 
ATOM   154  C  "C2'" . DT  A 1 8   ? -7.320  2.069   4.757   1.00 15.76 ? 8   DT  C "C2'" 1 
ATOM   155  C  "C1'" . DT  A 1 8   ? -6.646  1.354   3.617   1.00 11.63 ? 8   DT  C "C1'" 1 
ATOM   156  N  N1    . DT  A 1 8   ? -7.185  -0.006  3.364   1.00 24.86 ? 8   DT  C N1    1 
ATOM   157  C  C2    . DT  A 1 8   ? -7.859  -0.168  2.144   1.00 24.28 ? 8   DT  C C2    1 
ATOM   158  O  O2    . DT  A 1 8   ? -8.014  0.737   1.307   1.00 21.75 ? 8   DT  C O2    1 
ATOM   159  N  N3    . DT  A 1 8   ? -8.361  -1.430  1.904   1.00 18.22 ? 8   DT  C N3    1 
ATOM   160  C  C4    . DT  A 1 8   ? -8.254  -2.508  2.740   1.00 18.44 ? 8   DT  C C4    1 
ATOM   161  O  O4    . DT  A 1 8   ? -8.754  -3.548  2.357   1.00 20.76 ? 8   DT  C O4    1 
ATOM   162  C  C5    . DT  A 1 8   ? -7.541  -2.282  3.995   1.00 26.85 ? 8   DT  C C5    1 
ATOM   163  C  C7    . DT  A 1 8   ? -7.372  -3.415  4.976   1.00 18.06 ? 8   DT  C C7    1 
ATOM   164  C  C6    . DT  A 1 8   ? -7.031  -1.064  4.280   1.00 25.58 ? 8   DT  C C6    1 
ATOM   165  P  P     . DC  A 1 9   ? -7.453  5.320   4.901   1.00 18.46 ? 9   DC  C P     1 
ATOM   166  O  OP1   . DC  A 1 9   ? -6.745  6.593   5.001   1.00 21.21 ? 9   DC  C OP1   1 
ATOM   167  O  OP2   . DC  A 1 9   ? -8.392  4.995   5.988   1.00 26.12 ? 9   DC  C OP2   1 
ATOM   168  O  "O5'" . DC  A 1 9   ? -8.299  5.245   3.552   1.00 24.81 ? 9   DC  C "O5'" 1 
ATOM   169  C  "C5'" . DC  A 1 9   ? -7.698  5.480   2.255   1.00 19.16 ? 9   DC  C "C5'" 1 
ATOM   170  C  "C4'" . DC  A 1 9   ? -8.669  5.066   1.139   1.00 19.39 ? 9   DC  C "C4'" 1 
ATOM   171  O  "O4'" . DC  A 1 9   ? -9.009  3.683   1.227   1.00 18.45 ? 9   DC  C "O4'" 1 
ATOM   172  C  "C3'" . DC  A 1 9   ? -9.943  5.827   1.268   1.00 20.43 ? 9   DC  C "C3'" 1 
ATOM   173  O  "O3'" . DC  A 1 9   ? -10.015 6.560   0.070   1.00 22.55 ? 9   DC  C "O3'" 1 
ATOM   174  C  "C2'" . DC  A 1 9   ? -11.026 4.803   1.428   1.00 19.65 ? 9   DC  C "C2'" 1 
ATOM   175  C  "C1'" . DC  A 1 9   ? -10.387 3.557   0.936   1.00 18.18 ? 9   DC  C "C1'" 1 
ATOM   176  N  N1    . DC  A 1 9   ? -10.844 2.336   1.621   1.00 25.10 ? 9   DC  C N1    1 
ATOM   177  C  C2    . DC  A 1 9   ? -11.559 1.425   0.865   1.00 23.71 ? 9   DC  C C2    1 
ATOM   178  O  O2    . DC  A 1 9   ? -11.812 1.640   -0.318  1.00 22.96 ? 9   DC  C O2    1 
ATOM   179  N  N3    . DC  A 1 9   ? -11.995 0.275   1.477   1.00 14.33 ? 9   DC  C N3    1 
ATOM   180  C  C4    . DC  A 1 9   ? -11.741 0.029   2.779   1.00 21.66 ? 9   DC  C C4    1 
ATOM   181  N  N4    . DC  A 1 9   ? -12.216 -1.092  3.317   1.00 15.35 ? 9   DC  C N4    1 
ATOM   182  C  C5    . DC  A 1 9   ? -10.995 0.972   3.576   1.00 18.62 ? 9   DC  C C5    1 
ATOM   183  C  C6    . DC  A 1 9   ? -10.577 2.093   2.950   1.00 25.12 ? 9   DC  C C6    1 
ATOM   184  P  P     . DT  A 1 10  ? -11.132 7.695   -0.175  1.00 30.85 ? 10  DT  C P     1 
ATOM   185  O  OP1   . DT  A 1 10  ? -10.479 8.602   -1.156  1.00 26.71 ? 10  DT  C OP1   1 
ATOM   186  O  OP2   . DT  A 1 10  ? -11.649 8.193   1.117   1.00 27.85 ? 10  DT  C OP2   1 
ATOM   187  O  "O5'" . DT  A 1 10  ? -12.373 6.925   -0.819  1.00 25.72 ? 10  DT  C "O5'" 1 
ATOM   188  C  "C5'" . DT  A 1 10  ? -12.222 6.241   -2.025  1.00 20.79 ? 10  DT  C "C5'" 1 
ATOM   189  C  "C4'" . DT  A 1 10  ? -13.551 5.697   -2.421  1.00 21.44 ? 10  DT  C "C4'" 1 
ATOM   190  O  "O4'" . DT  A 1 10  ? -13.752 4.519   -1.707  1.00 16.02 ? 10  DT  C "O4'" 1 
ATOM   191  C  "C3'" . DT  A 1 10  ? -14.712 6.641   -2.124  1.00 25.69 ? 10  DT  C "C3'" 1 
ATOM   192  O  "O3'" . DT  A 1 10  ? -15.486 6.771   -3.327  1.00 50.91 ? 10  DT  C "O3'" 1 
ATOM   193  C  "C2'" . DT  A 1 10  ? -15.489 5.938   -1.083  1.00 22.84 ? 10  DT  C "C2'" 1 
ATOM   194  C  "C1'" . DT  A 1 10  ? -15.142 4.492   -1.319  1.00 17.92 ? 10  DT  C "C1'" 1 
ATOM   195  N  N1    . DT  A 1 10  ? -15.129 3.630   -0.125  1.00 21.10 ? 10  DT  C N1    1 
ATOM   196  C  C2    . DT  A 1 10  ? -15.643 2.355   -0.252  1.00 20.07 ? 10  DT  C C2    1 
ATOM   197  O  O2    . DT  A 1 10  ? -16.094 1.938   -1.322  1.00 30.68 ? 10  DT  C O2    1 
ATOM   198  N  N3    . DT  A 1 10  ? -15.600 1.570   0.895   1.00 22.67 ? 10  DT  C N3    1 
ATOM   199  C  C4    . DT  A 1 10  ? -15.082 1.973   2.132   1.00 25.92 ? 10  DT  C C4    1 
ATOM   200  O  O4    . DT  A 1 10  ? -15.094 1.192   3.073   1.00 28.52 ? 10  DT  C O4    1 
ATOM   201  C  C5    . DT  A 1 10  ? -14.558 3.341   2.161   1.00 27.02 ? 10  DT  C C5    1 
ATOM   202  C  C7    . DT  A 1 10  ? -13.930 3.950   3.428   1.00 17.04 ? 10  DT  C C7    1 
ATOM   203  C  C6    . DT  A 1 10  ? -14.604 4.098   1.053   1.00 17.85 ? 10  DT  C C6    1 
ATOM   204  P  P     . DT  A 1 11  ? -16.553 7.948   -3.630  1.00 58.80 ? 11  DT  C P     1 
ATOM   205  O  OP1   . DT  A 1 11  ? -16.178 8.347   -5.020  1.00 46.80 ? 11  DT  C OP1   1 
ATOM   206  O  OP2   . DT  A 1 11  ? -16.608 8.932   -2.499  1.00 58.72 ? 11  DT  C OP2   1 
ATOM   207  O  "O5'" . DT  A 1 11  ? -17.946 7.165   -3.626  1.00 58.72 ? 11  DT  C "O5'" 1 
ATOM   208  C  "C5'" . DT  A 1 11  ? -18.205 6.111   -4.563  1.00 60.22 ? 11  DT  C "C5'" 1 
ATOM   209  C  "C4'" . DT  A 1 11  ? -19.339 5.225   -4.046  1.00 62.37 ? 11  DT  C "C4'" 1 
ATOM   210  O  "O4'" . DT  A 1 11  ? -18.888 4.533   -2.851  1.00 58.37 ? 11  DT  C "O4'" 1 
ATOM   211  C  "C3'" . DT  A 1 11  ? -20.609 6.084   -3.656  1.00 63.65 ? 11  DT  C "C3'" 1 
ATOM   212  O  "O3'" . DT  A 1 11  ? -21.827 5.419   -4.123  1.00 70.57 ? 11  DT  C "O3'" 1 
ATOM   213  C  "C2'" . DT  A 1 11  ? -20.557 6.038   -2.121  1.00 60.40 ? 11  DT  C "C2'" 1 
ATOM   214  C  "C1'" . DT  A 1 11  ? -19.986 4.618   -1.910  1.00 56.09 ? 11  DT  C "C1'" 1 
ATOM   215  N  N1    . DT  A 1 11  ? -19.422 4.362   -0.560  1.00 48.99 ? 11  DT  C N1    1 
ATOM   216  C  C2    . DT  A 1 11  ? -19.486 3.043   -0.073  1.00 46.44 ? 11  DT  C C2    1 
ATOM   217  O  O2    . DT  A 1 11  ? -19.966 2.066   -0.664  1.00 43.42 ? 11  DT  C O2    1 
ATOM   218  N  N3    . DT  A 1 11  ? -18.948 2.842   1.179   1.00 43.14 ? 11  DT  C N3    1 
ATOM   219  C  C4    . DT  A 1 11  ? -18.366 3.787   1.980   1.00 41.22 ? 11  DT  C C4    1 
ATOM   220  O  O4    . DT  A 1 11  ? -17.945 3.388   3.072   1.00 40.50 ? 11  DT  C O4    1 
ATOM   221  C  C5    . DT  A 1 11  ? -18.340 5.139   1.398   1.00 42.11 ? 11  DT  C C5    1 
ATOM   222  C  C7    . DT  A 1 11  ? -17.731 6.354   2.101   1.00 43.88 ? 11  DT  C C7    1 
ATOM   223  C  C6    . DT  A 1 11  ? -18.856 5.367   0.184   1.00 46.37 ? 11  DT  C C6    1 
ATOM   224  O  "O5'" . DA  B 1 1   ? -21.922 0.834   8.355   1.00 66.64 ? 1   DA  D "O5'" 1 
ATOM   225  C  "C5'" . DA  B 1 1   ? -23.131 0.234   8.904   1.00 63.56 ? 1   DA  D "C5'" 1 
ATOM   226  C  "C4'" . DA  B 1 1   ? -23.661 -1.060  8.167   1.00 55.15 ? 1   DA  D "C4'" 1 
ATOM   227  O  "O4'" . DA  B 1 1   ? -24.025 -0.741  6.807   1.00 44.00 ? 1   DA  D "O4'" 1 
ATOM   228  C  "C3'" . DA  B 1 1   ? -22.573 -2.149  8.002   1.00 49.20 ? 1   DA  D "C3'" 1 
ATOM   229  O  "O3'" . DA  B 1 1   ? -23.300 -3.389  7.849   1.00 47.34 ? 1   DA  D "O3'" 1 
ATOM   230  C  "C2'" . DA  B 1 1   ? -21.870 -1.700  6.719   1.00 38.18 ? 1   DA  D "C2'" 1 
ATOM   231  C  "C1'" . DA  B 1 1   ? -23.110 -1.389  5.918   1.00 41.33 ? 1   DA  D "C1'" 1 
ATOM   232  N  N9    . DA  B 1 1   ? -22.978 -0.437  4.810   1.00 37.79 ? 1   DA  D N9    1 
ATOM   233  C  C8    . DA  B 1 1   ? -23.572 -0.561  3.566   1.00 37.96 ? 1   DA  D C8    1 
ATOM   234  N  N7    . DA  B 1 1   ? -23.319 0.445   2.769   1.00 36.81 ? 1   DA  D N7    1 
ATOM   235  C  C5    . DA  B 1 1   ? -22.503 1.299   3.524   1.00 34.99 ? 1   DA  D C5    1 
ATOM   236  C  C6    . DA  B 1 1   ? -21.892 2.554   3.241   1.00 38.76 ? 1   DA  D C6    1 
ATOM   237  N  N6    . DA  B 1 1   ? -22.032 3.223   2.086   1.00 37.01 ? 1   DA  D N6    1 
ATOM   238  N  N1    . DA  B 1 1   ? -21.151 3.104   4.229   1.00 41.41 ? 1   DA  D N1    1 
ATOM   239  C  C2    . DA  B 1 1   ? -21.016 2.485   5.406   1.00 37.08 ? 1   DA  D C2    1 
ATOM   240  N  N3    . DA  B 1 1   ? -21.540 1.316   5.783   1.00 37.02 ? 1   DA  D N3    1 
ATOM   241  C  C4    . DA  B 1 1   ? -22.286 0.766   4.778   1.00 36.42 ? 1   DA  D C4    1 
ATOM   242  P  P     . DA  B 1 2   ? -22.664 -4.866  7.669   1.00 50.41 ? 2   DA  D P     1 
ATOM   243  O  OP1   . DA  B 1 2   ? -23.707 -5.808  8.158   1.00 44.14 ? 2   DA  D OP1   1 
ATOM   244  O  OP2   . DA  B 1 2   ? -21.281 -4.815  8.232   1.00 47.50 ? 2   DA  D OP2   1 
ATOM   245  O  "O5'" . DA  B 1 2   ? -22.532 -5.103  6.049   1.00 39.57 ? 2   DA  D "O5'" 1 
ATOM   246  C  "C5'" . DA  B 1 2   ? -23.716 -5.096  5.238   1.00 37.43 ? 2   DA  D "C5'" 1 
ATOM   247  C  "C4'" . DA  B 1 2   ? -23.369 -5.135  3.764   1.00 36.52 ? 2   DA  D "C4'" 1 
ATOM   248  O  "O4'" . DA  B 1 2   ? -22.639 -3.991  3.295   1.00 35.00 ? 2   DA  D "O4'" 1 
ATOM   249  C  "C3'" . DA  B 1 2   ? -22.430 -6.315  3.567   1.00 39.43 ? 2   DA  D "C3'" 1 
ATOM   250  O  "O3'" . DA  B 1 2   ? -22.850 -6.934  2.328   1.00 42.36 ? 2   DA  D "O3'" 1 
ATOM   251  C  "C2'" . DA  B 1 2   ? -21.006 -5.742  3.507   1.00 31.22 ? 2   DA  D "C2'" 1 
ATOM   252  C  "C1'" . DA  B 1 2   ? -21.278 -4.354  2.896   1.00 32.71 ? 2   DA  D "C1'" 1 
ATOM   253  N  N9    . DA  B 1 2   ? -20.380 -3.274  3.427   1.00 36.30 ? 2   DA  D N9    1 
ATOM   254  C  C8    . DA  B 1 2   ? -19.661 -3.224  4.619   1.00 38.04 ? 2   DA  D C8    1 
ATOM   255  N  N7    . DA  B 1 2   ? -18.990 -2.108  4.820   1.00 36.89 ? 2   DA  D N7    1 
ATOM   256  C  C5    . DA  B 1 2   ? -19.281 -1.355  3.673   1.00 31.16 ? 2   DA  D C5    1 
ATOM   257  C  C6    . DA  B 1 2   ? -18.876 -0.066  3.269   1.00 34.18 ? 2   DA  D C6    1 
ATOM   258  N  N6    . DA  B 1 2   ? -18.080 0.723   4.009   1.00 39.87 ? 2   DA  D N6    1 
ATOM   259  N  N1    . DA  B 1 2   ? -19.342 0.370   2.082   1.00 32.61 ? 2   DA  D N1    1 
ATOM   260  C  C2    . DA  B 1 2   ? -20.153 -0.420  1.355   1.00 31.69 ? 2   DA  D C2    1 
ATOM   261  N  N3    . DA  B 1 2   ? -20.606 -1.638  1.621   1.00 29.81 ? 2   DA  D N3    1 
ATOM   262  C  C4    . DA  B 1 2   ? -20.120 -2.052  2.819   1.00 35.42 ? 2   DA  D C4    1 
ATOM   263  P  P     . DA  B 1 3   ? -22.263 -8.296  1.671   1.00 37.20 ? 3   DA  D P     1 
ATOM   264  O  OP1   . DA  B 1 3   ? -23.456 -8.989  1.103   1.00 47.71 ? 3   DA  D OP1   1 
ATOM   265  O  OP2   . DA  B 1 3   ? -21.370 -9.032  2.629   1.00 33.27 ? 3   DA  D OP2   1 
ATOM   266  O  "O5'" . DA  B 1 3   ? -21.340 -7.775  0.412   1.00 32.29 ? 3   DA  D "O5'" 1 
ATOM   267  C  "C5'" . DA  B 1 3   ? -21.938 -7.057  -0.682  1.00 28.42 ? 3   DA  D "C5'" 1 
ATOM   268  C  "C4'" . DA  B 1 3   ? -20.863 -6.269  -1.395  1.00 28.58 ? 3   DA  D "C4'" 1 
ATOM   269  O  "O4'" . DA  B 1 3   ? -20.265 -5.328  -0.518  1.00 25.78 ? 3   DA  D "O4'" 1 
ATOM   270  C  "C3'" . DA  B 1 3   ? -19.747 -7.188  -1.830  1.00 28.30 ? 3   DA  D "C3'" 1 
ATOM   271  O  "O3'" . DA  B 1 3   ? -19.970 -7.266  -3.234  1.00 32.28 ? 3   DA  D "O3'" 1 
ATOM   272  C  "C2'" . DA  B 1 3   ? -18.431 -6.495  -1.399  1.00 24.11 ? 3   DA  D "C2'" 1 
ATOM   273  C  "C1'" . DA  B 1 3   ? -18.947 -5.139  -0.989  1.00 22.26 ? 3   DA  D "C1'" 1 
ATOM   274  N  N9    . DA  B 1 3   ? -18.194 -4.558  0.116   1.00 28.42 ? 3   DA  D N9    1 
ATOM   275  C  C8    . DA  B 1 3   ? -17.840 -5.128  1.286   1.00 25.53 ? 3   DA  D C8    1 
ATOM   276  N  N7    . DA  B 1 3   ? -17.144 -4.352  2.081   1.00 30.78 ? 3   DA  D N7    1 
ATOM   277  C  C5    . DA  B 1 3   ? -17.032 -3.167  1.369   1.00 28.30 ? 3   DA  D C5    1 
ATOM   278  C  C6    . DA  B 1 3   ? -16.402 -1.942  1.660   1.00 28.43 ? 3   DA  D C6    1 
ATOM   279  N  N6    . DA  B 1 3   ? -15.726 -1.737  2.802   1.00 19.58 ? 3   DA  D N6    1 
ATOM   280  N  N1    . DA  B 1 3   ? -16.487 -0.968  0.714   1.00 24.25 ? 3   DA  D N1    1 
ATOM   281  C  C2    . DA  B 1 3   ? -17.142 -1.211  -0.415  1.00 22.96 ? 3   DA  D C2    1 
ATOM   282  N  N3    . DA  B 1 3   ? -17.769 -2.322  -0.798  1.00 27.46 ? 3   DA  D N3    1 
ATOM   283  C  C4    . DA  B 1 3   ? -17.673 -3.278  0.160   1.00 28.48 ? 3   DA  D C4    1 
ATOM   284  P  P     . DG  B 1 4   ? -18.964 -7.832  -4.330  1.00 32.87 ? 4   DG  D P     1 
ATOM   285  O  OP1   . DG  B 1 4   ? -19.802 -8.184  -5.493  1.00 44.52 ? 4   DG  D OP1   1 
ATOM   286  O  OP2   . DG  B 1 4   ? -18.124 -8.840  -3.651  1.00 24.58 ? 4   DG  D OP2   1 
ATOM   287  O  "O5'" . DG  B 1 4   ? -17.951 -6.659  -4.856  1.00 33.34 ? 4   DG  D "O5'" 1 
ATOM   288  C  "C5'" . DG  B 1 4   ? -18.314 -5.409  -5.469  1.00 20.61 ? 4   DG  D "C5'" 1 
ATOM   289  C  "C4'" . DG  B 1 4   ? -17.111 -4.519  -5.375  1.00 22.35 ? 4   DG  D "C4'" 1 
ATOM   290  O  "O4'" . DG  B 1 4   ? -16.788 -4.346  -3.984  1.00 21.34 ? 4   DG  D "O4'" 1 
ATOM   291  C  "C3'" . DG  B 1 4   ? -15.847 -5.194  -5.925  1.00 18.38 ? 4   DG  D "C3'" 1 
ATOM   292  O  "O3'" . DG  B 1 4   ? -15.024 -4.299  -6.631  1.00 25.81 ? 4   DG  D "O3'" 1 
ATOM   293  C  "C2'" . DG  B 1 4   ? -15.007 -5.575  -4.687  1.00 14.46 ? 4   DG  D "C2'" 1 
ATOM   294  C  "C1'" . DG  B 1 4   ? -15.367 -4.357  -3.900  1.00 16.42 ? 4   DG  D "C1'" 1 
ATOM   295  N  N9    . DG  B 1 4   ? -14.904 -4.486  -2.512  1.00 25.96 ? 4   DG  D N9    1 
ATOM   296  C  C8    . DG  B 1 4   ? -14.858 -5.571  -1.658  1.00 27.78 ? 4   DG  D C8    1 
ATOM   297  N  N7    . DG  B 1 4   ? -14.345 -5.315  -0.494  1.00 18.89 ? 4   DG  D N7    1 
ATOM   298  C  C5    . DG  B 1 4   ? -14.034 -3.958  -0.595  1.00 22.25 ? 4   DG  D C5    1 
ATOM   299  C  C6    . DG  B 1 4   ? -13.444 -3.089  0.358   1.00 20.31 ? 4   DG  D C6    1 
ATOM   300  O  O6    . DG  B 1 4   ? -13.050 -3.319  1.498   1.00 19.07 ? 4   DG  D O6    1 
ATOM   301  N  N1    . DG  B 1 4   ? -13.314 -1.821  -0.145  1.00 16.71 ? 4   DG  D N1    1 
ATOM   302  C  C2    . DG  B 1 4   ? -13.677 -1.376  -1.387  1.00 20.56 ? 4   DG  D C2    1 
ATOM   303  N  N2    . DG  B 1 4   ? -13.429 -0.077  -1.634  1.00 13.52 ? 4   DG  D N2    1 
ATOM   304  N  N3    . DG  B 1 4   ? -14.232 -2.175  -2.298  1.00 20.39 ? 4   DG  D N3    1 
ATOM   305  C  C4    . DG  B 1 4   ? -14.375 -3.447  -1.820  1.00 22.09 ? 4   DG  D C4    1 
ATOM   306  P  P     . DA  B 1 5   ? -15.123 -4.032  -8.216  1.00 20.75 ? 5   DA  D P     1 
ATOM   307  O  OP1   . DA  B 1 5   ? -16.453 -3.492  -8.488  1.00 20.25 ? 5   DA  D OP1   1 
ATOM   308  O  OP2   . DA  B 1 5   ? -14.616 -5.265  -8.846  1.00 23.23 ? 5   DA  D OP2   1 
ATOM   309  O  "O5'" . DA  B 1 5   ? -14.023 -2.886  -8.347  1.00 15.83 ? 5   DA  D "O5'" 1 
ATOM   310  C  "C5'" . DA  B 1 5   ? -12.645 -3.010  -8.071  1.00 20.79 ? 5   DA  D "C5'" 1 
ATOM   311  C  "C4'" . DA  B 1 5   ? -12.139 -1.642  -7.485  1.00 19.10 ? 5   DA  D "C4'" 1 
ATOM   312  O  "O4'" . DA  B 1 5   ? -12.628 -1.431  -6.147  1.00 20.23 ? 5   DA  D "O4'" 1 
ATOM   313  C  "C3'" . DA  B 1 5   ? -10.634 -1.631  -7.366  1.00 17.95 ? 5   DA  D "C3'" 1 
ATOM   314  O  "O3'" . DA  B 1 5   ? -10.173 -1.162  -8.619  1.00 18.26 ? 5   DA  D "O3'" 1 
ATOM   315  C  "C2'" . DA  B 1 5   ? -10.354 -0.640  -6.236  1.00 14.47 ? 5   DA  D "C2'" 1 
ATOM   316  C  "C1'" . DA  B 1 5   ? -11.555 -0.919  -5.372  1.00 19.01 ? 5   DA  D "C1'" 1 
ATOM   317  N  N9    . DA  B 1 5   ? -11.312 -1.926  -4.285  1.00 25.67 ? 5   DA  D N9    1 
ATOM   318  C  C8    . DA  B 1 5   ? -11.734 -3.231  -4.212  1.00 22.64 ? 5   DA  D C8    1 
ATOM   319  N  N7    . DA  B 1 5   ? -11.418 -3.855  -3.122  1.00 24.53 ? 5   DA  D N7    1 
ATOM   320  C  C5    . DA  B 1 5   ? -10.724 -2.888  -2.405  1.00 28.65 ? 5   DA  D C5    1 
ATOM   321  C  C6    . DA  B 1 5   ? -10.122 -2.936  -1.138  1.00 24.10 ? 5   DA  D C6    1 
ATOM   322  N  N6    . DA  B 1 5   ? -10.164 -4.046  -0.356  1.00 14.50 ? 5   DA  D N6    1 
ATOM   323  N  N1    . DA  B 1 5   ? -9.515  -1.791  -0.739  1.00 25.19 ? 5   DA  D N1    1 
ATOM   324  C  C2    . DA  B 1 5   ? -9.515  -0.704  -1.532  1.00 23.64 ? 5   DA  D C2    1 
ATOM   325  N  N3    . DA  B 1 5   ? -10.051 -0.554  -2.733  1.00 25.12 ? 5   DA  D N3    1 
ATOM   326  C  C4    . DA  B 1 5   ? -10.649 -1.708  -3.110  1.00 24.16 ? 5   DA  D C4    1 
ATOM   327  P  P     . DT  B 1 6   ? -8.674  -1.371  -9.116  1.00 24.52 ? 6   DT  D P     1 
ATOM   328  O  OP1   . DT  B 1 6   ? -8.636  -0.834  -10.505 1.00 28.45 ? 6   DT  D OP1   1 
ATOM   329  O  OP2   . DT  B 1 6   ? -8.249  -2.765  -8.829  1.00 21.81 ? 6   DT  D OP2   1 
ATOM   330  O  "O5'" . DT  B 1 6   ? -7.716  -0.421  -8.188  1.00 23.64 ? 6   DT  D "O5'" 1 
ATOM   331  C  "C5'" . DT  B 1 6   ? -7.496  1.005   -8.309  1.00 24.43 ? 6   DT  D "C5'" 1 
ATOM   332  C  "C4'" . DT  B 1 6   ? -6.607  1.436   -7.135  1.00 22.45 ? 6   DT  D "C4'" 1 
ATOM   333  O  "O4'" . DT  B 1 6   ? -7.267  1.124   -5.892  1.00 21.43 ? 6   DT  D "O4'" 1 
ATOM   334  C  "C3'" . DT  B 1 6   ? -5.387  0.578   -7.008  1.00 17.73 ? 6   DT  D "C3'" 1 
ATOM   335  O  "O3'" . DT  B 1 6   ? -4.450  1.066   -7.955  1.00 22.40 ? 6   DT  D "O3'" 1 
ATOM   336  C  "C2'" . DT  B 1 6   ? -4.988  0.810   -5.585  1.00 17.67 ? 6   DT  D "C2'" 1 
ATOM   337  C  "C1'" . DT  B 1 6   ? -6.328  0.808   -4.890  1.00 14.79 ? 6   DT  D "C1'" 1 
ATOM   338  N  N1    . DT  B 1 6   ? -6.577  -0.527  -4.329  1.00 20.05 ? 6   DT  D N1    1 
ATOM   339  C  C2    . DT  B 1 6   ? -6.223  -0.717  -3.007  1.00 23.21 ? 6   DT  D C2    1 
ATOM   340  O  O2    . DT  B 1 6   ? -5.748  0.146   -2.279  1.00 18.35 ? 6   DT  D O2    1 
ATOM   341  N  N3    . DT  B 1 6   ? -6.435  -1.987  -2.498  1.00 21.08 ? 6   DT  D N3    1 
ATOM   342  C  C4    . DT  B 1 6   ? -6.963  -3.089  -3.175  1.00 25.55 ? 6   DT  D C4    1 
ATOM   343  O  O4    . DT  B 1 6   ? -7.068  -4.164  -2.596  1.00 12.93 ? 6   DT  D O4    1 
ATOM   344  C  C5    . DT  B 1 6   ? -7.315  -2.820  -4.552  1.00 20.85 ? 6   DT  D C5    1 
ATOM   345  C  C7    . DT  B 1 6   ? -7.901  -3.940  -5.398  1.00 17.79 ? 6   DT  D C7    1 
ATOM   346  C  C6    . DT  B 1 6   ? -7.118  -1.584  -5.074  1.00 22.65 ? 6   DT  D C6    1 
ATOM   347  P  P     . DA  B 1 7   ? -3.278  0.111   -8.521  1.00 23.84 ? 7   DA  D P     1 
ATOM   348  O  OP1   . DA  B 1 7   ? -2.453  0.971   -9.403  1.00 30.72 ? 7   DA  D OP1   1 
ATOM   349  O  OP2   . DA  B 1 7   ? -3.982  -1.071  -9.127  1.00 30.64 ? 7   DA  D OP2   1 
ATOM   350  O  "O5'" . DA  B 1 7   ? -2.310  -0.368  -7.322  1.00 25.04 ? 7   DA  D "O5'" 1 
ATOM   351  C  "C5'" . DA  B 1 7   ? -1.325  0.502   -6.786  1.00 19.90 ? 7   DA  D "C5'" 1 
ATOM   352  C  "C4'" . DA  B 1 7   ? -0.282  -0.276  -6.048  1.00 24.62 ? 7   DA  D "C4'" 1 
ATOM   353  O  "O4'" . DA  B 1 7   ? -0.920  -1.054  -4.992  1.00 28.10 ? 7   DA  D "O4'" 1 
ATOM   354  C  "C3'" . DA  B 1 7   ? 0.380   -1.308  -6.944  1.00 15.76 ? 7   DA  D "C3'" 1 
ATOM   355  O  "O3'" . DA  B 1 7   ? 1.727   -1.290  -6.587  1.00 18.39 ? 7   DA  D "O3'" 1 
ATOM   356  C  "C2'" . DA  B 1 7   ? -0.282  -2.661  -6.555  1.00 24.32 ? 7   DA  D "C2'" 1 
ATOM   357  C  "C1'" . DA  B 1 7   ? -0.564  -2.464  -5.046  1.00 22.24 ? 7   DA  D "C1'" 1 
ATOM   358  N  N9    . DA  B 1 7   ? -1.766  -3.196  -4.542  1.00 18.05 ? 7   DA  D N9    1 
ATOM   359  C  C8    . DA  B 1 7   ? -3.054  -3.131  -5.020  1.00 18.90 ? 7   DA  D C8    1 
ATOM   360  N  N7    . DA  B 1 7   ? -3.923  -3.865  -4.376  1.00 19.87 ? 7   DA  D N7    1 
ATOM   361  C  C5    . DA  B 1 7   ? -3.146  -4.471  -3.383  1.00 18.43 ? 7   DA  D C5    1 
ATOM   362  C  C6    . DA  B 1 7   ? -3.475  -5.396  -2.337  1.00 13.32 ? 7   DA  D C6    1 
ATOM   363  N  N6    . DA  B 1 7   ? -4.703  -5.870  -2.146  1.00 15.49 ? 7   DA  D N6    1 
ATOM   364  N  N1    . DA  B 1 7   ? -2.455  -5.787  -1.535  1.00 18.85 ? 7   DA  D N1    1 
ATOM   365  C  C2    . DA  B 1 7   ? -1.205  -5.325  -1.724  1.00 16.70 ? 7   DA  D C2    1 
ATOM   366  N  N3    . DA  B 1 7   ? -0.775  -4.459  -2.669  1.00 26.19 ? 7   DA  D N3    1 
ATOM   367  C  C4    . DA  B 1 7   ? -1.826  -4.065  -3.481  1.00 17.22 ? 7   DA  D C4    1 
ATOM   368  P  P     . DT  B 1 8   ? 2.757   -2.165  -7.351  1.00 29.36 ? 8   DT  D P     1 
ATOM   369  O  OP1   . DT  B 1 8   ? 4.073   -1.533  -7.173  1.00 31.63 ? 8   DT  D OP1   1 
ATOM   370  O  OP2   . DT  B 1 8   ? 2.192   -2.400  -8.708  1.00 22.96 ? 8   DT  D OP2   1 
ATOM   371  O  "O5'" . DT  B 1 8   ? 2.781   -3.551  -6.537  1.00 28.96 ? 8   DT  D "O5'" 1 
ATOM   372  C  "C5'" . DT  B 1 8   ? 3.549   -3.719  -5.353  1.00 23.83 ? 8   DT  D "C5'" 1 
ATOM   373  C  "C4'" . DT  B 1 8   ? 3.337   -5.112  -4.853  1.00 16.15 ? 8   DT  D "C4'" 1 
ATOM   374  O  "O4'" . DT  B 1 8   ? 1.942   -5.334  -4.653  1.00 20.61 ? 8   DT  D "O4'" 1 
ATOM   375  C  "C3'" . DT  B 1 8   ? 3.721   -6.165  -5.886  1.00 23.81 ? 8   DT  D "C3'" 1 
ATOM   376  O  "O3'" . DT  B 1 8   ? 4.513   -7.103  -5.241  1.00 23.12 ? 8   DT  D "O3'" 1 
ATOM   377  C  "C2'" . DT  B 1 8   ? 2.398   -6.854  -6.241  1.00 18.01 ? 8   DT  D "C2'" 1 
ATOM   378  C  "C1'" . DT  B 1 8   ? 1.779   -6.735  -4.840  1.00 13.05 ? 8   DT  D "C1'" 1 
ATOM   379  N  N1    . DT  B 1 8   ? 0.337   -7.047  -4.799  1.00 21.28 ? 8   DT  D N1    1 
ATOM   380  C  C2    . DT  B 1 8   ? -0.138  -7.817  -3.691  1.00 22.35 ? 8   DT  D C2    1 
ATOM   381  O  O2    . DT  B 1 8   ? 0.558   -8.232  -2.773  1.00 21.58 ? 8   DT  D O2    1 
ATOM   382  N  N3    . DT  B 1 8   ? -1.491  -8.112  -3.656  1.00 7.83  ? 8   DT  D N3    1 
ATOM   383  C  C4    . DT  B 1 8   ? -2.422  -7.721  -4.608  1.00 18.17 ? 8   DT  D C4    1 
ATOM   384  O  O4    . DT  B 1 8   ? -3.610  -8.038  -4.442  1.00 19.14 ? 8   DT  D O4    1 
ATOM   385  C  C5    . DT  B 1 8   ? -1.858  -6.923  -5.736  1.00 16.96 ? 8   DT  D C5    1 
ATOM   386  C  C7    . DT  B 1 8   ? -2.765  -6.433  -6.841  1.00 10.88 ? 8   DT  D C7    1 
ATOM   387  C  C6    . DT  B 1 8   ? -0.537  -6.615  -5.805  1.00 17.65 ? 8   DT  D C6    1 
ATOM   388  P  P     . DC  B 1 9   ? 5.965   -7.558  -5.541  1.00 24.90 ? 9   DC  D P     1 
ATOM   389  O  OP1   . DC  B 1 9   ? 6.910   -6.422  -5.316  1.00 28.37 ? 9   DC  D OP1   1 
ATOM   390  O  OP2   . DC  B 1 9   ? 5.912   -8.239  -6.859  1.00 38.40 ? 9   DC  D OP2   1 
ATOM   391  O  "O5'" . DC  B 1 9   ? 6.066   -8.665  -4.366  1.00 34.96 ? 9   DC  D "O5'" 1 
ATOM   392  C  "C5'" . DC  B 1 9   ? 5.701   -8.281  -3.009  1.00 26.72 ? 9   DC  D "C5'" 1 
ATOM   393  C  "C4'" . DC  B 1 9   ? 4.839   -9.302  -2.329  1.00 26.61 ? 9   DC  D "C4'" 1 
ATOM   394  O  "O4'" . DC  B 1 9   ? 3.564   -9.325  -2.867  1.00 28.63 ? 9   DC  D "O4'" 1 
ATOM   395  C  "C3'" . DC  B 1 9   ? 5.403   -10.664 -2.567  1.00 29.95 ? 9   DC  D "C3'" 1 
ATOM   396  O  "O3'" . DC  B 1 9   ? 6.081   -11.092 -1.372  1.00 33.03 ? 9   DC  D "O3'" 1 
ATOM   397  C  "C2'" . DC  B 1 9   ? 4.207   -11.493 -2.855  1.00 28.30 ? 9   DC  D "C2'" 1 
ATOM   398  C  "C1'" . DC  B 1 9   ? 3.064   -10.613 -2.619  1.00 26.57 ? 9   DC  D "C1'" 1 
ATOM   399  N  N1    . DC  B 1 9   ? 1.968   -10.853 -3.557  1.00 23.71 ? 9   DC  D N1    1 
ATOM   400  C  C2    . DC  B 1 9   ? 0.850   -11.476 -3.061  1.00 25.10 ? 9   DC  D C2    1 
ATOM   401  O  O2    . DC  B 1 9   ? 0.808   -11.817 -1.892  1.00 21.77 ? 9   DC  D O2    1 
ATOM   402  N  N3    . DC  B 1 9   ? -0.220  -11.717 -3.886  1.00 22.62 ? 9   DC  D N3    1 
ATOM   403  C  C4    . DC  B 1 9   ? -0.176  -11.344 -5.185  1.00 20.73 ? 9   DC  D C4    1 
ATOM   404  N  N4    . DC  B 1 9   ? -1.248  -11.601 -5.960  1.00 23.40 ? 9   DC  D N4    1 
ATOM   405  C  C5    . DC  B 1 9   ? 0.998   -10.687 -5.723  1.00 16.84 ? 9   DC  D C5    1 
ATOM   406  C  C6    . DC  B 1 9   ? 2.035   -10.464 -4.884  1.00 21.69 ? 9   DC  D C6    1 
ATOM   407  P  P     . DT  B 1 10  ? 7.101   -12.368 -1.342  1.00 40.86 ? 10  DT  D P     1 
ATOM   408  O  OP1   . DT  B 1 10  ? 8.162   -12.089 -0.326  1.00 47.54 ? 10  DT  D OP1   1 
ATOM   409  O  OP2   . DT  B 1 10  ? 7.395   -12.842 -2.717  1.00 39.14 ? 10  DT  D OP2   1 
ATOM   410  O  "O5'" . DT  B 1 10  ? 6.047   -13.475 -0.710  1.00 47.70 ? 10  DT  D "O5'" 1 
ATOM   411  C  "C5'" . DT  B 1 10  ? 5.238   -13.359 0.500   1.00 38.23 ? 10  DT  D "C5'" 1 
ATOM   412  C  "C4'" . DT  B 1 10  ? 4.306   -14.581 0.684   1.00 44.49 ? 10  DT  D "C4'" 1 
ATOM   413  O  "O4'" . DT  B 1 10  ? 3.239   -14.679 -0.255  1.00 41.12 ? 10  DT  D "O4'" 1 
ATOM   414  C  "C3'" . DT  B 1 10  ? 5.102   -15.843 0.335   1.00 47.54 ? 10  DT  D "C3'" 1 
ATOM   415  O  "O3'" . DT  B 1 10  ? 4.641   -16.844 1.225   1.00 61.51 ? 10  DT  D "O3'" 1 
ATOM   416  C  "C2'" . DT  B 1 10  ? 4.803   -16.214 -1.119  1.00 41.69 ? 10  DT  D "C2'" 1 
ATOM   417  C  "C1'" . DT  B 1 10  ? 3.331   -15.899 -1.079  1.00 33.91 ? 10  DT  D "C1'" 1 
ATOM   418  N  N1    . DT  B 1 10  ? 2.714   -15.525 -2.388  1.00 33.51 ? 10  DT  D N1    1 
ATOM   419  C  C2    . DT  B 1 10  ? 1.347   -15.795 -2.564  1.00 29.74 ? 10  DT  D C2    1 
ATOM   420  O  O2    . DT  B 1 10  ? 0.626   -16.334 -1.727  1.00 36.06 ? 10  DT  D O2    1 
ATOM   421  N  N3    . DT  B 1 10  ? 0.790   -15.415 -3.761  1.00 21.90 ? 10  DT  D N3    1 
ATOM   422  C  C4    . DT  B 1 10  ? 1.447   -14.795 -4.796  1.00 25.55 ? 10  DT  D C4    1 
ATOM   423  O  O4    . DT  B 1 10  ? 0.791   -14.506 -5.798  1.00 29.35 ? 10  DT  D O4    1 
ATOM   424  C  C5    . DT  B 1 10  ? 2.867   -14.543 -4.556  1.00 32.72 ? 10  DT  D C5    1 
ATOM   425  C  C7    . DT  B 1 10  ? 3.749   -13.845 -5.614  1.00 30.05 ? 10  DT  D C7    1 
ATOM   426  C  C6    . DT  B 1 10  ? 3.446   -14.911 -3.381  1.00 32.84 ? 10  DT  D C6    1 
ATOM   427  P  P     . DT  B 1 11  ? 5.652   -17.902 1.914   1.00 70.04 ? 11  DT  D P     1 
ATOM   428  O  OP1   . DT  B 1 11  ? 5.940   -17.404 3.301   1.00 61.08 ? 11  DT  D OP1   1 
ATOM   429  O  OP2   . DT  B 1 11  ? 6.736   -18.281 0.914   1.00 64.10 ? 11  DT  D OP2   1 
ATOM   430  O  "O5'" . DT  B 1 11  ? 4.620   -19.132 2.051   1.00 65.24 ? 11  DT  D "O5'" 1 
ATOM   431  C  "C5'" . DT  B 1 11  ? 3.231   -19.251 2.445   1.00 67.85 ? 11  DT  D "C5'" 1 
ATOM   432  C  "C4'" . DT  B 1 11  ? 2.645   -20.278 1.454   1.00 78.86 ? 11  DT  D "C4'" 1 
ATOM   433  O  "O4'" . DT  B 1 11  ? 2.250   -19.627 0.220   1.00 77.04 ? 11  DT  D "O4'" 1 
ATOM   434  C  "C3'" . DT  B 1 11  ? 3.786   -21.325 1.043   1.00 81.94 ? 11  DT  D "C3'" 1 
ATOM   435  O  "O3'" . DT  B 1 11  ? 3.525   -22.636 1.613   1.00 87.91 ? 11  DT  D "O3'" 1 
ATOM   436  C  "C2'" . DT  B 1 11  ? 3.770   -21.423 -0.487  1.00 77.18 ? 11  DT  D "C2'" 1 
ATOM   437  C  "C1'" . DT  B 1 11  ? 2.531   -20.550 -0.877  1.00 73.14 ? 11  DT  D "C1'" 1 
ATOM   438  N  N1    . DT  B 1 11  ? 2.786   -19.773 -2.168  1.00 62.96 ? 11  DT  D N1    1 
ATOM   439  C  C2    . DT  B 1 11  ? 1.648   -19.454 -2.937  1.00 56.39 ? 11  DT  D C2    1 
ATOM   440  O  O2    . DT  B 1 11  ? 0.485   -19.746 -2.619  1.00 56.55 ? 11  DT  D O2    1 
ATOM   441  N  N3    . DT  B 1 11  ? 1.887   -18.760 -4.113  1.00 46.59 ? 11  DT  D N3    1 
ATOM   442  C  C4    . DT  B 1 11  ? 3.127   -18.353 -4.596  1.00 53.04 ? 11  DT  D C4    1 
ATOM   443  O  O4    . DT  B 1 11  ? 3.158   -17.742 -5.672  1.00 52.08 ? 11  DT  D O4    1 
ATOM   444  C  C5    . DT  B 1 11  ? 4.277   -18.712 -3.747  1.00 58.99 ? 11  DT  D C5    1 
ATOM   445  C  C7    . DT  B 1 11  ? 5.745   -18.318 -4.129  1.00 61.21 ? 11  DT  D C7    1 
ATOM   446  C  C6    . DT  B 1 11  ? 4.067   -19.395 -2.590  1.00 64.55 ? 11  DT  D C6    1 
ATOM   447  N  N     . SER C 2 1   ? 6.994   2.892   32.523  1.00 37.49 ? 2   SER A N     1 
ATOM   448  C  CA    . SER C 2 1   ? 6.821   1.594   31.808  1.00 34.70 ? 2   SER A CA    1 
ATOM   449  C  C     . SER C 2 1   ? 7.320   1.756   30.384  1.00 35.55 ? 2   SER A C     1 
ATOM   450  O  O     . SER C 2 1   ? 7.580   2.880   29.936  1.00 34.40 ? 2   SER A O     1 
ATOM   451  C  CB    . SER C 2 1   ? 5.334   1.203   31.778  1.00 35.66 ? 2   SER A CB    1 
ATOM   452  O  OG    . SER C 2 1   ? 4.513   2.260   31.285  1.00 35.60 ? 2   SER A OG    1 
ATOM   453  N  N     . LEU C 2 2   ? 7.462   0.636   29.679  1.00 36.42 ? 3   LEU A N     1 
ATOM   454  C  CA    . LEU C 2 2   ? 7.877   0.662   28.281  1.00 34.20 ? 3   LEU A CA    1 
ATOM   455  C  C     . LEU C 2 2   ? 6.771   1.443   27.551  1.00 31.96 ? 3   LEU A C     1 
ATOM   456  O  O     . LEU C 2 2   ? 7.035   2.329   26.740  1.00 34.18 ? 3   LEU A O     1 
ATOM   457  C  CB    . LEU C 2 2   ? 7.961   -0.767  27.749  1.00 32.41 ? 3   LEU A CB    1 
ATOM   458  C  CG    . LEU C 2 2   ? 8.127   -0.990  26.247  1.00 36.41 ? 3   LEU A CG    1 
ATOM   459  C  CD1   . LEU C 2 2   ? 9.490   -0.517  25.781  1.00 35.38 ? 3   LEU A CD1   1 
ATOM   460  C  CD2   . LEU C 2 2   ? 7.957   -2.466  25.960  1.00 31.91 ? 3   LEU A CD2   1 
ATOM   461  N  N     . ARG C 2 3   ? 5.531   1.113   27.878  1.00 27.58 ? 4   ARG A N     1 
ATOM   462  C  CA    . ARG C 2 3   ? 4.373   1.750   27.284  1.00 27.52 ? 4   ARG A CA    1 
ATOM   463  C  C     . ARG C 2 3   ? 4.309   3.267   27.475  1.00 29.87 ? 4   ARG A C     1 
ATOM   464  O  O     . ARG C 2 3   ? 4.125   3.993   26.500  1.00 32.39 ? 4   ARG A O     1 
ATOM   465  C  CB    . ARG C 2 3   ? 3.108   1.086   27.823  1.00 23.99 ? 4   ARG A CB    1 
ATOM   466  C  CG    . ARG C 2 3   ? 1.824   1.655   27.289  1.00 24.37 ? 4   ARG A CG    1 
ATOM   467  C  CD    . ARG C 2 3   ? 0.698   0.691   27.507  1.00 21.82 ? 4   ARG A CD    1 
ATOM   468  N  NE    . ARG C 2 3   ? -0.583  1.278   27.138  1.00 26.50 ? 4   ARG A NE    1 
ATOM   469  C  CZ    . ARG C 2 3   ? -1.604  0.578   26.659  1.00 22.40 ? 4   ARG A CZ    1 
ATOM   470  N  NH1   . ARG C 2 3   ? -1.481  -0.725  26.479  1.00 32.44 ? 4   ARG A NH1   1 
ATOM   471  N  NH2   . ARG C 2 3   ? -2.744  1.181   26.358  1.00 23.27 ? 4   ARG A NH2   1 
ATOM   472  N  N     . SER C 2 4   ? 4.459   3.755   28.706  1.00 29.71 ? 5   SER A N     1 
ATOM   473  C  CA    . SER C 2 4   ? 4.389   5.203   28.947  1.00 32.01 ? 5   SER A CA    1 
ATOM   474  C  C     . SER C 2 4   ? 5.510   5.967   28.227  1.00 29.06 ? 5   SER A C     1 
ATOM   475  O  O     . SER C 2 4   ? 5.284   7.035   27.650  1.00 28.78 ? 5   SER A O     1 
ATOM   476  C  CB    . SER C 2 4   ? 4.404   5.508   30.458  1.00 32.62 ? 5   SER A CB    1 
ATOM   477  O  OG    . SER C 2 4   ? 5.585   5.028   31.094  1.00 37.89 ? 5   SER A OG    1 
ATOM   478  N  N     . ASP C 2 5   ? 6.712   5.404   28.264  1.00 28.17 ? 6   ASP A N     1 
ATOM   479  C  CA    . ASP C 2 5   ? 7.869   6.003   27.619  1.00 30.20 ? 6   ASP A CA    1 
ATOM   480  C  C     . ASP C 2 5   ? 7.706   6.046   26.106  1.00 28.52 ? 6   ASP A C     1 
ATOM   481  O  O     . ASP C 2 5   ? 8.069   7.029   25.459  1.00 30.18 ? 6   ASP A O     1 
ATOM   482  C  CB    . ASP C 2 5   ? 9.135   5.216   27.968  1.00 35.97 ? 6   ASP A CB    1 
ATOM   483  C  CG    . ASP C 2 5   ? 9.631   5.496   29.372  1.00 38.40 ? 6   ASP A CG    1 
ATOM   484  O  OD1   . ASP C 2 5   ? 9.037   6.348   30.068  1.00 34.82 ? 6   ASP A OD1   1 
ATOM   485  O  OD2   . ASP C 2 5   ? 10.625  4.858   29.774  1.00 39.44 ? 6   ASP A OD2   1 
ATOM   486  N  N     . LEU C 2 6   ? 7.165   4.972   25.547  1.00 28.46 ? 7   LEU A N     1 
ATOM   487  C  CA    . LEU C 2 6   ? 6.939   4.889   24.118  1.00 25.57 ? 7   LEU A CA    1 
ATOM   488  C  C     . LEU C 2 6   ? 5.944   5.967   23.679  1.00 24.36 ? 7   LEU A C     1 
ATOM   489  O  O     . LEU C 2 6   ? 6.212   6.710   22.729  1.00 23.77 ? 7   LEU A O     1 
ATOM   490  C  CB    . LEU C 2 6   ? 6.410   3.503   23.754  1.00 27.58 ? 7   LEU A CB    1 
ATOM   491  C  CG    . LEU C 2 6   ? 6.330   3.198   22.263  1.00 34.03 ? 7   LEU A CG    1 
ATOM   492  C  CD1   . LEU C 2 6   ? 7.705   3.362   21.622  1.00 33.68 ? 7   LEU A CD1   1 
ATOM   493  C  CD2   . LEU C 2 6   ? 5.814   1.782   22.079  1.00 36.48 ? 7   LEU A CD2   1 
ATOM   494  N  N     . ILE C 2 7   ? 4.807   6.069   24.367  1.00 22.10 ? 8   ILE A N     1 
ATOM   495  C  CA    . ILE C 2 7   ? 3.814   7.068   23.998  1.00 27.83 ? 8   ILE A CA    1 
ATOM   496  C  C     . ILE C 2 7   ? 4.312   8.499   24.221  1.00 30.31 ? 8   ILE A C     1 
ATOM   497  O  O     . ILE C 2 7   ? 3.951   9.417   23.473  1.00 31.51 ? 8   ILE A O     1 
ATOM   498  C  CB    . ILE C 2 7   ? 2.452   6.829   24.705  1.00 36.03 ? 8   ILE A CB    1 
ATOM   499  C  CG1   . ILE C 2 7   ? 1.401   7.755   24.094  1.00 49.50 ? 8   ILE A CG1   1 
ATOM   500  C  CG2   . ILE C 2 7   ? 2.550   7.091   26.191  1.00 40.36 ? 8   ILE A CG2   1 
ATOM   501  C  CD1   . ILE C 2 7   ? 1.317   7.674   22.570  1.00 46.53 ? 8   ILE A CD1   1 
ATOM   502  N  N     . ASN C 2 8   ? 5.145   8.696   25.237  1.00 31.54 ? 9   ASN A N     1 
ATOM   503  C  CA    . ASN C 2 8   ? 5.693   10.024  25.492  1.00 28.33 ? 9   ASN A CA    1 
ATOM   504  C  C     . ASN C 2 8   ? 6.669   10.393  24.378  1.00 25.04 ? 9   ASN A C     1 
ATOM   505  O  O     . ASN C 2 8   ? 6.664   11.524  23.891  1.00 26.22 ? 9   ASN A O     1 
ATOM   506  C  CB    . ASN C 2 8   ? 6.386   10.080  26.853  1.00 32.43 ? 9   ASN A CB    1 
ATOM   507  C  CG    . ASN C 2 8   ? 5.431   10.447  27.987  1.00 39.60 ? 9   ASN A CG    1 
ATOM   508  O  OD1   . ASN C 2 8   ? 4.240   10.139  27.948  1.00 42.83 ? 9   ASN A OD1   1 
ATOM   509  N  ND2   . ASN C 2 8   ? 5.959   11.109  29.002  1.00 43.47 ? 9   ASN A ND2   1 
ATOM   510  N  N     . ALA C 2 9   ? 7.496   9.441   23.962  1.00 24.75 ? 10  ALA A N     1 
ATOM   511  C  CA    . ALA C 2 9   ? 8.463   9.693   22.890  1.00 29.01 ? 10  ALA A CA    1 
ATOM   512  C  C     . ALA C 2 9   ? 7.772   10.010  21.557  1.00 33.58 ? 10  ALA A C     1 
ATOM   513  O  O     . ALA C 2 9   ? 8.186   10.929  20.836  1.00 36.11 ? 10  ALA A O     1 
ATOM   514  C  CB    . ALA C 2 9   ? 9.388   8.504   22.724  1.00 20.44 ? 10  ALA A CB    1 
ATOM   515  N  N     . LEU C 2 10  ? 6.721   9.252   21.242  1.00 33.23 ? 11  LEU A N     1 
ATOM   516  C  CA    . LEU C 2 10  ? 5.957   9.433   20.010  1.00 31.10 ? 11  LEU A CA    1 
ATOM   517  C  C     . LEU C 2 10  ? 5.255   10.783  19.986  1.00 29.93 ? 11  LEU A C     1 
ATOM   518  O  O     . LEU C 2 10  ? 5.348   11.517  19.001  1.00 30.67 ? 11  LEU A O     1 
ATOM   519  C  CB    . LEU C 2 10  ? 4.931   8.297   19.834  1.00 32.46 ? 11  LEU A CB    1 
ATOM   520  C  CG    . LEU C 2 10  ? 5.474   6.917   19.410  1.00 31.44 ? 11  LEU A CG    1 
ATOM   521  C  CD1   . LEU C 2 10  ? 4.376   5.888   19.466  1.00 28.46 ? 11  LEU A CD1   1 
ATOM   522  C  CD2   . LEU C 2 10  ? 6.061   6.986   18.009  1.00 31.86 ? 11  LEU A CD2   1 
ATOM   523  N  N     . TYR C 2 11  ? 4.559   11.104  21.072  1.00 30.76 ? 12  TYR A N     1 
ATOM   524  C  CA    . TYR C 2 11  ? 3.833   12.371  21.207  1.00 33.67 ? 12  TYR A CA    1 
ATOM   525  C  C     . TYR C 2 11  ? 4.785   13.555  21.040  1.00 35.72 ? 12  TYR A C     1 
ATOM   526  O  O     . TYR C 2 11  ? 4.487   14.517  20.327  1.00 37.18 ? 12  TYR A O     1 
ATOM   527  C  CB    . TYR C 2 11  ? 3.182   12.448  22.589  1.00 33.08 ? 12  TYR A CB    1 
ATOM   528  C  CG    . TYR C 2 11  ? 2.228   13.602  22.769  1.00 31.07 ? 12  TYR A CG    1 
ATOM   529  C  CD1   . TYR C 2 11  ? 0.982   13.599  22.148  1.00 35.24 ? 12  TYR A CD1   1 
ATOM   530  C  CD2   . TYR C 2 11  ? 2.566   14.697  23.570  1.00 48.27 ? 12  TYR A CD2   1 
ATOM   531  C  CE1   . TYR C 2 11  ? 0.086   14.659  22.316  1.00 41.16 ? 12  TYR A CE1   1 
ATOM   532  C  CE2   . TYR C 2 11  ? 1.677   15.767  23.748  1.00 43.94 ? 12  TYR A CE2   1 
ATOM   533  C  CZ    . TYR C 2 11  ? 0.438   15.740  23.117  1.00 45.76 ? 12  TYR A CZ    1 
ATOM   534  O  OH    . TYR C 2 11  ? -0.453  16.782  23.282  1.00 45.18 ? 12  TYR A OH    1 
ATOM   535  N  N     . ASP C 2 12  ? 5.927   13.462  21.712  1.00 34.37 ? 13  ASP A N     1 
ATOM   536  C  CA    . ASP C 2 12  ? 6.967   14.485  21.684  1.00 34.66 ? 13  ASP A CA    1 
ATOM   537  C  C     . ASP C 2 12  ? 7.589   14.641  20.286  1.00 35.58 ? 13  ASP A C     1 
ATOM   538  O  O     . ASP C 2 12  ? 7.621   15.737  19.718  1.00 33.93 ? 13  ASP A O     1 
ATOM   539  C  CB    . ASP C 2 12  ? 8.057   14.117  22.709  1.00 33.17 ? 13  ASP A CB    1 
ATOM   540  C  CG    . ASP C 2 12  ? 9.200   15.121  22.750  1.00 38.11 ? 13  ASP A CG    1 
ATOM   541  O  OD1   . ASP C 2 12  ? 8.927   16.328  22.937  1.00 39.40 ? 13  ASP A OD1   1 
ATOM   542  O  OD2   . ASP C 2 12  ? 10.369  14.699  22.595  1.00 41.82 ? 13  ASP A OD2   1 
ATOM   543  N  N     . GLU C 2 13  ? 8.081   13.536  19.738  1.00 37.92 ? 14  GLU A N     1 
ATOM   544  C  CA    . GLU C 2 13  ? 8.714   13.545  18.428  1.00 40.10 ? 14  GLU A CA    1 
ATOM   545  C  C     . GLU C 2 13  ? 7.757   14.057  17.349  1.00 41.97 ? 14  GLU A C     1 
ATOM   546  O  O     . GLU C 2 13  ? 8.157   14.803  16.449  1.00 44.51 ? 14  GLU A O     1 
ATOM   547  C  CB    . GLU C 2 13  ? 9.182   12.140  18.076  1.00 39.93 ? 14  GLU A CB    1 
ATOM   548  C  CG    . GLU C 2 13  ? 10.235  12.091  16.986  1.00 53.53 ? 14  GLU A CG    1 
ATOM   549  C  CD    . GLU C 2 13  ? 11.625  12.430  17.489  1.00 60.70 ? 14  GLU A CD    1 
ATOM   550  O  OE1   . GLU C 2 13  ? 11.808  12.591  18.718  1.00 66.65 ? 14  GLU A OE1   1 
ATOM   551  O  OE2   . GLU C 2 13  ? 12.541  12.532  16.647  1.00 68.59 ? 14  GLU A OE2   1 
ATOM   552  N  N     . ASN C 2 14  ? 6.492   13.664  17.454  1.00 41.84 ? 15  ASN A N     1 
ATOM   553  C  CA    . ASN C 2 14  ? 5.474   14.056  16.490  1.00 43.60 ? 15  ASN A CA    1 
ATOM   554  C  C     . ASN C 2 14  ? 5.208   15.558  16.425  1.00 47.48 ? 15  ASN A C     1 
ATOM   555  O  O     . ASN C 2 14  ? 4.718   16.069  15.416  1.00 47.59 ? 15  ASN A O     1 
ATOM   556  C  CB    . ASN C 2 14  ? 4.170   13.332  16.793  1.00 42.33 ? 15  ASN A CB    1 
ATOM   557  C  CG    . ASN C 2 14  ? 3.146   13.529  15.710  1.00 52.52 ? 15  ASN A CG    1 
ATOM   558  O  OD1   . ASN C 2 14  ? 3.347   13.085  14.577  1.00 57.29 ? 15  ASN A OD1   1 
ATOM   559  N  ND2   . ASN C 2 14  ? 2.040   14.195  16.042  1.00 46.63 ? 15  ASN A ND2   1 
ATOM   560  N  N     . GLN C 2 15  ? 5.528   16.270  17.497  1.00 50.55 ? 16  GLN A N     1 
ATOM   561  C  CA    . GLN C 2 15  ? 5.300   17.705  17.530  1.00 52.58 ? 16  GLN A CA    1 
ATOM   562  C  C     . GLN C 2 15  ? 6.515   18.520  17.116  1.00 53.98 ? 16  GLN A C     1 
ATOM   563  O  O     . GLN C 2 15  ? 6.381   19.605  16.561  1.00 56.61 ? 16  GLN A O     1 
ATOM   564  C  CB    . GLN C 2 15  ? 4.836   18.116  18.920  1.00 48.94 ? 16  GLN A CB    1 
ATOM   565  C  CG    . GLN C 2 15  ? 3.500   17.512  19.281  1.00 56.07 ? 16  GLN A CG    1 
ATOM   566  C  CD    . GLN C 2 15  ? 3.123   17.753  20.719  1.00 60.76 ? 16  GLN A CD    1 
ATOM   567  O  OE1   . GLN C 2 15  ? 3.986   17.915  21.578  1.00 68.40 ? 16  GLN A OE1   1 
ATOM   568  N  NE2   . GLN C 2 15  ? 1.827   17.776  20.993  1.00 60.50 ? 16  GLN A NE2   1 
ATOM   569  N  N     . LYS C 2 16  ? 7.703   17.995  17.376  1.00 57.82 ? 17  LYS A N     1 
ATOM   570  C  CA    . LYS C 2 16  ? 8.924   18.712  17.044  1.00 62.69 ? 17  LYS A CA    1 
ATOM   571  C  C     . LYS C 2 16  ? 9.475   18.468  15.638  1.00 65.66 ? 17  LYS A C     1 
ATOM   572  O  O     . LYS C 2 16  ? 10.455  19.110  15.241  1.00 65.68 ? 17  LYS A O     1 
ATOM   573  C  CB    . LYS C 2 16  ? 9.997   18.408  18.098  1.00 65.46 ? 17  LYS A CB    1 
ATOM   574  C  CG    . LYS C 2 16  ? 9.645   18.945  19.482  1.00 69.55 ? 17  LYS A CG    1 
ATOM   575  C  CD    . LYS C 2 16  ? 10.654  18.529  20.539  1.00 78.98 ? 17  LYS A CD    1 
ATOM   576  C  CE    . LYS C 2 16  ? 10.310  19.152  21.892  1.00 77.80 ? 17  LYS A CE    1 
ATOM   577  N  NZ    . LYS C 2 16  ? 11.201  18.677  22.991  1.00 72.60 ? 17  LYS A NZ    1 
ATOM   578  N  N     . TYR C 2 17  ? 8.860   17.559  14.880  1.00 65.47 ? 18  TYR A N     1 
ATOM   579  C  CA    . TYR C 2 17  ? 9.348   17.253  13.533  1.00 64.27 ? 18  TYR A CA    1 
ATOM   580  C  C     . TYR C 2 17  ? 8.262   17.144  12.466  1.00 61.55 ? 18  TYR A C     1 
ATOM   581  O  O     . TYR C 2 17  ? 7.118   16.800  12.762  1.00 62.29 ? 18  TYR A O     1 
ATOM   582  C  CB    . TYR C 2 17  ? 10.198  15.965  13.553  1.00 67.75 ? 18  TYR A CB    1 
ATOM   583  C  CG    . TYR C 2 17  ? 11.552  16.124  14.232  1.00 72.99 ? 18  TYR A CG    1 
ATOM   584  C  CD1   . TYR C 2 17  ? 12.663  16.593  13.522  1.00 75.20 ? 18  TYR A CD1   1 
ATOM   585  C  CD2   . TYR C 2 17  ? 11.719  15.825  15.587  1.00 73.77 ? 18  TYR A CD2   1 
ATOM   586  C  CE1   . TYR C 2 17  ? 13.905  16.764  14.142  1.00 78.93 ? 18  TYR A CE1   1 
ATOM   587  C  CE2   . TYR C 2 17  ? 12.960  15.994  16.217  1.00 78.58 ? 18  TYR A CE2   1 
ATOM   588  C  CZ    . TYR C 2 17  ? 14.046  16.463  15.488  1.00 79.92 ? 18  TYR A CZ    1 
ATOM   589  O  OH    . TYR C 2 17  ? 15.268  16.634  16.105  1.00 79.86 ? 18  TYR A OH    1 
ATOM   590  N  N     . ASP C 2 18  ? 8.642   17.444  11.225  1.00 55.73 ? 19  ASP A N     1 
ATOM   591  C  CA    . ASP C 2 18  ? 7.735   17.392  10.082  1.00 50.02 ? 19  ASP A CA    1 
ATOM   592  C  C     . ASP C 2 18  ? 8.443   16.838  8.853   1.00 45.54 ? 19  ASP A C     1 
ATOM   593  O  O     . ASP C 2 18  ? 9.382   17.453  8.347   1.00 43.93 ? 19  ASP A O     1 
ATOM   594  C  CB    . ASP C 2 18  ? 7.206   18.789  9.762   1.00 55.70 ? 19  ASP A CB    1 
ATOM   595  C  CG    . ASP C 2 18  ? 5.881   19.093  10.449  1.00 66.08 ? 19  ASP A CG    1 
ATOM   596  O  OD1   . ASP C 2 18  ? 5.665   18.628  11.591  1.00 72.04 ? 19  ASP A OD1   1 
ATOM   597  O  OD2   . ASP C 2 18  ? 5.051   19.804  9.837   1.00 69.61 ? 19  ASP A OD2   1 
ATOM   598  N  N     . VAL C 2 19  ? 7.997   15.678  8.379   1.00 40.36 ? 20  VAL A N     1 
ATOM   599  C  CA    . VAL C 2 19  ? 8.592   15.044  7.199   1.00 36.53 ? 20  VAL A CA    1 
ATOM   600  C  C     . VAL C 2 19  ? 8.107   15.781  5.946   1.00 32.03 ? 20  VAL A C     1 
ATOM   601  O  O     . VAL C 2 19  ? 6.918   16.059  5.806   1.00 28.91 ? 20  VAL A O     1 
ATOM   602  C  CB    . VAL C 2 19  ? 8.204   13.542  7.108   1.00 33.53 ? 20  VAL A CB    1 
ATOM   603  C  CG1   . VAL C 2 19  ? 8.701   12.951  5.789   1.00 32.22 ? 20  VAL A CG1   1 
ATOM   604  C  CG2   . VAL C 2 19  ? 8.810   12.770  8.276   1.00 30.86 ? 20  VAL A CG2   1 
ATOM   605  N  N     . CYS C 2 20  ? 9.011   16.100  5.031   1.00 29.90 ? 21  CYS A N     1 
ATOM   606  C  CA    . CYS C 2 20  ? 8.587   16.831  3.845   1.00 31.98 ? 21  CYS A CA    1 
ATOM   607  C  C     . CYS C 2 20  ? 9.007   16.243  2.503   1.00 31.23 ? 21  CYS A C     1 
ATOM   608  O  O     . CYS C 2 20  ? 8.681   16.802  1.455   1.00 31.57 ? 21  CYS A O     1 
ATOM   609  C  CB    . CYS C 2 20  ? 9.047   18.288  3.953   1.00 35.44 ? 21  CYS A CB    1 
ATOM   610  S  SG    . CYS C 2 20  ? 10.816  18.460  4.205   1.00 36.01 ? 21  CYS A SG    1 
ATOM   611  N  N     . GLY C 2 21  ? 9.724   15.126  2.521   1.00 28.53 ? 22  GLY A N     1 
ATOM   612  C  CA    . GLY C 2 21  ? 10.125  14.518  1.267   1.00 28.56 ? 22  GLY A CA    1 
ATOM   613  C  C     . GLY C 2 21  ? 11.133  13.394  1.387   1.00 26.94 ? 22  GLY A C     1 
ATOM   614  O  O     . GLY C 2 21  ? 11.617  13.093  2.476   1.00 27.82 ? 22  GLY A O     1 
ATOM   615  N  N     . ILE C 2 22  ? 11.435  12.762  0.261   1.00 25.40 ? 23  ILE A N     1 
ATOM   616  C  CA    . ILE C 2 22  ? 12.411  11.688  0.227   1.00 26.86 ? 23  ILE A CA    1 
ATOM   617  C  C     . ILE C 2 22  ? 13.650  12.323  -0.363  1.00 25.31 ? 23  ILE A C     1 
ATOM   618  O  O     . ILE C 2 22  ? 13.562  13.164  -1.260  1.00 24.50 ? 23  ILE A O     1 
ATOM   619  C  CB    . ILE C 2 22  ? 11.941  10.463  -0.627  1.00 32.84 ? 23  ILE A CB    1 
ATOM   620  C  CG1   . ILE C 2 22  ? 11.680  10.867  -2.080  1.00 41.50 ? 23  ILE A CG1   1 
ATOM   621  C  CG2   . ILE C 2 22  ? 10.684  9.862   -0.015  1.00 28.02 ? 23  ILE A CG2   1 
ATOM   622  C  CD1   . ILE C 2 22  ? 11.288  9.702   -2.992  1.00 54.31 ? 23  ILE A CD1   1 
ATOM   623  N  N     . ILE C 2 23  ? 14.805  11.928  0.145   1.00 24.73 ? 24  ILE A N     1 
ATOM   624  C  CA    . ILE C 2 23  ? 16.049  12.505  -0.311  1.00 26.66 ? 24  ILE A CA    1 
ATOM   625  C  C     . ILE C 2 23  ? 16.910  11.465  -1.014  1.00 26.70 ? 24  ILE A C     1 
ATOM   626  O  O     . ILE C 2 23  ? 16.926  10.289  -0.622  1.00 25.28 ? 24  ILE A O     1 
ATOM   627  C  CB    . ILE C 2 23  ? 16.819  13.140  0.898   1.00 28.43 ? 24  ILE A CB    1 
ATOM   628  C  CG1   . ILE C 2 23  ? 18.023  13.947  0.417   1.00 26.96 ? 24  ILE A CG1   1 
ATOM   629  C  CG2   . ILE C 2 23  ? 17.268  12.058  1.868   1.00 23.57 ? 24  ILE A CG2   1 
ATOM   630  C  CD1   . ILE C 2 23  ? 18.650  14.792  1.493   1.00 28.98 ? 24  ILE A CD1   1 
ATOM   631  N  N     . SER C 2 24  ? 17.607  11.903  -2.063  1.00 25.73 ? 25  SER A N     1 
ATOM   632  C  CA    . SER C 2 24  ? 18.510  11.035  -2.801  1.00 31.77 ? 25  SER A CA    1 
ATOM   633  C  C     . SER C 2 24  ? 19.921  11.292  -2.238  1.00 33.81 ? 25  SER A C     1 
ATOM   634  O  O     . SER C 2 24  ? 20.182  12.364  -1.677  1.00 32.27 ? 25  SER A O     1 
ATOM   635  C  CB    . SER C 2 24  ? 18.447  11.342  -4.311  1.00 32.37 ? 25  SER A CB    1 
ATOM   636  O  OG    . SER C 2 24  ? 19.255  12.449  -4.680  1.00 35.72 ? 25  SER A OG    1 
ATOM   637  N  N     . ALA C 2 25  ? 20.821  10.321  -2.380  1.00 35.99 ? 26  ALA A N     1 
ATOM   638  C  CA    . ALA C 2 25  ? 22.195  10.454  -1.886  1.00 38.28 ? 26  ALA A CA    1 
ATOM   639  C  C     . ALA C 2 25  ? 22.923  11.621  -2.560  1.00 41.36 ? 26  ALA A C     1 
ATOM   640  O  O     . ALA C 2 25  ? 23.932  12.125  -2.055  1.00 41.85 ? 26  ALA A O     1 
ATOM   641  C  CB    . ALA C 2 25  ? 22.959  9.154   -2.111  1.00 36.74 ? 26  ALA A CB    1 
ATOM   642  N  N     . GLU C 2 26  ? 22.395  12.041  -3.705  1.00 44.37 ? 27  GLU A N     1 
ATOM   643  C  CA    . GLU C 2 26  ? 22.952  13.145  -4.479  1.00 45.51 ? 27  GLU A CA    1 
ATOM   644  C  C     . GLU C 2 26  ? 22.405  14.481  -3.968  1.00 45.02 ? 27  GLU A C     1 
ATOM   645  O  O     . GLU C 2 26  ? 22.651  15.530  -4.562  1.00 45.99 ? 27  GLU A O     1 
ATOM   646  C  CB    . GLU C 2 26  ? 22.612  12.964  -5.966  1.00 50.07 ? 27  GLU A CB    1 
ATOM   647  C  CG    . GLU C 2 26  ? 23.181  11.679  -6.614  1.00 55.07 ? 27  GLU A CG    1 
ATOM   648  C  CD    . GLU C 2 26  ? 22.513  10.378  -6.135  1.00 55.33 ? 27  GLU A CD    1 
ATOM   649  O  OE1   . GLU C 2 26  ? 21.324  10.403  -5.741  1.00 58.18 ? 27  GLU A OE1   1 
ATOM   650  O  OE2   . GLU C 2 26  ? 23.186  9.322   -6.156  1.00 48.73 ? 27  GLU A OE2   1 
ATOM   651  N  N     . GLY C 2 27  ? 21.649  14.426  -2.872  1.00 42.52 ? 28  GLY A N     1 
ATOM   652  C  CA    . GLY C 2 27  ? 21.098  15.624  -2.266  1.00 40.75 ? 28  GLY A CA    1 
ATOM   653  C  C     . GLY C 2 27  ? 19.828  16.200  -2.865  1.00 40.24 ? 28  GLY A C     1 
ATOM   654  O  O     . GLY C 2 27  ? 19.388  17.279  -2.456  1.00 39.47 ? 28  GLY A O     1 
ATOM   655  N  N     . LYS C 2 28  ? 19.229  15.502  -3.824  1.00 37.87 ? 29  LYS A N     1 
ATOM   656  C  CA    . LYS C 2 28  ? 18.007  16.001  -4.444  1.00 38.23 ? 29  LYS A CA    1 
ATOM   657  C  C     . LYS C 2 28  ? 16.822  15.571  -3.566  1.00 36.20 ? 29  LYS A C     1 
ATOM   658  O  O     . LYS C 2 28  ? 16.808  14.455  -3.040  1.00 38.23 ? 29  LYS A O     1 
ATOM   659  C  CB    . LYS C 2 28  ? 17.885  15.440  -5.865  1.00 42.16 ? 29  LYS A CB    1 
ATOM   660  C  CG    . LYS C 2 28  ? 17.195  16.354  -6.856  1.00 48.37 ? 29  LYS A CG    1 
ATOM   661  C  CD    . LYS C 2 28  ? 17.157  15.708  -8.234  1.00 60.62 ? 29  LYS A CD    1 
ATOM   662  C  CE    . LYS C 2 28  ? 16.410  16.579  -9.237  1.00 66.34 ? 29  LYS A CE    1 
ATOM   663  N  NZ    . LYS C 2 28  ? 16.160  15.894  -10.550 1.00 60.64 ? 29  LYS A NZ    1 
ATOM   664  N  N     . ILE C 2 29  ? 15.840  16.449  -3.396  1.00 30.60 ? 30  ILE A N     1 
ATOM   665  C  CA    . ILE C 2 29  ? 14.682  16.137  -2.565  1.00 29.35 ? 30  ILE A CA    1 
ATOM   666  C  C     . ILE C 2 29  ? 13.391  16.087  -3.382  1.00 30.17 ? 30  ILE A C     1 
ATOM   667  O  O     . ILE C 2 29  ? 13.153  16.955  -4.228  1.00 27.45 ? 30  ILE A O     1 
ATOM   668  C  CB    . ILE C 2 29  ? 14.521  17.181  -1.445  1.00 29.16 ? 30  ILE A CB    1 
ATOM   669  C  CG1   . ILE C 2 29  ? 15.830  17.298  -0.663  1.00 29.37 ? 30  ILE A CG1   1 
ATOM   670  C  CG2   . ILE C 2 29  ? 13.355  16.796  -0.521  1.00 26.29 ? 30  ILE A CG2   1 
ATOM   671  C  CD1   . ILE C 2 29  ? 15.846  18.437  0.326   1.00 33.32 ? 30  ILE A CD1   1 
ATOM   672  N  N     . TYR C 2 30  ? 12.565  15.074  -3.129  1.00 27.99 ? 31  TYR A N     1 
ATOM   673  C  CA    . TYR C 2 30  ? 11.298  14.911  -3.839  1.00 27.19 ? 31  TYR A CA    1 
ATOM   674  C  C     . TYR C 2 30  ? 10.141  15.063  -2.851  1.00 26.42 ? 31  TYR A C     1 
ATOM   675  O  O     . TYR C 2 30  ? 10.132  14.422  -1.802  1.00 30.11 ? 31  TYR A O     1 
ATOM   676  C  CB    . TYR C 2 30  ? 11.239  13.532  -4.519  1.00 24.56 ? 31  TYR A CB    1 
ATOM   677  C  CG    . TYR C 2 30  ? 12.389  13.263  -5.470  1.00 28.59 ? 31  TYR A CG    1 
ATOM   678  C  CD1   . TYR C 2 30  ? 13.665  12.944  -4.985  1.00 21.55 ? 31  TYR A CD1   1 
ATOM   679  C  CD2   . TYR C 2 30  ? 12.212  13.347  -6.857  1.00 27.17 ? 31  TYR A CD2   1 
ATOM   680  C  CE1   . TYR C 2 30  ? 14.740  12.717  -5.861  1.00 27.11 ? 31  TYR A CE1   1 
ATOM   681  C  CE2   . TYR C 2 30  ? 13.282  13.122  -7.741  1.00 22.47 ? 31  TYR A CE2   1 
ATOM   682  C  CZ    . TYR C 2 30  ? 14.539  12.809  -7.234  1.00 26.13 ? 31  TYR A CZ    1 
ATOM   683  O  OH    . TYR C 2 30  ? 15.596  12.603  -8.089  1.00 29.63 ? 31  TYR A OH    1 
ATOM   684  N  N     . PRO C 2 31  ? 9.156   15.922  -3.167  1.00 27.77 ? 32  PRO A N     1 
ATOM   685  C  CA    . PRO C 2 31  ? 7.966   16.197  -2.344  1.00 26.27 ? 32  PRO A CA    1 
ATOM   686  C  C     . PRO C 2 31  ? 7.076   14.982  -2.118  1.00 27.02 ? 32  PRO A C     1 
ATOM   687  O  O     . PRO C 2 31  ? 7.158   13.995  -2.849  1.00 26.01 ? 32  PRO A O     1 
ATOM   688  C  CB    . PRO C 2 31  ? 7.223   17.257  -3.154  1.00 25.19 ? 32  PRO A CB    1 
ATOM   689  C  CG    . PRO C 2 31  ? 8.311   17.921  -3.925  1.00 30.27 ? 32  PRO A CG    1 
ATOM   690  C  CD    . PRO C 2 31  ? 9.131   16.749  -4.383  1.00 27.97 ? 32  PRO A CD    1 
ATOM   691  N  N     . LEU C 2 32  ? 6.212   15.067  -1.111  1.00 27.24 ? 33  LEU A N     1 
ATOM   692  C  CA    . LEU C 2 32  ? 5.298   13.978  -0.781  1.00 27.48 ? 33  LEU A CA    1 
ATOM   693  C  C     . LEU C 2 32  ? 3.895   14.209  -1.350  1.00 28.20 ? 33  LEU A C     1 
ATOM   694  O  O     . LEU C 2 32  ? 3.478   15.350  -1.546  1.00 30.34 ? 33  LEU A O     1 
ATOM   695  C  CB    . LEU C 2 32  ? 5.195   13.816  0.742   1.00 25.72 ? 33  LEU A CB    1 
ATOM   696  C  CG    . LEU C 2 32  ? 6.460   13.549  1.556   1.00 33.00 ? 33  LEU A CG    1 
ATOM   697  C  CD1   . LEU C 2 32  ? 6.100   13.513  3.028   1.00 35.71 ? 33  LEU A CD1   1 
ATOM   698  C  CD2   . LEU C 2 32  ? 7.107   12.250  1.125   1.00 30.17 ? 33  LEU A CD2   1 
ATOM   699  N  N     . GLY C 2 33  ? 3.183   13.112  -1.610  1.00 28.97 ? 34  GLY A N     1 
ATOM   700  C  CA    . GLY C 2 33  ? 1.818   13.166  -2.117  1.00 29.65 ? 34  GLY A CA    1 
ATOM   701  C  C     . GLY C 2 33  ? 0.838   13.117  -0.949  1.00 32.69 ? 34  GLY A C     1 
ATOM   702  O  O     . GLY C 2 33  ? 1.224   12.787  0.177   1.00 29.79 ? 34  GLY A O     1 
ATOM   703  N  N     . SER C 2 34  ? -0.429  13.426  -1.211  1.00 36.23 ? 35  SER A N     1 
ATOM   704  C  CA    . SER C 2 34  ? -1.456  13.478  -0.163  1.00 41.87 ? 35  SER A CA    1 
ATOM   705  C  C     . SER C 2 34  ? -2.265  12.226  0.219   1.00 43.34 ? 35  SER A C     1 
ATOM   706  O  O     . SER C 2 34  ? -3.062  12.276  1.162   1.00 46.65 ? 35  SER A O     1 
ATOM   707  C  CB    . SER C 2 34  ? -2.427  14.620  -0.492  1.00 46.48 ? 35  SER A CB    1 
ATOM   708  O  OG    . SER C 2 34  ? -2.804  14.581  -1.865  1.00 53.27 ? 35  SER A OG    1 
ATOM   709  N  N     . ASP C 2 35  ? -2.087  11.113  -0.487  1.00 42.74 ? 36  ASP A N     1 
ATOM   710  C  CA    . ASP C 2 35  ? -2.857  9.917   -0.154  1.00 41.46 ? 36  ASP A CA    1 
ATOM   711  C  C     . ASP C 2 35  ? -2.241  9.070   0.977   1.00 37.55 ? 36  ASP A C     1 
ATOM   712  O  O     . ASP C 2 35  ? -1.026  9.108   1.213   1.00 39.05 ? 36  ASP A O     1 
ATOM   713  C  CB    . ASP C 2 35  ? -3.180  9.092   -1.423  1.00 48.17 ? 36  ASP A CB    1 
ATOM   714  C  CG    . ASP C 2 35  ? -1.945  8.636   -2.186  1.00 53.91 ? 36  ASP A CG    1 
ATOM   715  O  OD1   . ASP C 2 35  ? -0.929  9.361   -2.208  1.00 59.24 ? 36  ASP A OD1   1 
ATOM   716  O  OD2   . ASP C 2 35  ? -2.000  7.535   -2.777  1.00 62.80 ? 36  ASP A OD2   1 
ATOM   717  N  N     . THR C 2 36  ? -3.089  8.309   1.667   1.00 32.38 ? 37  THR A N     1 
ATOM   718  C  CA    . THR C 2 36  ? -2.667  7.499   2.809   1.00 28.94 ? 37  THR A CA    1 
ATOM   719  C  C     . THR C 2 36  ? -1.572  6.488   2.514   1.00 29.03 ? 37  THR A C     1 
ATOM   720  O  O     . THR C 2 36  ? -0.738  6.235   3.383   1.00 27.00 ? 37  THR A O     1 
ATOM   721  C  CB    . THR C 2 36  ? -3.873  6.786   3.490   1.00 30.19 ? 37  THR A CB    1 
ATOM   722  O  OG1   . THR C 2 36  ? -4.954  7.717   3.624   1.00 25.26 ? 37  THR A OG1   1 
ATOM   723  C  CG2   . THR C 2 36  ? -3.499  6.283   4.895   1.00 23.45 ? 37  THR A CG2   1 
ATOM   724  N  N     . LYS C 2 37  ? -1.553  5.914   1.310   1.00 28.49 ? 38  LYS A N     1 
ATOM   725  C  CA    . LYS C 2 37  ? -0.509  4.942   0.977   1.00 28.51 ? 38  LYS A CA    1 
ATOM   726  C  C     . LYS C 2 37  ? 0.855   5.580   1.221   1.00 25.50 ? 38  LYS A C     1 
ATOM   727  O  O     . LYS C 2 37  ? 1.766   4.945   1.743   1.00 29.21 ? 38  LYS A O     1 
ATOM   728  C  CB    . LYS C 2 37  ? -0.606  4.490   -0.483  1.00 35.56 ? 38  LYS A CB    1 
ATOM   729  C  CG    . LYS C 2 37  ? 0.335   3.337   -0.813  1.00 46.77 ? 38  LYS A CG    1 
ATOM   730  C  CD    . LYS C 2 37  ? 0.611   3.222   -2.306  1.00 58.92 ? 38  LYS A CD    1 
ATOM   731  C  CE    . LYS C 2 37  ? 1.550   2.046   -2.600  1.00 68.78 ? 38  LYS A CE    1 
ATOM   732  N  NZ    . LYS C 2 37  ? 0.924   0.705   -2.341  1.00 70.79 ? 38  LYS A NZ    1 
ATOM   733  N  N     . VAL C 2 38  ? 0.984   6.847   0.849   1.00 20.88 ? 39  VAL A N     1 
ATOM   734  C  CA    . VAL C 2 38  ? 2.234   7.559   1.034   1.00 22.81 ? 39  VAL A CA    1 
ATOM   735  C  C     . VAL C 2 38  ? 2.502   7.881   2.510   1.00 21.15 ? 39  VAL A C     1 
ATOM   736  O  O     . VAL C 2 38  ? 3.556   7.546   3.049   1.00 16.45 ? 39  VAL A O     1 
ATOM   737  C  CB    . VAL C 2 38  ? 2.248   8.860   0.182   1.00 26.40 ? 39  VAL A CB    1 
ATOM   738  C  CG1   . VAL C 2 38  ? 3.403   9.770   0.606   1.00 26.81 ? 39  VAL A CG1   1 
ATOM   739  C  CG2   . VAL C 2 38  ? 2.382   8.495   -1.297  1.00 26.22 ? 39  VAL A CG2   1 
ATOM   740  N  N     . LEU C 2 39  ? 1.543   8.524   3.162   1.00 22.26 ? 40  LEU A N     1 
ATOM   741  C  CA    . LEU C 2 39  ? 1.708   8.888   4.562   1.00 27.96 ? 40  LEU A CA    1 
ATOM   742  C  C     . LEU C 2 39  ? 1.870   7.699   5.491   1.00 26.94 ? 40  LEU A C     1 
ATOM   743  O  O     . LEU C 2 39  ? 2.606   7.778   6.473   1.00 26.85 ? 40  LEU A O     1 
ATOM   744  C  CB    . LEU C 2 39  ? 0.565   9.800   4.990   1.00 28.33 ? 40  LEU A CB    1 
ATOM   745  C  CG    . LEU C 2 39  ? 0.854   11.131  4.292   1.00 37.90 ? 40  LEU A CG    1 
ATOM   746  C  CD1   . LEU C 2 39  ? -0.391  11.958  4.109   1.00 34.84 ? 40  LEU A CD1   1 
ATOM   747  C  CD2   . LEU C 2 39  ? 1.918   11.871  5.089   1.00 37.52 ? 40  LEU A CD2   1 
ATOM   748  N  N     . SER C 2 40  ? 1.200   6.598   5.173   1.00 26.12 ? 41  SER A N     1 
ATOM   749  C  CA    . SER C 2 40  ? 1.300   5.373   5.963   1.00 25.27 ? 41  SER A CA    1 
ATOM   750  C  C     . SER C 2 40  ? 2.777   4.949   5.992   1.00 25.46 ? 41  SER A C     1 
ATOM   751  O  O     . SER C 2 40  ? 3.348   4.686   7.054   1.00 25.49 ? 41  SER A O     1 
ATOM   752  C  CB    . SER C 2 40  ? 0.438   4.278   5.322   1.00 26.17 ? 41  SER A CB    1 
ATOM   753  O  OG    . SER C 2 40  ? 0.618   3.031   5.959   1.00 39.32 ? 41  SER A OG    1 
ATOM   754  N  N     . THR C 2 41  ? 3.384   4.896   4.810   1.00 25.57 ? 42  THR A N     1 
ATOM   755  C  CA    . THR C 2 41  ? 4.787   4.532   4.643   1.00 25.78 ? 42  THR A CA    1 
ATOM   756  C  C     . THR C 2 41  ? 5.702   5.485   5.413   1.00 24.44 ? 42  THR A C     1 
ATOM   757  O  O     . THR C 2 41  ? 6.665   5.057   6.056   1.00 24.03 ? 42  THR A O     1 
ATOM   758  C  CB    . THR C 2 41  ? 5.156   4.558   3.139   1.00 25.03 ? 42  THR A CB    1 
ATOM   759  O  OG1   . THR C 2 41  ? 4.567   3.426   2.492   1.00 32.30 ? 42  THR A OG1   1 
ATOM   760  C  CG2   . THR C 2 41  ? 6.650   4.545   2.934   1.00 25.92 ? 42  THR A CG2   1 
ATOM   761  N  N     . ILE C 2 42  ? 5.395   6.776   5.346   1.00 25.73 ? 43  ILE A N     1 
ATOM   762  C  CA    . ILE C 2 42  ? 6.188   7.790   6.039   1.00 25.47 ? 43  ILE A CA    1 
ATOM   763  C  C     . ILE C 2 42  ? 6.104   7.626   7.568   1.00 23.68 ? 43  ILE A C     1 
ATOM   764  O  O     . ILE C 2 42  ? 7.134   7.593   8.246   1.00 23.50 ? 43  ILE A O     1 
ATOM   765  C  CB    . ILE C 2 42  ? 5.780   9.233   5.571   1.00 29.23 ? 43  ILE A CB    1 
ATOM   766  C  CG1   . ILE C 2 42  ? 6.792   9.760   4.547   1.00 28.18 ? 43  ILE A CG1   1 
ATOM   767  C  CG2   . ILE C 2 42  ? 5.743   10.207  6.730   1.00 38.09 ? 43  ILE A CG2   1 
ATOM   768  C  CD1   . ILE C 2 42  ? 6.932   8.924   3.303   1.00 23.99 ? 43  ILE A CD1   1 
ATOM   769  N  N     . PHE C 2 43  ? 4.895   7.502   8.109   1.00 21.58 ? 44  PHE A N     1 
ATOM   770  C  CA    . PHE C 2 43  ? 4.740   7.345   9.555   1.00 24.16 ? 44  PHE A CA    1 
ATOM   771  C  C     . PHE C 2 43  ? 5.416   6.094   10.093  1.00 24.84 ? 44  PHE A C     1 
ATOM   772  O  O     . PHE C 2 43  ? 5.905   6.100   11.216  1.00 28.16 ? 44  PHE A O     1 
ATOM   773  C  CB    . PHE C 2 43  ? 3.268   7.373   9.954   1.00 20.34 ? 44  PHE A CB    1 
ATOM   774  C  CG    . PHE C 2 43  ? 2.602   8.702   9.708   1.00 20.86 ? 44  PHE A CG    1 
ATOM   775  C  CD1   . PHE C 2 43  ? 3.300   9.888   9.884   1.00 21.45 ? 44  PHE A CD1   1 
ATOM   776  C  CD2   . PHE C 2 43  ? 1.282   8.765   9.281   1.00 26.03 ? 44  PHE A CD2   1 
ATOM   777  C  CE1   . PHE C 2 43  ? 2.693   11.118  9.634   1.00 19.24 ? 44  PHE A CE1   1 
ATOM   778  C  CE2   . PHE C 2 43  ? 0.666   9.984   9.028   1.00 23.98 ? 44  PHE A CE2   1 
ATOM   779  C  CZ    . PHE C 2 43  ? 1.372   11.164  9.205   1.00 25.73 ? 44  PHE A CZ    1 
ATOM   780  N  N     . GLU C 2 44  ? 5.451   5.026   9.300   1.00 24.58 ? 45  GLU A N     1 
ATOM   781  C  CA    . GLU C 2 44  ? 6.110   3.800   9.729   1.00 23.77 ? 45  GLU A CA    1 
ATOM   782  C  C     . GLU C 2 44  ? 7.603   4.024   9.807   1.00 24.28 ? 45  GLU A C     1 
ATOM   783  O  O     . GLU C 2 44  ? 8.232   3.696   10.813  1.00 23.27 ? 45  GLU A O     1 
ATOM   784  C  CB    . GLU C 2 44  ? 5.827   2.649   8.772   1.00 34.61 ? 45  GLU A CB    1 
ATOM   785  C  CG    . GLU C 2 44  ? 4.626   1.814   9.151   1.00 50.68 ? 45  GLU A CG    1 
ATOM   786  C  CD    . GLU C 2 44  ? 4.524   0.552   8.327   1.00 63.71 ? 45  GLU A CD    1 
ATOM   787  O  OE1   . GLU C 2 44  ? 5.348   -0.365  8.543   1.00 67.58 ? 45  GLU A OE1   1 
ATOM   788  O  OE2   . GLU C 2 44  ? 3.621   0.481   7.464   1.00 73.01 ? 45  GLU A OE2   1 
ATOM   789  N  N     . LEU C 2 45  ? 8.174   4.585   8.742   1.00 24.41 ? 46  LEU A N     1 
ATOM   790  C  CA    . LEU C 2 45  ? 9.612   4.867   8.697   1.00 26.64 ? 46  LEU A CA    1 
ATOM   791  C  C     . LEU C 2 45  ? 10.008  5.820   9.826   1.00 25.58 ? 46  LEU A C     1 
ATOM   792  O  O     . LEU C 2 45  ? 11.065  5.672   10.449  1.00 24.37 ? 46  LEU A O     1 
ATOM   793  C  CB    . LEU C 2 45  ? 10.000  5.479   7.344   1.00 27.43 ? 46  LEU A CB    1 
ATOM   794  C  CG    . LEU C 2 45  ? 9.972   4.525   6.156   1.00 28.96 ? 46  LEU A CG    1 
ATOM   795  C  CD1   . LEU C 2 45  ? 10.490  5.243   4.929   1.00 31.85 ? 46  LEU A CD1   1 
ATOM   796  C  CD2   . LEU C 2 45  ? 10.835  3.311   6.452   1.00 29.69 ? 46  LEU A CD2   1 
ATOM   797  N  N     . PHE C 2 46  ? 9.140   6.796   10.070  1.00 22.61 ? 47  PHE A N     1 
ATOM   798  C  CA    . PHE C 2 46  ? 9.318   7.794   11.114  1.00 25.18 ? 47  PHE A CA    1 
ATOM   799  C  C     . PHE C 2 46  ? 9.368   7.137   12.514  1.00 23.29 ? 47  PHE A C     1 
ATOM   800  O  O     . PHE C 2 46  ? 10.242  7.442   13.327  1.00 23.77 ? 47  PHE A O     1 
ATOM   801  C  CB    . PHE C 2 46  ? 8.156   8.795   11.028  1.00 27.25 ? 47  PHE A CB    1 
ATOM   802  C  CG    . PHE C 2 46  ? 8.232   9.917   12.022  1.00 32.71 ? 47  PHE A CG    1 
ATOM   803  C  CD1   . PHE C 2 46  ? 9.113   10.973  11.831  1.00 29.93 ? 47  PHE A CD1   1 
ATOM   804  C  CD2   . PHE C 2 46  ? 7.414   9.921   13.147  1.00 34.08 ? 47  PHE A CD2   1 
ATOM   805  C  CE1   . PHE C 2 46  ? 9.175   12.022  12.747  1.00 41.58 ? 47  PHE A CE1   1 
ATOM   806  C  CE2   . PHE C 2 46  ? 7.469   10.963  14.068  1.00 41.18 ? 47  PHE A CE2   1 
ATOM   807  C  CZ    . PHE C 2 46  ? 8.350   12.014  13.868  1.00 40.71 ? 47  PHE A CZ    1 
ATOM   808  N  N     . SER C 2 47  ? 8.431   6.235   12.778  1.00 23.57 ? 48  SER A N     1 
ATOM   809  C  CA    . SER C 2 47  ? 8.342   5.547   14.067  1.00 22.48 ? 48  SER A CA    1 
ATOM   810  C  C     . SER C 2 47  ? 9.443   4.529   14.372  1.00 23.68 ? 48  SER A C     1 
ATOM   811  O  O     . SER C 2 47  ? 9.740   4.288   15.541  1.00 22.43 ? 48  SER A O     1 
ATOM   812  C  CB    . SER C 2 47  ? 6.985   4.855   14.175  1.00 16.08 ? 48  SER A CB    1 
ATOM   813  O  OG    . SER C 2 47  ? 5.932   5.767   13.922  1.00 23.05 ? 48  SER A OG    1 
ATOM   814  N  N     . ARG C 2 48  ? 10.049  3.936   13.341  1.00 24.72 ? 49  ARG A N     1 
ATOM   815  C  CA    . ARG C 2 48  ? 11.088  2.923   13.544  1.00 28.30 ? 49  ARG A CA    1 
ATOM   816  C  C     . ARG C 2 48  ? 12.196  3.255   14.565  1.00 28.08 ? 49  ARG A C     1 
ATOM   817  O  O     . ARG C 2 48  ? 12.348  2.539   15.564  1.00 26.21 ? 49  ARG A O     1 
ATOM   818  C  CB    . ARG C 2 48  ? 11.709  2.491   12.204  1.00 25.99 ? 49  ARG A CB    1 
ATOM   819  C  CG    . ARG C 2 48  ? 10.726  1.828   11.252  1.00 33.48 ? 49  ARG A CG    1 
ATOM   820  C  CD    . ARG C 2 48  ? 11.353  1.466   9.898   1.00 37.75 ? 49  ARG A CD    1 
ATOM   821  N  NE    . ARG C 2 48  ? 12.354  0.406   9.994   1.00 34.70 ? 49  ARG A NE    1 
ATOM   822  C  CZ    . ARG C 2 48  ? 13.650  0.574   9.755   1.00 48.26 ? 49  ARG A CZ    1 
ATOM   823  N  NH1   . ARG C 2 48  ? 14.116  1.766   9.407   1.00 50.14 ? 49  ARG A NH1   1 
ATOM   824  N  NH2   . ARG C 2 48  ? 14.483  -0.453  9.864   1.00 47.01 ? 49  ARG A NH2   1 
ATOM   825  N  N     . PRO C 2 49  ? 12.977  4.335   14.340  1.00 27.29 ? 50  PRO A N     1 
ATOM   826  C  CA    . PRO C 2 49  ? 14.048  4.681   15.286  1.00 23.97 ? 50  PRO A CA    1 
ATOM   827  C  C     . PRO C 2 49  ? 13.591  4.970   16.716  1.00 23.64 ? 50  PRO A C     1 
ATOM   828  O  O     . PRO C 2 49  ? 14.313  4.665   17.661  1.00 27.91 ? 50  PRO A O     1 
ATOM   829  C  CB    . PRO C 2 49  ? 14.710  5.892   14.633  1.00 19.29 ? 50  PRO A CB    1 
ATOM   830  C  CG    . PRO C 2 49  ? 13.603  6.504   13.852  1.00 29.75 ? 50  PRO A CG    1 
ATOM   831  C  CD    . PRO C 2 49  ? 12.940  5.305   13.232  1.00 24.68 ? 50  PRO A CD    1 
ATOM   832  N  N     . ILE C 2 50  ? 12.405  5.552   16.868  1.00 22.89 ? 51  ILE A N     1 
ATOM   833  C  CA    . ILE C 2 50  ? 11.841  5.868   18.186  1.00 26.86 ? 51  ILE A CA    1 
ATOM   834  C  C     . ILE C 2 50  ? 11.554  4.583   18.954  1.00 26.19 ? 51  ILE A C     1 
ATOM   835  O  O     . ILE C 2 50  ? 11.930  4.448   20.113  1.00 26.36 ? 51  ILE A O     1 
ATOM   836  C  CB    . ILE C 2 50  ? 10.517  6.649   18.066  1.00 25.38 ? 51  ILE A CB    1 
ATOM   837  C  CG1   . ILE C 2 50  ? 10.764  7.997   17.408  1.00 29.21 ? 51  ILE A CG1   1 
ATOM   838  C  CG2   . ILE C 2 50  ? 9.898   6.867   19.437  1.00 33.37 ? 51  ILE A CG2   1 
ATOM   839  C  CD1   . ILE C 2 50  ? 9.489   8.745   17.143  1.00 40.31 ? 51  ILE A CD1   1 
ATOM   840  N  N     . ILE C 2 51  ? 10.876  3.651   18.291  1.00 27.98 ? 52  ILE A N     1 
ATOM   841  C  CA    . ILE C 2 51  ? 10.535  2.361   18.876  1.00 28.20 ? 52  ILE A CA    1 
ATOM   842  C  C     . ILE C 2 51  ? 11.817  1.640   19.298  1.00 29.27 ? 52  ILE A C     1 
ATOM   843  O  O     . ILE C 2 51  ? 11.921  1.133   20.415  1.00 28.66 ? 52  ILE A O     1 
ATOM   844  C  CB    . ILE C 2 51  ? 9.697   1.510   17.864  1.00 26.77 ? 52  ILE A CB    1 
ATOM   845  C  CG1   . ILE C 2 51  ? 8.277   2.088   17.779  1.00 22.98 ? 52  ILE A CG1   1 
ATOM   846  C  CG2   . ILE C 2 51  ? 9.678   0.041   18.261  1.00 23.94 ? 52  ILE A CG2   1 
ATOM   847  C  CD1   . ILE C 2 51  ? 7.383   1.422   16.784  1.00 28.17 ? 52  ILE A CD1   1 
ATOM   848  N  N     . ASN C 2 52  ? 12.796  1.612   18.406  1.00 27.99 ? 53  ASN A N     1 
ATOM   849  C  CA    . ASN C 2 52  ? 14.059  0.959   18.695  1.00 28.72 ? 53  ASN A CA    1 
ATOM   850  C  C     . ASN C 2 52  ? 14.787  1.596   19.883  1.00 30.07 ? 53  ASN A C     1 
ATOM   851  O  O     . ASN C 2 52  ? 15.295  0.897   20.757  1.00 29.14 ? 53  ASN A O     1 
ATOM   852  C  CB    . ASN C 2 52  ? 14.946  0.999   17.471  1.00 32.00 ? 53  ASN A CB    1 
ATOM   853  C  CG    . ASN C 2 52  ? 16.157  0.146   17.630  1.00 37.16 ? 53  ASN A CG    1 
ATOM   854  O  OD1   . ASN C 2 52  ? 16.061  -1.079  17.631  1.00 42.74 ? 53  ASN A OD1   1 
ATOM   855  N  ND2   . ASN C 2 52  ? 17.314  0.779   17.771  1.00 35.04 ? 53  ASN A ND2   1 
ATOM   856  N  N     . LYS C 2 53  ? 14.834  2.922   19.908  1.00 29.80 ? 54  LYS A N     1 
ATOM   857  C  CA    . LYS C 2 53  ? 15.477  3.664   20.988  1.00 33.16 ? 54  LYS A CA    1 
ATOM   858  C  C     . LYS C 2 53  ? 14.831  3.325   22.345  1.00 35.46 ? 54  LYS A C     1 
ATOM   859  O  O     . LYS C 2 53  ? 15.521  2.949   23.294  1.00 36.74 ? 54  LYS A O     1 
ATOM   860  C  CB    . LYS C 2 53  ? 15.365  5.172   20.723  1.00 31.35 ? 54  LYS A CB    1 
ATOM   861  C  CG    . LYS C 2 53  ? 15.896  6.054   21.840  1.00 44.20 ? 54  LYS A CG    1 
ATOM   862  C  CD    . LYS C 2 53  ? 15.475  7.502   21.644  1.00 59.02 ? 54  LYS A CD    1 
ATOM   863  C  CE    . LYS C 2 53  ? 15.761  8.329   22.891  1.00 71.24 ? 54  LYS A CE    1 
ATOM   864  N  NZ    . LYS C 2 53  ? 15.255  9.725   22.762  1.00 72.27 ? 54  LYS A NZ    1 
ATOM   865  N  N     . ILE C 2 54  ? 13.510  3.450   22.430  1.00 33.69 ? 55  ILE A N     1 
ATOM   866  C  CA    . ILE C 2 54  ? 12.803  3.177   23.673  1.00 33.73 ? 55  ILE A CA    1 
ATOM   867  C  C     . ILE C 2 54  ? 12.884  1.710   24.082  1.00 35.75 ? 55  ILE A C     1 
ATOM   868  O  O     . ILE C 2 54  ? 12.986  1.404   25.266  1.00 39.42 ? 55  ILE A O     1 
ATOM   869  C  CB    . ILE C 2 54  ? 11.319  3.616   23.591  1.00 32.89 ? 55  ILE A CB    1 
ATOM   870  C  CG1   . ILE C 2 54  ? 11.231  5.125   23.330  1.00 31.93 ? 55  ILE A CG1   1 
ATOM   871  C  CG2   . ILE C 2 54  ? 10.576  3.241   24.880  1.00 30.33 ? 55  ILE A CG2   1 
ATOM   872  C  CD1   . ILE C 2 54  ? 11.924  5.980   24.359  1.00 25.07 ? 55  ILE A CD1   1 
ATOM   873  N  N     . ALA C 2 55  ? 12.843  0.801   23.116  1.00 36.20 ? 56  ALA A N     1 
ATOM   874  C  CA    . ALA C 2 55  ? 12.917  -0.622  23.418  1.00 36.88 ? 56  ALA A CA    1 
ATOM   875  C  C     . ALA C 2 55  ? 14.262  -0.955  24.059  1.00 38.27 ? 56  ALA A C     1 
ATOM   876  O  O     . ALA C 2 55  ? 14.327  -1.633  25.085  1.00 36.86 ? 56  ALA A O     1 
ATOM   877  C  CB    . ALA C 2 55  ? 12.726  -1.430  22.158  1.00 32.42 ? 56  ALA A CB    1 
ATOM   878  N  N     . GLU C 2 56  ? 15.332  -0.466  23.447  1.00 41.17 ? 57  GLU A N     1 
ATOM   879  C  CA    . GLU C 2 56  ? 16.688  -0.693  23.935  1.00 44.24 ? 57  GLU A CA    1 
ATOM   880  C  C     . GLU C 2 56  ? 16.850  -0.267  25.401  1.00 43.29 ? 57  GLU A C     1 
ATOM   881  O  O     . GLU C 2 56  ? 17.452  -0.981  26.198  1.00 46.55 ? 57  GLU A O     1 
ATOM   882  C  CB    . GLU C 2 56  ? 17.676  0.076   23.059  1.00 44.94 ? 57  GLU A CB    1 
ATOM   883  C  CG    . GLU C 2 56  ? 19.130  -0.146  23.407  1.00 63.82 ? 57  GLU A CG    1 
ATOM   884  C  CD    . GLU C 2 56  ? 20.044  0.917   22.819  1.00 75.96 ? 57  GLU A CD    1 
ATOM   885  O  OE1   . GLU C 2 56  ? 19.558  1.797   22.069  1.00 77.86 ? 57  GLU A OE1   1 
ATOM   886  O  OE2   . GLU C 2 56  ? 21.258  0.873   23.113  1.00 79.79 ? 57  GLU A OE2   1 
ATOM   887  N  N     . LYS C 2 57  ? 16.304  0.894   25.746  1.00 40.85 ? 58  LYS A N     1 
ATOM   888  C  CA    . LYS C 2 57  ? 16.379  1.432   27.102  1.00 41.78 ? 58  LYS A CA    1 
ATOM   889  C  C     . LYS C 2 57  ? 15.779  0.486   28.146  1.00 43.07 ? 58  LYS A C     1 
ATOM   890  O  O     . LYS C 2 57  ? 16.190  0.484   29.310  1.00 47.63 ? 58  LYS A O     1 
ATOM   891  C  CB    . LYS C 2 57  ? 15.669  2.789   27.151  1.00 42.44 ? 58  LYS A CB    1 
ATOM   892  C  CG    . LYS C 2 57  ? 15.473  3.377   28.547  1.00 51.76 ? 58  LYS A CG    1 
ATOM   893  C  CD    . LYS C 2 57  ? 14.601  4.624   28.490  1.00 58.10 ? 58  LYS A CD    1 
ATOM   894  C  CE    . LYS C 2 57  ? 14.332  5.196   29.874  1.00 65.26 ? 58  LYS A CE    1 
ATOM   895  N  NZ    . LYS C 2 57  ? 13.422  6.385   29.815  1.00 62.03 ? 58  LYS A NZ    1 
ATOM   896  N  N     . HIS C 2 58  ? 14.807  -0.317  27.731  1.00 40.92 ? 59  HIS A N     1 
ATOM   897  C  CA    . HIS C 2 58  ? 14.153  -1.258  28.633  1.00 38.06 ? 59  HIS A CA    1 
ATOM   898  C  C     . HIS C 2 58  ? 14.639  -2.689  28.423  1.00 35.80 ? 59  HIS A C     1 
ATOM   899  O  O     . HIS C 2 58  ? 14.019  -3.635  28.908  1.00 36.91 ? 59  HIS A O     1 
ATOM   900  C  CB    . HIS C 2 58  ? 12.629  -1.202  28.450  1.00 36.56 ? 59  HIS A CB    1 
ATOM   901  C  CG    . HIS C 2 58  ? 12.017  0.108   28.838  1.00 34.88 ? 59  HIS A CG    1 
ATOM   902  N  ND1   . HIS C 2 58  ? 11.240  0.262   29.967  1.00 32.92 ? 59  HIS A ND1   1 
ATOM   903  C  CD2   . HIS C 2 58  ? 12.068  1.327   28.250  1.00 33.69 ? 59  HIS A CD2   1 
ATOM   904  C  CE1   . HIS C 2 58  ? 10.839  1.518   30.058  1.00 32.58 ? 59  HIS A CE1   1 
ATOM   905  N  NE2   . HIS C 2 58  ? 11.327  2.185   29.028  1.00 36.87 ? 59  HIS A NE2   1 
ATOM   906  N  N     . GLY C 2 59  ? 15.743  -2.841  27.697  1.00 36.86 ? 60  GLY A N     1 
ATOM   907  C  CA    . GLY C 2 59  ? 16.292  -4.158  27.436  1.00 38.22 ? 60  GLY A CA    1 
ATOM   908  C  C     . GLY C 2 59  ? 15.431  -5.081  26.581  1.00 41.94 ? 60  GLY A C     1 
ATOM   909  O  O     . GLY C 2 59  ? 15.352  -6.288  26.843  1.00 44.15 ? 60  GLY A O     1 
ATOM   910  N  N     . TYR C 2 60  ? 14.785  -4.528  25.558  1.00 42.03 ? 61  TYR A N     1 
ATOM   911  C  CA    . TYR C 2 60  ? 13.953  -5.330  24.664  1.00 40.11 ? 61  TYR A CA    1 
ATOM   912  C  C     . TYR C 2 60  ? 14.586  -5.450  23.290  1.00 41.40 ? 61  TYR A C     1 
ATOM   913  O  O     . TYR C 2 60  ? 15.232  -4.513  22.809  1.00 43.85 ? 61  TYR A O     1 
ATOM   914  C  CB    . TYR C 2 60  ? 12.569  -4.712  24.500  1.00 31.52 ? 61  TYR A CB    1 
ATOM   915  C  CG    . TYR C 2 60  ? 11.605  -5.012  25.615  1.00 30.97 ? 61  TYR A CG    1 
ATOM   916  C  CD1   . TYR C 2 60  ? 11.555  -4.213  26.756  1.00 36.04 ? 61  TYR A CD1   1 
ATOM   917  C  CD2   . TYR C 2 60  ? 10.720  -6.077  25.516  1.00 32.44 ? 61  TYR A CD2   1 
ATOM   918  C  CE1   . TYR C 2 60  ? 10.642  -4.466  27.772  1.00 33.73 ? 61  TYR A CE1   1 
ATOM   919  C  CE2   . TYR C 2 60  ? 9.804   -6.342  26.524  1.00 39.83 ? 61  TYR A CE2   1 
ATOM   920  C  CZ    . TYR C 2 60  ? 9.768   -5.533  27.647  1.00 40.87 ? 61  TYR A CZ    1 
ATOM   921  O  OH    . TYR C 2 60  ? 8.842   -5.791  28.629  1.00 44.58 ? 61  TYR A OH    1 
ATOM   922  N  N     . ILE C 2 61  ? 14.397  -6.608  22.668  1.00 40.82 ? 62  ILE A N     1 
ATOM   923  C  CA    . ILE C 2 61  ? 14.901  -6.868  21.326  1.00 41.62 ? 62  ILE A CA    1 
ATOM   924  C  C     . ILE C 2 61  ? 13.769  -6.424  20.402  1.00 39.41 ? 62  ILE A C     1 
ATOM   925  O  O     . ILE C 2 61  ? 12.592  -6.607  20.735  1.00 40.29 ? 62  ILE A O     1 
ATOM   926  C  CB    . ILE C 2 61  ? 15.151  -8.384  21.101  1.00 46.89 ? 62  ILE A CB    1 
ATOM   927  C  CG1   . ILE C 2 61  ? 16.160  -8.901  22.119  1.00 55.58 ? 62  ILE A CG1   1 
ATOM   928  C  CG2   . ILE C 2 61  ? 15.663  -8.647  19.686  1.00 47.65 ? 62  ILE A CG2   1 
ATOM   929  C  CD1   . ILE C 2 61  ? 16.341  -10.393 22.064  1.00 64.77 ? 62  ILE A CD1   1 
ATOM   930  N  N     . VAL C 2 62  ? 14.112  -5.837  19.258  1.00 36.16 ? 63  VAL A N     1 
ATOM   931  C  CA    . VAL C 2 62  ? 13.102  -5.401  18.307  1.00 32.22 ? 63  VAL A CA    1 
ATOM   932  C  C     . VAL C 2 62  ? 13.322  -6.156  17.008  1.00 32.65 ? 63  VAL A C     1 
ATOM   933  O  O     . VAL C 2 62  ? 14.439  -6.205  16.498  1.00 32.22 ? 63  VAL A O     1 
ATOM   934  C  CB    . VAL C 2 62  ? 13.181  -3.889  18.034  1.00 28.07 ? 63  VAL A CB    1 
ATOM   935  C  CG1   . VAL C 2 62  ? 12.052  -3.460  17.103  1.00 33.44 ? 63  VAL A CG1   1 
ATOM   936  C  CG2   . VAL C 2 62  ? 13.065  -3.131  19.326  1.00 34.40 ? 63  VAL A CG2   1 
ATOM   937  N  N     . GLU C 2 63  ? 12.257  -6.751  16.484  1.00 30.86 ? 64  GLU A N     1 
ATOM   938  C  CA    . GLU C 2 63  ? 12.331  -7.489  15.234  1.00 28.21 ? 64  GLU A CA    1 
ATOM   939  C  C     . GLU C 2 63  ? 11.222  -7.122  14.275  1.00 26.84 ? 64  GLU A C     1 
ATOM   940  O  O     . GLU C 2 63  ? 10.055  -6.980  14.665  1.00 28.22 ? 64  GLU A O     1 
ATOM   941  C  CB    . GLU C 2 63  ? 12.279  -8.992  15.477  1.00 29.27 ? 64  GLU A CB    1 
ATOM   942  C  CG    . GLU C 2 63  ? 13.574  -9.577  15.978  1.00 37.11 ? 64  GLU A CG    1 
ATOM   943  C  CD    . GLU C 2 63  ? 13.495  -11.079 16.165  1.00 46.01 ? 64  GLU A CD    1 
ATOM   944  O  OE1   . GLU C 2 63  ? 12.628  -11.727 15.530  1.00 45.37 ? 64  GLU A OE1   1 
ATOM   945  O  OE2   . GLU C 2 63  ? 14.308  -11.607 16.952  1.00 44.23 ? 64  GLU A OE2   1 
ATOM   946  N  N     . GLU C 2 64  ? 11.607  -6.975  13.012  1.00 26.10 ? 65  GLU A N     1 
ATOM   947  C  CA    . GLU C 2 64  ? 10.689  -6.647  11.925  1.00 27.98 ? 65  GLU A CA    1 
ATOM   948  C  C     . GLU C 2 64  ? 10.494  -7.905  11.077  1.00 27.02 ? 65  GLU A C     1 
ATOM   949  O  O     . GLU C 2 64  ? 11.386  -8.764  11.018  1.00 28.72 ? 65  GLU A O     1 
ATOM   950  C  CB    . GLU C 2 64  ? 11.271  -5.517  11.084  1.00 24.51 ? 65  GLU A CB    1 
ATOM   951  C  CG    . GLU C 2 64  ? 11.565  -4.263  11.899  1.00 25.07 ? 65  GLU A CG    1 
ATOM   952  C  CD    . GLU C 2 64  ? 12.088  -3.137  11.048  1.00 22.43 ? 65  GLU A CD    1 
ATOM   953  O  OE1   . GLU C 2 64  ? 13.314  -3.094  10.797  1.00 26.13 ? 65  GLU A OE1   1 
ATOM   954  O  OE2   . GLU C 2 64  ? 11.261  -2.301  10.632  1.00 29.30 ? 65  GLU A OE2   1 
ATOM   955  N  N     . PRO C 2 65  ? 9.334   -8.034  10.411  1.00 28.63 ? 66  PRO A N     1 
ATOM   956  C  CA    . PRO C 2 65  ? 9.055   -9.209  9.582   1.00 32.10 ? 66  PRO A CA    1 
ATOM   957  C  C     . PRO C 2 65  ? 10.147  -9.497  8.561   1.00 38.22 ? 66  PRO A C     1 
ATOM   958  O  O     . PRO C 2 65  ? 10.707  -8.579  7.959   1.00 37.62 ? 66  PRO A O     1 
ATOM   959  C  CB    . PRO C 2 65  ? 7.734   -8.848  8.914   1.00 30.21 ? 66  PRO A CB    1 
ATOM   960  C  CG    . PRO C 2 65  ? 7.073   -7.970  9.925   1.00 29.96 ? 66  PRO A CG    1 
ATOM   961  C  CD    . PRO C 2 65  ? 8.202   -7.091  10.372  1.00 27.03 ? 66  PRO A CD    1 
ATOM   962  N  N     . LYS C 2 66  ? 10.446  -10.781 8.380   1.00 46.76 ? 67  LYS A N     1 
ATOM   963  C  CA    . LYS C 2 66  ? 11.454  -11.223 7.415   1.00 52.49 ? 67  LYS A CA    1 
ATOM   964  C  C     . LYS C 2 66  ? 10.791  -11.334 6.041   1.00 53.67 ? 67  LYS A C     1 
ATOM   965  O  O     . LYS C 2 66  ? 11.453  -11.225 5.010   1.00 55.03 ? 67  LYS A O     1 
ATOM   966  C  CB    . LYS C 2 66  ? 12.025  -12.589 7.823   1.00 57.70 ? 67  LYS A CB    1 
ATOM   967  C  CG    . LYS C 2 66  ? 12.750  -12.603 9.163   1.00 66.84 ? 67  LYS A CG    1 
ATOM   968  C  CD    . LYS C 2 66  ? 13.963  -11.681 9.138   1.00 80.48 ? 67  LYS A CD    1 
ATOM   969  C  CE    . LYS C 2 66  ? 14.688  -11.703 10.474  1.00 92.91 ? 67  LYS A CE    1 
ATOM   970  N  NZ    . LYS C 2 66  ? 15.881  -10.806 10.487  1.00 99.00 ? 67  LYS A NZ    1 
ATOM   971  N  N     . GLN C 2 67  ? 9.478   -11.548 6.042   1.00 54.42 ? 68  GLN A N     1 
ATOM   972  C  CA    . GLN C 2 67  ? 8.715   -11.691 4.816   1.00 56.11 ? 68  GLN A CA    1 
ATOM   973  C  C     . GLN C 2 67  ? 7.613   -10.660 4.748   1.00 54.61 ? 68  GLN A C     1 
ATOM   974  O  O     . GLN C 2 67  ? 7.207   -10.110 5.762   1.00 55.56 ? 68  GLN A O     1 
ATOM   975  C  CB    . GLN C 2 67  ? 8.130   -13.088 4.741   1.00 66.15 ? 68  GLN A CB    1 
ATOM   976  C  CG    . GLN C 2 67  ? 9.192   -14.161 4.800   1.00 76.13 ? 68  GLN A CG    1 
ATOM   977  C  CD    . GLN C 2 67  ? 8.590   -15.529 4.922   1.00 84.34 ? 68  GLN A CD    1 
ATOM   978  O  OE1   . GLN C 2 67  ? 8.612   -16.135 5.993   1.00 86.40 ? 68  GLN A OE1   1 
ATOM   979  N  NE2   . GLN C 2 67  ? 8.038   -16.028 3.826   1.00 82.23 ? 68  GLN A NE2   1 
ATOM   980  N  N     . GLN C 2 68  ? 7.121   -10.419 3.544   1.00 53.68 ? 69  GLN A N     1 
ATOM   981  C  CA    . GLN C 2 68  ? 6.107   -9.402  3.307   1.00 54.56 ? 69  GLN A CA    1 
ATOM   982  C  C     . GLN C 2 68  ? 4.718   -9.452  3.925   1.00 52.11 ? 69  GLN A C     1 
ATOM   983  O  O     . GLN C 2 68  ? 4.302   -8.493  4.577   1.00 54.77 ? 69  GLN A O     1 
ATOM   984  C  CB    . GLN C 2 68  ? 6.002   -9.164  1.802   1.00 60.71 ? 69  GLN A CB    1 
ATOM   985  C  CG    . GLN C 2 68  ? 7.348   -8.922  1.137   1.00 66.18 ? 69  GLN A CG    1 
ATOM   986  C  CD    . GLN C 2 68  ? 8.033   -7.660  1.606   1.00 74.80 ? 69  GLN A CD    1 
ATOM   987  O  OE1   . GLN C 2 68  ? 8.356   -6.807  0.787   1.00 81.23 ? 69  GLN A OE1   1 
ATOM   988  N  NE2   . GLN C 2 68  ? 8.244   -7.525  2.926   1.00 83.00 ? 69  GLN A NE2   1 
ATOM   989  N  N     . ASN C 2 69  ? 3.999   -10.547 3.737   1.00 48.23 ? 70  ASN A N     1 
ATOM   990  C  CA    . ASN C 2 69  ? 2.643   -10.642 4.275   1.00 43.84 ? 70  ASN A CA    1 
ATOM   991  C  C     . ASN C 2 69  ? 2.601   -11.071 5.741   1.00 36.66 ? 70  ASN A C     1 
ATOM   992  O  O     . ASN C 2 69  ? 1.756   -11.879 6.128   1.00 38.15 ? 70  ASN A O     1 
ATOM   993  C  CB    . ASN C 2 69  ? 1.808   -11.612 3.421   1.00 47.81 ? 70  ASN A CB    1 
ATOM   994  C  CG    . ASN C 2 69  ? 1.652   -11.138 1.985   1.00 53.77 ? 70  ASN A CG    1 
ATOM   995  O  OD1   . ASN C 2 69  ? 1.854   -9.951  1.674   1.00 56.29 ? 70  ASN A OD1   1 
ATOM   996  N  ND2   . ASN C 2 69  ? 1.294   -12.062 1.094   1.00 47.40 ? 70  ASN A ND2   1 
ATOM   997  N  N     . HIS C 2 70  ? 3.500   -10.529 6.554   1.00 28.67 ? 71  HIS A N     1 
ATOM   998  C  CA    . HIS C 2 70  ? 3.584   -10.894 7.966   1.00 29.24 ? 71  HIS A CA    1 
ATOM   999  C  C     . HIS C 2 70  ? 3.314   -9.758  8.947   1.00 28.29 ? 71  HIS A C     1 
ATOM   1000 O  O     . HIS C 2 70  ? 3.793   -8.639  8.767   1.00 31.85 ? 71  HIS A O     1 
ATOM   1001 C  CB    . HIS C 2 70  ? 4.967   -11.471 8.286   1.00 25.69 ? 71  HIS A CB    1 
ATOM   1002 C  CG    . HIS C 2 70  ? 5.154   -12.897 7.865   1.00 41.04 ? 71  HIS A CG    1 
ATOM   1003 N  ND1   . HIS C 2 70  ? 4.211   -13.605 7.150   1.00 40.99 ? 71  HIS A ND1   1 
ATOM   1004 C  CD2   . HIS C 2 70  ? 6.192   -13.744 8.057   1.00 44.93 ? 71  HIS A CD2   1 
ATOM   1005 C  CE1   . HIS C 2 70  ? 4.656   -14.823 6.921   1.00 45.60 ? 71  HIS A CE1   1 
ATOM   1006 N  NE2   . HIS C 2 70  ? 5.858   -14.938 7.462   1.00 48.49 ? 71  HIS A NE2   1 
ATOM   1007 N  N     . TYR C 2 71  ? 2.546   -10.077 9.982   1.00 25.94 ? 72  TYR A N     1 
ATOM   1008 C  CA    . TYR C 2 71  ? 2.224   -9.155  11.058  1.00 25.44 ? 72  TYR A CA    1 
ATOM   1009 C  C     . TYR C 2 71  ? 3.116   -9.634  12.224  1.00 26.67 ? 72  TYR A C     1 
ATOM   1010 O  O     . TYR C 2 71  ? 3.462   -10.813 12.273  1.00 26.19 ? 72  TYR A O     1 
ATOM   1011 C  CB    . TYR C 2 71  ? 0.735   -9.298  11.380  1.00 24.15 ? 72  TYR A CB    1 
ATOM   1012 C  CG    . TYR C 2 71  ? 0.303   -8.833  12.759  1.00 33.95 ? 72  TYR A CG    1 
ATOM   1013 C  CD1   . TYR C 2 71  ? 0.436   -9.672  13.873  1.00 31.26 ? 72  TYR A CD1   1 
ATOM   1014 C  CD2   . TYR C 2 71  ? -0.276  -7.578  12.948  1.00 29.83 ? 72  TYR A CD2   1 
ATOM   1015 C  CE1   . TYR C 2 71  ? -0.001  -9.279  15.130  1.00 18.43 ? 72  TYR A CE1   1 
ATOM   1016 C  CE2   . TYR C 2 71  ? -0.720  -7.170  14.214  1.00 22.65 ? 72  TYR A CE2   1 
ATOM   1017 C  CZ    . TYR C 2 71  ? -0.582  -8.028  15.294  1.00 20.79 ? 72  TYR A CZ    1 
ATOM   1018 O  OH    . TYR C 2 71  ? -1.040  -7.658  16.536  1.00 20.25 ? 72  TYR A OH    1 
ATOM   1019 N  N     . PRO C 2 72  ? 3.528   -8.738  13.154  1.00 29.57 ? 73  PRO A N     1 
ATOM   1020 C  CA    . PRO C 2 72  ? 3.284   -7.296  13.285  1.00 27.88 ? 73  PRO A CA    1 
ATOM   1021 C  C     . PRO C 2 72  ? 4.483   -6.507  12.757  1.00 24.49 ? 73  PRO A C     1 
ATOM   1022 O  O     . PRO C 2 72  ? 5.524   -7.096  12.443  1.00 22.93 ? 73  PRO A O     1 
ATOM   1023 C  CB    . PRO C 2 72  ? 3.152   -7.132  14.792  1.00 22.30 ? 73  PRO A CB    1 
ATOM   1024 C  CG    . PRO C 2 72  ? 4.269   -8.028  15.294  1.00 23.67 ? 73  PRO A CG    1 
ATOM   1025 C  CD    . PRO C 2 72  ? 4.318   -9.215  14.311  1.00 26.22 ? 73  PRO A CD    1 
ATOM   1026 N  N     . ASP C 2 73  ? 4.332   -5.184  12.671  1.00 24.12 ? 74  ASP A N     1 
ATOM   1027 C  CA    . ASP C 2 73  ? 5.413   -4.308  12.207  1.00 19.98 ? 74  ASP A CA    1 
ATOM   1028 C  C     . ASP C 2 73  ? 6.619   -4.451  13.112  1.00 19.24 ? 74  ASP A C     1 
ATOM   1029 O  O     . ASP C 2 73  ? 7.758   -4.457  12.650  1.00 20.16 ? 74  ASP A O     1 
ATOM   1030 C  CB    . ASP C 2 73  ? 4.979   -2.840  12.213  1.00 19.45 ? 74  ASP A CB    1 
ATOM   1031 C  CG    . ASP C 2 73  ? 3.981   -2.516  11.123  1.00 26.07 ? 74  ASP A CG    1 
ATOM   1032 O  OD1   . ASP C 2 73  ? 3.972   -3.204  10.082  1.00 28.60 ? 74  ASP A OD1   1 
ATOM   1033 O  OD2   . ASP C 2 73  ? 3.199   -1.565  11.309  1.00 26.36 ? 74  ASP A OD2   1 
ATOM   1034 N  N     . PHE C 2 74  ? 6.363   -4.560  14.410  1.00 19.37 ? 75  PHE A N     1 
ATOM   1035 C  CA    . PHE C 2 74  ? 7.436   -4.692  15.373  1.00 19.87 ? 75  PHE A CA    1 
ATOM   1036 C  C     . PHE C 2 74  ? 7.086   -5.729  16.418  1.00 19.84 ? 75  PHE A C     1 
ATOM   1037 O  O     . PHE C 2 74  ? 5.971   -5.750  16.927  1.00 19.05 ? 75  PHE A O     1 
ATOM   1038 C  CB    . PHE C 2 74  ? 7.692   -3.350  16.072  1.00 23.05 ? 75  PHE A CB    1 
ATOM   1039 C  CG    . PHE C 2 74  ? 8.055   -2.226  15.132  1.00 27.58 ? 75  PHE A CG    1 
ATOM   1040 C  CD1   . PHE C 2 74  ? 9.371   -2.063  14.693  1.00 24.68 ? 75  PHE A CD1   1 
ATOM   1041 C  CD2   . PHE C 2 74  ? 7.075   -1.334  14.677  1.00 24.14 ? 75  PHE A CD2   1 
ATOM   1042 C  CE1   . PHE C 2 74  ? 9.705   -1.026  13.811  1.00 21.86 ? 75  PHE A CE1   1 
ATOM   1043 C  CE2   . PHE C 2 74  ? 7.396   -0.295  13.796  1.00 18.04 ? 75  PHE A CE2   1 
ATOM   1044 C  CZ    . PHE C 2 74  ? 8.714   -0.143  13.363  1.00 18.78 ? 75  PHE A CZ    1 
ATOM   1045 N  N     . THR C 2 75  ? 8.052   -6.590  16.716  1.00 23.28 ? 76  THR A N     1 
ATOM   1046 C  CA    . THR C 2 75  ? 7.917   -7.618  17.738  1.00 25.69 ? 76  THR A CA    1 
ATOM   1047 C  C     . THR C 2 75  ? 9.012   -7.327  18.761  1.00 24.74 ? 76  THR A C     1 
ATOM   1048 O  O     . THR C 2 75  ? 10.204  -7.339  18.424  1.00 19.88 ? 76  THR A O     1 
ATOM   1049 C  CB    . THR C 2 75  ? 8.123   -9.045  17.169  1.00 27.39 ? 76  THR A CB    1 
ATOM   1050 O  OG1   . THR C 2 75  ? 7.085   -9.340  16.224  1.00 29.19 ? 76  THR A OG1   1 
ATOM   1051 C  CG2   . THR C 2 75  ? 8.085   -10.088 18.298  1.00 28.00 ? 76  THR A CG2   1 
ATOM   1052 N  N     . LEU C 2 76  ? 8.599   -7.045  19.995  1.00 26.64 ? 77  LEU A N     1 
ATOM   1053 C  CA    . LEU C 2 76  ? 9.530   -6.759  21.087  1.00 29.63 ? 77  LEU A CA    1 
ATOM   1054 C  C     . LEU C 2 76  ? 9.481   -7.886  22.119  1.00 31.43 ? 77  LEU A C     1 
ATOM   1055 O  O     . LEU C 2 76  ? 8.417   -8.470  22.358  1.00 27.34 ? 77  LEU A O     1 
ATOM   1056 C  CB    . LEU C 2 76  ? 9.187   -5.426  21.769  1.00 25.51 ? 77  LEU A CB    1 
ATOM   1057 C  CG    . LEU C 2 76  ? 9.522   -4.114  21.052  1.00 31.18 ? 77  LEU A CG    1 
ATOM   1058 C  CD1   . LEU C 2 76  ? 8.683   -3.966  19.795  1.00 30.40 ? 77  LEU A CD1   1 
ATOM   1059 C  CD2   . LEU C 2 76  ? 9.275   -2.946  21.994  1.00 25.20 ? 77  LEU A CD2   1 
ATOM   1060 N  N     . TYR C 2 77  ? 10.631  -8.188  22.720  1.00 35.40 ? 78  TYR A N     1 
ATOM   1061 C  CA    . TYR C 2 77  ? 10.726  -9.231  23.738  1.00 39.42 ? 78  TYR A CA    1 
ATOM   1062 C  C     . TYR C 2 77  ? 12.109  -9.249  24.382  1.00 42.42 ? 78  TYR A C     1 
ATOM   1063 O  O     . TYR C 2 77  ? 13.111  -8.956  23.724  1.00 42.93 ? 78  TYR A O     1 
ATOM   1064 C  CB    . TYR C 2 77  ? 10.425  -10.615 23.136  1.00 36.54 ? 78  TYR A CB    1 
ATOM   1065 C  CG    . TYR C 2 77  ? 11.493  -11.137 22.199  1.00 44.04 ? 78  TYR A CG    1 
ATOM   1066 C  CD1   . TYR C 2 77  ? 12.556  -11.896 22.682  1.00 46.94 ? 78  TYR A CD1   1 
ATOM   1067 C  CD2   . TYR C 2 77  ? 11.444  -10.875 20.830  1.00 45.25 ? 78  TYR A CD2   1 
ATOM   1068 C  CE1   . TYR C 2 77  ? 13.539  -12.379 21.837  1.00 42.20 ? 78  TYR A CE1   1 
ATOM   1069 C  CE2   . TYR C 2 77  ? 12.429  -11.359 19.972  1.00 44.92 ? 78  TYR A CE2   1 
ATOM   1070 C  CZ    . TYR C 2 77  ? 13.471  -12.110 20.487  1.00 46.86 ? 78  TYR A CZ    1 
ATOM   1071 O  OH    . TYR C 2 77  ? 14.450  -12.601 19.660  1.00 50.82 ? 78  TYR A OH    1 
ATOM   1072 N  N     . LYS C 2 78  ? 12.159  -9.585  25.668  1.00 43.45 ? 79  LYS A N     1 
ATOM   1073 C  CA    . LYS C 2 78  ? 13.422  -9.676  26.386  1.00 45.51 ? 79  LYS A CA    1 
ATOM   1074 C  C     . LYS C 2 78  ? 13.974  -11.072 26.109  1.00 47.82 ? 79  LYS A C     1 
ATOM   1075 O  O     . LYS C 2 78  ? 13.210  -12.037 26.001  1.00 47.21 ? 79  LYS A O     1 
ATOM   1076 C  CB    . LYS C 2 78  ? 13.200  -9.503  27.887  1.00 48.17 ? 79  LYS A CB    1 
ATOM   1077 C  CG    . LYS C 2 78  ? 12.805  -8.105  28.308  1.00 55.63 ? 79  LYS A CG    1 
ATOM   1078 C  CD    . LYS C 2 78  ? 12.538  -8.064  29.796  1.00 62.37 ? 79  LYS A CD    1 
ATOM   1079 C  CE    . LYS C 2 78  ? 12.214  -6.664  30.256  1.00 66.34 ? 79  LYS A CE    1 
ATOM   1080 N  NZ    . LYS C 2 78  ? 11.623  -6.679  31.619  1.00 69.39 ? 79  LYS A NZ    1 
ATOM   1081 N  N     . PRO C 2 79  ? 15.306  -11.205 25.993  1.00 48.23 ? 80  PRO A N     1 
ATOM   1082 C  CA    . PRO C 2 79  ? 15.934  -12.504 25.725  1.00 48.39 ? 80  PRO A CA    1 
ATOM   1083 C  C     . PRO C 2 79  ? 15.520  -13.575 26.737  1.00 48.83 ? 80  PRO A C     1 
ATOM   1084 O  O     . PRO C 2 79  ? 15.363  -14.742 26.392  1.00 47.64 ? 80  PRO A O     1 
ATOM   1085 C  CB    . PRO C 2 79  ? 17.425  -12.188 25.825  1.00 49.53 ? 80  PRO A CB    1 
ATOM   1086 C  CG    . PRO C 2 79  ? 17.494  -10.758 25.392  1.00 51.52 ? 80  PRO A CG    1 
ATOM   1087 C  CD    . PRO C 2 79  ? 16.323  -10.144 26.105  1.00 49.76 ? 80  PRO A CD    1 
ATOM   1088 N  N     . SER C 2 80  ? 15.340  -13.151 27.983  1.00 49.35 ? 81  SER A N     1 
ATOM   1089 C  CA    . SER C 2 80  ? 14.967  -14.030 29.086  1.00 48.75 ? 81  SER A CA    1 
ATOM   1090 C  C     . SER C 2 80  ? 13.487  -14.433 29.195  1.00 49.50 ? 81  SER A C     1 
ATOM   1091 O  O     . SER C 2 80  ? 13.127  -15.264 30.035  1.00 52.24 ? 81  SER A O     1 
ATOM   1092 C  CB    . SER C 2 80  ? 15.423  -13.385 30.393  1.00 49.32 ? 81  SER A CB    1 
ATOM   1093 O  OG    . SER C 2 80  ? 15.002  -12.029 30.461  1.00 51.70 ? 81  SER A OG    1 
ATOM   1094 N  N     . GLU C 2 81  ? 12.624  -13.855 28.365  1.00 46.38 ? 82  GLU A N     1 
ATOM   1095 C  CA    . GLU C 2 81  ? 11.204  -14.198 28.407  1.00 45.11 ? 82  GLU A CA    1 
ATOM   1096 C  C     . GLU C 2 81  ? 10.623  -14.235 26.994  1.00 44.12 ? 82  GLU A C     1 
ATOM   1097 O  O     . GLU C 2 81  ? 9.747   -13.440 26.651  1.00 41.16 ? 82  GLU A O     1 
ATOM   1098 C  CB    . GLU C 2 81  ? 10.426  -13.189 29.251  1.00 48.18 ? 82  GLU A CB    1 
ATOM   1099 C  CG    . GLU C 2 81  ? 10.829  -13.113 30.697  1.00 52.00 ? 82  GLU A CG    1 
ATOM   1100 C  CD    . GLU C 2 81  ? 10.308  -11.847 31.350  1.00 63.23 ? 82  GLU A CD    1 
ATOM   1101 O  OE1   . GLU C 2 81  ? 9.112   -11.800 31.697  1.00 66.87 ? 82  GLU A OE1   1 
ATOM   1102 O  OE2   . GLU C 2 81  ? 11.085  -10.888 31.520  1.00 72.56 ? 82  GLU A OE2   1 
ATOM   1103 N  N     . PRO C 2 82  ? 11.103  -15.168 26.156  1.00 44.49 ? 83  PRO A N     1 
ATOM   1104 C  CA    . PRO C 2 82  ? 10.633  -15.308 24.776  1.00 43.87 ? 83  PRO A CA    1 
ATOM   1105 C  C     . PRO C 2 82  ? 9.134   -15.527 24.622  1.00 41.06 ? 83  PRO A C     1 
ATOM   1106 O  O     . PRO C 2 82  ? 8.564   -15.156 23.609  1.00 42.71 ? 83  PRO A O     1 
ATOM   1107 C  CB    . PRO C 2 82  ? 11.449  -16.497 24.248  1.00 51.00 ? 83  PRO A CB    1 
ATOM   1108 C  CG    . PRO C 2 82  ? 11.775  -17.282 25.494  1.00 49.31 ? 83  PRO A CG    1 
ATOM   1109 C  CD    . PRO C 2 82  ? 12.136  -16.177 26.451  1.00 48.02 ? 83  PRO A CD    1 
ATOM   1110 N  N     . ASN C 2 83  ? 8.484   -16.119 25.612  1.00 40.02 ? 84  ASN A N     1 
ATOM   1111 C  CA    . ASN C 2 83  ? 7.053   -16.341 25.479  1.00 40.26 ? 84  ASN A CA    1 
ATOM   1112 C  C     . ASN C 2 83  ? 6.174   -15.197 25.935  1.00 38.08 ? 84  ASN A C     1 
ATOM   1113 O  O     . ASN C 2 83  ? 4.970   -15.369 26.106  1.00 39.27 ? 84  ASN A O     1 
ATOM   1114 C  CB    . ASN C 2 83  ? 6.631   -17.648 26.147  1.00 49.81 ? 84  ASN A CB    1 
ATOM   1115 C  CG    . ASN C 2 83  ? 6.747   -18.827 25.210  1.00 58.65 ? 84  ASN A CG    1 
ATOM   1116 O  OD1   . ASN C 2 83  ? 7.842   -19.169 24.759  1.00 59.03 ? 84  ASN A OD1   1 
ATOM   1117 N  ND2   . ASN C 2 83  ? 5.619   -19.456 24.904  1.00 70.97 ? 84  ASN A ND2   1 
ATOM   1118 N  N     . LYS C 2 84  ? 6.774   -14.031 26.141  1.00 36.11 ? 85  LYS A N     1 
ATOM   1119 C  CA    . LYS C 2 84  ? 6.015   -12.843 26.516  1.00 37.26 ? 85  LYS A CA    1 
ATOM   1120 C  C     . LYS C 2 84  ? 6.404   -11.768 25.498  1.00 37.42 ? 85  LYS A C     1 
ATOM   1121 O  O     . LYS C 2 84  ? 7.152   -10.839 25.802  1.00 40.66 ? 85  LYS A O     1 
ATOM   1122 C  CB    . LYS C 2 84  ? 6.348   -12.389 27.938  1.00 39.46 ? 85  LYS A CB    1 
ATOM   1123 C  CG    . LYS C 2 84  ? 5.975   -13.385 29.013  1.00 45.92 ? 85  LYS A CG    1 
ATOM   1124 C  CD    . LYS C 2 84  ? 6.346   -12.828 30.379  1.00 60.62 ? 85  LYS A CD    1 
ATOM   1125 C  CE    . LYS C 2 84  ? 6.662   -13.953 31.372  1.00 70.07 ? 85  LYS A CE    1 
ATOM   1126 N  NZ    . LYS C 2 84  ? 7.109   -13.421 32.702  1.00 70.96 ? 85  LYS A NZ    1 
ATOM   1127 N  N     . LYS C 2 85  ? 5.901   -11.911 24.281  1.00 34.55 ? 86  LYS A N     1 
ATOM   1128 C  CA    . LYS C 2 85  ? 6.209   -10.964 23.225  1.00 30.96 ? 86  LYS A CA    1 
ATOM   1129 C  C     . LYS C 2 85  ? 5.175   -9.865  23.117  1.00 26.95 ? 86  LYS A C     1 
ATOM   1130 O  O     . LYS C 2 85  ? 4.004   -10.054 23.447  1.00 27.00 ? 86  LYS A O     1 
ATOM   1131 C  CB    . LYS C 2 85  ? 6.334   -11.682 21.886  1.00 28.80 ? 86  LYS A CB    1 
ATOM   1132 C  CG    . LYS C 2 85  ? 7.469   -12.659 21.832  1.00 24.26 ? 86  LYS A CG    1 
ATOM   1133 C  CD    . LYS C 2 85  ? 7.696   -13.103 20.420  1.00 20.39 ? 86  LYS A CD    1 
ATOM   1134 C  CE    . LYS C 2 85  ? 9.058   -13.749 20.280  1.00 21.70 ? 86  LYS A CE    1 
ATOM   1135 N  NZ    . LYS C 2 85  ? 9.048   -15.158 20.755  1.00 29.15 ? 86  LYS A NZ    1 
ATOM   1136 N  N     . ILE C 2 86  ? 5.625   -8.708  22.655  1.00 27.51 ? 87  ILE A N     1 
ATOM   1137 C  CA    . ILE C 2 86  ? 4.758   -7.554  22.467  1.00 27.35 ? 87  ILE A CA    1 
ATOM   1138 C  C     . ILE C 2 86  ? 4.736   -7.237  20.971  1.00 23.97 ? 87  ILE A C     1 
ATOM   1139 O  O     . ILE C 2 86  ? 5.794   -7.102  20.347  1.00 20.05 ? 87  ILE A O     1 
ATOM   1140 C  CB    . ILE C 2 86  ? 5.283   -6.309  23.237  1.00 29.96 ? 87  ILE A CB    1 
ATOM   1141 C  CG1   . ILE C 2 86  ? 5.256   -6.572  24.745  1.00 31.41 ? 87  ILE A CG1   1 
ATOM   1142 C  CG2   . ILE C 2 86  ? 4.437   -5.076  22.891  1.00 24.36 ? 87  ILE A CG2   1 
ATOM   1143 C  CD1   . ILE C 2 86  ? 5.764   -5.416  25.574  1.00 41.98 ? 87  ILE A CD1   1 
ATOM   1144 N  N     . ALA C 2 87  ? 3.537   -7.133  20.406  1.00 23.13 ? 88  ALA A N     1 
ATOM   1145 C  CA    . ALA C 2 87  ? 3.378   -6.814  18.993  1.00 22.93 ? 88  ALA A CA    1 
ATOM   1146 C  C     . ALA C 2 87  ? 2.963   -5.351  18.879  1.00 23.46 ? 88  ALA A C     1 
ATOM   1147 O  O     . ALA C 2 87  ? 2.056   -4.903  19.587  1.00 22.66 ? 88  ALA A O     1 
ATOM   1148 C  CB    . ALA C 2 87  ? 2.313   -7.714  18.362  1.00 23.12 ? 88  ALA A CB    1 
ATOM   1149 N  N     . ILE C 2 88  ? 3.629   -4.603  18.004  1.00 24.82 ? 89  ILE A N     1 
ATOM   1150 C  CA    . ILE C 2 88  ? 3.291   -3.198  17.783  1.00 24.07 ? 89  ILE A CA    1 
ATOM   1151 C  C     . ILE C 2 88  ? 3.015   -3.021  16.300  1.00 22.62 ? 89  ILE A C     1 
ATOM   1152 O  O     . ILE C 2 88  ? 3.852   -3.348  15.456  1.00 23.83 ? 89  ILE A O     1 
ATOM   1153 C  CB    . ILE C 2 88  ? 4.430   -2.240  18.211  1.00 29.95 ? 89  ILE A CB    1 
ATOM   1154 C  CG1   . ILE C 2 88  ? 4.657   -2.335  19.719  1.00 32.47 ? 89  ILE A CG1   1 
ATOM   1155 C  CG2   . ILE C 2 88  ? 4.065   -0.801  17.855  1.00 22.47 ? 89  ILE A CG2   1 
ATOM   1156 C  CD1   . ILE C 2 88  ? 5.806   -1.503  20.209  1.00 31.64 ? 89  ILE A CD1   1 
ATOM   1157 N  N     . ASP C 2 89  ? 1.835   -2.513  15.985  1.00 22.65 ? 90  ASP A N     1 
ATOM   1158 C  CA    . ASP C 2 89  ? 1.447   -2.304  14.607  1.00 20.72 ? 90  ASP A CA    1 
ATOM   1159 C  C     . ASP C 2 89  ? 1.070   -0.851  14.360  1.00 18.18 ? 90  ASP A C     1 
ATOM   1160 O  O     . ASP C 2 89  ? 0.271   -0.268  15.092  1.00 19.82 ? 90  ASP A O     1 
ATOM   1161 C  CB    . ASP C 2 89  ? 0.273   -3.218  14.265  1.00 25.00 ? 90  ASP A CB    1 
ATOM   1162 C  CG    . ASP C 2 89  ? 0.346   -3.753  12.852  1.00 26.27 ? 90  ASP A CG    1 
ATOM   1163 O  OD1   . ASP C 2 89  ? 1.469   -4.094  12.414  1.00 24.71 ? 90  ASP A OD1   1 
ATOM   1164 O  OD2   . ASP C 2 89  ? -0.713  -3.832  12.190  1.00 30.81 ? 90  ASP A OD2   1 
ATOM   1165 N  N     . ILE C 2 90  ? 1.651   -0.276  13.316  1.00 17.23 ? 91  ILE A N     1 
ATOM   1166 C  CA    . ILE C 2 90  ? 1.387   1.109   12.958  1.00 18.68 ? 91  ILE A CA    1 
ATOM   1167 C  C     . ILE C 2 90  ? 0.254   1.216   11.931  1.00 20.09 ? 91  ILE A C     1 
ATOM   1168 O  O     . ILE C 2 90  ? 0.308   0.603   10.864  1.00 20.27 ? 91  ILE A O     1 
ATOM   1169 C  CB    . ILE C 2 90  ? 2.674   1.775   12.416  1.00 25.47 ? 91  ILE A CB    1 
ATOM   1170 C  CG1   . ILE C 2 90  ? 3.780   1.638   13.464  1.00 20.65 ? 91  ILE A CG1   1 
ATOM   1171 C  CG2   . ILE C 2 90  ? 2.427   3.270   12.080  1.00 20.38 ? 91  ILE A CG2   1 
ATOM   1172 C  CD1   . ILE C 2 90  ? 5.113   2.117   13.005  1.00 41.02 ? 91  ILE A CD1   1 
ATOM   1173 N  N     . LYS C 2 91  ? -0.763  1.999   12.266  1.00 17.70 ? 92  LYS A N     1 
ATOM   1174 C  CA    . LYS C 2 91  ? -1.911  2.198   11.403  1.00 19.65 ? 92  LYS A CA    1 
ATOM   1175 C  C     . LYS C 2 91  ? -2.205  3.675   11.167  1.00 20.49 ? 92  LYS A C     1 
ATOM   1176 O  O     . LYS C 2 91  ? -2.112  4.492   12.077  1.00 20.24 ? 92  LYS A O     1 
ATOM   1177 C  CB    . LYS C 2 91  ? -3.120  1.473   11.986  1.00 21.84 ? 92  LYS A CB    1 
ATOM   1178 C  CG    . LYS C 2 91  ? -2.833  -0.009  12.076  1.00 27.57 ? 92  LYS A CG    1 
ATOM   1179 C  CD    . LYS C 2 91  ? -4.046  -0.832  12.245  1.00 30.69 ? 92  LYS A CD    1 
ATOM   1180 C  CE    . LYS C 2 91  ? -3.750  -2.206  11.702  1.00 31.92 ? 92  LYS A CE    1 
ATOM   1181 N  NZ    . LYS C 2 91  ? -3.511  -2.129  10.240  1.00 28.46 ? 92  LYS A NZ    1 
ATOM   1182 N  N     . THR C 2 92  ? -2.564  4.005   9.933   1.00 18.04 ? 93  THR A N     1 
ATOM   1183 C  CA    . THR C 2 92  ? -2.833  5.377   9.548   1.00 17.43 ? 93  THR A CA    1 
ATOM   1184 C  C     . THR C 2 92  ? -4.208  5.554   8.918   1.00 19.83 ? 93  THR A C     1 
ATOM   1185 O  O     . THR C 2 92  ? -4.763  4.634   8.312   1.00 20.79 ? 93  THR A O     1 
ATOM   1186 C  CB    . THR C 2 92  ? -1.774  5.846   8.524   1.00 18.24 ? 93  THR A CB    1 
ATOM   1187 O  OG1   . THR C 2 92  ? -0.460  5.538   9.011   1.00 22.12 ? 93  THR A OG1   1 
ATOM   1188 C  CG2   . THR C 2 92  ? -1.869  7.339   8.274   1.00 17.88 ? 93  THR A CG2   1 
ATOM   1189 N  N     . THR C 2 93  ? -4.762  6.747   9.088   1.00 18.24 ? 94  THR A N     1 
ATOM   1190 C  CA    . THR C 2 93  ? -6.023  7.119   8.476   1.00 15.27 ? 94  THR A CA    1 
ATOM   1191 C  C     . THR C 2 93  ? -6.030  8.643   8.384   1.00 18.90 ? 94  THR A C     1 
ATOM   1192 O  O     . THR C 2 93  ? -5.222  9.320   9.021   1.00 17.52 ? 94  THR A O     1 
ATOM   1193 C  CB    . THR C 2 93  ? -7.255  6.589   9.222   1.00 22.47 ? 94  THR A CB    1 
ATOM   1194 O  OG1   . THR C 2 93  ? -8.391  6.702   8.353   1.00 17.75 ? 94  THR A OG1   1 
ATOM   1195 C  CG2   . THR C 2 93  ? -7.522  7.381   10.516  1.00 21.53 ? 94  THR A CG2   1 
ATOM   1196 N  N     . TYR C 2 94  ? -6.931  9.186   7.584   1.00 22.58 ? 95  TYR A N     1 
ATOM   1197 C  CA    . TYR C 2 94  ? -6.975  10.619  7.402   1.00 23.74 ? 95  TYR A CA    1 
ATOM   1198 C  C     . TYR C 2 94  ? -8.316  11.189  7.781   1.00 25.70 ? 95  TYR A C     1 
ATOM   1199 O  O     . TYR C 2 94  ? -9.293  10.460  7.944   1.00 25.25 ? 95  TYR A O     1 
ATOM   1200 C  CB    . TYR C 2 94  ? -6.648  10.982  5.948   1.00 24.82 ? 95  TYR A CB    1 
ATOM   1201 C  CG    . TYR C 2 94  ? -7.804  10.831  4.985   1.00 32.99 ? 95  TYR A CG    1 
ATOM   1202 C  CD1   . TYR C 2 94  ? -8.225  9.572   4.558   1.00 32.66 ? 95  TYR A CD1   1 
ATOM   1203 C  CD2   . TYR C 2 94  ? -8.483  11.951  4.505   1.00 34.34 ? 95  TYR A CD2   1 
ATOM   1204 C  CE1   . TYR C 2 94  ? -9.292  9.434   3.678   1.00 33.15 ? 95  TYR A CE1   1 
ATOM   1205 C  CE2   . TYR C 2 94  ? -9.547  11.824  3.624   1.00 37.26 ? 95  TYR A CE2   1 
ATOM   1206 C  CZ    . TYR C 2 94  ? -9.946  10.563  3.214   1.00 39.68 ? 95  TYR A CZ    1 
ATOM   1207 O  OH    . TYR C 2 94  ? -10.991 10.437  2.333   1.00 36.41 ? 95  TYR A OH    1 
ATOM   1208 N  N     . THR C 2 95  ? -8.347  12.506  7.916   1.00 27.16 ? 96  THR A N     1 
ATOM   1209 C  CA    . THR C 2 95  ? -9.553  13.221  8.257   1.00 31.88 ? 96  THR A CA    1 
ATOM   1210 C  C     . THR C 2 95  ? -9.525  14.456  7.353   1.00 37.10 ? 96  THR A C     1 
ATOM   1211 O  O     . THR C 2 95  ? -8.443  14.927  6.977   1.00 35.99 ? 96  THR A O     1 
ATOM   1212 C  CB    . THR C 2 95  ? -9.540  13.586  9.752   1.00 28.51 ? 96  THR A CB    1 
ATOM   1213 O  OG1   . THR C 2 95  ? -10.884 13.710  10.222  1.00 37.21 ? 96  THR A OG1   1 
ATOM   1214 C  CG2   . THR C 2 95  ? -8.776  14.875  9.995   1.00 26.39 ? 96  THR A CG2   1 
ATOM   1215 N  N     . ASN C 2 96  ? -10.698 14.965  6.983   1.00 41.39 ? 97  ASN A N     1 
ATOM   1216 C  CA    . ASN C 2 96  ? -10.760 16.141  6.111   1.00 47.11 ? 97  ASN A CA    1 
ATOM   1217 C  C     . ASN C 2 96  ? -10.757 17.451  6.882   1.00 50.65 ? 97  ASN A C     1 
ATOM   1218 O  O     . ASN C 2 96  ? -10.249 18.460  6.403   1.00 52.03 ? 97  ASN A O     1 
ATOM   1219 C  CB    . ASN C 2 96  ? -11.972 16.082  5.189   1.00 43.96 ? 97  ASN A CB    1 
ATOM   1220 C  CG    . ASN C 2 96  ? -11.681 15.342  3.903   1.00 46.97 ? 97  ASN A CG    1 
ATOM   1221 O  OD1   . ASN C 2 96  ? -12.432 14.452  3.509   1.00 49.05 ? 97  ASN A OD1   1 
ATOM   1222 N  ND2   . ASN C 2 96  ? -10.587 15.705  3.239   1.00 53.64 ? 97  ASN A ND2   1 
ATOM   1223 N  N     . LYS C 2 97  ? -11.331 17.421  8.075   1.00 53.57 ? 98  LYS A N     1 
ATOM   1224 C  CA    . LYS C 2 97  ? -11.382 18.576  8.949   1.00 56.49 ? 98  LYS A CA    1 
ATOM   1225 C  C     . LYS C 2 97  ? -11.166 17.955  10.324  1.00 58.47 ? 98  LYS A C     1 
ATOM   1226 O  O     . LYS C 2 97  ? -11.796 16.952  10.657  1.00 58.11 ? 98  LYS A O     1 
ATOM   1227 C  CB    . LYS C 2 97  ? -12.748 19.289  8.855   1.00 59.68 ? 98  LYS A CB    1 
ATOM   1228 C  CG    . LYS C 2 97  ? -13.968 18.404  9.119   1.00 63.52 ? 98  LYS A CG    1 
ATOM   1229 C  CD    . LYS C 2 97  ? -15.282 19.189  9.209   1.00 69.37 ? 98  LYS A CD    1 
ATOM   1230 C  CE    . LYS C 2 97  ? -15.230 20.316  10.254  1.00 71.60 ? 98  LYS A CE    1 
ATOM   1231 N  NZ    . LYS C 2 97  ? -14.540 19.938  11.526  1.00 75.80 ? 98  LYS A NZ    1 
ATOM   1232 N  N     . GLU C 2 98  ? -10.263 18.538  11.105  1.00 61.51 ? 99  GLU A N     1 
ATOM   1233 C  CA    . GLU C 2 98  ? -9.957  18.019  12.438  1.00 65.45 ? 99  GLU A CA    1 
ATOM   1234 C  C     . GLU C 2 98  ? -11.218 17.812  13.276  1.00 65.87 ? 99  GLU A C     1 
ATOM   1235 O  O     . GLU C 2 98  ? -12.193 18.560  13.148  1.00 65.27 ? 99  GLU A O     1 
ATOM   1236 C  CB    . GLU C 2 98  ? -9.002  18.960  13.165  1.00 72.13 ? 99  GLU A CB    1 
ATOM   1237 C  CG    . GLU C 2 98  ? -7.679  19.183  12.437  1.00 81.72 ? 99  GLU A CG    1 
ATOM   1238 C  CD    . GLU C 2 98  ? -6.726  20.089  13.195  1.00 90.47 ? 99  GLU A CD    1 
ATOM   1239 O  OE1   . GLU C 2 98  ? -6.907  20.253  14.424  1.00 94.64 ? 99  GLU A OE1   1 
ATOM   1240 O  OE2   . GLU C 2 98  ? -5.795  20.631  12.554  1.00 89.53 ? 99  GLU A OE2   1 
ATOM   1241 N  N     . ASN C 2 99  ? -11.175 16.789  14.127  1.00 65.78 ? 100 ASN A N     1 
ATOM   1242 C  CA    . ASN C 2 99  ? -12.280 16.431  15.024  1.00 67.35 ? 100 ASN A CA    1 
ATOM   1243 C  C     . ASN C 2 99  ? -13.488 15.709  14.417  1.00 65.19 ? 100 ASN A C     1 
ATOM   1244 O  O     . ASN C 2 99  ? -14.584 15.747  14.983  1.00 66.25 ? 100 ASN A O     1 
ATOM   1245 C  CB    . ASN C 2 99  ? -12.745 17.660  15.817  1.00 75.49 ? 100 ASN A CB    1 
ATOM   1246 C  CG    . ASN C 2 99  ? -11.612 18.307  16.579  1.00 84.18 ? 100 ASN A CG    1 
ATOM   1247 O  OD1   . ASN C 2 99  ? -10.962 17.656  17.408  1.00 88.23 ? 100 ASN A OD1   1 
ATOM   1248 N  ND2   . ASN C 2 99  ? -11.355 19.583  16.305  1.00 85.68 ? 100 ASN A ND2   1 
ATOM   1249 N  N     . GLU C 2 100 ? -13.287 15.060  13.272  1.00 60.16 ? 101 GLU A N     1 
ATOM   1250 C  CA    . GLU C 2 100 ? -14.350 14.267  12.647  1.00 54.38 ? 101 GLU A CA    1 
ATOM   1251 C  C     . GLU C 2 100 ? -14.216 12.863  13.237  1.00 47.34 ? 101 GLU A C     1 
ATOM   1252 O  O     . GLU C 2 100 ? -13.299 12.598  14.018  1.00 45.79 ? 101 GLU A O     1 
ATOM   1253 C  CB    . GLU C 2 100 ? -14.144 14.155  11.137  1.00 57.94 ? 101 GLU A CB    1 
ATOM   1254 C  CG    . GLU C 2 100 ? -14.644 15.312  10.317  1.00 65.12 ? 101 GLU A CG    1 
ATOM   1255 C  CD    . GLU C 2 100 ? -14.504 15.055  8.818   1.00 71.87 ? 101 GLU A CD    1 
ATOM   1256 O  OE1   . GLU C 2 100 ? -13.515 14.405  8.394   1.00 68.64 ? 101 GLU A OE1   1 
ATOM   1257 O  OE2   . GLU C 2 100 ? -15.390 15.506  8.061   1.00 76.48 ? 101 GLU A OE2   1 
ATOM   1258 N  N     . LYS C 2 101 ? -15.122 11.961  12.880  1.00 42.93 ? 102 LYS A N     1 
ATOM   1259 C  CA    . LYS C 2 101 ? -15.010 10.592  13.377  1.00 35.59 ? 102 LYS A CA    1 
ATOM   1260 C  C     . LYS C 2 101 ? -14.031 9.874   12.458  1.00 32.66 ? 102 LYS A C     1 
ATOM   1261 O  O     . LYS C 2 101 ? -13.982 10.142  11.248  1.00 29.66 ? 102 LYS A O     1 
ATOM   1262 C  CB    . LYS C 2 101 ? -16.364 9.889   13.365  1.00 32.85 ? 102 LYS A CB    1 
ATOM   1263 C  CG    . LYS C 2 101 ? -17.295 10.348  14.468  1.00 48.07 ? 102 LYS A CG    1 
ATOM   1264 C  CD    . LYS C 2 101 ? -18.526 9.476   14.549  1.00 56.85 ? 102 LYS A CD    1 
ATOM   1265 C  CE    . LYS C 2 101 ? -19.305 9.779   15.809  1.00 64.52 ? 102 LYS A CE    1 
ATOM   1266 N  NZ    . LYS C 2 101 ? -20.524 8.945   15.879  1.00 65.89 ? 102 LYS A NZ    1 
ATOM   1267 N  N     . ILE C 2 102 ? -13.246 8.972   13.029  1.00 26.16 ? 103 ILE A N     1 
ATOM   1268 C  CA    . ILE C 2 102 ? -12.275 8.218   12.256  1.00 26.10 ? 103 ILE A CA    1 
ATOM   1269 C  C     . ILE C 2 102 ? -12.426 6.729   12.545  1.00 24.05 ? 103 ILE A C     1 
ATOM   1270 O  O     . ILE C 2 102 ? -13.088 6.347   13.510  1.00 24.84 ? 103 ILE A O     1 
ATOM   1271 C  CB    . ILE C 2 102 ? -10.837 8.646   12.604  1.00 25.75 ? 103 ILE A CB    1 
ATOM   1272 C  CG1   . ILE C 2 102 ? -10.610 8.519   14.108  1.00 25.50 ? 103 ILE A CG1   1 
ATOM   1273 C  CG2   . ILE C 2 102 ? -10.598 10.081  12.169  1.00 29.75 ? 103 ILE A CG2   1 
ATOM   1274 C  CD1   . ILE C 2 102 ? -9.213  8.826   14.534  1.00 26.08 ? 103 ILE A CD1   1 
ATOM   1275 N  N     . LYS C 2 103 ? -11.829 5.896   11.701  1.00 21.38 ? 104 LYS A N     1 
ATOM   1276 C  CA    . LYS C 2 103 ? -11.860 4.450   11.891  1.00 21.64 ? 104 LYS A CA    1 
ATOM   1277 C  C     . LYS C 2 103 ? -10.625 3.868   11.240  1.00 20.60 ? 104 LYS A C     1 
ATOM   1278 O  O     . LYS C 2 103 ? -10.064 4.463   10.319  1.00 22.05 ? 104 LYS A O     1 
ATOM   1279 C  CB    . LYS C 2 103 ? -13.131 3.825   11.304  1.00 23.66 ? 104 LYS A CB    1 
ATOM   1280 C  CG    . LYS C 2 103 ? -13.317 4.021   9.832   1.00 28.15 ? 104 LYS A CG    1 
ATOM   1281 C  CD    . LYS C 2 103 ? -14.703 3.560   9.412   1.00 42.68 ? 104 LYS A CD    1 
ATOM   1282 C  CE    . LYS C 2 103 ? -14.927 3.741   7.902   1.00 48.59 ? 104 LYS A CE    1 
ATOM   1283 N  NZ    . LYS C 2 103 ? -14.772 5.153   7.426   1.00 46.92 ? 104 LYS A NZ    1 
ATOM   1284 N  N     . PHE C 2 104 ? -10.194 2.712   11.728  1.00 16.85 ? 105 PHE A N     1 
ATOM   1285 C  CA    . PHE C 2 104 ? -9.015  2.052   11.200  1.00 14.78 ? 105 PHE A CA    1 
ATOM   1286 C  C     . PHE C 2 104 ? -9.381  0.626   10.813  1.00 14.82 ? 105 PHE A C     1 
ATOM   1287 O  O     . PHE C 2 104 ? -10.433 0.118   11.219  1.00 14.22 ? 105 PHE A O     1 
ATOM   1288 C  CB    . PHE C 2 104 ? -7.909  1.977   12.260  1.00 9.35  ? 105 PHE A CB    1 
ATOM   1289 C  CG    . PHE C 2 104 ? -7.405  3.318   12.733  1.00 17.68 ? 105 PHE A CG    1 
ATOM   1290 C  CD1   . PHE C 2 104 ? -8.050  3.994   13.770  1.00 7.66  ? 105 PHE A CD1   1 
ATOM   1291 C  CD2   . PHE C 2 104 ? -6.272  3.898   12.152  1.00 17.46 ? 105 PHE A CD2   1 
ATOM   1292 C  CE1   . PHE C 2 104 ? -7.578  5.224   14.225  1.00 16.03 ? 105 PHE A CE1   1 
ATOM   1293 C  CE2   . PHE C 2 104 ? -5.786  5.138   12.601  1.00 22.60 ? 105 PHE A CE2   1 
ATOM   1294 C  CZ    . PHE C 2 104 ? -6.442  5.799   13.640  1.00 16.46 ? 105 PHE A CZ    1 
ATOM   1295 N  N     . THR C 2 105 ? -8.517  -0.008  10.028  1.00 9.99  ? 106 THR A N     1 
ATOM   1296 C  CA    . THR C 2 105 ? -8.706  -1.403  9.658   1.00 13.85 ? 106 THR A CA    1 
ATOM   1297 C  C     . THR C 2 105 ? -7.675  -2.029  10.598  1.00 13.55 ? 106 THR A C     1 
ATOM   1298 O  O     . THR C 2 105 ? -6.522  -1.629  10.596  1.00 14.26 ? 106 THR A O     1 
ATOM   1299 C  CB    . THR C 2 105 ? -8.403  -1.661  8.149   1.00 14.09 ? 106 THR A CB    1 
ATOM   1300 O  OG1   . THR C 2 105 ? -7.116  -1.133  7.794   1.00 19.16 ? 106 THR A OG1   1 
ATOM   1301 C  CG2   . THR C 2 105 ? -9.467  -1.012  7.284   1.00 8.69  ? 106 THR A CG2   1 
ATOM   1302 N  N     . LEU C 2 106 ? -8.091  -2.993  11.410  1.00 16.84 ? 107 LEU A N     1 
ATOM   1303 C  CA    . LEU C 2 106 ? -7.193  -3.575  12.408  1.00 21.06 ? 107 LEU A CA    1 
ATOM   1304 C  C     . LEU C 2 106 ? -6.521  -4.906  12.111  1.00 22.04 ? 107 LEU A C     1 
ATOM   1305 O  O     . LEU C 2 106 ? -6.070  -5.591  13.037  1.00 26.49 ? 107 LEU A O     1 
ATOM   1306 C  CB    . LEU C 2 106 ? -7.916  -3.654  13.770  1.00 17.31 ? 107 LEU A CB    1 
ATOM   1307 C  CG    . LEU C 2 106 ? -8.393  -2.318  14.347  1.00 19.19 ? 107 LEU A CG    1 
ATOM   1308 C  CD1   . LEU C 2 106 ? -9.252  -2.553  15.567  1.00 22.30 ? 107 LEU A CD1   1 
ATOM   1309 C  CD2   . LEU C 2 106 ? -7.192  -1.431  14.678  1.00 14.60 ? 107 LEU A CD2   1 
ATOM   1310 N  N     . GLY C 2 107 ? -6.434  -5.277  10.842  1.00 17.53 ? 108 GLY A N     1 
ATOM   1311 C  CA    . GLY C 2 107 ? -5.802  -6.544  10.516  1.00 17.19 ? 108 GLY A CA    1 
ATOM   1312 C  C     . GLY C 2 107 ? -6.828  -7.591  10.134  1.00 12.31 ? 108 GLY A C     1 
ATOM   1313 O  O     . GLY C 2 107 ? -8.030  -7.414  10.364  1.00 16.31 ? 108 GLY A O     1 
ATOM   1314 N  N     . GLY C 2 108 ? -6.367  -8.687  9.551   1.00 14.26 ? 109 GLY A N     1 
ATOM   1315 C  CA    . GLY C 2 108 ? -7.290  -9.719  9.126   1.00 15.27 ? 109 GLY A CA    1 
ATOM   1316 C  C     . GLY C 2 108 ? -7.925  -10.489 10.267  1.00 19.39 ? 109 GLY A C     1 
ATOM   1317 O  O     . GLY C 2 108 ? -7.371  -10.571 11.362  1.00 19.68 ? 109 GLY A O     1 
ATOM   1318 N  N     . TYR C 2 109 ? -9.100  -11.053 10.025  1.00 19.89 ? 110 TYR A N     1 
ATOM   1319 C  CA    . TYR C 2 109 ? -9.731  -11.855 11.046  1.00 20.57 ? 110 TYR A CA    1 
ATOM   1320 C  C     . TYR C 2 109 ? -9.755  -13.327 10.637  1.00 21.40 ? 110 TYR A C     1 
ATOM   1321 O  O     . TYR C 2 109 ? -10.361 -14.148 11.312  1.00 21.98 ? 110 TYR A O     1 
ATOM   1322 C  CB    . TYR C 2 109 ? -11.136 -11.340 11.382  1.00 20.94 ? 110 TYR A CB    1 
ATOM   1323 C  CG    . TYR C 2 109 ? -12.143 -11.275 10.249  1.00 23.87 ? 110 TYR A CG    1 
ATOM   1324 C  CD1   . TYR C 2 109 ? -12.782 -12.428 9.787   1.00 22.88 ? 110 TYR A CD1   1 
ATOM   1325 C  CD2   . TYR C 2 109 ? -12.498 -10.051 9.677   1.00 17.40 ? 110 TYR A CD2   1 
ATOM   1326 C  CE1   . TYR C 2 109 ? -13.754 -12.364 8.787   1.00 19.19 ? 110 TYR A CE1   1 
ATOM   1327 C  CE2   . TYR C 2 109 ? -13.467 -9.973  8.677   1.00 20.23 ? 110 TYR A CE2   1 
ATOM   1328 C  CZ    . TYR C 2 109 ? -14.089 -11.137 8.242   1.00 23.88 ? 110 TYR A CZ    1 
ATOM   1329 O  OH    . TYR C 2 109 ? -15.056 -11.081 7.281   1.00 17.89 ? 110 TYR A OH    1 
ATOM   1330 N  N     . THR C 2 110 ? -9.088  -13.668 9.539   1.00 18.17 ? 111 THR A N     1 
ATOM   1331 C  CA    . THR C 2 110 ? -9.085  -15.060 9.103   1.00 21.61 ? 111 THR A CA    1 
ATOM   1332 C  C     . THR C 2 110 ? -7.692  -15.678 9.064   1.00 21.77 ? 111 THR A C     1 
ATOM   1333 O  O     . THR C 2 110 ? -7.535  -16.808 8.606   1.00 23.01 ? 111 THR A O     1 
ATOM   1334 C  CB    . THR C 2 110 ? -9.772  -15.250 7.716   1.00 16.79 ? 111 THR A CB    1 
ATOM   1335 O  OG1   . THR C 2 110 ? -8.976  -14.641 6.698   1.00 19.36 ? 111 THR A OG1   1 
ATOM   1336 C  CG2   . THR C 2 110 ? -11.149 -14.613 7.701   1.00 13.84 ? 111 THR A CG2   1 
ATOM   1337 N  N     . SER C 2 111 ? -6.689  -14.943 9.546   1.00 21.27 ? 112 SER A N     1 
ATOM   1338 C  CA    . SER C 2 111 ? -5.314  -15.441 9.563   1.00 22.96 ? 112 SER A CA    1 
ATOM   1339 C  C     . SER C 2 111 ? -4.870  -15.896 10.970  1.00 24.71 ? 112 SER A C     1 
ATOM   1340 O  O     . SER C 2 111 ? -5.504  -16.770 11.550  1.00 21.54 ? 112 SER A O     1 
ATOM   1341 C  CB    . SER C 2 111 ? -4.354  -14.390 8.979   1.00 24.78 ? 112 SER A CB    1 
ATOM   1342 O  OG    . SER C 2 111 ? -4.532  -13.122 9.597   1.00 22.01 ? 112 SER A OG    1 
ATOM   1343 N  N     . PHE C 2 112 ? -3.808  -15.303 11.518  1.00 26.54 ? 113 PHE A N     1 
ATOM   1344 C  CA    . PHE C 2 112 ? -3.285  -15.685 12.833  1.00 24.47 ? 113 PHE A CA    1 
ATOM   1345 C  C     . PHE C 2 112 ? -4.265  -15.758 14.015  1.00 25.46 ? 113 PHE A C     1 
ATOM   1346 O  O     . PHE C 2 112 ? -3.987  -16.487 14.971  1.00 26.56 ? 113 PHE A O     1 
ATOM   1347 C  CB    . PHE C 2 112 ? -2.066  -14.832 13.206  1.00 25.78 ? 113 PHE A CB    1 
ATOM   1348 C  CG    . PHE C 2 112 ? -2.321  -13.351 13.160  1.00 32.48 ? 113 PHE A CG    1 
ATOM   1349 C  CD1   . PHE C 2 112 ? -2.951  -12.708 14.223  1.00 20.79 ? 113 PHE A CD1   1 
ATOM   1350 C  CD2   . PHE C 2 112 ? -1.952  -12.601 12.043  1.00 26.00 ? 113 PHE A CD2   1 
ATOM   1351 C  CE1   . PHE C 2 112 ? -3.215  -11.347 14.179  1.00 19.75 ? 113 PHE A CE1   1 
ATOM   1352 C  CE2   . PHE C 2 112 ? -2.211  -11.231 11.987  1.00 30.54 ? 113 PHE A CE2   1 
ATOM   1353 C  CZ    . PHE C 2 112 ? -2.845  -10.603 13.058  1.00 30.45 ? 113 PHE A CZ    1 
ATOM   1354 N  N     . ILE C 2 113 ? -5.392  -15.039 13.992  1.00 22.97 ? 114 ILE A N     1 
ATOM   1355 C  CA    . ILE C 2 113 ? -6.313  -15.178 15.129  1.00 26.68 ? 114 ILE A CA    1 
ATOM   1356 C  C     . ILE C 2 113 ? -7.097  -16.493 15.033  1.00 27.20 ? 114 ILE A C     1 
ATOM   1357 O  O     . ILE C 2 113 ? -7.661  -16.953 16.023  1.00 25.32 ? 114 ILE A O     1 
ATOM   1358 C  CB    . ILE C 2 113 ? -7.330  -13.990 15.332  1.00 27.23 ? 114 ILE A CB    1 
ATOM   1359 C  CG1   . ILE C 2 113 ? -8.474  -14.059 14.330  1.00 26.59 ? 114 ILE A CG1   1 
ATOM   1360 C  CG2   . ILE C 2 113 ? -6.616  -12.649 15.307  1.00 26.02 ? 114 ILE A CG2   1 
ATOM   1361 C  CD1   . ILE C 2 113 ? -9.653  -13.202 14.739  1.00 25.98 ? 114 ILE A CD1   1 
ATOM   1362 N  N     . ARG C 2 114 ? -7.135  -17.091 13.843  1.00 26.53 ? 115 ARG A N     1 
ATOM   1363 C  CA    . ARG C 2 114 ? -7.834  -18.360 13.655  1.00 28.34 ? 115 ARG A CA    1 
ATOM   1364 C  C     . ARG C 2 114 ? -6.844  -19.503 13.505  1.00 30.94 ? 115 ARG A C     1 
ATOM   1365 O  O     . ARG C 2 114 ? -7.169  -20.653 13.780  1.00 31.83 ? 115 ARG A O     1 
ATOM   1366 C  CB    . ARG C 2 114 ? -8.762  -18.306 12.438  1.00 27.13 ? 115 ARG A CB    1 
ATOM   1367 C  CG    . ARG C 2 114 ? -9.977  -17.452 12.671  1.00 17.48 ? 115 ARG A CG    1 
ATOM   1368 C  CD    . ARG C 2 114 ? -11.033 -17.587 11.600  1.00 18.36 ? 115 ARG A CD    1 
ATOM   1369 N  NE    . ARG C 2 114 ? -11.975 -16.471 11.712  1.00 11.88 ? 115 ARG A NE    1 
ATOM   1370 C  CZ    . ARG C 2 114 ? -13.248 -16.502 11.341  1.00 23.52 ? 115 ARG A CZ    1 
ATOM   1371 N  NH1   . ARG C 2 114 ? -13.783 -17.603 10.818  1.00 25.70 ? 115 ARG A NH1   1 
ATOM   1372 N  NH2   . ARG C 2 114 ? -13.992 -15.418 11.498  1.00 16.49 ? 115 ARG A NH2   1 
ATOM   1373 N  N     . ASN C 2 115 ? -5.634  -19.175 13.072  1.00 33.41 ? 116 ASN A N     1 
ATOM   1374 C  CA    . ASN C 2 115 ? -4.572  -20.151 12.864  1.00 38.80 ? 116 ASN A CA    1 
ATOM   1375 C  C     . ASN C 2 115 ? -3.289  -19.589 13.471  1.00 38.83 ? 116 ASN A C     1 
ATOM   1376 O  O     . ASN C 2 115 ? -2.612  -18.757 12.869  1.00 42.17 ? 116 ASN A O     1 
ATOM   1377 C  CB    . ASN C 2 115 ? -4.381  -20.389 11.360  1.00 47.46 ? 116 ASN A CB    1 
ATOM   1378 C  CG    . ASN C 2 115 ? -3.336  -21.459 11.055  1.00 60.04 ? 116 ASN A CG    1 
ATOM   1379 O  OD1   . ASN C 2 115 ? -2.238  -21.482 11.631  1.00 56.44 ? 116 ASN A OD1   1 
ATOM   1380 N  ND2   . ASN C 2 115 ? -3.677  -22.353 10.138  1.00 64.08 ? 116 ASN A ND2   1 
ATOM   1381 N  N     . ASN C 2 116 ? -2.972  -20.060 14.666  1.00 35.59 ? 117 ASN A N     1 
ATOM   1382 C  CA    . ASN C 2 116 ? -1.799  -19.651 15.440  1.00 33.09 ? 117 ASN A CA    1 
ATOM   1383 C  C     . ASN C 2 116 ? -0.476  -19.272 14.717  1.00 30.92 ? 117 ASN A C     1 
ATOM   1384 O  O     . ASN C 2 116 ? 0.316   -18.501 15.261  1.00 28.89 ? 117 ASN A O     1 
ATOM   1385 C  CB    . ASN C 2 116 ? -1.541  -20.752 16.485  1.00 35.19 ? 117 ASN A CB    1 
ATOM   1386 C  CG    . ASN C 2 116 ? -0.485  -20.379 17.502  1.00 39.94 ? 117 ASN A CG    1 
ATOM   1387 O  OD1   . ASN C 2 116 ? -0.666  -19.442 18.275  1.00 47.49 ? 117 ASN A OD1   1 
ATOM   1388 N  ND2   . ASN C 2 116 ? 0.622   -21.116 17.516  1.00 34.13 ? 117 ASN A ND2   1 
ATOM   1389 N  N     . THR C 2 117 ? -0.220  -19.790 13.514  1.00 30.91 ? 118 THR A N     1 
ATOM   1390 C  CA    . THR C 2 117 ? 1.048   -19.491 12.817  1.00 30.22 ? 118 THR A CA    1 
ATOM   1391 C  C     . THR C 2 117 ? 0.923   -18.861 11.433  1.00 28.97 ? 118 THR A C     1 
ATOM   1392 O  O     . THR C 2 117 ? 1.923   -18.689 10.734  1.00 27.71 ? 118 THR A O     1 
ATOM   1393 C  CB    . THR C 2 117 ? 1.887   -20.769 12.625  1.00 33.45 ? 118 THR A CB    1 
ATOM   1394 O  OG1   . THR C 2 117 ? 1.050   -21.803 12.086  1.00 35.89 ? 118 THR A OG1   1 
ATOM   1395 C  CG2   . THR C 2 117 ? 2.491   -21.231 13.942  1.00 33.55 ? 118 THR A CG2   1 
ATOM   1396 N  N     . LYS C 2 118 ? -0.295  -18.517 11.042  1.00 26.86 ? 119 LYS A N     1 
ATOM   1397 C  CA    . LYS C 2 118 ? -0.559  -17.951 9.725   1.00 29.34 ? 119 LYS A CA    1 
ATOM   1398 C  C     . LYS C 2 118 ? -0.303  -16.441 9.598   1.00 30.59 ? 119 LYS A C     1 
ATOM   1399 O  O     . LYS C 2 118 ? -0.905  -15.640 10.315  1.00 29.59 ? 119 LYS A O     1 
ATOM   1400 C  CB    . LYS C 2 118 ? -2.002  -18.266 9.350   1.00 30.04 ? 119 LYS A CB    1 
ATOM   1401 C  CG    . LYS C 2 118 ? -2.352  -18.123 7.893   1.00 40.14 ? 119 LYS A CG    1 
ATOM   1402 C  CD    . LYS C 2 118 ? -3.804  -18.476 7.756   1.00 44.92 ? 119 LYS A CD    1 
ATOM   1403 C  CE    . LYS C 2 118 ? -4.281  -18.439 6.338   1.00 49.88 ? 119 LYS A CE    1 
ATOM   1404 N  NZ    . LYS C 2 118 ? -5.735  -18.755 6.382   1.00 40.93 ? 119 LYS A NZ    1 
ATOM   1405 N  N     . ASN C 2 119 ? 0.591   -16.082 8.674   1.00 30.33 ? 120 ASN A N     1 
ATOM   1406 C  CA    . ASN C 2 119 ? 0.963   -14.688 8.369   1.00 31.10 ? 120 ASN A CA    1 
ATOM   1407 C  C     . ASN C 2 119 ? 1.432   -13.872 9.567   1.00 28.60 ? 120 ASN A C     1 
ATOM   1408 O  O     . ASN C 2 119 ? 1.149   -12.676 9.660   1.00 26.34 ? 120 ASN A O     1 
ATOM   1409 C  CB    . ASN C 2 119 ? -0.201  -13.955 7.672   1.00 30.13 ? 120 ASN A CB    1 
ATOM   1410 C  CG    . ASN C 2 119 ? -0.570  -14.579 6.337   1.00 31.99 ? 120 ASN A CG    1 
ATOM   1411 O  OD1   . ASN C 2 119 ? -1.486  -15.391 6.256   1.00 32.45 ? 120 ASN A OD1   1 
ATOM   1412 N  ND2   . ASN C 2 119 ? 0.143   -14.201 5.286   1.00 28.50 ? 120 ASN A ND2   1 
ATOM   1413 N  N     . ILE C 2 120 ? 2.159   -14.515 10.472  1.00 26.66 ? 121 ILE A N     1 
ATOM   1414 C  CA    . ILE C 2 120 ? 2.647   -13.848 11.667  1.00 23.77 ? 121 ILE A CA    1 
ATOM   1415 C  C     . ILE C 2 120 ? 4.090   -14.290 11.901  1.00 23.03 ? 121 ILE A C     1 
ATOM   1416 O  O     . ILE C 2 120 ? 4.444   -15.435 11.636  1.00 25.63 ? 121 ILE A O     1 
ATOM   1417 C  CB    . ILE C 2 120 ? 1.693   -14.157 12.875  1.00 29.05 ? 121 ILE A CB    1 
ATOM   1418 C  CG1   . ILE C 2 120 ? 2.101   -13.353 14.115  1.00 26.37 ? 121 ILE A CG1   1 
ATOM   1419 C  CG2   . ILE C 2 120 ? 1.612   -15.667 13.119  1.00 26.66 ? 121 ILE A CG2   1 
ATOM   1420 C  CD1   . ILE C 2 120 ? 1.017   -13.298 15.188  1.00 17.65 ? 121 ILE A CD1   1 
ATOM   1421 N  N     . VAL C 2 121 ? 4.930   -13.373 12.372  1.00 21.95 ? 122 VAL A N     1 
ATOM   1422 C  CA    . VAL C 2 121 ? 6.341   -13.676 12.602  1.00 24.97 ? 122 VAL A CA    1 
ATOM   1423 C  C     . VAL C 2 121 ? 6.555   -14.800 13.620  1.00 26.19 ? 122 VAL A C     1 
ATOM   1424 O  O     . VAL C 2 121 ? 7.337   -15.715 13.374  1.00 30.34 ? 122 VAL A O     1 
ATOM   1425 C  CB    . VAL C 2 121 ? 7.125   -12.411 13.019  1.00 24.22 ? 122 VAL A CB    1 
ATOM   1426 C  CG1   . VAL C 2 121 ? 8.613   -12.711 13.064  1.00 30.98 ? 122 VAL A CG1   1 
ATOM   1427 C  CG2   . VAL C 2 121 ? 6.858   -11.280 12.024  1.00 27.08 ? 122 VAL A CG2   1 
ATOM   1428 N  N     . TYR C 2 122 ? 5.868   -14.731 14.757  1.00 26.03 ? 123 TYR A N     1 
ATOM   1429 C  CA    . TYR C 2 122 ? 5.966   -15.765 15.785  1.00 24.13 ? 123 TYR A CA    1 
ATOM   1430 C  C     . TYR C 2 122 ? 4.556   -16.228 16.055  1.00 25.36 ? 123 TYR A C     1 
ATOM   1431 O  O     . TYR C 2 122 ? 3.612   -15.456 15.868  1.00 27.94 ? 123 TYR A O     1 
ATOM   1432 C  CB    . TYR C 2 122 ? 6.549   -15.208 17.082  1.00 23.32 ? 123 TYR A CB    1 
ATOM   1433 C  CG    . TYR C 2 122 ? 8.019   -14.931 17.013  1.00 28.31 ? 123 TYR A CG    1 
ATOM   1434 C  CD1   . TYR C 2 122 ? 8.942   -15.958 17.196  1.00 26.98 ? 123 TYR A CD1   1 
ATOM   1435 C  CD2   . TYR C 2 122 ? 8.497   -13.640 16.756  1.00 29.20 ? 123 TYR A CD2   1 
ATOM   1436 C  CE1   . TYR C 2 122 ? 10.312  -15.716 17.123  1.00 30.13 ? 123 TYR A CE1   1 
ATOM   1437 C  CE2   . TYR C 2 122 ? 9.868   -13.383 16.680  1.00 30.51 ? 123 TYR A CE2   1 
ATOM   1438 C  CZ    . TYR C 2 122 ? 10.767  -14.430 16.864  1.00 36.01 ? 123 TYR A CZ    1 
ATOM   1439 O  OH    . TYR C 2 122 ? 12.121  -14.197 16.789  1.00 34.96 ? 123 TYR A OH    1 
ATOM   1440 N  N     . PRO C 2 123 ? 4.383   -17.496 16.488  1.00 28.93 ? 124 PRO A N     1 
ATOM   1441 C  CA    . PRO C 2 123 ? 3.042   -18.020 16.777  1.00 24.62 ? 124 PRO A CA    1 
ATOM   1442 C  C     . PRO C 2 123 ? 2.307   -17.032 17.682  1.00 24.19 ? 124 PRO A C     1 
ATOM   1443 O  O     . PRO C 2 123 ? 2.870   -16.528 18.651  1.00 24.00 ? 124 PRO A O     1 
ATOM   1444 C  CB    . PRO C 2 123 ? 3.341   -19.340 17.476  1.00 27.13 ? 124 PRO A CB    1 
ATOM   1445 C  CG    . PRO C 2 123 ? 4.593   -19.800 16.774  1.00 25.97 ? 124 PRO A CG    1 
ATOM   1446 C  CD    . PRO C 2 123 ? 5.413   -18.526 16.726  1.00 22.87 ? 124 PRO A CD    1 
ATOM   1447 N  N     . PHE C 2 124 ? 1.055   -16.763 17.340  1.00 21.78 ? 125 PHE A N     1 
ATOM   1448 C  CA    . PHE C 2 124 ? 0.181   -15.829 18.037  1.00 23.39 ? 125 PHE A CA    1 
ATOM   1449 C  C     . PHE C 2 124 ? 0.152   -15.989 19.561  1.00 28.59 ? 125 PHE A C     1 
ATOM   1450 O  O     . PHE C 2 124 ? 0.082   -15.000 20.300  1.00 27.54 ? 125 PHE A O     1 
ATOM   1451 C  CB    . PHE C 2 124 ? -1.216  -15.998 17.455  1.00 19.75 ? 125 PHE A CB    1 
ATOM   1452 C  CG    . PHE C 2 124 ? -2.236  -15.035 17.980  1.00 23.00 ? 125 PHE A CG    1 
ATOM   1453 C  CD1   . PHE C 2 124 ? -2.229  -13.703 17.582  1.00 21.23 ? 125 PHE A CD1   1 
ATOM   1454 C  CD2   . PHE C 2 124 ? -3.248  -15.480 18.832  1.00 22.33 ? 125 PHE A CD2   1 
ATOM   1455 C  CE1   . PHE C 2 124 ? -3.221  -12.822 18.020  1.00 22.57 ? 125 PHE A CE1   1 
ATOM   1456 C  CE2   . PHE C 2 124 ? -4.248  -14.612 19.280  1.00 22.14 ? 125 PHE A CE2   1 
ATOM   1457 C  CZ    . PHE C 2 124 ? -4.236  -13.277 18.871  1.00 27.07 ? 125 PHE A CZ    1 
ATOM   1458 N  N     . ASP C 2 125 ? 0.208   -17.231 20.030  1.00 29.33 ? 126 ASP A N     1 
ATOM   1459 C  CA    . ASP C 2 125 ? 0.166   -17.485 21.462  1.00 30.51 ? 126 ASP A CA    1 
ATOM   1460 C  C     . ASP C 2 125 ? 1.408   -17.015 22.225  1.00 27.96 ? 126 ASP A C     1 
ATOM   1461 O  O     . ASP C 2 125 ? 1.400   -16.993 23.453  1.00 32.01 ? 126 ASP A O     1 
ATOM   1462 C  CB    . ASP C 2 125 ? -0.153  -18.967 21.753  1.00 29.97 ? 126 ASP A CB    1 
ATOM   1463 C  CG    . ASP C 2 125 ? 0.843   -19.939 21.122  1.00 37.73 ? 126 ASP A CG    1 
ATOM   1464 O  OD1   . ASP C 2 125 ? 1.859   -19.511 20.532  1.00 50.44 ? 126 ASP A OD1   1 
ATOM   1465 O  OD2   . ASP C 2 125 ? 0.599   -21.156 21.221  1.00 41.41 ? 126 ASP A OD2   1 
ATOM   1466 N  N     . GLN C 2 126 ? 2.465   -16.638 21.512  1.00 24.18 ? 127 GLN A N     1 
ATOM   1467 C  CA    . GLN C 2 126 ? 3.676   -16.147 22.170  1.00 27.19 ? 127 GLN A CA    1 
ATOM   1468 C  C     . GLN C 2 126 ? 3.621   -14.647 22.466  1.00 27.20 ? 127 GLN A C     1 
ATOM   1469 O  O     . GLN C 2 126 ? 4.534   -14.105 23.087  1.00 28.42 ? 127 GLN A O     1 
ATOM   1470 C  CB    . GLN C 2 126 ? 4.914   -16.449 21.330  1.00 28.29 ? 127 GLN A CB    1 
ATOM   1471 C  CG    . GLN C 2 126 ? 5.364   -17.881 21.420  1.00 31.74 ? 127 GLN A CG    1 
ATOM   1472 C  CD    . GLN C 2 126 ? 6.397   -18.228 20.381  1.00 33.38 ? 127 GLN A CD    1 
ATOM   1473 O  OE1   . GLN C 2 126 ? 7.202   -17.392 19.970  1.00 34.14 ? 127 GLN A OE1   1 
ATOM   1474 N  NE2   . GLN C 2 126 ? 6.380   -19.474 19.941  1.00 39.42 ? 127 GLN A NE2   1 
ATOM   1475 N  N     . TYR C 2 127 ? 2.557   -13.981 22.019  1.00 27.28 ? 128 TYR A N     1 
ATOM   1476 C  CA    . TYR C 2 127 ? 2.383   -12.543 22.230  1.00 25.75 ? 128 TYR A CA    1 
ATOM   1477 C  C     . TYR C 2 127 ? 1.408   -12.312 23.372  1.00 25.36 ? 128 TYR A C     1 
ATOM   1478 O  O     . TYR C 2 127 ? 0.336   -12.913 23.402  1.00 26.45 ? 128 TYR A O     1 
ATOM   1479 C  CB    . TYR C 2 127 ? 1.841   -11.864 20.963  1.00 16.39 ? 128 TYR A CB    1 
ATOM   1480 C  CG    . TYR C 2 127 ? 2.820   -11.825 19.809  1.00 16.82 ? 128 TYR A CG    1 
ATOM   1481 C  CD1   . TYR C 2 127 ? 3.758   -10.791 19.695  1.00 16.92 ? 128 TYR A CD1   1 
ATOM   1482 C  CD2   . TYR C 2 127 ? 2.802   -12.813 18.819  1.00 16.89 ? 128 TYR A CD2   1 
ATOM   1483 C  CE1   . TYR C 2 127 ? 4.653   -10.744 18.615  1.00 22.63 ? 128 TYR A CE1   1 
ATOM   1484 C  CE2   . TYR C 2 127 ? 3.690   -12.778 17.736  1.00 18.14 ? 128 TYR A CE2   1 
ATOM   1485 C  CZ    . TYR C 2 127 ? 4.609   -11.744 17.639  1.00 26.76 ? 128 TYR A CZ    1 
ATOM   1486 O  OH    . TYR C 2 127 ? 5.475   -11.709 16.567  1.00 30.30 ? 128 TYR A OH    1 
ATOM   1487 N  N     . ILE C 2 128 ? 1.786   -11.441 24.301  1.00 24.72 ? 129 ILE A N     1 
ATOM   1488 C  CA    . ILE C 2 128 ? 0.953   -11.122 25.456  1.00 26.61 ? 129 ILE A CA    1 
ATOM   1489 C  C     . ILE C 2 128 ? 0.243   -9.791  25.275  1.00 25.56 ? 129 ILE A C     1 
ATOM   1490 O  O     . ILE C 2 128 ? -0.623  -9.436  26.070  1.00 29.15 ? 129 ILE A O     1 
ATOM   1491 C  CB    . ILE C 2 128 ? 1.792   -11.056 26.754  1.00 29.03 ? 129 ILE A CB    1 
ATOM   1492 C  CG1   . ILE C 2 128 ? 2.951   -10.070 26.578  1.00 35.29 ? 129 ILE A CG1   1 
ATOM   1493 C  CG2   . ILE C 2 128 ? 2.312   -12.441 27.096  1.00 37.69 ? 129 ILE A CG2   1 
ATOM   1494 C  CD1   . ILE C 2 128 ? 3.788   -9.864  27.806  1.00 46.51 ? 129 ILE A CD1   1 
ATOM   1495 N  N     . ALA C 2 129 ? 0.610   -9.052  24.234  1.00 23.77 ? 130 ALA A N     1 
ATOM   1496 C  CA    . ALA C 2 129 ? -0.004  -7.758  23.978  1.00 22.43 ? 130 ALA A CA    1 
ATOM   1497 C  C     . ALA C 2 129 ? 0.079   -7.368  22.509  1.00 18.29 ? 130 ALA A C     1 
ATOM   1498 O  O     . ALA C 2 129 ? 1.045   -7.684  21.811  1.00 17.19 ? 130 ALA A O     1 
ATOM   1499 C  CB    . ALA C 2 129 ? 0.656   -6.682  24.840  1.00 22.58 ? 130 ALA A CB    1 
ATOM   1500 N  N     . HIS C 2 130 ? -0.951  -6.677  22.051  1.00 15.47 ? 131 HIS A N     1 
ATOM   1501 C  CA    . HIS C 2 130 ? -1.015  -6.209  20.680  1.00 16.37 ? 131 HIS A CA    1 
ATOM   1502 C  C     . HIS C 2 130 ? -1.365  -4.737  20.745  1.00 17.33 ? 131 HIS A C     1 
ATOM   1503 O  O     . HIS C 2 130 ? -2.519  -4.354  21.001  1.00 15.76 ? 131 HIS A O     1 
ATOM   1504 C  CB    . HIS C 2 130 ? -2.057  -7.005  19.886  1.00 17.94 ? 131 HIS A CB    1 
ATOM   1505 C  CG    . HIS C 2 130 ? -1.757  -8.470  19.816  1.00 21.04 ? 131 HIS A CG    1 
ATOM   1506 N  ND1   . HIS C 2 130 ? -0.896  -9.012  18.883  1.00 23.74 ? 131 HIS A ND1   1 
ATOM   1507 C  CD2   . HIS C 2 130 ? -2.173  -9.503  20.587  1.00 16.75 ? 131 HIS A CD2   1 
ATOM   1508 C  CE1   . HIS C 2 130 ? -0.793  -10.313 19.085  1.00 25.52 ? 131 HIS A CE1   1 
ATOM   1509 N  NE2   . HIS C 2 130 ? -1.558  -10.636 20.114  1.00 18.54 ? 131 HIS A NE2   1 
ATOM   1510 N  N     . TRP C 2 131 ? -0.341  -3.920  20.520  1.00 17.59 ? 132 TRP A N     1 
ATOM   1511 C  CA    . TRP C 2 131 ? -0.457  -2.474  20.544  1.00 20.27 ? 132 TRP A CA    1 
ATOM   1512 C  C     . TRP C 2 131 ? -0.589  -1.863  19.156  1.00 22.50 ? 132 TRP A C     1 
ATOM   1513 O  O     . TRP C 2 131 ? 0.082   -2.279  18.208  1.00 23.56 ? 132 TRP A O     1 
ATOM   1514 C  CB    . TRP C 2 131 ? 0.773   -1.878  21.205  1.00 18.64 ? 132 TRP A CB    1 
ATOM   1515 C  CG    . TRP C 2 131 ? 0.902   -2.174  22.658  1.00 29.74 ? 132 TRP A CG    1 
ATOM   1516 C  CD1   . TRP C 2 131 ? -0.051  -2.707  23.491  1.00 25.75 ? 132 TRP A CD1   1 
ATOM   1517 C  CD2   . TRP C 2 131 ? 2.060   -1.947  23.465  1.00 28.43 ? 132 TRP A CD2   1 
ATOM   1518 N  NE1   . TRP C 2 131 ? 0.453   -2.821  24.766  1.00 23.01 ? 132 TRP A NE1   1 
ATOM   1519 C  CE2   . TRP C 2 131 ? 1.746   -2.363  24.776  1.00 28.46 ? 132 TRP A CE2   1 
ATOM   1520 C  CE3   . TRP C 2 131 ? 3.338   -1.429  23.205  1.00 30.07 ? 132 TRP A CE3   1 
ATOM   1521 C  CZ2   . TRP C 2 131 ? 2.667   -2.277  25.827  1.00 30.01 ? 132 TRP A CZ2   1 
ATOM   1522 C  CZ3   . TRP C 2 131 ? 4.256   -1.343  24.252  1.00 29.75 ? 132 TRP A CZ3   1 
ATOM   1523 C  CH2   . TRP C 2 131 ? 3.913   -1.766  25.545  1.00 29.65 ? 132 TRP A CH2   1 
ATOM   1524 N  N     . ILE C 2 132 ? -1.454  -0.866  19.051  1.00 20.56 ? 133 ILE A N     1 
ATOM   1525 C  CA    . ILE C 2 132 ? -1.666  -0.157  17.808  1.00 21.45 ? 133 ILE A CA    1 
ATOM   1526 C  C     . ILE C 2 132 ? -1.199  1.279   18.008  1.00 21.59 ? 133 ILE A C     1 
ATOM   1527 O  O     . ILE C 2 132 ? -1.637  1.948   18.949  1.00 17.11 ? 133 ILE A O     1 
ATOM   1528 C  CB    . ILE C 2 132 ? -3.166  -0.088  17.425  1.00 21.94 ? 133 ILE A CB    1 
ATOM   1529 C  CG1   . ILE C 2 132 ? -3.736  -1.492  17.207  1.00 20.96 ? 133 ILE A CG1   1 
ATOM   1530 C  CG2   . ILE C 2 132 ? -3.340  0.772   16.172  1.00 21.14 ? 133 ILE A CG2   1 
ATOM   1531 C  CD1   . ILE C 2 132 ? -3.121  -2.219  16.038  1.00 10.10 ? 133 ILE A CD1   1 
ATOM   1532 N  N     . ILE C 2 133 ? -0.305  1.737   17.139  1.00 21.17 ? 134 ILE A N     1 
ATOM   1533 C  CA    . ILE C 2 133 ? 0.151   3.121   17.160  1.00 18.02 ? 134 ILE A CA    1 
ATOM   1534 C  C     . ILE C 2 133 ? -0.619  3.702   15.978  1.00 18.45 ? 134 ILE A C     1 
ATOM   1535 O  O     . ILE C 2 133 ? -0.297  3.429   14.820  1.00 19.85 ? 134 ILE A O     1 
ATOM   1536 C  CB    . ILE C 2 133 ? 1.673   3.258   16.918  1.00 16.67 ? 134 ILE A CB    1 
ATOM   1537 C  CG1   . ILE C 2 133 ? 2.443   2.651   18.087  1.00 14.40 ? 134 ILE A CG1   1 
ATOM   1538 C  CG2   . ILE C 2 133 ? 2.065   4.735   16.812  1.00 18.88 ? 134 ILE A CG2   1 
ATOM   1539 C  CD1   . ILE C 2 133 ? 3.937   2.753   17.931  1.00 22.06 ? 134 ILE A CD1   1 
ATOM   1540 N  N     . GLY C 2 134 ? -1.649  4.478   16.275  1.00 15.25 ? 135 GLY A N     1 
ATOM   1541 C  CA    . GLY C 2 134 ? -2.461  5.065   15.233  1.00 16.22 ? 135 GLY A CA    1 
ATOM   1542 C  C     . GLY C 2 134 ? -2.113  6.510   14.933  1.00 21.71 ? 135 GLY A C     1 
ATOM   1543 O  O     . GLY C 2 134 ? -1.915  7.317   15.850  1.00 18.90 ? 135 GLY A O     1 
ATOM   1544 N  N     . TYR C 2 135 ? -2.035  6.830   13.643  1.00 21.34 ? 136 TYR A N     1 
ATOM   1545 C  CA    . TYR C 2 135 ? -1.745  8.177   13.169  1.00 18.18 ? 136 TYR A CA    1 
ATOM   1546 C  C     . TYR C 2 135 ? -2.975  8.685   12.434  1.00 19.49 ? 136 TYR A C     1 
ATOM   1547 O  O     . TYR C 2 135 ? -3.611  7.939   11.689  1.00 20.36 ? 136 TYR A O     1 
ATOM   1548 C  CB    . TYR C 2 135 ? -0.566  8.172   12.209  1.00 13.57 ? 136 TYR A CB    1 
ATOM   1549 C  CG    . TYR C 2 135 ? 0.774   8.073   12.883  1.00 25.29 ? 136 TYR A CG    1 
ATOM   1550 C  CD1   . TYR C 2 135 ? 1.429   9.219   13.343  1.00 26.24 ? 136 TYR A CD1   1 
ATOM   1551 C  CD2   . TYR C 2 135 ? 1.398   6.839   13.067  1.00 17.87 ? 136 TYR A CD2   1 
ATOM   1552 C  CE1   . TYR C 2 135 ? 2.678   9.135   13.973  1.00 11.86 ? 136 TYR A CE1   1 
ATOM   1553 C  CE2   . TYR C 2 135 ? 2.648   6.749   13.696  1.00 14.67 ? 136 TYR A CE2   1 
ATOM   1554 C  CZ    . TYR C 2 135 ? 3.279   7.904   14.145  1.00 20.63 ? 136 TYR A CZ    1 
ATOM   1555 O  OH    . TYR C 2 135 ? 4.510   7.830   14.764  1.00 18.47 ? 136 TYR A OH    1 
ATOM   1556 N  N     . VAL C 2 136 ? -3.320  9.946   12.660  1.00 18.70 ? 137 VAL A N     1 
ATOM   1557 C  CA    . VAL C 2 136 ? -4.456  10.574  12.002  1.00 18.71 ? 137 VAL A CA    1 
ATOM   1558 C  C     . VAL C 2 136 ? -3.895  11.885  11.479  1.00 24.75 ? 137 VAL A C     1 
ATOM   1559 O  O     . VAL C 2 136 ? -3.263  12.634  12.227  1.00 21.80 ? 137 VAL A O     1 
ATOM   1560 C  CB    . VAL C 2 136 ? -5.589  10.902  12.974  1.00 19.93 ? 137 VAL A CB    1 
ATOM   1561 C  CG1   . VAL C 2 136 ? -6.799  11.395  12.205  1.00 21.52 ? 137 VAL A CG1   1 
ATOM   1562 C  CG2   . VAL C 2 136 ? -5.942  9.690   13.793  1.00 27.46 ? 137 VAL A CG2   1 
ATOM   1563 N  N     . TYR C 2 137 ? -4.103  12.162  10.200  1.00 23.53 ? 138 TYR A N     1 
ATOM   1564 C  CA    . TYR C 2 137 ? -3.602  13.401  9.626   1.00 25.18 ? 138 TYR A CA    1 
ATOM   1565 C  C     . TYR C 2 137 ? -4.748  14.040  8.861   1.00 25.21 ? 138 TYR A C     1 
ATOM   1566 O  O     . TYR C 2 137 ? -5.636  13.347  8.361   1.00 23.90 ? 138 TYR A O     1 
ATOM   1567 C  CB    . TYR C 2 137 ? -2.398  13.130  8.701   1.00 26.18 ? 138 TYR A CB    1 
ATOM   1568 C  CG    . TYR C 2 137 ? -2.754  12.392  7.425   1.00 28.69 ? 138 TYR A CG    1 
ATOM   1569 C  CD1   . TYR C 2 137 ? -2.880  10.998  7.408   1.00 25.01 ? 138 TYR A CD1   1 
ATOM   1570 C  CD2   . TYR C 2 137 ? -3.010  13.093  6.242   1.00 33.71 ? 138 TYR A CD2   1 
ATOM   1571 C  CE1   . TYR C 2 137 ? -3.259  10.321  6.249   1.00 18.22 ? 138 TYR A CE1   1 
ATOM   1572 C  CE2   . TYR C 2 137 ? -3.391  12.427  5.077   1.00 29.47 ? 138 TYR A CE2   1 
ATOM   1573 C  CZ    . TYR C 2 137 ? -3.517  11.042  5.090   1.00 33.44 ? 138 TYR A CZ    1 
ATOM   1574 O  OH    . TYR C 2 137 ? -3.937  10.396  3.951   1.00 33.39 ? 138 TYR A OH    1 
ATOM   1575 N  N     . THR C 2 138 ? -4.740  15.361  8.791   1.00 28.37 ? 139 THR A N     1 
ATOM   1576 C  CA    . THR C 2 138 ? -5.768  16.078  8.058   1.00 31.90 ? 139 THR A CA    1 
ATOM   1577 C  C     . THR C 2 138 ? -5.170  16.260  6.675   1.00 31.24 ? 139 THR A C     1 
ATOM   1578 O  O     . THR C 2 138 ? -4.072  16.813  6.538   1.00 29.90 ? 139 THR A O     1 
ATOM   1579 C  CB    . THR C 2 138 ? -6.067  17.440  8.701   1.00 36.31 ? 139 THR A CB    1 
ATOM   1580 O  OG1   . THR C 2 138 ? -6.520  17.240  10.044  1.00 32.94 ? 139 THR A OG1   1 
ATOM   1581 C  CG2   . THR C 2 138 ? -7.138  18.164  7.922   1.00 35.84 ? 139 THR A CG2   1 
ATOM   1582 N  N     . ARG C 2 139 ? -5.887  15.781  5.664   1.00 35.00 ? 140 ARG A N     1 
ATOM   1583 C  CA    . ARG C 2 139 ? -5.439  15.840  4.273   1.00 38.64 ? 140 ARG A CA    1 
ATOM   1584 C  C     . ARG C 2 139 ? -5.387  17.270  3.719   1.00 41.64 ? 140 ARG A C     1 
ATOM   1585 O  O     . ARG C 2 139 ? -6.283  18.078  3.978   1.00 40.41 ? 140 ARG A O     1 
ATOM   1586 C  CB    . ARG C 2 139 ? -6.368  14.976  3.419   1.00 42.94 ? 140 ARG A CB    1 
ATOM   1587 C  CG    . ARG C 2 139 ? -5.750  14.475  2.142   1.00 54.06 ? 140 ARG A CG    1 
ATOM   1588 C  CD    . ARG C 2 139 ? -6.701  13.540  1.426   1.00 59.70 ? 140 ARG A CD    1 
ATOM   1589 N  NE    . ARG C 2 139 ? -6.065  12.902  0.273   1.00 69.21 ? 140 ARG A NE    1 
ATOM   1590 C  CZ    . ARG C 2 139 ? -6.706  12.538  -0.838  1.00 70.86 ? 140 ARG A CZ    1 
ATOM   1591 N  NH1   . ARG C 2 139 ? -8.016  12.746  -0.959  1.00 72.92 ? 140 ARG A NH1   1 
ATOM   1592 N  NH2   . ARG C 2 139 ? -6.039  11.963  -1.835  1.00 64.51 ? 140 ARG A NH2   1 
ATOM   1593 N  N     . VAL C 2 140 ? -4.334  17.573  2.961   1.00 45.72 ? 141 VAL A N     1 
ATOM   1594 C  CA    . VAL C 2 140 ? -4.149  18.896  2.352   1.00 50.47 ? 141 VAL A CA    1 
ATOM   1595 C  C     . VAL C 2 140 ? -4.060  18.798  0.817   1.00 54.93 ? 141 VAL A C     1 
ATOM   1596 O  O     . VAL C 2 140 ? -3.379  17.921  0.277   1.00 55.37 ? 141 VAL A O     1 
ATOM   1597 C  CB    . VAL C 2 140 ? -2.886  19.599  2.936   1.00 48.53 ? 141 VAL A CB    1 
ATOM   1598 C  CG1   . VAL C 2 140 ? -2.452  20.761  2.062   1.00 54.12 ? 141 VAL A CG1   1 
ATOM   1599 C  CG2   . VAL C 2 140 ? -3.191  20.115  4.333   1.00 49.54 ? 141 VAL A CG2   1 
ATOM   1600 N  N     . ALA C 2 141 ? -4.759  19.700  0.127   1.00 59.87 ? 142 ALA A N     1 
ATOM   1601 C  CA    . ALA C 2 141 ? -4.790  19.735  -1.340  1.00 63.98 ? 142 ALA A CA    1 
ATOM   1602 C  C     . ALA C 2 141 ? -3.417  19.954  -1.982  1.00 65.31 ? 142 ALA A C     1 
ATOM   1603 O  O     . ALA C 2 141 ? -2.734  20.937  -1.690  1.00 63.74 ? 142 ALA A O     1 
ATOM   1604 C  CB    . ALA C 2 141 ? -5.765  20.816  -1.814  1.00 66.53 ? 142 ALA A CB    1 
ATOM   1605 N  N     . THR C 2 142 ? -3.028  19.029  -2.858  1.00 68.65 ? 143 THR A N     1 
ATOM   1606 C  CA    . THR C 2 142 ? -1.745  19.094  -3.563  1.00 72.56 ? 143 THR A CA    1 
ATOM   1607 C  C     . THR C 2 142 ? -1.718  20.286  -4.523  1.00 74.20 ? 143 THR A C     1 
ATOM   1608 O  O     . THR C 2 142 ? -2.635  20.461  -5.335  1.00 73.40 ? 143 THR A O     1 
ATOM   1609 C  CB    . THR C 2 142 ? -1.489  17.805  -4.396  1.00 76.46 ? 143 THR A CB    1 
ATOM   1610 O  OG1   . THR C 2 142 ? -1.808  16.643  -3.615  1.00 81.33 ? 143 THR A OG1   1 
ATOM   1611 C  CG2   . THR C 2 142 ? -0.028  17.733  -4.830  1.00 74.22 ? 143 THR A CG2   1 
ATOM   1612 N  N     . ARG C 2 143 ? -0.666  21.095  -4.432  1.00 76.62 ? 144 ARG A N     1 
ATOM   1613 C  CA    . ARG C 2 143 ? -0.518  22.272  -5.290  1.00 78.59 ? 144 ARG A CA    1 
ATOM   1614 C  C     . ARG C 2 143 ? 0.606   22.065  -6.311  1.00 77.97 ? 144 ARG A C     1 
ATOM   1615 O  O     . ARG C 2 143 ? 1.335   21.072  -6.249  1.00 78.20 ? 144 ARG A O     1 
ATOM   1616 C  CB    . ARG C 2 143 ? -0.251  23.514  -4.427  1.00 84.35 ? 144 ARG A CB    1 
ATOM   1617 C  CG    . ARG C 2 143 ? -1.382  23.810  -3.440  1.00 93.74 ? 144 ARG A CG    1 
ATOM   1618 C  CD    . ARG C 2 143 ? -1.060  24.944  -2.472  1.00 99.00 ? 144 ARG A CD    1 
ATOM   1619 N  NE    . ARG C 2 143 ? -2.160  25.143  -1.522  1.00 99.00 ? 144 ARG A NE    1 
ATOM   1620 C  CZ    . ARG C 2 143 ? -2.180  26.063  -0.553  1.00 99.00 ? 144 ARG A CZ    1 
ATOM   1621 N  NH1   . ARG C 2 143 ? -1.153  26.897  -0.387  1.00 99.00 ? 144 ARG A NH1   1 
ATOM   1622 N  NH2   . ARG C 2 143 ? -3.235  26.154  0.257   1.00 99.00 ? 144 ARG A NH2   1 
ATOM   1623 N  N     . LYS C 2 144 ? 0.742   23.001  -7.247  1.00 76.37 ? 145 LYS A N     1 
ATOM   1624 C  CA    . LYS C 2 144 ? 1.774   22.912  -8.279  1.00 74.38 ? 145 LYS A CA    1 
ATOM   1625 C  C     . LYS C 2 144 ? 3.181   22.865  -7.690  1.00 71.52 ? 145 LYS A C     1 
ATOM   1626 O  O     . LYS C 2 144 ? 4.067   22.207  -8.244  1.00 71.38 ? 145 LYS A O     1 
ATOM   1627 C  CB    . LYS C 2 144 ? 1.665   24.095  -9.244  1.00 80.36 ? 145 LYS A CB    1 
ATOM   1628 C  CG    . LYS C 2 144 ? 2.739   24.121  -10.335 1.00 91.44 ? 145 LYS A CG    1 
ATOM   1629 C  CD    . LYS C 2 144 ? 2.708   25.436  -11.114 1.00 99.00 ? 145 LYS A CD    1 
ATOM   1630 C  CE    . LYS C 2 144 ? 3.913   25.564  -12.047 1.00 99.00 ? 145 LYS A CE    1 
ATOM   1631 N  NZ    . LYS C 2 144 ? 3.990   26.920  -12.682 1.00 99.00 ? 145 LYS A NZ    1 
ATOM   1632 N  N     . SER C 2 145 ? 3.380   23.559  -6.570  1.00 68.94 ? 146 SER A N     1 
ATOM   1633 C  CA    . SER C 2 145 ? 4.681   23.614  -5.899  1.00 66.14 ? 146 SER A CA    1 
ATOM   1634 C  C     . SER C 2 145 ? 5.237   22.236  -5.518  1.00 64.34 ? 146 SER A C     1 
ATOM   1635 O  O     . SER C 2 145 ? 6.451   22.026  -5.531  1.00 63.55 ? 146 SER A O     1 
ATOM   1636 C  CB    . SER C 2 145 ? 4.608   24.535  -4.664  1.00 67.68 ? 146 SER A CB    1 
ATOM   1637 O  OG    . SER C 2 145 ? 3.425   24.321  -3.903  1.00 65.57 ? 146 SER A OG    1 
ATOM   1638 N  N     . SER C 2 146 ? 4.357   21.295  -5.188  1.00 62.23 ? 147 SER A N     1 
ATOM   1639 C  CA    . SER C 2 146 ? 4.797   19.954  -4.817  1.00 61.85 ? 147 SER A CA    1 
ATOM   1640 C  C     . SER C 2 146 ? 5.056   19.041  -6.025  1.00 58.09 ? 147 SER A C     1 
ATOM   1641 O  O     . SER C 2 146 ? 5.055   17.817  -5.887  1.00 57.53 ? 147 SER A O     1 
ATOM   1642 C  CB    . SER C 2 146 ? 3.782   19.304  -3.861  1.00 64.70 ? 147 SER A CB    1 
ATOM   1643 O  OG    . SER C 2 146 ? 2.441   19.603  -4.213  1.00 72.21 ? 147 SER A OG    1 
ATOM   1644 N  N     . LEU C 2 147 ? 5.287   19.637  -7.197  1.00 54.82 ? 148 LEU A N     1 
ATOM   1645 C  CA    . LEU C 2 147 ? 5.527   18.873  -8.421  1.00 50.21 ? 148 LEU A CA    1 
ATOM   1646 C  C     . LEU C 2 147 ? 6.912   19.069  -9.025  1.00 47.88 ? 148 LEU A C     1 
ATOM   1647 O  O     . LEU C 2 147 ? 7.134   18.765  -10.195 1.00 48.55 ? 148 LEU A O     1 
ATOM   1648 C  CB    . LEU C 2 147 ? 4.451   19.206  -9.453  1.00 46.31 ? 148 LEU A CB    1 
ATOM   1649 C  CG    . LEU C 2 147 ? 3.053   18.763  -9.015  1.00 50.24 ? 148 LEU A CG    1 
ATOM   1650 C  CD1   . LEU C 2 147 ? 1.982   19.425  -9.864  1.00 50.10 ? 148 LEU A CD1   1 
ATOM   1651 C  CD2   . LEU C 2 147 ? 2.971   17.251  -9.081  1.00 47.00 ? 148 LEU A CD2   1 
ATOM   1652 N  N     . LYS C 2 148 ? 7.842   19.570  -8.223  1.00 45.37 ? 149 LYS A N     1 
ATOM   1653 C  CA    . LYS C 2 148 ? 9.207   19.797  -8.670  1.00 43.51 ? 149 LYS A CA    1 
ATOM   1654 C  C     . LYS C 2 148 ? 10.155  19.236  -7.617  1.00 40.99 ? 149 LYS A C     1 
ATOM   1655 O  O     . LYS C 2 148 ? 9.727   18.865  -6.534  1.00 40.67 ? 149 LYS A O     1 
ATOM   1656 C  CB    . LYS C 2 148 ? 9.451   21.298  -8.854  1.00 44.40 ? 149 LYS A CB    1 
ATOM   1657 C  CG    . LYS C 2 148 ? 9.197   22.121  -7.597  1.00 53.41 ? 149 LYS A CG    1 
ATOM   1658 C  CD    . LYS C 2 148 ? 9.335   23.622  -7.834  1.00 57.93 ? 149 LYS A CD    1 
ATOM   1659 C  CE    . LYS C 2 148 ? 10.759  24.023  -8.192  1.00 64.06 ? 149 LYS A CE    1 
ATOM   1660 N  NZ    . LYS C 2 148 ? 11.718  23.753  -7.085  1.00 65.02 ? 149 LYS A NZ    1 
ATOM   1661 N  N     . THR C 2 149 ? 11.439  19.161  -7.933  1.00 39.34 ? 150 THR A N     1 
ATOM   1662 C  CA    . THR C 2 149 ? 12.417  18.678  -6.971  1.00 37.99 ? 150 THR A CA    1 
ATOM   1663 C  C     . THR C 2 149 ? 12.977  19.882  -6.200  1.00 38.30 ? 150 THR A C     1 
ATOM   1664 O  O     . THR C 2 149 ? 12.787  21.027  -6.604  1.00 37.24 ? 150 THR A O     1 
ATOM   1665 C  CB    . THR C 2 149 ? 13.552  17.930  -7.671  1.00 35.44 ? 150 THR A CB    1 
ATOM   1666 O  OG1   . THR C 2 149 ? 14.115  18.758  -8.695  1.00 37.65 ? 150 THR A OG1   1 
ATOM   1667 C  CG2   . THR C 2 149 ? 13.021  16.664  -8.303  1.00 40.27 ? 150 THR A CG2   1 
ATOM   1668 N  N     . TYR C 2 150 ? 13.664  19.632  -5.095  1.00 37.90 ? 151 TYR A N     1 
ATOM   1669 C  CA    . TYR C 2 150 ? 14.217  20.711  -4.297  1.00 37.43 ? 151 TYR A CA    1 
ATOM   1670 C  C     . TYR C 2 150 ? 15.635  20.394  -3.873  1.00 40.44 ? 151 TYR A C     1 
ATOM   1671 O  O     . TYR C 2 150 ? 16.130  19.289  -4.102  1.00 41.14 ? 151 TYR A O     1 
ATOM   1672 C  CB    . TYR C 2 150 ? 13.373  20.935  -3.049  1.00 29.69 ? 151 TYR A CB    1 
ATOM   1673 C  CG    . TYR C 2 150 ? 12.003  21.495  -3.309  1.00 31.63 ? 151 TYR A CG    1 
ATOM   1674 C  CD1   . TYR C 2 150 ? 10.947  20.662  -3.682  1.00 31.17 ? 151 TYR A CD1   1 
ATOM   1675 C  CD2   . TYR C 2 150 ? 11.751  22.860  -3.155  1.00 32.40 ? 151 TYR A CD2   1 
ATOM   1676 C  CE1   . TYR C 2 150 ? 9.670   21.176  -3.894  1.00 27.74 ? 151 TYR A CE1   1 
ATOM   1677 C  CE2   . TYR C 2 150 ? 10.485  23.387  -3.362  1.00 26.86 ? 151 TYR A CE2   1 
ATOM   1678 C  CZ    . TYR C 2 150 ? 9.446   22.539  -3.730  1.00 32.24 ? 151 TYR A CZ    1 
ATOM   1679 O  OH    . TYR C 2 150 ? 8.183   23.053  -3.921  1.00 29.58 ? 151 TYR A OH    1 
ATOM   1680 N  N     . ASN C 2 151 ? 16.281  21.373  -3.247  1.00 42.67 ? 152 ASN A N     1 
ATOM   1681 C  CA    . ASN C 2 151 ? 17.647  21.219  -2.771  1.00 41.64 ? 152 ASN A CA    1 
ATOM   1682 C  C     . ASN C 2 151 ? 17.621  21.341  -1.259  1.00 41.99 ? 152 ASN A C     1 
ATOM   1683 O  O     . ASN C 2 151 ? 16.640  21.828  -0.696  1.00 38.60 ? 152 ASN A O     1 
ATOM   1684 C  CB    . ASN C 2 151 ? 18.543  22.295  -3.375  1.00 47.19 ? 152 ASN A CB    1 
ATOM   1685 C  CG    . ASN C 2 151 ? 18.602  22.215  -4.883  1.00 54.88 ? 152 ASN A CG    1 
ATOM   1686 O  OD1   . ASN C 2 151 ? 19.521  21.623  -5.449  1.00 56.32 ? 152 ASN A OD1   1 
ATOM   1687 N  ND2   . ASN C 2 151 ? 17.618  22.812  -5.547  1.00 56.99 ? 152 ASN A ND2   1 
ATOM   1688 N  N     . ILE C 2 152 ? 18.698  20.903  -0.608  1.00 44.81 ? 153 ILE A N     1 
ATOM   1689 C  CA    . ILE C 2 152 ? 18.810  20.937  0.853   1.00 46.35 ? 153 ILE A CA    1 
ATOM   1690 C  C     . ILE C 2 152 ? 18.584  22.327  1.466   1.00 49.29 ? 153 ILE A C     1 
ATOM   1691 O  O     . ILE C 2 152 ? 18.009  22.452  2.555   1.00 48.78 ? 153 ILE A O     1 
ATOM   1692 C  CB    . ILE C 2 152 ? 20.181  20.378  1.314   1.00 46.04 ? 153 ILE A CB    1 
ATOM   1693 C  CG1   . ILE C 2 152 ? 20.336  18.926  0.855   1.00 40.29 ? 153 ILE A CG1   1 
ATOM   1694 C  CG2   . ILE C 2 152 ? 20.291  20.435  2.831   1.00 49.55 ? 153 ILE A CG2   1 
ATOM   1695 C  CD1   . ILE C 2 152 ? 21.736  18.364  1.037   1.00 50.24 ? 153 ILE A CD1   1 
ATOM   1696 N  N     . ASN C 2 153 ? 19.028  23.368  0.768   1.00 50.85 ? 154 ASN A N     1 
ATOM   1697 C  CA    . ASN C 2 153 ? 18.860  24.732  1.261   1.00 54.18 ? 154 ASN A CA    1 
ATOM   1698 C  C     . ASN C 2 153 ? 17.397  25.212  1.225   1.00 54.64 ? 154 ASN A C     1 
ATOM   1699 O  O     . ASN C 2 153 ? 17.077  26.275  1.758   1.00 56.26 ? 154 ASN A O     1 
ATOM   1700 C  CB    . ASN C 2 153 ? 19.760  25.693  0.467   1.00 54.28 ? 154 ASN A CB    1 
ATOM   1701 C  CG    . ASN C 2 153 ? 19.422  25.732  -1.021  1.00 62.69 ? 154 ASN A CG    1 
ATOM   1702 O  OD1   . ASN C 2 153 ? 18.845  24.789  -1.570  1.00 67.99 ? 154 ASN A OD1   1 
ATOM   1703 N  ND2   . ASN C 2 153 ? 19.785  26.825  -1.680  1.00 56.23 ? 154 ASN A ND2   1 
ATOM   1704 N  N     . GLU C 2 154 ? 16.513  24.425  0.611   1.00 54.28 ? 155 GLU A N     1 
ATOM   1705 C  CA    . GLU C 2 154 ? 15.098  24.791  0.491   1.00 51.87 ? 155 GLU A CA    1 
ATOM   1706 C  C     . GLU C 2 154 ? 14.151  23.963  1.357   1.00 47.99 ? 155 GLU A C     1 
ATOM   1707 O  O     . GLU C 2 154 ? 12.936  23.997  1.138   1.00 43.84 ? 155 GLU A O     1 
ATOM   1708 C  CB    . GLU C 2 154 ? 14.636  24.662  -0.964  1.00 54.49 ? 155 GLU A CB    1 
ATOM   1709 C  CG    . GLU C 2 154 ? 15.482  25.394  -1.984  1.00 62.21 ? 155 GLU A CG    1 
ATOM   1710 C  CD    . GLU C 2 154 ? 14.977  25.185  -3.396  1.00 67.59 ? 155 GLU A CD    1 
ATOM   1711 O  OE1   . GLU C 2 154 ? 15.326  24.152  -4.004  1.00 69.32 ? 155 GLU A OE1   1 
ATOM   1712 O  OE2   . GLU C 2 154 ? 14.229  26.053  -3.896  1.00 70.43 ? 155 GLU A OE2   1 
ATOM   1713 N  N     . LEU C 2 155 ? 14.691  23.230  2.331   1.00 47.68 ? 156 LEU A N     1 
ATOM   1714 C  CA    . LEU C 2 155 ? 13.875  22.383  3.208   1.00 47.05 ? 156 LEU A CA    1 
ATOM   1715 C  C     . LEU C 2 155 ? 12.612  23.044  3.734   1.00 47.42 ? 156 LEU A C     1 
ATOM   1716 O  O     . LEU C 2 155 ? 11.536  22.449  3.701   1.00 45.61 ? 156 LEU A O     1 
ATOM   1717 C  CB    . LEU C 2 155 ? 14.697  21.861  4.389   1.00 47.32 ? 156 LEU A CB    1 
ATOM   1718 C  CG    . LEU C 2 155 ? 15.563  20.627  4.121   1.00 45.42 ? 156 LEU A CG    1 
ATOM   1719 C  CD1   . LEU C 2 155 ? 16.225  20.199  5.417   1.00 50.76 ? 156 LEU A CD1   1 
ATOM   1720 C  CD2   . LEU C 2 155 ? 14.715  19.488  3.560   1.00 43.25 ? 156 LEU A CD2   1 
ATOM   1721 N  N     . ASN C 2 156 ? 12.743  24.278  4.208   1.00 50.24 ? 157 ASN A N     1 
ATOM   1722 C  CA    . ASN C 2 156 ? 11.607  25.027  4.751   1.00 47.82 ? 157 ASN A CA    1 
ATOM   1723 C  C     . ASN C 2 156 ? 10.558  25.427  3.724   1.00 45.98 ? 157 ASN A C     1 
ATOM   1724 O  O     . ASN C 2 156 ? 9.438   25.772  4.094   1.00 47.36 ? 157 ASN A O     1 
ATOM   1725 C  CB    . ASN C 2 156 ? 12.088  26.301  5.447   1.00 51.89 ? 157 ASN A CB    1 
ATOM   1726 C  CG    . ASN C 2 156 ? 12.990  26.022  6.620   1.00 57.09 ? 157 ASN A CG    1 
ATOM   1727 O  OD1   . ASN C 2 156 ? 14.121  26.506  6.669   1.00 59.53 ? 157 ASN A OD1   1 
ATOM   1728 N  ND2   . ASN C 2 156 ? 12.500  25.240  7.576   1.00 59.22 ? 157 ASN A ND2   1 
ATOM   1729 N  N     . GLU C 2 157 ? 10.911  25.387  2.444   1.00 44.54 ? 158 GLU A N     1 
ATOM   1730 C  CA    . GLU C 2 157 ? 9.989   25.795  1.387   1.00 44.49 ? 158 GLU A CA    1 
ATOM   1731 C  C     . GLU C 2 157 ? 9.114   24.712  0.787   1.00 41.10 ? 158 GLU A C     1 
ATOM   1732 O  O     . GLU C 2 157 ? 8.108   25.018  0.153   1.00 41.35 ? 158 GLU A O     1 
ATOM   1733 C  CB    . GLU C 2 157 ? 10.759  26.460  0.258   1.00 49.59 ? 158 GLU A CB    1 
ATOM   1734 C  CG    . GLU C 2 157 ? 11.484  27.718  0.650   1.00 55.54 ? 158 GLU A CG    1 
ATOM   1735 C  CD    . GLU C 2 157 ? 12.320  28.239  -0.487  1.00 66.13 ? 158 GLU A CD    1 
ATOM   1736 O  OE1   . GLU C 2 157 ? 11.749  28.504  -1.572  1.00 66.04 ? 158 GLU A OE1   1 
ATOM   1737 O  OE2   . GLU C 2 157 ? 13.547  28.377  -0.294  1.00 74.38 ? 158 GLU A OE2   1 
ATOM   1738 N  N     . ILE C 2 158 ? 9.498   23.455  0.972   1.00 38.65 ? 159 ILE A N     1 
ATOM   1739 C  CA    . ILE C 2 158 ? 8.739   22.332  0.423   1.00 33.78 ? 159 ILE A CA    1 
ATOM   1740 C  C     . ILE C 2 158 ? 7.381   22.226  1.106   1.00 34.45 ? 159 ILE A C     1 
ATOM   1741 O  O     . ILE C 2 158 ? 7.304   22.167  2.334   1.00 37.50 ? 159 ILE A O     1 
ATOM   1742 C  CB    . ILE C 2 158 ? 9.493   21.009  0.632   1.00 27.67 ? 159 ILE A CB    1 
ATOM   1743 C  CG1   . ILE C 2 158 ? 10.880  21.106  0.015   1.00 24.65 ? 159 ILE A CG1   1 
ATOM   1744 C  CG2   . ILE C 2 158 ? 8.715   19.854  0.030   1.00 19.71 ? 159 ILE A CG2   1 
ATOM   1745 C  CD1   . ILE C 2 158 ? 11.757  19.927  0.316   1.00 27.07 ? 159 ILE A CD1   1 
ATOM   1746 N  N     . PRO C 2 159 ? 6.288   22.214  0.326   1.00 32.67 ? 160 PRO A N     1 
ATOM   1747 C  CA    . PRO C 2 159 ? 4.948   22.108  0.917   1.00 34.18 ? 160 PRO A CA    1 
ATOM   1748 C  C     . PRO C 2 159 ? 4.615   20.702  1.441   1.00 36.07 ? 160 PRO A C     1 
ATOM   1749 O  O     . PRO C 2 159 ? 4.980   19.691  0.832   1.00 36.59 ? 160 PRO A O     1 
ATOM   1750 C  CB    . PRO C 2 159 ? 4.036   22.518  -0.233  1.00 31.62 ? 160 PRO A CB    1 
ATOM   1751 C  CG    . PRO C 2 159 ? 4.761   21.985  -1.425  1.00 38.12 ? 160 PRO A CG    1 
ATOM   1752 C  CD    . PRO C 2 159 ? 6.214   22.329  -1.141  1.00 33.28 ? 160 PRO A CD    1 
ATOM   1753 N  N     . LYS C 2 160 ? 3.930   20.646  2.578   1.00 38.71 ? 161 LYS A N     1 
ATOM   1754 C  CA    . LYS C 2 160 ? 3.529   19.377  3.177   1.00 40.68 ? 161 LYS A CA    1 
ATOM   1755 C  C     . LYS C 2 160 ? 2.112   19.037  2.742   1.00 40.45 ? 161 LYS A C     1 
ATOM   1756 O  O     . LYS C 2 160 ? 1.262   19.918  2.620   1.00 41.53 ? 161 LYS A O     1 
ATOM   1757 C  CB    . LYS C 2 160 ? 3.603   19.451  4.708   1.00 43.29 ? 161 LYS A CB    1 
ATOM   1758 C  CG    . LYS C 2 160 ? 5.022   19.409  5.245   1.00 44.62 ? 161 LYS A CG    1 
ATOM   1759 C  CD    . LYS C 2 160 ? 5.201   20.324  6.435   1.00 46.37 ? 161 LYS A CD    1 
ATOM   1760 C  CE    . LYS C 2 160 ? 6.675   20.601  6.647   1.00 51.86 ? 161 LYS A CE    1 
ATOM   1761 N  NZ    . LYS C 2 160 ? 6.898   21.628  7.693   1.00 63.06 ? 161 LYS A NZ    1 
ATOM   1762 N  N     . PRO C 2 161 ? 1.843   17.748  2.488   1.00 42.67 ? 162 PRO A N     1 
ATOM   1763 C  CA    . PRO C 2 161 ? 0.523   17.276  2.067   1.00 43.53 ? 162 PRO A CA    1 
ATOM   1764 C  C     . PRO C 2 161 ? -0.388  16.926  3.262   1.00 44.36 ? 162 PRO A C     1 
ATOM   1765 O  O     . PRO C 2 161 ? -1.492  16.404  3.079   1.00 45.92 ? 162 PRO A O     1 
ATOM   1766 C  CB    . PRO C 2 161 ? 0.870   16.051  1.241   1.00 42.31 ? 162 PRO A CB    1 
ATOM   1767 C  CG    . PRO C 2 161 ? 1.971   15.435  2.065   1.00 47.31 ? 162 PRO A CG    1 
ATOM   1768 C  CD    . PRO C 2 161 ? 2.801   16.626  2.550   1.00 47.46 ? 162 PRO A CD    1 
ATOM   1769 N  N     . TYR C 2 162 ? 0.080   17.206  4.478   1.00 40.87 ? 163 TYR A N     1 
ATOM   1770 C  CA    . TYR C 2 162 ? -0.692  16.940  5.690   1.00 39.59 ? 163 TYR A CA    1 
ATOM   1771 C  C     . TYR C 2 162 ? -0.709  18.193  6.541   1.00 41.13 ? 163 TYR A C     1 
ATOM   1772 O  O     . TYR C 2 162 ? 0.159   19.060  6.406   1.00 36.23 ? 163 TYR A O     1 
ATOM   1773 C  CB    . TYR C 2 162 ? -0.099  15.774  6.488   1.00 38.07 ? 163 TYR A CB    1 
ATOM   1774 C  CG    . TYR C 2 162 ? 1.332   15.994  6.935   1.00 43.57 ? 163 TYR A CG    1 
ATOM   1775 C  CD1   . TYR C 2 162 ? 1.626   16.654  8.135   1.00 35.46 ? 163 TYR A CD1   1 
ATOM   1776 C  CD2   . TYR C 2 162 ? 2.398   15.552  6.149   1.00 41.60 ? 163 TYR A CD2   1 
ATOM   1777 C  CE1   . TYR C 2 162 ? 2.943   16.868  8.528   1.00 38.10 ? 163 TYR A CE1   1 
ATOM   1778 C  CE2   . TYR C 2 162 ? 3.711   15.761  6.538   1.00 43.62 ? 163 TYR A CE2   1 
ATOM   1779 C  CZ    . TYR C 2 162 ? 3.982   16.419  7.720   1.00 37.91 ? 163 TYR A CZ    1 
ATOM   1780 O  OH    . TYR C 2 162 ? 5.288   16.628  8.085   1.00 41.62 ? 163 TYR A OH    1 
ATOM   1781 N  N     . LYS C 2 163 ? -1.682  18.278  7.433   1.00 43.46 ? 164 LYS A N     1 
ATOM   1782 C  CA    . LYS C 2 163 ? -1.821  19.457  8.255   1.00 47.22 ? 164 LYS A CA    1 
ATOM   1783 C  C     . LYS C 2 163 ? -1.618  19.265  9.758   1.00 48.68 ? 164 LYS A C     1 
ATOM   1784 O  O     . LYS C 2 163 ? -0.730  19.888  10.344  1.00 54.78 ? 164 LYS A O     1 
ATOM   1785 C  CB    . LYS C 2 163 ? -3.188  20.061  7.970   1.00 49.87 ? 164 LYS A CB    1 
ATOM   1786 C  CG    . LYS C 2 163 ? -3.333  21.542  8.185   1.00 52.17 ? 164 LYS A CG    1 
ATOM   1787 C  CD    . LYS C 2 163 ? -4.767  21.888  7.853   1.00 56.77 ? 164 LYS A CD    1 
ATOM   1788 C  CE    . LYS C 2 163 ? -5.112  23.331  8.098   1.00 60.87 ? 164 LYS A CE    1 
ATOM   1789 N  NZ    . LYS C 2 163 ? -6.593  23.438  8.021   1.00 61.23 ? 164 LYS A NZ    1 
ATOM   1790 N  N     . GLY C 2 164 ? -2.420  18.409  10.383  1.00 44.20 ? 165 GLY A N     1 
ATOM   1791 C  CA    . GLY C 2 164 ? -2.293  18.243  11.821  1.00 41.50 ? 165 GLY A CA    1 
ATOM   1792 C  C     . GLY C 2 164 ? -2.284  16.813  12.305  1.00 37.52 ? 165 GLY A C     1 
ATOM   1793 O  O     . GLY C 2 164 ? -3.330  16.265  12.659  1.00 39.63 ? 165 GLY A O     1 
ATOM   1794 N  N     . VAL C 2 165 ? -1.099  16.222  12.329  1.00 27.34 ? 166 VAL A N     1 
ATOM   1795 C  CA    . VAL C 2 165 ? -0.933  14.845  12.741  1.00 24.51 ? 166 VAL A CA    1 
ATOM   1796 C  C     . VAL C 2 165 ? -1.141  14.623  14.242  1.00 26.98 ? 166 VAL A C     1 
ATOM   1797 O  O     . VAL C 2 165 ? -0.585  15.339  15.080  1.00 28.46 ? 166 VAL A O     1 
ATOM   1798 C  CB    . VAL C 2 165 ? 0.456   14.334  12.347  1.00 16.32 ? 166 VAL A CB    1 
ATOM   1799 C  CG1   . VAL C 2 165 ? 0.553   12.858  12.588  1.00 24.70 ? 166 VAL A CG1   1 
ATOM   1800 C  CG2   . VAL C 2 165 ? 0.712   14.630  10.891  1.00 24.57 ? 166 VAL A CG2   1 
ATOM   1801 N  N     . LYS C 2 166 ? -1.955  13.627  14.572  1.00 26.27 ? 167 LYS A N     1 
ATOM   1802 C  CA    . LYS C 2 166 ? -2.225  13.238  15.956  1.00 23.59 ? 167 LYS A CA    1 
ATOM   1803 C  C     . LYS C 2 166 ? -1.812  11.770  16.058  1.00 24.84 ? 167 LYS A C     1 
ATOM   1804 O  O     . LYS C 2 166 ? -1.975  11.010  15.092  1.00 23.09 ? 167 LYS A O     1 
ATOM   1805 C  CB    . LYS C 2 166 ? -3.718  13.381  16.268  1.00 20.25 ? 167 LYS A CB    1 
ATOM   1806 C  CG    . LYS C 2 166 ? -4.196  14.805  16.307  1.00 26.19 ? 167 LYS A CG    1 
ATOM   1807 C  CD    . LYS C 2 166 ? -5.702  14.857  16.310  1.00 38.87 ? 167 LYS A CD    1 
ATOM   1808 C  CE    . LYS C 2 166 ? -6.201  16.284  16.166  1.00 56.41 ? 167 LYS A CE    1 
ATOM   1809 N  NZ    . LYS C 2 166 ? -7.676  16.339  15.930  1.00 68.47 ? 167 LYS A NZ    1 
ATOM   1810 N  N     . VAL C 2 167 ? -1.279  11.366  17.207  1.00 23.36 ? 168 VAL A N     1 
ATOM   1811 C  CA    . VAL C 2 167 ? -0.860  9.979   17.392  1.00 23.63 ? 168 VAL A CA    1 
ATOM   1812 C  C     . VAL C 2 167 ? -1.346  9.423   18.738  1.00 25.02 ? 168 VAL A C     1 
ATOM   1813 O  O     . VAL C 2 167 ? -1.516  10.169  19.701  1.00 24.07 ? 168 VAL A O     1 
ATOM   1814 C  CB    . VAL C 2 167 ? 0.693   9.851   17.274  1.00 26.09 ? 168 VAL A CB    1 
ATOM   1815 C  CG1   . VAL C 2 167 ? 1.383   10.634  18.386  1.00 24.14 ? 168 VAL A CG1   1 
ATOM   1816 C  CG2   . VAL C 2 167 ? 1.115   8.386   17.285  1.00 22.36 ? 168 VAL A CG2   1 
ATOM   1817 N  N     . PHE C 2 168 ? -1.589  8.116   18.791  1.00 22.57 ? 169 PHE A N     1 
ATOM   1818 C  CA    . PHE C 2 168 ? -2.021  7.455   20.021  1.00 21.10 ? 169 PHE A CA    1 
ATOM   1819 C  C     . PHE C 2 168 ? -1.481  6.038   20.070  1.00 20.29 ? 169 PHE A C     1 
ATOM   1820 O  O     . PHE C 2 168 ? -1.091  5.484   19.037  1.00 20.68 ? 169 PHE A O     1 
ATOM   1821 C  CB    . PHE C 2 168 ? -3.555  7.431   20.138  1.00 20.18 ? 169 PHE A CB    1 
ATOM   1822 C  CG    . PHE C 2 168 ? -4.248  6.497   19.164  1.00 22.91 ? 169 PHE A CG    1 
ATOM   1823 C  CD1   . PHE C 2 168 ? -4.222  5.110   19.350  1.00 21.69 ? 169 PHE A CD1   1 
ATOM   1824 C  CD2   . PHE C 2 168 ? -4.942  7.007   18.076  1.00 18.84 ? 169 PHE A CD2   1 
ATOM   1825 C  CE1   . PHE C 2 168 ? -4.877  4.253   18.470  1.00 19.09 ? 169 PHE A CE1   1 
ATOM   1826 C  CE2   . PHE C 2 168 ? -5.601  6.152   17.188  1.00 27.81 ? 169 PHE A CE2   1 
ATOM   1827 C  CZ    . PHE C 2 168 ? -5.565  4.772   17.390  1.00 18.29 ? 169 PHE A CZ    1 
ATOM   1828 N  N     . LEU C 2 169 ? -1.445  5.457   21.264  1.00 18.99 ? 170 LEU A N     1 
ATOM   1829 C  CA    . LEU C 2 169 ? -1.010  4.077   21.429  1.00 18.67 ? 170 LEU A CA    1 
ATOM   1830 C  C     . LEU C 2 169 ? -2.120  3.426   22.259  1.00 21.46 ? 170 LEU A C     1 
ATOM   1831 O  O     . LEU C 2 169 ? -2.511  3.927   23.311  1.00 20.15 ? 170 LEU A O     1 
ATOM   1832 C  CB    . LEU C 2 169 ? 0.354   3.984   22.120  1.00 19.96 ? 170 LEU A CB    1 
ATOM   1833 C  CG    . LEU C 2 169 ? 1.002   2.587   22.135  1.00 21.73 ? 170 LEU A CG    1 
ATOM   1834 C  CD1   . LEU C 2 169 ? 2.501   2.697   22.329  1.00 23.50 ? 170 LEU A CD1   1 
ATOM   1835 C  CD2   . LEU C 2 169 ? 0.398   1.739   23.236  1.00 25.06 ? 170 LEU A CD2   1 
ATOM   1836 N  N     . GLN C 2 170 ? -2.632  2.305   21.777  1.00 18.88 ? 171 GLN A N     1 
ATOM   1837 C  CA    . GLN C 2 170 ? -3.718  1.630   22.457  1.00 17.54 ? 171 GLN A CA    1 
ATOM   1838 C  C     . GLN C 2 170 ? -3.751  0.134   22.077  1.00 18.72 ? 171 GLN A C     1 
ATOM   1839 O  O     . GLN C 2 170 ? -3.280  -0.272  21.008  1.00 15.65 ? 171 GLN A O     1 
ATOM   1840 C  CB    . GLN C 2 170 ? -5.024  2.348   22.082  1.00 10.84 ? 171 GLN A CB    1 
ATOM   1841 C  CG    . GLN C 2 170 ? -6.254  1.936   22.843  1.00 18.99 ? 171 GLN A CG    1 
ATOM   1842 C  CD    . GLN C 2 170 ? -6.122  2.162   24.332  1.00 25.28 ? 171 GLN A CD    1 
ATOM   1843 O  OE1   . GLN C 2 170 ? -5.585  1.319   25.050  1.00 19.52 ? 171 GLN A OE1   1 
ATOM   1844 N  NE2   . GLN C 2 170 ? -6.612  3.298   24.804  1.00 17.93 ? 171 GLN A NE2   1 
ATOM   1845 N  N     . ASP C 2 171 ? -4.287  -0.689  22.969  1.00 20.49 ? 172 ASP A N     1 
ATOM   1846 C  CA    . ASP C 2 171 ? -4.387  -2.117  22.714  1.00 17.43 ? 172 ASP A CA    1 
ATOM   1847 C  C     . ASP C 2 171 ? -5.414  -2.326  21.616  1.00 19.02 ? 172 ASP A C     1 
ATOM   1848 O  O     . ASP C 2 171 ? -6.462  -1.651  21.580  1.00 18.86 ? 172 ASP A O     1 
ATOM   1849 C  CB    . ASP C 2 171 ? -4.832  -2.862  23.975  1.00 20.40 ? 172 ASP A CB    1 
ATOM   1850 C  CG    . ASP C 2 171 ? -3.810  -2.781  25.091  1.00 20.27 ? 172 ASP A CG    1 
ATOM   1851 O  OD1   . ASP C 2 171 ? -2.798  -3.516  25.046  1.00 22.00 ? 172 ASP A OD1   1 
ATOM   1852 O  OD2   . ASP C 2 171 ? -4.026  -1.975  26.013  1.00 25.28 ? 172 ASP A OD2   1 
ATOM   1853 N  N     . LYS C 2 172 ? -5.113  -3.261  20.726  1.00 17.06 ? 173 LYS A N     1 
ATOM   1854 C  CA    . LYS C 2 172 ? -6.007  -3.578  19.616  1.00 16.58 ? 173 LYS A CA    1 
ATOM   1855 C  C     . LYS C 2 172 ? -7.432  -3.933  20.040  1.00 15.49 ? 173 LYS A C     1 
ATOM   1856 O  O     . LYS C 2 172 ? -8.395  -3.394  19.497  1.00 17.67 ? 173 LYS A O     1 
ATOM   1857 C  CB    . LYS C 2 172 ? -5.439  -4.731  18.776  1.00 14.29 ? 173 LYS A CB    1 
ATOM   1858 C  CG    . LYS C 2 172 ? -6.256  -4.973  17.511  1.00 22.87 ? 173 LYS A CG    1 
ATOM   1859 C  CD    . LYS C 2 172 ? -5.859  -6.235  16.767  1.00 28.74 ? 173 LYS A CD    1 
ATOM   1860 C  CE    . LYS C 2 172 ? -4.468  -6.150  16.202  1.00 34.04 ? 173 LYS A CE    1 
ATOM   1861 N  NZ    . LYS C 2 172 ? -4.254  -7.310  15.300  1.00 35.05 ? 173 LYS A NZ    1 
ATOM   1862 N  N     . TRP C 2 173 ? -7.576  -4.833  21.011  1.00 17.39 ? 174 TRP A N     1 
ATOM   1863 C  CA    . TRP C 2 173 ? -8.906  -5.267  21.445  1.00 16.17 ? 174 TRP A CA    1 
ATOM   1864 C  C     . TRP C 2 173 ? -9.781  -4.155  21.995  1.00 16.96 ? 174 TRP A C     1 
ATOM   1865 O  O     . TRP C 2 173 ? -11.003 -4.167  21.820  1.00 16.92 ? 174 TRP A O     1 
ATOM   1866 C  CB    . TRP C 2 173 ? -8.797  -6.424  22.456  1.00 19.33 ? 174 TRP A CB    1 
ATOM   1867 C  CG    . TRP C 2 173 ? -8.421  -6.050  23.876  1.00 19.06 ? 174 TRP A CG    1 
ATOM   1868 C  CD1   . TRP C 2 173 ? -7.169  -6.066  24.431  1.00 20.16 ? 174 TRP A CD1   1 
ATOM   1869 C  CD2   . TRP C 2 173 ? -9.321  -5.646  24.925  1.00 13.88 ? 174 TRP A CD2   1 
ATOM   1870 N  NE1   . TRP C 2 173 ? -7.236  -5.701  25.760  1.00 18.23 ? 174 TRP A NE1   1 
ATOM   1871 C  CE2   . TRP C 2 173 ? -8.542  -5.441  26.088  1.00 18.68 ? 174 TRP A CE2   1 
ATOM   1872 C  CE3   . TRP C 2 173 ? -10.709 -5.442  24.991  1.00 14.63 ? 174 TRP A CE3   1 
ATOM   1873 C  CZ2   . TRP C 2 173 ? -9.106  -5.041  27.310  1.00 10.55 ? 174 TRP A CZ2   1 
ATOM   1874 C  CZ3   . TRP C 2 173 ? -11.273 -5.045  26.202  1.00 22.57 ? 174 TRP A CZ3   1 
ATOM   1875 C  CH2   . TRP C 2 173 ? -10.467 -4.851  27.348  1.00 19.91 ? 174 TRP A CH2   1 
ATOM   1876 N  N     . VAL C 2 174 ? -9.146  -3.191  22.654  1.00 18.01 ? 175 VAL A N     1 
ATOM   1877 C  CA    . VAL C 2 174 ? -9.848  -2.063  23.260  1.00 18.37 ? 175 VAL A CA    1 
ATOM   1878 C  C     . VAL C 2 174 ? -10.524 -1.185  22.206  1.00 18.12 ? 175 VAL A C     1 
ATOM   1879 O  O     . VAL C 2 174 ? -11.655 -0.715  22.407  1.00 17.33 ? 175 VAL A O     1 
ATOM   1880 C  CB    . VAL C 2 174 ? -8.851  -1.208  24.123  1.00 26.28 ? 175 VAL A CB    1 
ATOM   1881 C  CG1   . VAL C 2 174 ? -9.496  0.064   24.601  1.00 17.20 ? 175 VAL A CG1   1 
ATOM   1882 C  CG2   . VAL C 2 174 ? -8.372  -2.014  25.313  1.00 19.99 ? 175 VAL A CG2   1 
ATOM   1883 N  N     . ILE C 2 175 ? -9.841  -0.967  21.083  1.00 16.66 ? 176 ILE A N     1 
ATOM   1884 C  CA    . ILE C 2 175 ? -10.395 -0.120  20.027  1.00 20.71 ? 176 ILE A CA    1 
ATOM   1885 C  C     . ILE C 2 175 ? -11.125 -0.876  18.907  1.00 22.93 ? 176 ILE A C     1 
ATOM   1886 O  O     . ILE C 2 175 ? -11.691 -0.249  17.991  1.00 22.21 ? 176 ILE A O     1 
ATOM   1887 C  CB    . ILE C 2 175 ? -9.307  0.817   19.422  1.00 20.75 ? 176 ILE A CB    1 
ATOM   1888 C  CG1   . ILE C 2 175 ? -8.147  0.007   18.842  1.00 24.68 ? 176 ILE A CG1   1 
ATOM   1889 C  CG2   . ILE C 2 175 ? -8.780  1.750   20.492  1.00 18.25 ? 176 ILE A CG2   1 
ATOM   1890 C  CD1   . ILE C 2 175 ? -7.218  0.816   17.959  1.00 27.47 ? 176 ILE A CD1   1 
ATOM   1891 N  N     . ALA C 2 176 ? -11.108 -2.208  18.989  1.00 19.66 ? 177 ALA A N     1 
ATOM   1892 C  CA    . ALA C 2 176 ? -11.779 -3.070  18.017  1.00 17.97 ? 177 ALA A CA    1 
ATOM   1893 C  C     . ALA C 2 176 ? -13.283 -2.830  18.026  1.00 18.66 ? 177 ALA A C     1 
ATOM   1894 O  O     . ALA C 2 176 ? -13.884 -2.624  19.088  1.00 19.70 ? 177 ALA A O     1 
ATOM   1895 C  CB    . ALA C 2 176 ? -11.495 -4.520  18.331  1.00 14.85 ? 177 ALA A CB    1 
ATOM   1896 N  N     . GLY C 2 177 ? -13.885 -2.857  16.839  1.00 18.26 ? 178 GLY A N     1 
ATOM   1897 C  CA    . GLY C 2 177 ? -15.320 -2.656  16.712  1.00 16.91 ? 178 GLY A CA    1 
ATOM   1898 C  C     . GLY C 2 177 ? -16.003 -3.973  16.361  1.00 17.26 ? 178 GLY A C     1 
ATOM   1899 O  O     . GLY C 2 177 ? -15.378 -5.030  16.403  1.00 15.59 ? 178 GLY A O     1 
ATOM   1900 N  N     . ASP C 2 178 ? -17.282 -3.916  16.008  1.00 15.95 ? 179 ASP A N     1 
ATOM   1901 C  CA    . ASP C 2 178 ? -18.025 -5.125  15.677  1.00 17.54 ? 179 ASP A CA    1 
ATOM   1902 C  C     . ASP C 2 178 ? -18.433 -5.267  14.202  1.00 20.32 ? 179 ASP A C     1 
ATOM   1903 O  O     . ASP C 2 178 ? -19.185 -6.176  13.847  1.00 19.79 ? 179 ASP A O     1 
ATOM   1904 C  CB    . ASP C 2 178 ? -19.261 -5.248  16.593  1.00 12.25 ? 179 ASP A CB    1 
ATOM   1905 C  CG    . ASP C 2 178 ? -20.216 -4.064  16.476  1.00 21.37 ? 179 ASP A CG    1 
ATOM   1906 O  OD1   . ASP C 2 178 ? -19.902 -3.074  15.778  1.00 20.15 ? 179 ASP A OD1   1 
ATOM   1907 O  OD2   . ASP C 2 178 ? -21.297 -4.128  17.092  1.00 18.91 ? 179 ASP A OD2   1 
ATOM   1908 N  N     . LEU C 2 179 ? -17.948 -4.367  13.350  1.00 22.00 ? 180 LEU A N     1 
ATOM   1909 C  CA    . LEU C 2 179 ? -18.237 -4.418  11.914  1.00 19.73 ? 180 LEU A CA    1 
ATOM   1910 C  C     . LEU C 2 179 ? -16.901 -4.590  11.192  1.00 19.82 ? 180 LEU A C     1 
ATOM   1911 O  O     . LEU C 2 179 ? -15.884 -4.052  11.633  1.00 19.61 ? 180 LEU A O     1 
ATOM   1912 C  CB    . LEU C 2 179 ? -18.912 -3.126  11.441  1.00 22.46 ? 180 LEU A CB    1 
ATOM   1913 C  CG    . LEU C 2 179 ? -20.187 -2.690  12.173  1.00 36.64 ? 180 LEU A CG    1 
ATOM   1914 C  CD1   . LEU C 2 179 ? -20.752 -1.458  11.496  1.00 33.40 ? 180 LEU A CD1   1 
ATOM   1915 C  CD2   . LEU C 2 179 ? -21.217 -3.810  12.189  1.00 31.29 ? 180 LEU A CD2   1 
ATOM   1916 N  N     . ALA C 2 180 ? -16.889 -5.338  10.092  1.00 16.93 ? 181 ALA A N     1 
ATOM   1917 C  CA    . ALA C 2 180 ? -15.655 -5.543  9.349   1.00 17.94 ? 181 ALA A CA    1 
ATOM   1918 C  C     . ALA C 2 180 ? -15.110 -4.211  8.819   1.00 16.43 ? 181 ALA A C     1 
ATOM   1919 O  O     . ALA C 2 180 ? -15.874 -3.309  8.496   1.00 17.00 ? 181 ALA A O     1 
ATOM   1920 C  CB    . ALA C 2 180 ? -15.897 -6.505  8.201   1.00 20.45 ? 181 ALA A CB    1 
ATOM   1921 N  N     . GLY C 2 181 ? -13.789 -4.096  8.747   1.00 16.88 ? 182 GLY A N     1 
ATOM   1922 C  CA    . GLY C 2 181 ? -13.155 -2.895  8.225   1.00 15.89 ? 182 GLY A CA    1 
ATOM   1923 C  C     . GLY C 2 181 ? -12.929 -2.977  6.715   1.00 20.02 ? 182 GLY A C     1 
ATOM   1924 O  O     . GLY C 2 181 ? -12.539 -1.989  6.087   1.00 20.63 ? 182 GLY A O     1 
ATOM   1925 N  N     . SER C 2 182 ? -13.152 -4.153  6.125   1.00 16.19 ? 183 SER A N     1 
ATOM   1926 C  CA    . SER C 2 182 ? -13.028 -4.339  4.672   1.00 16.49 ? 183 SER A CA    1 
ATOM   1927 C  C     . SER C 2 182 ? -13.752 -5.622  4.260   1.00 18.94 ? 183 SER A C     1 
ATOM   1928 O  O     . SER C 2 182 ? -13.933 -6.540  5.078   1.00 17.97 ? 183 SER A O     1 
ATOM   1929 C  CB    . SER C 2 182 ? -11.559 -4.335  4.201   1.00 8.56  ? 183 SER A CB    1 
ATOM   1930 O  OG    . SER C 2 182 ? -10.829 -5.473  4.610   1.00 13.17 ? 183 SER A OG    1 
ATOM   1931 N  N     . GLY C 2 183 ? -14.172 -5.673  3.000   1.00 17.61 ? 184 GLY A N     1 
ATOM   1932 C  CA    . GLY C 2 183 ? -14.903 -6.816  2.486   1.00 13.33 ? 184 GLY A CA    1 
ATOM   1933 C  C     . GLY C 2 183 ? -14.034 -7.941  1.975   1.00 18.52 ? 184 GLY A C     1 
ATOM   1934 O  O     . GLY C 2 183 ? -13.800 -8.924  2.687   1.00 20.89 ? 184 GLY A O     1 
ATOM   1935 N  N     . ASN C 2 184 ? -13.539 -7.805  0.750   1.00 17.50 ? 185 ASN A N     1 
ATOM   1936 C  CA    . ASN C 2 184 ? -12.727 -8.858  0.148   1.00 20.24 ? 185 ASN A CA    1 
ATOM   1937 C  C     . ASN C 2 184 ? -11.404 -9.190  0.835   1.00 20.33 ? 185 ASN A C     1 
ATOM   1938 O  O     . ASN C 2 184 ? -10.872 -10.294 0.663   1.00 21.60 ? 185 ASN A O     1 
ATOM   1939 C  CB    . ASN C 2 184 ? -12.516 -8.603  -1.365  1.00 20.64 ? 185 ASN A CB    1 
ATOM   1940 C  CG    . ASN C 2 184 ? -11.877 -7.254  -1.672  1.00 21.47 ? 185 ASN A CG    1 
ATOM   1941 O  OD1   . ASN C 2 184 ? -11.557 -6.469  -0.777  1.00 25.00 ? 185 ASN A OD1   1 
ATOM   1942 N  ND2   . ASN C 2 184 ? -11.693 -6.979  -2.953  1.00 19.96 ? 185 ASN A ND2   1 
ATOM   1943 N  N     . THR C 2 185 ? -10.860 -8.249  1.601   1.00 17.31 ? 186 THR A N     1 
ATOM   1944 C  CA    . THR C 2 185 ? -9.611  -8.495  2.320   1.00 15.70 ? 186 THR A CA    1 
ATOM   1945 C  C     . THR C 2 185 ? -9.883  -8.815  3.813   1.00 16.52 ? 186 THR A C     1 
ATOM   1946 O  O     . THR C 2 185 ? -8.968  -8.824  4.648   1.00 15.38 ? 186 THR A O     1 
ATOM   1947 C  CB    . THR C 2 185 ? -8.644  -7.297  2.172   1.00 18.39 ? 186 THR A CB    1 
ATOM   1948 O  OG1   . THR C 2 185 ? -9.347  -6.085  2.460   1.00 12.29 ? 186 THR A OG1   1 
ATOM   1949 C  CG2   . THR C 2 185 ? -8.094  -7.233  0.750   1.00 17.20 ? 186 THR A CG2   1 
ATOM   1950 N  N     . THR C 2 186 ? -11.154 -9.066  4.121   1.00 13.09 ? 187 THR A N     1 
ATOM   1951 C  CA    . THR C 2 186 ? -11.620 -9.447  5.457   1.00 17.42 ? 187 THR A CA    1 
ATOM   1952 C  C     . THR C 2 186 ? -10.823 -8.874  6.641   1.00 18.35 ? 187 THR A C     1 
ATOM   1953 O  O     . THR C 2 186 ? -10.093 -9.598  7.339   1.00 15.62 ? 187 THR A O     1 
ATOM   1954 C  CB    . THR C 2 186 ? -11.656 -10.988 5.580   1.00 10.39 ? 187 THR A CB    1 
ATOM   1955 O  OG1   . THR C 2 186 ? -10.368 -11.520 5.249   1.00 9.91  ? 187 THR A OG1   1 
ATOM   1956 C  CG2   . THR C 2 186 ? -12.711 -11.584 4.630   1.00 15.54 ? 187 THR A CG2   1 
ATOM   1957 N  N     . ASN C 2 187 ? -10.953 -7.575  6.860   1.00 15.74 ? 188 ASN A N     1 
ATOM   1958 C  CA    . ASN C 2 187 ? -10.251 -6.946  7.968   1.00 19.06 ? 188 ASN A CA    1 
ATOM   1959 C  C     . ASN C 2 187 ? -11.244 -6.620  9.071   1.00 18.88 ? 188 ASN A C     1 
ATOM   1960 O  O     . ASN C 2 187 ? -12.444 -6.432  8.826   1.00 14.13 ? 188 ASN A O     1 
ATOM   1961 C  CB    . ASN C 2 187 ? -9.542  -5.648  7.523   1.00 11.69 ? 188 ASN A CB    1 
ATOM   1962 C  CG    . ASN C 2 187 ? -8.029  -5.801  7.403   1.00 18.40 ? 188 ASN A CG    1 
ATOM   1963 O  OD1   . ASN C 2 187 ? -7.277  -5.104  8.075   1.00 17.91 ? 188 ASN A OD1   1 
ATOM   1964 N  ND2   . ASN C 2 187 ? -7.579  -6.706  6.546   1.00 15.51 ? 188 ASN A ND2   1 
ATOM   1965 N  N     . ILE C 2 188 ? -10.718 -6.562  10.290  1.00 21.70 ? 189 ILE A N     1 
ATOM   1966 C  CA    . ILE C 2 188 ? -11.481 -6.199  11.476  1.00 19.60 ? 189 ILE A CA    1 
ATOM   1967 C  C     . ILE C 2 188 ? -11.624 -4.669  11.423  1.00 19.04 ? 189 ILE A C     1 
ATOM   1968 O  O     . ILE C 2 188 ? -10.673 -3.966  11.077  1.00 14.96 ? 189 ILE A O     1 
ATOM   1969 C  CB    . ILE C 2 188 ? -10.680 -6.572  12.761  1.00 22.18 ? 189 ILE A CB    1 
ATOM   1970 C  CG1   . ILE C 2 188 ? -10.519 -8.089  12.857  1.00 22.07 ? 189 ILE A CG1   1 
ATOM   1971 C  CG2   . ILE C 2 188 ? -11.341 -5.975  14.002  1.00 20.34 ? 189 ILE A CG2   1 
ATOM   1972 C  CD1   . ILE C 2 188 ? -9.539  -8.527  13.925  1.00 24.50 ? 189 ILE A CD1   1 
ATOM   1973 N  N     . GLY C 2 189 ? -12.801 -4.152  11.744  1.00 19.00 ? 190 GLY A N     1 
ATOM   1974 C  CA    . GLY C 2 189 ? -12.966 -2.711  11.753  1.00 19.58 ? 190 GLY A CA    1 
ATOM   1975 C  C     . GLY C 2 189 ? -12.827 -2.204  13.183  1.00 20.64 ? 190 GLY A C     1 
ATOM   1976 O  O     . GLY C 2 189 ? -13.123 -2.942  14.127  1.00 20.37 ? 190 GLY A O     1 
ATOM   1977 N  N     . SER C 2 190 ? -12.367 -0.968  13.359  1.00 19.75 ? 191 SER A N     1 
ATOM   1978 C  CA    . SER C 2 190 ? -12.239 -0.391  14.699  1.00 16.96 ? 191 SER A CA    1 
ATOM   1979 C  C     . SER C 2 190 ? -13.563 0.283   15.027  1.00 18.93 ? 191 SER A C     1 
ATOM   1980 O  O     . SER C 2 190 ? -14.484 0.278   14.201  1.00 17.14 ? 191 SER A O     1 
ATOM   1981 C  CB    . SER C 2 190 ? -11.115 0.660   14.733  1.00 16.52 ? 191 SER A CB    1 
ATOM   1982 O  OG    . SER C 2 190 ? -11.477 1.851   14.043  1.00 16.02 ? 191 SER A OG    1 
ATOM   1983 N  N     . ILE C 2 191 ? -13.671 0.863   16.224  1.00 18.60 ? 192 ILE A N     1 
ATOM   1984 C  CA    . ILE C 2 191 ? -14.882 1.604   16.587  1.00 16.70 ? 192 ILE A CA    1 
ATOM   1985 C  C     . ILE C 2 191 ? -14.820 2.831   15.659  1.00 16.55 ? 192 ILE A C     1 
ATOM   1986 O  O     . ILE C 2 191 ? -13.732 3.214   15.207  1.00 15.17 ? 192 ILE A O     1 
ATOM   1987 C  CB    . ILE C 2 191 ? -14.848 2.078   18.085  1.00 22.54 ? 192 ILE A CB    1 
ATOM   1988 C  CG1   . ILE C 2 191 ? -13.553 2.862   18.365  1.00 23.08 ? 192 ILE A CG1   1 
ATOM   1989 C  CG2   . ILE C 2 191 ? -14.931 0.880   19.034  1.00 20.75 ? 192 ILE A CG2   1 
ATOM   1990 C  CD1   . ILE C 2 191 ? -13.384 3.314   19.786  1.00 22.75 ? 192 ILE A CD1   1 
ATOM   1991 N  N     . HIS C 2 192 ? -15.959 3.435   15.358  1.00 15.53 ? 193 HIS A N     1 
ATOM   1992 C  CA    . HIS C 2 192 ? -15.986 4.616   14.505  1.00 20.64 ? 193 HIS A CA    1 
ATOM   1993 C  C     . HIS C 2 192 ? -16.230 5.744   15.504  1.00 23.70 ? 193 HIS A C     1 
ATOM   1994 O  O     . HIS C 2 192 ? -17.368 6.014   15.884  1.00 25.72 ? 193 HIS A O     1 
ATOM   1995 C  CB    . HIS C 2 192 ? -17.135 4.507   13.498  1.00 21.08 ? 193 HIS A CB    1 
ATOM   1996 C  CG    . HIS C 2 192 ? -17.155 5.601   12.474  1.00 34.20 ? 193 HIS A CG    1 
ATOM   1997 N  ND1   . HIS C 2 192 ? -16.012 6.097   11.886  1.00 47.22 ? 193 HIS A ND1   1 
ATOM   1998 C  CD2   . HIS C 2 192 ? -18.187 6.282   11.919  1.00 37.43 ? 193 HIS A CD2   1 
ATOM   1999 C  CE1   . HIS C 2 192 ? -16.335 7.036   11.012  1.00 40.26 ? 193 HIS A CE1   1 
ATOM   2000 N  NE2   . HIS C 2 192 ? -17.650 7.167   11.013  1.00 36.97 ? 193 HIS A NE2   1 
ATOM   2001 N  N     . ALA C 2 193 ? -15.161 6.399   15.930  1.00 21.38 ? 194 ALA A N     1 
ATOM   2002 C  CA    . ALA C 2 193 ? -15.291 7.440   16.934  1.00 24.74 ? 194 ALA A CA    1 
ATOM   2003 C  C     . ALA C 2 193 ? -14.283 8.565   16.766  1.00 24.89 ? 194 ALA A C     1 
ATOM   2004 O  O     . ALA C 2 193 ? -13.524 8.600   15.800  1.00 25.87 ? 194 ALA A O     1 
ATOM   2005 C  CB    . ALA C 2 193 ? -15.144 6.812   18.314  1.00 24.50 ? 194 ALA A CB    1 
ATOM   2006 N  N     . HIS C 2 194 ? -14.283 9.494   17.716  1.00 24.70 ? 195 HIS A N     1 
ATOM   2007 C  CA    . HIS C 2 194 ? -13.357 10.623  17.684  1.00 23.24 ? 195 HIS A CA    1 
ATOM   2008 C  C     . HIS C 2 194 ? -12.033 10.184  18.272  1.00 20.53 ? 195 HIS A C     1 
ATOM   2009 O  O     . HIS C 2 194 ? -11.982 9.217   19.035  1.00 20.83 ? 195 HIS A O     1 
ATOM   2010 C  CB    . HIS C 2 194 ? -13.911 11.798  18.490  1.00 27.03 ? 195 HIS A CB    1 
ATOM   2011 C  CG    . HIS C 2 194 ? -15.189 12.347  17.944  1.00 30.27 ? 195 HIS A CG    1 
ATOM   2012 N  ND1   . HIS C 2 194 ? -15.229 13.237  16.892  1.00 39.59 ? 195 HIS A ND1   1 
ATOM   2013 C  CD2   . HIS C 2 194 ? -16.478 12.121  18.293  1.00 42.27 ? 195 HIS A CD2   1 
ATOM   2014 C  CE1   . HIS C 2 194 ? -16.486 13.537  16.616  1.00 44.33 ? 195 HIS A CE1   1 
ATOM   2015 N  NE2   . HIS C 2 194 ? -17.264 12.873  17.451  1.00 45.88 ? 195 HIS A NE2   1 
ATOM   2016 N  N     . TYR C 2 195 ? -10.969 10.896  17.918  1.00 18.35 ? 196 TYR A N     1 
ATOM   2017 C  CA    . TYR C 2 195 ? -9.628  10.595  18.402  1.00 19.77 ? 196 TYR A CA    1 
ATOM   2018 C  C     . TYR C 2 195 ? -9.544  10.386  19.927  1.00 21.18 ? 196 TYR A C     1 
ATOM   2019 O  O     . TYR C 2 195 ? -8.892  9.452   20.382  1.00 21.26 ? 196 TYR A O     1 
ATOM   2020 C  CB    . TYR C 2 195 ? -8.675  11.710  17.956  1.00 13.90 ? 196 TYR A CB    1 
ATOM   2021 C  CG    . TYR C 2 195 ? -7.306  11.715  18.612  1.00 18.32 ? 196 TYR A CG    1 
ATOM   2022 C  CD1   . TYR C 2 195 ? -6.300  10.858  18.186  1.00 14.87 ? 196 TYR A CD1   1 
ATOM   2023 C  CD2   . TYR C 2 195 ? -7.012  12.605  19.653  1.00 23.17 ? 196 TYR A CD2   1 
ATOM   2024 C  CE1   . TYR C 2 195 ? -5.033  10.880  18.775  1.00 21.51 ? 196 TYR A CE1   1 
ATOM   2025 C  CE2   . TYR C 2 195 ? -5.744  12.636  20.249  1.00 12.31 ? 196 TYR A CE2   1 
ATOM   2026 C  CZ    . TYR C 2 195 ? -4.764  11.776  19.808  1.00 16.34 ? 196 TYR A CZ    1 
ATOM   2027 O  OH    . TYR C 2 195 ? -3.518  11.801  20.397  1.00 18.59 ? 196 TYR A OH    1 
ATOM   2028 N  N     . LYS C 2 196 ? -10.202 11.239  20.711  1.00 23.78 ? 197 LYS A N     1 
ATOM   2029 C  CA    . LYS C 2 196 ? -10.150 11.115  22.171  1.00 27.70 ? 197 LYS A CA    1 
ATOM   2030 C  C     . LYS C 2 196 ? -10.639 9.750   22.662  1.00 27.53 ? 197 LYS A C     1 
ATOM   2031 O  O     . LYS C 2 196 ? -10.134 9.227   23.662  1.00 28.90 ? 197 LYS A O     1 
ATOM   2032 C  CB    . LYS C 2 196 ? -10.943 12.241  22.853  1.00 36.38 ? 197 LYS A CB    1 
ATOM   2033 C  CG    . LYS C 2 196 ? -12.443 11.985  23.002  1.00 49.32 ? 197 LYS A CG    1 
ATOM   2034 C  CD    . LYS C 2 196 ? -13.042 12.882  24.086  1.00 63.49 ? 197 LYS A CD    1 
ATOM   2035 C  CE    . LYS C 2 196 ? -14.375 12.344  24.598  1.00 71.79 ? 197 LYS A CE    1 
ATOM   2036 N  NZ    . LYS C 2 196 ? -14.231 10.993  25.228  1.00 73.80 ? 197 LYS A NZ    1 
ATOM   2037 N  N     . ASP C 2 197 ? -11.608 9.169   21.958  1.00 26.72 ? 198 ASP A N     1 
ATOM   2038 C  CA    . ASP C 2 197 ? -12.143 7.854   22.323  1.00 24.43 ? 198 ASP A CA    1 
ATOM   2039 C  C     . ASP C 2 197 ? -11.093 6.743   22.145  1.00 21.69 ? 198 ASP A C     1 
ATOM   2040 O  O     . ASP C 2 197 ? -11.123 5.742   22.860  1.00 22.72 ? 198 ASP A O     1 
ATOM   2041 C  CB    . ASP C 2 197 ? -13.402 7.543   21.504  1.00 27.26 ? 198 ASP A CB    1 
ATOM   2042 C  CG    . ASP C 2 197 ? -14.544 8.508   21.792  1.00 36.43 ? 198 ASP A CG    1 
ATOM   2043 O  OD1   . ASP C 2 197 ? -14.746 8.870   22.970  1.00 45.11 ? 198 ASP A OD1   1 
ATOM   2044 O  OD2   . ASP C 2 197 ? -15.243 8.909   20.839  1.00 48.98 ? 198 ASP A OD2   1 
ATOM   2045 N  N     . PHE C 2 198 ? -10.168 6.920   21.201  1.00 16.89 ? 199 PHE A N     1 
ATOM   2046 C  CA    . PHE C 2 198 ? -9.111  5.938   20.965  1.00 15.32 ? 199 PHE A CA    1 
ATOM   2047 C  C     . PHE C 2 198 ? -8.054  6.074   22.063  1.00 18.91 ? 199 PHE A C     1 
ATOM   2048 O  O     . PHE C 2 198 ? -7.567  5.080   22.607  1.00 22.75 ? 199 PHE A O     1 
ATOM   2049 C  CB    . PHE C 2 198 ? -8.463  6.152   19.589  1.00 16.19 ? 199 PHE A CB    1 
ATOM   2050 C  CG    . PHE C 2 198 ? -9.349  5.773   18.439  1.00 20.51 ? 199 PHE A CG    1 
ATOM   2051 C  CD1   . PHE C 2 198 ? -9.353  4.469   17.948  1.00 16.62 ? 199 PHE A CD1   1 
ATOM   2052 C  CD2   . PHE C 2 198 ? -10.199 6.706   17.861  1.00 16.64 ? 199 PHE A CD2   1 
ATOM   2053 C  CE1   . PHE C 2 198 ? -10.193 4.104   16.899  1.00 18.82 ? 199 PHE A CE1   1 
ATOM   2054 C  CE2   . PHE C 2 198 ? -11.047 6.349   16.808  1.00 20.83 ? 199 PHE A CE2   1 
ATOM   2055 C  CZ    . PHE C 2 198 ? -11.043 5.047   16.329  1.00 11.90 ? 199 PHE A CZ    1 
ATOM   2056 N  N     . VAL C 2 199 ? -7.708  7.313   22.391  1.00 18.60 ? 200 VAL A N     1 
ATOM   2057 C  CA    . VAL C 2 199 ? -6.727  7.589   23.440  1.00 18.81 ? 200 VAL A CA    1 
ATOM   2058 C  C     . VAL C 2 199 ? -7.236  7.032   24.777  1.00 16.86 ? 200 VAL A C     1 
ATOM   2059 O  O     . VAL C 2 199 ? -6.514  6.325   25.483  1.00 18.79 ? 200 VAL A O     1 
ATOM   2060 C  CB    . VAL C 2 199 ? -6.479  9.127   23.573  1.00 24.49 ? 200 VAL A CB    1 
ATOM   2061 C  CG1   . VAL C 2 199 ? -5.689  9.444   24.845  1.00 19.46 ? 200 VAL A CG1   1 
ATOM   2062 C  CG2   . VAL C 2 199 ? -5.716  9.634   22.357  1.00 16.36 ? 200 VAL A CG2   1 
ATOM   2063 N  N     . GLU C 2 200 ? -8.483  7.355   25.109  1.00 16.20 ? 201 GLU A N     1 
ATOM   2064 C  CA    . GLU C 2 200 ? -9.120  6.907   26.352  1.00 25.44 ? 201 GLU A CA    1 
ATOM   2065 C  C     . GLU C 2 200 ? -9.551  5.439   26.336  1.00 28.01 ? 201 GLU A C     1 
ATOM   2066 O  O     . GLU C 2 200 ? -9.779  4.843   27.390  1.00 27.72 ? 201 GLU A O     1 
ATOM   2067 C  CB    . GLU C 2 200 ? -10.347 7.767   26.660  1.00 28.91 ? 201 GLU A CB    1 
ATOM   2068 C  CG    . GLU C 2 200 ? -10.032 9.201   27.058  1.00 38.42 ? 201 GLU A CG    1 
ATOM   2069 C  CD    . GLU C 2 200 ? -11.281 10.036  27.256  1.00 39.43 ? 201 GLU A CD    1 
ATOM   2070 O  OE1   . GLU C 2 200 ? -12.268 9.522   27.833  1.00 47.78 ? 201 GLU A OE1   1 
ATOM   2071 O  OE2   . GLU C 2 200 ? -11.268 11.208  26.829  1.00 45.03 ? 201 GLU A OE2   1 
ATOM   2072 N  N     . GLY C 2 201 ? -9.680  4.866   25.143  1.00 28.69 ? 202 GLY A N     1 
ATOM   2073 C  CA    . GLY C 2 201 ? -10.058 3.466   25.029  1.00 27.40 ? 202 GLY A CA    1 
ATOM   2074 C  C     . GLY C 2 201 ? -11.507 3.137   25.318  1.00 27.65 ? 202 GLY A C     1 
ATOM   2075 O  O     . GLY C 2 201 ? -11.809 2.174   26.037  1.00 27.18 ? 202 GLY A O     1 
ATOM   2076 N  N     . LYS C 2 202 ? -12.408 3.934   24.756  1.00 27.58 ? 203 LYS A N     1 
ATOM   2077 C  CA    . LYS C 2 202 ? -13.826 3.721   24.948  1.00 29.64 ? 203 LYS A CA    1 
ATOM   2078 C  C     . LYS C 2 202 ? -14.369 2.823   23.841  1.00 31.78 ? 203 LYS A C     1 
ATOM   2079 O  O     . LYS C 2 202 ? -15.094 3.274   22.952  1.00 31.92 ? 203 LYS A O     1 
ATOM   2080 C  CB    . LYS C 2 202 ? -14.547 5.066   24.990  1.00 27.54 ? 203 LYS A CB    1 
ATOM   2081 C  CG    . LYS C 2 202 ? -14.122 5.909   26.189  1.00 47.02 ? 203 LYS A CG    1 
ATOM   2082 C  CD    . LYS C 2 202 ? -15.091 7.045   26.426  1.00 62.71 ? 203 LYS A CD    1 
ATOM   2083 C  CE    . LYS C 2 202 ? -14.982 7.560   27.848  1.00 71.78 ? 203 LYS A CE    1 
ATOM   2084 N  NZ    . LYS C 2 202 ? -16.162 8.398   28.196  1.00 71.01 ? 203 LYS A NZ    1 
ATOM   2085 N  N     . GLY C 2 203 ? -14.002 1.546   23.913  1.00 33.24 ? 204 GLY A N     1 
ATOM   2086 C  CA    . GLY C 2 203 ? -14.435 0.576   22.924  1.00 34.24 ? 204 GLY A CA    1 
ATOM   2087 C  C     . GLY C 2 203 ? -15.725 -0.113  23.308  1.00 31.79 ? 204 GLY A C     1 
ATOM   2088 O  O     . GLY C 2 203 ? -16.423 0.352   24.206  1.00 32.41 ? 204 GLY A O     1 
ATOM   2089 N  N     . ILE C 2 204 ? -16.041 -1.219  22.634  1.00 28.31 ? 205 ILE A N     1 
ATOM   2090 C  CA    . ILE C 2 204 ? -17.273 -1.953  22.918  1.00 26.47 ? 205 ILE A CA    1 
ATOM   2091 C  C     . ILE C 2 204 ? -17.079 -3.319  23.587  1.00 23.00 ? 205 ILE A C     1 
ATOM   2092 O  O     . ILE C 2 204 ? -17.997 -3.826  24.217  1.00 24.35 ? 205 ILE A O     1 
ATOM   2093 C  CB    . ILE C 2 204 ? -18.129 -2.175  21.650  1.00 30.69 ? 205 ILE A CB    1 
ATOM   2094 C  CG1   . ILE C 2 204 ? -17.317 -2.916  20.589  1.00 32.77 ? 205 ILE A CG1   1 
ATOM   2095 C  CG2   . ILE C 2 204 ? -18.646 -0.857  21.125  1.00 30.92 ? 205 ILE A CG2   1 
ATOM   2096 C  CD1   . ILE C 2 204 ? -18.144 -3.392  19.437  1.00 37.54 ? 205 ILE A CD1   1 
ATOM   2097 N  N     . PHE C 2 205 ? -15.903 -3.919  23.450  1.00 23.40 ? 206 PHE A N     1 
ATOM   2098 C  CA    . PHE C 2 205 ? -15.654 -5.220  24.055  1.00 24.64 ? 206 PHE A CA    1 
ATOM   2099 C  C     . PHE C 2 205 ? -15.297 -5.124  25.536  1.00 27.02 ? 206 PHE A C     1 
ATOM   2100 O  O     . PHE C 2 205 ? -14.587 -4.207  25.963  1.00 25.37 ? 206 PHE A O     1 
ATOM   2101 C  CB    . PHE C 2 205 ? -14.565 -5.971  23.279  1.00 19.54 ? 206 PHE A CB    1 
ATOM   2102 C  CG    . PHE C 2 205 ? -15.000 -6.399  21.899  1.00 26.71 ? 206 PHE A CG    1 
ATOM   2103 C  CD1   . PHE C 2 205 ? -15.959 -7.397  21.735  1.00 21.41 ? 206 PHE A CD1   1 
ATOM   2104 C  CD2   . PHE C 2 205 ? -14.466 -5.797  20.765  1.00 20.19 ? 206 PHE A CD2   1 
ATOM   2105 C  CE1   . PHE C 2 205 ? -16.379 -7.785  20.462  1.00 22.43 ? 206 PHE A CE1   1 
ATOM   2106 C  CE2   . PHE C 2 205 ? -14.881 -6.181  19.484  1.00 23.73 ? 206 PHE A CE2   1 
ATOM   2107 C  CZ    . PHE C 2 205 ? -15.838 -7.175  19.336  1.00 20.64 ? 206 PHE A CZ    1 
ATOM   2108 N  N     . ASP C 2 206 ? -15.803 -6.073  26.321  1.00 27.00 ? 207 ASP A N     1 
ATOM   2109 C  CA    . ASP C 2 206 ? -15.526 -6.106  27.758  1.00 26.98 ? 207 ASP A CA    1 
ATOM   2110 C  C     . ASP C 2 206 ? -14.180 -6.717  28.073  1.00 24.62 ? 207 ASP A C     1 
ATOM   2111 O  O     . ASP C 2 206 ? -13.587 -6.411  29.103  1.00 29.41 ? 207 ASP A O     1 
ATOM   2112 C  CB    . ASP C 2 206 ? -16.611 -6.867  28.524  1.00 28.93 ? 207 ASP A CB    1 
ATOM   2113 C  CG    . ASP C 2 206 ? -17.869 -6.039  28.749  1.00 37.70 ? 207 ASP A CG    1 
ATOM   2114 O  OD1   . ASP C 2 206 ? -17.878 -4.825  28.435  1.00 43.09 ? 207 ASP A OD1   1 
ATOM   2115 O  OD2   . ASP C 2 206 ? -18.858 -6.614  29.248  1.00 49.70 ? 207 ASP A OD2   1 
ATOM   2116 N  N     . SER C 2 207 ? -13.689 -7.579  27.196  1.00 20.41 ? 208 SER A N     1 
ATOM   2117 C  CA    . SER C 2 207 ? -12.397 -8.198  27.446  1.00 22.45 ? 208 SER A CA    1 
ATOM   2118 C  C     . SER C 2 207 ? -11.764 -8.601  26.137  1.00 20.40 ? 208 SER A C     1 
ATOM   2119 O  O     . SER C 2 207 ? -12.434 -8.655  25.112  1.00 23.11 ? 208 SER A O     1 
ATOM   2120 C  CB    . SER C 2 207 ? -12.563 -9.441  28.322  1.00 24.31 ? 208 SER A CB    1 
ATOM   2121 O  OG    . SER C 2 207 ? -13.354 -10.427 27.669  1.00 27.99 ? 208 SER A OG    1 
ATOM   2122 N  N     . GLU C 2 208 ? -10.471 -8.887  26.181  1.00 17.44 ? 209 GLU A N     1 
ATOM   2123 C  CA    . GLU C 2 208 ? -9.748  -9.317  25.007  1.00 23.35 ? 209 GLU A CA    1 
ATOM   2124 C  C     . GLU C 2 208 ? -10.308 -10.671 24.568  1.00 29.03 ? 209 GLU A C     1 
ATOM   2125 O  O     . GLU C 2 208 ? -10.324 -10.989 23.379  1.00 33.41 ? 209 GLU A O     1 
ATOM   2126 C  CB    . GLU C 2 208 ? -8.268  -9.441  25.332  1.00 19.46 ? 209 GLU A CB    1 
ATOM   2127 C  CG    . GLU C 2 208 ? -7.401  -9.756  24.129  1.00 25.77 ? 209 GLU A CG    1 
ATOM   2128 C  CD    . GLU C 2 208 ? -5.927  -9.554  24.415  1.00 26.64 ? 209 GLU A CD    1 
ATOM   2129 O  OE1   . GLU C 2 208 ? -5.514  -9.672  25.589  1.00 39.35 ? 209 GLU A OE1   1 
ATOM   2130 O  OE2   . GLU C 2 208 ? -5.175  -9.272  23.465  1.00 29.88 ? 209 GLU A OE2   1 
ATOM   2131 N  N     . ASP C 2 209 ? -10.770 -11.458 25.536  1.00 25.05 ? 210 ASP A N     1 
ATOM   2132 C  CA    . ASP C 2 209 ? -11.331 -12.768 25.251  1.00 25.01 ? 210 ASP A CA    1 
ATOM   2133 C  C     . ASP C 2 209 ? -12.639 -12.648 24.487  1.00 21.97 ? 210 ASP A C     1 
ATOM   2134 O  O     . ASP C 2 209 ? -12.937 -13.483 23.641  1.00 24.37 ? 210 ASP A O     1 
ATOM   2135 C  CB    . ASP C 2 209 ? -11.567 -13.556 26.546  1.00 36.39 ? 210 ASP A CB    1 
ATOM   2136 C  CG    . ASP C 2 209 ? -10.275 -13.903 27.266  1.00 45.93 ? 210 ASP A CG    1 
ATOM   2137 O  OD1   . ASP C 2 209 ? -9.352  -14.435 26.611  1.00 52.57 ? 210 ASP A OD1   1 
ATOM   2138 O  OD2   . ASP C 2 209 ? -10.184 -13.644 28.486  1.00 58.92 ? 210 ASP A OD2   1 
ATOM   2139 N  N     . GLU C 2 210 ? -13.423 -11.618 24.781  1.00 17.08 ? 211 GLU A N     1 
ATOM   2140 C  CA    . GLU C 2 210 ? -14.688 -11.439 24.086  1.00 17.17 ? 211 GLU A CA    1 
ATOM   2141 C  C     . GLU C 2 210 ? -14.395 -10.955 22.667  1.00 21.79 ? 211 GLU A C     1 
ATOM   2142 O  O     . GLU C 2 210 ? -15.084 -11.317 21.711  1.00 20.60 ? 211 GLU A O     1 
ATOM   2143 C  CB    . GLU C 2 210 ? -15.563 -10.424 24.804  1.00 11.02 ? 211 GLU A CB    1 
ATOM   2144 C  CG    . GLU C 2 210 ? -16.973 -10.388 24.271  1.00 15.22 ? 211 GLU A CG    1 
ATOM   2145 C  CD    . GLU C 2 210 ? -17.816 -9.277  24.861  1.00 24.94 ? 211 GLU A CD    1 
ATOM   2146 O  OE1   . GLU C 2 210 ? -17.298 -8.165  25.099  1.00 21.46 ? 211 GLU A OE1   1 
ATOM   2147 O  OE2   . GLU C 2 210 ? -19.018 -9.511  25.086  1.00 26.77 ? 211 GLU A OE2   1 
ATOM   2148 N  N     . PHE C 2 211 ? -13.362 -10.129 22.548  1.00 20.05 ? 212 PHE A N     1 
ATOM   2149 C  CA    . PHE C 2 211 ? -12.950 -9.596  21.269  1.00 20.21 ? 212 PHE A CA    1 
ATOM   2150 C  C     . PHE C 2 211 ? -12.554 -10.764 20.366  1.00 18.83 ? 212 PHE A C     1 
ATOM   2151 O  O     . PHE C 2 211 ? -13.076 -10.901 19.261  1.00 20.16 ? 212 PHE A O     1 
ATOM   2152 C  CB    . PHE C 2 211 ? -11.785 -8.622  21.477  1.00 15.98 ? 212 PHE A CB    1 
ATOM   2153 C  CG    . PHE C 2 211 ? -10.902 -8.457  20.278  1.00 15.42 ? 212 PHE A CG    1 
ATOM   2154 C  CD1   . PHE C 2 211 ? -11.354 -7.787  19.148  1.00 14.25 ? 212 PHE A CD1   1 
ATOM   2155 C  CD2   . PHE C 2 211 ? -9.613  -8.985  20.279  1.00 14.36 ? 212 PHE A CD2   1 
ATOM   2156 C  CE1   . PHE C 2 211 ? -10.530 -7.646  18.030  1.00 19.11 ? 212 PHE A CE1   1 
ATOM   2157 C  CE2   . PHE C 2 211 ? -8.780  -8.849  19.167  1.00 18.74 ? 212 PHE A CE2   1 
ATOM   2158 C  CZ    . PHE C 2 211 ? -9.243  -8.177  18.038  1.00 17.23 ? 212 PHE A CZ    1 
ATOM   2159 N  N     . LEU C 2 212 ? -11.638 -11.601 20.845  1.00 18.51 ? 213 LEU A N     1 
ATOM   2160 C  CA    . LEU C 2 212 ? -11.173 -12.752 20.086  1.00 21.26 ? 213 LEU A CA    1 
ATOM   2161 C  C     . LEU C 2 212 ? -12.297 -13.673 19.644  1.00 22.94 ? 213 LEU A C     1 
ATOM   2162 O  O     . LEU C 2 212 ? -12.378 -14.042 18.473  1.00 24.85 ? 213 LEU A O     1 
ATOM   2163 C  CB    . LEU C 2 212 ? -10.155 -13.541 20.895  1.00 18.58 ? 213 LEU A CB    1 
ATOM   2164 C  CG    . LEU C 2 212 ? -8.813  -12.832 20.966  1.00 22.55 ? 213 LEU A CG    1 
ATOM   2165 C  CD1   . LEU C 2 212 ? -7.873  -13.609 21.869  1.00 20.05 ? 213 LEU A CD1   1 
ATOM   2166 C  CD2   . LEU C 2 212 ? -8.238  -12.714 19.552  1.00 27.10 ? 213 LEU A CD2   1 
ATOM   2167 N  N     . ASP C 2 213 ? -13.168 -14.035 20.577  1.00 20.77 ? 214 ASP A N     1 
ATOM   2168 C  CA    . ASP C 2 213 ? -14.271 -14.923 20.266  1.00 20.00 ? 214 ASP A CA    1 
ATOM   2169 C  C     . ASP C 2 213 ? -15.191 -14.326 19.212  1.00 18.97 ? 214 ASP A C     1 
ATOM   2170 O  O     . ASP C 2 213 ? -15.617 -15.024 18.294  1.00 17.75 ? 214 ASP A O     1 
ATOM   2171 C  CB    . ASP C 2 213 ? -15.071 -15.269 21.525  1.00 21.56 ? 214 ASP A CB    1 
ATOM   2172 C  CG    . ASP C 2 213 ? -15.971 -16.477 21.321  1.00 18.83 ? 214 ASP A CG    1 
ATOM   2173 O  OD1   . ASP C 2 213 ? -15.429 -17.568 21.033  1.00 21.24 ? 214 ASP A OD1   1 
ATOM   2174 O  OD2   . ASP C 2 213 ? -17.208 -16.333 21.441  1.00 19.60 ? 214 ASP A OD2   1 
ATOM   2175 N  N     . TYR C 2 214 ? -15.498 -13.043 19.337  1.00 15.31 ? 215 TYR A N     1 
ATOM   2176 C  CA    . TYR C 2 214 ? -16.365 -12.379 18.367  1.00 19.29 ? 215 TYR A CA    1 
ATOM   2177 C  C     . TYR C 2 214 ? -15.775 -12.486 16.961  1.00 20.91 ? 215 TYR A C     1 
ATOM   2178 O  O     . TYR C 2 214 ? -16.472 -12.839 16.011  1.00 18.52 ? 215 TYR A O     1 
ATOM   2179 C  CB    . TYR C 2 214 ? -16.529 -10.890 18.707  1.00 15.96 ? 215 TYR A CB    1 
ATOM   2180 C  CG    . TYR C 2 214 ? -17.486 -10.154 17.793  1.00 17.01 ? 215 TYR A CG    1 
ATOM   2181 C  CD1   . TYR C 2 214 ? -17.071 -9.654  16.549  1.00 20.05 ? 215 TYR A CD1   1 
ATOM   2182 C  CD2   . TYR C 2 214 ? -18.814 -9.980  18.154  1.00 15.67 ? 215 TYR A CD2   1 
ATOM   2183 C  CE1   . TYR C 2 214 ? -17.979 -8.999  15.691  1.00 5.80  ? 215 TYR A CE1   1 
ATOM   2184 C  CE2   . TYR C 2 214 ? -19.716 -9.335  17.309  1.00 18.05 ? 215 TYR A CE2   1 
ATOM   2185 C  CZ    . TYR C 2 214 ? -19.292 -8.849  16.083  1.00 11.32 ? 215 TYR A CZ    1 
ATOM   2186 O  OH    . TYR C 2 214 ? -20.209 -8.209  15.271  1.00 13.73 ? 215 TYR A OH    1 
ATOM   2187 N  N     . TRP C 2 215 ? -14.488 -12.182 16.833  1.00 19.43 ? 216 TRP A N     1 
ATOM   2188 C  CA    . TRP C 2 215 ? -13.858 -12.201 15.529  1.00 22.20 ? 216 TRP A CA    1 
ATOM   2189 C  C     . TRP C 2 215 ? -13.480 -13.560 14.966  1.00 24.48 ? 216 TRP A C     1 
ATOM   2190 O  O     . TRP C 2 215 ? -13.272 -13.699 13.758  1.00 25.33 ? 216 TRP A O     1 
ATOM   2191 C  CB    . TRP C 2 215 ? -12.707 -11.199 15.500  1.00 13.05 ? 216 TRP A CB    1 
ATOM   2192 C  CG    . TRP C 2 215 ? -13.273 -9.812  15.444  1.00 23.62 ? 216 TRP A CG    1 
ATOM   2193 C  CD1   . TRP C 2 215 ? -13.339 -8.902  16.467  1.00 27.35 ? 216 TRP A CD1   1 
ATOM   2194 C  CD2   . TRP C 2 215 ? -13.914 -9.194  14.316  1.00 26.21 ? 216 TRP A CD2   1 
ATOM   2195 N  NE1   . TRP C 2 215 ? -13.984 -7.763  16.044  1.00 19.89 ? 216 TRP A NE1   1 
ATOM   2196 C  CE2   . TRP C 2 215 ? -14.347 -7.912  14.732  1.00 23.54 ? 216 TRP A CE2   1 
ATOM   2197 C  CE3   . TRP C 2 215 ? -14.169 -9.602  12.993  1.00 19.75 ? 216 TRP A CE3   1 
ATOM   2198 C  CZ2   . TRP C 2 215 ? -15.019 -7.031  13.875  1.00 21.53 ? 216 TRP A CZ2   1 
ATOM   2199 C  CZ3   . TRP C 2 215 ? -14.836 -8.731  12.145  1.00 21.59 ? 216 TRP A CZ3   1 
ATOM   2200 C  CH2   . TRP C 2 215 ? -15.255 -7.455  12.592  1.00 20.94 ? 216 TRP A CH2   1 
ATOM   2201 N  N     . ARG C 2 216 ? -13.405 -14.561 15.832  1.00 22.74 ? 217 ARG A N     1 
ATOM   2202 C  CA    . ARG C 2 216 ? -13.108 -15.922 15.397  1.00 21.54 ? 217 ARG A CA    1 
ATOM   2203 C  C     . ARG C 2 216 ? -14.352 -16.617 14.820  1.00 21.51 ? 217 ARG A C     1 
ATOM   2204 O  O     . ARG C 2 216 ? -14.230 -17.579 14.060  1.00 25.14 ? 217 ARG A O     1 
ATOM   2205 C  CB    . ARG C 2 216 ? -12.584 -16.736 16.566  1.00 17.80 ? 217 ARG A CB    1 
ATOM   2206 C  CG    . ARG C 2 216 ? -11.132 -16.512 16.832  1.00 17.87 ? 217 ARG A CG    1 
ATOM   2207 C  CD    . ARG C 2 216 ? -10.729 -17.225 18.093  1.00 18.95 ? 217 ARG A CD    1 
ATOM   2208 N  NE    . ARG C 2 216 ? -9.290  -17.142 18.284  1.00 23.14 ? 217 ARG A NE    1 
ATOM   2209 C  CZ    . ARG C 2 216 ? -8.693  -17.195 19.467  1.00 27.18 ? 217 ARG A CZ    1 
ATOM   2210 N  NH1   . ARG C 2 216 ? -9.418  -17.320 20.574  1.00 23.84 ? 217 ARG A NH1   1 
ATOM   2211 N  NH2   . ARG C 2 216 ? -7.374  -17.122 19.540  1.00 17.61 ? 217 ARG A NH2   1 
ATOM   2212 N  N     . ASN C 2 217 ? -15.539 -16.123 15.177  1.00 18.30 ? 218 ASN A N     1 
ATOM   2213 C  CA    . ASN C 2 217 ? -16.800 -16.707 14.720  1.00 21.80 ? 218 ASN A CA    1 
ATOM   2214 C  C     . ASN C 2 217 ? -17.620 -15.777 13.843  1.00 21.85 ? 218 ASN A C     1 
ATOM   2215 O  O     . ASN C 2 217 ? -18.790 -16.043 13.558  1.00 20.62 ? 218 ASN A O     1 
ATOM   2216 C  CB    . ASN C 2 217 ? -17.649 -17.145 15.922  1.00 22.37 ? 218 ASN A CB    1 
ATOM   2217 C  CG    . ASN C 2 217 ? -16.997 -18.251 16.712  1.00 21.48 ? 218 ASN A CG    1 
ATOM   2218 O  OD1   . ASN C 2 217 ? -17.094 -19.420 16.357  1.00 32.45 ? 218 ASN A OD1   1 
ATOM   2219 N  ND2   . ASN C 2 217 ? -16.321 -17.888 17.786  1.00 23.56 ? 218 ASN A ND2   1 
ATOM   2220 N  N     . TYR C 2 218 ? -17.008 -14.678 13.424  1.00 21.78 ? 219 TYR A N     1 
ATOM   2221 C  CA    . TYR C 2 218 ? -17.671 -13.702 12.562  1.00 22.34 ? 219 TYR A CA    1 
ATOM   2222 C  C     . TYR C 2 218 ? -17.711 -14.331 11.156  1.00 21.35 ? 219 TYR A C     1 
ATOM   2223 O  O     . TYR C 2 218 ? -16.678 -14.765 10.653  1.00 19.32 ? 219 TYR A O     1 
ATOM   2224 C  CB    . TYR C 2 218 ? -16.833 -12.408 12.558  1.00 22.54 ? 219 TYR A CB    1 
ATOM   2225 C  CG    . TYR C 2 218 ? -17.435 -11.213 11.841  1.00 23.56 ? 219 TYR A CG    1 
ATOM   2226 C  CD1   . TYR C 2 218 ? -18.356 -10.384 12.478  1.00 20.51 ? 219 TYR A CD1   1 
ATOM   2227 C  CD2   . TYR C 2 218 ? -17.064 -10.902 10.531  1.00 16.42 ? 219 TYR A CD2   1 
ATOM   2228 C  CE1   . TYR C 2 218 ? -18.891 -9.273  11.831  1.00 23.75 ? 219 TYR A CE1   1 
ATOM   2229 C  CE2   . TYR C 2 218 ? -17.591 -9.799  9.878   1.00 19.85 ? 219 TYR A CE2   1 
ATOM   2230 C  CZ    . TYR C 2 218 ? -18.501 -8.989  10.528  1.00 26.63 ? 219 TYR A CZ    1 
ATOM   2231 O  OH    . TYR C 2 218 ? -19.014 -7.892  9.871   1.00 23.86 ? 219 TYR A OH    1 
ATOM   2232 N  N     . GLU C 2 219 ? -18.884 -14.401 10.537  1.00 20.39 ? 220 GLU A N     1 
ATOM   2233 C  CA    . GLU C 2 219 ? -18.979 -14.965 9.191   1.00 29.75 ? 220 GLU A CA    1 
ATOM   2234 C  C     . GLU C 2 219 ? -18.601 -13.915 8.125   1.00 33.03 ? 220 GLU A C     1 
ATOM   2235 O  O     . GLU C 2 219 ? -18.891 -12.728 8.295   1.00 33.97 ? 220 GLU A O     1 
ATOM   2236 C  CB    . GLU C 2 219 ? -20.390 -15.485 8.942   1.00 28.07 ? 220 GLU A CB    1 
ATOM   2237 C  CG    . GLU C 2 219 ? -20.796 -16.641 9.846   1.00 35.62 ? 220 GLU A CG    1 
ATOM   2238 C  CD    . GLU C 2 219 ? -20.048 -17.947 9.568   1.00 35.92 ? 220 GLU A CD    1 
ATOM   2239 O  OE1   . GLU C 2 219 ? -19.339 -18.059 8.546   1.00 33.31 ? 220 GLU A OE1   1 
ATOM   2240 O  OE2   . GLU C 2 219 ? -20.175 -18.879 10.388  1.00 45.55 ? 220 GLU A OE2   1 
ATOM   2241 N  N     . ARG C 2 220 ? -17.966 -14.358 7.037   1.00 32.97 ? 221 ARG A N     1 
ATOM   2242 C  CA    . ARG C 2 220 ? -17.503 -13.482 5.943   1.00 33.31 ? 221 ARG A CA    1 
ATOM   2243 C  C     . ARG C 2 220 ? -18.506 -12.635 5.154   1.00 33.49 ? 221 ARG A C     1 
ATOM   2244 O  O     . ARG C 2 220 ? -18.114 -11.617 4.577   1.00 33.23 ? 221 ARG A O     1 
ATOM   2245 C  CB    . ARG C 2 220 ? -16.689 -14.284 4.921   1.00 37.38 ? 221 ARG A CB    1 
ATOM   2246 C  CG    . ARG C 2 220 ? -15.344 -14.785 5.391   1.00 42.76 ? 221 ARG A CG    1 
ATOM   2247 C  CD    . ARG C 2 220 ? -14.683 -15.564 4.275   1.00 50.41 ? 221 ARG A CD    1 
ATOM   2248 N  NE    . ARG C 2 220 ? -13.454 -16.228 4.699   1.00 61.83 ? 221 ARG A NE    1 
ATOM   2249 C  CZ    . ARG C 2 220 ? -12.285 -16.096 4.076   1.00 67.57 ? 221 ARG A CZ    1 
ATOM   2250 N  NH1   . ARG C 2 220 ? -12.196 -15.317 3.004   1.00 65.41 ? 221 ARG A NH1   1 
ATOM   2251 N  NH2   . ARG C 2 220 ? -11.204 -16.738 4.521   1.00 64.31 ? 221 ARG A NH2   1 
ATOM   2252 N  N     . THR C 2 221 ? -19.774 -13.038 5.100   1.00 33.45 ? 222 THR A N     1 
ATOM   2253 C  CA    . THR C 2 221 ? -20.775 -12.271 4.345   1.00 36.56 ? 222 THR A CA    1 
ATOM   2254 C  C     . THR C 2 221 ? -22.023 -12.021 5.182   1.00 38.65 ? 222 THR A C     1 
ATOM   2255 O  O     . THR C 2 221 ? -22.358 -12.838 6.045   1.00 39.46 ? 222 THR A O     1 
ATOM   2256 C  CB    . THR C 2 221 ? -21.198 -13.020 3.061   1.00 38.82 ? 222 THR A CB    1 
ATOM   2257 O  OG1   . THR C 2 221 ? -21.756 -14.293 3.418   1.00 35.97 ? 222 THR A OG1   1 
ATOM   2258 C  CG2   . THR C 2 221 ? -19.997 -13.219 2.127   1.00 31.59 ? 222 THR A CG2   1 
ATOM   2259 N  N     . SER C 2 222 ? -22.723 -10.914 4.931   1.00 38.94 ? 223 SER A N     1 
ATOM   2260 C  CA    . SER C 2 222 ? -23.925 -10.620 5.711   1.00 42.35 ? 223 SER A CA    1 
ATOM   2261 C  C     . SER C 2 222 ? -24.930 -11.766 5.604   1.00 42.56 ? 223 SER A C     1 
ATOM   2262 O  O     . SER C 2 222 ? -25.696 -12.018 6.535   1.00 41.32 ? 223 SER A O     1 
ATOM   2263 C  CB    . SER C 2 222 ? -24.556 -9.281  5.293   1.00 40.05 ? 223 SER A CB    1 
ATOM   2264 O  OG    . SER C 2 222 ? -24.944 -9.288  3.939   1.00 40.78 ? 223 SER A OG    1 
ATOM   2265 N  N     . GLN C 2 223 ? -24.908 -12.466 4.474   1.00 44.73 ? 224 GLN A N     1 
ATOM   2266 C  CA    . GLN C 2 223 ? -25.798 -13.599 4.247   1.00 46.55 ? 224 GLN A CA    1 
ATOM   2267 C  C     . GLN C 2 223 ? -25.545 -14.658 5.324   1.00 44.09 ? 224 GLN A C     1 
ATOM   2268 O  O     . GLN C 2 223 ? -26.478 -15.144 5.952   1.00 41.42 ? 224 GLN A O     1 
ATOM   2269 C  CB    . GLN C 2 223 ? -25.549 -14.191 2.861   1.00 53.83 ? 224 GLN A CB    1 
ATOM   2270 C  CG    . GLN C 2 223 ? -26.454 -15.367 2.510   1.00 70.15 ? 224 GLN A CG    1 
ATOM   2271 C  CD    . GLN C 2 223 ? -26.020 -16.107 1.244   1.00 84.28 ? 224 GLN A CD    1 
ATOM   2272 O  OE1   . GLN C 2 223 ? -26.534 -17.188 0.945   1.00 88.51 ? 224 GLN A OE1   1 
ATOM   2273 N  NE2   . GLN C 2 223 ? -25.072 -15.532 0.499   1.00 87.98 ? 224 GLN A NE2   1 
ATOM   2274 N  N     . LEU C 2 224 ? -24.278 -15.004 5.534   1.00 43.90 ? 225 LEU A N     1 
ATOM   2275 C  CA    . LEU C 2 224 ? -23.912 -15.989 6.547   1.00 44.23 ? 225 LEU A CA    1 
ATOM   2276 C  C     . LEU C 2 224 ? -24.097 -15.431 7.970   1.00 44.80 ? 225 LEU A C     1 
ATOM   2277 O  O     . LEU C 2 224 ? -24.291 -16.192 8.922   1.00 45.95 ? 225 LEU A O     1 
ATOM   2278 C  CB    . LEU C 2 224 ? -22.463 -16.446 6.348   1.00 46.80 ? 225 LEU A CB    1 
ATOM   2279 C  CG    . LEU C 2 224 ? -22.087 -17.170 5.049   1.00 47.58 ? 225 LEU A CG    1 
ATOM   2280 C  CD1   . LEU C 2 224 ? -20.615 -17.534 5.081   1.00 44.05 ? 225 LEU A CD1   1 
ATOM   2281 C  CD2   . LEU C 2 224 ? -22.933 -18.420 4.881   1.00 42.44 ? 225 LEU A CD2   1 
ATOM   2282 N  N     . ARG C 2 225 ? -24.036 -14.108 8.114   1.00 40.48 ? 226 ARG A N     1 
ATOM   2283 C  CA    . ARG C 2 225 ? -24.209 -13.471 9.418   1.00 38.90 ? 226 ARG A CA    1 
ATOM   2284 C  C     . ARG C 2 225 ? -25.681 -13.269 9.782   1.00 41.71 ? 226 ARG A C     1 
ATOM   2285 O  O     . ARG C 2 225 ? -26.008 -13.058 10.947  1.00 42.50 ? 226 ARG A O     1 
ATOM   2286 C  CB    . ARG C 2 225 ? -23.486 -12.125 9.466   1.00 28.66 ? 226 ARG A CB    1 
ATOM   2287 C  CG    . ARG C 2 225 ? -21.985 -12.225 9.387   1.00 21.65 ? 226 ARG A CG    1 
ATOM   2288 C  CD    . ARG C 2 225 ? -21.329 -10.881 9.676   1.00 25.33 ? 226 ARG A CD    1 
ATOM   2289 N  NE    . ARG C 2 225 ? -21.684 -9.840  8.710   1.00 29.75 ? 226 ARG A NE    1 
ATOM   2290 C  CZ    . ARG C 2 225 ? -20.962 -9.521  7.633   1.00 34.52 ? 226 ARG A CZ    1 
ATOM   2291 N  NH1   . ARG C 2 225 ? -19.827 -10.158 7.357   1.00 27.68 ? 226 ARG A NH1   1 
ATOM   2292 N  NH2   . ARG C 2 225 ? -21.372 -8.554  6.824   1.00 30.76 ? 226 ARG A NH2   1 
ATOM   2293 N  N     . ASN C 2 226 ? -26.563 -13.333 8.789   1.00 44.49 ? 227 ASN A N     1 
ATOM   2294 C  CA    . ASN C 2 226 ? -28.003 -13.163 9.005   1.00 49.18 ? 227 ASN A CA    1 
ATOM   2295 C  C     . ASN C 2 226 ? -28.566 -14.090 10.082  1.00 50.16 ? 227 ASN A C     1 
ATOM   2296 O  O     . ASN C 2 226 ? -29.365 -13.675 10.919  1.00 52.07 ? 227 ASN A O     1 
ATOM   2297 C  CB    . ASN C 2 226 ? -28.771 -13.404 7.702   1.00 53.61 ? 227 ASN A CB    1 
ATOM   2298 C  CG    . ASN C 2 226 ? -28.989 -12.133 6.897   1.00 64.08 ? 227 ASN A CG    1 
ATOM   2299 O  OD1   . ASN C 2 226 ? -28.885 -11.017 7.418   1.00 65.54 ? 227 ASN A OD1   1 
ATOM   2300 N  ND2   . ASN C 2 226 ? -29.303 -12.299 5.610   1.00 63.48 ? 227 ASN A ND2   1 
ATOM   2301 N  N     . ASP C 2 227 ? -28.149 -15.348 10.053  1.00 50.63 ? 228 ASP A N     1 
ATOM   2302 C  CA    . ASP C 2 227 ? -28.631 -16.318 11.022  1.00 52.53 ? 228 ASP A CA    1 
ATOM   2303 C  C     . ASP C 2 227 ? -27.734 -16.459 12.261  1.00 50.15 ? 228 ASP A C     1 
ATOM   2304 O  O     . ASP C 2 227 ? -28.062 -17.217 13.176  1.00 51.61 ? 228 ASP A O     1 
ATOM   2305 C  CB    . ASP C 2 227 ? -28.805 -17.690 10.344  1.00 64.73 ? 228 ASP A CB    1 
ATOM   2306 C  CG    . ASP C 2 227 ? -27.497 -18.233 9.727   1.00 78.63 ? 228 ASP A CG    1 
ATOM   2307 O  OD1   . ASP C 2 227 ? -26.431 -17.577 9.831   1.00 82.52 ? 228 ASP A OD1   1 
ATOM   2308 O  OD2   . ASP C 2 227 ? -27.539 -19.334 9.130   1.00 86.24 ? 228 ASP A OD2   1 
ATOM   2309 N  N     . LYS C 2 228 ? -26.617 -15.734 12.286  1.00 44.45 ? 229 LYS A N     1 
ATOM   2310 C  CA    . LYS C 2 228 ? -25.674 -15.797 13.404  1.00 39.68 ? 229 LYS A CA    1 
ATOM   2311 C  C     . LYS C 2 228 ? -25.652 -14.433 14.120  1.00 40.58 ? 229 LYS A C     1 
ATOM   2312 O  O     . LYS C 2 228 ? -26.534 -14.150 14.936  1.00 44.95 ? 229 LYS A O     1 
ATOM   2313 C  CB    . LYS C 2 228 ? -24.293 -16.185 12.872  1.00 35.50 ? 229 LYS A CB    1 
ATOM   2314 C  CG    . LYS C 2 228 ? -23.441 -16.956 13.849  1.00 27.58 ? 229 LYS A CG    1 
ATOM   2315 C  CD    . LYS C 2 228 ? -22.186 -17.405 13.179  1.00 25.23 ? 229 LYS A CD    1 
ATOM   2316 C  CE    . LYS C 2 228 ? -21.355 -18.243 14.104  1.00 26.77 ? 229 LYS A CE    1 
ATOM   2317 N  NZ    . LYS C 2 228 ? -20.062 -18.603 13.465  1.00 24.43 ? 229 LYS A NZ    1 
ATOM   2318 N  N     . TYR C 2 229 ? -24.661 -13.592 13.838  1.00 34.93 ? 230 TYR A N     1 
ATOM   2319 C  CA    . TYR C 2 229 ? -24.619 -12.270 14.450  1.00 31.48 ? 230 TYR A CA    1 
ATOM   2320 C  C     . TYR C 2 229 ? -23.904 -11.251 13.571  1.00 29.23 ? 230 TYR A C     1 
ATOM   2321 O  O     . TYR C 2 229 ? -22.888 -11.551 12.937  1.00 27.14 ? 230 TYR A O     1 
ATOM   2322 C  CB    . TYR C 2 229 ? -23.992 -12.308 15.847  1.00 25.39 ? 230 TYR A CB    1 
ATOM   2323 C  CG    . TYR C 2 229 ? -22.577 -12.821 15.911  1.00 21.64 ? 230 TYR A CG    1 
ATOM   2324 C  CD1   . TYR C 2 229 ? -21.494 -11.981 15.670  1.00 20.32 ? 230 TYR A CD1   1 
ATOM   2325 C  CD2   . TYR C 2 229 ? -22.316 -14.136 16.264  1.00 13.82 ? 230 TYR A CD2   1 
ATOM   2326 C  CE1   . TYR C 2 229 ? -20.190 -12.444 15.790  1.00 14.33 ? 230 TYR A CE1   1 
ATOM   2327 C  CE2   . TYR C 2 229 ? -21.021 -14.604 16.385  1.00 14.76 ? 230 TYR A CE2   1 
ATOM   2328 C  CZ    . TYR C 2 229 ? -19.964 -13.753 16.153  1.00 11.52 ? 230 TYR A CZ    1 
ATOM   2329 O  OH    . TYR C 2 229 ? -18.683 -14.217 16.316  1.00 14.01 ? 230 TYR A OH    1 
ATOM   2330 N  N     . ASN C 2 230 ? -24.459 -10.047 13.556  1.00 28.41 ? 231 ASN A N     1 
ATOM   2331 C  CA    . ASN C 2 230 ? -23.954 -8.928  12.775  1.00 28.51 ? 231 ASN A CA    1 
ATOM   2332 C  C     . ASN C 2 230 ? -23.397 -7.781  13.615  1.00 26.73 ? 231 ASN A C     1 
ATOM   2333 O  O     . ASN C 2 230 ? -22.902 -6.800  13.073  1.00 25.18 ? 231 ASN A O     1 
ATOM   2334 C  CB    . ASN C 2 230 ? -25.075 -8.390  11.890  1.00 35.48 ? 231 ASN A CB    1 
ATOM   2335 C  CG    . ASN C 2 230 ? -25.168 -9.122  10.581  1.00 50.71 ? 231 ASN A CG    1 
ATOM   2336 O  OD1   . ASN C 2 230 ? -24.358 -8.898  9.679   1.00 57.14 ? 231 ASN A OD1   1 
ATOM   2337 N  ND2   . ASN C 2 230 ? -26.146 -10.009 10.462  1.00 56.57 ? 231 ASN A ND2   1 
ATOM   2338 N  N     . ASN C 2 231 ? -23.492 -7.902  14.934  1.00 26.36 ? 232 ASN A N     1 
ATOM   2339 C  CA    . ASN C 2 231 ? -23.014 -6.874  15.847  1.00 25.01 ? 232 ASN A CA    1 
ATOM   2340 C  C     . ASN C 2 231 ? -22.870 -7.451  17.253  1.00 26.90 ? 232 ASN A C     1 
ATOM   2341 O  O     . ASN C 2 231 ? -23.251 -8.603  17.506  1.00 25.99 ? 232 ASN A O     1 
ATOM   2342 C  CB    . ASN C 2 231 ? -23.970 -5.679  15.857  1.00 25.25 ? 232 ASN A CB    1 
ATOM   2343 C  CG    . ASN C 2 231 ? -25.359 -6.045  16.347  1.00 34.58 ? 232 ASN A CG    1 
ATOM   2344 O  OD1   . ASN C 2 231 ? -25.512 -6.739  17.350  1.00 31.38 ? 232 ASN A OD1   1 
ATOM   2345 N  ND2   . ASN C 2 231 ? -26.380 -5.578  15.642  1.00 31.18 ? 232 ASN A ND2   1 
ATOM   2346 N  N     . ILE C 2 232 ? -22.329 -6.640  18.161  1.00 26.23 ? 233 ILE A N     1 
ATOM   2347 C  CA    . ILE C 2 232 ? -22.083 -7.040  19.543  1.00 23.56 ? 233 ILE A CA    1 
ATOM   2348 C  C     . ILE C 2 232 ? -23.353 -7.437  20.312  1.00 23.51 ? 233 ILE A C     1 
ATOM   2349 O  O     . ILE C 2 232 ? -23.316 -8.385  21.094  1.00 24.87 ? 233 ILE A O     1 
ATOM   2350 C  CB    . ILE C 2 232 ? -21.282 -5.932  20.294  1.00 23.73 ? 233 ILE A CB    1 
ATOM   2351 C  CG1   . ILE C 2 232 ? -20.741 -6.459  21.621  1.00 18.23 ? 233 ILE A CG1   1 
ATOM   2352 C  CG2   . ILE C 2 232 ? -22.165 -4.695  20.518  1.00 21.80 ? 233 ILE A CG2   1 
ATOM   2353 C  CD1   . ILE C 2 232 ? -19.884 -7.677  21.506  1.00 16.62 ? 233 ILE A CD1   1 
ATOM   2354 N  N     . SER C 2 233 ? -24.471 -6.743  20.099  1.00 20.49 ? 234 SER A N     1 
ATOM   2355 C  CA    . SER C 2 233 ? -25.703 -7.107  20.798  1.00 24.61 ? 234 SER A CA    1 
ATOM   2356 C  C     . SER C 2 233 ? -26.113 -8.521  20.413  1.00 26.45 ? 234 SER A C     1 
ATOM   2357 O  O     . SER C 2 233 ? -26.271 -9.379  21.275  1.00 26.25 ? 234 SER A O     1 
ATOM   2358 C  CB    . SER C 2 233 ? -26.839 -6.148  20.457  1.00 27.93 ? 234 SER A CB    1 
ATOM   2359 O  OG    . SER C 2 233 ? -26.539 -4.842  20.905  1.00 45.36 ? 234 SER A OG    1 
ATOM   2360 N  N     . GLU C 2 234 ? -26.276 -8.757  19.112  1.00 26.10 ? 235 GLU A N     1 
ATOM   2361 C  CA    . GLU C 2 234 ? -26.660 -10.068 18.599  1.00 23.56 ? 235 GLU A CA    1 
ATOM   2362 C  C     . GLU C 2 234 ? -25.671 -11.146 19.018  1.00 23.05 ? 235 GLU A C     1 
ATOM   2363 O  O     . GLU C 2 234 ? -26.068 -12.282 19.252  1.00 27.42 ? 235 GLU A O     1 
ATOM   2364 C  CB    . GLU C 2 234 ? -26.777 -10.030 17.081  1.00 21.64 ? 235 GLU A CB    1 
ATOM   2365 C  CG    . GLU C 2 234 ? -27.870 -9.106  16.596  1.00 23.84 ? 235 GLU A CG    1 
ATOM   2366 C  CD    . GLU C 2 234 ? -28.043 -9.118  15.076  1.00 27.92 ? 235 GLU A CD    1 
ATOM   2367 O  OE1   . GLU C 2 234 ? -27.214 -9.710  14.356  1.00 22.09 ? 235 GLU A OE1   1 
ATOM   2368 O  OE2   . GLU C 2 234 ? -29.027 -8.523  14.597  1.00 32.80 ? 235 GLU A OE2   1 
ATOM   2369 N  N     . TYR C 2 235 ? -24.391 -10.796 19.117  1.00 20.82 ? 236 TYR A N     1 
ATOM   2370 C  CA    . TYR C 2 235 ? -23.385 -11.757 19.541  1.00 20.61 ? 236 TYR A CA    1 
ATOM   2371 C  C     . TYR C 2 235 ? -23.629 -12.156 21.007  1.00 24.17 ? 236 TYR A C     1 
ATOM   2372 O  O     . TYR C 2 235 ? -23.528 -13.327 21.360  1.00 24.94 ? 236 TYR A O     1 
ATOM   2373 C  CB    . TYR C 2 235 ? -21.978 -11.179 19.372  1.00 18.97 ? 236 TYR A CB    1 
ATOM   2374 C  CG    . TYR C 2 235 ? -20.910 -11.917 20.149  1.00 19.79 ? 236 TYR A CG    1 
ATOM   2375 C  CD1   . TYR C 2 235 ? -20.345 -13.089 19.659  1.00 16.70 ? 236 TYR A CD1   1 
ATOM   2376 C  CD2   . TYR C 2 235 ? -20.481 -11.450 21.396  1.00 23.10 ? 236 TYR A CD2   1 
ATOM   2377 C  CE1   . TYR C 2 235 ? -19.376 -13.786 20.388  1.00 14.11 ? 236 TYR A CE1   1 
ATOM   2378 C  CE2   . TYR C 2 235 ? -19.518 -12.135 22.134  1.00 22.00 ? 236 TYR A CE2   1 
ATOM   2379 C  CZ    . TYR C 2 235 ? -18.969 -13.301 21.629  1.00 25.76 ? 236 TYR A CZ    1 
ATOM   2380 O  OH    . TYR C 2 235 ? -18.022 -13.985 22.368  1.00 21.23 ? 236 TYR A OH    1 
ATOM   2381 N  N     . ARG C 2 236 ? -23.951 -11.190 21.859  1.00 23.77 ? 237 ARG A N     1 
ATOM   2382 C  CA    . ARG C 2 236 ? -24.200 -11.489 23.264  1.00 25.76 ? 237 ARG A CA    1 
ATOM   2383 C  C     . ARG C 2 236 ? -25.461 -12.329 23.478  1.00 26.53 ? 237 ARG A C     1 
ATOM   2384 O  O     . ARG C 2 236 ? -25.490 -13.179 24.363  1.00 25.45 ? 237 ARG A O     1 
ATOM   2385 C  CB    . ARG C 2 236 ? -24.219 -10.199 24.083  1.00 20.65 ? 237 ARG A CB    1 
ATOM   2386 C  CG    . ARG C 2 236 ? -22.809 -9.697  24.307  1.00 21.51 ? 237 ARG A CG    1 
ATOM   2387 C  CD    . ARG C 2 236 ? -22.723 -8.280  24.824  1.00 25.12 ? 237 ARG A CD    1 
ATOM   2388 N  NE    . ARG C 2 236 ? -21.313 -7.926  24.979  1.00 27.67 ? 237 ARG A NE    1 
ATOM   2389 C  CZ    . ARG C 2 236 ? -20.835 -6.684  25.082  1.00 31.29 ? 237 ARG A CZ    1 
ATOM   2390 N  NH1   . ARG C 2 236 ? -21.653 -5.642  25.058  1.00 21.86 ? 237 ARG A NH1   1 
ATOM   2391 N  NH2   . ARG C 2 236 ? -19.524 -6.486  25.213  1.00 19.94 ? 237 ARG A NH2   1 
ATOM   2392 N  N     . ASN C 2 237 ? -26.497 -12.103 22.676  1.00 27.35 ? 238 ASN A N     1 
ATOM   2393 C  CA    . ASN C 2 237 ? -27.715 -12.904 22.785  1.00 30.73 ? 238 ASN A CA    1 
ATOM   2394 C  C     . ASN C 2 237 ? -27.384 -14.321 22.348  1.00 29.78 ? 238 ASN A C     1 
ATOM   2395 O  O     . ASN C 2 237 ? -27.832 -15.294 22.951  1.00 30.01 ? 238 ASN A O     1 
ATOM   2396 C  CB    . ASN C 2 237 ? -28.817 -12.355 21.886  1.00 31.00 ? 238 ASN A CB    1 
ATOM   2397 C  CG    . ASN C 2 237 ? -29.225 -10.968 22.278  1.00 48.17 ? 238 ASN A CG    1 
ATOM   2398 O  OD1   . ASN C 2 237 ? -29.150 -10.598 23.451  1.00 49.25 ? 238 ASN A OD1   1 
ATOM   2399 N  ND2   . ASN C 2 237 ? -29.657 -10.181 21.306  1.00 54.27 ? 238 ASN A ND2   1 
ATOM   2400 N  N     . TRP C 2 238 ? -26.587 -14.414 21.291  1.00 25.27 ? 239 TRP A N     1 
ATOM   2401 C  CA    . TRP C 2 238 ? -26.150 -15.680 20.721  1.00 25.59 ? 239 TRP A CA    1 
ATOM   2402 C  C     . TRP C 2 238 ? -25.373 -16.500 21.760  1.00 25.68 ? 239 TRP A C     1 
ATOM   2403 O  O     . TRP C 2 238 ? -25.538 -17.721 21.857  1.00 25.93 ? 239 TRP A O     1 
ATOM   2404 C  CB    . TRP C 2 238 ? -25.290 -15.371 19.491  1.00 18.19 ? 239 TRP A CB    1 
ATOM   2405 C  CG    . TRP C 2 238 ? -24.782 -16.543 18.748  1.00 18.97 ? 239 TRP A CG    1 
ATOM   2406 C  CD1   . TRP C 2 238 ? -25.492 -17.355 17.912  1.00 19.43 ? 239 TRP A CD1   1 
ATOM   2407 C  CD2   . TRP C 2 238 ? -23.429 -17.012 18.718  1.00 13.00 ? 239 TRP A CD2   1 
ATOM   2408 N  NE1   . TRP C 2 238 ? -24.658 -18.304 17.358  1.00 19.07 ? 239 TRP A NE1   1 
ATOM   2409 C  CE2   . TRP C 2 238 ? -23.387 -18.113 17.836  1.00 16.02 ? 239 TRP A CE2   1 
ATOM   2410 C  CE3   . TRP C 2 238 ? -22.247 -16.603 19.346  1.00 11.90 ? 239 TRP A CE3   1 
ATOM   2411 C  CZ2   . TRP C 2 238 ? -22.197 -18.815 17.564  1.00 15.43 ? 239 TRP A CZ2   1 
ATOM   2412 C  CZ3   . TRP C 2 238 ? -21.066 -17.298 19.076  1.00 11.76 ? 239 TRP A CZ3   1 
ATOM   2413 C  CH2   . TRP C 2 238 ? -21.054 -18.392 18.192  1.00 18.28 ? 239 TRP A CH2   1 
ATOM   2414 N  N     . ILE C 2 239 ? -24.527 -15.820 22.531  1.00 26.05 ? 240 ILE A N     1 
ATOM   2415 C  CA    . ILE C 2 239 ? -23.727 -16.448 23.588  1.00 27.38 ? 240 ILE A CA    1 
ATOM   2416 C  C     . ILE C 2 239 ? -24.663 -16.938 24.706  1.00 27.66 ? 240 ILE A C     1 
ATOM   2417 O  O     . ILE C 2 239 ? -24.547 -18.064 25.196  1.00 25.53 ? 240 ILE A O     1 
ATOM   2418 C  CB    . ILE C 2 239 ? -22.683 -15.427 24.151  1.00 28.38 ? 240 ILE A CB    1 
ATOM   2419 C  CG1   . ILE C 2 239 ? -21.479 -15.354 23.214  1.00 28.28 ? 240 ILE A CG1   1 
ATOM   2420 C  CG2   . ILE C 2 239 ? -22.263 -15.770 25.578  1.00 24.81 ? 240 ILE A CG2   1 
ATOM   2421 C  CD1   . ILE C 2 239 ? -20.787 -16.673 22.999  1.00 28.69 ? 240 ILE A CD1   1 
ATOM   2422 N  N     . TYR C 2 240 ? -25.599 -16.077 25.081  1.00 27.72 ? 241 TYR A N     1 
ATOM   2423 C  CA    . TYR C 2 240 ? -26.573 -16.363 26.121  1.00 30.61 ? 241 TYR A CA    1 
ATOM   2424 C  C     . TYR C 2 240 ? -27.398 -17.625 25.831  1.00 34.17 ? 241 TYR A C     1 
ATOM   2425 O  O     . TYR C 2 240 ? -27.698 -18.399 26.748  1.00 33.07 ? 241 TYR A O     1 
ATOM   2426 C  CB    . TYR C 2 240 ? -27.510 -15.164 26.273  1.00 26.99 ? 241 TYR A CB    1 
ATOM   2427 C  CG    . TYR C 2 240 ? -28.515 -15.324 27.375  1.00 30.68 ? 241 TYR A CG    1 
ATOM   2428 C  CD1   . TYR C 2 240 ? -28.184 -14.992 28.685  1.00 36.87 ? 241 TYR A CD1   1 
ATOM   2429 C  CD2   . TYR C 2 240 ? -29.789 -15.818 27.118  1.00 25.96 ? 241 TYR A CD2   1 
ATOM   2430 C  CE1   . TYR C 2 240 ? -29.088 -15.143 29.713  1.00 33.34 ? 241 TYR A CE1   1 
ATOM   2431 C  CE2   . TYR C 2 240 ? -30.709 -15.975 28.142  1.00 31.70 ? 241 TYR A CE2   1 
ATOM   2432 C  CZ    . TYR C 2 240 ? -30.347 -15.635 29.442  1.00 35.90 ? 241 TYR A CZ    1 
ATOM   2433 O  OH    . TYR C 2 240 ? -31.238 -15.782 30.480  1.00 42.58 ? 241 TYR A OH    1 
ATOM   2434 N  N     . ARG C 2 241 ? -27.759 -17.811 24.559  1.00 30.30 ? 242 ARG A N     1 
ATOM   2435 C  CA    . ARG C 2 241 ? -28.561 -18.949 24.105  1.00 28.77 ? 242 ARG A CA    1 
ATOM   2436 C  C     . ARG C 2 241 ? -27.813 -20.252 23.851  1.00 26.64 ? 242 ARG A C     1 
ATOM   2437 O  O     . ARG C 2 241 ? -28.437 -21.250 23.501  1.00 30.65 ? 242 ARG A O     1 
ATOM   2438 C  CB    . ARG C 2 241 ? -29.313 -18.612 22.820  1.00 29.40 ? 242 ARG A CB    1 
ATOM   2439 C  CG    . ARG C 2 241 ? -30.385 -17.558 22.924  1.00 37.48 ? 242 ARG A CG    1 
ATOM   2440 C  CD    . ARG C 2 241 ? -31.184 -17.559 21.619  1.00 50.32 ? 242 ARG A CD    1 
ATOM   2441 N  NE    . ARG C 2 241 ? -30.309 -17.669 20.450  1.00 57.77 ? 242 ARG A NE    1 
ATOM   2442 C  CZ    . ARG C 2 241 ? -29.715 -16.637 19.853  1.00 66.52 ? 242 ARG A CZ    1 
ATOM   2443 N  NH1   . ARG C 2 241 ? -29.905 -15.398 20.298  1.00 73.72 ? 242 ARG A NH1   1 
ATOM   2444 N  NH2   . ARG C 2 241 ? -28.930 -16.843 18.802  1.00 66.37 ? 242 ARG A NH2   1 
ATOM   2445 N  N     . GLY C 2 242 ? -26.496 -20.257 24.007  1.00 23.62 ? 243 GLY A N     1 
ATOM   2446 C  CA    . GLY C 2 242 ? -25.765 -21.487 23.794  1.00 22.43 ? 243 GLY A CA    1 
ATOM   2447 C  C     . GLY C 2 242 ? -25.023 -21.579 22.477  1.00 29.70 ? 243 GLY A C     1 
ATOM   2448 O  O     . GLY C 2 242 ? -24.637 -22.673 22.062  1.00 28.58 ? 243 GLY A O     1 
ATOM   2449 N  N     . ARG C 2 243 ? -24.819 -20.439 21.818  1.00 32.02 ? 244 ARG A N     1 
ATOM   2450 C  CA    . ARG C 2 243 ? -24.094 -20.393 20.547  1.00 32.42 ? 244 ARG A CA    1 
ATOM   2451 C  C     . ARG C 2 243 ? -24.821 -21.166 19.445  1.00 34.94 ? 244 ARG A C     1 
ATOM   2452 O  O     . ARG C 2 243 ? -24.238 -21.998 18.742  1.00 33.28 ? 244 ARG A O     1 
ATOM   2453 C  CB    . ARG C 2 243 ? -22.658 -20.901 20.747  1.00 22.00 ? 244 ARG A CB    1 
ATOM   2454 C  CG    . ARG C 2 243 ? -21.939 -20.150 21.872  1.00 27.82 ? 244 ARG A CG    1 
ATOM   2455 C  CD    . ARG C 2 243 ? -20.625 -20.797 22.276  1.00 33.17 ? 244 ARG A CD    1 
ATOM   2456 N  NE    . ARG C 2 243 ? -19.570 -20.524 21.305  1.00 44.63 ? 244 ARG A NE    1 
ATOM   2457 C  CZ    . ARG C 2 243 ? -18.666 -19.554 21.425  1.00 39.86 ? 244 ARG A CZ    1 
ATOM   2458 N  NH1   . ARG C 2 243 ? -18.674 -18.758 22.488  1.00 39.03 ? 244 ARG A NH1   1 
ATOM   2459 N  NH2   . ARG C 2 243 ? -17.750 -19.382 20.480  1.00 33.54 ? 244 ARG A NH2   1 
ATOM   2460 N  N     . LYS C 2 244 ? -26.107 -20.858 19.308  1.00 39.06 ? 245 LYS A N     1 
ATOM   2461 C  CA    . LYS C 2 244 ? -26.975 -21.482 18.322  1.00 46.75 ? 245 LYS A CA    1 
ATOM   2462 C  C     . LYS C 2 244 ? -28.197 -20.570 18.118  1.00 51.59 ? 245 LYS A C     1 
ATOM   2463 O  O     . LYS C 2 244 ? -28.966 -20.813 17.160  1.00 55.40 ? 245 LYS A O     1 
ATOM   2464 C  CB    . LYS C 2 244 ? -27.410 -22.880 18.808  1.00 50.93 ? 245 LYS A CB    1 
ATOM   2465 C  CG    . LYS C 2 244 ? -28.358 -22.877 20.008  1.00 56.56 ? 245 LYS A CG    1 
ATOM   2466 C  CD    . LYS C 2 244 ? -28.572 -24.276 20.579  1.00 66.76 ? 245 LYS A CD    1 
ATOM   2467 C  CE    . LYS C 2 244 ? -29.849 -24.347 21.435  1.00 72.45 ? 245 LYS A CE    1 
ATOM   2468 N  NZ    . LYS C 2 244 ? -29.891 -23.369 22.568  1.00 74.55 ? 245 LYS A NZ    1 
ATOM   2469 O  OXT   . LYS C 2 244 ? -28.368 -19.616 18.919  1.00 50.07 ? 245 LYS A OXT   1 
ATOM   2470 N  N     . SER D 2 1   ? 8.765   12.748  -29.259 1.00 19.06 ? 2   SER B N     1 
ATOM   2471 C  CA    . SER D 2 1   ? 7.331   12.825  -28.880 1.00 21.93 ? 2   SER B CA    1 
ATOM   2472 C  C     . SER D 2 1   ? 7.253   12.844  -27.354 1.00 19.56 ? 2   SER B C     1 
ATOM   2473 O  O     . SER D 2 1   ? 8.274   12.740  -26.674 1.00 18.68 ? 2   SER B O     1 
ATOM   2474 C  CB    . SER D 2 1   ? 6.621   11.572  -29.392 1.00 25.58 ? 2   SER B CB    1 
ATOM   2475 O  OG    . SER D 2 1   ? 7.317   10.417  -28.929 1.00 20.77 ? 2   SER B OG    1 
ATOM   2476 N  N     . LEU D 2 2   ? 6.045   12.972  -26.820 1.00 21.59 ? 3   LEU B N     1 
ATOM   2477 C  CA    . LEU D 2 2   ? 5.860   12.962  -25.369 1.00 24.20 ? 3   LEU B CA    1 
ATOM   2478 C  C     . LEU D 2 2   ? 6.417   11.645  -24.825 1.00 24.56 ? 3   LEU B C     1 
ATOM   2479 O  O     . LEU D 2 2   ? 7.152   11.635  -23.841 1.00 26.82 ? 3   LEU B O     1 
ATOM   2480 C  CB    . LEU D 2 2   ? 4.368   13.093  -25.030 1.00 22.54 ? 3   LEU B CB    1 
ATOM   2481 C  CG    . LEU D 2 2   ? 3.889   12.857  -23.592 1.00 28.72 ? 3   LEU B CG    1 
ATOM   2482 C  CD1   . LEU D 2 2   ? 4.521   13.860  -22.630 1.00 27.78 ? 3   LEU B CD1   1 
ATOM   2483 C  CD2   . LEU D 2 2   ? 2.375   12.979  -23.549 1.00 27.27 ? 3   LEU B CD2   1 
ATOM   2484 N  N     . ARG D 2 3   ? 6.073   10.544  -25.494 1.00 25.49 ? 4   ARG B N     1 
ATOM   2485 C  CA    . ARG D 2 3   ? 6.504   9.211   -25.084 1.00 23.57 ? 4   ARG B CA    1 
ATOM   2486 C  C     . ARG D 2 3   ? 8.018   8.990   -25.108 1.00 24.34 ? 4   ARG B C     1 
ATOM   2487 O  O     . ARG D 2 3   ? 8.581   8.453   -24.143 1.00 23.63 ? 4   ARG B O     1 
ATOM   2488 C  CB    . ARG D 2 3   ? 5.797   8.149   -25.931 1.00 26.68 ? 4   ARG B CB    1 
ATOM   2489 C  CG    . ARG D 2 3   ? 6.127   6.733   -25.534 1.00 26.59 ? 4   ARG B CG    1 
ATOM   2490 C  CD    . ARG D 2 3   ? 5.606   5.754   -26.561 1.00 33.34 ? 4   ARG B CD    1 
ATOM   2491 N  NE    . ARG D 2 3   ? 5.995   4.382   -26.245 1.00 25.40 ? 4   ARG B NE    1 
ATOM   2492 C  CZ    . ARG D 2 3   ? 5.123   3.386   -26.119 1.00 28.75 ? 4   ARG B CZ    1 
ATOM   2493 N  NH1   . ARG D 2 3   ? 3.830   3.635   -26.293 1.00 26.06 ? 4   ARG B NH1   1 
ATOM   2494 N  NH2   . ARG D 2 3   ? 5.535   2.151   -25.824 1.00 15.77 ? 4   ARG B NH2   1 
ATOM   2495 N  N     . SER D 2 4   ? 8.684   9.394   -26.193 1.00 22.30 ? 5   SER B N     1 
ATOM   2496 C  CA    . SER D 2 4   ? 10.140  9.218   -26.291 1.00 21.62 ? 5   SER B CA    1 
ATOM   2497 C  C     . SER D 2 4   ? 10.855  10.115  -25.266 1.00 18.85 ? 5   SER B C     1 
ATOM   2498 O  O     . SER D 2 4   ? 11.821  9.699   -24.624 1.00 16.83 ? 5   SER B O     1 
ATOM   2499 C  CB    . SER D 2 4   ? 10.641  9.524   -27.719 1.00 15.89 ? 5   SER B CB    1 
ATOM   2500 O  OG    . SER D 2 4   ? 10.307  10.848  -28.117 1.00 20.52 ? 5   SER B OG    1 
ATOM   2501 N  N     . ASP D 2 5   ? 10.376  11.346  -25.127 1.00 20.75 ? 6   ASP B N     1 
ATOM   2502 C  CA    . ASP D 2 5   ? 10.943  12.285  -24.164 1.00 24.83 ? 6   ASP B CA    1 
ATOM   2503 C  C     . ASP D 2 5   ? 10.798  11.728  -22.748 1.00 27.09 ? 6   ASP B C     1 
ATOM   2504 O  O     . ASP D 2 5   ? 11.762  11.713  -21.971 1.00 26.22 ? 6   ASP B O     1 
ATOM   2505 C  CB    . ASP D 2 5   ? 10.246  13.637  -24.276 1.00 30.78 ? 6   ASP B CB    1 
ATOM   2506 C  CG    . ASP D 2 5   ? 10.774  14.467  -25.432 1.00 32.27 ? 6   ASP B CG    1 
ATOM   2507 O  OD1   . ASP D 2 5   ? 11.852  14.124  -25.968 1.00 22.29 ? 6   ASP B OD1   1 
ATOM   2508 O  OD2   . ASP D 2 5   ? 10.112  15.458  -25.798 1.00 23.37 ? 6   ASP B OD2   1 
ATOM   2509 N  N     . LEU D 2 6   ? 9.600   11.260  -22.421 1.00 24.73 ? 7   LEU B N     1 
ATOM   2510 C  CA    . LEU D 2 6   ? 9.356   10.682  -21.110 1.00 28.23 ? 7   LEU B CA    1 
ATOM   2511 C  C     . LEU D 2 6   ? 10.293  9.499   -20.853 1.00 30.79 ? 7   LEU B C     1 
ATOM   2512 O  O     . LEU D 2 6   ? 10.859  9.375   -19.764 1.00 32.59 ? 7   LEU B O     1 
ATOM   2513 C  CB    . LEU D 2 6   ? 7.907   10.231  -20.997 1.00 28.45 ? 7   LEU B CB    1 
ATOM   2514 C  CG    . LEU D 2 6   ? 7.462   9.779   -19.604 1.00 39.35 ? 7   LEU B CG    1 
ATOM   2515 C  CD1   . LEU D 2 6   ? 7.902   10.807  -18.559 1.00 37.64 ? 7   LEU B CD1   1 
ATOM   2516 C  CD2   . LEU D 2 6   ? 5.945   9.617   -19.592 1.00 39.16 ? 7   LEU B CD2   1 
ATOM   2517 N  N     . ILE D 2 7   ? 10.466  8.637   -21.854 1.00 31.35 ? 8   ILE B N     1 
ATOM   2518 C  CA    . ILE D 2 7   ? 11.340  7.476   -21.706 1.00 31.98 ? 8   ILE B CA    1 
ATOM   2519 C  C     . ILE D 2 7   ? 12.799  7.866   -21.509 1.00 33.55 ? 8   ILE B C     1 
ATOM   2520 O  O     . ILE D 2 7   ? 13.511  7.243   -20.724 1.00 33.84 ? 8   ILE B O     1 
ATOM   2521 C  CB    . ILE D 2 7   ? 11.243  6.526   -22.926 1.00 35.84 ? 8   ILE B CB    1 
ATOM   2522 C  CG1   . ILE D 2 7   ? 9.874   5.849   -22.970 1.00 36.99 ? 8   ILE B CG1   1 
ATOM   2523 C  CG2   . ILE D 2 7   ? 12.307  5.453   -22.840 1.00 32.89 ? 8   ILE B CG2   1 
ATOM   2524 C  CD1   . ILE D 2 7   ? 9.675   4.967   -24.187 1.00 43.78 ? 8   ILE B CD1   1 
ATOM   2525 N  N     . ASN D 2 8   ? 13.251  8.890   -22.225 1.00 35.10 ? 9   ASN B N     1 
ATOM   2526 C  CA    . ASN D 2 8   ? 14.638  9.338   -22.101 1.00 35.05 ? 9   ASN B CA    1 
ATOM   2527 C  C     . ASN D 2 8   ? 14.868  9.899   -20.710 1.00 30.44 ? 9   ASN B C     1 
ATOM   2528 O  O     . ASN D 2 8   ? 15.847  9.543   -20.049 1.00 29.36 ? 9   ASN B O     1 
ATOM   2529 C  CB    . ASN D 2 8   ? 14.973  10.409  -23.149 1.00 41.63 ? 9   ASN B CB    1 
ATOM   2530 C  CG    . ASN D 2 8   ? 15.036  9.851   -24.562 1.00 44.12 ? 9   ASN B CG    1 
ATOM   2531 O  OD1   . ASN D 2 8   ? 15.532  8.742   -24.794 1.00 41.59 ? 9   ASN B OD1   1 
ATOM   2532 N  ND2   . ASN D 2 8   ? 14.532  10.623  -25.518 1.00 54.40 ? 9   ASN B ND2   1 
ATOM   2533 N  N     . ALA D 2 9   ? 13.953  10.767  -20.278 1.00 28.08 ? 10  ALA B N     1 
ATOM   2534 C  CA    . ALA D 2 9   ? 14.005  11.406  -18.959 1.00 30.65 ? 10  ALA B CA    1 
ATOM   2535 C  C     . ALA D 2 9   ? 14.040  10.378  -17.830 1.00 32.51 ? 10  ALA B C     1 
ATOM   2536 O  O     . ALA D 2 9   ? 14.765  10.558  -16.846 1.00 32.69 ? 10  ALA B O     1 
ATOM   2537 C  CB    . ALA D 2 9   ? 12.813  12.335  -18.780 1.00 25.39 ? 10  ALA B CB    1 
ATOM   2538 N  N     . LEU D 2 10  ? 13.260  9.306   -17.973 1.00 33.61 ? 11  LEU B N     1 
ATOM   2539 C  CA    . LEU D 2 10  ? 13.224  8.245   -16.971 1.00 36.33 ? 11  LEU B CA    1 
ATOM   2540 C  C     . LEU D 2 10  ? 14.561  7.529   -16.871 1.00 38.53 ? 11  LEU B C     1 
ATOM   2541 O  O     . LEU D 2 10  ? 15.019  7.240   -15.763 1.00 39.58 ? 11  LEU B O     1 
ATOM   2542 C  CB    . LEU D 2 10  ? 12.123  7.225   -17.273 1.00 31.12 ? 11  LEU B CB    1 
ATOM   2543 C  CG    . LEU D 2 10  ? 10.696  7.742   -17.106 1.00 36.76 ? 11  LEU B CG    1 
ATOM   2544 C  CD1   . LEU D 2 10  ? 9.723   6.720   -17.673 1.00 37.58 ? 11  LEU B CD1   1 
ATOM   2545 C  CD2   . LEU D 2 10  ? 10.411  8.039   -15.646 1.00 30.23 ? 11  LEU B CD2   1 
ATOM   2546 N  N     . TYR D 2 11  ? 15.191  7.245   -18.009 1.00 40.71 ? 12  TYR B N     1 
ATOM   2547 C  CA    . TYR D 2 11  ? 16.487  6.564   -17.989 1.00 48.31 ? 12  TYR B CA    1 
ATOM   2548 C  C     . TYR D 2 11  ? 17.553  7.397   -17.277 1.00 49.65 ? 12  TYR B C     1 
ATOM   2549 O  O     . TYR D 2 11  ? 18.270  6.892   -16.408 1.00 49.64 ? 12  TYR B O     1 
ATOM   2550 C  CB    . TYR D 2 11  ? 16.967  6.229   -19.409 1.00 55.55 ? 12  TYR B CB    1 
ATOM   2551 C  CG    . TYR D 2 11  ? 16.221  5.086   -20.065 1.00 65.40 ? 12  TYR B CG    1 
ATOM   2552 C  CD1   . TYR D 2 11  ? 15.844  3.958   -19.331 1.00 65.79 ? 12  TYR B CD1   1 
ATOM   2553 C  CD2   . TYR D 2 11  ? 15.885  5.135   -21.422 1.00 66.70 ? 12  TYR B CD2   1 
ATOM   2554 C  CE1   . TYR D 2 11  ? 15.147  2.905   -19.929 1.00 67.11 ? 12  TYR B CE1   1 
ATOM   2555 C  CE2   . TYR D 2 11  ? 15.188  4.090   -22.030 1.00 64.61 ? 12  TYR B CE2   1 
ATOM   2556 C  CZ    . TYR D 2 11  ? 14.821  2.977   -21.278 1.00 69.20 ? 12  TYR B CZ    1 
ATOM   2557 O  OH    . TYR D 2 11  ? 14.122  1.941   -21.867 1.00 65.90 ? 12  TYR B OH    1 
ATOM   2558 N  N     . ASP D 2 12  ? 17.644  8.672   -17.641 1.00 51.97 ? 13  ASP B N     1 
ATOM   2559 C  CA    . ASP D 2 12  ? 18.632  9.579   -17.058 1.00 56.05 ? 13  ASP B CA    1 
ATOM   2560 C  C     . ASP D 2 12  ? 18.450  9.789   -15.564 1.00 55.41 ? 13  ASP B C     1 
ATOM   2561 O  O     . ASP D 2 12  ? 19.345  9.475   -14.777 1.00 55.13 ? 13  ASP B O     1 
ATOM   2562 C  CB    . ASP D 2 12  ? 18.612  10.934  -17.777 1.00 60.90 ? 13  ASP B CB    1 
ATOM   2563 C  CG    . ASP D 2 12  ? 19.415  10.928  -19.072 1.00 69.25 ? 13  ASP B CG    1 
ATOM   2564 O  OD1   . ASP D 2 12  ? 20.107  9.924   -19.368 1.00 66.73 ? 13  ASP B OD1   1 
ATOM   2565 O  OD2   . ASP D 2 12  ? 19.353  11.942  -19.797 1.00 77.65 ? 13  ASP B OD2   1 
ATOM   2566 N  N     . GLU D 2 13  ? 17.291  10.317  -15.180 1.00 55.08 ? 14  GLU B N     1 
ATOM   2567 C  CA    . GLU D 2 13  ? 16.988  10.572  -13.777 1.00 55.16 ? 14  GLU B CA    1 
ATOM   2568 C  C     . GLU D 2 13  ? 17.286  9.356   -12.906 1.00 56.23 ? 14  GLU B C     1 
ATOM   2569 O  O     . GLU D 2 13  ? 17.984  9.458   -11.898 1.00 56.33 ? 14  GLU B O     1 
ATOM   2570 C  CB    . GLU D 2 13  ? 15.519  10.959  -13.612 1.00 54.10 ? 14  GLU B CB    1 
ATOM   2571 C  CG    . GLU D 2 13  ? 15.108  11.273  -12.168 1.00 62.83 ? 14  GLU B CG    1 
ATOM   2572 C  CD    . GLU D 2 13  ? 15.344  12.727  -11.762 1.00 69.42 ? 14  GLU B CD    1 
ATOM   2573 O  OE1   . GLU D 2 13  ? 16.227  13.397  -12.343 1.00 72.27 ? 14  GLU B OE1   1 
ATOM   2574 O  OE2   . GLU D 2 13  ? 14.635  13.203  -10.850 1.00 67.02 ? 14  GLU B OE2   1 
ATOM   2575 N  N     . ASN D 2 14  ? 16.761  8.205   -13.306 1.00 58.04 ? 15  ASN B N     1 
ATOM   2576 C  CA    . ASN D 2 14  ? 16.947  6.974   -12.548 1.00 62.43 ? 15  ASN B CA    1 
ATOM   2577 C  C     . ASN D 2 14  ? 18.410  6.523   -12.496 1.00 64.09 ? 15  ASN B C     1 
ATOM   2578 O  O     . ASN D 2 14  ? 18.871  5.954   -11.502 1.00 64.69 ? 15  ASN B O     1 
ATOM   2579 C  CB    . ASN D 2 14  ? 16.070  5.866   -13.137 1.00 62.19 ? 15  ASN B CB    1 
ATOM   2580 C  CG    . ASN D 2 14  ? 15.898  4.711   -12.191 1.00 58.14 ? 15  ASN B CG    1 
ATOM   2581 O  OD1   . ASN D 2 14  ? 15.194  4.818   -11.191 1.00 60.92 ? 15  ASN B OD1   1 
ATOM   2582 N  ND2   . ASN D 2 14  ? 16.542  3.597   -12.495 1.00 55.89 ? 15  ASN B ND2   1 
ATOM   2583 N  N     . GLN D 2 15  ? 19.133  6.775   -13.576 1.00 65.40 ? 16  GLN B N     1 
ATOM   2584 C  CA    . GLN D 2 15  ? 20.533  6.407   -13.653 1.00 69.52 ? 16  GLN B CA    1 
ATOM   2585 C  C     . GLN D 2 15  ? 21.395  7.372   -12.834 1.00 71.02 ? 16  GLN B C     1 
ATOM   2586 O  O     . GLN D 2 15  ? 22.507  7.027   -12.422 1.00 72.54 ? 16  GLN B O     1 
ATOM   2587 C  CB    . GLN D 2 15  ? 20.969  6.412   -15.109 1.00 72.12 ? 16  GLN B CB    1 
ATOM   2588 C  CG    . GLN D 2 15  ? 22.399  6.063   -15.330 1.00 78.89 ? 16  GLN B CG    1 
ATOM   2589 C  CD    . GLN D 2 15  ? 22.969  6.837   -16.485 1.00 88.73 ? 16  GLN B CD    1 
ATOM   2590 O  OE1   . GLN D 2 15  ? 22.610  7.994   -16.711 1.00 90.12 ? 16  GLN B OE1   1 
ATOM   2591 N  NE2   . GLN D 2 15  ? 23.863  6.209   -17.230 1.00 96.15 ? 16  GLN B NE2   1 
ATOM   2592 N  N     . LYS D 2 16  ? 20.869  8.574   -12.600 1.00 70.51 ? 17  LYS B N     1 
ATOM   2593 C  CA    . LYS D 2 16  ? 21.585  9.601   -11.848 1.00 70.17 ? 17  LYS B CA    1 
ATOM   2594 C  C     . LYS D 2 16  ? 21.212  9.748   -10.366 1.00 68.85 ? 17  LYS B C     1 
ATOM   2595 O  O     . LYS D 2 16  ? 21.982  10.329  -9.597  1.00 68.86 ? 17  LYS B O     1 
ATOM   2596 C  CB    . LYS D 2 16  ? 21.417  10.968  -12.530 1.00 69.40 ? 17  LYS B CB    1 
ATOM   2597 C  CG    . LYS D 2 16  ? 21.959  11.034  -13.948 1.00 80.07 ? 17  LYS B CG    1 
ATOM   2598 C  CD    . LYS D 2 16  ? 21.772  12.422  -14.547 1.00 87.79 ? 17  LYS B CD    1 
ATOM   2599 C  CE    . LYS D 2 16  ? 22.417  12.516  -15.922 1.00 98.15 ? 17  LYS B CE    1 
ATOM   2600 N  NZ    . LYS D 2 16  ? 22.342  13.895  -16.492 1.00 99.00 ? 17  LYS B NZ    1 
ATOM   2601 N  N     . TYR D 2 17  ? 20.053  9.232   -9.957  1.00 66.50 ? 18  TYR B N     1 
ATOM   2602 C  CA    . TYR D 2 17  ? 19.636  9.383   -8.560  1.00 62.68 ? 18  TYR B CA    1 
ATOM   2603 C  C     . TYR D 2 17  ? 19.191  8.139   -7.799  1.00 58.94 ? 18  TYR B C     1 
ATOM   2604 O  O     . TYR D 2 17  ? 18.457  7.297   -8.319  1.00 59.35 ? 18  TYR B O     1 
ATOM   2605 C  CB    . TYR D 2 17  ? 18.547  10.465  -8.456  1.00 65.34 ? 18  TYR B CB    1 
ATOM   2606 C  CG    . TYR D 2 17  ? 19.008  11.823  -8.944  1.00 67.62 ? 18  TYR B CG    1 
ATOM   2607 C  CD1   . TYR D 2 17  ? 19.986  12.538  -8.251  1.00 68.14 ? 18  TYR B CD1   1 
ATOM   2608 C  CD2   . TYR D 2 17  ? 18.491  12.380  -10.114 1.00 67.79 ? 18  TYR B CD2   1 
ATOM   2609 C  CE1   . TYR D 2 17  ? 20.438  13.769  -8.712  1.00 69.52 ? 18  TYR B CE1   1 
ATOM   2610 C  CE2   . TYR D 2 17  ? 18.936  13.611  -10.583 1.00 68.92 ? 18  TYR B CE2   1 
ATOM   2611 C  CZ    . TYR D 2 17  ? 19.909  14.297  -9.878  1.00 72.55 ? 18  TYR B CZ    1 
ATOM   2612 O  OH    . TYR D 2 17  ? 20.360  15.512  -10.338 1.00 79.78 ? 18  TYR B OH    1 
ATOM   2613 N  N     . ASP D 2 18  ? 19.653  8.047   -6.553  1.00 55.84 ? 19  ASP B N     1 
ATOM   2614 C  CA    . ASP D 2 18  ? 19.319  6.948   -5.652  1.00 51.72 ? 19  ASP B CA    1 
ATOM   2615 C  C     . ASP D 2 18  ? 18.737  7.494   -4.356  1.00 46.13 ? 19  ASP B C     1 
ATOM   2616 O  O     . ASP D 2 18  ? 19.400  8.240   -3.637  1.00 46.48 ? 19  ASP B O     1 
ATOM   2617 C  CB    . ASP D 2 18  ? 20.556  6.111   -5.331  1.00 57.24 ? 19  ASP B CB    1 
ATOM   2618 C  CG    . ASP D 2 18  ? 20.846  5.064   -6.392  1.00 73.35 ? 19  ASP B CG    1 
ATOM   2619 O  OD1   . ASP D 2 18  ? 19.937  4.742   -7.195  1.00 84.72 ? 19  ASP B OD1   1 
ATOM   2620 O  OD2   . ASP D 2 18  ? 21.990  4.559   -6.422  1.00 76.05 ? 19  ASP B OD2   1 
ATOM   2621 N  N     . VAL D 2 19  ? 17.496  7.119   -4.074  1.00 40.44 ? 20  VAL B N     1 
ATOM   2622 C  CA    . VAL D 2 19  ? 16.787  7.541   -2.871  1.00 38.82 ? 20  VAL B CA    1 
ATOM   2623 C  C     . VAL D 2 19  ? 17.343  6.756   -1.680  1.00 37.90 ? 20  VAL B C     1 
ATOM   2624 O  O     . VAL D 2 19  ? 17.526  5.541   -1.775  1.00 38.70 ? 20  VAL B O     1 
ATOM   2625 C  CB    . VAL D 2 19  ? 15.270  7.253   -2.994  1.00 37.09 ? 20  VAL B CB    1 
ATOM   2626 C  CG1   . VAL D 2 19  ? 14.541  7.802   -1.786  1.00 42.07 ? 20  VAL B CG1   1 
ATOM   2627 C  CG2   . VAL D 2 19  ? 14.709  7.862   -4.283  1.00 33.79 ? 20  VAL B CG2   1 
ATOM   2628 N  N     . CYS D 2 20  ? 17.617  7.432   -0.564  1.00 35.00 ? 21  CYS B N     1 
ATOM   2629 C  CA    . CYS D 2 20  ? 18.157  6.725   0.596   1.00 32.30 ? 21  CYS B CA    1 
ATOM   2630 C  C     . CYS D 2 20  ? 17.435  6.974   1.910   1.00 30.02 ? 21  CYS B C     1 
ATOM   2631 O  O     . CYS D 2 20  ? 17.804  6.411   2.938   1.00 33.90 ? 21  CYS B O     1 
ATOM   2632 C  CB    . CYS D 2 20  ? 19.653  7.013   0.753   1.00 34.47 ? 21  CYS B CB    1 
ATOM   2633 S  SG    . CYS D 2 20  ? 20.083  8.757   0.820   1.00 40.79 ? 21  CYS B SG    1 
ATOM   2634 N  N     . GLY D 2 21  ? 16.408  7.808   1.896   1.00 27.30 ? 22  GLY B N     1 
ATOM   2635 C  CA    . GLY D 2 21  ? 15.689  8.037   3.129   1.00 26.61 ? 22  GLY B CA    1 
ATOM   2636 C  C     . GLY D 2 21  ? 14.693  9.155   2.997   1.00 26.83 ? 22  GLY B C     1 
ATOM   2637 O  O     . GLY D 2 21  ? 14.622  9.790   1.941   1.00 27.08 ? 22  GLY B O     1 
ATOM   2638 N  N     . ILE D 2 22  ? 13.911  9.382   4.050   1.00 22.89 ? 23  ILE B N     1 
ATOM   2639 C  CA    . ILE D 2 22  ? 12.947  10.464  4.050   1.00 20.76 ? 23  ILE B CA    1 
ATOM   2640 C  C     . ILE D 2 22  ? 13.567  11.546  4.925   1.00 21.23 ? 23  ILE B C     1 
ATOM   2641 O  O     . ILE D 2 22  ? 14.347  11.247  5.832   1.00 17.67 ? 23  ILE B O     1 
ATOM   2642 C  CB    . ILE D 2 22  ? 11.556  10.023  4.578   1.00 25.91 ? 23  ILE B CB    1 
ATOM   2643 C  CG1   . ILE D 2 22  ? 11.658  9.462   5.989   1.00 30.69 ? 23  ILE B CG1   1 
ATOM   2644 C  CG2   . ILE D 2 22  ? 10.951  8.957   3.646   1.00 30.89 ? 23  ILE B CG2   1 
ATOM   2645 C  CD1   . ILE D 2 22  ? 10.308  9.201   6.618   1.00 31.53 ? 23  ILE B CD1   1 
ATOM   2646 N  N     . ILE D 2 23  ? 13.243  12.800  4.657   1.00 23.08 ? 24  ILE B N     1 
ATOM   2647 C  CA    . ILE D 2 23  ? 13.829  13.889  5.421   1.00 25.37 ? 24  ILE B CA    1 
ATOM   2648 C  C     . ILE D 2 23  ? 12.805  14.841  6.029   1.00 24.18 ? 24  ILE B C     1 
ATOM   2649 O  O     . ILE D 2 23  ? 11.774  15.133  5.427   1.00 24.69 ? 24  ILE B O     1 
ATOM   2650 C  CB    . ILE D 2 23  ? 14.854  14.671  4.557   1.00 27.16 ? 24  ILE B CB    1 
ATOM   2651 C  CG1   . ILE D 2 23  ? 15.543  15.745  5.401   1.00 29.58 ? 24  ILE B CG1   1 
ATOM   2652 C  CG2   . ILE D 2 23  ? 14.163  15.284  3.335   1.00 26.08 ? 24  ILE B CG2   1 
ATOM   2653 C  CD1   . ILE D 2 23  ? 16.721  16.390  4.724   1.00 32.07 ? 24  ILE B CD1   1 
ATOM   2654 N  N     . SER D 2 24  ? 13.093  15.304  7.241   1.00 26.03 ? 25  SER B N     1 
ATOM   2655 C  CA    . SER D 2 24  ? 12.224  16.237  7.935   1.00 29.22 ? 25  SER B CA    1 
ATOM   2656 C  C     . SER D 2 24  ? 12.720  17.649  7.633   1.00 32.35 ? 25  SER B C     1 
ATOM   2657 O  O     . SER D 2 24  ? 13.888  17.845  7.269   1.00 32.57 ? 25  SER B O     1 
ATOM   2658 C  CB    . SER D 2 24  ? 12.240  15.965  9.442   1.00 24.63 ? 25  SER B CB    1 
ATOM   2659 O  OG    . SER D 2 24  ? 13.531  16.148  10.002  1.00 30.63 ? 25  SER B OG    1 
ATOM   2660 N  N     . ALA D 2 25  ? 11.834  18.629  7.776   1.00 34.74 ? 26  ALA B N     1 
ATOM   2661 C  CA    . ALA D 2 25  ? 12.171  20.025  7.513   1.00 39.96 ? 26  ALA B CA    1 
ATOM   2662 C  C     . ALA D 2 25  ? 13.371  20.492  8.334   1.00 40.34 ? 26  ALA B C     1 
ATOM   2663 O  O     . ALA D 2 25  ? 14.097  21.399  7.931   1.00 42.10 ? 26  ALA B O     1 
ATOM   2664 C  CB    . ALA D 2 25  ? 10.961  20.908  7.805   1.00 44.80 ? 26  ALA B CB    1 
ATOM   2665 N  N     . GLU D 2 26  ? 13.562  19.847  9.480   1.00 40.81 ? 27  GLU B N     1 
ATOM   2666 C  CA    . GLU D 2 26  ? 14.632  20.144  10.421  1.00 38.85 ? 27  GLU B CA    1 
ATOM   2667 C  C     . GLU D 2 26  ? 15.964  19.498  10.033  1.00 39.63 ? 27  GLU B C     1 
ATOM   2668 O  O     . GLU D 2 26  ? 16.931  19.592  10.781  1.00 40.91 ? 27  GLU B O     1 
ATOM   2669 C  CB    . GLU D 2 26  ? 14.214  19.685  11.824  1.00 43.29 ? 27  GLU B CB    1 
ATOM   2670 C  CG    . GLU D 2 26  ? 12.854  20.246  12.317  1.00 52.48 ? 27  GLU B CG    1 
ATOM   2671 C  CD    . GLU D 2 26  ? 11.614  19.689  11.577  1.00 55.46 ? 27  GLU B CD    1 
ATOM   2672 O  OE1   . GLU D 2 26  ? 11.638  18.528  11.115  1.00 54.13 ? 27  GLU B OE1   1 
ATOM   2673 O  OE2   . GLU D 2 26  ? 10.601  20.413  11.456  1.00 51.87 ? 27  GLU B OE2   1 
ATOM   2674 N  N     . GLY D 2 27  ? 16.014  18.843  8.873   1.00 37.34 ? 28  GLY B N     1 
ATOM   2675 C  CA    . GLY D 2 27  ? 17.246  18.216  8.411   1.00 34.84 ? 28  GLY B CA    1 
ATOM   2676 C  C     . GLY D 2 27  ? 17.589  16.813  8.903   1.00 35.24 ? 28  GLY B C     1 
ATOM   2677 O  O     . GLY D 2 27  ? 18.689  16.311  8.630   1.00 33.07 ? 28  GLY B O     1 
ATOM   2678 N  N     . LYS D 2 28  ? 16.665  16.172  9.616   1.00 34.39 ? 29  LYS B N     1 
ATOM   2679 C  CA    . LYS D 2 28  ? 16.890  14.824  10.145  1.00 35.64 ? 29  LYS B CA    1 
ATOM   2680 C  C     . LYS D 2 28  ? 16.447  13.775  9.106   1.00 33.32 ? 29  LYS B C     1 
ATOM   2681 O  O     . LYS D 2 28  ? 15.313  13.809  8.634   1.00 30.16 ? 29  LYS B O     1 
ATOM   2682 C  CB    . LYS D 2 28  ? 16.102  14.667  11.448  1.00 34.89 ? 29  LYS B CB    1 
ATOM   2683 C  CG    . LYS D 2 28  ? 16.652  13.647  12.423  1.00 48.06 ? 29  LYS B CG    1 
ATOM   2684 C  CD    . LYS D 2 28  ? 15.751  13.575  13.652  1.00 57.23 ? 29  LYS B CD    1 
ATOM   2685 C  CE    . LYS D 2 28  ? 16.228  12.536  14.649  1.00 63.62 ? 29  LYS B CE    1 
ATOM   2686 N  NZ    . LYS D 2 28  ? 15.216  12.330  15.725  1.00 67.84 ? 29  LYS B NZ    1 
ATOM   2687 N  N     . ILE D 2 29  ? 17.337  12.853  8.754   1.00 31.86 ? 30  ILE B N     1 
ATOM   2688 C  CA    . ILE D 2 29  ? 17.027  11.824  7.761   1.00 31.22 ? 30  ILE B CA    1 
ATOM   2689 C  C     . ILE D 2 29  ? 16.747  10.452  8.376   1.00 33.42 ? 30  ILE B C     1 
ATOM   2690 O  O     . ILE D 2 29  ? 17.528  9.951   9.182   1.00 32.40 ? 30  ILE B O     1 
ATOM   2691 C  CB    . ILE D 2 29  ? 18.178  11.676  6.744   1.00 34.77 ? 30  ILE B CB    1 
ATOM   2692 C  CG1   . ILE D 2 29  ? 18.454  13.023  6.075   1.00 32.73 ? 30  ILE B CG1   1 
ATOM   2693 C  CG2   . ILE D 2 29  ? 17.838  10.628  5.688   1.00 29.95 ? 30  ILE B CG2   1 
ATOM   2694 C  CD1   . ILE D 2 29  ? 19.750  13.049  5.295   1.00 34.08 ? 30  ILE B CD1   1 
ATOM   2695 N  N     . TYR D 2 30  ? 15.624  9.852   7.990   1.00 31.83 ? 31  TYR B N     1 
ATOM   2696 C  CA    . TYR D 2 30  ? 15.237  8.529   8.472   1.00 31.04 ? 31  TYR B CA    1 
ATOM   2697 C  C     . TYR D 2 30  ? 15.456  7.551   7.309   1.00 31.44 ? 31  TYR B C     1 
ATOM   2698 O  O     . TYR D 2 30  ? 14.994  7.795   6.185   1.00 28.18 ? 31  TYR B O     1 
ATOM   2699 C  CB    . TYR D 2 30  ? 13.761  8.521   8.904   1.00 28.57 ? 31  TYR B CB    1 
ATOM   2700 C  CG    . TYR D 2 30  ? 13.392  9.561   9.949   1.00 33.35 ? 31  TYR B CG    1 
ATOM   2701 C  CD1   . TYR D 2 30  ? 13.354  10.923  9.628   1.00 28.40 ? 31  TYR B CD1   1 
ATOM   2702 C  CD2   . TYR D 2 30  ? 13.086  9.183   11.267  1.00 33.83 ? 31  TYR B CD2   1 
ATOM   2703 C  CE1   . TYR D 2 30  ? 13.023  11.886  10.591  1.00 34.48 ? 31  TYR B CE1   1 
ATOM   2704 C  CE2   . TYR D 2 30  ? 12.753  10.139  12.240  1.00 34.61 ? 31  TYR B CE2   1 
ATOM   2705 C  CZ    . TYR D 2 30  ? 12.725  11.488  11.894  1.00 43.27 ? 31  TYR B CZ    1 
ATOM   2706 O  OH    . TYR D 2 30  ? 12.410  12.444  12.842  1.00 45.45 ? 31  TYR B OH    1 
ATOM   2707 N  N     . PRO D 2 31  ? 16.172  6.439   7.557   1.00 30.97 ? 32  PRO B N     1 
ATOM   2708 C  CA    . PRO D 2 31  ? 16.441  5.438   6.514   1.00 31.79 ? 32  PRO B CA    1 
ATOM   2709 C  C     . PRO D 2 31  ? 15.197  4.678   6.016   1.00 31.66 ? 32  PRO B C     1 
ATOM   2710 O  O     . PRO D 2 31  ? 14.133  4.690   6.652   1.00 29.64 ? 32  PRO B O     1 
ATOM   2711 C  CB    . PRO D 2 31  ? 17.460  4.515   7.183   1.00 31.56 ? 32  PRO B CB    1 
ATOM   2712 C  CG    . PRO D 2 31  ? 17.060  4.573   8.628   1.00 34.60 ? 32  PRO B CG    1 
ATOM   2713 C  CD    . PRO D 2 31  ? 16.787  6.044   8.837   1.00 33.67 ? 32  PRO B CD    1 
ATOM   2714 N  N     . LEU D 2 32  ? 15.334  4.019   4.873   1.00 32.36 ? 33  LEU B N     1 
ATOM   2715 C  CA    . LEU D 2 32  ? 14.225  3.272   4.302   1.00 36.00 ? 33  LEU B CA    1 
ATOM   2716 C  C     . LEU D 2 32  ? 14.125  1.847   4.851   1.00 37.52 ? 33  LEU B C     1 
ATOM   2717 O  O     . LEU D 2 32  ? 15.130  1.209   5.169   1.00 37.28 ? 33  LEU B O     1 
ATOM   2718 C  CB    . LEU D 2 32  ? 14.345  3.247   2.771   1.00 29.79 ? 33  LEU B CB    1 
ATOM   2719 C  CG    . LEU D 2 32  ? 14.433  4.597   2.045   1.00 31.29 ? 33  LEU B CG    1 
ATOM   2720 C  CD1   . LEU D 2 32  ? 14.686  4.358   0.566   1.00 29.98 ? 33  LEU B CD1   1 
ATOM   2721 C  CD2   . LEU D 2 32  ? 13.161  5.416   2.241   1.00 24.17 ? 33  LEU B CD2   1 
ATOM   2722 N  N     . GLY D 2 33  ? 12.895  1.362   4.967   1.00 44.23 ? 34  GLY B N     1 
ATOM   2723 C  CA    . GLY D 2 33  ? 12.662  0.007   5.436   1.00 50.04 ? 34  GLY B CA    1 
ATOM   2724 C  C     . GLY D 2 33  ? 12.857  -0.894  4.227   1.00 55.14 ? 34  GLY B C     1 
ATOM   2725 O  O     . GLY D 2 33  ? 12.901  -0.402  3.092   1.00 54.67 ? 34  GLY B O     1 
ATOM   2726 N  N     . SER D 2 34  ? 12.965  -2.200  4.441   1.00 58.15 ? 35  SER B N     1 
ATOM   2727 C  CA    . SER D 2 34  ? 13.187  -3.118  3.326   1.00 59.25 ? 35  SER B CA    1 
ATOM   2728 C  C     . SER D 2 34  ? 11.944  -3.634  2.594   1.00 58.21 ? 35  SER B C     1 
ATOM   2729 O  O     . SER D 2 34  ? 12.032  -4.016  1.425   1.00 58.52 ? 35  SER B O     1 
ATOM   2730 C  CB    . SER D 2 34  ? 14.055  -4.302  3.786   1.00 60.80 ? 35  SER B CB    1 
ATOM   2731 O  OG    . SER D 2 34  ? 13.681  -4.747  5.081   1.00 68.68 ? 35  SER B OG    1 
ATOM   2732 N  N     . ASP D 2 35  ? 10.785  -3.641  3.249   1.00 56.12 ? 36  ASP B N     1 
ATOM   2733 C  CA    . ASP D 2 35  ? 9.599   -4.172  2.589   1.00 56.86 ? 36  ASP B CA    1 
ATOM   2734 C  C     . ASP D 2 35  ? 9.080   -3.411  1.366   1.00 57.06 ? 36  ASP B C     1 
ATOM   2735 O  O     . ASP D 2 35  ? 9.046   -2.186  1.332   1.00 60.08 ? 36  ASP B O     1 
ATOM   2736 C  CB    . ASP D 2 35  ? 8.475   -4.421  3.602   1.00 54.93 ? 36  ASP B CB    1 
ATOM   2737 C  CG    . ASP D 2 35  ? 7.758   -3.164  4.022   1.00 54.57 ? 36  ASP B CG    1 
ATOM   2738 O  OD1   . ASP D 2 35  ? 8.441   -2.163  4.314   1.00 62.09 ? 36  ASP B OD1   1 
ATOM   2739 O  OD2   . ASP D 2 35  ? 6.503   -3.191  4.062   1.00 51.80 ? 36  ASP B OD2   1 
ATOM   2740 N  N     . THR D 2 36  ? 8.679   -4.185  0.367   1.00 55.89 ? 37  THR B N     1 
ATOM   2741 C  CA    . THR D 2 36  ? 8.143   -3.735  -0.906  1.00 53.30 ? 37  THR B CA    1 
ATOM   2742 C  C     . THR D 2 36  ? 7.174   -2.552  -0.839  1.00 48.73 ? 37  THR B C     1 
ATOM   2743 O  O     . THR D 2 36  ? 7.176   -1.710  -1.738  1.00 48.26 ? 37  THR B O     1 
ATOM   2744 C  CB    . THR D 2 36  ? 7.458   -4.943  -1.640  1.00 59.86 ? 37  THR B CB    1 
ATOM   2745 O  OG1   . THR D 2 36  ? 6.888   -4.499  -2.876  1.00 63.44 ? 37  THR B OG1   1 
ATOM   2746 C  CG2   . THR D 2 36  ? 6.337   -5.561  -0.768  1.00 55.94 ? 37  THR B CG2   1 
ATOM   2747 N  N     . LYS D 2 37  ? 6.353   -2.475  0.206   1.00 43.08 ? 38  LYS B N     1 
ATOM   2748 C  CA    . LYS D 2 37  ? 5.400   -1.376  0.317   1.00 43.02 ? 38  LYS B CA    1 
ATOM   2749 C  C     . LYS D 2 37  ? 6.132   -0.026  0.296   1.00 41.50 ? 38  LYS B C     1 
ATOM   2750 O  O     . LYS D 2 37  ? 5.636   0.956   -0.276  1.00 42.75 ? 38  LYS B O     1 
ATOM   2751 C  CB    . LYS D 2 37  ? 4.563   -1.512  1.598   1.00 50.11 ? 38  LYS B CB    1 
ATOM   2752 C  CG    . LYS D 2 37  ? 3.461   -0.461  1.738   1.00 58.69 ? 38  LYS B CG    1 
ATOM   2753 C  CD    . LYS D 2 37  ? 2.686   -0.612  3.048   1.00 77.85 ? 38  LYS B CD    1 
ATOM   2754 C  CE    . LYS D 2 37  ? 1.576   0.434   3.167   1.00 85.54 ? 38  LYS B CE    1 
ATOM   2755 N  NZ    . LYS D 2 37  ? 0.816   0.315   4.446   1.00 82.81 ? 38  LYS B NZ    1 
ATOM   2756 N  N     . VAL D 2 38  ? 7.315   0.012   0.909   1.00 33.94 ? 39  VAL B N     1 
ATOM   2757 C  CA    . VAL D 2 38  ? 8.108   1.225   0.969   1.00 30.24 ? 39  VAL B CA    1 
ATOM   2758 C  C     . VAL D 2 38  ? 8.618   1.639   -0.408  1.00 28.88 ? 39  VAL B C     1 
ATOM   2759 O  O     . VAL D 2 38  ? 8.389   2.769   -0.839  1.00 27.82 ? 39  VAL B O     1 
ATOM   2760 C  CB    . VAL D 2 38  ? 9.276   1.069   1.972   1.00 29.65 ? 39  VAL B CB    1 
ATOM   2761 C  CG1   . VAL D 2 38  ? 10.281  2.199   1.820   1.00 33.82 ? 39  VAL B CG1   1 
ATOM   2762 C  CG2   . VAL D 2 38  ? 8.721   1.072   3.388   1.00 24.67 ? 39  VAL B CG2   1 
ATOM   2763 N  N     . LEU D 2 39  ? 9.299   0.730   -1.102  1.00 27.89 ? 40  LEU B N     1 
ATOM   2764 C  CA    . LEU D 2 39  ? 9.841   1.027   -2.431  1.00 26.96 ? 40  LEU B CA    1 
ATOM   2765 C  C     . LEU D 2 39  ? 8.767   1.340   -3.474  1.00 25.95 ? 40  LEU B C     1 
ATOM   2766 O  O     . LEU D 2 39  ? 8.966   2.167   -4.358  1.00 24.87 ? 40  LEU B O     1 
ATOM   2767 C  CB    . LEU D 2 39  ? 10.729  -0.123  -2.886  1.00 30.31 ? 40  LEU B CB    1 
ATOM   2768 C  CG    . LEU D 2 39  ? 11.966  -0.219  -1.990  1.00 38.86 ? 40  LEU B CG    1 
ATOM   2769 C  CD1   . LEU D 2 39  ? 12.686  -1.537  -2.174  1.00 37.03 ? 40  LEU B CD1   1 
ATOM   2770 C  CD2   . LEU D 2 39  ? 12.879  0.959   -2.299  1.00 46.66 ? 40  LEU B CD2   1 
ATOM   2771 N  N     . SER D 2 40  ? 7.623   0.680   -3.364  1.00 27.38 ? 41  SER B N     1 
ATOM   2772 C  CA    . SER D 2 40  ? 6.516   0.914   -4.275  1.00 29.29 ? 41  SER B CA    1 
ATOM   2773 C  C     . SER D 2 40  ? 6.174   2.405   -4.180  1.00 28.46 ? 41  SER B C     1 
ATOM   2774 O  O     . SER D 2 40  ? 6.030   3.091   -5.193  1.00 27.99 ? 41  SER B O     1 
ATOM   2775 C  CB    . SER D 2 40  ? 5.323   0.044   -3.857  1.00 29.11 ? 41  SER B CB    1 
ATOM   2776 O  OG    . SER D 2 40  ? 4.179   0.320   -4.641  1.00 35.92 ? 41  SER B OG    1 
ATOM   2777 N  N     . THR D 2 41  ? 6.067   2.895   -2.945  1.00 30.38 ? 42  THR B N     1 
ATOM   2778 C  CA    . THR D 2 41  ? 5.753   4.295   -2.657  1.00 27.62 ? 42  THR B CA    1 
ATOM   2779 C  C     . THR D 2 41  ? 6.859   5.263   -3.106  1.00 24.16 ? 42  THR B C     1 
ATOM   2780 O  O     . THR D 2 41  ? 6.583   6.312   -3.698  1.00 23.96 ? 42  THR B O     1 
ATOM   2781 C  CB    . THR D 2 41  ? 5.485   4.476   -1.140  1.00 32.41 ? 42  THR B CB    1 
ATOM   2782 O  OG1   . THR D 2 41  ? 4.268   3.802   -0.793  1.00 37.86 ? 42  THR B OG1   1 
ATOM   2783 C  CG2   . THR D 2 41  ? 5.368   5.949   -0.770  1.00 27.96 ? 42  THR B CG2   1 
ATOM   2784 N  N     . ILE D 2 42  ? 8.105   4.911   -2.832  1.00 21.07 ? 43  ILE B N     1 
ATOM   2785 C  CA    . ILE D 2 42  ? 9.220   5.766   -3.211  1.00 25.23 ? 43  ILE B CA    1 
ATOM   2786 C  C     . ILE D 2 42  ? 9.286   5.987   -4.727  1.00 26.90 ? 43  ILE B C     1 
ATOM   2787 O  O     . ILE D 2 42  ? 9.360   7.130   -5.182  1.00 27.87 ? 43  ILE B O     1 
ATOM   2788 C  CB    . ILE D 2 42  ? 10.568  5.207   -2.650  1.00 26.98 ? 43  ILE B CB    1 
ATOM   2789 C  CG1   . ILE D 2 42  ? 10.835  5.789   -1.260  1.00 31.10 ? 43  ILE B CG1   1 
ATOM   2790 C  CG2   . ILE D 2 42  ? 11.733  5.607   -3.526  1.00 35.91 ? 43  ILE B CG2   1 
ATOM   2791 C  CD1   . ILE D 2 42  ? 9.678   5.694   -0.310  1.00 30.12 ? 43  ILE B CD1   1 
ATOM   2792 N  N     . PHE D 2 43  ? 9.245   4.906   -5.506  1.00 25.80 ? 44  PHE B N     1 
ATOM   2793 C  CA    . PHE D 2 43  ? 9.306   5.018   -6.963  1.00 27.14 ? 44  PHE B CA    1 
ATOM   2794 C  C     . PHE D 2 43  ? 8.168   5.836   -7.556  1.00 26.64 ? 44  PHE B C     1 
ATOM   2795 O  O     . PHE D 2 43  ? 8.347   6.538   -8.552  1.00 26.50 ? 44  PHE B O     1 
ATOM   2796 C  CB    . PHE D 2 43  ? 9.399   3.633   -7.598  1.00 25.11 ? 44  PHE B CB    1 
ATOM   2797 C  CG    . PHE D 2 43  ? 10.677  2.931   -7.273  1.00 21.07 ? 44  PHE B CG    1 
ATOM   2798 C  CD1   . PHE D 2 43  ? 11.888  3.609   -7.375  1.00 18.75 ? 44  PHE B CD1   1 
ATOM   2799 C  CD2   . PHE D 2 43  ? 10.677  1.612   -6.819  1.00 28.79 ? 44  PHE B CD2   1 
ATOM   2800 C  CE1   . PHE D 2 43  ? 13.085  2.982   -7.023  1.00 25.07 ? 44  PHE B CE1   1 
ATOM   2801 C  CE2   . PHE D 2 43  ? 11.866  0.974   -6.463  1.00 21.87 ? 44  PHE B CE2   1 
ATOM   2802 C  CZ    . PHE D 2 43  ? 13.071  1.656   -6.563  1.00 23.89 ? 44  PHE B CZ    1 
ATOM   2803 N  N     . GLU D 2 44  ? 6.996   5.763   -6.947  1.00 26.53 ? 45  GLU B N     1 
ATOM   2804 C  CA    . GLU D 2 44  ? 5.891   6.555   -7.438  1.00 30.05 ? 45  GLU B CA    1 
ATOM   2805 C  C     . GLU D 2 44  ? 6.250   8.037   -7.242  1.00 31.13 ? 45  GLU B C     1 
ATOM   2806 O  O     . GLU D 2 44  ? 6.121   8.842   -8.170  1.00 30.77 ? 45  GLU B O     1 
ATOM   2807 C  CB    . GLU D 2 44  ? 4.617   6.200   -6.683  1.00 39.34 ? 45  GLU B CB    1 
ATOM   2808 C  CG    . GLU D 2 44  ? 3.370   6.832   -7.267  1.00 58.39 ? 45  GLU B CG    1 
ATOM   2809 C  CD    . GLU D 2 44  ? 2.127   6.495   -6.476  1.00 74.43 ? 45  GLU B CD    1 
ATOM   2810 O  OE1   . GLU D 2 44  ? 2.057   5.381   -5.906  1.00 83.81 ? 45  GLU B OE1   1 
ATOM   2811 O  OE2   . GLU D 2 44  ? 1.219   7.351   -6.427  1.00 82.34 ? 45  GLU B OE2   1 
ATOM   2812 N  N     . LEU D 2 45  ? 6.715   8.392   -6.041  1.00 29.33 ? 46  LEU B N     1 
ATOM   2813 C  CA    . LEU D 2 45  ? 7.095   9.773   -5.732  1.00 27.79 ? 46  LEU B CA    1 
ATOM   2814 C  C     . LEU D 2 45  ? 8.289   10.259  -6.557  1.00 27.73 ? 46  LEU B C     1 
ATOM   2815 O  O     . LEU D 2 45  ? 8.376   11.434  -6.902  1.00 28.33 ? 46  LEU B O     1 
ATOM   2816 C  CB    . LEU D 2 45  ? 7.430   9.925   -4.243  1.00 29.80 ? 46  LEU B CB    1 
ATOM   2817 C  CG    . LEU D 2 45  ? 6.299   9.797   -3.224  1.00 31.61 ? 46  LEU B CG    1 
ATOM   2818 C  CD1   . LEU D 2 45  ? 6.861   9.928   -1.814  1.00 29.15 ? 46  LEU B CD1   1 
ATOM   2819 C  CD2   . LEU D 2 45  ? 5.252   10.859  -3.491  1.00 20.26 ? 46  LEU B CD2   1 
ATOM   2820 N  N     . PHE D 2 46  ? 9.205   9.350   -6.863  1.00 26.40 ? 47  PHE B N     1 
ATOM   2821 C  CA    . PHE D 2 46  ? 10.403  9.659   -7.642  1.00 28.14 ? 47  PHE B CA    1 
ATOM   2822 C  C     . PHE D 2 46  ? 10.034  10.055  -9.086  1.00 28.60 ? 47  PHE B C     1 
ATOM   2823 O  O     . PHE D 2 46  ? 10.698  10.896  -9.701  1.00 29.75 ? 47  PHE B O     1 
ATOM   2824 C  CB    . PHE D 2 46  ? 11.321  8.429   -7.622  1.00 24.27 ? 47  PHE B CB    1 
ATOM   2825 C  CG    . PHE D 2 46  ? 12.667  8.639   -8.261  1.00 30.05 ? 47  PHE B CG    1 
ATOM   2826 C  CD1   . PHE D 2 46  ? 13.691  9.278   -7.568  1.00 35.21 ? 47  PHE B CD1   1 
ATOM   2827 C  CD2   . PHE D 2 46  ? 12.920  8.177   -9.552  1.00 36.89 ? 47  PHE B CD2   1 
ATOM   2828 C  CE1   . PHE D 2 46  ? 14.951  9.452   -8.151  1.00 42.54 ? 47  PHE B CE1   1 
ATOM   2829 C  CE2   . PHE D 2 46  ? 14.175  8.345   -10.145 1.00 37.98 ? 47  PHE B CE2   1 
ATOM   2830 C  CZ    . PHE D 2 46  ? 15.192  8.984   -9.442  1.00 41.31 ? 47  PHE B CZ    1 
ATOM   2831 N  N     . SER D 2 47  ? 8.971   9.448   -9.608  1.00 28.08 ? 48  SER B N     1 
ATOM   2832 C  CA    . SER D 2 47  ? 8.501   9.701   -10.961 1.00 24.67 ? 48  SER B CA    1 
ATOM   2833 C  C     . SER D 2 47  ? 7.651   10.959  -11.180 1.00 25.76 ? 48  SER B C     1 
ATOM   2834 O  O     . SER D 2 47  ? 7.744   11.562  -12.247 1.00 24.53 ? 48  SER B O     1 
ATOM   2835 C  CB    . SER D 2 47  ? 7.701   8.493   -11.462 1.00 31.02 ? 48  SER B CB    1 
ATOM   2836 O  OG    . SER D 2 47  ? 8.402   7.278   -11.286 1.00 27.01 ? 48  SER B OG    1 
ATOM   2837 N  N     . ARG D 2 48  ? 6.829   11.355  -10.198 1.00 23.95 ? 49  ARG B N     1 
ATOM   2838 C  CA    . ARG D 2 48  ? 5.943   12.525  -10.337 1.00 23.68 ? 49  ARG B CA    1 
ATOM   2839 C  C     . ARG D 2 48  ? 6.586   13.748  -10.956 1.00 26.94 ? 49  ARG B C     1 
ATOM   2840 O  O     . ARG D 2 48  ? 6.056   14.295  -11.919 1.00 22.11 ? 49  ARG B O     1 
ATOM   2841 C  CB    . ARG D 2 48  ? 5.316   12.934  -9.005  1.00 28.95 ? 49  ARG B CB    1 
ATOM   2842 C  CG    . ARG D 2 48  ? 4.424   11.890  -8.405  1.00 42.50 ? 49  ARG B CG    1 
ATOM   2843 C  CD    . ARG D 2 48  ? 4.124   12.176  -6.951  1.00 47.86 ? 49  ARG B CD    1 
ATOM   2844 N  NE    . ARG D 2 48  ? 3.063   13.157  -6.767  1.00 41.31 ? 49  ARG B NE    1 
ATOM   2845 C  CZ    . ARG D 2 48  ? 3.214   14.304  -6.116  1.00 40.56 ? 49  ARG B CZ    1 
ATOM   2846 N  NH1   . ARG D 2 48  ? 4.393   14.638  -5.609  1.00 43.25 ? 49  ARG B NH1   1 
ATOM   2847 N  NH2   . ARG D 2 48  ? 2.184   15.122  -5.980  1.00 36.32 ? 49  ARG B NH2   1 
ATOM   2848 N  N     . PRO D 2 49  ? 7.735   14.204  -10.409 1.00 30.44 ? 50  PRO B N     1 
ATOM   2849 C  CA    . PRO D 2 49  ? 8.406   15.384  -10.969 1.00 30.59 ? 50  PRO B CA    1 
ATOM   2850 C  C     . PRO D 2 49  ? 8.779   15.231  -12.457 1.00 27.18 ? 50  PRO B C     1 
ATOM   2851 O  O     . PRO D 2 49  ? 8.558   16.149  -13.259 1.00 25.95 ? 50  PRO B O     1 
ATOM   2852 C  CB    . PRO D 2 49  ? 9.646   15.531  -10.069 1.00 28.01 ? 50  PRO B CB    1 
ATOM   2853 C  CG    . PRO D 2 49  ? 9.202   14.935  -8.766  1.00 27.14 ? 50  PRO B CG    1 
ATOM   2854 C  CD    . PRO D 2 49  ? 8.487   13.696  -9.244  1.00 26.02 ? 50  PRO B CD    1 
ATOM   2855 N  N     . ILE D 2 50  ? 9.336   14.077  -12.816 1.00 25.97 ? 51  ILE B N     1 
ATOM   2856 C  CA    . ILE D 2 50  ? 9.738   13.810  -14.201 1.00 27.98 ? 51  ILE B CA    1 
ATOM   2857 C  C     . ILE D 2 50  ? 8.547   13.898  -15.157 1.00 27.80 ? 51  ILE B C     1 
ATOM   2858 O  O     . ILE D 2 50  ? 8.600   14.579  -16.181 1.00 30.72 ? 51  ILE B O     1 
ATOM   2859 C  CB    . ILE D 2 50  ? 10.345  12.414  -14.344 1.00 28.74 ? 51  ILE B CB    1 
ATOM   2860 C  CG1   . ILE D 2 50  ? 11.427  12.202  -13.285 1.00 36.56 ? 51  ILE B CG1   1 
ATOM   2861 C  CG2   . ILE D 2 50  ? 10.922  12.244  -15.740 1.00 32.81 ? 51  ILE B CG2   1 
ATOM   2862 C  CD1   . ILE D 2 50  ? 11.869  10.756  -13.165 1.00 44.19 ? 51  ILE B CD1   1 
ATOM   2863 N  N     . ILE D 2 51  ? 7.472   13.202  -14.807 1.00 25.54 ? 52  ILE B N     1 
ATOM   2864 C  CA    . ILE D 2 51  ? 6.256   13.181  -15.605 1.00 23.61 ? 52  ILE B CA    1 
ATOM   2865 C  C     . ILE D 2 51  ? 5.704   14.588  -15.784 1.00 25.72 ? 52  ILE B C     1 
ATOM   2866 O  O     . ILE D 2 51  ? 5.319   14.981  -16.879 1.00 29.42 ? 52  ILE B O     1 
ATOM   2867 C  CB    . ILE D 2 51  ? 5.184   12.260  -14.940 1.00 22.72 ? 52  ILE B CB    1 
ATOM   2868 C  CG1   . ILE D 2 51  ? 5.613   10.798  -15.083 1.00 18.29 ? 52  ILE B CG1   1 
ATOM   2869 C  CG2   . ILE D 2 51  ? 3.782   12.514  -15.531 1.00 18.78 ? 52  ILE B CG2   1 
ATOM   2870 C  CD1   . ILE D 2 51  ? 4.915   9.864   -14.120 1.00 25.78 ? 52  ILE B CD1   1 
ATOM   2871 N  N     . ASN D 2 52  ? 5.670   15.354  -14.707 1.00 28.61 ? 53  ASN B N     1 
ATOM   2872 C  CA    . ASN D 2 52  ? 5.141   16.705  -14.777 1.00 27.65 ? 53  ASN B CA    1 
ATOM   2873 C  C     . ASN D 2 52  ? 6.024   17.623  -15.626 1.00 27.37 ? 53  ASN B C     1 
ATOM   2874 O  O     . ASN D 2 52  ? 5.528   18.488  -16.353 1.00 27.89 ? 53  ASN B O     1 
ATOM   2875 C  CB    . ASN D 2 52  ? 4.992   17.268  -13.371 1.00 33.85 ? 53  ASN B CB    1 
ATOM   2876 C  CG    . ASN D 2 52  ? 4.182   18.523  -13.351 1.00 44.28 ? 53  ASN B CG    1 
ATOM   2877 O  OD1   . ASN D 2 52  ? 2.949   18.479  -13.365 1.00 48.37 ? 53  ASN B OD1   1 
ATOM   2878 N  ND2   . ASN D 2 52  ? 4.862   19.663  -13.321 1.00 49.12 ? 53  ASN B ND2   1 
ATOM   2879 N  N     . LYS D 2 53  ? 7.331   17.425  -15.535 1.00 24.45 ? 54  LYS B N     1 
ATOM   2880 C  CA    . LYS D 2 53  ? 8.286   18.222  -16.283 1.00 27.38 ? 54  LYS B CA    1 
ATOM   2881 C  C     . LYS D 2 53  ? 8.103   18.019  -17.794 1.00 30.16 ? 54  LYS B C     1 
ATOM   2882 O  O     . LYS D 2 53  ? 7.932   18.988  -18.546 1.00 28.57 ? 54  LYS B O     1 
ATOM   2883 C  CB    . LYS D 2 53  ? 9.703   17.838  -15.865 1.00 28.76 ? 54  LYS B CB    1 
ATOM   2884 C  CG    . LYS D 2 53  ? 10.782  18.743  -16.401 1.00 33.53 ? 54  LYS B CG    1 
ATOM   2885 C  CD    . LYS D 2 53  ? 12.144  18.188  -16.063 1.00 43.08 ? 54  LYS B CD    1 
ATOM   2886 C  CE    . LYS D 2 53  ? 13.237  19.041  -16.674 1.00 54.10 ? 54  LYS B CE    1 
ATOM   2887 N  NZ    . LYS D 2 53  ? 14.575  18.399  -16.520 1.00 60.66 ? 54  LYS B NZ    1 
ATOM   2888 N  N     . ILE D 2 54  ? 8.134   16.762  -18.232 1.00 29.14 ? 55  ILE B N     1 
ATOM   2889 C  CA    . ILE D 2 54  ? 7.966   16.429  -19.644 1.00 28.53 ? 55  ILE B CA    1 
ATOM   2890 C  C     . ILE D 2 54  ? 6.571   16.776  -20.174 1.00 29.29 ? 55  ILE B C     1 
ATOM   2891 O  O     . ILE D 2 54  ? 6.420   17.203  -21.326 1.00 29.42 ? 55  ILE B O     1 
ATOM   2892 C  CB    . ILE D 2 54  ? 8.238   14.945  -19.893 1.00 29.12 ? 55  ILE B CB    1 
ATOM   2893 C  CG1   . ILE D 2 54  ? 9.671   14.607  -19.469 1.00 28.84 ? 55  ILE B CG1   1 
ATOM   2894 C  CG2   . ILE D 2 54  ? 7.974   14.601  -21.359 1.00 32.88 ? 55  ILE B CG2   1 
ATOM   2895 C  CD1   . ILE D 2 54  ? 10.740  15.448  -20.152 1.00 28.53 ? 55  ILE B CD1   1 
ATOM   2896 N  N     . ALA D 2 55  ? 5.555   16.594  -19.338 1.00 26.92 ? 56  ALA B N     1 
ATOM   2897 C  CA    . ALA D 2 55  ? 4.190   16.896  -19.733 1.00 27.35 ? 56  ALA B CA    1 
ATOM   2898 C  C     . ALA D 2 55  ? 4.031   18.373  -20.056 1.00 30.96 ? 56  ALA B C     1 
ATOM   2899 O  O     . ALA D 2 55  ? 3.482   18.726  -21.110 1.00 31.75 ? 56  ALA B O     1 
ATOM   2900 C  CB    . ALA D 2 55  ? 3.225   16.494  -18.649 1.00 24.78 ? 56  ALA B CB    1 
ATOM   2901 N  N     . GLU D 2 56  ? 4.507   19.237  -19.158 1.00 31.84 ? 57  GLU B N     1 
ATOM   2902 C  CA    . GLU D 2 56  ? 4.416   20.681  -19.368 1.00 35.63 ? 57  GLU B CA    1 
ATOM   2903 C  C     . GLU D 2 56  ? 5.099   21.075  -20.671 1.00 34.46 ? 57  GLU B C     1 
ATOM   2904 O  O     . GLU D 2 56  ? 4.548   21.835  -21.469 1.00 35.07 ? 57  GLU B O     1 
ATOM   2905 C  CB    . GLU D 2 56  ? 5.049   21.446  -18.205 1.00 41.91 ? 57  GLU B CB    1 
ATOM   2906 C  CG    . GLU D 2 56  ? 4.150   21.566  -16.974 1.00 62.08 ? 57  GLU B CG    1 
ATOM   2907 C  CD    . GLU D 2 56  ? 4.698   22.530  -15.919 1.00 76.55 ? 57  GLU B CD    1 
ATOM   2908 O  OE1   . GLU D 2 56  ? 5.634   23.311  -16.228 1.00 80.80 ? 57  GLU B OE1   1 
ATOM   2909 O  OE2   . GLU D 2 56  ? 4.185   22.505  -14.774 1.00 83.08 ? 57  GLU B OE2   1 
ATOM   2910 N  N     . LYS D 2 57  ? 6.295   20.536  -20.874 1.00 32.68 ? 58  LYS B N     1 
ATOM   2911 C  CA    . LYS D 2 57  ? 7.085   20.778  -22.069 1.00 34.91 ? 58  LYS B CA    1 
ATOM   2912 C  C     . LYS D 2 57  ? 6.337   20.434  -23.372 1.00 35.98 ? 58  LYS B C     1 
ATOM   2913 O  O     . LYS D 2 57  ? 6.767   20.839  -24.449 1.00 39.45 ? 58  LYS B O     1 
ATOM   2914 C  CB    . LYS D 2 57  ? 8.381   19.968  -21.976 1.00 33.80 ? 58  LYS B CB    1 
ATOM   2915 C  CG    . LYS D 2 57  ? 9.278   20.066  -23.184 1.00 42.70 ? 58  LYS B CG    1 
ATOM   2916 C  CD    . LYS D 2 57  ? 10.379  19.026  -23.134 1.00 55.57 ? 58  LYS B CD    1 
ATOM   2917 C  CE    . LYS D 2 57  ? 11.124  18.971  -24.461 1.00 65.12 ? 58  LYS B CE    1 
ATOM   2918 N  NZ    . LYS D 2 57  ? 12.092  17.840  -24.534 1.00 67.96 ? 58  LYS B NZ    1 
ATOM   2919 N  N     . HIS D 2 58  ? 5.231   19.691  -23.282 1.00 32.79 ? 59  HIS B N     1 
ATOM   2920 C  CA    . HIS D 2 58  ? 4.449   19.312  -24.462 1.00 28.78 ? 59  HIS B CA    1 
ATOM   2921 C  C     . HIS D 2 58  ? 3.030   19.840  -24.493 1.00 29.97 ? 59  HIS B C     1 
ATOM   2922 O  O     . HIS D 2 58  ? 2.246   19.441  -25.351 1.00 34.62 ? 59  HIS B O     1 
ATOM   2923 C  CB    . HIS D 2 58  ? 4.390   17.791  -24.617 1.00 27.45 ? 59  HIS B CB    1 
ATOM   2924 C  CG    . HIS D 2 58  ? 5.679   17.183  -25.057 1.00 21.43 ? 59  HIS B CG    1 
ATOM   2925 N  ND1   . HIS D 2 58  ? 5.997   16.987  -26.385 1.00 29.19 ? 59  HIS B ND1   1 
ATOM   2926 C  CD2   . HIS D 2 58  ? 6.740   16.735  -24.346 1.00 29.13 ? 59  HIS B CD2   1 
ATOM   2927 C  CE1   . HIS D 2 58  ? 7.198   16.441  -26.472 1.00 28.79 ? 59  HIS B CE1   1 
ATOM   2928 N  NE2   . HIS D 2 58  ? 7.671   16.278  -25.248 1.00 27.44 ? 59  HIS B NE2   1 
ATOM   2929 N  N     . GLY D 2 59  ? 2.687   20.723  -23.567 1.00 29.03 ? 60  GLY B N     1 
ATOM   2930 C  CA    . GLY D 2 59  ? 1.346   21.280  -23.554 1.00 29.14 ? 60  GLY B CA    1 
ATOM   2931 C  C     . GLY D 2 59  ? 0.284   20.393  -22.936 1.00 33.27 ? 60  GLY B C     1 
ATOM   2932 O  O     . GLY D 2 59  ? -0.914  20.546  -23.221 1.00 34.81 ? 60  GLY B O     1 
ATOM   2933 N  N     . TYR D 2 60  ? 0.714   19.471  -22.082 1.00 31.51 ? 61  TYR B N     1 
ATOM   2934 C  CA    . TYR D 2 60  ? -0.204  18.557  -21.423 1.00 32.30 ? 61  TYR B CA    1 
ATOM   2935 C  C     . TYR D 2 60  ? -0.480  18.887  -19.958 1.00 30.79 ? 61  TYR B C     1 
ATOM   2936 O  O     . TYR D 2 60  ? 0.446   19.140  -19.185 1.00 32.40 ? 61  TYR B O     1 
ATOM   2937 C  CB    . TYR D 2 60  ? 0.347   17.131  -21.493 1.00 35.69 ? 61  TYR B CB    1 
ATOM   2938 C  CG    . TYR D 2 60  ? 0.111   16.423  -22.803 1.00 38.26 ? 61  TYR B CG    1 
ATOM   2939 C  CD1   . TYR D 2 60  ? -1.048  15.670  -23.007 1.00 34.44 ? 61  TYR B CD1   1 
ATOM   2940 C  CD2   . TYR D 2 60  ? 1.053   16.482  -23.831 1.00 39.15 ? 61  TYR B CD2   1 
ATOM   2941 C  CE1   . TYR D 2 60  ? -1.262  14.990  -24.197 1.00 36.18 ? 61  TYR B CE1   1 
ATOM   2942 C  CE2   . TYR D 2 60  ? 0.851   15.805  -25.030 1.00 43.11 ? 61  TYR B CE2   1 
ATOM   2943 C  CZ    . TYR D 2 60  ? -0.308  15.061  -25.204 1.00 41.28 ? 61  TYR B CZ    1 
ATOM   2944 O  OH    . TYR D 2 60  ? -0.507  14.382  -26.378 1.00 48.41 ? 61  TYR B OH    1 
ATOM   2945 N  N     . ILE D 2 61  ? -1.755  18.884  -19.589 1.00 32.23 ? 62  ILE B N     1 
ATOM   2946 C  CA    . ILE D 2 61  ? -2.172  19.096  -18.204 1.00 33.49 ? 62  ILE B CA    1 
ATOM   2947 C  C     . ILE D 2 61  ? -2.008  17.724  -17.514 1.00 33.99 ? 62  ILE B C     1 
ATOM   2948 O  O     . ILE D 2 61  ? -2.270  16.681  -18.134 1.00 29.60 ? 62  ILE B O     1 
ATOM   2949 C  CB    . ILE D 2 61  ? -3.666  19.558  -18.136 1.00 39.94 ? 62  ILE B CB    1 
ATOM   2950 C  CG1   . ILE D 2 61  ? -3.746  21.082  -17.999 1.00 50.02 ? 62  ILE B CG1   1 
ATOM   2951 C  CG2   . ILE D 2 61  ? -4.389  18.912  -16.959 1.00 41.96 ? 62  ILE B CG2   1 
ATOM   2952 C  CD1   . ILE D 2 61  ? -3.010  21.850  -19.076 1.00 59.80 ? 62  ILE B CD1   1 
ATOM   2953 N  N     . VAL D 2 62  ? -1.568  17.718  -16.255 1.00 32.82 ? 63  VAL B N     1 
ATOM   2954 C  CA    . VAL D 2 62  ? -1.402  16.469  -15.507 1.00 29.11 ? 63  VAL B CA    1 
ATOM   2955 C  C     . VAL D 2 62  ? -2.335  16.433  -14.303 1.00 30.23 ? 63  VAL B C     1 
ATOM   2956 O  O     . VAL D 2 62  ? -2.341  17.358  -13.494 1.00 29.80 ? 63  VAL B O     1 
ATOM   2957 C  CB    . VAL D 2 62  ? 0.038   16.287  -15.009 1.00 30.03 ? 63  VAL B CB    1 
ATOM   2958 C  CG1   . VAL D 2 62  ? 0.148   15.032  -14.147 1.00 23.45 ? 63  VAL B CG1   1 
ATOM   2959 C  CG2   . VAL D 2 62  ? 0.972   16.187  -16.178 1.00 27.34 ? 63  VAL B CG2   1 
ATOM   2960 N  N     . GLU D 2 63  ? -3.122  15.365  -14.189 1.00 28.05 ? 64  GLU B N     1 
ATOM   2961 C  CA    . GLU D 2 63  ? -4.055  15.208  -13.080 1.00 27.26 ? 64  GLU B CA    1 
ATOM   2962 C  C     . GLU D 2 63  ? -3.909  13.897  -12.331 1.00 30.52 ? 64  GLU B C     1 
ATOM   2963 O  O     . GLU D 2 63  ? -3.796  12.828  -12.944 1.00 27.55 ? 64  GLU B O     1 
ATOM   2964 C  CB    . GLU D 2 63  ? -5.484  15.274  -13.567 1.00 26.92 ? 64  GLU B CB    1 
ATOM   2965 C  CG    . GLU D 2 63  ? -5.906  16.606  -14.053 1.00 38.44 ? 64  GLU B CG    1 
ATOM   2966 C  CD    . GLU D 2 63  ? -7.396  16.690  -14.199 1.00 37.92 ? 64  GLU B CD    1 
ATOM   2967 O  OE1   . GLU D 2 63  ? -8.102  15.792  -13.686 1.00 40.26 ? 64  GLU B OE1   1 
ATOM   2968 O  OE2   . GLU D 2 63  ? -7.862  17.660  -14.827 1.00 47.25 ? 64  GLU B OE2   1 
ATOM   2969 N  N     . GLU D 2 64  ? -3.923  13.987  -11.005 1.00 27.04 ? 65  GLU B N     1 
ATOM   2970 C  CA    . GLU D 2 64  ? -3.829  12.819  -10.146 1.00 26.22 ? 65  GLU B CA    1 
ATOM   2971 C  C     . GLU D 2 64  ? -5.244  12.607  -9.631  1.00 27.16 ? 65  GLU B C     1 
ATOM   2972 O  O     . GLU D 2 64  ? -6.058  13.528  -9.680  1.00 28.18 ? 65  GLU B O     1 
ATOM   2973 C  CB    . GLU D 2 64  ? -2.838  13.069  -9.013  1.00 24.17 ? 65  GLU B CB    1 
ATOM   2974 C  CG    . GLU D 2 64  ? -1.432  13.337  -9.529  1.00 28.09 ? 65  GLU B CG    1 
ATOM   2975 C  CD    . GLU D 2 64  ? -0.397  13.443  -8.424  1.00 33.13 ? 65  GLU B CD    1 
ATOM   2976 O  OE1   . GLU D 2 64  ? -0.101  12.412  -7.784  1.00 38.93 ? 65  GLU B OE1   1 
ATOM   2977 O  OE2   . GLU D 2 64  ? 0.127   14.554  -8.195  1.00 37.02 ? 65  GLU B OE2   1 
ATOM   2978 N  N     . PRO D 2 65  ? -5.569  11.393  -9.149  1.00 27.27 ? 66  PRO B N     1 
ATOM   2979 C  CA    . PRO D 2 65  ? -6.921  11.109  -8.642  1.00 25.57 ? 66  PRO B CA    1 
ATOM   2980 C  C     . PRO D 2 65  ? -7.293  11.809  -7.322  1.00 26.44 ? 66  PRO B C     1 
ATOM   2981 O  O     . PRO D 2 65  ? -6.431  12.119  -6.503  1.00 23.90 ? 66  PRO B O     1 
ATOM   2982 C  CB    . PRO D 2 65  ? -6.913  9.582   -8.460  1.00 24.20 ? 66  PRO B CB    1 
ATOM   2983 C  CG    . PRO D 2 65  ? -5.697  9.105   -9.231  1.00 27.26 ? 66  PRO B CG    1 
ATOM   2984 C  CD    . PRO D 2 65  ? -4.709  10.200  -9.042  1.00 19.90 ? 66  PRO B CD    1 
ATOM   2985 N  N     . LYS D 2 66  ? -8.584  12.059  -7.128  1.00 30.35 ? 67  LYS B N     1 
ATOM   2986 C  CA    . LYS D 2 66  ? -9.073  12.657  -5.887  1.00 34.90 ? 67  LYS B CA    1 
ATOM   2987 C  C     . LYS D 2 66  ? -9.296  11.470  -4.929  1.00 34.85 ? 67  LYS B C     1 
ATOM   2988 O  O     . LYS D 2 66  ? -8.752  11.449  -3.821  1.00 35.00 ? 67  LYS B O     1 
ATOM   2989 C  CB    . LYS D 2 66  ? -10.380 13.413  -6.129  1.00 41.54 ? 67  LYS B CB    1 
ATOM   2990 C  CG    . LYS D 2 66  ? -10.240 14.576  -7.099  1.00 61.55 ? 67  LYS B CG    1 
ATOM   2991 C  CD    . LYS D 2 66  ? -11.590 15.214  -7.414  1.00 74.32 ? 67  LYS B CD    1 
ATOM   2992 C  CE    . LYS D 2 66  ? -11.443 16.378  -8.404  1.00 79.44 ? 67  LYS B CE    1 
ATOM   2993 N  NZ    . LYS D 2 66  ? -12.745 17.073  -8.678  1.00 78.75 ? 67  LYS B NZ    1 
ATOM   2994 N  N     . GLN D 2 67  ? -10.094 10.487  -5.355  1.00 30.36 ? 68  GLN B N     1 
ATOM   2995 C  CA    . GLN D 2 67  ? -10.336 9.294   -4.548  1.00 30.31 ? 68  GLN B CA    1 
ATOM   2996 C  C     . GLN D 2 67  ? -9.091  8.427   -4.638  1.00 30.16 ? 68  GLN B C     1 
ATOM   2997 O  O     . GLN D 2 67  ? -8.551  8.201   -5.724  1.00 27.59 ? 68  GLN B O     1 
ATOM   2998 C  CB    . GLN D 2 67  ? -11.544 8.495   -5.040  1.00 38.81 ? 68  GLN B CB    1 
ATOM   2999 C  CG    . GLN D 2 67  ? -12.891 9.119   -4.733  1.00 45.81 ? 68  GLN B CG    1 
ATOM   3000 C  CD    . GLN D 2 67  ? -13.321 10.107  -5.790  1.00 61.50 ? 68  GLN B CD    1 
ATOM   3001 O  OE1   . GLN D 2 67  ? -12.490 10.740  -6.448  1.00 62.00 ? 68  GLN B OE1   1 
ATOM   3002 N  NE2   . GLN D 2 67  ? -14.628 10.242  -5.970  1.00 68.60 ? 68  GLN B NE2   1 
ATOM   3003 N  N     . GLN D 2 68  ? -8.654  7.928   -3.490  1.00 28.67 ? 69  GLN B N     1 
ATOM   3004 C  CA    . GLN D 2 68  ? -7.441  7.130   -3.404  1.00 27.41 ? 69  GLN B CA    1 
ATOM   3005 C  C     . GLN D 2 68  ? -7.416  5.745   -4.066  1.00 27.11 ? 69  GLN B C     1 
ATOM   3006 O  O     . GLN D 2 68  ? -6.350  5.142   -4.203  1.00 27.65 ? 69  GLN B O     1 
ATOM   3007 C  CB    . GLN D 2 68  ? -7.023  7.052   -1.937  1.00 31.68 ? 69  GLN B CB    1 
ATOM   3008 C  CG    . GLN D 2 68  ? -6.926  8.443   -1.310  1.00 34.24 ? 69  GLN B CG    1 
ATOM   3009 C  CD    . GLN D 2 68  ? -6.456  8.423   0.124   1.00 37.28 ? 69  GLN B CD    1 
ATOM   3010 O  OE1   . GLN D 2 68  ? -5.578  7.643   0.497   1.00 32.35 ? 69  GLN B OE1   1 
ATOM   3011 N  NE2   . GLN D 2 68  ? -7.037  9.289   0.942   1.00 42.11 ? 69  GLN B NE2   1 
ATOM   3012 N  N     . ASN D 2 69  ? -8.568  5.238   -4.480  1.00 24.42 ? 70  ASN B N     1 
ATOM   3013 C  CA    . ASN D 2 69  ? -8.596  3.936   -5.133  1.00 26.20 ? 70  ASN B CA    1 
ATOM   3014 C  C     . ASN D 2 69  ? -9.116  4.039   -6.570  1.00 26.49 ? 70  ASN B C     1 
ATOM   3015 O  O     . ASN D 2 69  ? -9.830  3.152   -7.057  1.00 25.67 ? 70  ASN B O     1 
ATOM   3016 C  CB    . ASN D 2 69  ? -9.414  2.930   -4.305  1.00 26.02 ? 70  ASN B CB    1 
ATOM   3017 C  CG    . ASN D 2 69  ? -10.785 3.448   -3.950  1.00 30.10 ? 70  ASN B CG    1 
ATOM   3018 O  OD1   . ASN D 2 69  ? -11.250 4.447   -4.513  1.00 29.22 ? 70  ASN B OD1   1 
ATOM   3019 N  ND2   . ASN D 2 69  ? -11.444 2.781   -3.011  1.00 32.54 ? 70  ASN B ND2   1 
ATOM   3020 N  N     . HIS D 2 70  ? -8.753  5.138   -7.236  1.00 23.39 ? 71  HIS B N     1 
ATOM   3021 C  CA    . HIS D 2 70  ? -9.133  5.402   -8.628  1.00 21.98 ? 71  HIS B CA    1 
ATOM   3022 C  C     . HIS D 2 70  ? -7.906  5.304   -9.538  1.00 22.56 ? 71  HIS B C     1 
ATOM   3023 O  O     . HIS D 2 70  ? -6.813  5.751   -9.184  1.00 22.67 ? 71  HIS B O     1 
ATOM   3024 C  CB    . HIS D 2 70  ? -9.718  6.813   -8.787  1.00 19.26 ? 71  HIS B CB    1 
ATOM   3025 C  CG    . HIS D 2 70  ? -11.181 6.919   -8.479  1.00 24.46 ? 71  HIS B CG    1 
ATOM   3026 N  ND1   . HIS D 2 70  ? -11.826 6.093   -7.580  1.00 28.93 ? 71  HIS B ND1   1 
ATOM   3027 C  CD2   . HIS D 2 70  ? -12.123 7.773   -8.945  1.00 30.68 ? 71  HIS B CD2   1 
ATOM   3028 C  CE1   . HIS D 2 70  ? -13.101 6.434   -7.507  1.00 30.88 ? 71  HIS B CE1   1 
ATOM   3029 N  NE2   . HIS D 2 70  ? -13.306 7.451   -8.325  1.00 35.50 ? 71  HIS B NE2   1 
ATOM   3030 N  N     . TYR D 2 71  ? -8.095  4.711   -10.710 1.00 22.16 ? 72  TYR B N     1 
ATOM   3031 C  CA    . TYR D 2 71  ? -7.039  4.581   -11.711 1.00 16.74 ? 72  TYR B CA    1 
ATOM   3032 C  C     . TYR D 2 71  ? -7.181  5.801   -12.637 1.00 13.97 ? 72  TYR B C     1 
ATOM   3033 O  O     . TYR D 2 71  ? -8.291  6.313   -12.819 1.00 14.89 ? 72  TYR B O     1 
ATOM   3034 C  CB    . TYR D 2 71  ? -7.283  3.282   -12.496 1.00 15.08 ? 72  TYR B CB    1 
ATOM   3035 C  CG    . TYR D 2 71  ? -6.521  3.138   -13.797 1.00 17.04 ? 72  TYR B CG    1 
ATOM   3036 C  CD1   . TYR D 2 71  ? -7.066  3.590   -15.005 1.00 13.26 ? 72  TYR B CD1   1 
ATOM   3037 C  CD2   . TYR D 2 71  ? -5.259  2.538   -13.826 1.00 10.74 ? 72  TYR B CD2   1 
ATOM   3038 C  CE1   . TYR D 2 71  ? -6.370  3.445   -16.210 1.00 13.67 ? 72  TYR B CE1   1 
ATOM   3039 C  CE2   . TYR D 2 71  ? -4.559  2.388   -15.021 1.00 17.56 ? 72  TYR B CE2   1 
ATOM   3040 C  CZ    . TYR D 2 71  ? -5.121  2.843   -16.207 1.00 20.80 ? 72  TYR B CZ    1 
ATOM   3041 O  OH    . TYR D 2 71  ? -4.435  2.683   -17.387 1.00 23.66 ? 72  TYR B OH    1 
ATOM   3042 N  N     . PRO D 2 72  ? -6.073  6.318   -13.198 1.00 12.26 ? 73  PRO B N     1 
ATOM   3043 C  CA    . PRO D 2 72  ? -4.654  5.958   -13.109 1.00 12.82 ? 73  PRO B CA    1 
ATOM   3044 C  C     . PRO D 2 72  ? -3.890  6.949   -12.217 1.00 17.42 ? 73  PRO B C     1 
ATOM   3045 O  O     . PRO D 2 72  ? -4.435  7.971   -11.785 1.00 20.72 ? 73  PRO B O     1 
ATOM   3046 C  CB    . PRO D 2 72  ? -4.191  6.069   -14.558 1.00 10.04 ? 73  PRO B CB    1 
ATOM   3047 C  CG    . PRO D 2 72  ? -5.040  7.254   -15.097 1.00 8.91  ? 73  PRO B CG    1 
ATOM   3048 C  CD    . PRO D 2 72  ? -6.269  7.392   -14.194 1.00 12.92 ? 73  PRO B CD    1 
ATOM   3049 N  N     . ASP D 2 73  ? -2.625  6.652   -11.950 1.00 19.33 ? 74  ASP B N     1 
ATOM   3050 C  CA    . ASP D 2 73  ? -1.816  7.548   -11.135 1.00 22.60 ? 74  ASP B CA    1 
ATOM   3051 C  C     . ASP D 2 73  ? -1.793  8.933   -11.775 1.00 22.89 ? 74  ASP B C     1 
ATOM   3052 O  O     . ASP D 2 73  ? -2.000  9.941   -11.098 1.00 23.10 ? 74  ASP B O     1 
ATOM   3053 C  CB    . ASP D 2 73  ? -0.386  7.013   -10.996 1.00 15.82 ? 74  ASP B CB    1 
ATOM   3054 C  CG    . ASP D 2 73  ? -0.313  5.757   -10.144 1.00 23.13 ? 74  ASP B CG    1 
ATOM   3055 O  OD1   . ASP D 2 73  ? -1.096  5.629   -9.180  1.00 27.63 ? 74  ASP B OD1   1 
ATOM   3056 O  OD2   . ASP D 2 73  ? 0.532   4.895   -10.435 1.00 30.72 ? 74  ASP B OD2   1 
ATOM   3057 N  N     . PHE D 2 74  ? -1.549  8.975   -13.081 1.00 24.46 ? 75  PHE B N     1 
ATOM   3058 C  CA    . PHE D 2 74  ? -1.500  10.239  -13.804 1.00 23.95 ? 75  PHE B CA    1 
ATOM   3059 C  C     . PHE D 2 74  ? -2.331  10.236  -15.082 1.00 22.45 ? 75  PHE B C     1 
ATOM   3060 O  O     . PHE D 2 74  ? -2.241  9.306   -15.887 1.00 21.41 ? 75  PHE B O     1 
ATOM   3061 C  CB    . PHE D 2 74  ? -0.053  10.571  -14.154 1.00 23.54 ? 75  PHE B CB    1 
ATOM   3062 C  CG    . PHE D 2 74  ? 0.868   10.542  -12.978 1.00 33.11 ? 75  PHE B CG    1 
ATOM   3063 C  CD1   . PHE D 2 74  ? 1.003   11.660  -12.152 1.00 34.68 ? 75  PHE B CD1   1 
ATOM   3064 C  CD2   . PHE D 2 74  ? 1.597   9.395   -12.680 1.00 34.07 ? 75  PHE B CD2   1 
ATOM   3065 C  CE1   . PHE D 2 74  ? 1.850   11.631  -11.047 1.00 27.06 ? 75  PHE B CE1   1 
ATOM   3066 C  CE2   . PHE D 2 74  ? 2.449   9.355   -11.572 1.00 32.04 ? 75  PHE B CE2   1 
ATOM   3067 C  CZ    . PHE D 2 74  ? 2.573   10.474  -10.758 1.00 27.04 ? 75  PHE B CZ    1 
ATOM   3068 N  N     . THR D 2 75  ? -3.143  11.275  -15.254 1.00 22.46 ? 76  THR B N     1 
ATOM   3069 C  CA    . THR D 2 75  ? -3.950  11.454  -16.452 1.00 24.63 ? 76  THR B CA    1 
ATOM   3070 C  C     . THR D 2 75  ? -3.367  12.690  -17.161 1.00 27.19 ? 76  THR B C     1 
ATOM   3071 O  O     . THR D 2 75  ? -3.358  13.782  -16.580 1.00 26.10 ? 76  THR B O     1 
ATOM   3072 C  CB    . THR D 2 75  ? -5.430  11.717  -16.109 1.00 24.13 ? 76  THR B CB    1 
ATOM   3073 O  OG1   . THR D 2 75  ? -6.016  10.525  -15.579 1.00 28.60 ? 76  THR B OG1   1 
ATOM   3074 C  CG2   . THR D 2 75  ? -6.212  12.149  -17.359 1.00 25.18 ? 76  THR B CG2   1 
ATOM   3075 N  N     . LEU D 2 76  ? -2.868  12.510  -18.387 1.00 24.62 ? 77  LEU B N     1 
ATOM   3076 C  CA    . LEU D 2 76  ? -2.300  13.604  -19.188 1.00 24.34 ? 77  LEU B CA    1 
ATOM   3077 C  C     . LEU D 2 76  ? -3.214  13.939  -20.370 1.00 27.81 ? 77  LEU B C     1 
ATOM   3078 O  O     . LEU D 2 76  ? -3.779  13.037  -21.004 1.00 24.54 ? 77  LEU B O     1 
ATOM   3079 C  CB    . LEU D 2 76  ? -0.919  13.232  -19.729 1.00 15.63 ? 77  LEU B CB    1 
ATOM   3080 C  CG    . LEU D 2 76  ? 0.282   13.283  -18.789 1.00 24.75 ? 77  LEU B CG    1 
ATOM   3081 C  CD1   . LEU D 2 76  ? 0.054   12.359  -17.616 1.00 27.53 ? 77  LEU B CD1   1 
ATOM   3082 C  CD2   . LEU D 2 76  ? 1.540   12.884  -19.531 1.00 13.73 ? 77  LEU B CD2   1 
ATOM   3083 N  N     . TYR D 2 77  ? -3.362  15.228  -20.668 1.00 29.25 ? 78  TYR B N     1 
ATOM   3084 C  CA    . TYR D 2 77  ? -4.204  15.657  -21.786 1.00 33.66 ? 78  TYR B CA    1 
ATOM   3085 C  C     . TYR D 2 77  ? -4.071  17.146  -22.120 1.00 37.07 ? 78  TYR B C     1 
ATOM   3086 O  O     . TYR D 2 77  ? -3.752  17.965  -21.257 1.00 36.54 ? 78  TYR B O     1 
ATOM   3087 C  CB    . TYR D 2 77  ? -5.676  15.337  -21.496 1.00 28.17 ? 78  TYR B CB    1 
ATOM   3088 C  CG    . TYR D 2 77  ? -6.306  16.220  -20.445 1.00 35.40 ? 78  TYR B CG    1 
ATOM   3089 C  CD1   . TYR D 2 77  ? -6.236  15.888  -19.091 1.00 36.07 ? 78  TYR B CD1   1 
ATOM   3090 C  CD2   . TYR D 2 77  ? -6.972  17.395  -20.804 1.00 36.40 ? 78  TYR B CD2   1 
ATOM   3091 C  CE1   . TYR D 2 77  ? -6.807  16.700  -18.127 1.00 39.04 ? 78  TYR B CE1   1 
ATOM   3092 C  CE2   . TYR D 2 77  ? -7.545  18.215  -19.847 1.00 35.80 ? 78  TYR B CE2   1 
ATOM   3093 C  CZ    . TYR D 2 77  ? -7.459  17.864  -18.513 1.00 43.69 ? 78  TYR B CZ    1 
ATOM   3094 O  OH    . TYR D 2 77  ? -8.021  18.681  -17.566 1.00 45.75 ? 78  TYR B OH    1 
ATOM   3095 N  N     . LYS D 2 78  ? -4.310  17.487  -23.382 1.00 40.86 ? 79  LYS B N     1 
ATOM   3096 C  CA    . LYS D 2 78  ? -4.268  18.876  -23.831 1.00 40.06 ? 79  LYS B CA    1 
ATOM   3097 C  C     . LYS D 2 78  ? -5.690  19.387  -23.638 1.00 39.68 ? 79  LYS B C     1 
ATOM   3098 O  O     . LYS D 2 78  ? -6.652  18.660  -23.895 1.00 36.92 ? 79  LYS B O     1 
ATOM   3099 C  CB    . LYS D 2 78  ? -3.874  18.954  -25.303 1.00 38.55 ? 79  LYS B CB    1 
ATOM   3100 C  CG    . LYS D 2 78  ? -2.512  18.379  -25.579 1.00 37.78 ? 79  LYS B CG    1 
ATOM   3101 C  CD    . LYS D 2 78  ? -2.029  18.752  -26.959 1.00 44.51 ? 79  LYS B CD    1 
ATOM   3102 C  CE    . LYS D 2 78  ? -0.555  18.422  -27.096 1.00 44.02 ? 79  LYS B CE    1 
ATOM   3103 N  NZ    . LYS D 2 78  ? 0.081   19.101  -28.250 1.00 46.55 ? 79  LYS B NZ    1 
ATOM   3104 N  N     . PRO D 2 79  ? -5.849  20.639  -23.185 1.00 42.30 ? 80  PRO B N     1 
ATOM   3105 C  CA    . PRO D 2 79  ? -7.189  21.202  -22.965 1.00 46.03 ? 80  PRO B CA    1 
ATOM   3106 C  C     . PRO D 2 79  ? -8.050  21.172  -24.225 1.00 48.92 ? 80  PRO B C     1 
ATOM   3107 O  O     . PRO D 2 79  ? -9.282  21.098  -24.152 1.00 49.47 ? 80  PRO B O     1 
ATOM   3108 C  CB    . PRO D 2 79  ? -6.889  22.626  -22.500 1.00 47.78 ? 80  PRO B CB    1 
ATOM   3109 C  CG    . PRO D 2 79  ? -5.533  22.492  -21.854 1.00 48.23 ? 80  PRO B CG    1 
ATOM   3110 C  CD    . PRO D 2 79  ? -4.807  21.620  -22.844 1.00 43.09 ? 80  PRO B CD    1 
ATOM   3111 N  N     . SER D 2 80  ? -7.373  21.228  -25.372 1.00 50.16 ? 81  SER B N     1 
ATOM   3112 C  CA    . SER D 2 80  ? -7.996  21.198  -26.694 1.00 51.21 ? 81  SER B CA    1 
ATOM   3113 C  C     . SER D 2 80  ? -8.435  19.790  -27.145 1.00 53.77 ? 81  SER B C     1 
ATOM   3114 O  O     . SER D 2 80  ? -9.341  19.652  -27.967 1.00 56.39 ? 81  SER B O     1 
ATOM   3115 C  CB    . SER D 2 80  ? -7.015  21.779  -27.713 1.00 49.88 ? 81  SER B CB    1 
ATOM   3116 O  OG    . SER D 2 80  ? -5.716  21.215  -27.554 1.00 52.27 ? 81  SER B OG    1 
ATOM   3117 N  N     . GLU D 2 81  ? -7.787  18.753  -26.611 1.00 54.31 ? 82  GLU B N     1 
ATOM   3118 C  CA    . GLU D 2 81  ? -8.092  17.361  -26.952 1.00 52.58 ? 82  GLU B CA    1 
ATOM   3119 C  C     . GLU D 2 81  ? -8.584  16.627  -25.703 1.00 52.65 ? 82  GLU B C     1 
ATOM   3120 O  O     . GLU D 2 81  ? -7.892  15.744  -25.182 1.00 50.36 ? 82  GLU B O     1 
ATOM   3121 C  CB    . GLU D 2 81  ? -6.828  16.662  -27.460 1.00 55.41 ? 82  GLU B CB    1 
ATOM   3122 C  CG    . GLU D 2 81  ? -6.102  17.370  -28.585 1.00 61.57 ? 82  GLU B CG    1 
ATOM   3123 C  CD    . GLU D 2 81  ? -6.670  17.043  -29.946 1.00 64.77 ? 82  GLU B CD    1 
ATOM   3124 O  OE1   . GLU D 2 81  ? -7.876  17.289  -30.178 1.00 66.86 ? 82  GLU B OE1   1 
ATOM   3125 O  OE2   . GLU D 2 81  ? -5.898  16.536  -30.788 1.00 63.98 ? 82  GLU B OE2   1 
ATOM   3126 N  N     . PRO D 2 82  ? -9.788  16.970  -25.209 1.00 51.45 ? 83  PRO B N     1 
ATOM   3127 C  CA    . PRO D 2 82  ? -10.292 16.298  -24.012 1.00 50.31 ? 83  PRO B CA    1 
ATOM   3128 C  C     . PRO D 2 82  ? -10.489 14.795  -24.166 1.00 50.00 ? 83  PRO B C     1 
ATOM   3129 O  O     . PRO D 2 82  ? -10.338 14.057  -23.204 1.00 50.82 ? 83  PRO B O     1 
ATOM   3130 C  CB    . PRO D 2 82  ? -11.601 17.034  -23.727 1.00 51.51 ? 83  PRO B CB    1 
ATOM   3131 C  CG    . PRO D 2 82  ? -12.047 17.465  -25.080 1.00 55.81 ? 83  PRO B CG    1 
ATOM   3132 C  CD    . PRO D 2 82  ? -10.763 17.961  -25.694 1.00 49.66 ? 83  PRO B CD    1 
ATOM   3133 N  N     . ASN D 2 83  ? -10.812 14.330  -25.367 1.00 49.06 ? 84  ASN B N     1 
ATOM   3134 C  CA    . ASN D 2 83  ? -11.030 12.898  -25.560 1.00 48.24 ? 84  ASN B CA    1 
ATOM   3135 C  C     . ASN D 2 83  ? -9.822  12.170  -26.118 1.00 44.61 ? 84  ASN B C     1 
ATOM   3136 O  O     . ASN D 2 83  ? -9.956  11.188  -26.842 1.00 45.18 ? 84  ASN B O     1 
ATOM   3137 C  CB    . ASN D 2 83  ? -12.253 12.640  -26.445 1.00 49.42 ? 84  ASN B CB    1 
ATOM   3138 C  CG    . ASN D 2 83  ? -13.531 13.135  -25.816 1.00 55.26 ? 84  ASN B CG    1 
ATOM   3139 O  OD1   . ASN D 2 83  ? -14.368 12.347  -25.385 1.00 67.41 ? 84  ASN B OD1   1 
ATOM   3140 N  ND2   . ASN D 2 83  ? -13.693 14.453  -25.761 1.00 55.31 ? 84  ASN B ND2   1 
ATOM   3141 N  N     . LYS D 2 84  ? -8.637  12.661  -25.786 1.00 42.08 ? 85  LYS B N     1 
ATOM   3142 C  CA    . LYS D 2 84  ? -7.406  12.023  -26.230 1.00 41.12 ? 85  LYS B CA    1 
ATOM   3143 C  C     . LYS D 2 84  ? -6.457  11.994  -25.039 1.00 39.22 ? 85  LYS B C     1 
ATOM   3144 O  O     . LYS D 2 84  ? -5.294  12.399  -25.132 1.00 39.60 ? 85  LYS B O     1 
ATOM   3145 C  CB    . LYS D 2 84  ? -6.791  12.768  -27.419 1.00 46.66 ? 85  LYS B CB    1 
ATOM   3146 C  CG    . LYS D 2 84  ? -7.606  12.669  -28.708 1.00 57.09 ? 85  LYS B CG    1 
ATOM   3147 C  CD    . LYS D 2 84  ? -6.831  13.260  -29.879 1.00 72.33 ? 85  LYS B CD    1 
ATOM   3148 C  CE    . LYS D 2 84  ? -7.603  13.171  -31.195 1.00 79.78 ? 85  LYS B CE    1 
ATOM   3149 N  NZ    . LYS D 2 84  ? -6.749  13.649  -32.331 1.00 81.49 ? 85  LYS B NZ    1 
ATOM   3150 N  N     . LYS D 2 85  ? -6.986  11.502  -23.917 1.00 36.78 ? 86  LYS B N     1 
ATOM   3151 C  CA    . LYS D 2 85  ? -6.257  11.398  -22.660 1.00 28.68 ? 86  LYS B CA    1 
ATOM   3152 C  C     . LYS D 2 85  ? -5.339  10.195  -22.598 1.00 26.33 ? 86  LYS B C     1 
ATOM   3153 O  O     . LYS D 2 85  ? -5.638  9.133   -23.140 1.00 26.46 ? 86  LYS B O     1 
ATOM   3154 C  CB    . LYS D 2 85  ? -7.236  11.332  -21.495 1.00 25.76 ? 86  LYS B CB    1 
ATOM   3155 C  CG    . LYS D 2 85  ? -8.202  12.496  -21.422 1.00 26.39 ? 86  LYS B CG    1 
ATOM   3156 C  CD    . LYS D 2 85  ? -8.904  12.510  -20.093 1.00 23.51 ? 86  LYS B CD    1 
ATOM   3157 C  CE    . LYS D 2 85  ? -9.584  13.829  -19.858 1.00 24.05 ? 86  LYS B CE    1 
ATOM   3158 N  NZ    . LYS D 2 85  ? -10.892 13.886  -20.531 1.00 27.48 ? 86  LYS B NZ    1 
ATOM   3159 N  N     . ILE D 2 86  ? -4.213  10.372  -21.929 1.00 23.54 ? 87  ILE B N     1 
ATOM   3160 C  CA    . ILE D 2 86  ? -3.240  9.310   -21.763 1.00 21.80 ? 87  ILE B CA    1 
ATOM   3161 C  C     . ILE D 2 86  ? -3.232  8.937   -20.277 1.00 25.86 ? 87  ILE B C     1 
ATOM   3162 O  O     . ILE D 2 86  ? -3.312  9.824   -19.418 1.00 26.20 ? 87  ILE B O     1 
ATOM   3163 C  CB    . ILE D 2 86  ? -1.857  9.795   -22.168 1.00 19.79 ? 87  ILE B CB    1 
ATOM   3164 C  CG1   . ILE D 2 86  ? -1.873  10.222  -23.640 1.00 18.99 ? 87  ILE B CG1   1 
ATOM   3165 C  CG2   . ILE D 2 86  ? -0.809  8.721   -21.877 1.00 17.21 ? 87  ILE B CG2   1 
ATOM   3166 C  CD1   . ILE D 2 86  ? -0.604  10.903  -24.066 1.00 20.37 ? 87  ILE B CD1   1 
ATOM   3167 N  N     . ALA D 2 87  ? -3.150  7.642   -19.978 1.00 24.95 ? 88  ALA B N     1 
ATOM   3168 C  CA    . ALA D 2 87  ? -3.124  7.167   -18.599 1.00 22.08 ? 88  ALA B CA    1 
ATOM   3169 C  C     . ALA D 2 87  ? -1.761  6.565   -18.326 1.00 23.06 ? 88  ALA B C     1 
ATOM   3170 O  O     . ALA D 2 87  ? -1.200  5.856   -19.163 1.00 22.87 ? 88  ALA B O     1 
ATOM   3171 C  CB    . ALA D 2 87  ? -4.208  6.134   -18.362 1.00 19.26 ? 88  ALA B CB    1 
ATOM   3172 N  N     . ILE D 2 88  ? -1.216  6.871   -17.156 1.00 21.99 ? 89  ILE B N     1 
ATOM   3173 C  CA    . ILE D 2 88  ? 0.068   6.337   -16.760 1.00 22.11 ? 89  ILE B CA    1 
ATOM   3174 C  C     . ILE D 2 88  ? -0.099  5.722   -15.377 1.00 24.14 ? 89  ILE B C     1 
ATOM   3175 O  O     . ILE D 2 88  ? -0.723  6.307   -14.475 1.00 23.89 ? 89  ILE B O     1 
ATOM   3176 C  CB    . ILE D 2 88  ? 1.154   7.410   -16.749 1.00 22.19 ? 89  ILE B CB    1 
ATOM   3177 C  CG1   . ILE D 2 88  ? 1.167   8.135   -18.095 1.00 25.53 ? 89  ILE B CG1   1 
ATOM   3178 C  CG2   . ILE D 2 88  ? 2.500   6.763   -16.537 1.00 18.63 ? 89  ILE B CG2   1 
ATOM   3179 C  CD1   . ILE D 2 88  ? 2.189   9.233   -18.201 1.00 25.39 ? 89  ILE B CD1   1 
ATOM   3180 N  N     . ASP D 2 89  ? 0.453   4.527   -15.223 1.00 23.90 ? 90  ASP B N     1 
ATOM   3181 C  CA    . ASP D 2 89  ? 0.365   3.793   -13.979 1.00 24.75 ? 90  ASP B CA    1 
ATOM   3182 C  C     . ASP D 2 89  ? 1.756   3.298   -13.665 1.00 20.72 ? 90  ASP B C     1 
ATOM   3183 O  O     . ASP D 2 89  ? 2.463   2.817   -14.548 1.00 21.78 ? 90  ASP B O     1 
ATOM   3184 C  CB    . ASP D 2 89  ? -0.597  2.612   -14.146 1.00 30.27 ? 90  ASP B CB    1 
ATOM   3185 C  CG    . ASP D 2 89  ? -1.313  2.257   -12.864 1.00 29.42 ? 90  ASP B CG    1 
ATOM   3186 O  OD1   . ASP D 2 89  ? -1.324  3.085   -11.936 1.00 43.58 ? 90  ASP B OD1   1 
ATOM   3187 O  OD2   . ASP D 2 89  ? -1.872  1.147   -12.784 1.00 34.57 ? 90  ASP B OD2   1 
ATOM   3188 N  N     . ILE D 2 90  ? 2.146   3.427   -12.405 1.00 19.63 ? 91  ILE B N     1 
ATOM   3189 C  CA    . ILE D 2 90  ? 3.464   2.997   -11.966 1.00 18.18 ? 91  ILE B CA    1 
ATOM   3190 C  C     . ILE D 2 90  ? 3.358   1.656   -11.252 1.00 17.38 ? 91  ILE B C     1 
ATOM   3191 O  O     . ILE D 2 90  ? 2.516   1.489   -10.362 1.00 19.10 ? 91  ILE B O     1 
ATOM   3192 C  CB    . ILE D 2 90  ? 4.102   4.079   -11.075 1.00 22.85 ? 91  ILE B CB    1 
ATOM   3193 C  CG1   . ILE D 2 90  ? 4.243   5.367   -11.897 1.00 21.11 ? 91  ILE B CG1   1 
ATOM   3194 C  CG2   . ILE D 2 90  ? 5.470   3.624   -10.580 1.00 15.67 ? 91  ILE B CG2   1 
ATOM   3195 C  CD1   . ILE D 2 90  ? 4.629   6.567   -11.099 1.00 39.19 ? 91  ILE B CD1   1 
ATOM   3196 N  N     . LYS D 2 91  ? 4.201   0.707   -11.655 1.00 13.82 ? 92  LYS B N     1 
ATOM   3197 C  CA    . LYS D 2 91  ? 4.204   -0.643  -11.094 1.00 15.74 ? 92  LYS B CA    1 
ATOM   3198 C  C     . LYS D 2 91  ? 5.622   -1.020  -10.725 1.00 16.84 ? 92  LYS B C     1 
ATOM   3199 O  O     . LYS D 2 91  ? 6.568   -0.636  -11.404 1.00 19.72 ? 92  LYS B O     1 
ATOM   3200 C  CB    . LYS D 2 91  ? 3.695   -1.663  -12.122 1.00 14.78 ? 92  LYS B CB    1 
ATOM   3201 C  CG    . LYS D 2 91  ? 2.341   -1.373  -12.709 1.00 15.10 ? 92  LYS B CG    1 
ATOM   3202 C  CD    . LYS D 2 91  ? 1.284   -1.614  -11.691 1.00 20.04 ? 92  LYS B CD    1 
ATOM   3203 C  CE    . LYS D 2 91  ? -0.048  -1.245  -12.229 1.00 20.95 ? 92  LYS B CE    1 
ATOM   3204 N  NZ    . LYS D 2 91  ? -1.060  -1.408  -11.169 1.00 30.95 ? 92  LYS B NZ    1 
ATOM   3205 N  N     . THR D 2 92  ? 5.777   -1.777  -9.647  1.00 17.41 ? 93  THR B N     1 
ATOM   3206 C  CA    . THR D 2 92  ? 7.102   -2.193  -9.213  1.00 19.72 ? 93  THR B CA    1 
ATOM   3207 C  C     . THR D 2 92  ? 7.086   -3.665  -8.796  1.00 18.24 ? 93  THR B C     1 
ATOM   3208 O  O     . THR D 2 92  ? 6.038   -4.219  -8.444  1.00 17.04 ? 93  THR B O     1 
ATOM   3209 C  CB    . THR D 2 92  ? 7.612   -1.328  -8.003  1.00 24.05 ? 93  THR B CB    1 
ATOM   3210 O  OG1   . THR D 2 92  ? 6.981   -1.767  -6.792  1.00 27.86 ? 93  THR B OG1   1 
ATOM   3211 C  CG2   . THR D 2 92  ? 7.272   0.138   -8.205  1.00 14.51 ? 93  THR B CG2   1 
ATOM   3212 N  N     . THR D 2 93  ? 8.251   -4.294  -8.847  1.00 16.66 ? 94  THR B N     1 
ATOM   3213 C  CA    . THR D 2 93  ? 8.389   -5.673  -8.430  1.00 19.70 ? 94  THR B CA    1 
ATOM   3214 C  C     . THR D 2 93  ? 9.874   -5.833  -8.144  1.00 24.78 ? 94  THR B C     1 
ATOM   3215 O  O     . THR D 2 93  ? 10.649  -4.928  -8.454  1.00 27.51 ? 94  THR B O     1 
ATOM   3216 C  CB    . THR D 2 93  ? 7.919   -6.653  -9.522  1.00 22.54 ? 94  THR B CB    1 
ATOM   3217 O  OG1   . THR D 2 93  ? 7.783   -7.958  -8.948  1.00 22.14 ? 94  THR B OG1   1 
ATOM   3218 C  CG2   . THR D 2 93  ? 8.912   -6.705  -10.691 1.00 20.74 ? 94  THR B CG2   1 
ATOM   3219 N  N     . TYR D 2 94  ? 10.279  -6.960  -7.563  1.00 26.81 ? 95  TYR B N     1 
ATOM   3220 C  CA    . TYR D 2 94  ? 11.685  -7.177  -7.239  1.00 30.38 ? 95  TYR B CA    1 
ATOM   3221 C  C     . TYR D 2 94  ? 12.247  -8.481  -7.825  1.00 34.79 ? 95  TYR B C     1 
ATOM   3222 O  O     . TYR D 2 94  ? 11.495  -9.347  -8.278  1.00 34.02 ? 95  TYR B O     1 
ATOM   3223 C  CB    . TYR D 2 94  ? 11.857  -7.200  -5.709  1.00 32.56 ? 95  TYR B CB    1 
ATOM   3224 C  CG    . TYR D 2 94  ? 11.315  -8.459  -5.052  1.00 39.11 ? 95  TYR B CG    1 
ATOM   3225 C  CD1   . TYR D 2 94  ? 12.095  -9.619  -4.971  1.00 41.89 ? 95  TYR B CD1   1 
ATOM   3226 C  CD2   . TYR D 2 94  ? 10.011  -8.513  -4.561  1.00 37.14 ? 95  TYR B CD2   1 
ATOM   3227 C  CE1   . TYR D 2 94  ? 11.590  -10.794 -4.429  1.00 50.94 ? 95  TYR B CE1   1 
ATOM   3228 C  CE2   . TYR D 2 94  ? 9.495   -9.687  -4.016  1.00 44.94 ? 95  TYR B CE2   1 
ATOM   3229 C  CZ    . TYR D 2 94  ? 10.290  -10.822 -3.958  1.00 54.41 ? 95  TYR B CZ    1 
ATOM   3230 O  OH    . TYR D 2 94  ? 9.784   -11.993 -3.452  1.00 62.31 ? 95  TYR B OH    1 
ATOM   3231 N  N     . THR D 2 95  ? 13.573  -8.598  -7.814  1.00 38.16 ? 96  THR B N     1 
ATOM   3232 C  CA    . THR D 2 95  ? 14.283  -9.802  -8.243  1.00 46.37 ? 96  THR B CA    1 
ATOM   3233 C  C     . THR D 2 95  ? 15.306  -10.040 -7.143  1.00 53.39 ? 96  THR B C     1 
ATOM   3234 O  O     . THR D 2 95  ? 15.801  -9.080  -6.540  1.00 52.71 ? 96  THR B O     1 
ATOM   3235 C  CB    . THR D 2 95  ? 15.073  -9.632  -9.555  1.00 46.18 ? 96  THR B CB    1 
ATOM   3236 O  OG1   . THR D 2 95  ? 15.649  -8.322  -9.618  1.00 48.31 ? 96  THR B OG1   1 
ATOM   3237 C  CG2   . THR D 2 95  ? 14.203  -9.907  -10.753 1.00 44.82 ? 96  THR B CG2   1 
ATOM   3238 N  N     . ASN D 2 96  ? 15.611  -11.306 -6.866  1.00 58.44 ? 97  ASN B N     1 
ATOM   3239 C  CA    . ASN D 2 96  ? 16.609  -11.642 -5.842  1.00 61.80 ? 97  ASN B CA    1 
ATOM   3240 C  C     . ASN D 2 96  ? 17.970  -11.618 -6.526  1.00 65.90 ? 97  ASN B C     1 
ATOM   3241 O  O     . ASN D 2 96  ? 18.987  -11.290 -5.916  1.00 65.47 ? 97  ASN B O     1 
ATOM   3242 C  CB    . ASN D 2 96  ? 16.338  -13.021 -5.249  1.00 57.72 ? 97  ASN B CB    1 
ATOM   3243 C  CG    . ASN D 2 96  ? 15.062  -13.063 -4.438  1.00 61.35 ? 97  ASN B CG    1 
ATOM   3244 O  OD1   . ASN D 2 96  ? 14.832  -12.216 -3.577  1.00 61.67 ? 97  ASN B OD1   1 
ATOM   3245 N  ND2   . ASN D 2 96  ? 14.219  -14.054 -4.710  1.00 65.71 ? 97  ASN B ND2   1 
ATOM   3246 N  N     . LYS D 2 97  ? 17.959  -11.980 -7.806  1.00 70.73 ? 98  LYS B N     1 
ATOM   3247 C  CA    . LYS D 2 97  ? 19.146  -11.981 -8.647  1.00 76.25 ? 98  LYS B CA    1 
ATOM   3248 C  C     . LYS D 2 97  ? 18.756  -11.207 -9.897  1.00 77.71 ? 98  LYS B C     1 
ATOM   3249 O  O     . LYS D 2 97  ? 17.615  -11.283 -10.347 1.00 78.17 ? 98  LYS B O     1 
ATOM   3250 C  CB    . LYS D 2 97  ? 19.560  -13.413 -9.004  1.00 81.75 ? 98  LYS B CB    1 
ATOM   3251 C  CG    . LYS D 2 97  ? 20.104  -14.177 -7.818  1.00 87.45 ? 98  LYS B CG    1 
ATOM   3252 C  CD    . LYS D 2 97  ? 20.619  -15.546 -8.204  1.00 99.00 ? 98  LYS B CD    1 
ATOM   3253 C  CE    . LYS D 2 97  ? 21.359  -16.172 -7.029  1.00 99.00 ? 98  LYS B CE    1 
ATOM   3254 N  NZ    . LYS D 2 97  ? 21.908  -17.521 -7.352  1.00 99.00 ? 98  LYS B NZ    1 
ATOM   3255 N  N     . GLU D 2 98  ? 19.708  -10.473 -10.452 1.00 79.38 ? 99  GLU B N     1 
ATOM   3256 C  CA    . GLU D 2 98  ? 19.475  -9.629  -11.618 1.00 81.46 ? 99  GLU B CA    1 
ATOM   3257 C  C     . GLU D 2 98  ? 18.848  -10.204 -12.910 1.00 81.15 ? 99  GLU B C     1 
ATOM   3258 O  O     . GLU D 2 98  ? 18.282  -9.444  -13.697 1.00 80.92 ? 99  GLU B O     1 
ATOM   3259 C  CB    . GLU D 2 98  ? 20.781  -8.922  -11.972 1.00 85.10 ? 99  GLU B CB    1 
ATOM   3260 C  CG    . GLU D 2 98  ? 20.612  -7.697  -12.853 1.00 87.85 ? 99  GLU B CG    1 
ATOM   3261 C  CD    . GLU D 2 98  ? 21.938  -7.102  -13.289 1.00 94.10 ? 99  GLU B CD    1 
ATOM   3262 O  OE1   . GLU D 2 98  ? 23.011  -7.634  -12.907 1.00 96.37 ? 99  GLU B OE1   1 
ATOM   3263 O  OE2   . GLU D 2 98  ? 21.898  -6.092  -14.022 1.00 96.76 ? 99  GLU B OE2   1 
ATOM   3264 N  N     . ASN D 2 99  ? 18.928  -11.515 -13.131 1.00 80.48 ? 100 ASN B N     1 
ATOM   3265 C  CA    . ASN D 2 99  ? 18.377  -12.074 -14.377 1.00 80.53 ? 100 ASN B CA    1 
ATOM   3266 C  C     . ASN D 2 99  ? 17.221  -13.081 -14.300 1.00 79.24 ? 100 ASN B C     1 
ATOM   3267 O  O     . ASN D 2 99  ? 17.047  -13.918 -15.196 1.00 80.28 ? 100 ASN B O     1 
ATOM   3268 C  CB    . ASN D 2 99  ? 19.512  -12.667 -15.215 1.00 85.79 ? 100 ASN B CB    1 
ATOM   3269 C  CG    . ASN D 2 99  ? 20.538  -11.627 -15.626 1.00 92.88 ? 100 ASN B CG    1 
ATOM   3270 O  OD1   . ASN D 2 99  ? 20.222  -10.665 -16.332 1.00 97.16 ? 100 ASN B OD1   1 
ATOM   3271 N  ND2   . ASN D 2 99  ? 21.779  -11.817 -15.184 1.00 94.72 ? 100 ASN B ND2   1 
ATOM   3272 N  N     . GLU D 2 100 ? 16.425  -12.995 -13.241 1.00 76.11 ? 101 GLU B N     1 
ATOM   3273 C  CA    . GLU D 2 100 ? 15.282  -13.892 -13.077 1.00 70.44 ? 101 GLU B CA    1 
ATOM   3274 C  C     . GLU D 2 100 ? 14.085  -13.316 -13.829 1.00 64.85 ? 101 GLU B C     1 
ATOM   3275 O  O     . GLU D 2 100 ? 14.100  -12.154 -14.243 1.00 63.19 ? 101 GLU B O     1 
ATOM   3276 C  CB    . GLU D 2 100 ? 14.922  -14.019 -11.593 1.00 74.66 ? 101 GLU B CB    1 
ATOM   3277 C  CG    . GLU D 2 100 ? 16.068  -14.473 -10.700 1.00 81.12 ? 101 GLU B CG    1 
ATOM   3278 C  CD    . GLU D 2 100 ? 15.749  -14.361 -9.213  1.00 86.80 ? 101 GLU B CD    1 
ATOM   3279 O  OE1   . GLU D 2 100 ? 14.865  -13.555 -8.839  1.00 87.33 ? 101 GLU B OE1   1 
ATOM   3280 O  OE2   . GLU D 2 100 ? 16.390  -15.083 -8.416  1.00 89.10 ? 101 GLU B OE2   1 
ATOM   3281 N  N     . LYS D 2 101 ? 13.052  -14.130 -14.013 1.00 59.91 ? 102 LYS B N     1 
ATOM   3282 C  CA    . LYS D 2 101 ? 11.844  -13.654 -14.681 1.00 53.66 ? 102 LYS B CA    1 
ATOM   3283 C  C     . LYS D 2 101 ? 11.073  -12.823 -13.658 1.00 46.50 ? 102 LYS B C     1 
ATOM   3284 O  O     . LYS D 2 101 ? 11.145  -13.085 -12.456 1.00 47.74 ? 102 LYS B O     1 
ATOM   3285 C  CB    . LYS D 2 101 ? 10.983  -14.829 -15.162 1.00 53.38 ? 102 LYS B CB    1 
ATOM   3286 C  CG    . LYS D 2 101 ? 11.560  -15.568 -16.359 1.00 64.63 ? 102 LYS B CG    1 
ATOM   3287 C  CD    . LYS D 2 101 ? 10.642  -16.689 -16.826 1.00 71.97 ? 102 LYS B CD    1 
ATOM   3288 C  CE    . LYS D 2 101 ? 11.161  -17.329 -18.111 1.00 75.84 ? 102 LYS B CE    1 
ATOM   3289 N  NZ    . LYS D 2 101 ? 10.283  -18.435 -18.589 1.00 75.94 ? 102 LYS B NZ    1 
ATOM   3290 N  N     . ILE D 2 102 ? 10.343  -11.823 -14.131 1.00 40.81 ? 103 ILE B N     1 
ATOM   3291 C  CA    . ILE D 2 102 ? 9.563   -10.955 -13.252 1.00 34.16 ? 103 ILE B CA    1 
ATOM   3292 C  C     . ILE D 2 102 ? 8.148   -10.869 -13.790 1.00 29.72 ? 103 ILE B C     1 
ATOM   3293 O  O     . ILE D 2 102 ? 7.882   -11.279 -14.917 1.00 25.31 ? 103 ILE B O     1 
ATOM   3294 C  CB    . ILE D 2 102 ? 10.164  -9.530  -13.203 1.00 32.66 ? 103 ILE B CB    1 
ATOM   3295 C  CG1   . ILE D 2 102 ? 10.140  -8.893  -14.598 1.00 29.25 ? 103 ILE B CG1   1 
ATOM   3296 C  CG2   . ILE D 2 102 ? 11.596  -9.594  -12.719 1.00 29.16 ? 103 ILE B CG2   1 
ATOM   3297 C  CD1   . ILE D 2 102 ? 10.812  -7.534  -14.677 1.00 32.39 ? 103 ILE B CD1   1 
ATOM   3298 N  N     . LYS D 2 103 ? 7.241   -10.347 -12.982 1.00 26.46 ? 104 LYS B N     1 
ATOM   3299 C  CA    . LYS D 2 103 ? 5.856   -10.174 -13.399 1.00 24.72 ? 104 LYS B CA    1 
ATOM   3300 C  C     . LYS D 2 103 ? 5.284   -9.036  -12.570 1.00 21.95 ? 104 LYS B C     1 
ATOM   3301 O  O     . LYS D 2 103 ? 5.788   -8.744  -11.485 1.00 23.14 ? 104 LYS B O     1 
ATOM   3302 C  CB    . LYS D 2 103 ? 5.047   -11.463 -13.203 1.00 24.33 ? 104 LYS B CB    1 
ATOM   3303 C  CG    . LYS D 2 103 ? 5.011   -11.982 -11.787 1.00 31.24 ? 104 LYS B CG    1 
ATOM   3304 C  CD    . LYS D 2 103 ? 4.279   -13.315 -11.697 1.00 42.51 ? 104 LYS B CD    1 
ATOM   3305 C  CE    . LYS D 2 103 ? 4.512   -13.963 -10.325 1.00 58.32 ? 104 LYS B CE    1 
ATOM   3306 N  NZ    . LYS D 2 103 ? 3.802   -15.265 -10.137 1.00 62.52 ? 104 LYS B NZ    1 
ATOM   3307 N  N     . PHE D 2 104 ? 4.242   -8.398  -13.087 1.00 19.24 ? 105 PHE B N     1 
ATOM   3308 C  CA    . PHE D 2 104 ? 3.590   -7.275  -12.432 1.00 17.74 ? 105 PHE B CA    1 
ATOM   3309 C  C     . PHE D 2 104 ? 2.088   -7.526  -12.349 1.00 21.08 ? 105 PHE B C     1 
ATOM   3310 O  O     . PHE D 2 104 ? 1.546   -8.374  -13.073 1.00 21.20 ? 105 PHE B O     1 
ATOM   3311 C  CB    . PHE D 2 104 ? 3.789   -5.991  -13.262 1.00 13.46 ? 105 PHE B CB    1 
ATOM   3312 C  CG    . PHE D 2 104 ? 5.221   -5.578  -13.427 1.00 18.89 ? 105 PHE B CG    1 
ATOM   3313 C  CD1   . PHE D 2 104 ? 6.000   -6.107  -14.449 1.00 18.57 ? 105 PHE B CD1   1 
ATOM   3314 C  CD2   . PHE D 2 104 ? 5.801   -4.667  -12.547 1.00 22.93 ? 105 PHE B CD2   1 
ATOM   3315 C  CE1   . PHE D 2 104 ? 7.343   -5.737  -14.596 1.00 30.64 ? 105 PHE B CE1   1 
ATOM   3316 C  CE2   . PHE D 2 104 ? 7.143   -4.290  -12.682 1.00 22.91 ? 105 PHE B CE2   1 
ATOM   3317 C  CZ    . PHE D 2 104 ? 7.916   -4.826  -13.708 1.00 29.54 ? 105 PHE B CZ    1 
ATOM   3318 N  N     . THR D 2 105 ? 1.424   -6.792  -11.460 1.00 18.63 ? 106 THR B N     1 
ATOM   3319 C  CA    . THR D 2 105 ? -0.026  -6.847  -11.344 1.00 19.63 ? 106 THR B CA    1 
ATOM   3320 C  C     . THR D 2 105 ? -0.360  -5.609  -12.173 1.00 17.96 ? 106 THR B C     1 
ATOM   3321 O  O     . THR D 2 105 ? 0.299   -4.584  -12.024 1.00 19.72 ? 106 THR B O     1 
ATOM   3322 C  CB    . THR D 2 105 ? -0.519  -6.716  -9.872  1.00 19.67 ? 106 THR B CB    1 
ATOM   3323 O  OG1   . THR D 2 105 ? 0.155   -5.637  -9.211  1.00 26.88 ? 106 THR B OG1   1 
ATOM   3324 C  CG2   . THR D 2 105 ? -0.267  -8.022  -9.117  1.00 30.83 ? 106 THR B CG2   1 
ATOM   3325 N  N     . LEU D 2 106 ? -1.362  -5.694  -13.043 1.00 16.81 ? 107 LEU B N     1 
ATOM   3326 C  CA    . LEU D 2 106 ? -1.683  -4.575  -13.932 1.00 17.13 ? 107 LEU B CA    1 
ATOM   3327 C  C     . LEU D 2 106 ? -3.023  -3.902  -13.734 1.00 15.89 ? 107 LEU B C     1 
ATOM   3328 O  O     . LEU D 2 106 ? -3.530  -3.252  -14.641 1.00 19.89 ? 107 LEU B O     1 
ATOM   3329 C  CB    . LEU D 2 106 ? -1.536  -5.016  -15.402 1.00 14.08 ? 107 LEU B CB    1 
ATOM   3330 C  CG    . LEU D 2 106 ? -0.127  -5.478  -15.795 1.00 19.16 ? 107 LEU B CG    1 
ATOM   3331 C  CD1   . LEU D 2 106 ? -0.132  -6.025  -17.206 1.00 21.68 ? 107 LEU B CD1   1 
ATOM   3332 C  CD2   . LEU D 2 106 ? 0.857   -4.321  -15.682 1.00 13.59 ? 107 LEU B CD2   1 
ATOM   3333 N  N     . GLY D 2 107 ? -3.605  -4.042  -12.554 1.00 15.85 ? 108 GLY B N     1 
ATOM   3334 C  CA    . GLY D 2 107 ? -4.889  -3.407  -12.318 1.00 10.82 ? 108 GLY B CA    1 
ATOM   3335 C  C     . GLY D 2 107 ? -6.043  -4.386  -12.395 1.00 13.29 ? 108 GLY B C     1 
ATOM   3336 O  O     . GLY D 2 107 ? -5.905  -5.502  -12.888 1.00 10.09 ? 108 GLY B O     1 
ATOM   3337 N  N     . GLY D 2 108 ? -7.196  -3.963  -11.908 1.00 15.52 ? 109 GLY B N     1 
ATOM   3338 C  CA    . GLY D 2 108 ? -8.343  -4.843  -11.906 1.00 20.47 ? 109 GLY B CA    1 
ATOM   3339 C  C     . GLY D 2 108 ? -8.910  -5.131  -13.276 1.00 19.84 ? 109 GLY B C     1 
ATOM   3340 O  O     . GLY D 2 108 ? -8.751  -4.343  -14.215 1.00 20.82 ? 109 GLY B O     1 
ATOM   3341 N  N     . TYR D 2 109 ? -9.575  -6.272  -13.396 1.00 17.55 ? 110 TYR B N     1 
ATOM   3342 C  CA    . TYR D 2 109 ? -10.200 -6.629  -14.655 1.00 14.27 ? 110 TYR B CA    1 
ATOM   3343 C  C     . TYR D 2 109 ? -11.714 -6.614  -14.527 1.00 13.58 ? 110 TYR B C     1 
ATOM   3344 O  O     . TYR D 2 109 ? -12.419 -6.979  -15.460 1.00 18.24 ? 110 TYR B O     1 
ATOM   3345 C  CB    . TYR D 2 109 ? -9.693  -7.982  -15.174 1.00 15.41 ? 110 TYR B CB    1 
ATOM   3346 C  CG    . TYR D 2 109 ? -9.888  -9.179  -14.259 1.00 19.91 ? 110 TYR B CG    1 
ATOM   3347 C  CD1   . TYR D 2 109 ? -11.147 -9.769  -14.092 1.00 19.02 ? 110 TYR B CD1   1 
ATOM   3348 C  CD2   . TYR D 2 109 ? -8.805  -9.740  -13.583 1.00 12.40 ? 110 TYR B CD2   1 
ATOM   3349 C  CE1   . TYR D 2 109 ? -11.319 -10.893 -13.272 1.00 22.38 ? 110 TYR B CE1   1 
ATOM   3350 C  CE2   . TYR D 2 109 ? -8.965  -10.862 -12.762 1.00 14.73 ? 110 TYR B CE2   1 
ATOM   3351 C  CZ    . TYR D 2 109 ? -10.218 -11.430 -12.613 1.00 19.94 ? 110 TYR B CZ    1 
ATOM   3352 O  OH    . TYR D 2 109 ? -10.365 -12.532 -11.801 1.00 20.16 ? 110 TYR B OH    1 
ATOM   3353 N  N     . THR D 2 110 ? -12.222 -6.182  -13.375 1.00 12.70 ? 111 THR B N     1 
ATOM   3354 C  CA    . THR D 2 110 ? -13.664 -6.134  -13.171 1.00 13.76 ? 111 THR B CA    1 
ATOM   3355 C  C     . THR D 2 110 ? -14.212 -4.723  -12.973 1.00 18.46 ? 111 THR B C     1 
ATOM   3356 O  O     . THR D 2 110 ? -15.422 -4.543  -12.833 1.00 23.01 ? 111 THR B O     1 
ATOM   3357 C  CB    . THR D 2 110 ? -14.100 -6.994  -11.955 1.00 26.10 ? 111 THR B CB    1 
ATOM   3358 O  OG1   . THR D 2 110 ? -13.491 -6.488  -10.765 1.00 23.86 ? 111 THR B OG1   1 
ATOM   3359 C  CG2   . THR D 2 110 ? -13.678 -8.453  -12.141 1.00 20.48 ? 111 THR B CG2   1 
ATOM   3360 N  N     . SER D 2 111 ? -13.339 -3.721  -12.959 1.00 18.76 ? 112 SER B N     1 
ATOM   3361 C  CA    . SER D 2 111 ? -13.803 -2.352  -12.766 1.00 23.80 ? 112 SER B CA    1 
ATOM   3362 C  C     . SER D 2 111 ? -14.081 -1.595  -14.082 1.00 26.84 ? 112 SER B C     1 
ATOM   3363 O  O     . SER D 2 111 ? -15.011 -1.955  -14.813 1.00 25.21 ? 112 SER B O     1 
ATOM   3364 C  CB    . SER D 2 111 ? -12.831 -1.577  -11.857 1.00 22.24 ? 112 SER B CB    1 
ATOM   3365 O  OG    . SER D 2 111 ? -11.508 -1.553  -12.373 1.00 30.71 ? 112 SER B OG    1 
ATOM   3366 N  N     . PHE D 2 112 ? -13.284 -0.569  -14.386 1.00 23.03 ? 113 PHE B N     1 
ATOM   3367 C  CA    . PHE D 2 112 ? -13.480 0.236   -15.590 1.00 26.72 ? 113 PHE B CA    1 
ATOM   3368 C  C     . PHE D 2 112 ? -13.424 -0.475  -16.946 1.00 26.92 ? 113 PHE B C     1 
ATOM   3369 O  O     . PHE D 2 112 ? -14.056 -0.002  -17.888 1.00 27.35 ? 113 PHE B O     1 
ATOM   3370 C  CB    . PHE D 2 112 ? -12.539 1.451   -15.607 1.00 18.08 ? 113 PHE B CB    1 
ATOM   3371 C  CG    . PHE D 2 112 ? -11.088 1.101   -15.503 1.00 14.34 ? 113 PHE B CG    1 
ATOM   3372 C  CD1   . PHE D 2 112 ? -10.348 0.816   -16.641 1.00 14.47 ? 113 PHE B CD1   1 
ATOM   3373 C  CD2   . PHE D 2 112 ? -10.460 1.058   -14.262 1.00 15.03 ? 113 PHE B CD2   1 
ATOM   3374 C  CE1   . PHE D 2 112 ? -8.994  0.488   -16.549 1.00 16.27 ? 113 PHE B CE1   1 
ATOM   3375 C  CE2   . PHE D 2 112 ? -9.108  0.732   -14.153 1.00 20.51 ? 113 PHE B CE2   1 
ATOM   3376 C  CZ    . PHE D 2 112 ? -8.373  0.446   -15.297 1.00 22.98 ? 113 PHE B CZ    1 
ATOM   3377 N  N     . ILE D 2 113 ? -12.694 -1.584  -17.082 1.00 28.73 ? 114 ILE B N     1 
ATOM   3378 C  CA    . ILE D 2 113 ? -12.686 -2.252  -18.393 1.00 30.20 ? 114 ILE B CA    1 
ATOM   3379 C  C     . ILE D 2 113 ? -14.024 -2.958  -18.677 1.00 29.47 ? 114 ILE B C     1 
ATOM   3380 O  O     . ILE D 2 113 ? -14.271 -3.366  -19.795 1.00 33.10 ? 114 ILE B O     1 
ATOM   3381 C  CB    . ILE D 2 113 ? -11.492 -3.257  -18.615 1.00 32.25 ? 114 ILE B CB    1 
ATOM   3382 C  CG1   . ILE D 2 113 ? -11.674 -4.520  -17.790 1.00 27.86 ? 114 ILE B CG1   1 
ATOM   3383 C  CG2   . ILE D 2 113 ? -10.147 -2.600  -18.308 1.00 26.83 ? 114 ILE B CG2   1 
ATOM   3384 C  CD1   . ILE D 2 113 ? -10.607 -5.540  -18.076 1.00 29.22 ? 114 ILE B CD1   1 
ATOM   3385 N  N     . ARG D 2 114 ? -14.881 -3.102  -17.670 1.00 27.50 ? 115 ARG B N     1 
ATOM   3386 C  CA    . ARG D 2 114 ? -16.187 -3.718  -17.872 1.00 28.60 ? 115 ARG B CA    1 
ATOM   3387 C  C     . ARG D 2 114 ? -17.274 -2.669  -17.692 1.00 35.12 ? 115 ARG B C     1 
ATOM   3388 O  O     . ARG D 2 114 ? -18.280 -2.663  -18.399 1.00 37.74 ? 115 ARG B O     1 
ATOM   3389 C  CB    . ARG D 2 114 ? -16.412 -4.851  -16.885 1.00 20.38 ? 115 ARG B CB    1 
ATOM   3390 C  CG    . ARG D 2 114 ? -15.427 -5.966  -17.044 1.00 21.11 ? 115 ARG B CG    1 
ATOM   3391 C  CD    . ARG D 2 114 ? -15.802 -7.185  -16.217 1.00 11.67 ? 115 ARG B CD    1 
ATOM   3392 N  NE    . ARG D 2 114 ? -14.731 -8.166  -16.310 1.00 11.00 ? 115 ARG B NE    1 
ATOM   3393 C  CZ    . ARG D 2 114 ? -14.891 -9.475  -16.176 1.00 18.49 ? 115 ARG B CZ    1 
ATOM   3394 N  NH1   . ARG D 2 114 ? -16.091 -9.979  -15.935 1.00 18.23 ? 115 ARG B NH1   1 
ATOM   3395 N  NH2   . ARG D 2 114 ? -13.841 -10.278 -16.286 1.00 16.40 ? 115 ARG B NH2   1 
ATOM   3396 N  N     . ASN D 2 115 ? -17.062 -1.784  -16.731 1.00 40.73 ? 116 ASN B N     1 
ATOM   3397 C  CA    . ASN D 2 115 ? -17.995 -0.710  -16.436 1.00 47.63 ? 116 ASN B CA    1 
ATOM   3398 C  C     . ASN D 2 115 ? -17.236 0.601   -16.660 1.00 49.10 ? 116 ASN B C     1 
ATOM   3399 O  O     . ASN D 2 115 ? -16.504 1.068   -15.782 1.00 52.88 ? 116 ASN B O     1 
ATOM   3400 C  CB    . ASN D 2 115 ? -18.460 -0.817  -14.987 1.00 50.84 ? 116 ASN B CB    1 
ATOM   3401 C  CG    . ASN D 2 115 ? -19.303 0.360   -14.568 1.00 66.26 ? 116 ASN B CG    1 
ATOM   3402 O  OD1   . ASN D 2 115 ? -19.650 1.216   -15.387 1.00 78.83 ? 116 ASN B OD1   1 
ATOM   3403 N  ND2   . ASN D 2 115 ? -19.641 0.418   -13.288 1.00 71.32 ? 116 ASN B ND2   1 
ATOM   3404 N  N     . ASN D 2 116 ? -17.429 1.179   -17.840 1.00 44.69 ? 117 ASN B N     1 
ATOM   3405 C  CA    . ASN D 2 116 ? -16.771 2.414   -18.299 1.00 42.43 ? 117 ASN B CA    1 
ATOM   3406 C  C     . ASN D 2 116 ? -16.376 3.535   -17.300 1.00 40.27 ? 117 ASN B C     1 
ATOM   3407 O  O     . ASN D 2 116 ? -15.473 4.334   -17.583 1.00 35.25 ? 117 ASN B O     1 
ATOM   3408 C  CB    . ASN D 2 116 ? -17.626 3.007   -19.433 1.00 42.66 ? 117 ASN B CB    1 
ATOM   3409 C  CG    . ASN D 2 116 ? -16.927 4.130   -20.196 1.00 46.91 ? 117 ASN B CG    1 
ATOM   3410 O  OD1   . ASN D 2 116 ? -15.824 3.960   -20.718 1.00 40.68 ? 117 ASN B OD1   1 
ATOM   3411 N  ND2   . ASN D 2 116 ? -17.579 5.285   -20.269 1.00 45.19 ? 117 ASN B ND2   1 
ATOM   3412 N  N     . THR D 2 117 ? -17.024 3.601   -16.144 1.00 38.75 ? 118 THR B N     1 
ATOM   3413 C  CA    . THR D 2 117 ? -16.736 4.669   -15.193 1.00 40.33 ? 118 THR B CA    1 
ATOM   3414 C  C     . THR D 2 117 ? -16.412 4.264   -13.751 1.00 39.31 ? 118 THR B C     1 
ATOM   3415 O  O     . THR D 2 117 ? -16.165 5.125   -12.902 1.00 38.15 ? 118 THR B O     1 
ATOM   3416 C  CB    . THR D 2 117 ? -17.917 5.642   -15.153 1.00 43.54 ? 118 THR B CB    1 
ATOM   3417 O  OG1   . THR D 2 117 ? -19.138 4.893   -15.130 1.00 42.95 ? 118 THR B OG1   1 
ATOM   3418 C  CG2   . THR D 2 117 ? -17.912 6.540   -16.372 1.00 45.11 ? 118 THR B CG2   1 
ATOM   3419 N  N     . LYS D 2 118 ? -16.407 2.969   -13.468 1.00 36.34 ? 119 LYS B N     1 
ATOM   3420 C  CA    . LYS D 2 118 ? -16.131 2.504   -12.117 1.00 33.88 ? 119 LYS B CA    1 
ATOM   3421 C  C     . LYS D 2 118 ? -14.647 2.610   -11.779 1.00 32.47 ? 119 LYS B C     1 
ATOM   3422 O  O     . LYS D 2 118 ? -13.792 2.059   -12.485 1.00 30.63 ? 119 LYS B O     1 
ATOM   3423 C  CB    . LYS D 2 118 ? -16.585 1.053   -11.950 1.00 34.89 ? 119 LYS B CB    1 
ATOM   3424 C  CG    . LYS D 2 118 ? -16.551 0.532   -10.523 1.00 41.85 ? 119 LYS B CG    1 
ATOM   3425 C  CD    . LYS D 2 118 ? -16.433 -0.984  -10.504 1.00 54.82 ? 119 LYS B CD    1 
ATOM   3426 C  CE    . LYS D 2 118 ? -17.565 -1.655  -11.287 1.00 61.43 ? 119 LYS B CE    1 
ATOM   3427 N  NZ    . LYS D 2 118 ? -17.447 -3.147  -11.345 1.00 49.66 ? 119 LYS B NZ    1 
ATOM   3428 N  N     . ASN D 2 119 ? -14.360 3.324   -10.695 1.00 28.34 ? 120 ASN B N     1 
ATOM   3429 C  CA    . ASN D 2 119 ? -13.006 3.507   -10.174 1.00 25.82 ? 120 ASN B CA    1 
ATOM   3430 C  C     . ASN D 2 119 ? -11.966 4.034   -11.165 1.00 23.82 ? 120 ASN B C     1 
ATOM   3431 O  O     . ASN D 2 119 ? -10.834 3.533   -11.226 1.00 18.49 ? 120 ASN B O     1 
ATOM   3432 C  CB    . ASN D 2 119 ? -12.519 2.202   -9.506  1.00 25.03 ? 120 ASN B CB    1 
ATOM   3433 C  CG    . ASN D 2 119 ? -13.219 1.928   -8.177  1.00 30.98 ? 120 ASN B CG    1 
ATOM   3434 O  OD1   . ASN D 2 119 ? -14.338 1.410   -8.136  1.00 36.20 ? 120 ASN B OD1   1 
ATOM   3435 N  ND2   . ASN D 2 119 ? -12.559 2.279   -7.083  1.00 27.49 ? 120 ASN B ND2   1 
ATOM   3436 N  N     . ILE D 2 120 ? -12.353 5.054   -11.928 1.00 22.20 ? 121 ILE B N     1 
ATOM   3437 C  CA    . ILE D 2 120 ? -11.466 5.681   -12.909 1.00 24.04 ? 121 ILE B CA    1 
ATOM   3438 C  C     . ILE D 2 120 ? -11.730 7.192   -12.866 1.00 23.66 ? 121 ILE B C     1 
ATOM   3439 O  O     . ILE D 2 120 ? -12.881 7.615   -12.728 1.00 23.79 ? 121 ILE B O     1 
ATOM   3440 C  CB    . ILE D 2 120 ? -11.689 5.089   -14.347 1.00 19.19 ? 121 ILE B CB    1 
ATOM   3441 C  CG1   . ILE D 2 120 ? -10.624 5.622   -15.312 1.00 13.95 ? 121 ILE B CG1   1 
ATOM   3442 C  CG2   . ILE D 2 120 ? -13.106 5.380   -14.838 1.00 14.92 ? 121 ILE B CG2   1 
ATOM   3443 C  CD1   . ILE D 2 120 ? -10.463 4.770   -16.571 1.00 17.91 ? 121 ILE B CD1   1 
ATOM   3444 N  N     . VAL D 2 121 ? -10.664 7.990   -12.964 1.00 23.40 ? 122 VAL B N     1 
ATOM   3445 C  CA    . VAL D 2 121 ? -10.769 9.454   -12.894 1.00 25.76 ? 122 VAL B CA    1 
ATOM   3446 C  C     . VAL D 2 121 ? -11.714 10.028  -13.955 1.00 27.52 ? 122 VAL B C     1 
ATOM   3447 O  O     . VAL D 2 121 ? -12.588 10.834  -13.633 1.00 26.88 ? 122 VAL B O     1 
ATOM   3448 C  CB    . VAL D 2 121 ? -9.378  10.123  -13.009 1.00 29.02 ? 122 VAL B CB    1 
ATOM   3449 C  CG1   . VAL D 2 121 ? -9.489  11.622  -12.767 1.00 24.15 ? 122 VAL B CG1   1 
ATOM   3450 C  CG2   . VAL D 2 121 ? -8.427  9.512   -12.003 1.00 26.60 ? 122 VAL B CG2   1 
ATOM   3451 N  N     . TYR D 2 122 ? -11.524 9.613   -15.209 1.00 28.14 ? 123 TYR B N     1 
ATOM   3452 C  CA    . TYR D 2 122 ? -12.378 10.021  -16.339 1.00 26.30 ? 123 TYR B CA    1 
ATOM   3453 C  C     . TYR D 2 122 ? -12.871 8.728   -16.997 1.00 25.30 ? 123 TYR B C     1 
ATOM   3454 O  O     . TYR D 2 122 ? -12.230 7.684   -16.865 1.00 25.04 ? 123 TYR B O     1 
ATOM   3455 C  CB    . TYR D 2 122 ? -11.577 10.825  -17.375 1.00 22.05 ? 123 TYR B CB    1 
ATOM   3456 C  CG    . TYR D 2 122 ? -11.211 12.217  -16.925 1.00 29.47 ? 123 TYR B CG    1 
ATOM   3457 C  CD1   . TYR D 2 122 ? -12.155 13.240  -16.953 1.00 32.37 ? 123 TYR B CD1   1 
ATOM   3458 C  CD2   . TYR D 2 122 ? -9.924  12.511  -16.461 1.00 30.89 ? 123 TYR B CD2   1 
ATOM   3459 C  CE1   . TYR D 2 122 ? -11.837 14.518  -16.531 1.00 33.55 ? 123 TYR B CE1   1 
ATOM   3460 C  CE2   . TYR D 2 122 ? -9.593  13.791  -16.034 1.00 27.30 ? 123 TYR B CE2   1 
ATOM   3461 C  CZ    . TYR D 2 122 ? -10.562 14.789  -16.072 1.00 37.54 ? 123 TYR B CZ    1 
ATOM   3462 O  OH    . TYR D 2 122 ? -10.273 16.059  -15.639 1.00 41.16 ? 123 TYR B OH    1 
ATOM   3463 N  N     . PRO D 2 123 ? -14.011 8.771   -17.708 1.00 25.08 ? 124 PRO B N     1 
ATOM   3464 C  CA    . PRO D 2 123 ? -14.532 7.565   -18.369 1.00 24.90 ? 124 PRO B CA    1 
ATOM   3465 C  C     . PRO D 2 123 ? -13.479 6.888   -19.260 1.00 24.45 ? 124 PRO B C     1 
ATOM   3466 O  O     . PRO D 2 123 ? -12.771 7.555   -20.022 1.00 25.90 ? 124 PRO B O     1 
ATOM   3467 C  CB    . PRO D 2 123 ? -15.709 8.107   -19.172 1.00 29.14 ? 124 PRO B CB    1 
ATOM   3468 C  CG    . PRO D 2 123 ? -16.206 9.236   -18.290 1.00 25.82 ? 124 PRO B CG    1 
ATOM   3469 C  CD    . PRO D 2 123 ? -14.904 9.919   -17.935 1.00 22.57 ? 124 PRO B CD    1 
ATOM   3470 N  N     . PHE D 2 124 ? -13.382 5.567   -19.157 1.00 21.82 ? 125 PHE B N     1 
ATOM   3471 C  CA    . PHE D 2 124 ? -12.411 4.776   -19.916 1.00 22.00 ? 125 PHE B CA    1 
ATOM   3472 C  C     . PHE D 2 124 ? -12.307 5.136   -21.404 1.00 21.32 ? 125 PHE B C     1 
ATOM   3473 O  O     . PHE D 2 124 ? -11.208 5.167   -21.969 1.00 17.33 ? 125 PHE B O     1 
ATOM   3474 C  CB    . PHE D 2 124 ? -12.746 3.284   -19.775 1.00 22.67 ? 125 PHE B CB    1 
ATOM   3475 C  CG    . PHE D 2 124 ? -11.685 2.355   -20.317 1.00 18.82 ? 125 PHE B CG    1 
ATOM   3476 C  CD1   . PHE D 2 124 ? -10.474 2.191   -19.647 1.00 15.40 ? 125 PHE B CD1   1 
ATOM   3477 C  CD2   . PHE D 2 124 ? -11.908 1.627   -21.486 1.00 25.55 ? 125 PHE B CD2   1 
ATOM   3478 C  CE1   . PHE D 2 124 ? -9.500  1.315   -20.129 1.00 26.52 ? 125 PHE B CE1   1 
ATOM   3479 C  CE2   . PHE D 2 124 ? -10.934 0.741   -21.984 1.00 19.13 ? 125 PHE B CE2   1 
ATOM   3480 C  CZ    . PHE D 2 124 ? -9.731  0.585   -21.304 1.00 26.33 ? 125 PHE B CZ    1 
ATOM   3481 N  N     . ASP D 2 125 ? -13.444 5.405   -22.038 1.00 23.61 ? 126 ASP B N     1 
ATOM   3482 C  CA    . ASP D 2 125 ? -13.438 5.734   -23.460 1.00 29.77 ? 126 ASP B CA    1 
ATOM   3483 C  C     . ASP D 2 125 ? -12.732 7.052   -23.824 1.00 30.68 ? 126 ASP B C     1 
ATOM   3484 O  O     . ASP D 2 125 ? -12.449 7.286   -24.994 1.00 36.37 ? 126 ASP B O     1 
ATOM   3485 C  CB    . ASP D 2 125 ? -14.862 5.695   -24.036 1.00 26.48 ? 126 ASP B CB    1 
ATOM   3486 C  CG    . ASP D 2 125 ? -15.808 6.637   -23.329 1.00 35.69 ? 126 ASP B CG    1 
ATOM   3487 O  OD1   . ASP D 2 125 ? -15.464 7.821   -23.159 1.00 49.78 ? 126 ASP B OD1   1 
ATOM   3488 O  OD2   . ASP D 2 125 ? -16.907 6.197   -22.940 1.00 48.18 ? 126 ASP B OD2   1 
ATOM   3489 N  N     . GLN D 2 126 ? -12.446 7.904   -22.839 1.00 27.89 ? 127 GLN B N     1 
ATOM   3490 C  CA    . GLN D 2 126 ? -11.749 9.160   -23.116 1.00 26.26 ? 127 GLN B CA    1 
ATOM   3491 C  C     . GLN D 2 126 ? -10.237 8.998   -23.181 1.00 25.76 ? 127 GLN B C     1 
ATOM   3492 O  O     . GLN D 2 126 ? -9.527  9.938   -23.551 1.00 29.59 ? 127 GLN B O     1 
ATOM   3493 C  CB    . GLN D 2 126 ? -12.098 10.217  -22.084 1.00 25.02 ? 127 GLN B CB    1 
ATOM   3494 C  CG    . GLN D 2 126 ? -13.527 10.673  -22.178 1.00 24.30 ? 127 GLN B CG    1 
ATOM   3495 C  CD    . GLN D 2 126 ? -13.872 11.693  -21.126 1.00 32.46 ? 127 GLN B CD    1 
ATOM   3496 O  OE1   . GLN D 2 126 ? -12.993 12.234  -20.459 1.00 32.33 ? 127 GLN B OE1   1 
ATOM   3497 N  NE2   . GLN D 2 126 ? -15.162 11.963  -20.965 1.00 31.11 ? 127 GLN B NE2   1 
ATOM   3498 N  N     . TYR D 2 127 ? -9.744  7.813   -22.819 1.00 23.60 ? 128 TYR B N     1 
ATOM   3499 C  CA    . TYR D 2 127 ? -8.310  7.523   -22.861 1.00 24.95 ? 128 TYR B CA    1 
ATOM   3500 C  C     . TYR D 2 127 ? -7.969  6.824   -24.184 1.00 28.23 ? 128 TYR B C     1 
ATOM   3501 O  O     . TYR D 2 127 ? -8.734  5.984   -24.659 1.00 29.31 ? 128 TYR B O     1 
ATOM   3502 C  CB    . TYR D 2 127 ? -7.891  6.635   -21.671 1.00 22.53 ? 128 TYR B CB    1 
ATOM   3503 C  CG    . TYR D 2 127 ? -7.974  7.314   -20.312 1.00 17.84 ? 128 TYR B CG    1 
ATOM   3504 C  CD1   . TYR D 2 127 ? -9.173  7.349   -19.596 1.00 15.79 ? 128 TYR B CD1   1 
ATOM   3505 C  CD2   . TYR D 2 127 ? -6.857  7.936   -19.755 1.00 17.78 ? 128 TYR B CD2   1 
ATOM   3506 C  CE1   . TYR D 2 127 ? -9.261  7.987   -18.363 1.00 17.22 ? 128 TYR B CE1   1 
ATOM   3507 C  CE2   . TYR D 2 127 ? -6.931  8.583   -18.515 1.00 18.99 ? 128 TYR B CE2   1 
ATOM   3508 C  CZ    . TYR D 2 127 ? -8.133  8.605   -17.825 1.00 22.46 ? 128 TYR B CZ    1 
ATOM   3509 O  OH    . TYR D 2 127 ? -8.212  9.245   -16.606 1.00 24.77 ? 128 TYR B OH    1 
ATOM   3510 N  N     . ILE D 2 128 ? -6.830  7.171   -24.776 1.00 26.67 ? 129 ILE B N     1 
ATOM   3511 C  CA    . ILE D 2 128 ? -6.416  6.562   -26.037 1.00 27.03 ? 129 ILE B CA    1 
ATOM   3512 C  C     . ILE D 2 128 ? -5.127  5.768   -25.874 1.00 23.67 ? 129 ILE B C     1 
ATOM   3513 O  O     . ILE D 2 128 ? -4.676  5.098   -26.809 1.00 24.20 ? 129 ILE B O     1 
ATOM   3514 C  CB    . ILE D 2 128 ? -6.217  7.616   -27.154 1.00 29.14 ? 129 ILE B CB    1 
ATOM   3515 C  CG1   . ILE D 2 128 ? -5.119  8.608   -26.756 1.00 32.80 ? 129 ILE B CG1   1 
ATOM   3516 C  CG2   . ILE D 2 128 ? -7.527  8.347   -27.408 1.00 36.44 ? 129 ILE B CG2   1 
ATOM   3517 C  CD1   . ILE D 2 128 ? -4.454  9.285   -27.924 1.00 40.01 ? 129 ILE B CD1   1 
ATOM   3518 N  N     . ALA D 2 129 ? -4.532  5.853   -24.688 1.00 18.55 ? 130 ALA B N     1 
ATOM   3519 C  CA    . ALA D 2 129 ? -3.310  5.124   -24.389 1.00 18.08 ? 130 ALA B CA    1 
ATOM   3520 C  C     . ALA D 2 129 ? -3.208  4.850   -22.892 1.00 17.82 ? 130 ALA B C     1 
ATOM   3521 O  O     . ALA D 2 129 ? -3.659  5.647   -22.061 1.00 18.58 ? 130 ALA B O     1 
ATOM   3522 C  CB    . ALA D 2 129 ? -2.092  5.894   -24.874 1.00 24.76 ? 130 ALA B CB    1 
ATOM   3523 N  N     . HIS D 2 130 ? -2.621  3.711   -22.558 1.00 16.78 ? 131 HIS B N     1 
ATOM   3524 C  CA    . HIS D 2 130 ? -2.452  3.301   -21.178 1.00 15.25 ? 131 HIS B CA    1 
ATOM   3525 C  C     . HIS D 2 130 ? -1.023  2.822   -21.079 1.00 16.09 ? 131 HIS B C     1 
ATOM   3526 O  O     . HIS D 2 130 ? -0.689  1.743   -21.559 1.00 17.16 ? 131 HIS B O     1 
ATOM   3527 C  CB    . HIS D 2 130 ? -3.442  2.170   -20.811 1.00 9.53  ? 131 HIS B CB    1 
ATOM   3528 C  CG    . HIS D 2 130 ? -4.884  2.575   -20.922 1.00 14.32 ? 131 HIS B CG    1 
ATOM   3529 N  ND1   . HIS D 2 130 ? -5.597  3.104   -19.866 1.00 19.93 ? 131 HIS B ND1   1 
ATOM   3530 C  CD2   . HIS D 2 130 ? -5.734  2.568   -21.977 1.00 15.65 ? 131 HIS B CD2   1 
ATOM   3531 C  CE1   . HIS D 2 130 ? -6.819  3.407   -20.264 1.00 21.09 ? 131 HIS B CE1   1 
ATOM   3532 N  NE2   . HIS D 2 130 ? -6.928  3.091   -21.542 1.00 18.70 ? 131 HIS B NE2   1 
ATOM   3533 N  N     . TRP D 2 131 ? -0.171  3.640   -20.474 1.00 16.91 ? 132 TRP B N     1 
ATOM   3534 C  CA    . TRP D 2 131 ? 1.219   3.276   -20.326 1.00 17.25 ? 132 TRP B CA    1 
ATOM   3535 C  C     . TRP D 2 131 ? 1.462   2.798   -18.918 1.00 18.11 ? 132 TRP B C     1 
ATOM   3536 O  O     . TRP D 2 131 ? 0.766   3.196   -17.977 1.00 20.26 ? 132 TRP B O     1 
ATOM   3537 C  CB    . TRP D 2 131 ? 2.128   4.465   -20.604 1.00 17.61 ? 132 TRP B CB    1 
ATOM   3538 C  CG    . TRP D 2 131 ? 1.985   5.058   -21.969 1.00 28.20 ? 132 TRP B CG    1 
ATOM   3539 C  CD1   . TRP D 2 131 ? 1.473   4.457   -23.088 1.00 26.80 ? 132 TRP B CD1   1 
ATOM   3540 C  CD2   . TRP D 2 131 ? 2.366   6.381   -22.361 1.00 30.80 ? 132 TRP B CD2   1 
ATOM   3541 N  NE1   . TRP D 2 131 ? 1.513   5.328   -24.153 1.00 24.16 ? 132 TRP B NE1   1 
ATOM   3542 C  CE2   . TRP D 2 131 ? 2.057   6.516   -23.736 1.00 30.44 ? 132 TRP B CE2   1 
ATOM   3543 C  CE3   . TRP D 2 131 ? 2.941   7.470   -21.683 1.00 27.92 ? 132 TRP B CE3   1 
ATOM   3544 C  CZ2   . TRP D 2 131 ? 2.305   7.695   -24.447 1.00 34.88 ? 132 TRP B CZ2   1 
ATOM   3545 C  CZ3   . TRP D 2 131 ? 3.188   8.642   -22.389 1.00 26.07 ? 132 TRP B CZ3   1 
ATOM   3546 C  CH2   . TRP D 2 131 ? 2.870   8.744   -23.758 1.00 34.18 ? 132 TRP B CH2   1 
ATOM   3547 N  N     . ILE D 2 132 ? 2.464   1.946   -18.793 1.00 15.32 ? 133 ILE B N     1 
ATOM   3548 C  CA    . ILE D 2 132 ? 2.869   1.387   -17.528 1.00 19.03 ? 133 ILE B CA    1 
ATOM   3549 C  C     . ILE D 2 132 ? 4.338   1.745   -17.395 1.00 19.67 ? 133 ILE B C     1 
ATOM   3550 O  O     . ILE D 2 132 ? 5.127   1.510   -18.318 1.00 13.67 ? 133 ILE B O     1 
ATOM   3551 C  CB    . ILE D 2 132 ? 2.764   -0.182  -17.521 1.00 24.57 ? 133 ILE B CB    1 
ATOM   3552 C  CG1   . ILE D 2 132 ? 1.307   -0.653  -17.566 1.00 13.22 ? 133 ILE B CG1   1 
ATOM   3553 C  CG2   . ILE D 2 132 ? 3.467   -0.750  -16.310 1.00 18.82 ? 133 ILE B CG2   1 
ATOM   3554 C  CD1   . ILE D 2 132 ? 0.496   -0.287  -16.366 1.00 29.22 ? 133 ILE B CD1   1 
ATOM   3555 N  N     . ILE D 2 133 ? 4.706   2.337   -16.265 1.00 21.12 ? 134 ILE B N     1 
ATOM   3556 C  CA    . ILE D 2 133 ? 6.111   2.630   -16.007 1.00 20.12 ? 134 ILE B CA    1 
ATOM   3557 C  C     . ILE D 2 133 ? 6.387   1.589   -14.942 1.00 21.19 ? 134 ILE B C     1 
ATOM   3558 O  O     . ILE D 2 133 ? 5.779   1.620   -13.868 1.00 19.85 ? 134 ILE B O     1 
ATOM   3559 C  CB    . ILE D 2 133 ? 6.348   4.056   -15.455 1.00 20.67 ? 134 ILE B CB    1 
ATOM   3560 C  CG1   . ILE D 2 133 ? 6.031   5.086   -16.538 1.00 21.26 ? 134 ILE B CG1   1 
ATOM   3561 C  CG2   . ILE D 2 133 ? 7.811   4.218   -15.046 1.00 18.85 ? 134 ILE B CG2   1 
ATOM   3562 C  CD1   . ILE D 2 133 ? 5.971   6.494   -16.033 1.00 24.97 ? 134 ILE B CD1   1 
ATOM   3563 N  N     . GLY D 2 134 ? 7.276   0.654   -15.247 1.00 21.10 ? 135 GLY B N     1 
ATOM   3564 C  CA    . GLY D 2 134 ? 7.580   -0.395  -14.302 1.00 21.53 ? 135 GLY B CA    1 
ATOM   3565 C  C     . GLY D 2 134 ? 8.991   -0.286  -13.779 1.00 24.77 ? 135 GLY B C     1 
ATOM   3566 O  O     . GLY D 2 134 ? 9.922   -0.023  -14.537 1.00 25.41 ? 135 GLY B O     1 
ATOM   3567 N  N     . TYR D 2 135 ? 9.151   -0.483  -12.478 1.00 22.44 ? 136 TYR B N     1 
ATOM   3568 C  CA    . TYR D 2 135 ? 10.458  -0.427  -11.859 1.00 18.84 ? 136 TYR B CA    1 
ATOM   3569 C  C     . TYR D 2 135 ? 10.738  -1.811  -11.330 1.00 18.72 ? 136 TYR B C     1 
ATOM   3570 O  O     . TYR D 2 135 ? 9.859   -2.444  -10.747 1.00 22.21 ? 136 TYR B O     1 
ATOM   3571 C  CB    . TYR D 2 135 ? 10.462  0.553   -10.692 1.00 14.32 ? 136 TYR B CB    1 
ATOM   3572 C  CG    . TYR D 2 135 ? 10.452  1.999   -11.081 1.00 13.51 ? 136 TYR B CG    1 
ATOM   3573 C  CD1   . TYR D 2 135 ? 9.252   2.688   -11.278 1.00 12.45 ? 136 TYR B CD1   1 
ATOM   3574 C  CD2   . TYR D 2 135 ? 11.647  2.693   -11.231 1.00 13.13 ? 136 TYR B CD2   1 
ATOM   3575 C  CE1   . TYR D 2 135 ? 9.252   4.034   -11.614 1.00 13.87 ? 136 TYR B CE1   1 
ATOM   3576 C  CE2   . TYR D 2 135 ? 11.662  4.032   -11.565 1.00 15.89 ? 136 TYR B CE2   1 
ATOM   3577 C  CZ    . TYR D 2 135 ? 10.470  4.700   -11.757 1.00 23.45 ? 136 TYR B CZ    1 
ATOM   3578 O  OH    . TYR D 2 135 ? 10.520  6.029   -12.103 1.00 20.58 ? 136 TYR B OH    1 
ATOM   3579 N  N     . VAL D 2 136 ? 11.962  -2.274  -11.535 1.00 18.07 ? 137 VAL B N     1 
ATOM   3580 C  CA    . VAL D 2 136 ? 12.388  -3.584  -11.079 1.00 21.83 ? 137 VAL B CA    1 
ATOM   3581 C  C     . VAL D 2 136 ? 13.624  -3.309  -10.255 1.00 22.55 ? 137 VAL B C     1 
ATOM   3582 O  O     . VAL D 2 136 ? 14.545  -2.660  -10.736 1.00 25.37 ? 137 VAL B O     1 
ATOM   3583 C  CB    . VAL D 2 136 ? 12.807  -4.503  -12.251 1.00 20.31 ? 137 VAL B CB    1 
ATOM   3584 C  CG1   . VAL D 2 136 ? 12.972  -5.939  -11.747 1.00 22.19 ? 137 VAL B CG1   1 
ATOM   3585 C  CG2   . VAL D 2 136 ? 11.786  -4.422  -13.389 1.00 27.05 ? 137 VAL B CG2   1 
ATOM   3586 N  N     . TYR D 2 137 ? 13.650  -3.790  -9.023  1.00 24.43 ? 138 TYR B N     1 
ATOM   3587 C  CA    . TYR D 2 137 ? 14.806  -3.577  -8.165  1.00 27.62 ? 138 TYR B CA    1 
ATOM   3588 C  C     . TYR D 2 137 ? 15.244  -4.908  -7.584  1.00 27.01 ? 138 TYR B C     1 
ATOM   3589 O  O     . TYR D 2 137 ? 14.429  -5.810  -7.392  1.00 27.43 ? 138 TYR B O     1 
ATOM   3590 C  CB    . TYR D 2 137 ? 14.478  -2.585  -7.038  1.00 20.37 ? 138 TYR B CB    1 
ATOM   3591 C  CG    . TYR D 2 137 ? 13.331  -3.024  -6.162  1.00 25.74 ? 138 TYR B CG    1 
ATOM   3592 C  CD1   . TYR D 2 137 ? 12.015  -2.695  -6.489  1.00 26.91 ? 138 TYR B CD1   1 
ATOM   3593 C  CD2   . TYR D 2 137 ? 13.554  -3.775  -5.007  1.00 25.61 ? 138 TYR B CD2   1 
ATOM   3594 C  CE1   . TYR D 2 137 ? 10.944  -3.105  -5.685  1.00 30.29 ? 138 TYR B CE1   1 
ATOM   3595 C  CE2   . TYR D 2 137 ? 12.486  -4.190  -4.196  1.00 29.36 ? 138 TYR B CE2   1 
ATOM   3596 C  CZ    . TYR D 2 137 ? 11.188  -3.850  -4.543  1.00 25.91 ? 138 TYR B CZ    1 
ATOM   3597 O  OH    . TYR D 2 137 ? 10.135  -4.246  -3.747  1.00 38.35 ? 138 TYR B OH    1 
ATOM   3598 N  N     . THR D 2 138 ? 16.537  -5.023  -7.319  1.00 30.36 ? 139 THR B N     1 
ATOM   3599 C  CA    . THR D 2 138 ? 17.115  -6.228  -6.735  1.00 34.91 ? 139 THR B CA    1 
ATOM   3600 C  C     . THR D 2 138 ? 17.222  -5.986  -5.230  1.00 35.51 ? 139 THR B C     1 
ATOM   3601 O  O     . THR D 2 138 ? 17.873  -5.036  -4.814  1.00 35.88 ? 139 THR B O     1 
ATOM   3602 C  CB    . THR D 2 138 ? 18.535  -6.470  -7.300  1.00 37.08 ? 139 THR B CB    1 
ATOM   3603 O  OG1   . THR D 2 138 ? 18.480  -6.540  -8.734  1.00 44.65 ? 139 THR B OG1   1 
ATOM   3604 C  CG2   . THR D 2 138 ? 19.117  -7.748  -6.746  1.00 38.73 ? 139 THR B CG2   1 
ATOM   3605 N  N     . ARG D 2 139 ? 16.589  -6.815  -4.412  1.00 38.66 ? 140 ARG B N     1 
ATOM   3606 C  CA    . ARG D 2 139 ? 16.688  -6.626  -2.969  1.00 45.98 ? 140 ARG B CA    1 
ATOM   3607 C  C     . ARG D 2 139 ? 18.130  -6.855  -2.520  1.00 51.59 ? 140 ARG B C     1 
ATOM   3608 O  O     . ARG D 2 139 ? 18.951  -7.377  -3.277  1.00 52.80 ? 140 ARG B O     1 
ATOM   3609 C  CB    . ARG D 2 139 ? 15.805  -7.613  -2.222  1.00 50.37 ? 140 ARG B CB    1 
ATOM   3610 C  CG    . ARG D 2 139 ? 14.346  -7.277  -2.171  1.00 61.74 ? 140 ARG B CG    1 
ATOM   3611 C  CD    . ARG D 2 139 ? 13.733  -8.040  -1.021  1.00 71.97 ? 140 ARG B CD    1 
ATOM   3612 N  NE    . ARG D 2 139 ? 12.284  -8.128  -1.110  1.00 84.30 ? 140 ARG B NE    1 
ATOM   3613 C  CZ    . ARG D 2 139 ? 11.594  -9.245  -0.897  1.00 92.67 ? 140 ARG B CZ    1 
ATOM   3614 N  NH1   . ARG D 2 139 ? 12.221  -10.373 -0.584  1.00 95.63 ? 140 ARG B NH1   1 
ATOM   3615 N  NH2   . ARG D 2 139 ? 10.271  -9.237  -0.997  1.00 98.14 ? 140 ARG B NH2   1 
ATOM   3616 N  N     . VAL D 2 140 ? 18.439  -6.461  -1.290  1.00 56.23 ? 141 VAL B N     1 
ATOM   3617 C  CA    . VAL D 2 140 ? 19.777  -6.659  -0.737  1.00 59.22 ? 141 VAL B CA    1 
ATOM   3618 C  C     . VAL D 2 140 ? 19.726  -7.963  0.073   1.00 60.44 ? 141 VAL B C     1 
ATOM   3619 O  O     . VAL D 2 140 ? 18.654  -8.376  0.516   1.00 59.34 ? 141 VAL B O     1 
ATOM   3620 C  CB    . VAL D 2 140 ? 20.196  -5.464  0.176   1.00 59.96 ? 141 VAL B CB    1 
ATOM   3621 C  CG1   . VAL D 2 140 ? 21.579  -5.698  0.774   1.00 70.25 ? 141 VAL B CG1   1 
ATOM   3622 C  CG2   . VAL D 2 140 ? 20.216  -4.189  -0.635  1.00 59.34 ? 141 VAL B CG2   1 
ATOM   3623 N  N     . ALA D 2 141 ? 20.875  -8.610  0.257   1.00 63.82 ? 142 ALA B N     1 
ATOM   3624 C  CA    . ALA D 2 141 ? 20.944  -9.866  1.011   1.00 68.05 ? 142 ALA B CA    1 
ATOM   3625 C  C     . ALA D 2 141 ? 20.518  -9.742  2.488   1.00 70.09 ? 142 ALA B C     1 
ATOM   3626 O  O     . ALA D 2 141 ? 19.857  -10.636 3.034   1.00 69.70 ? 142 ALA B O     1 
ATOM   3627 C  CB    . ALA D 2 141 ? 22.358  -10.449 0.914   1.00 68.60 ? 142 ALA B CB    1 
ATOM   3628 N  N     . THR D 2 142 ? 20.901  -8.632  3.119   1.00 71.98 ? 143 THR B N     1 
ATOM   3629 C  CA    . THR D 2 142 ? 20.588  -8.378  4.530   1.00 72.73 ? 143 THR B CA    1 
ATOM   3630 C  C     . THR D 2 142 ? 19.101  -8.083  4.789   1.00 72.73 ? 143 THR B C     1 
ATOM   3631 O  O     . THR D 2 142 ? 18.506  -7.200  4.163   1.00 71.66 ? 143 THR B O     1 
ATOM   3632 C  CB    . THR D 2 142 ? 21.481  -7.224  5.099   1.00 74.88 ? 143 THR B CB    1 
ATOM   3633 O  OG1   . THR D 2 142 ? 21.226  -7.056  6.501   1.00 71.88 ? 143 THR B OG1   1 
ATOM   3634 C  CG2   . THR D 2 142 ? 21.234  -5.900  4.358   1.00 63.93 ? 143 THR B CG2   1 
ATOM   3635 N  N     . ARG D 2 143 ? 18.516  -8.840  5.722   1.00 74.02 ? 144 ARG B N     1 
ATOM   3636 C  CA    . ARG D 2 143 ? 17.105  -8.701  6.102   1.00 77.43 ? 144 ARG B CA    1 
ATOM   3637 C  C     . ARG D 2 143 ? 16.893  -7.664  7.233   1.00 78.00 ? 144 ARG B C     1 
ATOM   3638 O  O     . ARG D 2 143 ? 15.760  -7.408  7.655   1.00 77.06 ? 144 ARG B O     1 
ATOM   3639 C  CB    . ARG D 2 143 ? 16.544  -10.062 6.559   1.00 79.12 ? 144 ARG B CB    1 
ATOM   3640 C  CG    . ARG D 2 143 ? 16.249  -11.068 5.445   1.00 83.73 ? 144 ARG B CG    1 
ATOM   3641 C  CD    . ARG D 2 143 ? 15.696  -12.373 6.022   1.00 86.99 ? 144 ARG B CD    1 
ATOM   3642 N  NE    . ARG D 2 143 ? 16.685  -13.093 6.832   1.00 92.27 ? 144 ARG B NE    1 
ATOM   3643 C  CZ    . ARG D 2 143 ? 16.478  -14.282 7.405   1.00 93.91 ? 144 ARG B CZ    1 
ATOM   3644 N  NH1   . ARG D 2 143 ? 15.303  -14.894 7.275   1.00 93.66 ? 144 ARG B NH1   1 
ATOM   3645 N  NH2   . ARG D 2 143 ? 17.444  -14.867 8.116   1.00 90.54 ? 144 ARG B NH2   1 
ATOM   3646 N  N     . LYS D 2 144 ? 17.980  -7.077  7.718   1.00 77.43 ? 145 LYS B N     1 
ATOM   3647 C  CA    . LYS D 2 144 ? 17.905  -6.101  8.805   1.00 76.75 ? 145 LYS B CA    1 
ATOM   3648 C  C     . LYS D 2 144 ? 18.322  -4.685  8.407   1.00 76.36 ? 145 LYS B C     1 
ATOM   3649 O  O     . LYS D 2 144 ? 19.500  -4.406  8.186   1.00 75.32 ? 145 LYS B O     1 
ATOM   3650 C  CB    . LYS D 2 144 ? 18.753  -6.588  9.983   1.00 76.07 ? 145 LYS B CB    1 
ATOM   3651 C  CG    . LYS D 2 144 ? 18.311  -7.934  10.546  1.00 70.53 ? 145 LYS B CG    1 
ATOM   3652 C  CD    . LYS D 2 144 ? 19.493  -8.694  11.115  1.00 73.55 ? 145 LYS B CD    1 
ATOM   3653 C  CE    . LYS D 2 144 ? 19.104  -10.119 11.464  1.00 72.82 ? 145 LYS B CE    1 
ATOM   3654 N  NZ    . LYS D 2 144 ? 20.292  -10.893 11.914  1.00 76.28 ? 145 LYS B NZ    1 
ATOM   3655 N  N     . SER D 2 145 ? 17.336  -3.796  8.334   1.00 76.09 ? 146 SER B N     1 
ATOM   3656 C  CA    . SER D 2 145 ? 17.551  -2.403  7.963   1.00 74.91 ? 146 SER B CA    1 
ATOM   3657 C  C     . SER D 2 145 ? 18.104  -1.611  9.153   1.00 70.90 ? 146 SER B C     1 
ATOM   3658 O  O     . SER D 2 145 ? 18.084  -2.098  10.289  1.00 70.96 ? 146 SER B O     1 
ATOM   3659 C  CB    . SER D 2 145 ? 16.224  -1.796  7.484   1.00 79.39 ? 146 SER B CB    1 
ATOM   3660 O  OG    . SER D 2 145 ? 15.662  -2.577  6.431   1.00 79.13 ? 146 SER B OG    1 
ATOM   3661 N  N     . SER D 2 146 ? 18.597  -0.401  8.887   1.00 66.92 ? 147 SER B N     1 
ATOM   3662 C  CA    . SER D 2 146 ? 19.155  0.464   9.927   1.00 62.21 ? 147 SER B CA    1 
ATOM   3663 C  C     . SER D 2 146 ? 18.005  1.077   10.743  1.00 59.03 ? 147 SER B C     1 
ATOM   3664 O  O     . SER D 2 146 ? 16.970  1.448   10.173  1.00 56.97 ? 147 SER B O     1 
ATOM   3665 C  CB    . SER D 2 146 ? 20.003  1.567   9.287   1.00 60.24 ? 147 SER B CB    1 
ATOM   3666 O  OG    . SER D 2 146 ? 20.622  2.377   10.265  1.00 53.77 ? 147 SER B OG    1 
ATOM   3667 N  N     . LEU D 2 147 ? 18.182  1.178   12.063  1.00 54.25 ? 148 LEU B N     1 
ATOM   3668 C  CA    . LEU D 2 147 ? 17.139  1.738   12.928  1.00 50.61 ? 148 LEU B CA    1 
ATOM   3669 C  C     . LEU D 2 147 ? 17.531  3.005   13.695  1.00 48.03 ? 148 LEU B C     1 
ATOM   3670 O  O     . LEU D 2 147 ? 17.115  3.211   14.842  1.00 49.67 ? 148 LEU B O     1 
ATOM   3671 C  CB    . LEU D 2 147 ? 16.620  0.676   13.908  1.00 47.54 ? 148 LEU B CB    1 
ATOM   3672 C  CG    . LEU D 2 147 ? 15.693  -0.404  13.344  1.00 45.55 ? 148 LEU B CG    1 
ATOM   3673 C  CD1   . LEU D 2 147 ? 16.393  -1.752  13.385  1.00 43.64 ? 148 LEU B CD1   1 
ATOM   3674 C  CD2   . LEU D 2 147 ? 14.405  -0.447  14.152  1.00 42.92 ? 148 LEU B CD2   1 
ATOM   3675 N  N     . LYS D 2 148 ? 18.329  3.852   13.058  1.00 45.48 ? 149 LYS B N     1 
ATOM   3676 C  CA    . LYS D 2 148 ? 18.760  5.110   13.660  1.00 44.39 ? 149 LYS B CA    1 
ATOM   3677 C  C     . LYS D 2 148 ? 18.630  6.191   12.593  1.00 42.94 ? 149 LYS B C     1 
ATOM   3678 O  O     . LYS D 2 148 ? 18.454  5.888   11.410  1.00 40.40 ? 149 LYS B O     1 
ATOM   3679 C  CB    . LYS D 2 148 ? 20.213  5.031   14.138  1.00 47.08 ? 149 LYS B CB    1 
ATOM   3680 C  CG    . LYS D 2 148 ? 21.226  4.967   13.012  1.00 47.67 ? 149 LYS B CG    1 
ATOM   3681 C  CD    . LYS D 2 148 ? 22.643  5.041   13.528  1.00 56.08 ? 149 LYS B CD    1 
ATOM   3682 C  CE    . LYS D 2 148 ? 23.625  4.954   12.374  1.00 56.92 ? 149 LYS B CE    1 
ATOM   3683 N  NZ    . LYS D 2 148 ? 25.040  5.046   12.818  1.00 63.84 ? 149 LYS B NZ    1 
ATOM   3684 N  N     . THR D 2 149 ? 18.713  7.446   13.014  1.00 41.08 ? 150 THR B N     1 
ATOM   3685 C  CA    . THR D 2 149 ? 18.601  8.559   12.094  1.00 37.48 ? 150 THR B CA    1 
ATOM   3686 C  C     . THR D 2 149 ? 19.978  9.042   11.666  1.00 36.48 ? 150 THR B C     1 
ATOM   3687 O  O     . THR D 2 149 ? 20.988  8.682   12.268  1.00 38.57 ? 150 THR B O     1 
ATOM   3688 C  CB    . THR D 2 149 ? 17.806  9.703   12.726  1.00 32.66 ? 150 THR B CB    1 
ATOM   3689 O  OG1   . THR D 2 149 ? 18.399  10.069  13.976  1.00 41.18 ? 150 THR B OG1   1 
ATOM   3690 C  CG2   . THR D 2 149 ? 16.380  9.263   12.967  1.00 30.36 ? 150 THR B CG2   1 
ATOM   3691 N  N     . TYR D 2 150 ? 20.005  9.854   10.619  1.00 34.77 ? 151 TYR B N     1 
ATOM   3692 C  CA    . TYR D 2 150 ? 21.235  10.399  10.069  1.00 33.92 ? 151 TYR B CA    1 
ATOM   3693 C  C     . TYR D 2 150 ? 20.993  11.870  9.797   1.00 35.99 ? 151 TYR B C     1 
ATOM   3694 O  O     . TYR D 2 150 ? 19.848  12.330  9.815   1.00 35.55 ? 151 TYR B O     1 
ATOM   3695 C  CB    . TYR D 2 150 ? 21.581  9.712   8.740   1.00 35.79 ? 151 TYR B CB    1 
ATOM   3696 C  CG    . TYR D 2 150 ? 21.842  8.222   8.830   1.00 35.89 ? 151 TYR B CG    1 
ATOM   3697 C  CD1   . TYR D 2 150 ? 20.790  7.307   8.824   1.00 30.12 ? 151 TYR B CD1   1 
ATOM   3698 C  CD2   . TYR D 2 150 ? 23.144  7.729   8.914   1.00 35.19 ? 151 TYR B CD2   1 
ATOM   3699 C  CE1   . TYR D 2 150 ? 21.028  5.940   8.902   1.00 33.36 ? 151 TYR B CE1   1 
ATOM   3700 C  CE2   . TYR D 2 150 ? 23.393  6.366   8.992   1.00 35.50 ? 151 TYR B CE2   1 
ATOM   3701 C  CZ    . TYR D 2 150 ? 22.333  5.474   8.987   1.00 39.29 ? 151 TYR B CZ    1 
ATOM   3702 O  OH    . TYR D 2 150 ? 22.576  4.117   9.074   1.00 41.09 ? 151 TYR B OH    1 
ATOM   3703 N  N     . ASN D 2 151 ? 22.068  12.610  9.553   1.00 38.02 ? 152 ASN B N     1 
ATOM   3704 C  CA    . ASN D 2 151 ? 21.944  14.027  9.239   1.00 43.67 ? 152 ASN B CA    1 
ATOM   3705 C  C     . ASN D 2 151 ? 22.573  14.245  7.871   1.00 43.84 ? 152 ASN B C     1 
ATOM   3706 O  O     . ASN D 2 151 ? 23.306  13.387  7.371   1.00 43.48 ? 152 ASN B O     1 
ATOM   3707 C  CB    . ASN D 2 151 ? 22.600  14.917  10.309  1.00 54.12 ? 152 ASN B CB    1 
ATOM   3708 C  CG    . ASN D 2 151 ? 24.101  14.710  10.413  1.00 67.30 ? 152 ASN B CG    1 
ATOM   3709 O  OD1   . ASN D 2 151 ? 24.867  15.144  9.550   1.00 71.40 ? 152 ASN B OD1   1 
ATOM   3710 N  ND2   . ASN D 2 151 ? 24.528  14.046  11.478  1.00 72.02 ? 152 ASN B ND2   1 
ATOM   3711 N  N     . ILE D 2 152 ? 22.280  15.393  7.277   1.00 45.41 ? 153 ILE B N     1 
ATOM   3712 C  CA    . ILE D 2 152 ? 22.758  15.756  5.944   1.00 46.69 ? 153 ILE B CA    1 
ATOM   3713 C  C     . ILE D 2 152 ? 24.220  15.414  5.602   1.00 46.33 ? 153 ILE B C     1 
ATOM   3714 O  O     . ILE D 2 152 ? 24.532  15.143  4.448   1.00 46.44 ? 153 ILE B O     1 
ATOM   3715 C  CB    . ILE D 2 152 ? 22.500  17.262  5.684   1.00 47.26 ? 153 ILE B CB    1 
ATOM   3716 C  CG1   . ILE D 2 152 ? 21.053  17.613  6.061   1.00 55.50 ? 153 ILE B CG1   1 
ATOM   3717 C  CG2   . ILE D 2 152 ? 22.721  17.583  4.219   1.00 46.69 ? 153 ILE B CG2   1 
ATOM   3718 C  CD1   . ILE D 2 152 ? 20.783  19.101  6.240   1.00 60.16 ? 153 ILE B CD1   1 
ATOM   3719 N  N     . ASN D 2 153 ? 25.107  15.420  6.593   1.00 49.11 ? 154 ASN B N     1 
ATOM   3720 C  CA    . ASN D 2 153 ? 26.527  15.122  6.366   1.00 52.21 ? 154 ASN B CA    1 
ATOM   3721 C  C     . ASN D 2 153 ? 26.783  13.654  6.065   1.00 52.78 ? 154 ASN B C     1 
ATOM   3722 O  O     . ASN D 2 153 ? 27.721  13.311  5.343   1.00 53.61 ? 154 ASN B O     1 
ATOM   3723 C  CB    . ASN D 2 153 ? 27.359  15.494  7.598   1.00 60.14 ? 154 ASN B CB    1 
ATOM   3724 C  CG    . ASN D 2 153 ? 27.238  16.958  7.969   1.00 76.59 ? 154 ASN B CG    1 
ATOM   3725 O  OD1   . ASN D 2 153 ? 27.644  17.839  7.211   1.00 81.32 ? 154 ASN B OD1   1 
ATOM   3726 N  ND2   . ASN D 2 153 ? 26.672  17.228  9.142   1.00 83.49 ? 154 ASN B ND2   1 
ATOM   3727 N  N     . GLU D 2 154 ? 25.937  12.794  6.624   1.00 51.15 ? 155 GLU B N     1 
ATOM   3728 C  CA    . GLU D 2 154 ? 26.071  11.349  6.487   1.00 47.85 ? 155 GLU B CA    1 
ATOM   3729 C  C     . GLU D 2 154 ? 25.342  10.684  5.321   1.00 45.62 ? 155 GLU B C     1 
ATOM   3730 O  O     . GLU D 2 154 ? 25.160  9.465   5.340   1.00 44.94 ? 155 GLU B O     1 
ATOM   3731 C  CB    . GLU D 2 154 ? 25.627  10.683  7.790   1.00 49.22 ? 155 GLU B CB    1 
ATOM   3732 C  CG    . GLU D 2 154 ? 26.288  11.247  9.039   1.00 57.59 ? 155 GLU B CG    1 
ATOM   3733 C  CD    . GLU D 2 154 ? 25.633  10.758  10.312  1.00 57.91 ? 155 GLU B CD    1 
ATOM   3734 O  OE1   . GLU D 2 154 ? 24.532  11.244  10.632  1.00 55.27 ? 155 GLU B OE1   1 
ATOM   3735 O  OE2   . GLU D 2 154 ? 26.215  9.891   10.994  1.00 67.29 ? 155 GLU B OE2   1 
ATOM   3736 N  N     . LEU D 2 155 ? 24.933  11.450  4.312   1.00 43.03 ? 156 LEU B N     1 
ATOM   3737 C  CA    . LEU D 2 155 ? 24.215  10.879  3.170   1.00 44.82 ? 156 LEU B CA    1 
ATOM   3738 C  C     . LEU D 2 155 ? 24.889  9.653   2.568   1.00 46.75 ? 156 LEU B C     1 
ATOM   3739 O  O     . LEU D 2 155 ? 24.216  8.695   2.192   1.00 47.35 ? 156 LEU B O     1 
ATOM   3740 C  CB    . LEU D 2 155 ? 24.007  11.920  2.067   1.00 42.47 ? 156 LEU B CB    1 
ATOM   3741 C  CG    . LEU D 2 155 ? 22.811  12.863  2.193   1.00 40.24 ? 156 LEU B CG    1 
ATOM   3742 C  CD1   . LEU D 2 155 ? 22.763  13.781  0.984   1.00 44.30 ? 156 LEU B CD1   1 
ATOM   3743 C  CD2   . LEU D 2 155 ? 21.532  12.067  2.292   1.00 45.21 ? 156 LEU B CD2   1 
ATOM   3744 N  N     . ASN D 2 156 ? 26.218  9.686   2.484   1.00 48.12 ? 157 ASN B N     1 
ATOM   3745 C  CA    . ASN D 2 156 ? 27.004  8.588   1.912   1.00 48.62 ? 157 ASN B CA    1 
ATOM   3746 C  C     . ASN D 2 156 ? 27.090  7.313   2.744   1.00 46.21 ? 157 ASN B C     1 
ATOM   3747 O  O     . ASN D 2 156 ? 27.497  6.267   2.233   1.00 47.09 ? 157 ASN B O     1 
ATOM   3748 C  CB    . ASN D 2 156 ? 28.429  9.062   1.616   1.00 57.98 ? 157 ASN B CB    1 
ATOM   3749 C  CG    . ASN D 2 156 ? 28.544  9.807   0.296   1.00 70.69 ? 157 ASN B CG    1 
ATOM   3750 O  OD1   . ASN D 2 156 ? 29.615  10.318  -0.039  1.00 77.04 ? 157 ASN B OD1   1 
ATOM   3751 N  ND2   . ASN D 2 156 ? 27.448  9.872   -0.463  1.00 72.61 ? 157 ASN B ND2   1 
ATOM   3752 N  N     . GLU D 2 157 ? 26.715  7.403   4.016   1.00 45.01 ? 158 GLU B N     1 
ATOM   3753 C  CA    . GLU D 2 157 ? 26.775  6.265   4.928   1.00 43.04 ? 158 GLU B CA    1 
ATOM   3754 C  C     . GLU D 2 157 ? 25.438  5.558   5.172   1.00 41.43 ? 158 GLU B C     1 
ATOM   3755 O  O     . GLU D 2 157 ? 25.389  4.565   5.905   1.00 39.96 ? 158 GLU B O     1 
ATOM   3756 C  CB    . GLU D 2 157 ? 27.345  6.718   6.273   1.00 44.25 ? 158 GLU B CB    1 
ATOM   3757 C  CG    . GLU D 2 157 ? 28.752  7.288   6.196   1.00 59.13 ? 158 GLU B CG    1 
ATOM   3758 C  CD    . GLU D 2 157 ? 29.219  7.902   7.511   1.00 68.33 ? 158 GLU B CD    1 
ATOM   3759 O  OE1   . GLU D 2 157 ? 28.506  7.778   8.535   1.00 60.55 ? 158 GLU B OE1   1 
ATOM   3760 O  OE2   . GLU D 2 157 ? 30.309  8.515   7.517   1.00 78.50 ? 158 GLU B OE2   1 
ATOM   3761 N  N     . ILE D 2 158 ? 24.357  6.054   4.575   1.00 38.70 ? 159 ILE B N     1 
ATOM   3762 C  CA    . ILE D 2 158 ? 23.047  5.440   4.778   1.00 37.45 ? 159 ILE B CA    1 
ATOM   3763 C  C     . ILE D 2 158 ? 22.868  4.218   3.884   1.00 36.41 ? 159 ILE B C     1 
ATOM   3764 O  O     . ILE D 2 158 ? 22.989  4.310   2.663   1.00 35.75 ? 159 ILE B O     1 
ATOM   3765 C  CB    . ILE D 2 158 ? 21.888  6.438   4.500   1.00 35.89 ? 159 ILE B CB    1 
ATOM   3766 C  CG1   . ILE D 2 158 ? 22.037  7.675   5.383   1.00 31.38 ? 159 ILE B CG1   1 
ATOM   3767 C  CG2   . ILE D 2 158 ? 20.536  5.773   4.782   1.00 31.62 ? 159 ILE B CG2   1 
ATOM   3768 C  CD1   . ILE D 2 158 ? 20.995  8.740   5.117   1.00 41.28 ? 159 ILE B CD1   1 
ATOM   3769 N  N     . PRO D 2 159 ? 22.592  3.050   4.484   1.00 36.37 ? 160 PRO B N     1 
ATOM   3770 C  CA    . PRO D 2 159 ? 22.398  1.840   3.681   1.00 37.42 ? 160 PRO B CA    1 
ATOM   3771 C  C     . PRO D 2 159 ? 21.092  1.906   2.866   1.00 38.70 ? 160 PRO B C     1 
ATOM   3772 O  O     . PRO D 2 159 ? 20.056  2.359   3.370   1.00 37.72 ? 160 PRO B O     1 
ATOM   3773 C  CB    . PRO D 2 159 ? 22.376  0.736   4.738   1.00 38.35 ? 160 PRO B CB    1 
ATOM   3774 C  CG    . PRO D 2 159 ? 21.760  1.422   5.925   1.00 41.30 ? 160 PRO B CG    1 
ATOM   3775 C  CD    . PRO D 2 159 ? 22.458  2.757   5.924   1.00 38.72 ? 160 PRO B CD    1 
ATOM   3776 N  N     . LYS D 2 160 ? 21.159  1.469   1.609   1.00 40.88 ? 161 LYS B N     1 
ATOM   3777 C  CA    . LYS D 2 160 ? 20.000  1.443   0.713   1.00 43.14 ? 161 LYS B CA    1 
ATOM   3778 C  C     . LYS D 2 160 ? 19.406  0.034   0.744   1.00 43.27 ? 161 LYS B C     1 
ATOM   3779 O  O     . LYS D 2 160 ? 20.141  -0.956  0.770   1.00 41.78 ? 161 LYS B O     1 
ATOM   3780 C  CB    . LYS D 2 160 ? 20.418  1.817   -0.713  1.00 47.09 ? 161 LYS B CB    1 
ATOM   3781 C  CG    . LYS D 2 160 ? 20.779  3.276   -0.846  1.00 52.07 ? 161 LYS B CG    1 
ATOM   3782 C  CD    . LYS D 2 160 ? 21.746  3.553   -1.976  1.00 55.83 ? 161 LYS B CD    1 
ATOM   3783 C  CE    . LYS D 2 160 ? 22.371  4.936   -1.765  1.00 64.37 ? 161 LYS B CE    1 
ATOM   3784 N  NZ    . LYS D 2 160 ? 23.391  5.328   -2.780  1.00 62.79 ? 161 LYS B NZ    1 
ATOM   3785 N  N     . PRO D 2 161 ? 18.067  -0.076  0.757   1.00 43.33 ? 162 PRO B N     1 
ATOM   3786 C  CA    . PRO D 2 161 ? 17.404  -1.386  0.789   1.00 44.03 ? 162 PRO B CA    1 
ATOM   3787 C  C     . PRO D 2 161 ? 17.344  -2.119  -0.571  1.00 43.27 ? 162 PRO B C     1 
ATOM   3788 O  O     . PRO D 2 161 ? 16.776  -3.212  -0.671  1.00 41.12 ? 162 PRO B O     1 
ATOM   3789 C  CB    . PRO D 2 161 ? 16.019  -1.037  1.324   1.00 44.86 ? 162 PRO B CB    1 
ATOM   3790 C  CG    . PRO D 2 161 ? 15.754  0.277   0.649   1.00 45.12 ? 162 PRO B CG    1 
ATOM   3791 C  CD    . PRO D 2 161 ? 17.077  1.018   0.759   1.00 42.68 ? 162 PRO B CD    1 
ATOM   3792 N  N     . TYR D 2 162 ? 17.933  -1.515  -1.604  1.00 41.27 ? 163 TYR B N     1 
ATOM   3793 C  CA    . TYR D 2 162 ? 17.944  -2.094  -2.942  1.00 40.97 ? 163 TYR B CA    1 
ATOM   3794 C  C     . TYR D 2 162 ? 19.335  -1.982  -3.547  1.00 41.56 ? 163 TYR B C     1 
ATOM   3795 O  O     . TYR D 2 162 ? 20.066  -1.040  -3.264  1.00 42.13 ? 163 TYR B O     1 
ATOM   3796 C  CB    . TYR D 2 162 ? 16.904  -1.404  -3.836  1.00 44.60 ? 163 TYR B CB    1 
ATOM   3797 C  CG    . TYR D 2 162 ? 17.066  0.098   -3.968  1.00 48.90 ? 163 TYR B CG    1 
ATOM   3798 C  CD1   . TYR D 2 162 ? 16.442  0.974   -3.070  1.00 49.33 ? 163 TYR B CD1   1 
ATOM   3799 C  CD2   . TYR D 2 162 ? 17.835  0.646   -4.996  1.00 47.12 ? 163 TYR B CD2   1 
ATOM   3800 C  CE1   . TYR D 2 162 ? 16.583  2.356   -3.194  1.00 49.27 ? 163 TYR B CE1   1 
ATOM   3801 C  CE2   . TYR D 2 162 ? 17.980  2.020   -5.128  1.00 54.80 ? 163 TYR B CE2   1 
ATOM   3802 C  CZ    . TYR D 2 162 ? 17.353  2.869   -4.227  1.00 53.70 ? 163 TYR B CZ    1 
ATOM   3803 O  OH    . TYR D 2 162 ? 17.510  4.227   -4.383  1.00 66.63 ? 163 TYR B OH    1 
ATOM   3804 N  N     . LYS D 2 163 ? 19.685  -2.953  -4.380  1.00 44.85 ? 164 LYS B N     1 
ATOM   3805 C  CA    . LYS D 2 163 ? 20.995  -3.023  -5.008  1.00 46.26 ? 164 LYS B CA    1 
ATOM   3806 C  C     . LYS D 2 163 ? 21.083  -2.442  -6.421  1.00 47.23 ? 164 LYS B C     1 
ATOM   3807 O  O     . LYS D 2 163 ? 22.127  -1.918  -6.805  1.00 49.90 ? 164 LYS B O     1 
ATOM   3808 C  CB    . LYS D 2 163 ? 21.471  -4.486  -5.000  1.00 50.83 ? 164 LYS B CB    1 
ATOM   3809 C  CG    . LYS D 2 163 ? 22.873  -4.707  -5.509  1.00 59.71 ? 164 LYS B CG    1 
ATOM   3810 C  CD    . LYS D 2 163 ? 23.217  -6.182  -5.560  1.00 69.14 ? 164 LYS B CD    1 
ATOM   3811 C  CE    . LYS D 2 163 ? 24.503  -6.376  -6.337  1.00 75.09 ? 164 LYS B CE    1 
ATOM   3812 N  NZ    . LYS D 2 163 ? 24.896  -7.801  -6.482  1.00 77.60 ? 164 LYS B NZ    1 
ATOM   3813 N  N     . GLY D 2 164 ? 20.005  -2.532  -7.195  1.00 44.02 ? 165 GLY B N     1 
ATOM   3814 C  CA    . GLY D 2 164 ? 20.030  -2.004  -8.552  1.00 42.03 ? 165 GLY B CA    1 
ATOM   3815 C  C     . GLY D 2 164 ? 18.610  -1.779  -9.012  1.00 40.75 ? 165 GLY B C     1 
ATOM   3816 O  O     . GLY D 2 164 ? 17.725  -2.516  -8.576  1.00 46.54 ? 165 GLY B O     1 
ATOM   3817 N  N     . VAL D 2 165 ? 18.377  -0.787  -9.868  1.00 32.69 ? 166 VAL B N     1 
ATOM   3818 C  CA    . VAL D 2 165 ? 17.024  -0.485  -10.337 1.00 28.62 ? 166 VAL B CA    1 
ATOM   3819 C  C     . VAL D 2 165 ? 16.948  -0.334  -11.847 1.00 30.16 ? 166 VAL B C     1 
ATOM   3820 O  O     . VAL D 2 165 ? 17.837  0.256   -12.459 1.00 31.21 ? 166 VAL B O     1 
ATOM   3821 C  CB    . VAL D 2 165 ? 16.477  0.840   -9.723  1.00 24.95 ? 166 VAL B CB    1 
ATOM   3822 C  CG1   . VAL D 2 165 ? 14.990  1.005   -10.056 1.00 19.87 ? 166 VAL B CG1   1 
ATOM   3823 C  CG2   . VAL D 2 165 ? 16.681  0.859   -8.227  1.00 22.55 ? 166 VAL B CG2   1 
ATOM   3824 N  N     . LYS D 2 166 ? 15.880  -0.865  -12.437 1.00 30.01 ? 167 LYS B N     1 
ATOM   3825 C  CA    . LYS D 2 166 ? 15.640  -0.766  -13.872 1.00 28.19 ? 167 LYS B CA    1 
ATOM   3826 C  C     . LYS D 2 166 ? 14.223  -0.239  -14.061 1.00 26.93 ? 167 LYS B C     1 
ATOM   3827 O  O     . LYS D 2 166 ? 13.325  -0.532  -13.271 1.00 27.07 ? 167 LYS B O     1 
ATOM   3828 C  CB    . LYS D 2 166 ? 15.762  -2.126  -14.544 1.00 28.65 ? 167 LYS B CB    1 
ATOM   3829 C  CG    . LYS D 2 166 ? 17.135  -2.737  -14.516 1.00 26.65 ? 167 LYS B CG    1 
ATOM   3830 C  CD    . LYS D 2 166 ? 17.036  -4.154  -15.048 1.00 41.30 ? 167 LYS B CD    1 
ATOM   3831 C  CE    . LYS D 2 166 ? 18.324  -4.932  -14.881 1.00 47.31 ? 167 LYS B CE    1 
ATOM   3832 N  NZ    . LYS D 2 166 ? 18.089  -6.379  -15.189 1.00 56.79 ? 167 LYS B NZ    1 
ATOM   3833 N  N     . VAL D 2 167 ? 14.023  0.541   -15.110 1.00 25.86 ? 168 VAL B N     1 
ATOM   3834 C  CA    . VAL D 2 167 ? 12.718  1.103   -15.377 1.00 24.60 ? 168 VAL B CA    1 
ATOM   3835 C  C     . VAL D 2 167 ? 12.398  0.956   -16.866 1.00 26.28 ? 168 VAL B C     1 
ATOM   3836 O  O     . VAL D 2 167 ? 13.298  0.858   -17.699 1.00 28.35 ? 168 VAL B O     1 
ATOM   3837 C  CB    . VAL D 2 167 ? 12.676  2.602   -14.964 1.00 21.54 ? 168 VAL B CB    1 
ATOM   3838 C  CG1   . VAL D 2 167 ? 13.626  3.419   -15.823 1.00 25.65 ? 168 VAL B CG1   1 
ATOM   3839 C  CG2   . VAL D 2 167 ? 11.264  3.148   -15.070 1.00 22.05 ? 168 VAL B CG2   1 
ATOM   3840 N  N     . PHE D 2 168 ? 11.118  0.928   -17.199 1.00 22.90 ? 169 PHE B N     1 
ATOM   3841 C  CA    . PHE D 2 168 ? 10.696  0.835   -18.586 1.00 21.08 ? 169 PHE B CA    1 
ATOM   3842 C  C     . PHE D 2 168 ? 9.311   1.448   -18.671 1.00 21.37 ? 169 PHE B C     1 
ATOM   3843 O  O     . PHE D 2 168 ? 8.590   1.532   -17.660 1.00 20.02 ? 169 PHE B O     1 
ATOM   3844 C  CB    . PHE D 2 168 ? 10.668  -0.636  -19.079 1.00 23.54 ? 169 PHE B CB    1 
ATOM   3845 C  CG    . PHE D 2 168 ? 9.618   -1.507  -18.406 1.00 20.69 ? 169 PHE B CG    1 
ATOM   3846 C  CD1   . PHE D 2 168 ? 8.263   -1.383  -18.727 1.00 20.76 ? 169 PHE B CD1   1 
ATOM   3847 C  CD2   . PHE D 2 168 ? 9.988   -2.440  -17.440 1.00 23.39 ? 169 PHE B CD2   1 
ATOM   3848 C  CE1   . PHE D 2 168 ? 7.295   -2.165  -18.097 1.00 16.86 ? 169 PHE B CE1   1 
ATOM   3849 C  CE2   . PHE D 2 168 ? 9.024   -3.231  -16.801 1.00 25.75 ? 169 PHE B CE2   1 
ATOM   3850 C  CZ    . PHE D 2 168 ? 7.678   -3.090  -17.132 1.00 14.79 ? 169 PHE B CZ    1 
ATOM   3851 N  N     . LEU D 2 169 ? 8.953   1.889   -19.870 1.00 17.94 ? 170 LEU B N     1 
ATOM   3852 C  CA    . LEU D 2 169 ? 7.629   2.434   -20.135 1.00 17.51 ? 170 LEU B CA    1 
ATOM   3853 C  C     . LEU D 2 169 ? 7.091   1.550   -21.261 1.00 20.40 ? 170 LEU B C     1 
ATOM   3854 O  O     . LEU D 2 169 ? 7.793   1.283   -22.237 1.00 20.95 ? 170 LEU B O     1 
ATOM   3855 C  CB    . LEU D 2 169 ? 7.708   3.887   -20.594 1.00 13.02 ? 170 LEU B CB    1 
ATOM   3856 C  CG    . LEU D 2 169 ? 6.346   4.555   -20.824 1.00 19.69 ? 170 LEU B CG    1 
ATOM   3857 C  CD1   . LEU D 2 169 ? 6.427   5.987   -20.397 1.00 25.71 ? 170 LEU B CD1   1 
ATOM   3858 C  CD2   . LEU D 2 169 ? 5.914   4.449   -22.273 1.00 23.86 ? 170 LEU B CD2   1 
ATOM   3859 N  N     . GLN D 2 170 ? 5.861   1.083   -21.141 1.00 21.20 ? 171 GLN B N     1 
ATOM   3860 C  CA    . GLN D 2 170 ? 5.319   0.239   -22.192 1.00 20.08 ? 171 GLN B CA    1 
ATOM   3861 C  C     . GLN D 2 170 ? 3.810   0.312   -22.149 1.00 20.19 ? 171 GLN B C     1 
ATOM   3862 O  O     . GLN D 2 170 ? 3.233   0.648   -21.114 1.00 18.73 ? 171 GLN B O     1 
ATOM   3863 C  CB    . GLN D 2 170 ? 5.806   -1.203  -21.999 1.00 15.05 ? 171 GLN B CB    1 
ATOM   3864 C  CG    . GLN D 2 170 ? 5.430   -2.168  -23.119 1.00 27.81 ? 171 GLN B CG    1 
ATOM   3865 C  CD    . GLN D 2 170 ? 5.961   -1.737  -24.480 1.00 23.15 ? 171 GLN B CD    1 
ATOM   3866 O  OE1   . GLN D 2 170 ? 5.275   -1.039  -25.232 1.00 21.38 ? 171 GLN B OE1   1 
ATOM   3867 N  NE2   . GLN D 2 170 ? 7.181   -2.150  -24.799 1.00 19.53 ? 171 GLN B NE2   1 
ATOM   3868 N  N     . ASP D 2 171 ? 3.164   0.017   -23.272 1.00 19.63 ? 172 ASP B N     1 
ATOM   3869 C  CA    . ASP D 2 171 ? 1.707   0.028   -23.303 1.00 16.55 ? 172 ASP B CA    1 
ATOM   3870 C  C     . ASP D 2 171 ? 1.234   -1.159  -22.466 1.00 17.55 ? 172 ASP B C     1 
ATOM   3871 O  O     . ASP D 2 171 ? 1.832   -2.239  -22.521 1.00 15.88 ? 172 ASP B O     1 
ATOM   3872 C  CB    . ASP D 2 171 ? 1.207   -0.107  -24.731 1.00 16.41 ? 172 ASP B CB    1 
ATOM   3873 C  CG    . ASP D 2 171 ? 1.521   1.104   -25.557 1.00 16.20 ? 172 ASP B CG    1 
ATOM   3874 O  OD1   . ASP D 2 171 ? 2.621   1.160   -26.124 1.00 24.22 ? 172 ASP B OD1   1 
ATOM   3875 O  OD2   . ASP D 2 171 ? 0.667   2.002   -25.634 1.00 19.09 ? 172 ASP B OD2   1 
ATOM   3876 N  N     . LYS D 2 172 ? 0.167   -0.952  -21.700 1.00 18.48 ? 173 LYS B N     1 
ATOM   3877 C  CA    . LYS D 2 172 ? -0.380  -1.993  -20.841 1.00 18.05 ? 173 LYS B CA    1 
ATOM   3878 C  C     . LYS D 2 172 ? -0.725  -3.286  -21.600 1.00 20.87 ? 173 LYS B C     1 
ATOM   3879 O  O     . LYS D 2 172 ? -0.323  -4.373  -21.181 1.00 19.86 ? 173 LYS B O     1 
ATOM   3880 C  CB    . LYS D 2 172 ? -1.630  -1.481  -20.113 1.00 17.12 ? 173 LYS B CB    1 
ATOM   3881 C  CG    . LYS D 2 172 ? -2.140  -2.460  -19.064 1.00 13.74 ? 173 LYS B CG    1 
ATOM   3882 C  CD    . LYS D 2 172 ? -3.563  -2.186  -18.640 1.00 20.49 ? 173 LYS B CD    1 
ATOM   3883 C  CE    . LYS D 2 172 ? -3.627  -1.245  -17.482 1.00 33.30 ? 173 LYS B CE    1 
ATOM   3884 N  NZ    . LYS D 2 172 ? -4.927  -1.379  -16.768 1.00 23.30 ? 173 LYS B NZ    1 
ATOM   3885 N  N     . TRP D 2 173 ? -1.454  -3.167  -22.713 1.00 21.08 ? 174 TRP B N     1 
ATOM   3886 C  CA    . TRP D 2 173 ? -1.862  -4.344  -23.483 1.00 21.43 ? 174 TRP B CA    1 
ATOM   3887 C  C     . TRP D 2 173 ? -0.713  -5.192  -24.001 1.00 18.89 ? 174 TRP B C     1 
ATOM   3888 O  O     . TRP D 2 173 ? -0.793  -6.420  -23.996 1.00 20.78 ? 174 TRP B O     1 
ATOM   3889 C  CB    . TRP D 2 173 ? -2.822  -3.957  -24.628 1.00 21.27 ? 174 TRP B CB    1 
ATOM   3890 C  CG    . TRP D 2 173 ? -2.191  -3.417  -25.887 1.00 28.93 ? 174 TRP B CG    1 
ATOM   3891 C  CD1   . TRP D 2 173 ? -2.010  -2.106  -26.219 1.00 24.95 ? 174 TRP B CD1   1 
ATOM   3892 C  CD2   . TRP D 2 173 ? -1.687  -4.184  -26.996 1.00 33.29 ? 174 TRP B CD2   1 
ATOM   3893 N  NE1   . TRP D 2 173 ? -1.428  -2.009  -27.460 1.00 19.67 ? 174 TRP B NE1   1 
ATOM   3894 C  CE2   . TRP D 2 173 ? -1.220  -3.267  -27.960 1.00 32.30 ? 174 TRP B CE2   1 
ATOM   3895 C  CE3   . TRP D 2 173 ? -1.589  -5.559  -27.266 1.00 29.84 ? 174 TRP B CE3   1 
ATOM   3896 C  CZ2   . TRP D 2 173 ? -0.662  -3.678  -29.177 1.00 28.34 ? 174 TRP B CZ2   1 
ATOM   3897 C  CZ3   . TRP D 2 173 ? -1.033  -5.967  -28.476 1.00 26.08 ? 174 TRP B CZ3   1 
ATOM   3898 C  CH2   . TRP D 2 173 ? -0.578  -5.029  -29.414 1.00 26.24 ? 174 TRP B CH2   1 
ATOM   3899 N  N     . VAL D 2 174 ? 0.361   -4.542  -24.431 1.00 20.12 ? 175 VAL B N     1 
ATOM   3900 C  CA    . VAL D 2 174 ? 1.525   -5.240  -24.978 1.00 18.67 ? 175 VAL B CA    1 
ATOM   3901 C  C     . VAL D 2 174 ? 2.200   -6.184  -23.982 1.00 22.80 ? 175 VAL B C     1 
ATOM   3902 O  O     . VAL D 2 174 ? 2.785   -7.205  -24.373 1.00 22.57 ? 175 VAL B O     1 
ATOM   3903 C  CB    . VAL D 2 174 ? 2.568   -4.212  -25.508 1.00 25.17 ? 175 VAL B CB    1 
ATOM   3904 C  CG1   . VAL D 2 174 ? 3.842   -4.895  -25.920 1.00 21.93 ? 175 VAL B CG1   1 
ATOM   3905 C  CG2   . VAL D 2 174 ? 2.003   -3.464  -26.686 1.00 25.54 ? 175 VAL B CG2   1 
ATOM   3906 N  N     . ILE D 2 175 ? 2.122   -5.851  -22.696 1.00 22.49 ? 176 ILE B N     1 
ATOM   3907 C  CA    . ILE D 2 175 ? 2.763   -6.671  -21.669 1.00 21.61 ? 176 ILE B CA    1 
ATOM   3908 C  C     . ILE D 2 175 ? 1.800   -7.472  -20.802 1.00 19.24 ? 176 ILE B C     1 
ATOM   3909 O  O     . ILE D 2 175 ? 2.229   -8.153  -19.873 1.00 19.60 ? 176 ILE B O     1 
ATOM   3910 C  CB    . ILE D 2 175 ? 3.689   -5.815  -20.738 1.00 30.46 ? 176 ILE B CB    1 
ATOM   3911 C  CG1   . ILE D 2 175 ? 2.871   -4.747  -19.994 1.00 25.83 ? 176 ILE B CG1   1 
ATOM   3912 C  CG2   . ILE D 2 175 ? 4.814   -5.197  -21.555 1.00 27.87 ? 176 ILE B CG2   1 
ATOM   3913 C  CD1   . ILE D 2 175 ? 3.622   -4.074  -18.868 1.00 24.66 ? 176 ILE B CD1   1 
ATOM   3914 N  N     . ALA D 2 176 ? 0.507   -7.388  -21.098 1.00 20.08 ? 177 ALA B N     1 
ATOM   3915 C  CA    . ALA D 2 176 ? -0.499  -8.129  -20.346 1.00 18.05 ? 177 ALA B CA    1 
ATOM   3916 C  C     . ALA D 2 176 ? -0.339  -9.616  -20.631 1.00 20.02 ? 177 ALA B C     1 
ATOM   3917 O  O     . ALA D 2 176 ? 0.111   -10.005 -21.709 1.00 21.57 ? 177 ALA B O     1 
ATOM   3918 C  CB    . ALA D 2 176 ? -1.887  -7.679  -20.730 1.00 10.33 ? 177 ALA B CB    1 
ATOM   3919 N  N     . GLY D 2 177 ? -0.701  -10.436 -19.652 1.00 18.03 ? 178 GLY B N     1 
ATOM   3920 C  CA    . GLY D 2 177 ? -0.616  -11.876 -19.797 1.00 13.84 ? 178 GLY B CA    1 
ATOM   3921 C  C     . GLY D 2 177 ? -2.009  -12.476 -19.807 1.00 15.79 ? 178 GLY B C     1 
ATOM   3922 O  O     . GLY D 2 177 ? -3.013  -11.758 -19.931 1.00 14.36 ? 178 GLY B O     1 
ATOM   3923 N  N     . ASP D 2 178 ? -2.084  -13.797 -19.672 1.00 18.58 ? 179 ASP B N     1 
ATOM   3924 C  CA    . ASP D 2 178 ? -3.373  -14.477 -19.676 1.00 21.13 ? 179 ASP B CA    1 
ATOM   3925 C  C     . ASP D 2 178 ? -3.752  -15.104 -18.340 1.00 21.13 ? 179 ASP B C     1 
ATOM   3926 O  O     . ASP D 2 178 ? -4.812  -15.707 -18.219 1.00 22.90 ? 179 ASP B O     1 
ATOM   3927 C  CB    . ASP D 2 178 ? -3.449  -15.515 -20.817 1.00 22.12 ? 179 ASP B CB    1 
ATOM   3928 C  CG    . ASP D 2 178 ? -2.341  -16.561 -20.763 1.00 25.57 ? 179 ASP B CG    1 
ATOM   3929 O  OD1   . ASP D 2 178 ? -1.360  -16.402 -20.000 1.00 28.63 ? 179 ASP B OD1   1 
ATOM   3930 O  OD2   . ASP D 2 178 ? -2.457  -17.560 -21.502 1.00 27.92 ? 179 ASP B OD2   1 
ATOM   3931 N  N     . LEU D 2 179 ? -2.886  -14.957 -17.342 1.00 22.28 ? 180 LEU B N     1 
ATOM   3932 C  CA    . LEU D 2 179 ? -3.142  -15.476 -15.994 1.00 23.35 ? 180 LEU B CA    1 
ATOM   3933 C  C     . LEU D 2 179 ? -3.355  -14.289 -15.041 1.00 23.97 ? 180 LEU B C     1 
ATOM   3934 O  O     . LEU D 2 179 ? -2.658  -13.275 -15.141 1.00 25.69 ? 180 LEU B O     1 
ATOM   3935 C  CB    . LEU D 2 179 ? -1.964  -16.322 -15.506 1.00 18.61 ? 180 LEU B CB    1 
ATOM   3936 C  CG    . LEU D 2 179 ? -1.657  -17.587 -16.304 1.00 31.47 ? 180 LEU B CG    1 
ATOM   3937 C  CD1   . LEU D 2 179 ? -0.502  -18.342 -15.649 1.00 29.69 ? 180 LEU B CD1   1 
ATOM   3938 C  CD2   . LEU D 2 179 ? -2.901  -18.467 -16.364 1.00 37.00 ? 180 LEU B CD2   1 
ATOM   3939 N  N     . ALA D 2 180 ? -4.317  -14.416 -14.132 1.00 18.25 ? 181 ALA B N     1 
ATOM   3940 C  CA    . ALA D 2 180 ? -4.621  -13.367 -13.168 1.00 18.40 ? 181 ALA B CA    1 
ATOM   3941 C  C     . ALA D 2 180 ? -3.415  -13.014 -12.282 1.00 18.27 ? 181 ALA B C     1 
ATOM   3942 O  O     . ALA D 2 180 ? -2.619  -13.880 -11.942 1.00 19.88 ? 181 ALA B O     1 
ATOM   3943 C  CB    . ALA D 2 180 ? -5.790  -13.792 -12.315 1.00 13.60 ? 181 ALA B CB    1 
ATOM   3944 N  N     . GLY D 2 181 ? -3.283  -11.736 -11.929 1.00 16.32 ? 182 GLY B N     1 
ATOM   3945 C  CA    . GLY D 2 181 ? -2.189  -11.295 -11.081 1.00 17.16 ? 182 GLY B CA    1 
ATOM   3946 C  C     . GLY D 2 181 ? -2.466  -11.450 -9.586  1.00 15.19 ? 182 GLY B C     1 
ATOM   3947 O  O     . GLY D 2 181 ? -1.546  -11.532 -8.775  1.00 17.51 ? 182 GLY B O     1 
ATOM   3948 N  N     . SER D 2 182 ? -3.736  -11.482 -9.218  1.00 15.82 ? 183 SER B N     1 
ATOM   3949 C  CA    . SER D 2 182 ? -4.118  -11.638 -7.825  1.00 17.46 ? 183 SER B CA    1 
ATOM   3950 C  C     . SER D 2 182 ? -5.495  -12.291 -7.784  1.00 17.92 ? 183 SER B C     1 
ATOM   3951 O  O     . SER D 2 182 ? -6.266  -12.209 -8.752  1.00 18.74 ? 183 SER B O     1 
ATOM   3952 C  CB    . SER D 2 182 ? -4.161  -10.272 -7.139  1.00 13.19 ? 183 SER B CB    1 
ATOM   3953 O  OG    . SER D 2 182 ? -5.239  -9.504  -7.651  1.00 15.09 ? 183 SER B OG    1 
ATOM   3954 N  N     . GLY D 2 183 ? -5.810  -12.923 -6.660  1.00 15.40 ? 184 GLY B N     1 
ATOM   3955 C  CA    . GLY D 2 183 ? -7.083  -13.597 -6.525  1.00 12.29 ? 184 GLY B CA    1 
ATOM   3956 C  C     . GLY D 2 183 ? -8.242  -12.770 -6.019  1.00 16.17 ? 184 GLY B C     1 
ATOM   3957 O  O     . GLY D 2 183 ? -9.091  -12.355 -6.815  1.00 17.99 ? 184 GLY B O     1 
ATOM   3958 N  N     . ASN D 2 184 ? -8.303  -12.522 -4.711  1.00 15.47 ? 185 ASN B N     1 
ATOM   3959 C  CA    . ASN D 2 184 ? -9.414  -11.747 -4.159  1.00 15.99 ? 185 ASN B CA    1 
ATOM   3960 C  C     . ASN D 2 184 ? -9.477  -10.304 -4.674  1.00 20.12 ? 185 ASN B C     1 
ATOM   3961 O  O     . ASN D 2 184 ? -10.530 -9.649  -4.594  1.00 15.96 ? 185 ASN B O     1 
ATOM   3962 C  CB    . ASN D 2 184 ? -9.402  -11.768 -2.617  1.00 19.14 ? 185 ASN B CB    1 
ATOM   3963 C  CG    . ASN D 2 184 ? -8.061  -11.364 -2.021  1.00 25.29 ? 185 ASN B CG    1 
ATOM   3964 O  OD1   . ASN D 2 184 ? -7.166  -10.873 -2.719  1.00 18.01 ? 185 ASN B OD1   1 
ATOM   3965 N  ND2   . ASN D 2 184 ? -7.913  -11.573 -0.720  1.00 21.12 ? 185 ASN B ND2   1 
ATOM   3966 N  N     . THR D 2 185 ? -8.368  -9.798  -5.211  1.00 19.27 ? 186 THR B N     1 
ATOM   3967 C  CA    . THR D 2 185 ? -8.370  -8.427  -5.716  1.00 19.69 ? 186 THR B CA    1 
ATOM   3968 C  C     . THR D 2 185 ? -8.434  -8.342  -7.244  1.00 23.93 ? 186 THR B C     1 
ATOM   3969 O  O     . THR D 2 185 ? -8.165  -7.288  -7.842  1.00 21.20 ? 186 THR B O     1 
ATOM   3970 C  CB    . THR D 2 185 ? -7.170  -7.639  -5.162  1.00 15.44 ? 186 THR B CB    1 
ATOM   3971 O  OG1   . THR D 2 185 ? -5.973  -8.416  -5.314  1.00 11.99 ? 186 THR B OG1   1 
ATOM   3972 C  CG2   . THR D 2 185 ? -7.396  -7.325  -3.686  1.00 11.15 ? 186 THR B CG2   1 
ATOM   3973 N  N     . THR D 2 186 ? -8.789  -9.471  -7.859  1.00 20.76 ? 187 THR B N     1 
ATOM   3974 C  CA    . THR D 2 186 ? -8.984  -9.602  -9.300  1.00 15.78 ? 187 THR B CA    1 
ATOM   3975 C  C     . THR D 2 186 ? -8.123  -8.746  -10.246 1.00 15.85 ? 187 THR B C     1 
ATOM   3976 O  O     . THR D 2 186 ? -8.653  -7.979  -11.048 1.00 12.38 ? 187 THR B O     1 
ATOM   3977 C  CB    . THR D 2 186 ? -10.487 -9.377  -9.638  1.00 17.84 ? 187 THR B CB    1 
ATOM   3978 O  OG1   . THR D 2 186 ? -10.942 -8.158  -9.046  1.00 12.09 ? 187 THR B OG1   1 
ATOM   3979 C  CG2   . THR D 2 186 ? -11.340 -10.498 -9.081  1.00 15.99 ? 187 THR B CG2   1 
ATOM   3980 N  N     . ASN D 2 187 ? -6.804  -8.882  -10.158 1.00 13.82 ? 188 ASN B N     1 
ATOM   3981 C  CA    . ASN D 2 187 ? -5.893  -8.113  -11.004 1.00 15.94 ? 188 ASN B CA    1 
ATOM   3982 C  C     . ASN D 2 187 ? -5.454  -8.858  -12.243 1.00 20.34 ? 188 ASN B C     1 
ATOM   3983 O  O     . ASN D 2 187 ? -5.340  -10.087 -12.238 1.00 20.19 ? 188 ASN B O     1 
ATOM   3984 C  CB    . ASN D 2 187 ? -4.607  -7.742  -10.247 1.00 8.61  ? 188 ASN B CB    1 
ATOM   3985 C  CG    . ASN D 2 187 ? -4.592  -6.308  -9.776  1.00 12.02 ? 188 ASN B CG    1 
ATOM   3986 O  OD1   . ASN D 2 187 ? -3.619  -5.587  -10.006 1.00 10.54 ? 188 ASN B OD1   1 
ATOM   3987 N  ND2   . ASN D 2 187 ? -5.666  -5.882  -9.112  1.00 9.56  ? 188 ASN B ND2   1 
ATOM   3988 N  N     . ILE D 2 188 ? -5.195  -8.096  -13.300 1.00 20.70 ? 189 ILE B N     1 
ATOM   3989 C  CA    . ILE D 2 188 ? -4.697  -8.628  -14.555 1.00 15.38 ? 189 ILE B CA    1 
ATOM   3990 C  C     . ILE D 2 188 ? -3.234  -8.966  -14.271 1.00 14.97 ? 189 ILE B C     1 
ATOM   3991 O  O     . ILE D 2 188 ? -2.532  -8.206  -13.604 1.00 17.92 ? 189 ILE B O     1 
ATOM   3992 C  CB    . ILE D 2 188 ? -4.774  -7.539  -15.653 1.00 14.51 ? 189 ILE B CB    1 
ATOM   3993 C  CG1   . ILE D 2 188 ? -6.232  -7.337  -16.072 1.00 14.66 ? 189 ILE B CG1   1 
ATOM   3994 C  CG2   . ILE D 2 188 ? -3.860  -7.880  -16.822 1.00 16.14 ? 189 ILE B CG2   1 
ATOM   3995 C  CD1   . ILE D 2 188 ? -6.468  -6.118  -16.929 1.00 18.45 ? 189 ILE B CD1   1 
ATOM   3996 N  N     . GLY D 2 189 ? -2.765  -10.104 -14.749 1.00 15.78 ? 190 GLY B N     1 
ATOM   3997 C  CA    . GLY D 2 189 ? -1.371  -10.448 -14.538 1.00 10.04 ? 190 GLY B CA    1 
ATOM   3998 C  C     . GLY D 2 189 ? -0.646  -10.065 -15.813 1.00 17.80 ? 190 GLY B C     1 
ATOM   3999 O  O     . GLY D 2 189 ? -1.279  -9.983  -16.876 1.00 16.68 ? 190 GLY B O     1 
ATOM   4000 N  N     . SER D 2 190 ? 0.655   -9.814  -15.732 1.00 14.96 ? 191 SER B N     1 
ATOM   4001 C  CA    . SER D 2 190 ? 1.417   -9.471  -16.924 1.00 17.35 ? 191 SER B CA    1 
ATOM   4002 C  C     . SER D 2 190 ? 2.115   -10.749 -17.352 1.00 19.03 ? 191 SER B C     1 
ATOM   4003 O  O     . SER D 2 190 ? 1.972   -11.793 -16.711 1.00 19.04 ? 191 SER B O     1 
ATOM   4004 C  CB    . SER D 2 190 ? 2.491   -8.408  -16.612 1.00 17.68 ? 191 SER B CB    1 
ATOM   4005 O  OG    . SER D 2 190 ? 3.598   -8.958  -15.896 1.00 16.65 ? 191 SER B OG    1 
ATOM   4006 N  N     . ILE D 2 191 ? 2.878   -10.667 -18.429 1.00 15.08 ? 192 ILE B N     1 
ATOM   4007 C  CA    . ILE D 2 191 ? 3.638   -11.815 -18.883 1.00 20.45 ? 192 ILE B CA    1 
ATOM   4008 C  C     . ILE D 2 191 ? 4.689   -12.105 -17.795 1.00 22.25 ? 192 ILE B C     1 
ATOM   4009 O  O     . ILE D 2 191 ? 5.058   -11.214 -17.026 1.00 25.57 ? 192 ILE B O     1 
ATOM   4010 C  CB    . ILE D 2 191 ? 4.337   -11.508 -20.252 1.00 21.58 ? 192 ILE B CB    1 
ATOM   4011 C  CG1   . ILE D 2 191 ? 5.317   -10.339 -20.109 1.00 20.62 ? 192 ILE B CG1   1 
ATOM   4012 C  CG2   . ILE D 2 191 ? 3.279   -11.140 -21.310 1.00 21.73 ? 192 ILE B CG2   1 
ATOM   4013 C  CD1   . ILE D 2 191 ? 6.040   -9.973  -21.402 1.00 21.00 ? 192 ILE B CD1   1 
ATOM   4014 N  N     . HIS D 2 192 ? 5.158   -13.342 -17.718 1.00 21.72 ? 193 HIS B N     1 
ATOM   4015 C  CA    . HIS D 2 192 ? 6.180   -13.714 -16.751 1.00 25.50 ? 193 HIS B CA    1 
ATOM   4016 C  C     . HIS D 2 192 ? 7.426   -13.863 -17.619 1.00 31.29 ? 193 HIS B C     1 
ATOM   4017 O  O     . HIS D 2 192 ? 7.686   -14.939 -18.159 1.00 35.10 ? 193 HIS B O     1 
ATOM   4018 C  CB    . HIS D 2 192 ? 5.798   -15.035 -16.071 1.00 28.02 ? 193 HIS B CB    1 
ATOM   4019 C  CG    . HIS D 2 192 ? 6.748   -15.468 -14.997 1.00 37.59 ? 193 HIS B CG    1 
ATOM   4020 N  ND1   . HIS D 2 192 ? 7.020   -14.698 -13.887 1.00 48.33 ? 193 HIS B ND1   1 
ATOM   4021 C  CD2   . HIS D 2 192 ? 7.489   -16.593 -14.863 1.00 45.78 ? 193 HIS B CD2   1 
ATOM   4022 C  CE1   . HIS D 2 192 ? 7.888   -15.329 -13.114 1.00 50.45 ? 193 HIS B CE1   1 
ATOM   4023 N  NE2   . HIS D 2 192 ? 8.188   -16.482 -13.685 1.00 51.71 ? 193 HIS B NE2   1 
ATOM   4024 N  N     . ALA D 2 193 ? 8.191   -12.780 -17.750 1.00 32.83 ? 194 ALA B N     1 
ATOM   4025 C  CA    . ALA D 2 193 ? 9.370   -12.765 -18.613 1.00 32.96 ? 194 ALA B CA    1 
ATOM   4026 C  C     . ALA D 2 193 ? 10.541  -11.970 -18.053 1.00 35.82 ? 194 ALA B C     1 
ATOM   4027 O  O     . ALA D 2 193 ? 10.491  -11.472 -16.933 1.00 35.17 ? 194 ALA B O     1 
ATOM   4028 C  CB    . ALA D 2 193 ? 8.976   -12.190 -19.972 1.00 30.36 ? 194 ALA B CB    1 
ATOM   4029 N  N     . HIS D 2 194 ? 11.602  -11.858 -18.850 1.00 37.69 ? 195 HIS B N     1 
ATOM   4030 C  CA    . HIS D 2 194 ? 12.795  -11.102 -18.461 1.00 37.63 ? 195 HIS B CA    1 
ATOM   4031 C  C     . HIS D 2 194 ? 12.586  -9.630  -18.779 1.00 34.97 ? 195 HIS B C     1 
ATOM   4032 O  O     . HIS D 2 194 ? 11.826  -9.289  -19.688 1.00 36.01 ? 195 HIS B O     1 
ATOM   4033 C  CB    . HIS D 2 194 ? 14.032  -11.589 -19.226 1.00 41.82 ? 195 HIS B CB    1 
ATOM   4034 C  CG    . HIS D 2 194 ? 14.381  -13.016 -18.960 1.00 43.94 ? 195 HIS B CG    1 
ATOM   4035 N  ND1   . HIS D 2 194 ? 14.923  -13.442 -17.766 1.00 47.22 ? 195 HIS B ND1   1 
ATOM   4036 C  CD2   . HIS D 2 194 ? 14.253  -14.122 -19.731 1.00 52.75 ? 195 HIS B CD2   1 
ATOM   4037 C  CE1   . HIS D 2 194 ? 15.114  -14.748 -17.811 1.00 49.76 ? 195 HIS B CE1   1 
ATOM   4038 N  NE2   . HIS D 2 194 ? 14.715  -15.185 -18.993 1.00 58.94 ? 195 HIS B NE2   1 
ATOM   4039 N  N     . TYR D 2 195 ? 13.273  -8.768  -18.037 1.00 32.10 ? 196 TYR B N     1 
ATOM   4040 C  CA    . TYR D 2 195 ? 13.188  -7.324  -18.223 1.00 31.10 ? 196 TYR B CA    1 
ATOM   4041 C  C     . TYR D 2 195 ? 13.211  -6.926  -19.711 1.00 31.61 ? 196 TYR B C     1 
ATOM   4042 O  O     . TYR D 2 195 ? 12.368  -6.143  -20.159 1.00 32.25 ? 196 TYR B O     1 
ATOM   4043 C  CB    . TYR D 2 195 ? 14.333  -6.644  -17.449 1.00 19.72 ? 196 TYR B CB    1 
ATOM   4044 C  CG    . TYR D 2 195 ? 14.501  -5.165  -17.735 1.00 22.82 ? 196 TYR B CG    1 
ATOM   4045 C  CD1   . TYR D 2 195 ? 13.560  -4.228  -17.289 1.00 24.09 ? 196 TYR B CD1   1 
ATOM   4046 C  CD2   . TYR D 2 195 ? 15.599  -4.702  -18.463 1.00 26.23 ? 196 TYR B CD2   1 
ATOM   4047 C  CE1   . TYR D 2 195 ? 13.706  -2.867  -17.565 1.00 19.25 ? 196 TYR B CE1   1 
ATOM   4048 C  CE2   . TYR D 2 195 ? 15.759  -3.346  -18.746 1.00 23.91 ? 196 TYR B CE2   1 
ATOM   4049 C  CZ    . TYR D 2 195 ? 14.810  -2.436  -18.298 1.00 28.01 ? 196 TYR B CZ    1 
ATOM   4050 O  OH    . TYR D 2 195 ? 14.968  -1.105  -18.610 1.00 26.35 ? 196 TYR B OH    1 
ATOM   4051 N  N     . LYS D 2 196 ? 14.173  -7.475  -20.458 1.00 34.28 ? 197 LYS B N     1 
ATOM   4052 C  CA    . LYS D 2 196 ? 14.343  -7.221  -21.898 1.00 34.01 ? 197 LYS B CA    1 
ATOM   4053 C  C     . LYS D 2 196 ? 13.024  -7.342  -22.686 1.00 34.88 ? 197 LYS B C     1 
ATOM   4054 O  O     . LYS D 2 196 ? 12.723  -6.510  -23.556 1.00 32.39 ? 197 LYS B O     1 
ATOM   4055 C  CB    . LYS D 2 196 ? 15.371  -8.215  -22.458 1.00 41.27 ? 197 LYS B CB    1 
ATOM   4056 C  CG    . LYS D 2 196 ? 15.718  -8.074  -23.947 1.00 56.03 ? 197 LYS B CG    1 
ATOM   4057 C  CD    . LYS D 2 196 ? 16.783  -9.121  -24.343 1.00 66.48 ? 197 LYS B CD    1 
ATOM   4058 C  CE    . LYS D 2 196 ? 17.540  -8.759  -25.635 1.00 66.98 ? 197 LYS B CE    1 
ATOM   4059 N  NZ    . LYS D 2 196 ? 16.897  -9.222  -26.907 1.00 61.83 ? 197 LYS B NZ    1 
ATOM   4060 N  N     . ASP D 2 197 ? 12.242  -8.374  -22.368 1.00 32.44 ? 198 ASP B N     1 
ATOM   4061 C  CA    . ASP D 2 197 ? 10.977  -8.618  -23.047 1.00 31.58 ? 198 ASP B CA    1 
ATOM   4062 C  C     . ASP D 2 197 ? 9.930   -7.532  -22.817 1.00 31.93 ? 198 ASP B C     1 
ATOM   4063 O  O     . ASP D 2 197 ? 9.117   -7.256  -23.697 1.00 32.42 ? 198 ASP B O     1 
ATOM   4064 C  CB    . ASP D 2 197 ? 10.411  -9.984  -22.643 1.00 39.56 ? 198 ASP B CB    1 
ATOM   4065 C  CG    . ASP D 2 197 ? 11.291  -11.145 -23.091 1.00 42.99 ? 198 ASP B CG    1 
ATOM   4066 O  OD1   . ASP D 2 197 ? 12.240  -10.929 -23.875 1.00 52.95 ? 198 ASP B OD1   1 
ATOM   4067 O  OD2   . ASP D 2 197 ? 11.030  -12.282 -22.653 1.00 47.13 ? 198 ASP B OD2   1 
ATOM   4068 N  N     . PHE D 2 198 ? 9.942   -6.916  -21.640 1.00 29.47 ? 199 PHE B N     1 
ATOM   4069 C  CA    . PHE D 2 198 ? 8.985   -5.850  -21.342 1.00 26.74 ? 199 PHE B CA    1 
ATOM   4070 C  C     . PHE D 2 198 ? 9.366   -4.607  -22.133 1.00 25.98 ? 199 PHE B C     1 
ATOM   4071 O  O     . PHE D 2 198 ? 8.503   -3.886  -22.656 1.00 22.07 ? 199 PHE B O     1 
ATOM   4072 C  CB    . PHE D 2 198 ? 8.982   -5.529  -19.842 1.00 27.11 ? 199 PHE B CB    1 
ATOM   4073 C  CG    . PHE D 2 198 ? 8.367   -6.603  -18.990 1.00 21.40 ? 199 PHE B CG    1 
ATOM   4074 C  CD1   . PHE D 2 198 ? 9.132   -7.667  -18.532 1.00 26.69 ? 199 PHE B CD1   1 
ATOM   4075 C  CD2   . PHE D 2 198 ? 7.020   -6.549  -18.651 1.00 28.08 ? 199 PHE B CD2   1 
ATOM   4076 C  CE1   . PHE D 2 198 ? 8.566   -8.663  -17.748 1.00 26.34 ? 199 PHE B CE1   1 
ATOM   4077 C  CE2   . PHE D 2 198 ? 6.440   -7.541  -17.865 1.00 20.69 ? 199 PHE B CE2   1 
ATOM   4078 C  CZ    . PHE D 2 198 ? 7.218   -8.601  -17.414 1.00 24.48 ? 199 PHE B CZ    1 
ATOM   4079 N  N     . VAL D 2 199 ? 10.672  -4.367  -22.219 1.00 28.02 ? 200 VAL B N     1 
ATOM   4080 C  CA    . VAL D 2 199 ? 11.197  -3.220  -22.955 1.00 30.61 ? 200 VAL B CA    1 
ATOM   4081 C  C     . VAL D 2 199 ? 10.854  -3.399  -24.428 1.00 33.42 ? 200 VAL B C     1 
ATOM   4082 O  O     . VAL D 2 199 ? 10.236  -2.526  -25.045 1.00 32.81 ? 200 VAL B O     1 
ATOM   4083 C  CB    . VAL D 2 199 ? 12.733  -3.113  -22.804 1.00 31.10 ? 200 VAL B CB    1 
ATOM   4084 C  CG1   . VAL D 2 199 ? 13.253  -1.891  -23.533 1.00 27.04 ? 200 VAL B CG1   1 
ATOM   4085 C  CG2   . VAL D 2 199 ? 13.111  -3.061  -21.332 1.00 34.85 ? 200 VAL B CG2   1 
ATOM   4086 N  N     . GLU D 2 200 ? 11.244  -4.542  -24.985 1.00 34.93 ? 201 GLU B N     1 
ATOM   4087 C  CA    . GLU D 2 200 ? 10.988  -4.826  -26.392 1.00 38.59 ? 201 GLU B CA    1 
ATOM   4088 C  C     . GLU D 2 200 ? 9.526   -5.055  -26.746 1.00 38.20 ? 201 GLU B C     1 
ATOM   4089 O  O     . GLU D 2 200 ? 9.164   -5.016  -27.918 1.00 41.37 ? 201 GLU B O     1 
ATOM   4090 C  CB    . GLU D 2 200 ? 11.842  -6.000  -26.841 1.00 40.24 ? 201 GLU B CB    1 
ATOM   4091 C  CG    . GLU D 2 200 ? 13.318  -5.709  -26.692 1.00 56.84 ? 201 GLU B CG    1 
ATOM   4092 C  CD    . GLU D 2 200 ? 14.202  -6.813  -27.226 1.00 70.19 ? 201 GLU B CD    1 
ATOM   4093 O  OE1   . GLU D 2 200 ? 13.678  -7.871  -27.638 1.00 76.44 ? 201 GLU B OE1   1 
ATOM   4094 O  OE2   . GLU D 2 200 ? 15.438  -6.619  -27.232 1.00 76.93 ? 201 GLU B OE2   1 
ATOM   4095 N  N     . GLY D 2 201 ? 8.699   -5.296  -25.732 1.00 35.71 ? 202 GLY B N     1 
ATOM   4096 C  CA    . GLY D 2 201 ? 7.279   -5.511  -25.942 1.00 31.55 ? 202 GLY B CA    1 
ATOM   4097 C  C     . GLY D 2 201 ? 6.880   -6.840  -26.555 1.00 32.77 ? 202 GLY B C     1 
ATOM   4098 O  O     . GLY D 2 201 ? 5.988   -6.907  -27.399 1.00 33.69 ? 202 GLY B O     1 
ATOM   4099 N  N     . LYS D 2 202 ? 7.524   -7.915  -26.133 1.00 31.42 ? 203 LYS B N     1 
ATOM   4100 C  CA    . LYS D 2 202 ? 7.200   -9.222  -26.658 1.00 32.02 ? 203 LYS B CA    1 
ATOM   4101 C  C     . LYS D 2 202 ? 6.046   -9.827  -25.856 1.00 31.40 ? 203 LYS B C     1 
ATOM   4102 O  O     . LYS D 2 202 ? 6.274   -10.626 -24.962 1.00 30.02 ? 203 LYS B O     1 
ATOM   4103 C  CB    . LYS D 2 202 ? 8.436   -10.113 -26.595 1.00 40.44 ? 203 LYS B CB    1 
ATOM   4104 C  CG    . LYS D 2 202 ? 9.533   -9.721  -27.565 1.00 48.45 ? 203 LYS B CG    1 
ATOM   4105 C  CD    . LYS D 2 202 ? 10.631  -10.762 -27.485 1.00 62.34 ? 203 LYS B CD    1 
ATOM   4106 C  CE    . LYS D 2 202 ? 11.890  -10.378 -28.241 1.00 71.78 ? 203 LYS B CE    1 
ATOM   4107 N  NZ    . LYS D 2 202 ? 13.004  -11.325 -27.882 1.00 74.49 ? 203 LYS B NZ    1 
ATOM   4108 N  N     . GLY D 2 203 ? 4.818   -9.438  -26.175 1.00 30.67 ? 204 GLY B N     1 
ATOM   4109 C  CA    . GLY D 2 203 ? 3.658   -9.923  -25.445 1.00 30.22 ? 204 GLY B CA    1 
ATOM   4110 C  C     . GLY D 2 203 ? 3.018   -11.173 -26.022 1.00 27.62 ? 204 GLY B C     1 
ATOM   4111 O  O     . GLY D 2 203 ? 3.593   -11.845 -26.883 1.00 26.07 ? 204 GLY B O     1 
ATOM   4112 N  N     . ILE D 2 204 ? 1.819   -11.489 -25.553 1.00 26.15 ? 205 ILE B N     1 
ATOM   4113 C  CA    . ILE D 2 204 ? 1.113   -12.668 -26.041 1.00 25.93 ? 205 ILE B CA    1 
ATOM   4114 C  C     . ILE D 2 204 ? -0.153  -12.327 -26.840 1.00 22.75 ? 205 ILE B C     1 
ATOM   4115 O  O     . ILE D 2 204 ? -0.627  -13.140 -27.628 1.00 23.87 ? 205 ILE B O     1 
ATOM   4116 C  CB    . ILE D 2 204 ? 0.739   -13.643 -24.894 1.00 25.80 ? 205 ILE B CB    1 
ATOM   4117 C  CG1   . ILE D 2 204 ? -0.390  -13.067 -24.051 1.00 21.98 ? 205 ILE B CG1   1 
ATOM   4118 C  CG2   . ILE D 2 204 ? 1.939   -13.937 -24.020 1.00 34.97 ? 205 ILE B CG2   1 
ATOM   4119 C  CD1   . ILE D 2 204 ? -0.858  -13.985 -22.960 1.00 26.58 ? 205 ILE B CD1   1 
ATOM   4120 N  N     . PHE D 2 205 ? -0.701  -11.135 -26.639 1.00 16.05 ? 206 PHE B N     1 
ATOM   4121 C  CA    . PHE D 2 205 ? -1.896  -10.736 -27.359 1.00 20.54 ? 206 PHE B CA    1 
ATOM   4122 C  C     . PHE D 2 205 ? -1.566  -10.184 -28.756 1.00 22.26 ? 206 PHE B C     1 
ATOM   4123 O  O     . PHE D 2 205 ? -0.538  -9.539  -28.951 1.00 21.49 ? 206 PHE B O     1 
ATOM   4124 C  CB    . PHE D 2 205 ? -2.673  -9.703  -26.547 1.00 16.68 ? 206 PHE B CB    1 
ATOM   4125 C  CG    . PHE D 2 205 ? -3.336  -10.273 -25.335 1.00 20.59 ? 206 PHE B CG    1 
ATOM   4126 C  CD1   . PHE D 2 205 ? -4.442  -11.105 -25.464 1.00 20.77 ? 206 PHE B CD1   1 
ATOM   4127 C  CD2   . PHE D 2 205 ? -2.852  -9.989  -24.063 1.00 28.12 ? 206 PHE B CD2   1 
ATOM   4128 C  CE1   . PHE D 2 205 ? -5.063  -11.653 -24.342 1.00 22.57 ? 206 PHE B CE1   1 
ATOM   4129 C  CE2   . PHE D 2 205 ? -3.466  -10.533 -22.929 1.00 26.32 ? 206 PHE B CE2   1 
ATOM   4130 C  CZ    . PHE D 2 205 ? -4.575  -11.368 -23.074 1.00 21.81 ? 206 PHE B CZ    1 
ATOM   4131 N  N     . ASP D 2 206 ? -2.445  -10.451 -29.720 1.00 25.11 ? 207 ASP B N     1 
ATOM   4132 C  CA    . ASP D 2 206 ? -2.265  -9.984  -31.095 1.00 26.03 ? 207 ASP B CA    1 
ATOM   4133 C  C     . ASP D 2 206 ? -2.672  -8.531  -31.279 1.00 28.41 ? 207 ASP B C     1 
ATOM   4134 O  O     . ASP D 2 206 ? -2.238  -7.874  -32.223 1.00 27.57 ? 207 ASP B O     1 
ATOM   4135 C  CB    . ASP D 2 206 ? -3.058  -10.865 -32.064 1.00 29.75 ? 207 ASP B CB    1 
ATOM   4136 C  CG    . ASP D 2 206 ? -2.407  -12.220 -32.286 1.00 38.62 ? 207 ASP B CG    1 
ATOM   4137 O  OD1   . ASP D 2 206 ? -1.157  -12.291 -32.292 1.00 48.44 ? 207 ASP B OD1   1 
ATOM   4138 O  OD2   . ASP D 2 206 ? -3.143  -13.214 -32.456 1.00 46.85 ? 207 ASP B OD2   1 
ATOM   4139 N  N     . SER D 2 207 ? -3.508  -8.031  -30.378 1.00 26.39 ? 208 SER B N     1 
ATOM   4140 C  CA    . SER D 2 207 ? -3.951  -6.658  -30.468 1.00 24.50 ? 208 SER B CA    1 
ATOM   4141 C  C     . SER D 2 207 ? -4.529  -6.234  -29.133 1.00 25.74 ? 208 SER B C     1 
ATOM   4142 O  O     . SER D 2 207 ? -4.818  -7.072  -28.270 1.00 27.64 ? 208 SER B O     1 
ATOM   4143 C  CB    . SER D 2 207 ? -5.025  -6.526  -31.545 1.00 23.30 ? 208 SER B CB    1 
ATOM   4144 O  OG    . SER D 2 207 ? -6.234  -7.135  -31.117 1.00 17.13 ? 208 SER B OG    1 
ATOM   4145 N  N     . GLU D 2 208 ? -4.703  -4.930  -28.976 1.00 23.09 ? 209 GLU B N     1 
ATOM   4146 C  CA    . GLU D 2 208 ? -5.265  -4.367  -27.771 1.00 22.60 ? 209 GLU B CA    1 
ATOM   4147 C  C     . GLU D 2 208 ? -6.725  -4.799  -27.664 1.00 21.49 ? 209 GLU B C     1 
ATOM   4148 O  O     . GLU D 2 208 ? -7.247  -4.995  -26.570 1.00 20.18 ? 209 GLU B O     1 
ATOM   4149 C  CB    . GLU D 2 208 ? -5.146  -2.852  -27.816 1.00 23.81 ? 209 GLU B CB    1 
ATOM   4150 C  CG    . GLU D 2 208 ? -5.692  -2.148  -26.593 1.00 27.96 ? 209 GLU B CG    1 
ATOM   4151 C  CD    . GLU D 2 208 ? -5.265  -0.697  -26.535 1.00 34.45 ? 209 GLU B CD    1 
ATOM   4152 O  OE1   . GLU D 2 208 ? -5.200  -0.036  -27.597 1.00 32.56 ? 209 GLU B OE1   1 
ATOM   4153 O  OE2   . GLU D 2 208 ? -4.991  -0.216  -25.420 1.00 29.92 ? 209 GLU B OE2   1 
ATOM   4154 N  N     . ASP D 2 209 ? -7.381  -4.953  -28.808 1.00 22.33 ? 210 ASP B N     1 
ATOM   4155 C  CA    . ASP D 2 209 ? -8.775  -5.394  -28.844 1.00 20.52 ? 210 ASP B CA    1 
ATOM   4156 C  C     . ASP D 2 209 ? -8.898  -6.822  -28.260 1.00 17.72 ? 210 ASP B C     1 
ATOM   4157 O  O     . ASP D 2 209 ? -9.864  -7.146  -27.566 1.00 16.73 ? 210 ASP B O     1 
ATOM   4158 C  CB    . ASP D 2 209 ? -9.284  -5.373  -30.284 1.00 29.97 ? 210 ASP B CB    1 
ATOM   4159 C  CG    . ASP D 2 209 ? -10.745 -5.720  -30.383 1.00 36.58 ? 210 ASP B CG    1 
ATOM   4160 O  OD1   . ASP D 2 209 ? -11.556 -5.062  -29.698 1.00 46.11 ? 210 ASP B OD1   1 
ATOM   4161 O  OD2   . ASP D 2 209 ? -11.079 -6.651  -31.144 1.00 43.44 ? 210 ASP B OD2   1 
ATOM   4162 N  N     . GLU D 2 210 ? -7.916  -7.669  -28.550 1.00 14.83 ? 211 GLU B N     1 
ATOM   4163 C  CA    . GLU D 2 210 ? -7.919  -9.026  -28.030 1.00 18.78 ? 211 GLU B CA    1 
ATOM   4164 C  C     . GLU D 2 210 ? -7.648  -9.010  -26.519 1.00 21.02 ? 211 GLU B C     1 
ATOM   4165 O  O     . GLU D 2 210 ? -8.285  -9.738  -25.757 1.00 18.69 ? 211 GLU B O     1 
ATOM   4166 C  CB    . GLU D 2 210 ? -6.862  -9.880  -28.727 1.00 14.28 ? 211 GLU B CB    1 
ATOM   4167 C  CG    . GLU D 2 210 ? -6.955  -11.334 -28.302 1.00 15.64 ? 211 GLU B CG    1 
ATOM   4168 C  CD    . GLU D 2 210 ? -6.052  -12.251 -29.071 1.00 20.89 ? 211 GLU B CD    1 
ATOM   4169 O  OE1   . GLU D 2 210 ? -4.834  -12.003 -29.123 1.00 23.59 ? 211 GLU B OE1   1 
ATOM   4170 O  OE2   . GLU D 2 210 ? -6.569  -13.236 -29.626 1.00 27.57 ? 211 GLU B OE2   1 
ATOM   4171 N  N     . PHE D 2 211 ? -6.693  -8.175  -26.106 1.00 22.10 ? 212 PHE B N     1 
ATOM   4172 C  CA    . PHE D 2 211 ? -6.323  -8.011  -24.706 1.00 16.80 ? 212 PHE B CA    1 
ATOM   4173 C  C     . PHE D 2 211 ? -7.564  -7.647  -23.906 1.00 13.09 ? 212 PHE B C     1 
ATOM   4174 O  O     . PHE D 2 211 ? -7.840  -8.237  -22.861 1.00 13.79 ? 212 PHE B O     1 
ATOM   4175 C  CB    . PHE D 2 211 ? -5.263  -6.907  -24.581 1.00 23.16 ? 212 PHE B CB    1 
ATOM   4176 C  CG    . PHE D 2 211 ? -5.244  -6.228  -23.240 1.00 18.09 ? 212 PHE B CG    1 
ATOM   4177 C  CD1   . PHE D 2 211 ? -4.778  -6.895  -22.113 1.00 27.32 ? 212 PHE B CD1   1 
ATOM   4178 C  CD2   . PHE D 2 211 ? -5.720  -4.935  -23.100 1.00 17.62 ? 212 PHE B CD2   1 
ATOM   4179 C  CE1   . PHE D 2 211 ? -4.793  -6.283  -20.860 1.00 24.15 ? 212 PHE B CE1   1 
ATOM   4180 C  CE2   . PHE D 2 211 ? -5.741  -4.309  -21.847 1.00 21.77 ? 212 PHE B CE2   1 
ATOM   4181 C  CZ    . PHE D 2 211 ? -5.276  -4.988  -20.725 1.00 16.29 ? 212 PHE B CZ    1 
ATOM   4182 N  N     . LEU D 2 212 ? -8.310  -6.674  -24.411 1.00 10.56 ? 213 LEU B N     1 
ATOM   4183 C  CA    . LEU D 2 212 ? -9.516  -6.211  -23.751 1.00 12.33 ? 213 LEU B CA    1 
ATOM   4184 C  C     . LEU D 2 212 ? -10.624 -7.255  -23.692 1.00 18.83 ? 213 LEU B C     1 
ATOM   4185 O  O     . LEU D 2 212 ? -11.216 -7.479  -22.629 1.00 18.47 ? 213 LEU B O     1 
ATOM   4186 C  CB    . LEU D 2 212 ? -10.023 -4.933  -24.415 1.00 16.06 ? 213 LEU B CB    1 
ATOM   4187 C  CG    . LEU D 2 212 ? -9.327  -3.625  -24.016 1.00 22.66 ? 213 LEU B CG    1 
ATOM   4188 C  CD1   . LEU D 2 212 ? -9.878  -2.487  -24.864 1.00 18.98 ? 213 LEU B CD1   1 
ATOM   4189 C  CD2   . LEU D 2 212 ? -9.563  -3.348  -22.528 1.00 15.28 ? 213 LEU B CD2   1 
ATOM   4190 N  N     . ASP D 2 213 ? -10.910 -7.893  -24.824 1.00 18.11 ? 214 ASP B N     1 
ATOM   4191 C  CA    . ASP D 2 213 ? -11.950 -8.919  -24.868 1.00 17.61 ? 214 ASP B CA    1 
ATOM   4192 C  C     . ASP D 2 213 ? -11.608 -10.076 -23.914 1.00 14.50 ? 214 ASP B C     1 
ATOM   4193 O  O     . ASP D 2 213 ? -12.465 -10.565 -23.183 1.00 12.45 ? 214 ASP B O     1 
ATOM   4194 C  CB    . ASP D 2 213 ? -12.108 -9.447  -26.292 1.00 18.30 ? 214 ASP B CB    1 
ATOM   4195 C  CG    . ASP D 2 213 ? -13.323 -10.337 -26.446 1.00 21.53 ? 214 ASP B CG    1 
ATOM   4196 O  OD1   . ASP D 2 213 ? -14.451 -9.840  -26.226 1.00 19.12 ? 214 ASP B OD1   1 
ATOM   4197 O  OD2   . ASP D 2 213 ? -13.150 -11.529 -26.785 1.00 23.85 ? 214 ASP B OD2   1 
ATOM   4198 N  N     . TYR D 2 214 ? -10.350 -10.502 -23.926 1.00 11.04 ? 215 TYR B N     1 
ATOM   4199 C  CA    . TYR D 2 214 ? -9.900  -11.561 -23.060 1.00 8.85  ? 215 TYR B CA    1 
ATOM   4200 C  C     . TYR D 2 214 ? -10.223 -11.215 -21.600 1.00 14.45 ? 215 TYR B C     1 
ATOM   4201 O  O     . TYR D 2 214 ? -10.901 -11.979 -20.904 1.00 12.36 ? 215 TYR B O     1 
ATOM   4202 C  CB    . TYR D 2 214 ? -8.392  -11.770 -23.233 1.00 9.78  ? 215 TYR B CB    1 
ATOM   4203 C  CG    . TYR D 2 214 ? -7.853  -12.926 -22.425 1.00 20.21 ? 215 TYR B CG    1 
ATOM   4204 C  CD1   . TYR D 2 214 ? -7.474  -12.754 -21.082 1.00 23.35 ? 215 TYR B CD1   1 
ATOM   4205 C  CD2   . TYR D 2 214 ? -7.766  -14.209 -22.977 1.00 16.02 ? 215 TYR B CD2   1 
ATOM   4206 C  CE1   . TYR D 2 214 ? -7.032  -13.830 -20.309 1.00 16.60 ? 215 TYR B CE1   1 
ATOM   4207 C  CE2   . TYR D 2 214 ? -7.327  -15.287 -22.213 1.00 20.82 ? 215 TYR B CE2   1 
ATOM   4208 C  CZ    . TYR D 2 214 ? -6.968  -15.093 -20.879 1.00 20.46 ? 215 TYR B CZ    1 
ATOM   4209 O  OH    . TYR D 2 214 ? -6.592  -16.174 -20.121 1.00 13.51 ? 215 TYR B OH    1 
ATOM   4210 N  N     . TRP D 2 215 ? -9.760  -10.058 -21.134 1.00 13.49 ? 216 TRP B N     1 
ATOM   4211 C  CA    . TRP D 2 215 ? -9.988  -9.686  -19.742 1.00 16.67 ? 216 TRP B CA    1 
ATOM   4212 C  C     . TRP D 2 215 ? -11.402 -9.277  -19.344 1.00 18.51 ? 216 TRP B C     1 
ATOM   4213 O  O     . TRP D 2 215 ? -11.756 -9.324  -18.162 1.00 19.91 ? 216 TRP B O     1 
ATOM   4214 C  CB    . TRP D 2 215 ? -8.923  -8.680  -19.296 1.00 7.33  ? 216 TRP B CB    1 
ATOM   4215 C  CG    . TRP D 2 215 ? -7.593  -9.379  -19.171 1.00 7.91  ? 216 TRP B CG    1 
ATOM   4216 C  CD1   . TRP D 2 215 ? -6.534  -9.295  -20.027 1.00 5.65  ? 216 TRP B CD1   1 
ATOM   4217 C  CD2   . TRP D 2 215 ? -7.202  -10.295 -18.141 1.00 7.28  ? 216 TRP B CD2   1 
ATOM   4218 N  NE1   . TRP D 2 215 ? -5.506  -10.104 -19.596 1.00 14.45 ? 216 TRP B NE1   1 
ATOM   4219 C  CE2   . TRP D 2 215 ? -5.891  -10.729 -18.440 1.00 12.76 ? 216 TRP B CE2   1 
ATOM   4220 C  CE3   . TRP D 2 215 ? -7.834  -10.792 -16.992 1.00 13.01 ? 216 TRP B CE3   1 
ATOM   4221 C  CZ2   . TRP D 2 215 ? -5.203  -11.631 -17.638 1.00 7.69  ? 216 TRP B CZ2   1 
ATOM   4222 C  CZ3   . TRP D 2 215 ? -7.148  -11.691 -16.194 1.00 7.46  ? 216 TRP B CZ3   1 
ATOM   4223 C  CH2   . TRP D 2 215 ? -5.845  -12.101 -16.523 1.00 14.66 ? 216 TRP B CH2   1 
ATOM   4224 N  N     . ARG D 2 216 ? -12.214 -8.892  -20.323 1.00 20.20 ? 217 ARG B N     1 
ATOM   4225 C  CA    . ARG D 2 216 ? -13.606 -8.526  -20.065 1.00 18.81 ? 217 ARG B CA    1 
ATOM   4226 C  C     . ARG D 2 216 ? -14.486 -9.760  -19.883 1.00 19.80 ? 217 ARG B C     1 
ATOM   4227 O  O     . ARG D 2 216 ? -15.600 -9.650  -19.361 1.00 23.34 ? 217 ARG B O     1 
ATOM   4228 C  CB    . ARG D 2 216 ? -14.183 -7.734  -21.231 1.00 17.99 ? 217 ARG B CB    1 
ATOM   4229 C  CG    . ARG D 2 216 ? -13.843 -6.281  -21.241 1.00 26.51 ? 217 ARG B CG    1 
ATOM   4230 C  CD    . ARG D 2 216 ? -14.386 -5.637  -22.487 1.00 24.35 ? 217 ARG B CD    1 
ATOM   4231 N  NE    . ARG D 2 216 ? -14.303 -4.187  -22.401 1.00 25.89 ? 217 ARG B NE    1 
ATOM   4232 C  CZ    . ARG D 2 216 ? -13.916 -3.395  -23.394 1.00 30.09 ? 217 ARG B CZ    1 
ATOM   4233 N  NH1   . ARG D 2 216 ? -13.576 -3.908  -24.567 1.00 30.83 ? 217 ARG B NH1   1 
ATOM   4234 N  NH2   . ARG D 2 216 ? -13.870 -2.083  -23.211 1.00 30.69 ? 217 ARG B NH2   1 
ATOM   4235 N  N     . ASN D 2 217 ? -13.994 -10.921 -20.321 1.00 18.26 ? 218 ASN B N     1 
ATOM   4236 C  CA    . ASN D 2 217 ? -14.763 -12.161 -20.244 1.00 21.91 ? 218 ASN B CA    1 
ATOM   4237 C  C     . ASN D 2 217 ? -14.120 -13.255 -19.393 1.00 21.09 ? 218 ASN B C     1 
ATOM   4238 O  O     . ASN D 2 217 ? -14.605 -14.384 -19.336 1.00 22.54 ? 218 ASN B O     1 
ATOM   4239 C  CB    . ASN D 2 217 ? -15.056 -12.673 -21.667 1.00 16.60 ? 218 ASN B CB    1 
ATOM   4240 C  CG    . ASN D 2 217 ? -16.001 -11.746 -22.430 1.00 23.67 ? 218 ASN B CG    1 
ATOM   4241 O  OD1   . ASN D 2 217 ? -17.214 -11.770 -22.230 1.00 25.42 ? 218 ASN B OD1   1 
ATOM   4242 N  ND2   . ASN D 2 217 ? -15.443 -10.919 -23.303 1.00 20.73 ? 218 ASN B ND2   1 
ATOM   4243 N  N     . TYR D 2 218 ? -13.026 -12.908 -18.731 1.00 20.14 ? 219 TYR B N     1 
ATOM   4244 C  CA    . TYR D 2 218 ? -12.305 -13.829 -17.858 1.00 21.77 ? 219 TYR B CA    1 
ATOM   4245 C  C     . TYR D 2 218 ? -13.147 -14.051 -16.584 1.00 22.01 ? 219 TYR B C     1 
ATOM   4246 O  O     . TYR D 2 218 ? -13.719 -13.102 -16.041 1.00 19.67 ? 219 TYR B O     1 
ATOM   4247 C  CB    . TYR D 2 218 ? -10.964 -13.192 -17.509 1.00 18.06 ? 219 TYR B CB    1 
ATOM   4248 C  CG    . TYR D 2 218 ? -9.992  -14.032 -16.721 1.00 15.52 ? 219 TYR B CG    1 
ATOM   4249 C  CD1   . TYR D 2 218 ? -9.071  -14.852 -17.373 1.00 14.94 ? 219 TYR B CD1   1 
ATOM   4250 C  CD2   . TYR D 2 218 ? -9.934  -13.951 -15.328 1.00 18.52 ? 219 TYR B CD2   1 
ATOM   4251 C  CE1   . TYR D 2 218 ? -8.105  -15.565 -16.662 1.00 21.13 ? 219 TYR B CE1   1 
ATOM   4252 C  CE2   . TYR D 2 218 ? -8.967  -14.664 -14.601 1.00 17.08 ? 219 TYR B CE2   1 
ATOM   4253 C  CZ    . TYR D 2 218 ? -8.055  -15.462 -15.277 1.00 17.55 ? 219 TYR B CZ    1 
ATOM   4254 O  OH    . TYR D 2 218 ? -7.064  -16.127 -14.589 1.00 23.46 ? 219 TYR B OH    1 
ATOM   4255 N  N     . GLU D 2 219 ? -13.239 -15.294 -16.120 1.00 20.35 ? 220 GLU B N     1 
ATOM   4256 C  CA    . GLU D 2 219 ? -14.007 -15.589 -14.903 1.00 23.99 ? 220 GLU B CA    1 
ATOM   4257 C  C     . GLU D 2 219 ? -13.117 -15.547 -13.649 1.00 26.34 ? 220 GLU B C     1 
ATOM   4258 O  O     . GLU D 2 219 ? -11.923 -15.859 -13.714 1.00 24.10 ? 220 GLU B O     1 
ATOM   4259 C  CB    . GLU D 2 219 ? -14.689 -16.957 -15.019 1.00 24.98 ? 220 GLU B CB    1 
ATOM   4260 C  CG    . GLU D 2 219 ? -15.682 -17.081 -16.181 1.00 32.06 ? 220 GLU B CG    1 
ATOM   4261 C  CD    . GLU D 2 219 ? -16.987 -16.333 -15.960 1.00 29.86 ? 220 GLU B CD    1 
ATOM   4262 O  OE1   . GLU D 2 219 ? -17.348 -16.044 -14.804 1.00 37.58 ? 220 GLU B OE1   1 
ATOM   4263 O  OE2   . GLU D 2 219 ? -17.665 -16.033 -16.958 1.00 37.92 ? 220 GLU B OE2   1 
ATOM   4264 N  N     . ARG D 2 220 ? -13.713 -15.169 -12.519 1.00 29.51 ? 221 ARG B N     1 
ATOM   4265 C  CA    . ARG D 2 220 ? -13.019 -15.042 -11.233 1.00 33.13 ? 221 ARG B CA    1 
ATOM   4266 C  C     . ARG D 2 220 ? -12.391 -16.306 -10.624 1.00 36.22 ? 221 ARG B C     1 
ATOM   4267 O  O     . ARG D 2 220 ? -11.290 -16.254 -10.061 1.00 37.67 ? 221 ARG B O     1 
ATOM   4268 C  CB    . ARG D 2 220 ? -13.964 -14.407 -10.204 1.00 34.58 ? 221 ARG B CB    1 
ATOM   4269 C  CG    . ARG D 2 220 ? -14.409 -13.002 -10.557 1.00 34.36 ? 221 ARG B CG    1 
ATOM   4270 C  CD    . ARG D 2 220 ? -15.381 -12.446 -9.530  1.00 36.21 ? 221 ARG B CD    1 
ATOM   4271 N  NE    . ARG D 2 220 ? -15.864 -11.107 -9.882  1.00 46.37 ? 221 ARG B NE    1 
ATOM   4272 C  CZ    . ARG D 2 220 ? -16.794 -10.855 -10.806 1.00 49.54 ? 221 ARG B CZ    1 
ATOM   4273 N  NH1   . ARG D 2 220 ? -17.349 -11.845 -11.493 1.00 57.25 ? 221 ARG B NH1   1 
ATOM   4274 N  NH2   . ARG D 2 220 ? -17.175 -9.607  -11.053 1.00 48.03 ? 221 ARG B NH2   1 
ATOM   4275 N  N     . THR D 2 221 ? -13.082 -17.435 -10.731 1.00 39.80 ? 222 THR B N     1 
ATOM   4276 C  CA    . THR D 2 221 ? -12.586 -18.688 -10.164 1.00 41.48 ? 222 THR B CA    1 
ATOM   4277 C  C     . THR D 2 221 ? -12.283 -19.690 -11.256 1.00 41.31 ? 222 THR B C     1 
ATOM   4278 O  O     . THR D 2 221 ? -12.913 -19.646 -12.318 1.00 39.00 ? 222 THR B O     1 
ATOM   4279 C  CB    . THR D 2 221 ? -13.630 -19.315 -9.224  1.00 39.07 ? 222 THR B CB    1 
ATOM   4280 O  OG1   . THR D 2 221 ? -14.898 -19.397 -9.896  1.00 43.38 ? 222 THR B OG1   1 
ATOM   4281 C  CG2   . THR D 2 221 ? -13.768 -18.486 -7.965  1.00 39.49 ? 222 THR B CG2   1 
ATOM   4282 N  N     . SER D 2 222 ? -11.335 -20.594 -11.006 1.00 41.39 ? 223 SER B N     1 
ATOM   4283 C  CA    . SER D 2 222 ? -11.001 -21.612 -12.001 1.00 45.76 ? 223 SER B CA    1 
ATOM   4284 C  C     . SER D 2 222 ? -12.212 -22.513 -12.271 1.00 45.10 ? 223 SER B C     1 
ATOM   4285 O  O     . SER D 2 222 ? -12.353 -23.058 -13.365 1.00 45.88 ? 223 SER B O     1 
ATOM   4286 C  CB    . SER D 2 222 ? -9.783  -22.436 -11.567 1.00 45.14 ? 223 SER B CB    1 
ATOM   4287 O  OG    . SER D 2 222 ? -9.756  -22.589 -10.167 1.00 47.39 ? 223 SER B OG    1 
ATOM   4288 N  N     . GLN D 2 223 ? -13.090 -22.650 -11.279 1.00 46.69 ? 224 GLN B N     1 
ATOM   4289 C  CA    . GLN D 2 223 ? -14.289 -23.468 -11.420 1.00 50.57 ? 224 GLN B CA    1 
ATOM   4290 C  C     . GLN D 2 223 ? -15.135 -22.936 -12.570 1.00 50.61 ? 224 GLN B C     1 
ATOM   4291 O  O     . GLN D 2 223 ? -15.650 -23.704 -13.387 1.00 52.79 ? 224 GLN B O     1 
ATOM   4292 C  CB    . GLN D 2 223 ? -15.119 -23.447 -10.131 1.00 55.07 ? 224 GLN B CB    1 
ATOM   4293 C  CG    . GLN D 2 223 ? -16.281 -24.435 -10.144 1.00 66.38 ? 224 GLN B CG    1 
ATOM   4294 C  CD    . GLN D 2 223 ? -17.267 -24.220 -9.005  1.00 75.00 ? 224 GLN B CD    1 
ATOM   4295 O  OE1   . GLN D 2 223 ? -16.962 -24.491 -7.839  1.00 79.73 ? 224 GLN B OE1   1 
ATOM   4296 N  NE2   . GLN D 2 223 ? -18.459 -23.732 -9.339  1.00 72.69 ? 224 GLN B NE2   1 
ATOM   4297 N  N     . LEU D 2 224 ? -15.277 -21.617 -12.627 1.00 48.93 ? 225 LEU B N     1 
ATOM   4298 C  CA    . LEU D 2 224 ? -16.056 -20.982 -13.682 1.00 47.95 ? 225 LEU B CA    1 
ATOM   4299 C  C     . LEU D 2 224 ? -15.264 -20.835 -14.986 1.00 45.75 ? 225 LEU B C     1 
ATOM   4300 O  O     . LEU D 2 224 ? -15.847 -20.781 -16.069 1.00 46.37 ? 225 LEU B O     1 
ATOM   4301 C  CB    . LEU D 2 224 ? -16.569 -19.627 -13.199 1.00 47.55 ? 225 LEU B CB    1 
ATOM   4302 C  CG    . LEU D 2 224 ? -17.669 -19.733 -12.140 1.00 50.24 ? 225 LEU B CG    1 
ATOM   4303 C  CD1   . LEU D 2 224 ? -17.950 -18.370 -11.545 1.00 49.95 ? 225 LEU B CD1   1 
ATOM   4304 C  CD2   . LEU D 2 224 ? -18.928 -20.324 -12.764 1.00 48.55 ? 225 LEU B CD2   1 
ATOM   4305 N  N     . ARG D 2 225 ? -13.939 -20.779 -14.876 1.00 42.36 ? 226 ARG B N     1 
ATOM   4306 C  CA    . ARG D 2 225 ? -13.076 -20.646 -16.040 1.00 40.67 ? 226 ARG B CA    1 
ATOM   4307 C  C     . ARG D 2 225 ? -12.919 -21.942 -16.810 1.00 43.69 ? 226 ARG B C     1 
ATOM   4308 O  O     . ARG D 2 225 ? -12.678 -21.923 -18.015 1.00 43.75 ? 226 ARG B O     1 
ATOM   4309 C  CB    . ARG D 2 225 ? -11.694 -20.151 -15.638 1.00 32.56 ? 226 ARG B CB    1 
ATOM   4310 C  CG    . ARG D 2 225 ? -11.670 -18.711 -15.206 1.00 26.11 ? 226 ARG B CG    1 
ATOM   4311 C  CD    . ARG D 2 225 ? -10.300 -18.118 -15.390 1.00 16.17 ? 226 ARG B CD    1 
ATOM   4312 N  NE    . ARG D 2 225 ? -9.282  -18.703 -14.516 1.00 28.97 ? 226 ARG B NE    1 
ATOM   4313 C  CZ    . ARG D 2 225 ? -9.146  -18.434 -13.216 1.00 28.82 ? 226 ARG B CZ    1 
ATOM   4314 N  NH1   . ARG D 2 225 ? -9.979  -17.599 -12.600 1.00 21.88 ? 226 ARG B NH1   1 
ATOM   4315 N  NH2   . ARG D 2 225 ? -8.174  -19.011 -12.526 1.00 29.26 ? 226 ARG B NH2   1 
ATOM   4316 N  N     . ASN D 2 226 ? -13.051 -23.070 -16.120 1.00 44.39 ? 227 ASN B N     1 
ATOM   4317 C  CA    . ASN D 2 226 ? -12.909 -24.370 -16.766 1.00 45.08 ? 227 ASN B CA    1 
ATOM   4318 C  C     . ASN D 2 226 ? -13.929 -24.656 -17.861 1.00 44.27 ? 227 ASN B C     1 
ATOM   4319 O  O     . ASN D 2 226 ? -13.688 -25.495 -18.725 1.00 45.79 ? 227 ASN B O     1 
ATOM   4320 C  CB    . ASN D 2 226 ? -12.910 -25.489 -15.730 1.00 49.23 ? 227 ASN B CB    1 
ATOM   4321 C  CG    . ASN D 2 226 ? -11.518 -25.786 -15.206 1.00 56.57 ? 227 ASN B CG    1 
ATOM   4322 O  OD1   . ASN D 2 226 ? -10.589 -24.990 -15.380 1.00 55.71 ? 227 ASN B OD1   1 
ATOM   4323 N  ND2   . ASN D 2 226 ? -11.362 -26.937 -14.562 1.00 61.96 ? 227 ASN B ND2   1 
ATOM   4324 N  N     . ASP D 2 227 ? -15.062 -23.962 -17.828 1.00 43.83 ? 228 ASP B N     1 
ATOM   4325 C  CA    . ASP D 2 227 ? -16.087 -24.135 -18.851 1.00 44.87 ? 228 ASP B CA    1 
ATOM   4326 C  C     . ASP D 2 227 ? -16.098 -22.930 -19.779 1.00 42.99 ? 228 ASP B C     1 
ATOM   4327 O  O     . ASP D 2 227 ? -17.121 -22.618 -20.393 1.00 46.91 ? 228 ASP B O     1 
ATOM   4328 C  CB    . ASP D 2 227 ? -17.465 -24.304 -18.209 1.00 58.55 ? 228 ASP B CB    1 
ATOM   4329 C  CG    . ASP D 2 227 ? -17.614 -25.634 -17.502 1.00 72.50 ? 228 ASP B CG    1 
ATOM   4330 O  OD1   . ASP D 2 227 ? -17.551 -26.681 -18.189 1.00 76.98 ? 228 ASP B OD1   1 
ATOM   4331 O  OD2   . ASP D 2 227 ? -17.790 -25.630 -16.263 1.00 78.14 ? 228 ASP B OD2   1 
ATOM   4332 N  N     . LYS D 2 228 ? -14.957 -22.252 -19.869 1.00 37.23 ? 229 LYS B N     1 
ATOM   4333 C  CA    . LYS D 2 228 ? -14.813 -21.071 -20.713 1.00 30.24 ? 229 LYS B CA    1 
ATOM   4334 C  C     . LYS D 2 228 ? -13.375 -21.089 -21.214 1.00 26.40 ? 229 LYS B C     1 
ATOM   4335 O  O     . LYS D 2 228 ? -13.091 -21.693 -22.238 1.00 29.98 ? 229 LYS B O     1 
ATOM   4336 C  CB    . LYS D 2 228 ? -15.102 -19.812 -19.899 1.00 31.26 ? 229 LYS B CB    1 
ATOM   4337 C  CG    . LYS D 2 228 ? -15.810 -18.741 -20.688 1.00 34.71 ? 229 LYS B CG    1 
ATOM   4338 C  CD    . LYS D 2 228 ? -16.152 -17.567 -19.824 1.00 32.47 ? 229 LYS B CD    1 
ATOM   4339 C  CE    . LYS D 2 228 ? -16.872 -16.531 -20.637 1.00 36.04 ? 229 LYS B CE    1 
ATOM   4340 N  NZ    . LYS D 2 228 ? -17.262 -15.378 -19.800 1.00 34.07 ? 229 LYS B NZ    1 
ATOM   4341 N  N     . TYR D 2 229 ? -12.460 -20.444 -20.505 1.00 21.61 ? 230 TYR B N     1 
ATOM   4342 C  CA    . TYR D 2 229 ? -11.060 -20.474 -20.919 1.00 21.82 ? 230 TYR B CA    1 
ATOM   4343 C  C     . TYR D 2 229 ? -10.169 -20.104 -19.751 1.00 20.30 ? 230 TYR B C     1 
ATOM   4344 O  O     . TYR D 2 229 ? -10.570 -19.322 -18.885 1.00 18.62 ? 230 TYR B O     1 
ATOM   4345 C  CB    . TYR D 2 229 ? -10.804 -19.543 -22.124 1.00 15.58 ? 230 TYR B CB    1 
ATOM   4346 C  CG    . TYR D 2 229 ? -11.192 -18.089 -21.930 1.00 9.21  ? 230 TYR B CG    1 
ATOM   4347 C  CD1   . TYR D 2 229 ? -10.278 -17.162 -21.405 1.00 14.34 ? 230 TYR B CD1   1 
ATOM   4348 C  CD2   . TYR D 2 229 ? -12.463 -17.636 -22.282 1.00 13.77 ? 230 TYR B CD2   1 
ATOM   4349 C  CE1   . TYR D 2 229 ? -10.628 -15.810 -21.239 1.00 5.52  ? 230 TYR B CE1   1 
ATOM   4350 C  CE2   . TYR D 2 229 ? -12.821 -16.299 -22.122 1.00 10.32 ? 230 TYR B CE2   1 
ATOM   4351 C  CZ    . TYR D 2 229 ? -11.896 -15.400 -21.602 1.00 14.59 ? 230 TYR B CZ    1 
ATOM   4352 O  OH    . TYR D 2 229 ? -12.250 -14.094 -21.457 1.00 11.28 ? 230 TYR B OH    1 
ATOM   4353 N  N     . ASN D 2 230 ? -8.969  -20.671 -19.740 1.00 21.30 ? 231 ASN B N     1 
ATOM   4354 C  CA    . ASN D 2 230 ? -7.988  -20.446 -18.681 1.00 23.71 ? 231 ASN B CA    1 
ATOM   4355 C  C     . ASN D 2 230 ? -6.687  -19.858 -19.202 1.00 24.26 ? 231 ASN B C     1 
ATOM   4356 O  O     . ASN D 2 230 ? -5.788  -19.549 -18.417 1.00 23.11 ? 231 ASN B O     1 
ATOM   4357 C  CB    . ASN D 2 230 ? -7.650  -21.761 -17.960 1.00 31.66 ? 231 ASN B CB    1 
ATOM   4358 C  CG    . ASN D 2 230 ? -8.657  -22.122 -16.886 1.00 46.11 ? 231 ASN B CG    1 
ATOM   4359 O  OD1   . ASN D 2 230 ? -8.672  -21.524 -15.809 1.00 58.21 ? 231 ASN B OD1   1 
ATOM   4360 N  ND2   . ASN D 2 230 ? -9.504  -23.107 -17.173 1.00 54.53 ? 231 ASN B ND2   1 
ATOM   4361 N  N     . ASN D 2 231 ? -6.578  -19.714 -20.520 1.00 21.54 ? 232 ASN B N     1 
ATOM   4362 C  CA    . ASN D 2 231 ? -5.367  -19.171 -21.133 1.00 21.64 ? 232 ASN B CA    1 
ATOM   4363 C  C     . ASN D 2 231 ? -5.702  -18.682 -22.540 1.00 21.49 ? 232 ASN B C     1 
ATOM   4364 O  O     . ASN D 2 231 ? -6.834  -18.849 -23.002 1.00 21.84 ? 232 ASN B O     1 
ATOM   4365 C  CB    . ASN D 2 231 ? -4.247  -20.222 -21.165 1.00 21.88 ? 232 ASN B CB    1 
ATOM   4366 C  CG    . ASN D 2 231 ? -4.649  -21.494 -21.910 1.00 28.57 ? 232 ASN B CG    1 
ATOM   4367 O  OD1   . ASN D 2 231 ? -5.130  -21.445 -23.040 1.00 43.06 ? 232 ASN B OD1   1 
ATOM   4368 N  ND2   . ASN D 2 231 ? -4.455  -22.633 -21.274 1.00 23.31 ? 232 ASN B ND2   1 
ATOM   4369 N  N     . ILE D 2 232 ? -4.724  -18.087 -23.215 1.00 20.57 ? 233 ILE B N     1 
ATOM   4370 C  CA    . ILE D 2 232 ? -4.942  -17.548 -24.549 1.00 21.35 ? 233 ILE B CA    1 
ATOM   4371 C  C     . ILE D 2 232 ? -5.427  -18.635 -25.543 1.00 22.98 ? 233 ILE B C     1 
ATOM   4372 O  O     . ILE D 2 232 ? -6.373  -18.397 -26.308 1.00 22.02 ? 233 ILE B O     1 
ATOM   4373 C  CB    . ILE D 2 232 ? -3.655  -16.777 -25.045 1.00 20.78 ? 233 ILE B CB    1 
ATOM   4374 C  CG1   . ILE D 2 232 ? -3.957  -15.928 -26.283 1.00 18.19 ? 233 ILE B CG1   1 
ATOM   4375 C  CG2   . ILE D 2 232 ? -2.519  -17.734 -25.331 1.00 18.95 ? 233 ILE B CG2   1 
ATOM   4376 C  CD1   . ILE D 2 232 ? -5.088  -14.957 -26.112 1.00 21.47 ? 233 ILE B CD1   1 
ATOM   4377 N  N     . SER D 2 233 ? -4.809  -19.819 -25.515 1.00 20.63 ? 234 SER B N     1 
ATOM   4378 C  CA    . SER D 2 233 ? -5.195  -20.909 -26.421 1.00 18.96 ? 234 SER B CA    1 
ATOM   4379 C  C     . SER D 2 233 ? -6.673  -21.217 -26.304 1.00 18.59 ? 234 SER B C     1 
ATOM   4380 O  O     . SER D 2 233 ? -7.424  -21.185 -27.289 1.00 20.52 ? 234 SER B O     1 
ATOM   4381 C  CB    . SER D 2 233 ? -4.414  -22.186 -26.105 1.00 21.63 ? 234 SER B CB    1 
ATOM   4382 O  OG    . SER D 2 233 ? -3.035  -22.019 -26.369 1.00 29.35 ? 234 SER B OG    1 
ATOM   4383 N  N     . GLU D 2 234 ? -7.086  -21.505 -25.079 1.00 15.90 ? 235 GLU B N     1 
ATOM   4384 C  CA    . GLU D 2 234 ? -8.463  -21.836 -24.797 1.00 16.32 ? 235 GLU B CA    1 
ATOM   4385 C  C     . GLU D 2 234 ? -9.407  -20.696 -25.127 1.00 17.59 ? 235 GLU B C     1 
ATOM   4386 O  O     . GLU D 2 234 ? -10.570 -20.913 -25.465 1.00 19.28 ? 235 GLU B O     1 
ATOM   4387 C  CB    . GLU D 2 234 ? -8.590  -22.232 -23.333 1.00 22.11 ? 235 GLU B CB    1 
ATOM   4388 C  CG    . GLU D 2 234 ? -7.719  -23.418 -23.002 1.00 21.17 ? 235 GLU B CG    1 
ATOM   4389 C  CD    . GLU D 2 234 ? -7.909  -23.917 -21.594 1.00 29.09 ? 235 GLU B CD    1 
ATOM   4390 O  OE1   . GLU D 2 234 ? -8.869  -23.487 -20.908 1.00 28.17 ? 235 GLU B OE1   1 
ATOM   4391 O  OE2   . GLU D 2 234 ? -7.083  -24.750 -21.177 1.00 36.12 ? 235 GLU B OE2   1 
ATOM   4392 N  N     . TYR D 2 235 ? -8.910  -19.474 -25.022 1.00 16.80 ? 236 TYR B N     1 
ATOM   4393 C  CA    . TYR D 2 235 ? -9.728  -18.314 -25.318 1.00 19.28 ? 236 TYR B CA    1 
ATOM   4394 C  C     . TYR D 2 235 ? -9.981  -18.251 -26.830 1.00 17.63 ? 236 TYR B C     1 
ATOM   4395 O  O     . TYR D 2 235 ? -11.095 -17.972 -27.289 1.00 14.54 ? 236 TYR B O     1 
ATOM   4396 C  CB    . TYR D 2 235 ? -9.005  -17.051 -24.849 1.00 18.50 ? 236 TYR B CB    1 
ATOM   4397 C  CG    . TYR D 2 235 ? -9.508  -15.810 -25.523 1.00 11.31 ? 236 TYR B CG    1 
ATOM   4398 C  CD1   . TYR D 2 235 ? -10.709 -15.225 -25.131 1.00 11.49 ? 236 TYR B CD1   1 
ATOM   4399 C  CD2   . TYR D 2 235 ? -8.781  -15.222 -26.560 1.00 14.35 ? 236 TYR B CD2   1 
ATOM   4400 C  CE1   . TYR D 2 235 ? -11.184 -14.077 -25.754 1.00 16.71 ? 236 TYR B CE1   1 
ATOM   4401 C  CE2   . TYR D 2 235 ? -9.242  -14.071 -27.195 1.00 15.06 ? 236 TYR B CE2   1 
ATOM   4402 C  CZ    . TYR D 2 235 ? -10.443 -13.504 -26.789 1.00 17.57 ? 236 TYR B CZ    1 
ATOM   4403 O  OH    . TYR D 2 235 ? -10.902 -12.370 -27.421 1.00 15.69 ? 236 TYR B OH    1 
ATOM   4404 N  N     . ARG D 2 236 ? -8.928  -18.503 -27.596 1.00 18.77 ? 237 ARG B N     1 
ATOM   4405 C  CA    . ARG D 2 236 ? -9.026  -18.491 -29.045 1.00 19.80 ? 237 ARG B CA    1 
ATOM   4406 C  C     . ARG D 2 236 ? -9.946  -19.624 -29.505 1.00 21.05 ? 237 ARG B C     1 
ATOM   4407 O  O     . ARG D 2 236 ? -10.734 -19.460 -30.446 1.00 20.33 ? 237 ARG B O     1 
ATOM   4408 C  CB    . ARG D 2 236 ? -7.624  -18.573 -29.647 1.00 15.27 ? 237 ARG B CB    1 
ATOM   4409 C  CG    . ARG D 2 236 ? -6.948  -17.199 -29.585 1.00 14.34 ? 237 ARG B CG    1 
ATOM   4410 C  CD    . ARG D 2 236 ? -5.499  -17.213 -30.041 1.00 20.70 ? 237 ARG B CD    1 
ATOM   4411 N  NE    . ARG D 2 236 ? -4.892  -15.888 -29.869 1.00 29.63 ? 237 ARG B NE    1 
ATOM   4412 C  CZ    . ARG D 2 236 ? -3.597  -15.677 -29.644 1.00 27.93 ? 237 ARG B CZ    1 
ATOM   4413 N  NH1   . ARG D 2 236 ? -2.757  -16.700 -29.563 1.00 27.32 ? 237 ARG B NH1   1 
ATOM   4414 N  NH2   . ARG D 2 236 ? -3.140  -14.441 -29.497 1.00 25.71 ? 237 ARG B NH2   1 
ATOM   4415 N  N     . ASN D 2 237 ? -9.863  -20.762 -28.820 1.00 19.51 ? 238 ASN B N     1 
ATOM   4416 C  CA    . ASN D 2 237 ? -10.733 -21.887 -29.130 1.00 17.42 ? 238 ASN B CA    1 
ATOM   4417 C  C     . ASN D 2 237 ? -12.180 -21.532 -28.761 1.00 20.03 ? 238 ASN B C     1 
ATOM   4418 O  O     . ASN D 2 237 ? -13.127 -21.952 -29.428 1.00 18.93 ? 238 ASN B O     1 
ATOM   4419 C  CB    . ASN D 2 237 ? -10.274 -23.127 -28.386 1.00 16.81 ? 238 ASN B CB    1 
ATOM   4420 C  CG    . ASN D 2 237 ? -10.870 -24.381 -28.958 1.00 30.70 ? 238 ASN B CG    1 
ATOM   4421 O  OD1   . ASN D 2 237 ? -12.033 -24.694 -28.715 1.00 27.40 ? 238 ASN B OD1   1 
ATOM   4422 N  ND2   . ASN D 2 237 ? -10.080 -25.111 -29.733 1.00 35.25 ? 238 ASN B ND2   1 
ATOM   4423 N  N     . TRP D 2 238 ? -12.342 -20.742 -27.701 1.00 19.14 ? 239 TRP B N     1 
ATOM   4424 C  CA    . TRP D 2 238 ? -13.654 -20.284 -27.231 1.00 19.82 ? 239 TRP B CA    1 
ATOM   4425 C  C     . TRP D 2 238 ? -14.290 -19.332 -28.273 1.00 20.92 ? 239 TRP B C     1 
ATOM   4426 O  O     . TRP D 2 238 ? -15.515 -19.313 -28.455 1.00 22.09 ? 239 TRP B O     1 
ATOM   4427 C  CB    . TRP D 2 238 ? -13.478 -19.584 -25.862 1.00 20.10 ? 239 TRP B CB    1 
ATOM   4428 C  CG    . TRP D 2 238 ? -14.717 -18.949 -25.262 1.00 17.02 ? 239 TRP B CG    1 
ATOM   4429 C  CD1   . TRP D 2 238 ? -15.744 -19.590 -24.620 1.00 23.82 ? 239 TRP B CD1   1 
ATOM   4430 C  CD2   . TRP D 2 238 ? -15.033 -17.551 -25.214 1.00 17.04 ? 239 TRP B CD2   1 
ATOM   4431 N  NE1   . TRP D 2 238 ? -16.670 -18.679 -24.175 1.00 18.82 ? 239 TRP B NE1   1 
ATOM   4432 C  CE2   . TRP D 2 238 ? -16.259 -17.421 -24.525 1.00 15.99 ? 239 TRP B CE2   1 
ATOM   4433 C  CE3   . TRP D 2 238 ? -14.397 -16.396 -25.682 1.00 20.06 ? 239 TRP B CE3   1 
ATOM   4434 C  CZ2   . TRP D 2 238 ? -16.860 -16.185 -24.292 1.00 18.30 ? 239 TRP B CZ2   1 
ATOM   4435 C  CZ3   . TRP D 2 238 ? -14.995 -15.165 -25.449 1.00 24.90 ? 239 TRP B CZ3   1 
ATOM   4436 C  CH2   . TRP D 2 238 ? -16.216 -15.071 -24.758 1.00 17.28 ? 239 TRP B CH2   1 
ATOM   4437 N  N     . ILE D 2 239 ? -13.457 -18.538 -28.947 1.00 19.98 ? 240 ILE B N     1 
ATOM   4438 C  CA    . ILE D 2 239 ? -13.936 -17.618 -29.988 1.00 23.72 ? 240 ILE B CA    1 
ATOM   4439 C  C     . ILE D 2 239 ? -14.465 -18.457 -31.171 1.00 24.41 ? 240 ILE B C     1 
ATOM   4440 O  O     . ILE D 2 239 ? -15.562 -18.207 -31.695 1.00 25.72 ? 240 ILE B O     1 
ATOM   4441 C  CB    . ILE D 2 239 ? -12.795 -16.676 -30.487 1.00 25.20 ? 240 ILE B CB    1 
ATOM   4442 C  CG1   . ILE D 2 239 ? -12.369 -15.705 -29.372 1.00 20.64 ? 240 ILE B CG1   1 
ATOM   4443 C  CG2   . ILE D 2 239 ? -13.254 -15.901 -31.729 1.00 20.78 ? 240 ILE B CG2   1 
ATOM   4444 C  CD1   . ILE D 2 239 ? -13.466 -14.758 -28.922 1.00 30.46 ? 240 ILE B CD1   1 
ATOM   4445 N  N     . TYR D 2 240 ? -13.678 -19.452 -31.580 1.00 23.16 ? 241 TYR B N     1 
ATOM   4446 C  CA    . TYR D 2 240 ? -14.072 -20.354 -32.658 1.00 23.65 ? 241 TYR B CA    1 
ATOM   4447 C  C     . TYR D 2 240 ? -15.440 -21.010 -32.356 1.00 24.88 ? 241 TYR B C     1 
ATOM   4448 O  O     . TYR D 2 240 ? -16.311 -21.064 -33.227 1.00 26.19 ? 241 TYR B O     1 
ATOM   4449 C  CB    . TYR D 2 240 ? -12.994 -21.425 -32.863 1.00 22.67 ? 241 TYR B CB    1 
ATOM   4450 C  CG    . TYR D 2 240 ? -13.492 -22.647 -33.604 1.00 32.60 ? 241 TYR B CG    1 
ATOM   4451 C  CD1   . TYR D 2 240 ? -13.586 -22.656 -34.997 1.00 32.83 ? 241 TYR B CD1   1 
ATOM   4452 C  CD2   . TYR D 2 240 ? -13.900 -23.787 -32.907 1.00 31.00 ? 241 TYR B CD2   1 
ATOM   4453 C  CE1   . TYR D 2 240 ? -14.078 -23.771 -35.678 1.00 32.19 ? 241 TYR B CE1   1 
ATOM   4454 C  CE2   . TYR D 2 240 ? -14.392 -24.905 -33.575 1.00 30.61 ? 241 TYR B CE2   1 
ATOM   4455 C  CZ    . TYR D 2 240 ? -14.479 -24.891 -34.961 1.00 33.92 ? 241 TYR B CZ    1 
ATOM   4456 O  OH    . TYR D 2 240 ? -14.964 -25.998 -35.621 1.00 24.11 ? 241 TYR B OH    1 
ATOM   4457 N  N     . ARG D 2 241 ? -15.630 -21.500 -31.129 1.00 23.82 ? 242 ARG B N     1 
ATOM   4458 C  CA    . ARG D 2 241 ? -16.888 -22.137 -30.718 1.00 24.20 ? 242 ARG B CA    1 
ATOM   4459 C  C     . ARG D 2 241 ? -18.112 -21.216 -30.740 1.00 26.16 ? 242 ARG B C     1 
ATOM   4460 O  O     . ARG D 2 241 ? -19.250 -21.675 -30.594 1.00 28.23 ? 242 ARG B O     1 
ATOM   4461 C  CB    . ARG D 2 241 ? -16.740 -22.744 -29.326 1.00 22.32 ? 242 ARG B CB    1 
ATOM   4462 C  CG    . ARG D 2 241 ? -16.010 -24.068 -29.309 1.00 34.99 ? 242 ARG B CG    1 
ATOM   4463 C  CD    . ARG D 2 241 ? -15.138 -24.225 -28.070 1.00 41.76 ? 242 ARG B CD    1 
ATOM   4464 N  NE    . ARG D 2 241 ? -15.780 -23.743 -26.848 1.00 42.65 ? 242 ARG B NE    1 
ATOM   4465 C  CZ    . ARG D 2 241 ? -15.114 -23.418 -25.742 1.00 37.23 ? 242 ARG B CZ    1 
ATOM   4466 N  NH1   . ARG D 2 241 ? -13.795 -23.524 -25.702 1.00 28.48 ? 242 ARG B NH1   1 
ATOM   4467 N  NH2   . ARG D 2 241 ? -15.764 -22.986 -24.672 1.00 46.47 ? 242 ARG B NH2   1 
ATOM   4468 N  N     . GLY D 2 242 ? -17.885 -19.919 -30.923 1.00 24.13 ? 243 GLY B N     1 
ATOM   4469 C  CA    . GLY D 2 242 ? -18.994 -18.987 -30.959 1.00 24.04 ? 243 GLY B CA    1 
ATOM   4470 C  C     . GLY D 2 242 ? -19.212 -18.255 -29.650 1.00 27.19 ? 243 GLY B C     1 
ATOM   4471 O  O     . GLY D 2 242 ? -20.311 -17.751 -29.406 1.00 25.67 ? 243 GLY B O     1 
ATOM   4472 N  N     . ARG D 2 243 ? -18.164 -18.197 -28.821 1.00 29.50 ? 244 ARG B N     1 
ATOM   4473 C  CA    . ARG D 2 243 ? -18.186 -17.515 -27.516 1.00 31.67 ? 244 ARG B CA    1 
ATOM   4474 C  C     . ARG D 2 243 ? -19.208 -18.146 -26.580 1.00 32.24 ? 244 ARG B C     1 
ATOM   4475 O  O     . ARG D 2 243 ? -20.031 -17.468 -25.970 1.00 30.95 ? 244 ARG B O     1 
ATOM   4476 C  CB    . ARG D 2 243 ? -18.447 -16.004 -27.682 1.00 26.48 ? 244 ARG B CB    1 
ATOM   4477 C  CG    . ARG D 2 243 ? -17.472 -15.318 -28.651 1.00 30.40 ? 244 ARG B CG    1 
ATOM   4478 C  CD    . ARG D 2 243 ? -17.877 -13.885 -28.972 1.00 33.11 ? 244 ARG B CD    1 
ATOM   4479 N  NE    . ARG D 2 243 ? -17.785 -13.016 -27.800 1.00 40.49 ? 244 ARG B NE    1 
ATOM   4480 C  CZ    . ARG D 2 243 ? -16.691 -12.347 -27.433 1.00 38.34 ? 244 ARG B CZ    1 
ATOM   4481 N  NH1   . ARG D 2 243 ? -15.574 -12.425 -28.148 1.00 30.00 ? 244 ARG B NH1   1 
ATOM   4482 N  NH2   . ARG D 2 243 ? -16.717 -11.592 -26.342 1.00 30.77 ? 244 ARG B NH2   1 
ATOM   4483 N  N     . LYS D 2 244 ? -19.126 -19.468 -26.487 1.00 37.78 ? 245 LYS B N     1 
ATOM   4484 C  CA    . LYS D 2 244 ? -19.992 -20.286 -25.641 1.00 39.19 ? 245 LYS B CA    1 
ATOM   4485 C  C     . LYS D 2 244 ? -19.288 -21.640 -25.465 1.00 38.49 ? 245 LYS B C     1 
ATOM   4486 O  O     . LYS D 2 244 ? -18.287 -21.908 -26.179 1.00 35.27 ? 245 LYS B O     1 
ATOM   4487 C  CB    . LYS D 2 244 ? -21.370 -20.493 -26.299 1.00 45.02 ? 245 LYS B CB    1 
ATOM   4488 C  CG    . LYS D 2 244 ? -21.371 -21.457 -27.492 1.00 49.32 ? 245 LYS B CG    1 
ATOM   4489 C  CD    . LYS D 2 244 ? -22.756 -21.638 -28.077 1.00 55.47 ? 245 LYS B CD    1 
ATOM   4490 C  CE    . LYS D 2 244 ? -23.219 -20.375 -28.773 1.00 61.99 ? 245 LYS B CE    1 
ATOM   4491 N  NZ    . LYS D 2 244 ? -24.601 -20.521 -29.306 1.00 72.61 ? 245 LYS B NZ    1 
ATOM   4492 O  OXT   . LYS D 2 244 ? -19.747 -22.422 -24.611 1.00 43.85 ? 245 LYS B OXT   1 
HETATM 4493 MG MG    . MG  E 3 .   ? -1.718  2.905   -9.881  1.00 32.02 ? 301 MG  B MG    1 
HETATM 4494 MG MG    . MG  F 3 .   ? -0.835  7.590   -7.278  1.00 41.68 ? 302 MG  B MG    1 
HETATM 4495 O  O     . HOH G 4 .   ? -9.387  -13.644 3.637   1.00 28.69 ? 16  HOH C O     1 
HETATM 4496 O  O     . HOH G 4 .   ? -3.540  -8.556  9.736   1.00 26.87 ? 17  HOH C O     1 
HETATM 4497 O  O     . HOH G 4 .   ? -4.771  -7.026  6.412   1.00 26.28 ? 21  HOH C O     1 
HETATM 4498 O  O     . HOH G 4 .   ? -8.690  3.291   7.973   1.00 17.58 ? 54  HOH C O     1 
HETATM 4499 O  O     . HOH G 4 .   ? -7.008  2.553   -0.790  1.00 20.34 ? 82  HOH C O     1 
HETATM 4500 O  O     . HOH G 4 .   ? -10.139 -15.174 -2.708  1.00 41.79 ? 85  HOH C O     1 
HETATM 4501 O  O     . HOH G 4 .   ? -3.632  -15.269 -8.696  1.00 34.74 ? 95  HOH C O     1 
HETATM 4502 O  O     . HOH G 4 .   ? 1.945   -5.328  9.781   1.00 41.22 ? 97  HOH C O     1 
HETATM 4503 O  O     . HOH G 4 .   ? -10.921 5.067   5.170   1.00 31.67 ? 106 HOH C O     1 
HETATM 4504 O  O     . HOH G 4 .   ? -2.976  1.598   1.865   1.00 32.87 ? 127 HOH C O     1 
HETATM 4505 O  O     . HOH G 4 .   ? -2.370  -15.932 1.513   1.00 37.68 ? 194 HOH C O     1 
HETATM 4506 O  O     . HOH G 4 .   ? -15.710 1.019   6.005   1.00 41.68 ? 220 HOH C O     1 
HETATM 4507 O  O     . HOH G 4 .   ? -13.240 -22.432 -7.918  1.00 36.62 ? 282 HOH C O     1 
HETATM 4508 O  O     . HOH H 4 .   ? -9.637  -5.031  -8.355  1.00 13.85 ? 12  HOH D O     1 
HETATM 4509 O  O     . HOH H 4 .   ? -6.870  -0.834  -12.152 1.00 21.83 ? 13  HOH D O     1 
HETATM 4510 O  O     . HOH H 4 .   ? -15.576 -8.727  -2.368  1.00 31.02 ? 14  HOH D O     1 
HETATM 4511 O  O     . HOH H 4 .   ? -18.485 -8.564  2.274   1.00 45.17 ? 15  HOH D O     1 
HETATM 4512 O  O     . HOH H 4 .   ? -3.693  3.180   -10.472 1.00 19.67 ? 16  HOH D O     1 
HETATM 4513 O  O     . HOH H 4 .   ? -14.132 1.510   -4.214  1.00 27.56 ? 17  HOH D O     1 
HETATM 4514 O  O     . HOH H 4 .   ? 4.097   1.451   -7.628  1.00 29.41 ? 18  HOH D O     1 
HETATM 4515 O  O     . HOH H 4 .   ? -21.897 -2.707  -0.673  1.00 43.77 ? 19  HOH D O     1 
HETATM 4516 O  O     . HOH H 4 .   ? -16.193 -3.263  5.149   1.00 43.79 ? 20  HOH D O     1 
HETATM 4517 O  O     . HOH H 4 .   ? 1.880   -2.743  -1.936  1.00 39.29 ? 21  HOH D O     1 
HETATM 4518 O  O     . HOH H 4 .   ? -21.918 -6.574  -5.284  1.00 45.67 ? 22  HOH D O     1 
HETATM 4519 O  O     . HOH H 4 .   ? -3.384  1.836   -2.512  1.00 45.16 ? 23  HOH D O     1 
HETATM 4520 O  O     . HOH H 4 .   ? -4.496  0.457   -11.507 1.00 32.66 ? 24  HOH D O     1 
HETATM 4521 O  O     . HOH I 4 .   ? -3.161  -6.130  23.758  1.00 22.92 ? 246 HOH A O     1 
HETATM 4522 O  O     . HOH I 4 .   ? -15.138 -8.788  5.645   1.00 18.20 ? 247 HOH A O     1 
HETATM 4523 O  O     . HOH I 4 .   ? -5.158  -6.609  21.822  1.00 19.34 ? 248 HOH A O     1 
HETATM 4524 O  O     . HOH I 4 .   ? -6.200  -12.988 11.987  1.00 23.31 ? 249 HOH A O     1 
HETATM 4525 O  O     . HOH I 4 .   ? -7.192  -10.666 5.432   1.00 19.73 ? 250 HOH A O     1 
HETATM 4526 O  O     . HOH I 4 .   ? -6.440  1.718   9.224   1.00 21.74 ? 251 HOH A O     1 
HETATM 4527 O  O     . HOH I 4 .   ? -13.645 -2.599  21.895  1.00 19.87 ? 252 HOH A O     1 
HETATM 4528 O  O     . HOH I 4 .   ? -21.078 -13.892 12.586  1.00 19.98 ? 253 HOH A O     1 
HETATM 4529 O  O     . HOH I 4 .   ? -7.621  -12.430 7.431   1.00 26.09 ? 254 HOH A O     1 
HETATM 4530 O  O     . HOH I 4 .   ? -1.662  -13.100 21.400  1.00 21.77 ? 255 HOH A O     1 
HETATM 4531 O  O     . HOH I 4 .   ? -15.887 -11.081 2.823   1.00 29.35 ? 256 HOH A O     1 
HETATM 4532 O  O     . HOH I 4 .   ? -11.176 -5.848  -6.012  1.00 21.11 ? 257 HOH A O     1 
HETATM 4533 O  O     . HOH I 4 .   ? -17.605 -17.163 6.902   1.00 32.03 ? 258 HOH A O     1 
HETATM 4534 O  O     . HOH I 4 .   ? 13.261  4.472   9.504   1.00 23.49 ? 259 HOH A O     1 
HETATM 4535 O  O     . HOH I 4 .   ? 7.842   -8.193  13.698  1.00 22.90 ? 260 HOH A O     1 
HETATM 4536 O  O     . HOH I 4 .   ? 6.104   17.129  0.839   1.00 25.51 ? 261 HOH A O     1 
HETATM 4537 O  O     . HOH I 4 .   ? -12.861 0.062   9.782   1.00 23.02 ? 262 HOH A O     1 
HETATM 4538 O  O     . HOH I 4 .   ? -11.944 -16.004 23.382  1.00 43.99 ? 263 HOH A O     1 
HETATM 4539 O  O     . HOH I 4 .   ? -4.728  -3.964  8.318   1.00 21.16 ? 264 HOH A O     1 
HETATM 4540 O  O     . HOH I 4 .   ? -16.768 -3.997  31.536  1.00 29.40 ? 265 HOH A O     1 
HETATM 4541 O  O     . HOH I 4 .   ? 7.379   13.689  -5.579  1.00 28.68 ? 266 HOH A O     1 
HETATM 4542 O  O     . HOH I 4 .   ? -22.656 -19.684 25.434  1.00 28.61 ? 267 HOH A O     1 
HETATM 4543 O  O     . HOH I 4 .   ? -2.833  -10.410 24.254  1.00 28.12 ? 268 HOH A O     1 
HETATM 4544 O  O     . HOH I 4 .   ? -8.983  -8.489  28.623  1.00 29.72 ? 269 HOH A O     1 
HETATM 4545 O  O     . HOH I 4 .   ? -5.657  -8.828  13.170  1.00 35.83 ? 270 HOH A O     1 
HETATM 4546 O  O     . HOH I 4 .   ? -11.998 -17.667 21.153  1.00 38.62 ? 271 HOH A O     1 
HETATM 4547 O  O     . HOH I 4 .   ? -21.253 -7.003  10.889  1.00 28.32 ? 272 HOH A O     1 
HETATM 4548 O  O     . HOH I 4 .   ? 9.890   9.072   26.411  1.00 40.35 ? 273 HOH A O     1 
HETATM 4549 O  O     . HOH I 4 .   ? -24.658 -12.738 27.134  1.00 27.22 ? 274 HOH A O     1 
HETATM 4550 O  O     . HOH I 4 .   ? 1.896   -7.792  -0.232  1.00 30.09 ? 275 HOH A O     1 
HETATM 4551 O  O     . HOH I 4 .   ? -16.516 -1.728  13.706  1.00 36.71 ? 276 HOH A O     1 
HETATM 4552 O  O     . HOH I 4 .   ? -10.927 7.230   9.192   1.00 22.72 ? 277 HOH A O     1 
HETATM 4553 O  O     . HOH I 4 .   ? -1.432  -4.072  27.209  1.00 38.70 ? 278 HOH A O     1 
HETATM 4554 O  O     . HOH I 4 .   ? -13.074 0.785   7.100   1.00 32.43 ? 279 HOH A O     1 
HETATM 4555 O  O     . HOH I 4 .   ? -17.723 -13.982 25.259  1.00 24.84 ? 280 HOH A O     1 
HETATM 4556 O  O     . HOH I 4 .   ? 6.654   -3.139  8.772   1.00 53.68 ? 281 HOH A O     1 
HETATM 4557 O  O     . HOH I 4 .   ? -3.611  -9.302  17.096  1.00 30.40 ? 282 HOH A O     1 
HETATM 4558 O  O     . HOH I 4 .   ? -5.208  -10.760 21.111  1.00 34.98 ? 283 HOH A O     1 
HETATM 4559 O  O     . HOH I 4 .   ? -3.272  -19.204 18.540  1.00 40.23 ? 284 HOH A O     1 
HETATM 4560 O  O     . HOH I 4 .   ? -3.763  -7.317  26.018  1.00 34.87 ? 285 HOH A O     1 
HETATM 4561 O  O     . HOH I 4 .   ? -30.956 -13.763 32.793  1.00 28.47 ? 286 HOH A O     1 
HETATM 4562 O  O     . HOH I 4 .   ? -13.211 -1.874  25.013  1.00 33.25 ? 287 HOH A O     1 
HETATM 4563 O  O     . HOH I 4 .   ? -19.457 -12.216 26.221  1.00 34.59 ? 288 HOH A O     1 
HETATM 4564 O  O     . HOH I 4 .   ? -5.120  -17.933 17.317  1.00 29.96 ? 289 HOH A O     1 
HETATM 4565 O  O     . HOH I 4 .   ? -11.408 13.826  19.720  1.00 31.76 ? 290 HOH A O     1 
HETATM 4566 O  O     . HOH I 4 .   ? 8.906   -13.026 9.589   1.00 40.36 ? 291 HOH A O     1 
HETATM 4567 O  O     . HOH I 4 .   ? -1.012  13.654  19.124  1.00 34.55 ? 292 HOH A O     1 
HETATM 4568 O  O     . HOH I 4 .   ? -11.796 -0.644  27.240  1.00 40.82 ? 293 HOH A O     1 
HETATM 4569 O  O     . HOH I 4 .   ? -18.273 2.428   16.557  1.00 30.93 ? 294 HOH A O     1 
HETATM 4570 O  O     . HOH I 4 .   ? -28.818 -12.953 17.987  1.00 41.65 ? 295 HOH A O     1 
HETATM 4571 O  O     . HOH I 4 .   ? 4.913   -1.505  29.447  1.00 35.77 ? 296 HOH A O     1 
HETATM 4572 O  O     . HOH I 4 .   ? -4.178  -12.813 22.460  1.00 34.82 ? 297 HOH A O     1 
HETATM 4573 O  O     . HOH I 4 .   ? -5.044  -8.675  19.459  1.00 40.90 ? 298 HOH A O     1 
HETATM 4574 O  O     . HOH I 4 .   ? -22.974 -2.237  17.981  1.00 35.29 ? 299 HOH A O     1 
HETATM 4575 O  O     . HOH I 4 .   ? 9.669   -10.422 26.879  1.00 38.68 ? 300 HOH A O     1 
HETATM 4576 O  O     . HOH I 4 .   ? 6.122   14.027  25.461  1.00 53.29 ? 301 HOH A O     1 
HETATM 4577 O  O     . HOH I 4 .   ? -5.763  6.790   28.260  1.00 34.88 ? 302 HOH A O     1 
HETATM 4578 O  O     . HOH I 4 .   ? 0.360   2.855   8.728   1.00 29.39 ? 303 HOH A O     1 
HETATM 4579 O  O     . HOH I 4 .   ? 0.075   -2.014  9.889   1.00 35.12 ? 304 HOH A O     1 
HETATM 4580 O  O     . HOH I 4 .   ? 8.888   21.689  4.578   1.00 38.11 ? 305 HOH A O     1 
HETATM 4581 O  O     . HOH I 4 .   ? -11.295 2.702   6.872   1.00 40.61 ? 306 HOH A O     1 
HETATM 4582 O  O     . HOH I 4 .   ? -18.600 -7.948  5.130   1.00 55.64 ? 307 HOH A O     1 
HETATM 4583 O  O     . HOH I 4 .   ? -25.174 -3.536  18.784  1.00 44.13 ? 308 HOH A O     1 
HETATM 4584 O  O     . HOH I 4 .   ? 8.607   9.387   29.172  1.00 47.61 ? 309 HOH A O     1 
HETATM 4585 O  O     . HOH I 4 .   ? 8.249   19.322  -12.714 1.00 42.56 ? 310 HOH A O     1 
HETATM 4586 O  O     . HOH I 4 .   ? 1.479   14.674  18.839  1.00 43.69 ? 311 HOH A O     1 
HETATM 4587 O  O     . HOH I 4 .   ? -5.337  -17.580 21.454  1.00 39.55 ? 312 HOH A O     1 
HETATM 4588 O  O     . HOH I 4 .   ? 4.066   -21.301 20.337  1.00 39.48 ? 313 HOH A O     1 
HETATM 4589 O  O     . HOH I 4 .   ? -19.666 -9.141  27.784  1.00 41.95 ? 314 HOH A O     1 
HETATM 4590 O  O     . HOH I 4 .   ? -0.290  -2.056  28.674  1.00 49.34 ? 315 HOH A O     1 
HETATM 4591 O  O     . HOH I 4 .   ? 0.097   -14.958 2.077   1.00 31.44 ? 316 HOH A O     1 
HETATM 4592 O  O     . HOH I 4 .   ? -21.885 -1.275  15.361  1.00 42.31 ? 317 HOH A O     1 
HETATM 4593 O  O     . HOH I 4 .   ? -5.874  -0.012  27.630  1.00 41.12 ? 318 HOH A O     1 
HETATM 4594 O  O     . HOH I 4 .   ? 4.840   15.443  12.366  1.00 47.37 ? 319 HOH A O     1 
HETATM 4595 O  O     . HOH I 4 .   ? 0.814   21.841  5.080   1.00 47.77 ? 320 HOH A O     1 
HETATM 4596 O  O     . HOH I 4 .   ? 3.326   -4.373  7.667   1.00 68.00 ? 321 HOH A O     1 
HETATM 4597 O  O     . HOH I 4 .   ? -14.298 -13.200 1.671   1.00 47.62 ? 322 HOH A O     1 
HETATM 4598 O  O     . HOH I 4 .   ? -29.311 -6.222  16.658  1.00 43.13 ? 323 HOH A O     1 
HETATM 4599 O  O     . HOH I 4 .   ? 3.693   18.126  -1.031  1.00 41.32 ? 324 HOH A O     1 
HETATM 4600 O  O     . HOH I 4 .   ? -6.858  -20.441 17.157  1.00 36.93 ? 325 HOH A O     1 
HETATM 4601 O  O     . HOH J 4 .   ? -11.055 -2.809  -14.752 1.00 19.48 ? 303 HOH B O     1 
HETATM 4602 O  O     . HOH J 4 .   ? -2.807  -0.559  -23.387 1.00 18.82 ? 304 HOH B O     1 
HETATM 4603 O  O     . HOH J 4 .   ? -12.651 -17.295 -18.481 1.00 23.81 ? 305 HOH B O     1 
HETATM 4604 O  O     . HOH J 4 .   ? -8.466  -13.324 -10.179 1.00 16.13 ? 306 HOH B O     1 
HETATM 4605 O  O     . HOH J 4 .   ? 0.322   -9.245  -24.484 1.00 13.71 ? 307 HOH B O     1 
HETATM 4606 O  O     . HOH J 4 .   ? -9.265  3.550   -23.100 1.00 17.92 ? 308 HOH B O     1 
HETATM 4607 O  O     . HOH J 4 .   ? -5.588  -3.272  -8.135  1.00 17.56 ? 309 HOH B O     1 
HETATM 4608 O  O     . HOH J 4 .   ? -2.207  -3.311  -9.428  1.00 16.53 ? 310 HOH B O     1 
HETATM 4609 O  O     . HOH J 4 .   ? 17.723  3.863   3.426   1.00 21.93 ? 311 HOH B O     1 
HETATM 4610 O  O     . HOH J 4 .   ? -5.524  10.493  -12.883 1.00 17.49 ? 312 HOH B O     1 
HETATM 4611 O  O     . HOH J 4 .   ? -7.082  -0.600  -23.523 1.00 33.97 ? 313 HOH B O     1 
HETATM 4612 O  O     . HOH J 4 .   ? -16.547 -27.739 -33.946 1.00 16.42 ? 314 HOH B O     1 
HETATM 4613 O  O     . HOH J 4 .   ? -13.169 -7.410  -7.658  1.00 21.98 ? 315 HOH B O     1 
HETATM 4614 O  O     . HOH J 4 .   ? -3.371  -3.138  -30.779 1.00 27.60 ? 316 HOH B O     1 
HETATM 4615 O  O     . HOH J 4 .   ? 8.204   -10.420 -9.825  1.00 26.41 ? 317 HOH B O     1 
HETATM 4616 O  O     . HOH J 4 .   ? -5.578  2.418   -25.533 1.00 32.86 ? 318 HOH B O     1 
HETATM 4617 O  O     . HOH J 4 .   ? -3.557  -0.633  -30.008 1.00 21.81 ? 319 HOH B O     1 
HETATM 4618 O  O     . HOH J 4 .   ? -7.701  -11.618 2.589   1.00 26.27 ? 320 HOH B O     1 
HETATM 4619 O  O     . HOH J 4 .   ? 11.420  1.578   -21.759 1.00 26.30 ? 321 HOH B O     1 
HETATM 4620 O  O     . HOH J 4 .   ? -6.750  -2.371  -15.260 1.00 23.35 ? 322 HOH B O     1 
HETATM 4621 O  O     . HOH J 4 .   ? -11.130 -5.353  -10.661 1.00 24.49 ? 323 HOH B O     1 
HETATM 4622 O  O     . HOH J 4 .   ? -1.983  1.947   -24.676 1.00 17.54 ? 324 HOH B O     1 
HETATM 4623 O  O     . HOH J 4 .   ? 1.300   -11.235 -12.485 1.00 34.82 ? 325 HOH B O     1 
HETATM 4624 O  O     . HOH J 4 .   ? -6.069  -18.208 -15.938 1.00 36.56 ? 326 HOH B O     1 
HETATM 4625 O  O     . HOH J 4 .   ? -16.511 -20.030 -35.785 1.00 32.44 ? 327 HOH B O     1 
HETATM 4626 O  O     . HOH J 4 .   ? -3.075  1.969   -27.162 1.00 27.90 ? 328 HOH B O     1 
HETATM 4627 O  O     . HOH J 4 .   ? -5.602  -0.655  -21.217 1.00 25.49 ? 329 HOH B O     1 
HETATM 4628 O  O     . HOH J 4 .   ? -11.343 -14.160 -7.558  1.00 32.65 ? 330 HOH B O     1 
HETATM 4629 O  O     . HOH J 4 .   ? -1.755  2.110   -17.525 1.00 27.89 ? 331 HOH B O     1 
HETATM 4630 O  O     . HOH J 4 .   ? -10.456 -11.793 -30.069 1.00 31.57 ? 332 HOH B O     1 
HETATM 4631 O  O     . HOH J 4 .   ? 3.237   -5.305  -9.628  1.00 20.29 ? 333 HOH B O     1 
HETATM 4632 O  O     . HOH J 4 .   ? -5.103  15.402  -25.192 1.00 39.36 ? 334 HOH B O     1 
HETATM 4633 O  O     . HOH J 4 .   ? -16.346 -14.756 -12.744 1.00 38.79 ? 335 HOH B O     1 
HETATM 4634 O  O     . HOH J 4 .   ? -0.140  -13.801 -16.897 1.00 26.78 ? 336 HOH B O     1 
HETATM 4635 O  O     . HOH J 4 .   ? -2.371  -20.636 -23.938 1.00 51.75 ? 337 HOH B O     1 
HETATM 4636 O  O     . HOH J 4 .   ? -15.992 4.772   -9.114  1.00 30.74 ? 338 HOH B O     1 
HETATM 4637 O  O     . HOH J 4 .   ? -15.179 -0.173  -20.593 1.00 39.00 ? 339 HOH B O     1 
HETATM 4638 O  O     . HOH J 4 .   ? 1.116   -11.730 -9.541  1.00 29.52 ? 340 HOH B O     1 
HETATM 4639 O  O     . HOH J 4 .   ? 0.253   2.568   -9.181  1.00 22.83 ? 341 HOH B O     1 
HETATM 4640 O  O     . HOH J 4 .   ? -2.114  3.438   -7.900  1.00 30.18 ? 342 HOH B O     1 
HETATM 4641 O  O     . HOH J 4 .   ? -2.671  -0.539  -14.781 1.00 28.82 ? 343 HOH B O     1 
HETATM 4642 O  O     . HOH J 4 .   ? -9.690  -15.873 -5.961  1.00 42.21 ? 344 HOH B O     1 
HETATM 4643 O  O     . HOH J 4 .   ? -6.260  0.301   -18.792 1.00 34.59 ? 345 HOH B O     1 
HETATM 4644 O  O     . HOH J 4 .   ? -15.464 1.904   -22.557 1.00 41.40 ? 346 HOH B O     1 
HETATM 4645 O  O     . HOH J 4 .   ? 4.029   -14.955 -19.793 1.00 35.79 ? 347 HOH B O     1 
HETATM 4646 O  O     . HOH J 4 .   ? 9.619   15.225  -28.727 1.00 49.70 ? 348 HOH B O     1 
HETATM 4647 O  O     . HOH J 4 .   ? -0.984  9.480   -8.379  1.00 32.28 ? 349 HOH B O     1 
HETATM 4648 O  O     . HOH J 4 .   ? -9.754  -9.421  -31.223 1.00 43.53 ? 350 HOH B O     1 
HETATM 4649 O  O     . HOH J 4 .   ? -8.114  -16.525 -9.832  1.00 44.71 ? 351 HOH B O     1 
HETATM 4650 O  O     . HOH J 4 .   ? -12.846 -8.808  -5.156  1.00 25.90 ? 352 HOH B O     1 
HETATM 4651 O  O     . HOH J 4 .   ? -3.894  5.758   -0.194  1.00 30.09 ? 353 HOH B O     1 
HETATM 4652 O  O     . HOH J 4 .   ? 4.330   -7.816  -9.223  1.00 38.89 ? 354 HOH B O     1 
HETATM 4653 O  O     . HOH J 4 .   ? 12.700  12.182  -27.727 1.00 46.40 ? 355 HOH B O     1 
HETATM 4654 O  O     . HOH J 4 .   ? -4.084  16.571  -9.487  1.00 31.02 ? 356 HOH B O     1 
HETATM 4655 O  O     . HOH J 4 .   ? -13.543 -12.852 -6.870  1.00 42.52 ? 357 HOH B O     1 
HETATM 4656 O  O     . HOH J 4 .   ? 25.290  3.724   8.439   1.00 52.91 ? 358 HOH B O     1 
HETATM 4657 O  O     . HOH J 4 .   ? 0.585   -15.863 -28.483 1.00 45.60 ? 359 HOH B O     1 
HETATM 4658 O  O     . HOH J 4 .   ? -7.077  -9.119  -32.664 1.00 36.27 ? 360 HOH B O     1 
HETATM 4659 O  O     . HOH J 4 .   ? 16.560  -8.918  -19.264 1.00 55.61 ? 361 HOH B O     1 
HETATM 4660 O  O     . HOH J 4 .   ? -17.355 -6.982  -9.397  1.00 46.74 ? 362 HOH B O     1 
HETATM 4661 O  O     . HOH J 4 .   ? 13.978  13.411  -22.330 1.00 43.88 ? 363 HOH B O     1 
HETATM 4662 O  O     . HOH J 4 .   ? -11.440 -23.436 -24.620 1.00 30.43 ? 364 HOH B O     1 
HETATM 4663 O  O     . HOH J 4 .   ? 0.213   20.203  -15.427 1.00 51.19 ? 365 HOH B O     1 
HETATM 4664 O  O     . HOH J 4 .   ? -16.583 -12.711 -16.668 1.00 36.33 ? 366 HOH B O     1 
HETATM 4665 O  O     . HOH J 4 .   ? -8.615  -25.441 -25.839 1.00 59.87 ? 367 HOH B O     1 
HETATM 4666 O  O     . HOH J 4 .   ? 13.219  7.462   -26.858 1.00 46.11 ? 368 HOH B O     1 
HETATM 4667 O  O     . HOH J 4 .   ? 3.044   -10.044 -8.550  1.00 45.90 ? 369 HOH B O     1 
HETATM 4668 O  O     . HOH J 4 .   ? -16.670 -0.502  -7.519  1.00 32.98 ? 370 HOH B O     1 
HETATM 4669 O  O     . HOH J 4 .   ? 8.401   22.099  -18.469 1.00 49.77 ? 371 HOH B O     1 
HETATM 4670 O  O     . HOH J 4 .   ? 14.657  -10.079 -15.907 1.00 43.20 ? 372 HOH B O     1 
HETATM 4671 O  O     . HOH J 4 .   ? 18.004  1.135   6.155   1.00 54.84 ? 373 HOH B O     1 
HETATM 4672 O  O     . HOH J 4 .   ? 3.184   4.960   -29.020 1.00 50.39 ? 374 HOH B O     1 
HETATM 4673 O  O     . HOH J 4 .   ? -20.935 -20.921 -33.505 1.00 56.78 ? 375 HOH B O     1 
HETATM 4674 O  O     . HOH J 4 .   ? -13.836 -3.794  -30.957 1.00 48.63 ? 376 HOH B O     1 
HETATM 4675 O  O     . HOH J 4 .   ? -4.044  4.035   -5.466  1.00 55.01 ? 377 HOH B O     1 
HETATM 4676 O  O     . HOH J 4 .   ? 10.668  -11.916 -9.024  1.00 44.66 ? 378 HOH B O     1 
HETATM 4677 O  O     . HOH J 4 .   ? -2.711  6.972   -7.150  1.00 29.26 ? 379 HOH B O     1 
HETATM 4678 O  O     . HOH J 4 .   ? 7.611   -3.748  -5.027  1.00 33.08 ? 380 HOH B O     1 
HETATM 4679 O  O     . HOH J 4 .   ? -4.306  5.277   -8.994  1.00 37.92 ? 381 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DG  4   4   4   DG  G   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DT  8   8   8   DT  T   C . n 
A 1 9   DC  9   9   9   DC  C   C . n 
A 1 10  DT  10  10  10  DT  T   C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
B 1 1   DA  1   1   1   DA  A   D . n 
B 1 2   DA  2   2   2   DA  A   D . n 
B 1 3   DA  3   3   3   DA  A   D . n 
B 1 4   DG  4   4   4   DG  G   D . n 
B 1 5   DA  5   5   5   DA  A   D . n 
B 1 6   DT  6   6   6   DT  T   D . n 
B 1 7   DA  7   7   7   DA  A   D . n 
B 1 8   DT  8   8   8   DT  T   D . n 
B 1 9   DC  9   9   9   DC  C   D . n 
B 1 10  DT  10  10  10  DT  T   D . n 
B 1 11  DT  11  11  11  DT  T   D . n 
C 2 1   SER 1   2   2   SER SER A . n 
C 2 2   LEU 2   3   3   LEU LEU A . n 
C 2 3   ARG 3   4   4   ARG ARG A . n 
C 2 4   SER 4   5   5   SER SER A . n 
C 2 5   ASP 5   6   6   ASP ASP A . n 
C 2 6   LEU 6   7   7   LEU LEU A . n 
C 2 7   ILE 7   8   8   ILE ILE A . n 
C 2 8   ASN 8   9   9   ASN ASN A . n 
C 2 9   ALA 9   10  10  ALA ALA A . n 
C 2 10  LEU 10  11  11  LEU LEU A . n 
C 2 11  TYR 11  12  12  TYR TYR A . n 
C 2 12  ASP 12  13  13  ASP ASP A . n 
C 2 13  GLU 13  14  14  GLU GLU A . n 
C 2 14  ASN 14  15  15  ASN ASN A . n 
C 2 15  GLN 15  16  16  GLN GLN A . n 
C 2 16  LYS 16  17  17  LYS LYS A . n 
C 2 17  TYR 17  18  18  TYR TYR A . n 
C 2 18  ASP 18  19  19  ASP ASP A . n 
C 2 19  VAL 19  20  20  VAL VAL A . n 
C 2 20  CYS 20  21  21  CYS CYS A . n 
C 2 21  GLY 21  22  22  GLY GLY A . n 
C 2 22  ILE 22  23  23  ILE ILE A . n 
C 2 23  ILE 23  24  24  ILE ILE A . n 
C 2 24  SER 24  25  25  SER SER A . n 
C 2 25  ALA 25  26  26  ALA ALA A . n 
C 2 26  GLU 26  27  27  GLU GLU A . n 
C 2 27  GLY 27  28  28  GLY GLY A . n 
C 2 28  LYS 28  29  29  LYS LYS A . n 
C 2 29  ILE 29  30  30  ILE ILE A . n 
C 2 30  TYR 30  31  31  TYR TYR A . n 
C 2 31  PRO 31  32  32  PRO PRO A . n 
C 2 32  LEU 32  33  33  LEU LEU A . n 
C 2 33  GLY 33  34  34  GLY GLY A . n 
C 2 34  SER 34  35  35  SER SER A . n 
C 2 35  ASP 35  36  36  ASP ASP A . n 
C 2 36  THR 36  37  37  THR THR A . n 
C 2 37  LYS 37  38  38  LYS LYS A . n 
C 2 38  VAL 38  39  39  VAL VAL A . n 
C 2 39  LEU 39  40  40  LEU LEU A . n 
C 2 40  SER 40  41  41  SER SER A . n 
C 2 41  THR 41  42  42  THR THR A . n 
C 2 42  ILE 42  43  43  ILE ILE A . n 
C 2 43  PHE 43  44  44  PHE PHE A . n 
C 2 44  GLU 44  45  45  GLU GLU A . n 
C 2 45  LEU 45  46  46  LEU LEU A . n 
C 2 46  PHE 46  47  47  PHE PHE A . n 
C 2 47  SER 47  48  48  SER SER A . n 
C 2 48  ARG 48  49  49  ARG ARG A . n 
C 2 49  PRO 49  50  50  PRO PRO A . n 
C 2 50  ILE 50  51  51  ILE ILE A . n 
C 2 51  ILE 51  52  52  ILE ILE A . n 
C 2 52  ASN 52  53  53  ASN ASN A . n 
C 2 53  LYS 53  54  54  LYS LYS A . n 
C 2 54  ILE 54  55  55  ILE ILE A . n 
C 2 55  ALA 55  56  56  ALA ALA A . n 
C 2 56  GLU 56  57  57  GLU GLU A . n 
C 2 57  LYS 57  58  58  LYS LYS A . n 
C 2 58  HIS 58  59  59  HIS HIS A . n 
C 2 59  GLY 59  60  60  GLY GLY A . n 
C 2 60  TYR 60  61  61  TYR TYR A . n 
C 2 61  ILE 61  62  62  ILE ILE A . n 
C 2 62  VAL 62  63  63  VAL VAL A . n 
C 2 63  GLU 63  64  64  GLU GLU A . n 
C 2 64  GLU 64  65  65  GLU GLU A . n 
C 2 65  PRO 65  66  66  PRO PRO A . n 
C 2 66  LYS 66  67  67  LYS LYS A . n 
C 2 67  GLN 67  68  68  GLN GLN A . n 
C 2 68  GLN 68  69  69  GLN GLN A . n 
C 2 69  ASN 69  70  70  ASN ASN A . n 
C 2 70  HIS 70  71  71  HIS HIS A . n 
C 2 71  TYR 71  72  72  TYR TYR A . n 
C 2 72  PRO 72  73  73  PRO PRO A . n 
C 2 73  ASP 73  74  74  ASP ASP A . n 
C 2 74  PHE 74  75  75  PHE PHE A . n 
C 2 75  THR 75  76  76  THR THR A . n 
C 2 76  LEU 76  77  77  LEU LEU A . n 
C 2 77  TYR 77  78  78  TYR TYR A . n 
C 2 78  LYS 78  79  79  LYS LYS A . n 
C 2 79  PRO 79  80  80  PRO PRO A . n 
C 2 80  SER 80  81  81  SER SER A . n 
C 2 81  GLU 81  82  82  GLU GLU A . n 
C 2 82  PRO 82  83  83  PRO PRO A . n 
C 2 83  ASN 83  84  84  ASN ASN A . n 
C 2 84  LYS 84  85  85  LYS LYS A . n 
C 2 85  LYS 85  86  86  LYS LYS A . n 
C 2 86  ILE 86  87  87  ILE ILE A . n 
C 2 87  ALA 87  88  88  ALA ALA A . n 
C 2 88  ILE 88  89  89  ILE ILE A . n 
C 2 89  ASP 89  90  90  ASP ASP A . n 
C 2 90  ILE 90  91  91  ILE ILE A . n 
C 2 91  LYS 91  92  92  LYS LYS A . n 
C 2 92  THR 92  93  93  THR THR A . n 
C 2 93  THR 93  94  94  THR THR A . n 
C 2 94  TYR 94  95  95  TYR TYR A . n 
C 2 95  THR 95  96  96  THR THR A . n 
C 2 96  ASN 96  97  97  ASN ASN A . n 
C 2 97  LYS 97  98  98  LYS LYS A . n 
C 2 98  GLU 98  99  99  GLU GLU A . n 
C 2 99  ASN 99  100 100 ASN ASN A . n 
C 2 100 GLU 100 101 101 GLU GLU A . n 
C 2 101 LYS 101 102 102 LYS LYS A . n 
C 2 102 ILE 102 103 103 ILE ILE A . n 
C 2 103 LYS 103 104 104 LYS LYS A . n 
C 2 104 PHE 104 105 105 PHE PHE A . n 
C 2 105 THR 105 106 106 THR THR A . n 
C 2 106 LEU 106 107 107 LEU LEU A . n 
C 2 107 GLY 107 108 108 GLY GLY A . n 
C 2 108 GLY 108 109 109 GLY GLY A . n 
C 2 109 TYR 109 110 110 TYR TYR A . n 
C 2 110 THR 110 111 111 THR THR A . n 
C 2 111 SER 111 112 112 SER SER A . n 
C 2 112 PHE 112 113 113 PHE PHE A . n 
C 2 113 ILE 113 114 114 ILE ILE A . n 
C 2 114 ARG 114 115 115 ARG ARG A . n 
C 2 115 ASN 115 116 116 ASN ASN A . n 
C 2 116 ASN 116 117 117 ASN ASN A . n 
C 2 117 THR 117 118 118 THR THR A . n 
C 2 118 LYS 118 119 119 LYS LYS A . n 
C 2 119 ASN 119 120 120 ASN ASN A . n 
C 2 120 ILE 120 121 121 ILE ILE A . n 
C 2 121 VAL 121 122 122 VAL VAL A . n 
C 2 122 TYR 122 123 123 TYR TYR A . n 
C 2 123 PRO 123 124 124 PRO PRO A . n 
C 2 124 PHE 124 125 125 PHE PHE A . n 
C 2 125 ASP 125 126 126 ASP ASP A . n 
C 2 126 GLN 126 127 127 GLN GLN A . n 
C 2 127 TYR 127 128 128 TYR TYR A . n 
C 2 128 ILE 128 129 129 ILE ILE A . n 
C 2 129 ALA 129 130 130 ALA ALA A . n 
C 2 130 HIS 130 131 131 HIS HIS A . n 
C 2 131 TRP 131 132 132 TRP TRP A . n 
C 2 132 ILE 132 133 133 ILE ILE A . n 
C 2 133 ILE 133 134 134 ILE ILE A . n 
C 2 134 GLY 134 135 135 GLY GLY A . n 
C 2 135 TYR 135 136 136 TYR TYR A . n 
C 2 136 VAL 136 137 137 VAL VAL A . n 
C 2 137 TYR 137 138 138 TYR TYR A . n 
C 2 138 THR 138 139 139 THR THR A . n 
C 2 139 ARG 139 140 140 ARG ARG A . n 
C 2 140 VAL 140 141 141 VAL VAL A . n 
C 2 141 ALA 141 142 142 ALA ALA A . n 
C 2 142 THR 142 143 143 THR THR A . n 
C 2 143 ARG 143 144 144 ARG ARG A . n 
C 2 144 LYS 144 145 145 LYS LYS A . n 
C 2 145 SER 145 146 146 SER SER A . n 
C 2 146 SER 146 147 147 SER SER A . n 
C 2 147 LEU 147 148 148 LEU LEU A . n 
C 2 148 LYS 148 149 149 LYS LYS A . n 
C 2 149 THR 149 150 150 THR THR A . n 
C 2 150 TYR 150 151 151 TYR TYR A . n 
C 2 151 ASN 151 152 152 ASN ASN A . n 
C 2 152 ILE 152 153 153 ILE ILE A . n 
C 2 153 ASN 153 154 154 ASN ASN A . n 
C 2 154 GLU 154 155 155 GLU GLU A . n 
C 2 155 LEU 155 156 156 LEU LEU A . n 
C 2 156 ASN 156 157 157 ASN ASN A . n 
C 2 157 GLU 157 158 158 GLU GLU A . n 
C 2 158 ILE 158 159 159 ILE ILE A . n 
C 2 159 PRO 159 160 160 PRO PRO A . n 
C 2 160 LYS 160 161 161 LYS LYS A . n 
C 2 161 PRO 161 162 162 PRO PRO A . n 
C 2 162 TYR 162 163 163 TYR TYR A . n 
C 2 163 LYS 163 164 164 LYS LYS A . n 
C 2 164 GLY 164 165 165 GLY GLY A . n 
C 2 165 VAL 165 166 166 VAL VAL A . n 
C 2 166 LYS 166 167 167 LYS LYS A . n 
C 2 167 VAL 167 168 168 VAL VAL A . n 
C 2 168 PHE 168 169 169 PHE PHE A . n 
C 2 169 LEU 169 170 170 LEU LEU A . n 
C 2 170 GLN 170 171 171 GLN GLN A . n 
C 2 171 ASP 171 172 172 ASP ASP A . n 
C 2 172 LYS 172 173 173 LYS LYS A . n 
C 2 173 TRP 173 174 174 TRP TRP A . n 
C 2 174 VAL 174 175 175 VAL VAL A . n 
C 2 175 ILE 175 176 176 ILE ILE A . n 
C 2 176 ALA 176 177 177 ALA ALA A . n 
C 2 177 GLY 177 178 178 GLY GLY A . n 
C 2 178 ASP 178 179 179 ASP ASP A . n 
C 2 179 LEU 179 180 180 LEU LEU A . n 
C 2 180 ALA 180 181 181 ALA ALA A . n 
C 2 181 GLY 181 182 182 GLY GLY A . n 
C 2 182 SER 182 183 183 SER SER A . n 
C 2 183 GLY 183 184 184 GLY GLY A . n 
C 2 184 ASN 184 185 185 ASN ASN A . n 
C 2 185 THR 185 186 186 THR THR A . n 
C 2 186 THR 186 187 187 THR THR A . n 
C 2 187 ASN 187 188 188 ASN ASN A . n 
C 2 188 ILE 188 189 189 ILE ILE A . n 
C 2 189 GLY 189 190 190 GLY GLY A . n 
C 2 190 SER 190 191 191 SER SER A . n 
C 2 191 ILE 191 192 192 ILE ILE A . n 
C 2 192 HIS 192 193 193 HIS HIS A . n 
C 2 193 ALA 193 194 194 ALA ALA A . n 
C 2 194 HIS 194 195 195 HIS HIS A . n 
C 2 195 TYR 195 196 196 TYR TYR A . n 
C 2 196 LYS 196 197 197 LYS LYS A . n 
C 2 197 ASP 197 198 198 ASP ASP A . n 
C 2 198 PHE 198 199 199 PHE PHE A . n 
C 2 199 VAL 199 200 200 VAL VAL A . n 
C 2 200 GLU 200 201 201 GLU GLU A . n 
C 2 201 GLY 201 202 202 GLY GLY A . n 
C 2 202 LYS 202 203 203 LYS LYS A . n 
C 2 203 GLY 203 204 204 GLY GLY A . n 
C 2 204 ILE 204 205 205 ILE ILE A . n 
C 2 205 PHE 205 206 206 PHE PHE A . n 
C 2 206 ASP 206 207 207 ASP ASP A . n 
C 2 207 SER 207 208 208 SER SER A . n 
C 2 208 GLU 208 209 209 GLU GLU A . n 
C 2 209 ASP 209 210 210 ASP ASP A . n 
C 2 210 GLU 210 211 211 GLU GLU A . n 
C 2 211 PHE 211 212 212 PHE PHE A . n 
C 2 212 LEU 212 213 213 LEU LEU A . n 
C 2 213 ASP 213 214 214 ASP ASP A . n 
C 2 214 TYR 214 215 215 TYR TYR A . n 
C 2 215 TRP 215 216 216 TRP TRP A . n 
C 2 216 ARG 216 217 217 ARG ARG A . n 
C 2 217 ASN 217 218 218 ASN ASN A . n 
C 2 218 TYR 218 219 219 TYR TYR A . n 
C 2 219 GLU 219 220 220 GLU GLU A . n 
C 2 220 ARG 220 221 221 ARG ARG A . n 
C 2 221 THR 221 222 222 THR THR A . n 
C 2 222 SER 222 223 223 SER SER A . n 
C 2 223 GLN 223 224 224 GLN GLN A . n 
C 2 224 LEU 224 225 225 LEU LEU A . n 
C 2 225 ARG 225 226 226 ARG ARG A . n 
C 2 226 ASN 226 227 227 ASN ASN A . n 
C 2 227 ASP 227 228 228 ASP ASP A . n 
C 2 228 LYS 228 229 229 LYS LYS A . n 
C 2 229 TYR 229 230 230 TYR TYR A . n 
C 2 230 ASN 230 231 231 ASN ASN A . n 
C 2 231 ASN 231 232 232 ASN ASN A . n 
C 2 232 ILE 232 233 233 ILE ILE A . n 
C 2 233 SER 233 234 234 SER SER A . n 
C 2 234 GLU 234 235 235 GLU GLU A . n 
C 2 235 TYR 235 236 236 TYR TYR A . n 
C 2 236 ARG 236 237 237 ARG ARG A . n 
C 2 237 ASN 237 238 238 ASN ASN A . n 
C 2 238 TRP 238 239 239 TRP TRP A . n 
C 2 239 ILE 239 240 240 ILE ILE A . n 
C 2 240 TYR 240 241 241 TYR TYR A . n 
C 2 241 ARG 241 242 242 ARG ARG A . n 
C 2 242 GLY 242 243 243 GLY GLY A . n 
C 2 243 ARG 243 244 244 ARG ARG A . n 
C 2 244 LYS 244 245 245 LYS LYS A . n 
D 2 1   SER 1   2   2   SER SER B . n 
D 2 2   LEU 2   3   3   LEU LEU B . n 
D 2 3   ARG 3   4   4   ARG ARG B . n 
D 2 4   SER 4   5   5   SER SER B . n 
D 2 5   ASP 5   6   6   ASP ASP B . n 
D 2 6   LEU 6   7   7   LEU LEU B . n 
D 2 7   ILE 7   8   8   ILE ILE B . n 
D 2 8   ASN 8   9   9   ASN ASN B . n 
D 2 9   ALA 9   10  10  ALA ALA B . n 
D 2 10  LEU 10  11  11  LEU LEU B . n 
D 2 11  TYR 11  12  12  TYR TYR B . n 
D 2 12  ASP 12  13  13  ASP ASP B . n 
D 2 13  GLU 13  14  14  GLU GLU B . n 
D 2 14  ASN 14  15  15  ASN ASN B . n 
D 2 15  GLN 15  16  16  GLN GLN B . n 
D 2 16  LYS 16  17  17  LYS LYS B . n 
D 2 17  TYR 17  18  18  TYR TYR B . n 
D 2 18  ASP 18  19  19  ASP ASP B . n 
D 2 19  VAL 19  20  20  VAL VAL B . n 
D 2 20  CYS 20  21  21  CYS CYS B . n 
D 2 21  GLY 21  22  22  GLY GLY B . n 
D 2 22  ILE 22  23  23  ILE ILE B . n 
D 2 23  ILE 23  24  24  ILE ILE B . n 
D 2 24  SER 24  25  25  SER SER B . n 
D 2 25  ALA 25  26  26  ALA ALA B . n 
D 2 26  GLU 26  27  27  GLU GLU B . n 
D 2 27  GLY 27  28  28  GLY GLY B . n 
D 2 28  LYS 28  29  29  LYS LYS B . n 
D 2 29  ILE 29  30  30  ILE ILE B . n 
D 2 30  TYR 30  31  31  TYR TYR B . n 
D 2 31  PRO 31  32  32  PRO PRO B . n 
D 2 32  LEU 32  33  33  LEU LEU B . n 
D 2 33  GLY 33  34  34  GLY GLY B . n 
D 2 34  SER 34  35  35  SER SER B . n 
D 2 35  ASP 35  36  36  ASP ASP B . n 
D 2 36  THR 36  37  37  THR THR B . n 
D 2 37  LYS 37  38  38  LYS LYS B . n 
D 2 38  VAL 38  39  39  VAL VAL B . n 
D 2 39  LEU 39  40  40  LEU LEU B . n 
D 2 40  SER 40  41  41  SER SER B . n 
D 2 41  THR 41  42  42  THR THR B . n 
D 2 42  ILE 42  43  43  ILE ILE B . n 
D 2 43  PHE 43  44  44  PHE PHE B . n 
D 2 44  GLU 44  45  45  GLU GLU B . n 
D 2 45  LEU 45  46  46  LEU LEU B . n 
D 2 46  PHE 46  47  47  PHE PHE B . n 
D 2 47  SER 47  48  48  SER SER B . n 
D 2 48  ARG 48  49  49  ARG ARG B . n 
D 2 49  PRO 49  50  50  PRO PRO B . n 
D 2 50  ILE 50  51  51  ILE ILE B . n 
D 2 51  ILE 51  52  52  ILE ILE B . n 
D 2 52  ASN 52  53  53  ASN ASN B . n 
D 2 53  LYS 53  54  54  LYS LYS B . n 
D 2 54  ILE 54  55  55  ILE ILE B . n 
D 2 55  ALA 55  56  56  ALA ALA B . n 
D 2 56  GLU 56  57  57  GLU GLU B . n 
D 2 57  LYS 57  58  58  LYS LYS B . n 
D 2 58  HIS 58  59  59  HIS HIS B . n 
D 2 59  GLY 59  60  60  GLY GLY B . n 
D 2 60  TYR 60  61  61  TYR TYR B . n 
D 2 61  ILE 61  62  62  ILE ILE B . n 
D 2 62  VAL 62  63  63  VAL VAL B . n 
D 2 63  GLU 63  64  64  GLU GLU B . n 
D 2 64  GLU 64  65  65  GLU GLU B . n 
D 2 65  PRO 65  66  66  PRO PRO B . n 
D 2 66  LYS 66  67  67  LYS LYS B . n 
D 2 67  GLN 67  68  68  GLN GLN B . n 
D 2 68  GLN 68  69  69  GLN GLN B . n 
D 2 69  ASN 69  70  70  ASN ASN B . n 
D 2 70  HIS 70  71  71  HIS HIS B . n 
D 2 71  TYR 71  72  72  TYR TYR B . n 
D 2 72  PRO 72  73  73  PRO PRO B . n 
D 2 73  ASP 73  74  74  ASP ASP B . n 
D 2 74  PHE 74  75  75  PHE PHE B . n 
D 2 75  THR 75  76  76  THR THR B . n 
D 2 76  LEU 76  77  77  LEU LEU B . n 
D 2 77  TYR 77  78  78  TYR TYR B . n 
D 2 78  LYS 78  79  79  LYS LYS B . n 
D 2 79  PRO 79  80  80  PRO PRO B . n 
D 2 80  SER 80  81  81  SER SER B . n 
D 2 81  GLU 81  82  82  GLU GLU B . n 
D 2 82  PRO 82  83  83  PRO PRO B . n 
D 2 83  ASN 83  84  84  ASN ASN B . n 
D 2 84  LYS 84  85  85  LYS LYS B . n 
D 2 85  LYS 85  86  86  LYS LYS B . n 
D 2 86  ILE 86  87  87  ILE ILE B . n 
D 2 87  ALA 87  88  88  ALA ALA B . n 
D 2 88  ILE 88  89  89  ILE ILE B . n 
D 2 89  ASP 89  90  90  ASP ASP B . n 
D 2 90  ILE 90  91  91  ILE ILE B . n 
D 2 91  LYS 91  92  92  LYS LYS B . n 
D 2 92  THR 92  93  93  THR THR B . n 
D 2 93  THR 93  94  94  THR THR B . n 
D 2 94  TYR 94  95  95  TYR TYR B . n 
D 2 95  THR 95  96  96  THR THR B . n 
D 2 96  ASN 96  97  97  ASN ASN B . n 
D 2 97  LYS 97  98  98  LYS LYS B . n 
D 2 98  GLU 98  99  99  GLU GLU B . n 
D 2 99  ASN 99  100 100 ASN ASN B . n 
D 2 100 GLU 100 101 101 GLU GLU B . n 
D 2 101 LYS 101 102 102 LYS LYS B . n 
D 2 102 ILE 102 103 103 ILE ILE B . n 
D 2 103 LYS 103 104 104 LYS LYS B . n 
D 2 104 PHE 104 105 105 PHE PHE B . n 
D 2 105 THR 105 106 106 THR THR B . n 
D 2 106 LEU 106 107 107 LEU LEU B . n 
D 2 107 GLY 107 108 108 GLY GLY B . n 
D 2 108 GLY 108 109 109 GLY GLY B . n 
D 2 109 TYR 109 110 110 TYR TYR B . n 
D 2 110 THR 110 111 111 THR THR B . n 
D 2 111 SER 111 112 112 SER SER B . n 
D 2 112 PHE 112 113 113 PHE PHE B . n 
D 2 113 ILE 113 114 114 ILE ILE B . n 
D 2 114 ARG 114 115 115 ARG ARG B . n 
D 2 115 ASN 115 116 116 ASN ASN B . n 
D 2 116 ASN 116 117 117 ASN ASN B . n 
D 2 117 THR 117 118 118 THR THR B . n 
D 2 118 LYS 118 119 119 LYS LYS B . n 
D 2 119 ASN 119 120 120 ASN ASN B . n 
D 2 120 ILE 120 121 121 ILE ILE B . n 
D 2 121 VAL 121 122 122 VAL VAL B . n 
D 2 122 TYR 122 123 123 TYR TYR B . n 
D 2 123 PRO 123 124 124 PRO PRO B . n 
D 2 124 PHE 124 125 125 PHE PHE B . n 
D 2 125 ASP 125 126 126 ASP ASP B . n 
D 2 126 GLN 126 127 127 GLN GLN B . n 
D 2 127 TYR 127 128 128 TYR TYR B . n 
D 2 128 ILE 128 129 129 ILE ILE B . n 
D 2 129 ALA 129 130 130 ALA ALA B . n 
D 2 130 HIS 130 131 131 HIS HIS B . n 
D 2 131 TRP 131 132 132 TRP TRP B . n 
D 2 132 ILE 132 133 133 ILE ILE B . n 
D 2 133 ILE 133 134 134 ILE ILE B . n 
D 2 134 GLY 134 135 135 GLY GLY B . n 
D 2 135 TYR 135 136 136 TYR TYR B . n 
D 2 136 VAL 136 137 137 VAL VAL B . n 
D 2 137 TYR 137 138 138 TYR TYR B . n 
D 2 138 THR 138 139 139 THR THR B . n 
D 2 139 ARG 139 140 140 ARG ARG B . n 
D 2 140 VAL 140 141 141 VAL VAL B . n 
D 2 141 ALA 141 142 142 ALA ALA B . n 
D 2 142 THR 142 143 143 THR THR B . n 
D 2 143 ARG 143 144 144 ARG ARG B . n 
D 2 144 LYS 144 145 145 LYS LYS B . n 
D 2 145 SER 145 146 146 SER SER B . n 
D 2 146 SER 146 147 147 SER SER B . n 
D 2 147 LEU 147 148 148 LEU LEU B . n 
D 2 148 LYS 148 149 149 LYS LYS B . n 
D 2 149 THR 149 150 150 THR THR B . n 
D 2 150 TYR 150 151 151 TYR TYR B . n 
D 2 151 ASN 151 152 152 ASN ASN B . n 
D 2 152 ILE 152 153 153 ILE ILE B . n 
D 2 153 ASN 153 154 154 ASN ASN B . n 
D 2 154 GLU 154 155 155 GLU GLU B . n 
D 2 155 LEU 155 156 156 LEU LEU B . n 
D 2 156 ASN 156 157 157 ASN ASN B . n 
D 2 157 GLU 157 158 158 GLU GLU B . n 
D 2 158 ILE 158 159 159 ILE ILE B . n 
D 2 159 PRO 159 160 160 PRO PRO B . n 
D 2 160 LYS 160 161 161 LYS LYS B . n 
D 2 161 PRO 161 162 162 PRO PRO B . n 
D 2 162 TYR 162 163 163 TYR TYR B . n 
D 2 163 LYS 163 164 164 LYS LYS B . n 
D 2 164 GLY 164 165 165 GLY GLY B . n 
D 2 165 VAL 165 166 166 VAL VAL B . n 
D 2 166 LYS 166 167 167 LYS LYS B . n 
D 2 167 VAL 167 168 168 VAL VAL B . n 
D 2 168 PHE 168 169 169 PHE PHE B . n 
D 2 169 LEU 169 170 170 LEU LEU B . n 
D 2 170 GLN 170 171 171 GLN GLN B . n 
D 2 171 ASP 171 172 172 ASP ASP B . n 
D 2 172 LYS 172 173 173 LYS LYS B . n 
D 2 173 TRP 173 174 174 TRP TRP B . n 
D 2 174 VAL 174 175 175 VAL VAL B . n 
D 2 175 ILE 175 176 176 ILE ILE B . n 
D 2 176 ALA 176 177 177 ALA ALA B . n 
D 2 177 GLY 177 178 178 GLY GLY B . n 
D 2 178 ASP 178 179 179 ASP ASP B . n 
D 2 179 LEU 179 180 180 LEU LEU B . n 
D 2 180 ALA 180 181 181 ALA ALA B . n 
D 2 181 GLY 181 182 182 GLY GLY B . n 
D 2 182 SER 182 183 183 SER SER B . n 
D 2 183 GLY 183 184 184 GLY GLY B . n 
D 2 184 ASN 184 185 185 ASN ASN B . n 
D 2 185 THR 185 186 186 THR THR B . n 
D 2 186 THR 186 187 187 THR THR B . n 
D 2 187 ASN 187 188 188 ASN ASN B . n 
D 2 188 ILE 188 189 189 ILE ILE B . n 
D 2 189 GLY 189 190 190 GLY GLY B . n 
D 2 190 SER 190 191 191 SER SER B . n 
D 2 191 ILE 191 192 192 ILE ILE B . n 
D 2 192 HIS 192 193 193 HIS HIS B . n 
D 2 193 ALA 193 194 194 ALA ALA B . n 
D 2 194 HIS 194 195 195 HIS HIS B . n 
D 2 195 TYR 195 196 196 TYR TYR B . n 
D 2 196 LYS 196 197 197 LYS LYS B . n 
D 2 197 ASP 197 198 198 ASP ASP B . n 
D 2 198 PHE 198 199 199 PHE PHE B . n 
D 2 199 VAL 199 200 200 VAL VAL B . n 
D 2 200 GLU 200 201 201 GLU GLU B . n 
D 2 201 GLY 201 202 202 GLY GLY B . n 
D 2 202 LYS 202 203 203 LYS LYS B . n 
D 2 203 GLY 203 204 204 GLY GLY B . n 
D 2 204 ILE 204 205 205 ILE ILE B . n 
D 2 205 PHE 205 206 206 PHE PHE B . n 
D 2 206 ASP 206 207 207 ASP ASP B . n 
D 2 207 SER 207 208 208 SER SER B . n 
D 2 208 GLU 208 209 209 GLU GLU B . n 
D 2 209 ASP 209 210 210 ASP ASP B . n 
D 2 210 GLU 210 211 211 GLU GLU B . n 
D 2 211 PHE 211 212 212 PHE PHE B . n 
D 2 212 LEU 212 213 213 LEU LEU B . n 
D 2 213 ASP 213 214 214 ASP ASP B . n 
D 2 214 TYR 214 215 215 TYR TYR B . n 
D 2 215 TRP 215 216 216 TRP TRP B . n 
D 2 216 ARG 216 217 217 ARG ARG B . n 
D 2 217 ASN 217 218 218 ASN ASN B . n 
D 2 218 TYR 218 219 219 TYR TYR B . n 
D 2 219 GLU 219 220 220 GLU GLU B . n 
D 2 220 ARG 220 221 221 ARG ARG B . n 
D 2 221 THR 221 222 222 THR THR B . n 
D 2 222 SER 222 223 223 SER SER B . n 
D 2 223 GLN 223 224 224 GLN GLN B . n 
D 2 224 LEU 224 225 225 LEU LEU B . n 
D 2 225 ARG 225 226 226 ARG ARG B . n 
D 2 226 ASN 226 227 227 ASN ASN B . n 
D 2 227 ASP 227 228 228 ASP ASP B . n 
D 2 228 LYS 228 229 229 LYS LYS B . n 
D 2 229 TYR 229 230 230 TYR TYR B . n 
D 2 230 ASN 230 231 231 ASN ASN B . n 
D 2 231 ASN 231 232 232 ASN ASN B . n 
D 2 232 ILE 232 233 233 ILE ILE B . n 
D 2 233 SER 233 234 234 SER SER B . n 
D 2 234 GLU 234 235 235 GLU GLU B . n 
D 2 235 TYR 235 236 236 TYR TYR B . n 
D 2 236 ARG 236 237 237 ARG ARG B . n 
D 2 237 ASN 237 238 238 ASN ASN B . n 
D 2 238 TRP 238 239 239 TRP TRP B . n 
D 2 239 ILE 239 240 240 ILE ILE B . n 
D 2 240 TYR 240 241 241 TYR TYR B . n 
D 2 241 ARG 241 242 242 ARG ARG B . n 
D 2 242 GLY 242 243 243 GLY GLY B . n 
D 2 243 ARG 243 244 244 ARG ARG B . n 
D 2 244 LYS 244 245 245 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MG  1  301 301 MG  MG  B . 
F 3 MG  1  302 302 MG  MG  B . 
G 4 HOH 1  16  16  HOH HOH C . 
G 4 HOH 2  17  17  HOH HOH C . 
G 4 HOH 3  21  21  HOH HOH C . 
G 4 HOH 4  54  54  HOH HOH C . 
G 4 HOH 5  82  82  HOH HOH C . 
G 4 HOH 6  85  85  HOH HOH C . 
G 4 HOH 7  95  95  HOH HOH C . 
G 4 HOH 8  97  97  HOH HOH C . 
G 4 HOH 9  106 106 HOH HOH C . 
G 4 HOH 10 127 127 HOH HOH C . 
G 4 HOH 11 194 194 HOH HOH C . 
G 4 HOH 12 220 220 HOH HOH C . 
G 4 HOH 13 282 282 HOH HOH C . 
H 4 HOH 1  12  2   HOH HOH D . 
H 4 HOH 2  13  38  HOH HOH D . 
H 4 HOH 3  14  57  HOH HOH D . 
H 4 HOH 4  15  62  HOH HOH D . 
H 4 HOH 5  16  66  HOH HOH D . 
H 4 HOH 6  17  143 HOH HOH D . 
H 4 HOH 7  18  151 HOH HOH D . 
H 4 HOH 8  19  162 HOH HOH D . 
H 4 HOH 9  20  181 HOH HOH D . 
H 4 HOH 10 21  197 HOH HOH D . 
H 4 HOH 11 22  274 HOH HOH D . 
H 4 HOH 12 23  275 HOH HOH D . 
H 4 HOH 13 24  280 HOH HOH D . 
I 4 HOH 1  246 4   HOH HOH A . 
I 4 HOH 2  247 5   HOH HOH A . 
I 4 HOH 3  248 8   HOH HOH A . 
I 4 HOH 4  249 10  HOH HOH A . 
I 4 HOH 5  250 13  HOH HOH A . 
I 4 HOH 6  251 14  HOH HOH A . 
I 4 HOH 7  252 15  HOH HOH A . 
I 4 HOH 8  253 22  HOH HOH A . 
I 4 HOH 9  254 25  HOH HOH A . 
I 4 HOH 10 255 26  HOH HOH A . 
I 4 HOH 11 256 28  HOH HOH A . 
I 4 HOH 12 257 29  HOH HOH A . 
I 4 HOH 13 258 30  HOH HOH A . 
I 4 HOH 14 259 31  HOH HOH A . 
I 4 HOH 15 260 34  HOH HOH A . 
I 4 HOH 16 261 35  HOH HOH A . 
I 4 HOH 17 262 43  HOH HOH A . 
I 4 HOH 18 263 45  HOH HOH A . 
I 4 HOH 19 264 46  HOH HOH A . 
I 4 HOH 20 265 47  HOH HOH A . 
I 4 HOH 21 266 48  HOH HOH A . 
I 4 HOH 22 267 49  HOH HOH A . 
I 4 HOH 23 268 50  HOH HOH A . 
I 4 HOH 24 269 51  HOH HOH A . 
I 4 HOH 25 270 52  HOH HOH A . 
I 4 HOH 26 271 53  HOH HOH A . 
I 4 HOH 27 272 55  HOH HOH A . 
I 4 HOH 28 273 58  HOH HOH A . 
I 4 HOH 29 274 61  HOH HOH A . 
I 4 HOH 30 275 64  HOH HOH A . 
I 4 HOH 31 276 65  HOH HOH A . 
I 4 HOH 32 277 68  HOH HOH A . 
I 4 HOH 33 278 69  HOH HOH A . 
I 4 HOH 34 279 70  HOH HOH A . 
I 4 HOH 35 280 78  HOH HOH A . 
I 4 HOH 36 281 79  HOH HOH A . 
I 4 HOH 37 282 81  HOH HOH A . 
I 4 HOH 38 283 83  HOH HOH A . 
I 4 HOH 39 284 84  HOH HOH A . 
I 4 HOH 40 285 91  HOH HOH A . 
I 4 HOH 41 286 92  HOH HOH A . 
I 4 HOH 42 287 93  HOH HOH A . 
I 4 HOH 43 288 96  HOH HOH A . 
I 4 HOH 44 289 98  HOH HOH A . 
I 4 HOH 45 290 99  HOH HOH A . 
I 4 HOH 46 291 100 HOH HOH A . 
I 4 HOH 47 292 102 HOH HOH A . 
I 4 HOH 48 293 103 HOH HOH A . 
I 4 HOH 49 294 104 HOH HOH A . 
I 4 HOH 50 295 114 HOH HOH A . 
I 4 HOH 51 296 117 HOH HOH A . 
I 4 HOH 52 297 136 HOH HOH A . 
I 4 HOH 53 298 139 HOH HOH A . 
I 4 HOH 54 299 140 HOH HOH A . 
I 4 HOH 55 300 142 HOH HOH A . 
I 4 HOH 56 301 144 HOH HOH A . 
I 4 HOH 57 302 146 HOH HOH A . 
I 4 HOH 58 303 147 HOH HOH A . 
I 4 HOH 59 304 153 HOH HOH A . 
I 4 HOH 60 305 155 HOH HOH A . 
I 4 HOH 61 306 156 HOH HOH A . 
I 4 HOH 62 307 159 HOH HOH A . 
I 4 HOH 63 308 174 HOH HOH A . 
I 4 HOH 64 309 180 HOH HOH A . 
I 4 HOH 65 310 182 HOH HOH A . 
I 4 HOH 66 311 196 HOH HOH A . 
I 4 HOH 67 312 198 HOH HOH A . 
I 4 HOH 68 313 202 HOH HOH A . 
I 4 HOH 69 314 205 HOH HOH A . 
I 4 HOH 70 315 211 HOH HOH A . 
I 4 HOH 71 316 213 HOH HOH A . 
I 4 HOH 72 317 215 HOH HOH A . 
I 4 HOH 73 318 219 HOH HOH A . 
I 4 HOH 74 319 221 HOH HOH A . 
I 4 HOH 75 320 224 HOH HOH A . 
I 4 HOH 76 321 242 HOH HOH A . 
I 4 HOH 77 322 259 HOH HOH A . 
I 4 HOH 78 323 267 HOH HOH A . 
I 4 HOH 79 324 281 HOH HOH A . 
I 4 HOH 80 325 283 HOH HOH A . 
J 4 HOH 1  303 1   HOH HOH B . 
J 4 HOH 2  304 3   HOH HOH B . 
J 4 HOH 3  305 6   HOH HOH B . 
J 4 HOH 4  306 7   HOH HOH B . 
J 4 HOH 5  307 9   HOH HOH B . 
J 4 HOH 6  308 11  HOH HOH B . 
J 4 HOH 7  309 12  HOH HOH B . 
J 4 HOH 8  310 18  HOH HOH B . 
J 4 HOH 9  311 19  HOH HOH B . 
J 4 HOH 10 312 20  HOH HOH B . 
J 4 HOH 11 313 23  HOH HOH B . 
J 4 HOH 12 314 24  HOH HOH B . 
J 4 HOH 13 315 27  HOH HOH B . 
J 4 HOH 14 316 32  HOH HOH B . 
J 4 HOH 15 317 33  HOH HOH B . 
J 4 HOH 16 318 36  HOH HOH B . 
J 4 HOH 17 319 37  HOH HOH B . 
J 4 HOH 18 320 39  HOH HOH B . 
J 4 HOH 19 321 40  HOH HOH B . 
J 4 HOH 20 322 41  HOH HOH B . 
J 4 HOH 21 323 42  HOH HOH B . 
J 4 HOH 22 324 44  HOH HOH B . 
J 4 HOH 23 325 56  HOH HOH B . 
J 4 HOH 24 326 59  HOH HOH B . 
J 4 HOH 25 327 60  HOH HOH B . 
J 4 HOH 26 328 67  HOH HOH B . 
J 4 HOH 27 329 71  HOH HOH B . 
J 4 HOH 28 330 72  HOH HOH B . 
J 4 HOH 29 331 74  HOH HOH B . 
J 4 HOH 30 332 75  HOH HOH B . 
J 4 HOH 31 333 76  HOH HOH B . 
J 4 HOH 32 334 77  HOH HOH B . 
J 4 HOH 33 335 80  HOH HOH B . 
J 4 HOH 34 336 87  HOH HOH B . 
J 4 HOH 35 337 88  HOH HOH B . 
J 4 HOH 36 338 89  HOH HOH B . 
J 4 HOH 37 339 94  HOH HOH B . 
J 4 HOH 38 340 101 HOH HOH B . 
J 4 HOH 39 341 105 HOH HOH B . 
J 4 HOH 40 342 107 HOH HOH B . 
J 4 HOH 41 343 109 HOH HOH B . 
J 4 HOH 42 344 110 HOH HOH B . 
J 4 HOH 43 345 111 HOH HOH B . 
J 4 HOH 44 346 113 HOH HOH B . 
J 4 HOH 45 347 116 HOH HOH B . 
J 4 HOH 46 348 119 HOH HOH B . 
J 4 HOH 47 349 121 HOH HOH B . 
J 4 HOH 48 350 128 HOH HOH B . 
J 4 HOH 49 351 129 HOH HOH B . 
J 4 HOH 50 352 130 HOH HOH B . 
J 4 HOH 51 353 133 HOH HOH B . 
J 4 HOH 52 354 135 HOH HOH B . 
J 4 HOH 53 355 138 HOH HOH B . 
J 4 HOH 54 356 148 HOH HOH B . 
J 4 HOH 55 357 149 HOH HOH B . 
J 4 HOH 56 358 150 HOH HOH B . 
J 4 HOH 57 359 152 HOH HOH B . 
J 4 HOH 58 360 164 HOH HOH B . 
J 4 HOH 59 361 165 HOH HOH B . 
J 4 HOH 60 362 171 HOH HOH B . 
J 4 HOH 61 363 172 HOH HOH B . 
J 4 HOH 62 364 173 HOH HOH B . 
J 4 HOH 63 365 175 HOH HOH B . 
J 4 HOH 64 366 190 HOH HOH B . 
J 4 HOH 65 367 191 HOH HOH B . 
J 4 HOH 66 368 207 HOH HOH B . 
J 4 HOH 67 369 208 HOH HOH B . 
J 4 HOH 68 370 209 HOH HOH B . 
J 4 HOH 69 371 214 HOH HOH B . 
J 4 HOH 70 372 218 HOH HOH B . 
J 4 HOH 71 373 230 HOH HOH B . 
J 4 HOH 72 374 231 HOH HOH B . 
J 4 HOH 73 375 244 HOH HOH B . 
J 4 HOH 74 376 246 HOH HOH B . 
J 4 HOH 75 377 254 HOH HOH B . 
J 4 HOH 76 378 256 HOH HOH B . 
J 4 HOH 77 379 264 HOH HOH B . 
J 4 HOH 78 380 284 HOH HOH B . 
J 4 HOH 79 381 285 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP1 ? B DA  7  ? D DA  7   ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD2 ? D ASP 73 ? B ASP 74  ? 1_555 152.8 ? 
2  OP1 ? B DA  7  ? D DA  7   ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 89 ? B ASP 90  ? 1_555 111.3 ? 
3  OD2 ? D ASP 73 ? B ASP 74  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 89 ? B ASP 90  ? 1_555 68.2  ? 
4  OP1 ? B DA  7  ? D DA  7   ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? H HOH .  ? D HOH 16  ? 1_555 81.7  ? 
5  OD2 ? D ASP 73 ? B ASP 74  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? H HOH .  ? D HOH 16  ? 1_555 124.2 ? 
6  OD1 ? D ASP 89 ? B ASP 90  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? H HOH .  ? D HOH 16  ? 1_555 83.6  ? 
7  OP1 ? B DA  7  ? D DA  7   ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 341 ? 1_555 95.9  ? 
8  OD2 ? D ASP 73 ? B ASP 74  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 341 ? 1_555 58.5  ? 
9  OD1 ? D ASP 89 ? B ASP 90  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 341 ? 1_555 99.3  ? 
10 O   ? H HOH .  ? D HOH 16  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 341 ? 1_555 176.7 ? 
11 OP1 ? B DA  7  ? D DA  7   ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 342 ? 1_555 87.3  ? 
12 OD2 ? D ASP 73 ? B ASP 74  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 342 ? 1_555 98.4  ? 
13 OD1 ? D ASP 89 ? B ASP 90  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 342 ? 1_555 160.3 ? 
14 O   ? H HOH .  ? D HOH 16  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 342 ? 1_555 93.2  ? 
15 O   ? J HOH .  ? B HOH 341 ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? J HOH .  ? B HOH 342 ? 1_555 84.5  ? 
16 OP1 ? B DA  7  ? D DA  7   ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 151.8 ? 
17 OD2 ? D ASP 73 ? B ASP 74  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 43.0  ? 
18 OD1 ? D ASP 89 ? B ASP 90  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 96.7  ? 
19 O   ? H HOH .  ? D HOH 16  ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 98.6  ? 
20 O   ? J HOH .  ? B HOH 341 ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 82.5  ? 
21 O   ? J HOH .  ? B HOH 342 ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 64.5  ? 
22 OE2 ? D GLU 44 ? B GLU 45  ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O   ? J HOH .  ? B HOH 349 ? 1_555 110.2 ? 
23 OE2 ? D GLU 44 ? B GLU 45  ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O   ? J HOH .  ? B HOH 379 ? 1_555 144.4 ? 
24 O   ? J HOH .  ? B HOH 349 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O   ? J HOH .  ? B HOH 379 ? 1_555 103.7 ? 
25 OE2 ? D GLU 44 ? B GLU 45  ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 105.9 ? 
26 O   ? J HOH .  ? B HOH 349 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 105.2 ? 
27 O   ? J HOH .  ? B HOH 379 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 OD1 ? D ASP 73 ? B ASP 74  ? 1_555 74.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-01-26 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "C5'" C DA 1  ? ? "C4'" C DA 1  ? ? 1.563 1.512 0.051  0.007 N 
2  1 N9    C DA 1  ? ? C4    C DA 1  ? ? 1.414 1.374 0.040  0.006 N 
3  1 "C5'" C DA 3  ? ? "C4'" C DA 3  ? ? 1.555 1.512 0.043  0.007 N 
4  1 C5    C DT 6  ? ? C7    C DT 6  ? ? 1.551 1.496 0.055  0.006 N 
5  1 C5    C DT 10 ? ? C7    C DT 10 ? ? 1.540 1.496 0.044  0.006 N 
6  1 "C5'" D DA 1  ? ? "C4'" D DA 1  ? ? 1.581 1.512 0.069  0.007 N 
7  1 "C5'" D DA 5  ? ? "C4'" D DA 5  ? ? 1.572 1.512 0.060  0.007 N 
8  1 N3    D DA 7  ? ? C4    D DA 7  ? ? 1.385 1.344 0.041  0.006 N 
9  1 N1    D DT 8  ? ? C2    D DT 8  ? ? 1.430 1.376 0.054  0.008 N 
10 1 "O4'" D DC 9  ? ? "C4'" D DC 9  ? ? 1.384 1.446 -0.062 0.010 N 
11 1 P     D DT 10 ? ? "O5'" D DT 10 ? ? 1.654 1.593 0.061  0.010 N 
12 1 C5    D DT 10 ? ? C7    D DT 10 ? ? 1.544 1.496 0.048  0.006 N 
13 1 "C4'" D DT 11 ? ? "C3'" D DT 11 ? ? 1.602 1.529 0.073  0.010 N 
14 1 C5    D DT 11 ? ? C7    D DT 11 ? ? 1.567 1.496 0.071  0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" C DA 3  ? ? "O3'" C DA 3  ? ? P     C DG 4  ? ? 128.37 119.70 8.67  1.20 Y 
2  1 "C3'" C DG 4  ? ? "C2'" C DG 4  ? ? "C1'" C DG 4  ? ? 96.53  102.40 -5.87 0.80 N 
3  1 "O4'" C DG 4  ? ? "C1'" C DG 4  ? ? N9    C DG 4  ? ? 112.49 108.30 4.19  0.30 N 
4  1 "O4'" C DA 5  ? ? "C1'" C DA 5  ? ? N9    C DA 5  ? ? 101.31 108.00 -6.69 0.70 N 
5  1 "O4'" C DT 6  ? ? "C4'" C DT 6  ? ? "C3'" C DT 6  ? ? 100.47 104.50 -4.03 0.40 N 
6  1 "O4'" C DT 6  ? ? "C1'" C DT 6  ? ? N1    C DT 6  ? ? 111.63 108.30 3.33  0.30 N 
7  1 C4    C DT 6  ? ? C5    C DT 6  ? ? C6    C DT 6  ? ? 121.79 118.00 3.79  0.60 N 
8  1 C6    C DT 6  ? ? C5    C DT 6  ? ? C7    C DT 6  ? ? 118.62 122.90 -4.28 0.60 N 
9  1 "O4'" C DA 7  ? ? "C1'" C DA 7  ? ? "C2'" C DA 7  ? ? 99.33  105.90 -6.57 0.80 N 
10 1 "C1'" C DT 8  ? ? "O4'" C DT 8  ? ? "C4'" C DT 8  ? ? 103.80 110.10 -6.30 1.00 N 
11 1 C5    C DT 8  ? ? C6    C DT 8  ? ? N1    C DT 8  ? ? 119.93 123.70 -3.77 0.60 N 
12 1 "C3'" C DT 8  ? ? "O3'" C DT 8  ? ? P     C DC 9  ? ? 131.22 119.70 11.52 1.20 Y 
13 1 "O4'" C DT 10 ? ? "C1'" C DT 10 ? ? N1    C DT 10 ? ? 102.73 108.00 -5.27 0.70 N 
14 1 C6    C DT 10 ? ? C5    C DT 10 ? ? C7    C DT 10 ? ? 118.04 122.90 -4.86 0.60 N 
15 1 N3    C DT 11 ? ? C2    C DT 11 ? ? O2    C DT 11 ? ? 118.03 122.30 -4.27 0.60 N 
16 1 N3    C DT 11 ? ? C4    C DT 11 ? ? O4    C DT 11 ? ? 116.03 119.90 -3.87 0.60 N 
17 1 C5    C DT 11 ? ? C4    C DT 11 ? ? O4    C DT 11 ? ? 129.75 124.90 4.85  0.70 N 
18 1 C4    C DT 11 ? ? C5    C DT 11 ? ? C7    C DT 11 ? ? 123.68 119.00 4.68  0.60 N 
19 1 C6    C DT 11 ? ? C5    C DT 11 ? ? C7    C DT 11 ? ? 115.77 122.90 -7.13 0.60 N 
20 1 "C3'" D DA 1  ? ? "C2'" D DA 1  ? ? "C1'" D DA 1  ? ? 97.36  102.40 -5.04 0.80 N 
21 1 "O4'" D DA 1  ? ? "C1'" D DA 1  ? ? N9    D DA 1  ? ? 103.47 108.00 -4.53 0.70 N 
22 1 "C3'" D DA 2  ? ? "O3'" D DA 2  ? ? P     D DA 3  ? ? 126.93 119.70 7.23  1.20 Y 
23 1 "C3'" D DG 4  ? ? "C2'" D DG 4  ? ? "C1'" D DG 4  ? ? 95.17  102.40 -7.23 0.80 N 
24 1 "O4'" D DG 4  ? ? "C1'" D DG 4  ? ? N9    D DG 4  ? ? 111.78 108.30 3.48  0.30 N 
25 1 "O4'" D DA 5  ? ? "C1'" D DA 5  ? ? "C2'" D DA 5  ? ? 110.89 106.80 4.09  0.50 N 
26 1 N1    D DA 5  ? ? C6    D DA 5  ? ? N6    D DA 5  ? ? 122.30 118.60 3.70  0.60 N 
27 1 "O4'" D DT 6  ? ? "C4'" D DT 6  ? ? "C3'" D DT 6  ? ? 100.13 104.50 -4.37 0.40 N 
28 1 "O4'" D DT 6  ? ? "C1'" D DT 6  ? ? N1    D DT 6  ? ? 111.24 108.30 2.94  0.30 N 
29 1 "C3'" D DT 8  ? ? "C2'" D DT 8  ? ? "C1'" D DT 8  ? ? 95.84  102.40 -6.56 0.80 N 
30 1 "O4'" D DT 8  ? ? "C1'" D DT 8  ? ? "C2'" D DT 8  ? ? 98.63  105.90 -7.27 0.80 N 
31 1 C4    D DT 8  ? ? C5    D DT 8  ? ? C6    D DT 8  ? ? 121.82 118.00 3.82  0.60 N 
32 1 C5    D DT 8  ? ? C6    D DT 8  ? ? N1    D DT 8  ? ? 120.03 123.70 -3.67 0.60 N 
33 1 N3    D DT 8  ? ? C2    D DT 8  ? ? O2    D DT 8  ? ? 117.65 122.30 -4.65 0.60 N 
34 1 C6    D DT 8  ? ? C5    D DT 8  ? ? C7    D DT 8  ? ? 118.23 122.90 -4.67 0.60 N 
35 1 "C3'" D DT 8  ? ? "O3'" D DT 8  ? ? P     D DC 9  ? ? 130.03 119.70 10.33 1.20 Y 
36 1 "O4'" D DT 10 ? ? "C4'" D DT 10 ? ? "C3'" D DT 10 ? ? 100.50 104.50 -4.00 0.40 N 
37 1 "C3'" D DT 10 ? ? "C2'" D DT 10 ? ? "C1'" D DT 10 ? ? 96.61  102.40 -5.79 0.80 N 
38 1 N3    D DT 10 ? ? C2    D DT 10 ? ? O2    D DT 10 ? ? 118.47 122.30 -3.83 0.60 N 
39 1 C6    D DT 10 ? ? C5    D DT 10 ? ? C7    D DT 10 ? ? 118.09 122.90 -4.81 0.60 N 
40 1 "O5'" D DT 11 ? ? "C5'" D DT 11 ? ? "C4'" D DT 11 ? ? 104.13 109.40 -5.27 0.80 N 
41 1 P     D DT 11 ? ? "O5'" D DT 11 ? ? "C5'" D DT 11 ? ? 134.42 120.90 13.52 1.60 N 
42 1 "O4'" D DT 11 ? ? "C1'" D DT 11 ? ? N1    D DT 11 ? ? 110.19 108.30 1.89  0.30 N 
43 1 C6    D DT 11 ? ? C5    D DT 11 ? ? C7    D DT 11 ? ? 118.57 122.90 -4.33 0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 70  ? ? -83.50  41.82   
2  1 TYR A 78  ? ? -172.84 146.45  
3  1 SER A 112 ? ? -103.48 -121.17 
4  1 ASN A 117 ? ? -33.66  -26.03  
5  1 THR A 187 ? ? 31.16   70.59   
6  1 LYS A 229 ? ? -114.29 -99.46  
7  1 GLU B 82  ? ? -117.26 69.23   
8  1 ASN B 84  ? ? -97.78  30.72   
9  1 SER B 112 ? ? -92.89  -112.80 
10 1 ASN B 117 ? ? -31.78  -23.16  
11 1 THR B 187 ? ? 32.43   58.30   
12 1 LYS B 229 ? ? -146.80 -91.61  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RVB 'double helix'        
1RVB 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 11 1_555 -0.310 -0.267 -0.521 -14.539 -9.951  8.362 1  C_DA2:DT11_D C 2  ? D 11 ? 20 1 
1 A DA 3  1_555 B DT 10 1_555 0.131  -0.142 -0.194 -6.411  -3.517  2.564 2  C_DA3:DT10_D C 3  ? D 10 ? 20 1 
1 A DG 4  1_555 B DC 9  1_555 -0.039 -0.208 0.017  4.382   -13.631 0.491 3  C_DG4:DC9_D  C 4  ? D 9  ? 19 1 
1 A DA 5  1_555 B DT 8  1_555 0.037  0.015  0.027  -3.156  -1.335  1.485 4  C_DA5:DT8_D  C 5  ? D 8  ? 20 1 
1 A DT 6  1_555 B DA 7  1_555 -0.001 -0.118 0.133  12.299  0.105   5.410 5  C_DT6:DA7_D  C 6  ? D 7  ? 20 1 
1 A DA 7  1_555 B DT 6  1_555 -0.005 -0.120 0.030  -13.468 -2.068  1.439 6  C_DA7:DT6_D  C 7  ? D 6  ? 20 1 
1 A DT 8  1_555 B DA 5  1_555 -0.003 -0.033 0.230  -0.325  2.975   2.826 7  C_DT8:DA5_D  C 8  ? D 5  ? 20 1 
1 A DC 9  1_555 B DG 4  1_555 0.015  -0.063 0.295  -8.885  -11.381 1.154 8  C_DC9:DG4_D  C 9  ? D 4  ? 19 1 
1 A DT 10 1_555 B DA 3  1_555 -0.147 -0.194 0.211  0.721   -9.218  3.332 9  C_DT10:DA3_D C 10 ? D 3  ? 20 1 
1 A DT 11 1_555 B DA 2  1_555 0.064  -0.243 -0.068 9.435   -8.851  4.020 10 C_DT11:DA2_D C 11 ? D 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 11 1_555 A DA 3  1_555 B DT 10 1_555 -0.160 0.982  3.194 -3.666 2.749   32.721 1.265  -0.335 3.261 4.850   
6.468  33.031 1 CC_DA2DA3:DT10DT11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 A DA 3  1_555 B DT 10 1_555 A DG 4  1_555 B DC 9  1_555 0.319  -0.110 3.271 -1.320 3.868   30.474 -0.963 -0.859 3.216 7.317   
2.497  30.740 2 CC_DA3DG4:DC9DT10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 A DG 4  1_555 B DC 9  1_555 A DA 5  1_555 B DT 8  1_555 -0.242 -0.339 3.728 -1.955 -14.094 39.754 1.221  0.103  3.647 -19.967 
2.769  42.126 3 CC_DG4DA5:DT8DC9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 A DA 5  1_555 B DT 8  1_555 A DT 6  1_555 B DA 7  1_555 -0.003 -1.052 3.153 0.151  1.290   25.280 -2.757 0.048  3.096 2.946   
-0.344 25.312 4 CC_DA5DT6:DA7DT8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 A DT 6  1_555 B DA 7  1_555 A DA 7  1_555 B DT 6  1_555 -0.018 -1.535 4.210 0.158  53.790  27.940 -4.419 0.026  0.684 64.547  
-0.190 60.130 5 CC_DT6DA7:DT6DA7_DD   C 6  ? D 7  ? C 7  ? D 6  ? 
1 A DA 7  1_555 B DT 6  1_555 A DT 8  1_555 B DA 5  1_555 0.380  -1.192 3.268 -2.273 -1.599  28.887 -2.025 -1.261 3.289 -3.196  
4.543  29.018 6 CC_DA7DT8:DA5DT6_DD   C 7  ? D 6  ? C 8  ? D 5  ? 
1 A DT 8  1_555 B DA 5  1_555 A DC 9  1_555 B DG 4  1_555 0.116  -0.872 3.647 3.914  -7.464  39.645 -0.306 0.333  3.739 -10.856 
-5.692 40.496 7 CC_DT8DC9:DG4DA5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 A DC 9  1_555 B DG 4  1_555 A DT 10 1_555 B DA 3  1_555 -0.507 -0.276 3.257 -0.179 2.454   29.490 -1.057 0.955  3.227 4.810   
0.351  29.591 8 CC_DC9DT10:DA3DG4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 A DT 10 1_555 B DA 3  1_555 A DT 11 1_555 B DA 2  1_555 -0.025 0.575  3.211 3.078  5.336   30.102 0.040  0.649  3.244 10.140  
-5.849 30.711 9 CC_DT10DT11:DA2DA3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION' MG  
4 water           HOH 
#