data_1RVC
# 
_entry.id   1RVC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RVC         
RCSB  PDE016       
WWPDB D_1000176242 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RVC 
_pdbx_database_status.recvd_initial_deposition_date   1994-10-21 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kostrewa, D.'  1 
'Winkler, F.K.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Mg2+ binding to the active site of EcoRV endonuclease: a crystallographic study of complexes with substrate and product DNA at 2 A resolution.
;
Biochemistry           34 683  696 1995 BICHAW US 0006-2960 0033 ? 7819264 10.1021/bi00002a036 
1       'The Crystal Structure of EcoRV Endonuclease and of its Complexes with Cognate and Noncognate DNA Fragments' 'Embo J.' 12 
1781 ?   1993 EMJODG UK 0261-4189 0897 ? ?       ?                   
2       'Structure and Function of Restriction Endonucleases' Curr.Opin.Struct.Biol. 2  93   ?   1992 COSBEF UK 0959-440X 0801 ? ? 
?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kostrewa, D.'   1  
primary 'Winkler, F.K.'  2  
1       'Winkler, F.K.'  3  
1       'Banner, D.W.'   4  
1       'Oefner, C.'     5  
1       'Tsernoglou, D.' 6  
1       'Brown, R.S.'    7  
1       'Heathman, S.P.' 8  
1       'Bryan, R.K.'    9  
1       'Martin, P.D.'   10 
1       'Petratos, K.'   11 
1       'Wilson, K.S.'   12 
2       'Winkler, F.K.'  13 
# 
_cell.entry_id           1RVC 
_cell.length_a           49.290 
_cell.length_b           50.340 
_cell.length_c           63.880 
_cell.angle_alpha        96.66 
_cell.angle_beta         108.76 
_cell.angle_gamma        108.41 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RVC 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*AP*AP*AP*GP*AP*T)-3')
;
1841.268  2   ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*TP*CP*TP*T)-3')
;
1470.010  2   ? ? ? ? 
3 polymer     man 'PROTEIN (ECO RV (E.C.3.1.21.4))'  28559.158 2   ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                    24.305    4   ? ? ? ? 
5 water       nat water                              18.015    219 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DG)(DA)(DT)' AAAGAT C,E ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DT)(DT)' ATCTT D,F ? 
3 'polypeptide(L)'        no no 
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
;SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DG  n 
1 5   DA  n 
1 6   DT  n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
3 1   SER n 
3 2   LEU n 
3 3   ARG n 
3 4   SER n 
3 5   ASP n 
3 6   LEU n 
3 7   ILE n 
3 8   ASN n 
3 9   ALA n 
3 10  LEU n 
3 11  TYR n 
3 12  ASP n 
3 13  GLU n 
3 14  ASN n 
3 15  GLN n 
3 16  LYS n 
3 17  TYR n 
3 18  ASP n 
3 19  VAL n 
3 20  CYS n 
3 21  GLY n 
3 22  ILE n 
3 23  ILE n 
3 24  SER n 
3 25  ALA n 
3 26  GLU n 
3 27  GLY n 
3 28  LYS n 
3 29  ILE n 
3 30  TYR n 
3 31  PRO n 
3 32  LEU n 
3 33  GLY n 
3 34  SER n 
3 35  ASP n 
3 36  THR n 
3 37  LYS n 
3 38  VAL n 
3 39  LEU n 
3 40  SER n 
3 41  THR n 
3 42  ILE n 
3 43  PHE n 
3 44  GLU n 
3 45  LEU n 
3 46  PHE n 
3 47  SER n 
3 48  ARG n 
3 49  PRO n 
3 50  ILE n 
3 51  ILE n 
3 52  ASN n 
3 53  LYS n 
3 54  ILE n 
3 55  ALA n 
3 56  GLU n 
3 57  LYS n 
3 58  HIS n 
3 59  GLY n 
3 60  TYR n 
3 61  ILE n 
3 62  VAL n 
3 63  GLU n 
3 64  GLU n 
3 65  PRO n 
3 66  LYS n 
3 67  GLN n 
3 68  GLN n 
3 69  ASN n 
3 70  HIS n 
3 71  TYR n 
3 72  PRO n 
3 73  ASP n 
3 74  PHE n 
3 75  THR n 
3 76  LEU n 
3 77  TYR n 
3 78  LYS n 
3 79  PRO n 
3 80  SER n 
3 81  GLU n 
3 82  PRO n 
3 83  ASN n 
3 84  LYS n 
3 85  LYS n 
3 86  ILE n 
3 87  ALA n 
3 88  ILE n 
3 89  ASP n 
3 90  ILE n 
3 91  LYS n 
3 92  THR n 
3 93  THR n 
3 94  TYR n 
3 95  THR n 
3 96  ASN n 
3 97  LYS n 
3 98  GLU n 
3 99  ASN n 
3 100 GLU n 
3 101 LYS n 
3 102 ILE n 
3 103 LYS n 
3 104 PHE n 
3 105 THR n 
3 106 LEU n 
3 107 GLY n 
3 108 GLY n 
3 109 TYR n 
3 110 THR n 
3 111 SER n 
3 112 PHE n 
3 113 ILE n 
3 114 ARG n 
3 115 ASN n 
3 116 ASN n 
3 117 THR n 
3 118 LYS n 
3 119 ASN n 
3 120 ILE n 
3 121 VAL n 
3 122 TYR n 
3 123 PRO n 
3 124 PHE n 
3 125 ASP n 
3 126 GLN n 
3 127 TYR n 
3 128 ILE n 
3 129 ALA n 
3 130 HIS n 
3 131 TRP n 
3 132 ILE n 
3 133 ILE n 
3 134 GLY n 
3 135 TYR n 
3 136 VAL n 
3 137 TYR n 
3 138 THR n 
3 139 ARG n 
3 140 VAL n 
3 141 ALA n 
3 142 THR n 
3 143 ARG n 
3 144 LYS n 
3 145 SER n 
3 146 SER n 
3 147 LEU n 
3 148 LYS n 
3 149 THR n 
3 150 TYR n 
3 151 ASN n 
3 152 ILE n 
3 153 ASN n 
3 154 GLU n 
3 155 LEU n 
3 156 ASN n 
3 157 GLU n 
3 158 ILE n 
3 159 PRO n 
3 160 LYS n 
3 161 PRO n 
3 162 TYR n 
3 163 LYS n 
3 164 GLY n 
3 165 VAL n 
3 166 LYS n 
3 167 VAL n 
3 168 PHE n 
3 169 LEU n 
3 170 GLN n 
3 171 ASP n 
3 172 LYS n 
3 173 TRP n 
3 174 VAL n 
3 175 ILE n 
3 176 ALA n 
3 177 GLY n 
3 178 ASP n 
3 179 LEU n 
3 180 ALA n 
3 181 GLY n 
3 182 SER n 
3 183 GLY n 
3 184 ASN n 
3 185 THR n 
3 186 THR n 
3 187 ASN n 
3 188 ILE n 
3 189 GLY n 
3 190 SER n 
3 191 ILE n 
3 192 HIS n 
3 193 ALA n 
3 194 HIS n 
3 195 TYR n 
3 196 LYS n 
3 197 ASP n 
3 198 PHE n 
3 199 VAL n 
3 200 GLU n 
3 201 GLY n 
3 202 LYS n 
3 203 GLY n 
3 204 ILE n 
3 205 PHE n 
3 206 ASP n 
3 207 SER n 
3 208 GLU n 
3 209 ASP n 
3 210 GLU n 
3 211 PHE n 
3 212 LEU n 
3 213 ASP n 
3 214 TYR n 
3 215 TRP n 
3 216 ARG n 
3 217 ASN n 
3 218 TYR n 
3 219 GLU n 
3 220 ARG n 
3 221 THR n 
3 222 SER n 
3 223 GLN n 
3 224 LEU n 
3 225 ARG n 
3 226 ASN n 
3 227 ASP n 
3 228 LYS n 
3 229 TYR n 
3 230 ASN n 
3 231 ASN n 
3 232 ILE n 
3 233 SER n 
3 234 GLU n 
3 235 TYR n 
3 236 ARG n 
3 237 ASN n 
3 238 TRP n 
3 239 ILE n 
3 240 TYR n 
3 241 ARG n 
3 242 GLY n 
3 243 ARG n 
3 244 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP T2E5_ECOLI 3 ? ? P04390 ? 
2 PDB 1RVC       1 ? ? 1RVC   ? 
3 PDB 1RVC       2 ? ? 1RVC   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1RVC A 1 ? 244 ? P04390 1 ? 244 ? 2 245 
2 1 1RVC B 1 ? 244 ? P04390 1 ? 244 ? 2 245 
3 2 1RVC C 1 ? 6   ? 1RVC   1 ? 6   ? 1 6   
4 3 1RVC D 1 ? 5   ? 1RVC   7 ? 11  ? 7 11  
5 2 1RVC E 1 ? 6   ? 1RVC   1 ? 6   ? 1 6   
6 3 1RVC F 1 ? 5   ? 1RVC   7 ? 11  ? 7 11  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RVC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.04 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1RVC 
_refine.ls_number_reflns_obs                     26645 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.000 
_refine.ls_d_res_high                            2.100 
_refine.ls_percent_reflns_obs                    99.900 
_refine.ls_R_factor_obs                          0.1560000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1560000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4046 
_refine_hist.pdbx_number_atoms_nucleic_acid   448 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             219 
_refine_hist.number_atoms_total               4717 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.83  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1RVC 
_struct.title                     
;MG2+ BINDING TO THE ACTIVE SITE OF ECO RV ENDONUCLEASE: A CRYSTALLOGRAPHIC STUDY OF COMPLEXES WITH SUBSTRATE AND PRODUCT DNA AT 2 ANGSTROMS RESOLUTION
;
_struct.pdbx_descriptor           'ECO RV (E.C.3.1.21.4)/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RVC 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER E 1   ? TYR E 17  ? SER A 2   TYR A 18  1 ? 17 
HELX_P HELX_P2  2  ASP E 35  ? HIS E 58  ? ASP A 36  HIS A 59  1 ? 24 
HELX_P HELX_P3  3  PRO E 123 ? ASP E 125 ? PRO A 124 ASP A 126 5 ? 3  
HELX_P HELX_P4  4  LYS E 144 ? LYS E 148 ? LYS A 145 LYS A 149 5 ? 5  
HELX_P HELX_P5  5  ASN E 153 ? ILE E 158 ? ASN A 154 ILE A 159 5 ? 6  
HELX_P HELX_P6  6  LYS E 172 ? ILE E 175 ? LYS A 173 ILE A 176 1 ? 4  
HELX_P HELX_P7  7  HIS E 194 ? GLY E 201 ? HIS A 195 GLY A 202 1 ? 8  
HELX_P HELX_P8  8  SER E 207 ? ASN E 217 ? SER A 208 ASN A 218 1 ? 11 
HELX_P HELX_P9  9  THR E 221 ? ASN E 226 ? THR A 222 ASN A 227 1 ? 6  
HELX_P HELX_P10 10 ASN E 231 ? ARG E 241 ? ASN A 232 ARG A 242 1 ? 11 
HELX_P HELX_P11 11 SER F 1   ? TYR F 17  ? SER B 2   TYR B 18  1 ? 17 
HELX_P HELX_P12 12 ASP F 35  ? HIS F 58  ? ASP B 36  HIS B 59  1 ? 24 
HELX_P HELX_P13 13 PRO F 123 ? ASP F 125 ? PRO B 124 ASP B 126 5 ? 3  
HELX_P HELX_P14 14 ASN F 153 ? ILE F 158 ? ASN B 154 ILE B 159 5 ? 6  
HELX_P HELX_P15 15 LYS F 172 ? ILE F 175 ? LYS B 173 ILE B 176 1 ? 4  
HELX_P HELX_P16 16 HIS F 194 ? GLY F 201 ? HIS B 195 GLY B 202 1 ? 8  
HELX_P HELX_P17 17 SER F 207 ? ASN F 217 ? SER B 208 ASN B 218 1 ? 11 
HELX_P HELX_P18 18 THR F 221 ? ASN F 226 ? THR B 222 ASN B 227 1 ? 6  
HELX_P HELX_P19 19 ASN F 231 ? ARG F 241 ? ASN B 232 ARG B 242 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I MG . MG ? ? ? 1_555 B DA  1  OP2 ? ? A MG 401 D DA  7   1_555 ? ? ? ? ? ? ?            1.916 ? 
metalc2  metalc ? ? I MG . MG ? ? ? 1_555 E GLU 44 OE2 ? ? A MG 401 A GLU 45  1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc3  metalc ? ? I MG . MG ? ? ? 1_555 E ASP 73 OD1 ? ? A MG 401 A ASP 74  1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc4  metalc ? ? I MG . MG ? ? ? 1_555 E ASP 73 OD2 ? ? A MG 401 A ASP 74  1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc5  metalc ? ? I MG . MG ? ? ? 1_555 L HOH .  O   ? ? A MG 401 D HOH 153 1_555 ? ? ? ? ? ? ?            2.055 ? 
metalc6  metalc ? ? I MG . MG ? ? ? 1_555 O HOH .  O   ? ? A MG 401 A HOH 487 1_555 ? ? ? ? ? ? ?            2.037 ? 
metalc7  metalc ? ? J MG . MG ? ? ? 1_555 F GLU 44 OE2 ? ? B MG 403 B GLU 45  1_555 ? ? ? ? ? ? ?            1.985 ? 
metalc8  metalc ? ? J MG . MG ? ? ? 1_555 P HOH .  O   ? ? B MG 403 B HOH 481 1_555 ? ? ? ? ? ? ?            1.989 ? 
metalc9  metalc ? ? J MG . MG ? ? ? 1_555 F ASP 73 OD2 ? ? B MG 403 B ASP 74  1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc10 metalc ? ? J MG . MG ? ? ? 1_555 F ASP 73 OD1 ? ? B MG 403 B ASP 74  1_555 ? ? ? ? ? ? ?            2.152 ? 
metalc11 metalc ? ? J MG . MG ? ? ? 1_555 D DA  1  OP2 ? ? B MG 403 F DA  7   1_555 ? ? ? ? ? ? ?            2.017 ? 
metalc12 metalc ? ? J MG . MG ? ? ? 1_555 N HOH .  O   ? ? B MG 403 F HOH 291 1_555 ? ? ? ? ? ? ?            2.111 ? 
metalc13 metalc ? ? G MG . MG ? ? ? 1_555 L HOH .  O   ? ? D MG 402 D HOH 240 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc14 metalc ? ? G MG . MG ? ? ? 1_555 B DA  1  OP1 ? ? D MG 402 D DA  7   1_555 ? ? ? ? ? ? ?            1.843 ? 
metalc15 metalc ? ? G MG . MG ? ? ? 1_555 O HOH .  O   ? ? D MG 402 A HOH 486 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc16 metalc ? ? G MG . MG ? ? ? 1_555 L HOH .  O   ? ? D MG 402 D HOH 184 1_555 ? ? ? ? ? ? ?            2.066 ? 
metalc17 metalc ? ? G MG . MG ? ? ? 1_555 L HOH .  O   ? ? D MG 402 D HOH 299 1_555 ? ? ? ? ? ? ?            2.126 ? 
metalc18 metalc ? ? G MG . MG ? ? ? 1_555 E GLN 68 O   ? ? D MG 402 A GLN 69  1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc19 metalc ? ? H MG . MG ? ? ? 1_555 O HOH .  O   ? ? F MG 404 A HOH 483 1_555 ? ? ? ? ? ? ?            2.232 ? 
metalc20 metalc ? ? H MG . MG ? ? ? 1_555 N HOH .  O   ? ? F MG 404 F HOH 126 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc21 metalc ? ? H MG . MG ? ? ? 1_555 F GLN 68 O   ? ? F MG 404 B GLN 69  1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc22 metalc ? ? H MG . MG ? ? ? 1_555 P HOH .  O   ? ? F MG 404 B HOH 476 1_555 ? ? ? ? ? ? ?            1.944 ? 
metalc23 metalc ? ? H MG . MG ? ? ? 1_555 P HOH .  O   ? ? F MG 404 B HOH 460 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc24 metalc ? ? H MG . MG ? ? ? 1_555 D DA  1  OP1 ? ? F MG 404 F DA  7   1_555 ? ? ? ? ? ? ?            1.895 ? 
hydrog1  hydrog ? ? A DA 2 N1 ? ? ? 1_555 D DT  5  N3  ? ? C DA 2   F DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DA 2 N6 ? ? ? 1_555 D DT  5  O4  ? ? C DA 2   F DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DA 3 N1 ? ? ? 1_555 D DT  4  N3  ? ? C DA 3   F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA 3 N6 ? ? ? 1_555 D DT  4  O4  ? ? C DA 3   F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG 4 N1 ? ? ? 1_555 D DC  3  N3  ? ? C DG 4   F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 4 N2 ? ? ? 1_555 D DC  3  O2  ? ? C DG 4   F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 4 O6 ? ? ? 1_555 D DC  3  N4  ? ? C DG 4   F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA 5 N1 ? ? ? 1_555 D DT  2  N3  ? ? C DA 5   F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA 5 N6 ? ? ? 1_555 D DT  2  O4  ? ? C DA 5   F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT 6 N3 ? ? ? 1_555 D DA  1  N1  ? ? C DT 6   F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT 6 O4 ? ? ? 1_555 D DA  1  N6  ? ? C DT 6   F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA 1 N1 ? ? ? 1_555 C DT  6  N3  ? ? D DA 7   E DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA 1 N6 ? ? ? 1_555 C DT  6  O4  ? ? D DA 7   E DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DT 2 N3 ? ? ? 1_555 C DA  5  N1  ? ? D DT 8   E DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT 2 O4 ? ? ? 1_555 C DA  5  N6  ? ? D DT 8   E DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC 3 N3 ? ? ? 1_555 C DG  4  N1  ? ? D DC 9   E DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC 3 N4 ? ? ? 1_555 C DG  4  O6  ? ? D DC 9   E DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC 3 O2 ? ? ? 1_555 C DG  4  N2  ? ? D DC 9   E DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT 4 N3 ? ? ? 1_555 C DA  3  N1  ? ? D DT 10  E DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT 4 O4 ? ? ? 1_555 C DA  3  N6  ? ? D DT 10  E DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT 5 N3 ? ? ? 1_555 C DA  2  N1  ? ? D DT 11  E DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT 5 O4 ? ? ? 1_555 C DA  2  N6  ? ? D DT 11  E DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 71 E . ? TYR 72 A PRO 72 E ? PRO 73 A 1 -0.69 
2 TYR 71 F . ? TYR 72 B PRO 72 F ? PRO 73 B 1 -0.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 3 ? 
D ? 5 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR E 150 ? ASN E 151 ? TYR A 151 ASN A 152 
A 2 LYS E 28  ? PRO E 31  ? LYS A 29  PRO A 32  
A 3 VAL E 19  ? SER E 24  ? VAL A 20  SER A 25  
A 4 VAL F 19  ? SER F 24  ? VAL B 20  SER B 25  
A 5 LYS F 28  ? PRO F 31  ? LYS B 29  PRO B 32  
A 6 TYR F 150 ? ASN F 151 ? TYR B 151 ASN B 152 
B 1 ILE E 61  ? GLU E 63  ? ILE A 62  GLU A 64  
B 2 PHE E 74  ? TYR E 77  ? PHE A 75  TYR A 78  
B 3 LYS E 85  ? THR E 95  ? LYS A 86  THR A 96  
B 4 TYR E 127 ? ARG E 139 ? TYR A 128 ARG A 140 
B 5 TYR E 162 ? ASP E 171 ? TYR A 163 ASP A 172 
C 1 THR E 105 ? GLY E 108 ? THR A 106 GLY A 109 
C 2 ASN E 187 ? SER E 190 ? ASN A 188 SER A 191 
C 3 ALA E 176 ? SER E 182 ? ALA A 177 SER A 183 
D 1 ILE F 61  ? GLU F 63  ? ILE B 62  GLU B 64  
D 2 PHE F 74  ? TYR F 77  ? PHE B 75  TYR B 78  
D 3 LYS F 85  ? THR F 95  ? LYS B 86  THR B 96  
D 4 TYR F 127 ? ARG F 139 ? TYR B 128 ARG B 140 
D 5 TYR F 162 ? ASP F 171 ? TYR B 163 ASP B 172 
E 1 THR F 105 ? GLY F 108 ? THR B 106 GLY B 109 
E 2 ASN F 187 ? SER F 190 ? ASN B 188 SER B 191 
E 3 ALA F 176 ? SER F 182 ? ALA B 177 SER B 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR E 150 ? O TYR A 151 N ILE E 29  ? N ILE A 30  
A 2 3 N TYR E 30  ? N TYR A 31  O ILE E 22  ? O ILE A 23  
A 3 4 O ILE E 23  ? O ILE A 24  N CYS F 20  ? N CYS B 21  
A 4 5 N SER F 24  ? N SER B 25  O LYS F 28  ? O LYS B 29  
A 5 6 N ILE F 29  ? N ILE B 30  O TYR F 150 ? O TYR B 151 
B 1 2 O GLU E 63  ? O GLU A 64  N THR E 75  ? N THR A 76  
B 2 3 O LEU E 76  ? O LEU A 77  N ILE E 86  ? N ILE A 87  
B 3 4 O LYS E 85  ? O LYS A 86  N ILE E 128 ? N ILE A 129 
B 4 5 O THR E 138 ? O THR A 139 N LYS E 163 ? N LYS A 164 
C 1 2 N LEU E 106 ? N LEU A 107 O ILE E 188 ? O ILE A 189 
C 2 3 O GLY E 189 ? O GLY A 190 N GLY E 177 ? N GLY A 178 
D 1 2 O GLU F 63  ? O GLU B 64  N THR F 75  ? N THR B 76  
D 2 3 O LEU F 76  ? O LEU B 77  N ILE F 86  ? N ILE B 87  
D 3 4 O LYS F 85  ? O LYS B 86  N ILE F 128 ? N ILE B 129 
D 4 5 O THR F 138 ? O THR B 139 N LYS F 163 ? N LYS B 164 
E 1 2 O GLY F 107 ? O GLY B 108 N ILE F 188 ? N ILE B 189 
E 2 3 O GLY F 189 ? O GLY B 190 N GLY F 177 ? N GLY B 178 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 401' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG D 402' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG B 403' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG F 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLU E 44 ? GLU A 45  . ? 1_555 ? 
2  AC1 5 ASP E 73 ? ASP A 74  . ? 1_555 ? 
3  AC1 5 HOH O .  ? HOH A 487 . ? 1_555 ? 
4  AC1 5 DA  B 1  ? DA  D 7   . ? 1_555 ? 
5  AC1 5 HOH L .  ? HOH D 153 . ? 1_555 ? 
6  AC2 6 GLN E 68 ? GLN A 69  . ? 1_555 ? 
7  AC2 6 HOH O .  ? HOH A 486 . ? 1_555 ? 
8  AC2 6 DA  B 1  ? DA  D 7   . ? 1_555 ? 
9  AC2 6 HOH L .  ? HOH D 184 . ? 1_555 ? 
10 AC2 6 HOH L .  ? HOH D 240 . ? 1_555 ? 
11 AC2 6 HOH L .  ? HOH D 299 . ? 1_555 ? 
12 AC3 5 GLU F 44 ? GLU B 45  . ? 1_555 ? 
13 AC3 5 ASP F 73 ? ASP B 74  . ? 1_555 ? 
14 AC3 5 HOH P .  ? HOH B 481 . ? 1_555 ? 
15 AC3 5 DA  D 1  ? DA  F 7   . ? 1_555 ? 
16 AC3 5 HOH N .  ? HOH F 291 . ? 1_555 ? 
17 AC4 6 HOH O .  ? HOH A 483 . ? 1_555 ? 
18 AC4 6 GLN F 68 ? GLN B 69  . ? 1_555 ? 
19 AC4 6 HOH P .  ? HOH B 460 . ? 1_555 ? 
20 AC4 6 HOH P .  ? HOH B 476 . ? 1_555 ? 
21 AC4 6 DA  D 1  ? DA  F 7   . ? 1_555 ? 
22 AC4 6 HOH N .  ? HOH F 126 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1RVC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1RVC 
_atom_sites.fract_transf_matrix[1][1]   0.020288 
_atom_sites.fract_transf_matrix[1][2]   0.006753 
_atom_sites.fract_transf_matrix[1][3]   0.008788 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020936 
_atom_sites.fract_transf_matrix[2][3]   0.005225 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017040 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DA  A 1 1   ? 0.823   -20.258 -12.833 1.00 72.27 ? 1   DA  C "O5'" 1 
ATOM   2    C  "C5'" . DA  A 1 1   ? 0.216   -21.328 -13.586 1.00 72.00 ? 1   DA  C "C5'" 1 
ATOM   3    C  "C4'" . DA  A 1 1   ? -1.034  -21.988 -12.927 1.00 69.75 ? 1   DA  C "C4'" 1 
ATOM   4    O  "O4'" . DA  A 1 1   ? -0.715  -22.551 -11.624 1.00 71.13 ? 1   DA  C "O4'" 1 
ATOM   5    C  "C3'" . DA  A 1 1   ? -2.106  -20.949 -12.623 1.00 66.55 ? 1   DA  C "C3'" 1 
ATOM   6    O  "O3'" . DA  A 1 1   ? -3.360  -21.627 -12.637 1.00 62.18 ? 1   DA  C "O3'" 1 
ATOM   7    C  "C2'" . DA  A 1 1   ? -1.737  -20.533 -11.214 1.00 64.03 ? 1   DA  C "C2'" 1 
ATOM   8    C  "C1'" . DA  A 1 1   ? -1.508  -21.883 -10.614 1.00 64.00 ? 1   DA  C "C1'" 1 
ATOM   9    N  N9    . DA  A 1 1   ? -0.708  -21.925 -9.373  1.00 57.60 ? 1   DA  C N9    1 
ATOM   10   C  C8    . DA  A 1 1   ? -1.125  -22.551 -8.220  1.00 58.45 ? 1   DA  C C8    1 
ATOM   11   N  N7    . DA  A 1 1   ? -0.246  -22.505 -7.242  1.00 54.45 ? 1   DA  C N7    1 
ATOM   12   C  C5    . DA  A 1 1   ? 0.841   -21.799 -7.774  1.00 52.06 ? 1   DA  C C5    1 
ATOM   13   C  C6    . DA  A 1 1   ? 2.100   -21.427 -7.210  1.00 53.98 ? 1   DA  C C6    1 
ATOM   14   N  N6    . DA  A 1 1   ? 2.439   -21.758 -5.948  1.00 46.78 ? 1   DA  C N6    1 
ATOM   15   N  N1    . DA  A 1 1   ? 2.961   -20.730 -7.994  1.00 53.64 ? 1   DA  C N1    1 
ATOM   16   C  C2    . DA  A 1 1   ? 2.587   -20.430 -9.247  1.00 57.32 ? 1   DA  C C2    1 
ATOM   17   N  N3    . DA  A 1 1   ? 1.443   -20.720 -9.891  1.00 54.64 ? 1   DA  C N3    1 
ATOM   18   C  C4    . DA  A 1 1   ? 0.584   -21.426 -9.083  1.00 54.76 ? 1   DA  C C4    1 
ATOM   19   P  P     . DA  A 1 2   ? -4.744  -20.796 -12.704 1.00 69.93 ? 2   DA  C P     1 
ATOM   20   O  OP1   . DA  A 1 2   ? -5.698  -21.589 -13.542 1.00 66.70 ? 2   DA  C OP1   1 
ATOM   21   O  OP2   . DA  A 1 2   ? -4.418  -19.371 -13.022 1.00 62.84 ? 2   DA  C OP2   1 
ATOM   22   O  "O5'" . DA  A 1 2   ? -5.278  -20.821 -11.185 1.00 64.44 ? 2   DA  C "O5'" 1 
ATOM   23   C  "C5'" . DA  A 1 2   ? -5.834  -21.998 -10.620 1.00 52.92 ? 2   DA  C "C5'" 1 
ATOM   24   C  "C4'" . DA  A 1 2   ? -6.014  -21.823 -9.129  1.00 45.57 ? 2   DA  C "C4'" 1 
ATOM   25   O  "O4'" . DA  A 1 2   ? -4.793  -21.409 -8.475  1.00 42.31 ? 2   DA  C "O4'" 1 
ATOM   26   C  "C3'" . DA  A 1 2   ? -7.068  -20.787 -8.906  1.00 42.39 ? 2   DA  C "C3'" 1 
ATOM   27   O  "O3'" . DA  A 1 2   ? -7.976  -21.451 -8.044  1.00 41.13 ? 2   DA  C "O3'" 1 
ATOM   28   C  "C2'" . DA  A 1 2   ? -6.309  -19.618 -8.287  1.00 39.18 ? 2   DA  C "C2'" 1 
ATOM   29   C  "C1'" . DA  A 1 2   ? -5.034  -20.203 -7.709  1.00 39.07 ? 2   DA  C "C1'" 1 
ATOM   30   N  N9    . DA  A 1 2   ? -3.791  -19.441 -7.929  1.00 32.11 ? 2   DA  C N9    1 
ATOM   31   C  C8    . DA  A 1 2   ? -3.400  -18.645 -8.986  1.00 34.35 ? 2   DA  C C8    1 
ATOM   32   N  N7    . DA  A 1 2   ? -2.184  -18.144 -8.871  1.00 30.67 ? 2   DA  C N7    1 
ATOM   33   C  C5    . DA  A 1 2   ? -1.747  -18.651 -7.642  1.00 24.17 ? 2   DA  C C5    1 
ATOM   34   C  C6    . DA  A 1 2   ? -0.545  -18.506 -6.925  1.00 22.59 ? 2   DA  C C6    1 
ATOM   35   N  N6    . DA  A 1 2   ? 0.511   -17.780 -7.334  1.00 25.59 ? 2   DA  C N6    1 
ATOM   36   N  N1    . DA  A 1 2   ? -0.484  -19.153 -5.754  1.00 26.16 ? 2   DA  C N1    1 
ATOM   37   C  C2    . DA  A 1 2   ? -1.517  -19.881 -5.325  1.00 27.13 ? 2   DA  C C2    1 
ATOM   38   N  N3    . DA  A 1 2   ? -2.680  -20.096 -5.890  1.00 29.09 ? 2   DA  C N3    1 
ATOM   39   C  C4    . DA  A 1 2   ? -2.725  -19.438 -7.068  1.00 28.92 ? 2   DA  C C4    1 
ATOM   40   P  P     . DA  A 1 3   ? -9.308  -20.787 -7.492  1.00 49.59 ? 3   DA  C P     1 
ATOM   41   O  OP1   . DA  A 1 3   ? -10.290 -21.853 -7.228  1.00 53.89 ? 3   DA  C OP1   1 
ATOM   42   O  OP2   . DA  A 1 3   ? -9.724  -19.657 -8.363  1.00 54.07 ? 3   DA  C OP2   1 
ATOM   43   O  "O5'" . DA  A 1 3   ? -8.848  -20.207 -6.064  1.00 46.25 ? 3   DA  C "O5'" 1 
ATOM   44   C  "C5'" . DA  A 1 3   ? -8.420  -21.127 -5.055  1.00 34.60 ? 3   DA  C "C5'" 1 
ATOM   45   C  "C4'" . DA  A 1 3   ? -7.669  -20.388 -3.949  1.00 30.31 ? 3   DA  C "C4'" 1 
ATOM   46   O  "O4'" . DA  A 1 3   ? -6.431  -19.793 -4.351  1.00 29.14 ? 3   DA  C "O4'" 1 
ATOM   47   C  "C3'" . DA  A 1 3   ? -8.590  -19.264 -3.499  1.00 30.80 ? 3   DA  C "C3'" 1 
ATOM   48   O  "O3'" . DA  A 1 3   ? -8.835  -19.617 -2.150  1.00 31.56 ? 3   DA  C "O3'" 1 
ATOM   49   C  "C2'" . DA  A 1 3   ? -7.799  -17.974 -3.711  1.00 28.33 ? 3   DA  C "C2'" 1 
ATOM   50   C  "C1'" . DA  A 1 3   ? -6.387  -18.464 -3.769  1.00 28.12 ? 3   DA  C "C1'" 1 
ATOM   51   N  N9    . DA  A 1 3   ? -5.550  -17.586 -4.616  1.00 26.40 ? 3   DA  C N9    1 
ATOM   52   C  C8    . DA  A 1 3   ? -5.850  -16.979 -5.822  1.00 21.19 ? 3   DA  C C8    1 
ATOM   53   N  N7    . DA  A 1 3   ? -4.849  -16.273 -6.299  1.00 21.41 ? 3   DA  C N7    1 
ATOM   54   C  C5    . DA  A 1 3   ? -3.829  -16.418 -5.358  1.00 16.55 ? 3   DA  C C5    1 
ATOM   55   C  C6    . DA  A 1 3   ? -2.538  -15.914 -5.295  1.00 19.20 ? 3   DA  C C6    1 
ATOM   56   N  N6    . DA  A 1 3   ? -2.013  -15.125 -6.241  1.00 18.87 ? 3   DA  C N6    1 
ATOM   57   N  N1    . DA  A 1 3   ? -1.810  -16.262 -4.211  1.00 20.85 ? 3   DA  C N1    1 
ATOM   58   C  C2    . DA  A 1 3   ? -2.329  -17.053 -3.264  1.00 20.25 ? 3   DA  C C2    1 
ATOM   59   N  N3    . DA  A 1 3   ? -3.521  -17.585 -3.211  1.00 23.37 ? 3   DA  C N3    1 
ATOM   60   C  C4    . DA  A 1 3   ? -4.240  -17.219 -4.315  1.00 21.34 ? 3   DA  C C4    1 
ATOM   61   P  P     . DG  A 1 4   ? -9.777  -18.873 -1.108  1.00 25.78 ? 4   DG  C P     1 
ATOM   62   O  OP1   . DG  A 1 4   ? -10.364 -19.975 -0.303  1.00 42.13 ? 4   DG  C OP1   1 
ATOM   63   O  OP2   . DG  A 1 4   ? -10.673 -17.916 -1.771  1.00 24.14 ? 4   DG  C OP2   1 
ATOM   64   O  "O5'" . DG  A 1 4   ? -8.717  -18.029 -0.209  1.00 22.43 ? 4   DG  C "O5'" 1 
ATOM   65   C  "C5'" . DG  A 1 4   ? -7.663  -18.618 0.542   1.00 15.13 ? 4   DG  C "C5'" 1 
ATOM   66   C  "C4'" . DG  A 1 4   ? -6.675  -17.579 0.949   1.00 20.98 ? 4   DG  C "C4'" 1 
ATOM   67   O  "O4'" . DG  A 1 4   ? -5.960  -17.127 -0.209  1.00 19.50 ? 4   DG  C "O4'" 1 
ATOM   68   C  "C3'" . DG  A 1 4   ? -7.396  -16.353 1.604   1.00 22.30 ? 4   DG  C "C3'" 1 
ATOM   69   O  "O3'" . DG  A 1 4   ? -6.550  -15.912 2.651   1.00 23.06 ? 4   DG  C "O3'" 1 
ATOM   70   C  "C2'" . DG  A 1 4   ? -7.377  -15.345 0.455   1.00 17.28 ? 4   DG  C "C2'" 1 
ATOM   71   C  "C1'" . DG  A 1 4   ? -5.973  -15.680 -0.080  1.00 21.07 ? 4   DG  C "C1'" 1 
ATOM   72   N  N9    . DG  A 1 4   ? -5.765  -14.949 -1.367  1.00 21.46 ? 4   DG  C N9    1 
ATOM   73   C  C8    . DG  A 1 4   ? -6.668  -14.635 -2.369  1.00 21.50 ? 4   DG  C C8    1 
ATOM   74   N  N7    . DG  A 1 4   ? -6.131  -13.944 -3.355  1.00 23.82 ? 4   DG  C N7    1 
ATOM   75   C  C5    . DG  A 1 4   ? -4.788  -13.804 -2.965  1.00 19.89 ? 4   DG  C C5    1 
ATOM   76   C  C6    . DG  A 1 4   ? -3.726  -13.153 -3.627  1.00 19.33 ? 4   DG  C C6    1 
ATOM   77   O  O6    . DG  A 1 4   ? -3.794  -12.582 -4.709  1.00 20.84 ? 4   DG  C O6    1 
ATOM   78   N  N1    . DG  A 1 4   ? -2.533  -13.229 -2.917  1.00 15.61 ? 4   DG  C N1    1 
ATOM   79   C  C2    . DG  A 1 4   ? -2.386  -13.874 -1.693  1.00 17.43 ? 4   DG  C C2    1 
ATOM   80   N  N2    . DG  A 1 4   ? -1.203  -13.886 -1.110  1.00 11.22 ? 4   DG  C N2    1 
ATOM   81   N  N3    . DG  A 1 4   ? -3.372  -14.481 -1.075  1.00 12.75 ? 4   DG  C N3    1 
ATOM   82   C  C4    . DG  A 1 4   ? -4.551  -14.411 -1.760  1.00 17.31 ? 4   DG  C C4    1 
ATOM   83   P  P     . DA  A 1 5   ? -6.707  -16.338 4.230   1.00 22.55 ? 5   DA  C P     1 
ATOM   84   O  OP1   . DA  A 1 5   ? -6.474  -17.800 4.321   1.00 28.98 ? 5   DA  C OP1   1 
ATOM   85   O  OP2   . DA  A 1 5   ? -7.983  -15.746 4.673   1.00 14.86 ? 5   DA  C OP2   1 
ATOM   86   O  "O5'" . DA  A 1 5   ? -5.424  -15.533 4.808   1.00 21.58 ? 5   DA  C "O5'" 1 
ATOM   87   C  "C5'" . DA  A 1 5   ? -5.315  -14.100 4.875   1.00 18.60 ? 5   DA  C "C5'" 1 
ATOM   88   C  "C4'" . DA  A 1 5   ? -3.865  -13.784 4.614   1.00 17.71 ? 5   DA  C "C4'" 1 
ATOM   89   O  "O4'" . DA  A 1 5   ? -3.579  -14.073 3.259   1.00 19.30 ? 5   DA  C "O4'" 1 
ATOM   90   C  "C3'" . DA  A 1 5   ? -3.547  -12.300 4.794   1.00 22.40 ? 5   DA  C "C3'" 1 
ATOM   91   O  "O3'" . DA  A 1 5   ? -3.291  -12.121 6.192   1.00 24.94 ? 5   DA  C "O3'" 1 
ATOM   92   C  "C2'" . DA  A 1 5   ? -2.290  -12.155 3.939   1.00 13.00 ? 5   DA  C "C2'" 1 
ATOM   93   C  "C1'" . DA  A 1 5   ? -2.664  -13.045 2.786   1.00 17.53 ? 5   DA  C "C1'" 1 
ATOM   94   N  N9    . DA  A 1 5   ? -3.417  -12.378 1.700   1.00 20.80 ? 5   DA  C N9    1 
ATOM   95   C  C8    . DA  A 1 5   ? -4.756  -12.494 1.358   1.00 14.94 ? 5   DA  C C8    1 
ATOM   96   N  N7    . DA  A 1 5   ? -5.097  -11.798 0.290   1.00 17.30 ? 5   DA  C N7    1 
ATOM   97   C  C5    . DA  A 1 5   ? -3.906  -11.187 -0.089  1.00 11.17 ? 5   DA  C C5    1 
ATOM   98   C  C6    . DA  A 1 5   ? -3.595  -10.322 -1.147  1.00 9.70  ? 5   DA  C C6    1 
ATOM   99   N  N6    . DA  A 1 5   ? -4.512  -9.917  -2.063  1.00 9.17  ? 5   DA  C N6    1 
ATOM   100  N  N1    . DA  A 1 5   ? -2.301  -9.919  -1.196  1.00 11.38 ? 5   DA  C N1    1 
ATOM   101  C  C2    . DA  A 1 5   ? -1.385  -10.313 -0.309  1.00 14.99 ? 5   DA  C C2    1 
ATOM   102  N  N3    . DA  A 1 5   ? -1.567  -11.127 0.725   1.00 15.17 ? 5   DA  C N3    1 
ATOM   103  C  C4    . DA  A 1 5   ? -2.871  -11.530 0.769   1.00 14.20 ? 5   DA  C C4    1 
ATOM   104  P  P     . DT  A 1 6   ? -3.433  -10.731 6.945   1.00 20.21 ? 6   DT  C P     1 
ATOM   105  O  OP1   . DT  A 1 6   ? -3.172  -11.004 8.397   1.00 26.88 ? 6   DT  C OP1   1 
ATOM   106  O  OP2   . DT  A 1 6   ? -4.660  -10.048 6.525   1.00 17.04 ? 6   DT  C OP2   1 
ATOM   107  O  "O5'" . DT  A 1 6   ? -2.237  -9.854  6.332   1.00 19.83 ? 6   DT  C "O5'" 1 
ATOM   108  C  "C5'" . DT  A 1 6   ? -0.863  -9.984  6.678   1.00 22.64 ? 6   DT  C "C5'" 1 
ATOM   109  C  "C4'" . DT  A 1 6   ? -0.115  -8.924  5.898   1.00 25.62 ? 6   DT  C "C4'" 1 
ATOM   110  O  "O4'" . DT  A 1 6   ? -0.181  -9.250  4.490   1.00 27.68 ? 6   DT  C "O4'" 1 
ATOM   111  C  "C3'" . DT  A 1 6   ? -0.807  -7.564  5.996   1.00 29.75 ? 6   DT  C "C3'" 1 
ATOM   112  O  "O3'" . DT  A 1 6   ? -0.290  -6.853  7.100   1.00 39.25 ? 6   DT  C "O3'" 1 
ATOM   113  C  "C2'" . DT  A 1 6   ? -0.358  -6.920  4.713   1.00 35.52 ? 6   DT  C "C2'" 1 
ATOM   114  C  "C1'" . DT  A 1 6   ? -0.293  -8.060  3.727   1.00 23.00 ? 6   DT  C "C1'" 1 
ATOM   115  N  N1    . DT  A 1 6   ? -1.522  -7.926  2.884   1.00 21.96 ? 6   DT  C N1    1 
ATOM   116  C  C2    . DT  A 1 6   ? -1.276  -7.279  1.659   1.00 22.07 ? 6   DT  C C2    1 
ATOM   117  O  O2    . DT  A 1 6   ? -0.143  -6.886  1.329   1.00 18.84 ? 6   DT  C O2    1 
ATOM   118  N  N3    . DT  A 1 6   ? -2.398  -7.112  0.841   1.00 16.14 ? 6   DT  C N3    1 
ATOM   119  C  C4    . DT  A 1 6   ? -3.712  -7.528  1.140   1.00 19.90 ? 6   DT  C C4    1 
ATOM   120  O  O4    . DT  A 1 6   ? -4.616  -7.293  0.349   1.00 19.22 ? 6   DT  C O4    1 
ATOM   121  C  C5    . DT  A 1 6   ? -3.881  -8.200  2.436   1.00 17.64 ? 6   DT  C C5    1 
ATOM   122  C  C7    . DT  A 1 6   ? -5.260  -8.705  2.856   1.00 17.84 ? 6   DT  C C7    1 
ATOM   123  C  C6    . DT  A 1 6   ? -2.806  -8.369  3.240   1.00 17.50 ? 6   DT  C C6    1 
ATOM   124  O  OP3   . DA  B 2 1   ? 1.300   -4.883  7.452   1.00 18.89 ? 7   DA  D OP3   1 
ATOM   125  P  P     . DA  B 2 1   ? 2.183   -3.995  6.456   1.00 29.11 ? 7   DA  D P     1 
ATOM   126  O  OP1   . DA  B 2 1   ? 3.147   -4.822  5.709   1.00 36.40 ? 7   DA  D OP1   1 
ATOM   127  O  OP2   . DA  B 2 1   ? 2.732   -2.796  7.122   1.00 40.69 ? 7   DA  D OP2   1 
ATOM   128  O  "O5'" . DA  B 2 1   ? 1.016   -3.535  5.425   1.00 35.42 ? 7   DA  D "O5'" 1 
ATOM   129  C  "C5'" . DA  B 2 1   ? -0.064  -2.636  5.720   1.00 29.38 ? 7   DA  D "C5'" 1 
ATOM   130  C  "C4'" . DA  B 2 1   ? 0.024   -1.398  4.820   1.00 30.81 ? 7   DA  D "C4'" 1 
ATOM   131  O  "O4'" . DA  B 2 1   ? 0.240   -1.734  3.428   1.00 28.81 ? 7   DA  D "O4'" 1 
ATOM   132  C  "C3'" . DA  B 2 1   ? -1.318  -0.675  4.878   1.00 29.84 ? 7   DA  D "C3'" 1 
ATOM   133  O  "O3'" . DA  B 2 1   ? -1.272  0.413   5.798   1.00 28.77 ? 7   DA  D "O3'" 1 
ATOM   134  C  "C2'" . DA  B 2 1   ? -1.432  -0.107  3.490   1.00 19.90 ? 7   DA  D "C2'" 1 
ATOM   135  C  "C1'" . DA  B 2 1   ? -0.806  -1.177  2.603   1.00 23.32 ? 7   DA  D "C1'" 1 
ATOM   136  N  N9    . DA  B 2 1   ? -1.867  -2.184  2.235   1.00 21.58 ? 7   DA  D N9    1 
ATOM   137  C  C8    . DA  B 2 1   ? -1.925  -3.512  2.588   1.00 21.24 ? 7   DA  D C8    1 
ATOM   138  N  N7    . DA  B 2 1   ? -2.983  -4.123  2.098   1.00 23.92 ? 7   DA  D N7    1 
ATOM   139  C  C5    . DA  B 2 1   ? -3.678  -3.174  1.377   1.00 20.30 ? 7   DA  D C5    1 
ATOM   140  C  C6    . DA  B 2 1   ? -4.883  -3.226  0.622   1.00 22.59 ? 7   DA  D C6    1 
ATOM   141  N  N6    . DA  B 2 1   ? -5.603  -4.327  0.460   1.00 15.75 ? 7   DA  D N6    1 
ATOM   142  N  N1    . DA  B 2 1   ? -5.301  -2.091  0.023   1.00 21.09 ? 7   DA  D N1    1 
ATOM   143  C  C2    . DA  B 2 1   ? -4.554  -0.987  0.177   1.00 21.21 ? 7   DA  D C2    1 
ATOM   144  N  N3    . DA  B 2 1   ? -3.421  -0.808  0.844   1.00 19.39 ? 7   DA  D N3    1 
ATOM   145  C  C4    . DA  B 2 1   ? -3.016  -1.970  1.443   1.00 22.64 ? 7   DA  D C4    1 
ATOM   146  P  P     . DT  B 2 2   ? -2.464  0.786   6.833   1.00 27.78 ? 8   DT  D P     1 
ATOM   147  O  OP1   . DT  B 2 2   ? -1.874  1.875   7.681   1.00 25.20 ? 8   DT  D OP1   1 
ATOM   148  O  OP2   . DT  B 2 2   ? -2.978  -0.450  7.446   1.00 23.54 ? 8   DT  D OP2   1 
ATOM   149  O  "O5'" . DT  B 2 2   ? -3.786  1.339   6.063   1.00 27.94 ? 8   DT  D "O5'" 1 
ATOM   150  C  "C5'" . DT  B 2 2   ? -3.837  2.472   5.247   1.00 25.55 ? 8   DT  D "C5'" 1 
ATOM   151  C  "C4'" . DT  B 2 2   ? -5.070  2.470   4.350   1.00 18.84 ? 8   DT  D "C4'" 1 
ATOM   152  O  "O4'" . DT  B 2 2   ? -5.186  1.175   3.773   1.00 18.01 ? 8   DT  D "O4'" 1 
ATOM   153  C  "C3'" . DT  B 2 2   ? -6.362  2.816   5.044   1.00 13.74 ? 8   DT  D "C3'" 1 
ATOM   154  O  "O3'" . DT  B 2 2   ? -6.414  4.206   4.829   1.00 14.81 ? 8   DT  D "O3'" 1 
ATOM   155  C  "C2'" . DT  B 2 2   ? -7.361  1.989   4.240   1.00 10.59 ? 8   DT  D "C2'" 1 
ATOM   156  C  "C1'" . DT  B 2 2   ? -6.482  1.296   3.167   1.00 15.14 ? 8   DT  D "C1'" 1 
ATOM   157  N  N1    . DT  B 2 2   ? -7.061  -0.033  2.847   1.00 20.45 ? 8   DT  D N1    1 
ATOM   158  C  C2    . DT  B 2 2   ? -7.849  -0.106  1.688   1.00 20.46 ? 8   DT  D C2    1 
ATOM   159  O  O2    . DT  B 2 2   ? -8.037  0.853   0.931   1.00 17.80 ? 8   DT  D O2    1 
ATOM   160  N  N3    . DT  B 2 2   ? -8.408  -1.353  1.438   1.00 15.21 ? 8   DT  D N3    1 
ATOM   161  C  C4    . DT  B 2 2   ? -8.252  -2.483  2.211   1.00 20.10 ? 8   DT  D C4    1 
ATOM   162  O  O4    . DT  B 2 2   ? -8.838  -3.497  1.869   1.00 19.90 ? 8   DT  D O4    1 
ATOM   163  C  C5    . DT  B 2 2   ? -7.409  -2.322  3.396   1.00 25.59 ? 8   DT  D C5    1 
ATOM   164  C  C7    . DT  B 2 2   ? -7.134  -3.487  4.356   1.00 18.65 ? 8   DT  D C7    1 
ATOM   165  C  C6    . DT  B 2 2   ? -6.855  -1.129  3.668   1.00 21.23 ? 8   DT  D C6    1 
ATOM   166  P  P     . DC  B 2 3   ? -7.639  5.254   4.774   1.00 16.36 ? 9   DC  D P     1 
ATOM   167  O  OP1   . DC  B 2 3   ? -6.950  6.543   4.762   1.00 19.41 ? 9   DC  D OP1   1 
ATOM   168  O  OP2   . DC  B 2 3   ? -8.546  4.989   5.910   1.00 23.71 ? 9   DC  D OP2   1 
ATOM   169  O  "O5'" . DC  B 2 3   ? -8.496  5.149   3.403   1.00 20.65 ? 9   DC  D "O5'" 1 
ATOM   170  C  "C5'" . DC  B 2 3   ? -7.875  5.456   2.147   1.00 16.11 ? 9   DC  D "C5'" 1 
ATOM   171  C  "C4'" . DC  B 2 3   ? -8.833  5.239   0.991   1.00 19.07 ? 9   DC  D "C4'" 1 
ATOM   172  O  "O4'" . DC  B 2 3   ? -9.217  3.865   0.888   1.00 18.31 ? 9   DC  D "O4'" 1 
ATOM   173  C  "C3'" . DC  B 2 3   ? -10.096 6.034   1.213   1.00 19.00 ? 9   DC  D "C3'" 1 
ATOM   174  O  "O3'" . DC  B 2 3   ? -10.319 6.760   0.012   1.00 17.86 ? 9   DC  D "O3'" 1 
ATOM   175  C  "C2'" . DC  B 2 3   ? -11.149 4.995   1.457   1.00 18.05 ? 9   DC  D "C2'" 1 
ATOM   176  C  "C1'" . DC  B 2 3   ? -10.619 3.776   0.743   1.00 16.92 ? 9   DC  D "C1'" 1 
ATOM   177  N  N1    . DC  B 2 3   ? -11.037 2.522   1.382   1.00 20.90 ? 9   DC  D N1    1 
ATOM   178  C  C2    . DC  B 2 3   ? -11.788 1.597   0.653   1.00 19.84 ? 9   DC  D C2    1 
ATOM   179  O  O2    . DC  B 2 3   ? -12.102 1.799   -0.524  1.00 19.17 ? 9   DC  D O2    1 
ATOM   180  N  N3    . DC  B 2 3   ? -12.168 0.433   1.280   1.00 13.53 ? 9   DC  D N3    1 
ATOM   181  C  C4    . DC  B 2 3   ? -11.824 0.202   2.559   1.00 16.83 ? 9   DC  D C4    1 
ATOM   182  N  N4    . DC  B 2 3   ? -12.226 -0.918  3.135   1.00 15.10 ? 9   DC  D N4    1 
ATOM   183  C  C5    . DC  B 2 3   ? -11.047 1.148   3.324   1.00 12.20 ? 9   DC  D C5    1 
ATOM   184  C  C6    . DC  B 2 3   ? -10.682 2.283   2.691   1.00 20.03 ? 9   DC  D C6    1 
ATOM   185  P  P     . DT  B 2 4   ? -11.431 7.950   -0.145  1.00 21.31 ? 10  DT  D P     1 
ATOM   186  O  OP1   . DT  B 2 4   ? -10.801 8.847   -1.131  1.00 19.16 ? 10  DT  D OP1   1 
ATOM   187  O  OP2   . DT  B 2 4   ? -11.806 8.441   1.182   1.00 19.73 ? 10  DT  D OP2   1 
ATOM   188  O  "O5'" . DT  B 2 4   ? -12.735 7.256   -0.741  1.00 21.71 ? 10  DT  D "O5'" 1 
ATOM   189  C  "C5'" . DT  B 2 4   ? -12.648 6.605   -2.002  1.00 21.65 ? 10  DT  D "C5'" 1 
ATOM   190  C  "C4'" . DT  B 2 4   ? -13.943 5.946   -2.358  1.00 20.77 ? 10  DT  D "C4'" 1 
ATOM   191  O  "O4'" . DT  B 2 4   ? -14.093 4.839   -1.549  1.00 19.24 ? 10  DT  D "O4'" 1 
ATOM   192  C  "C3'" . DT  B 2 4   ? -15.155 6.807   -2.092  1.00 27.98 ? 10  DT  D "C3'" 1 
ATOM   193  O  "O3'" . DT  B 2 4   ? -15.873 6.853   -3.332  1.00 40.41 ? 10  DT  D "O3'" 1 
ATOM   194  C  "C2'" . DT  B 2 4   ? -15.929 6.088   -1.003  1.00 22.62 ? 10  DT  D "C2'" 1 
ATOM   195  C  "C1'" . DT  B 2 4   ? -15.480 4.668   -1.205  1.00 18.18 ? 10  DT  D "C1'" 1 
ATOM   196  N  N1    . DT  B 2 4   ? -15.374 3.791   -0.022  1.00 19.76 ? 10  DT  D N1    1 
ATOM   197  C  C2    . DT  B 2 4   ? -15.856 2.500   -0.151  1.00 19.38 ? 10  DT  D C2    1 
ATOM   198  O  O2    . DT  B 2 4   ? -16.371 2.052   -1.176  1.00 23.20 ? 10  DT  D O2    1 
ATOM   199  N  N3    . DT  B 2 4   ? -15.723 1.704   0.960   1.00 18.91 ? 10  DT  D N3    1 
ATOM   200  C  C4    . DT  B 2 4   ? -15.159 2.080   2.168   1.00 20.94 ? 10  DT  D C4    1 
ATOM   201  O  O4    . DT  B 2 4   ? -15.106 1.261   3.076   1.00 26.26 ? 10  DT  D O4    1 
ATOM   202  C  C5    . DT  B 2 4   ? -14.683 3.438   2.220   1.00 22.01 ? 10  DT  D C5    1 
ATOM   203  C  C7    . DT  B 2 4   ? -14.037 3.960   3.491   1.00 20.01 ? 10  DT  D C7    1 
ATOM   204  C  C6    . DT  B 2 4   ? -14.802 4.241   1.144   1.00 23.23 ? 10  DT  D C6    1 
ATOM   205  P  P     . DT  B 2 5   ? -16.890 8.080   -3.614  1.00 49.79 ? 11  DT  D P     1 
ATOM   206  O  OP1   . DT  B 2 5   ? -16.596 8.465   -5.037  1.00 37.88 ? 11  DT  D OP1   1 
ATOM   207  O  OP2   . DT  B 2 5   ? -16.820 9.065   -2.474  1.00 40.48 ? 11  DT  D OP2   1 
ATOM   208  O  "O5'" . DT  B 2 5   ? -18.326 7.352   -3.559  1.00 48.34 ? 11  DT  D "O5'" 1 
ATOM   209  C  "C5'" . DT  B 2 5   ? -18.638 6.277   -4.474  1.00 49.89 ? 11  DT  D "C5'" 1 
ATOM   210  C  "C4'" . DT  B 2 5   ? -19.776 5.387   -3.933  1.00 52.50 ? 11  DT  D "C4'" 1 
ATOM   211  O  "O4'" . DT  B 2 5   ? -19.362 4.702   -2.718  1.00 47.48 ? 11  DT  D "O4'" 1 
ATOM   212  C  "C3'" . DT  B 2 5   ? -21.020 6.268   -3.555  1.00 57.68 ? 11  DT  D "C3'" 1 
ATOM   213  O  "O3'" . DT  B 2 5   ? -22.228 5.660   -4.150  1.00 64.05 ? 11  DT  D "O3'" 1 
ATOM   214  C  "C2'" . DT  B 2 5   ? -21.032 6.174   -2.000  1.00 49.62 ? 11  DT  D "C2'" 1 
ATOM   215  C  "C1'" . DT  B 2 5   ? -20.457 4.758   -1.769  1.00 45.40 ? 11  DT  D "C1'" 1 
ATOM   216  N  N1    . DT  B 2 5   ? -19.821 4.481   -0.443  1.00 38.15 ? 11  DT  D N1    1 
ATOM   217  C  C2    . DT  B 2 5   ? -19.763 3.150   -0.012  1.00 36.49 ? 11  DT  D C2    1 
ATOM   218  O  O2    . DT  B 2 5   ? -20.206 2.171   -0.620  1.00 37.82 ? 11  DT  D O2    1 
ATOM   219  N  N3    . DT  B 2 5   ? -19.152 2.955   1.204   1.00 35.46 ? 11  DT  D N3    1 
ATOM   220  C  C4    . DT  B 2 5   ? -18.605 3.933   2.015   1.00 32.76 ? 11  DT  D C4    1 
ATOM   221  O  O4    . DT  B 2 5   ? -18.084 3.563   3.071   1.00 32.97 ? 11  DT  D O4    1 
ATOM   222  C  C5    . DT  B 2 5   ? -18.706 5.300   1.500   1.00 33.69 ? 11  DT  D C5    1 
ATOM   223  C  C7    . DT  B 2 5   ? -18.153 6.531   2.257   1.00 34.07 ? 11  DT  D C7    1 
ATOM   224  C  C6    . DT  B 2 5   ? -19.299 5.508   0.317   1.00 39.13 ? 11  DT  D C6    1 
ATOM   225  O  "O5'" . DA  C 1 1   ? -21.273 0.949   8.300   1.00 49.80 ? 1   DA  E "O5'" 1 
ATOM   226  C  "C5'" . DA  C 1 1   ? -22.542 0.531   8.909   1.00 41.45 ? 1   DA  E "C5'" 1 
ATOM   227  C  "C4'" . DA  C 1 1   ? -23.346 -0.682  8.263   1.00 38.38 ? 1   DA  E "C4'" 1 
ATOM   228  O  "O4'" . DA  C 1 1   ? -23.876 -0.384  6.951   1.00 33.54 ? 1   DA  E "O4'" 1 
ATOM   229  C  "C3'" . DA  C 1 1   ? -22.392 -1.867  7.983   1.00 34.55 ? 1   DA  E "C3'" 1 
ATOM   230  O  "O3'" . DA  C 1 1   ? -23.196 -3.081  7.902   1.00 30.19 ? 1   DA  E "O3'" 1 
ATOM   231  C  "C2'" . DA  C 1 1   ? -21.825 -1.472  6.617   1.00 28.60 ? 1   DA  E "C2'" 1 
ATOM   232  C  "C1'" . DA  C 1 1   ? -23.133 -1.114  5.967   1.00 29.21 ? 1   DA  E "C1'" 1 
ATOM   233  N  N9    . DA  C 1 1   ? -23.095 -0.187  4.856   1.00 28.40 ? 1   DA  E N9    1 
ATOM   234  C  C8    . DA  C 1 1   ? -23.792 -0.323  3.688   1.00 30.07 ? 1   DA  E C8    1 
ATOM   235  N  N7    . DA  C 1 1   ? -23.620 0.680   2.873   1.00 34.03 ? 1   DA  E N7    1 
ATOM   236  C  C5    . DA  C 1 1   ? -22.746 1.541   3.538   1.00 28.81 ? 1   DA  E C5    1 
ATOM   237  C  C6    . DA  C 1 1   ? -22.177 2.792   3.198   1.00 31.27 ? 1   DA  E C6    1 
ATOM   238  N  N6    . DA  C 1 1   ? -22.416 3.454   2.074   1.00 28.51 ? 1   DA  E N6    1 
ATOM   239  N  N1    . DA  C 1 1   ? -21.356 3.343   4.103   1.00 28.42 ? 1   DA  E N1    1 
ATOM   240  C  C2    . DA  C 1 1   ? -21.116 2.719   5.254   1.00 22.10 ? 1   DA  E C2    1 
ATOM   241  N  N3    . DA  C 1 1   ? -21.581 1.563   5.693   1.00 23.35 ? 1   DA  E N3    1 
ATOM   242  C  C4    . DA  C 1 1   ? -22.411 1.015   4.763   1.00 27.51 ? 1   DA  E C4    1 
ATOM   243  P  P     . DA  C 1 2   ? -22.520 -4.561  7.884   1.00 37.16 ? 2   DA  E P     1 
ATOM   244  O  OP1   . DA  C 1 2   ? -23.565 -5.375  8.523   1.00 34.05 ? 2   DA  E OP1   1 
ATOM   245  O  OP2   . DA  C 1 2   ? -21.118 -4.473  8.385   1.00 34.05 ? 2   DA  E OP2   1 
ATOM   246  O  "O5'" . DA  C 1 2   ? -22.443 -4.944  6.273   1.00 30.92 ? 2   DA  E "O5'" 1 
ATOM   247  C  "C5'" . DA  C 1 2   ? -23.668 -5.027  5.514   1.00 25.91 ? 2   DA  E "C5'" 1 
ATOM   248  C  "C4'" . DA  C 1 2   ? -23.408 -5.056  4.000   1.00 26.74 ? 2   DA  E "C4'" 1 
ATOM   249  O  "O4'" . DA  C 1 2   ? -22.707 -3.897  3.516   1.00 21.15 ? 2   DA  E "O4'" 1 
ATOM   250  C  "C3'" . DA  C 1 2   ? -22.492 -6.238  3.711   1.00 27.29 ? 2   DA  E "C3'" 1 
ATOM   251  O  "O3'" . DA  C 1 2   ? -23.017 -6.843  2.497   1.00 27.59 ? 2   DA  E "O3'" 1 
ATOM   252  C  "C2'" . DA  C 1 2   ? -21.087 -5.646  3.563   1.00 21.07 ? 2   DA  E "C2'" 1 
ATOM   253  C  "C1'" . DA  C 1 2   ? -21.387 -4.249  3.009   1.00 25.39 ? 2   DA  E "C1'" 1 
ATOM   254  N  N9    . DA  C 1 2   ? -20.448 -3.164  3.484   1.00 26.24 ? 2   DA  E N9    1 
ATOM   255  C  C8    . DA  C 1 2   ? -19.607 -3.110  4.597   1.00 28.02 ? 2   DA  E C8    1 
ATOM   256  N  N7    . DA  C 1 2   ? -18.942 -1.990  4.733   1.00 29.57 ? 2   DA  E N7    1 
ATOM   257  C  C5    . DA  C 1 2   ? -19.366 -1.239  3.632   1.00 26.15 ? 2   DA  E C5    1 
ATOM   258  C  C6    . DA  C 1 2   ? -19.036 0.065   3.184   1.00 28.33 ? 2   DA  E C6    1 
ATOM   259  N  N6    . DA  C 1 2   ? -18.181 0.868   3.819   1.00 31.13 ? 2   DA  E N6    1 
ATOM   260  N  N1    . DA  C 1 2   ? -19.637 0.494   2.061   1.00 25.31 ? 2   DA  E N1    1 
ATOM   261  C  C2    . DA  C 1 2   ? -20.504 -0.302  1.421   1.00 23.02 ? 2   DA  E C2    1 
ATOM   262  N  N3    . DA  C 1 2   ? -20.898 -1.531  1.729   1.00 24.03 ? 2   DA  E N3    1 
ATOM   263  C  C4    . DA  C 1 2   ? -20.277 -1.945  2.869   1.00 25.57 ? 2   DA  E C4    1 
ATOM   264  P  P     . DA  C 1 3   ? -22.435 -8.166  1.785   1.00 30.77 ? 3   DA  E P     1 
ATOM   265  O  OP1   . DA  C 1 3   ? -23.649 -8.893  1.307   1.00 29.79 ? 3   DA  E OP1   1 
ATOM   266  O  OP2   . DA  C 1 3   ? -21.488 -8.853  2.697   1.00 25.14 ? 3   DA  E OP2   1 
ATOM   267  O  "O5'" . DA  C 1 3   ? -21.564 -7.652  0.489   1.00 28.68 ? 3   DA  E "O5'" 1 
ATOM   268  C  "C5'" . DA  C 1 3   ? -22.149 -6.856  -0.553  1.00 23.10 ? 3   DA  E "C5'" 1 
ATOM   269  C  "C4'" . DA  C 1 3   ? -21.037 -6.064  -1.184  1.00 21.13 ? 3   DA  E "C4'" 1 
ATOM   270  O  "O4'" . DA  C 1 3   ? -20.431 -5.211  -0.270  1.00 21.02 ? 3   DA  E "O4'" 1 
ATOM   271  C  "C3'" . DA  C 1 3   ? -19.935 -7.011  -1.601  1.00 24.77 ? 3   DA  E "C3'" 1 
ATOM   272  O  "O3'" . DA  C 1 3   ? -20.176 -7.136  -3.007  1.00 31.18 ? 3   DA  E "O3'" 1 
ATOM   273  C  "C2'" . DA  C 1 3   ? -18.600 -6.404  -1.210  1.00 19.71 ? 3   DA  E "C2'" 1 
ATOM   274  C  "C1'" . DA  C 1 3   ? -19.110 -5.070  -0.757  1.00 19.79 ? 3   DA  E "C1'" 1 
ATOM   275  N  N9    . DA  C 1 3   ? -18.298 -4.495  0.335   1.00 21.07 ? 3   DA  E N9    1 
ATOM   276  C  C8    . DA  C 1 3   ? -17.888 -5.081  1.497   1.00 20.89 ? 3   DA  E C8    1 
ATOM   277  N  N7    . DA  C 1 3   ? -17.176 -4.295  2.255   1.00 25.06 ? 3   DA  E N7    1 
ATOM   278  C  C5    . DA  C 1 3   ? -17.100 -3.089  1.552   1.00 25.17 ? 3   DA  E C5    1 
ATOM   279  C  C6    . DA  C 1 3   ? -16.477 -1.858  1.833   1.00 22.07 ? 3   DA  E C6    1 
ATOM   280  N  N6    . DA  C 1 3   ? -15.788 -1.638  2.951   1.00 22.66 ? 3   DA  E N6    1 
ATOM   281  N  N1    . DA  C 1 3   ? -16.608 -0.886  0.905   1.00 24.04 ? 3   DA  E N1    1 
ATOM   282  C  C2    . DA  C 1 3   ? -17.299 -1.104  -0.211  1.00 18.39 ? 3   DA  E C2    1 
ATOM   283  N  N3    . DA  C 1 3   ? -17.923 -2.202  -0.585  1.00 17.04 ? 3   DA  E N3    1 
ATOM   284  C  C4    . DA  C 1 3   ? -17.784 -3.184  0.363   1.00 21.78 ? 3   DA  E C4    1 
ATOM   285  P  P     . DG  C 1 4   ? -19.304 -7.910  -4.119  1.00 24.42 ? 4   DG  E P     1 
ATOM   286  O  OP1   . DG  C 1 4   ? -20.269 -8.171  -5.222  1.00 33.63 ? 4   DG  E OP1   1 
ATOM   287  O  OP2   . DG  C 1 4   ? -18.456 -8.988  -3.534  1.00 23.26 ? 4   DG  E OP2   1 
ATOM   288  O  "O5'" . DG  C 1 4   ? -18.271 -6.742  -4.591  1.00 24.25 ? 4   DG  E "O5'" 1 
ATOM   289  C  "C5'" . DG  C 1 4   ? -18.634 -5.512  -5.263  1.00 20.10 ? 4   DG  E "C5'" 1 
ATOM   290  C  "C4'" . DG  C 1 4   ? -17.437 -4.562  -5.190  1.00 17.31 ? 4   DG  E "C4'" 1 
ATOM   291  O  "O4'" . DG  C 1 4   ? -17.093 -4.345  -3.781  1.00 19.76 ? 4   DG  E "O4'" 1 
ATOM   292  C  "C3'" . DG  C 1 4   ? -16.169 -5.172  -5.822  1.00 15.01 ? 4   DG  E "C3'" 1 
ATOM   293  O  "O3'" . DG  C 1 4   ? -15.566 -4.176  -6.631  1.00 23.24 ? 4   DG  E "O3'" 1 
ATOM   294  C  "C2'" . DG  C 1 4   ? -15.253 -5.459  -4.609  1.00 15.03 ? 4   DG  E "C2'" 1 
ATOM   295  C  "C1'" . DG  C 1 4   ? -15.694 -4.299  -3.758  1.00 17.13 ? 4   DG  E "C1'" 1 
ATOM   296  N  N9    . DG  C 1 4   ? -15.182 -4.422  -2.406  1.00 21.25 ? 4   DG  E N9    1 
ATOM   297  C  C8    . DG  C 1 4   ? -15.088 -5.506  -1.585  1.00 25.45 ? 4   DG  E C8    1 
ATOM   298  N  N7    . DG  C 1 4   ? -14.522 -5.228  -0.440  1.00 19.69 ? 4   DG  E N7    1 
ATOM   299  C  C5    . DG  C 1 4   ? -14.230 -3.853  -0.531  1.00 24.15 ? 4   DG  E C5    1 
ATOM   300  C  C6    . DG  C 1 4   ? -13.605 -2.966  0.401   1.00 18.45 ? 4   DG  E C6    1 
ATOM   301  O  O6    . DG  C 1 4   ? -13.167 -3.238  1.511   1.00 15.80 ? 4   DG  E O6    1 
ATOM   302  N  N1    . DG  C 1 4   ? -13.512 -1.672  -0.102  1.00 16.11 ? 4   DG  E N1    1 
ATOM   303  C  C2    . DG  C 1 4   ? -13.960 -1.257  -1.353  1.00 21.54 ? 4   DG  E C2    1 
ATOM   304  N  N2    . DG  C 1 4   ? -13.801 0.013   -1.716  1.00 15.81 ? 4   DG  E N2    1 
ATOM   305  N  N3    . DG  C 1 4   ? -14.535 -2.081  -2.206  1.00 18.87 ? 4   DG  E N3    1 
ATOM   306  C  C4    . DG  C 1 4   ? -14.638 -3.358  -1.736  1.00 19.66 ? 4   DG  E C4    1 
ATOM   307  P  P     . DA  C 1 5   ? -15.582 -4.132  -8.253  1.00 15.67 ? 5   DA  E P     1 
ATOM   308  O  OP1   . DA  C 1 5   ? -16.931 -3.710  -8.609  1.00 18.63 ? 5   DA  E OP1   1 
ATOM   309  O  OP2   . DA  C 1 5   ? -14.976 -5.418  -8.639  1.00 13.04 ? 5   DA  E OP2   1 
ATOM   310  O  "O5'" . DA  C 1 5   ? -14.544 -2.910  -8.481  1.00 16.72 ? 5   DA  E "O5'" 1 
ATOM   311  C  "C5'" . DA  C 1 5   ? -13.161 -2.968  -8.110  1.00 9.71  ? 5   DA  E "C5'" 1 
ATOM   312  C  "C4'" . DA  C 1 5   ? -12.717 -1.600  -7.588  1.00 13.78 ? 5   DA  E "C4'" 1 
ATOM   313  O  "O4'" . DA  C 1 5   ? -13.222 -1.364  -6.273  1.00 20.48 ? 5   DA  E "O4'" 1 
ATOM   314  C  "C3'" . DA  C 1 5   ? -11.213 -1.520  -7.444  1.00 16.03 ? 5   DA  E "C3'" 1 
ATOM   315  O  "O3'" . DA  C 1 5   ? -10.738 -1.125  -8.726  1.00 16.76 ? 5   DA  E "O3'" 1 
ATOM   316  C  "C2'" . DA  C 1 5   ? -10.982 -0.450  -6.382  1.00 10.66 ? 5   DA  E "C2'" 1 
ATOM   317  C  "C1'" . DA  C 1 5   ? -12.163 -0.787  -5.490  1.00 15.09 ? 5   DA  E "C1'" 1 
ATOM   318  N  N9    . DA  C 1 5   ? -11.828 -1.792  -4.430  1.00 21.09 ? 5   DA  E N9    1 
ATOM   319  C  C8    . DA  C 1 5   ? -12.158 -3.144  -4.353  1.00 16.69 ? 5   DA  E C8    1 
ATOM   320  N  N7    . DA  C 1 5   ? -11.725 -3.726  -3.264  1.00 17.97 ? 5   DA  E N7    1 
ATOM   321  C  C5    . DA  C 1 5   ? -11.069 -2.708  -2.573  1.00 15.58 ? 5   DA  E C5    1 
ATOM   322  C  C6    . DA  C 1 5   ? -10.397 -2.701  -1.339  1.00 15.95 ? 5   DA  E C6    1 
ATOM   323  N  N6    . DA  C 1 5   ? -10.305 -3.791  -0.575  1.00 12.80 ? 5   DA  E N6    1 
ATOM   324  N  N1    . DA  C 1 5   ? -9.859  -1.527  -0.960  1.00 15.81 ? 5   DA  E N1    1 
ATOM   325  C  C2    . DA  C 1 5   ? -9.971  -0.433  -1.730  1.00 15.41 ? 5   DA  E C2    1 
ATOM   326  N  N3    . DA  C 1 5   ? -10.585 -0.312  -2.916  1.00 16.79 ? 5   DA  E N3    1 
ATOM   327  C  C4    . DA  C 1 5   ? -11.120 -1.519  -3.275  1.00 14.62 ? 5   DA  E C4    1 
ATOM   328  P  P     . DT  C 1 6   ? -9.214  -1.383  -9.212  1.00 18.56 ? 6   DT  E P     1 
ATOM   329  O  OP1   . DT  C 1 6   ? -9.110  -0.861  -10.602 1.00 22.85 ? 6   DT  E OP1   1 
ATOM   330  O  OP2   . DT  C 1 6   ? -8.794  -2.789  -8.925  1.00 17.02 ? 6   DT  E OP2   1 
ATOM   331  O  "O5'" . DT  C 1 6   ? -8.298  -0.428  -8.232  1.00 25.33 ? 6   DT  E "O5'" 1 
ATOM   332  C  "C5'" . DT  C 1 6   ? -8.162  1.011   -8.270  1.00 18.31 ? 6   DT  E "C5'" 1 
ATOM   333  C  "C4'" . DT  C 1 6   ? -7.257  1.420   -7.125  1.00 19.62 ? 6   DT  E "C4'" 1 
ATOM   334  O  "O4'" . DT  C 1 6   ? -7.912  1.030   -5.910  1.00 23.99 ? 6   DT  E "O4'" 1 
ATOM   335  C  "C3'" . DT  C 1 6   ? -5.963  0.611   -7.045  1.00 22.31 ? 6   DT  E "C3'" 1 
ATOM   336  O  "O3'" . DT  C 1 6   ? -5.025  1.162   -7.979  1.00 17.92 ? 6   DT  E "O3'" 1 
ATOM   337  C  "C2'" . DT  C 1 6   ? -5.541  0.846   -5.598  1.00 16.30 ? 6   DT  E "C2'" 1 
ATOM   338  C  "C1'" . DT  C 1 6   ? -6.906  0.822   -4.917  1.00 15.48 ? 6   DT  E "C1'" 1 
ATOM   339  N  N1    . DT  C 1 6   ? -7.036  -0.491  -4.257  1.00 20.02 ? 6   DT  E N1    1 
ATOM   340  C  C2    . DT  C 1 6   ? -6.462  -0.568  -2.982  1.00 20.89 ? 6   DT  E C2    1 
ATOM   341  O  O2    . DT  C 1 6   ? -5.906  0.390   -2.425  1.00 22.46 ? 6   DT  E O2    1 
ATOM   342  N  N3    . DT  C 1 6   ? -6.552  -1.817  -2.375  1.00 16.08 ? 6   DT  E N3    1 
ATOM   343  C  C4    . DT  C 1 6   ? -7.147  -2.968  -2.912  1.00 18.38 ? 6   DT  E C4    1 
ATOM   344  O  O4    . DT  C 1 6   ? -7.144  -4.032  -2.295  1.00 18.04 ? 6   DT  E O4    1 
ATOM   345  C  C5    . DT  C 1 6   ? -7.718  -2.798  -4.231  1.00 15.62 ? 6   DT  E C5    1 
ATOM   346  C  C7    . DT  C 1 6   ? -8.365  -4.019  -4.852  1.00 8.82  ? 6   DT  E C7    1 
ATOM   347  C  C6    . DT  C 1 6   ? -7.655  -1.599  -4.857  1.00 15.45 ? 6   DT  E C6    1 
ATOM   348  O  OP3   . DA  D 2 1   ? -3.246  3.008   -7.429  1.00 18.26 ? 7   DA  F OP3   1 
ATOM   349  P  P     . DA  D 2 1   ? -2.381  3.479   -6.173  1.00 19.87 ? 7   DA  F P     1 
ATOM   350  O  OP1   . DA  D 2 1   ? -3.136  4.505   -5.422  1.00 19.49 ? 7   DA  F OP1   1 
ATOM   351  O  OP2   . DA  D 2 1   ? -1.041  3.898   -6.642  1.00 13.64 ? 7   DA  F OP2   1 
ATOM   352  O  "O5'" . DA  D 2 1   ? -2.290  2.120   -5.305  1.00 17.61 ? 7   DA  F "O5'" 1 
ATOM   353  C  "C5'" . DA  D 2 1   ? -1.410  1.051   -5.660  1.00 17.86 ? 7   DA  F "C5'" 1 
ATOM   354  C  "C4'" . DA  D 2 1   ? -0.387  0.803   -4.576  1.00 20.39 ? 7   DA  F "C4'" 1 
ATOM   355  O  "O4'" . DA  D 2 1   ? -1.002  0.700   -3.257  1.00 23.74 ? 7   DA  F "O4'" 1 
ATOM   356  C  "C3'" . DA  D 2 1   ? 0.305   -0.530  -4.880  1.00 22.69 ? 7   DA  F "C3'" 1 
ATOM   357  O  "O3'" . DA  D 2 1   ? 1.431   -0.207  -5.691  1.00 19.91 ? 7   DA  F "O3'" 1 
ATOM   358  C  "C2'" . DA  D 2 1   ? 0.693   -0.966  -3.442  1.00 17.99 ? 7   DA  F "C2'" 1 
ATOM   359  C  "C1'" . DA  D 2 1   ? -0.579  -0.517  -2.650  1.00 21.34 ? 7   DA  F "C1'" 1 
ATOM   360  N  N9    . DA  D 2 1   ? -1.690  -1.530  -2.753  1.00 22.52 ? 7   DA  F N9    1 
ATOM   361  C  C8    . DA  D 2 1   ? -2.909  -1.442  -3.372  1.00 24.68 ? 7   DA  F C8    1 
ATOM   362  N  N7    . DA  D 2 1   ? -3.645  -2.532  -3.266  1.00 24.64 ? 7   DA  F N7    1 
ATOM   363  C  C5    . DA  D 2 1   ? -2.866  -3.421  -2.521  1.00 20.14 ? 7   DA  F C5    1 
ATOM   364  C  C6    . DA  D 2 1   ? -3.065  -4.765  -2.053  1.00 20.84 ? 7   DA  F C6    1 
ATOM   365  N  N6    . DA  D 2 1   ? -4.164  -5.526  -2.251  1.00 15.57 ? 7   DA  F N6    1 
ATOM   366  N  N1    . DA  D 2 1   ? -2.057  -5.307  -1.346  1.00 16.78 ? 7   DA  F N1    1 
ATOM   367  C  C2    . DA  D 2 1   ? -0.951  -4.609  -1.111  1.00 19.62 ? 7   DA  F C2    1 
ATOM   368  N  N3    . DA  D 2 1   ? -0.656  -3.377  -1.486  1.00 22.82 ? 7   DA  F N3    1 
ATOM   369  C  C4    . DA  D 2 1   ? -1.671  -2.818  -2.205  1.00 23.24 ? 7   DA  F C4    1 
ATOM   370  P  P     . DT  D 2 2   ? 2.059   -1.228  -6.752  1.00 19.66 ? 8   DT  F P     1 
ATOM   371  O  OP1   . DT  D 2 2   ? 3.329   -0.663  -7.218  1.00 13.74 ? 8   DT  F OP1   1 
ATOM   372  O  OP2   . DT  D 2 2   ? 0.996   -1.572  -7.730  1.00 22.16 ? 8   DT  F OP2   1 
ATOM   373  O  "O5'" . DT  D 2 2   ? 2.376   -2.461  -5.817  1.00 22.78 ? 8   DT  F "O5'" 1 
ATOM   374  C  "C5'" . DT  D 2 2   ? 3.040   -3.629  -6.234  1.00 21.05 ? 8   DT  F "C5'" 1 
ATOM   375  C  "C4'" . DT  D 2 2   ? 3.034   -4.609  -5.087  1.00 12.61 ? 8   DT  F "C4'" 1 
ATOM   376  O  "O4'" . DT  D 2 2   ? 1.712   -4.875  -4.583  1.00 16.42 ? 8   DT  F "O4'" 1 
ATOM   377  C  "C3'" . DT  D 2 2   ? 3.489   -5.920  -5.638  1.00 17.85 ? 8   DT  F "C3'" 1 
ATOM   378  O  "O3'" . DT  D 2 2   ? 4.749   -6.091  -5.017  1.00 14.75 ? 8   DT  F "O3'" 1 
ATOM   379  C  "C2'" . DT  D 2 2   ? 2.435   -6.956  -5.265  1.00 17.07 ? 8   DT  F "C2'" 1 
ATOM   380  C  "C1'" . DT  D 2 2   ? 1.635   -6.249  -4.182  1.00 14.34 ? 8   DT  F "C1'" 1 
ATOM   381  N  N1    . DT  D 2 2   ? 0.220   -6.706  -4.208  1.00 23.56 ? 8   DT  F N1    1 
ATOM   382  C  C2    . DT  D 2 2   ? -0.193  -7.616  -3.216  1.00 23.33 ? 8   DT  F C2    1 
ATOM   383  O  O2    . DT  D 2 2   ? 0.535   -8.040  -2.322  1.00 26.26 ? 8   DT  F O2    1 
ATOM   384  N  N3    . DT  D 2 2   ? -1.520  -8.035  -3.283  1.00 16.58 ? 8   DT  F N3    1 
ATOM   385  C  C4    . DT  D 2 2   ? -2.466  -7.647  -4.221  1.00 20.55 ? 8   DT  F C4    1 
ATOM   386  O  O4    . DT  D 2 2   ? -3.615  -8.098  -4.160  1.00 18.00 ? 8   DT  F O4    1 
ATOM   387  C  C5    . DT  D 2 2   ? -1.966  -6.701  -5.217  1.00 21.32 ? 8   DT  F C5    1 
ATOM   388  C  C7    . DT  D 2 2   ? -2.930  -6.211  -6.289  1.00 16.28 ? 8   DT  F C7    1 
ATOM   389  C  C6    . DT  D 2 2   ? -0.677  -6.267  -5.187  1.00 20.12 ? 8   DT  F C6    1 
ATOM   390  P  P     . DC  D 2 3   ? 5.715   -7.349  -5.258  1.00 19.39 ? 9   DC  F P     1 
ATOM   391  O  OP1   . DC  D 2 3   ? 7.063   -6.863  -4.983  1.00 16.40 ? 9   DC  F OP1   1 
ATOM   392  O  OP2   . DC  D 2 3   ? 5.407   -7.949  -6.592  1.00 26.74 ? 9   DC  F OP2   1 
ATOM   393  O  "O5'" . DC  D 2 3   ? 5.227   -8.362  -4.139  1.00 23.06 ? 9   DC  F "O5'" 1 
ATOM   394  C  "C5'" . DC  D 2 3   ? 5.368   -8.111  -2.732  1.00 21.45 ? 9   DC  F "C5'" 1 
ATOM   395  C  "C4'" . DC  D 2 3   ? 4.728   -9.234  -1.948  1.00 18.07 ? 9   DC  F "C4'" 1 
ATOM   396  O  "O4'" . DC  D 2 3   ? 3.362   -9.385  -2.345  1.00 24.53 ? 9   DC  F "O4'" 1 
ATOM   397  C  "C3'" . DC  D 2 3   ? 5.427   -10.545 -2.249  1.00 23.26 ? 9   DC  F "C3'" 1 
ATOM   398  O  "O3'" . DC  D 2 3   ? 6.011   -11.023 -1.038  1.00 25.85 ? 9   DC  F "O3'" 1 
ATOM   399  C  "C2'" . DC  D 2 3   ? 4.320   -11.453 -2.727  1.00 21.72 ? 9   DC  F "C2'" 1 
ATOM   400  C  "C1'" . DC  D 2 3   ? 3.049   -10.779 -2.318  1.00 23.84 ? 9   DC  F "C1'" 1 
ATOM   401  N  N1    . DC  D 2 3   ? 1.931   -11.028 -3.273  1.00 22.93 ? 9   DC  F N1    1 
ATOM   402  C  C2    . DC  D 2 3   ? 0.843   -11.778 -2.813  1.00 23.62 ? 9   DC  F C2    1 
ATOM   403  O  O2    . DC  D 2 3   ? 0.819   -12.235 -1.671  1.00 23.75 ? 9   DC  F O2    1 
ATOM   404  N  N3    . DC  D 2 3   ? -0.198  -12.010 -3.670  1.00 18.93 ? 9   DC  F N3    1 
ATOM   405  C  C4    . DC  D 2 3   ? -0.153  -11.514 -4.927  1.00 19.67 ? 9   DC  F C4    1 
ATOM   406  N  N4    . DC  D 2 3   ? -1.172  -11.756 -5.742  1.00 19.63 ? 9   DC  F N4    1 
ATOM   407  C  C5    . DC  D 2 3   ? 0.957   -10.741 -5.413  1.00 16.57 ? 9   DC  F C5    1 
ATOM   408  C  C6    . DC  D 2 3   ? 1.972   -10.527 -4.556  1.00 15.58 ? 9   DC  F C6    1 
ATOM   409  P  P     . DT  D 2 4   ? 7.152   -12.215 -0.934  1.00 30.38 ? 10  DT  F P     1 
ATOM   410  O  OP1   . DT  D 2 4   ? 7.923   -11.865 0.310   1.00 42.03 ? 10  DT  F OP1   1 
ATOM   411  O  OP2   . DT  D 2 4   ? 7.789   -12.383 -2.252  1.00 24.11 ? 10  DT  F OP2   1 
ATOM   412  O  "O5'" . DT  D 2 4   ? 6.284   -13.534 -0.654  1.00 29.39 ? 10  DT  F "O5'" 1 
ATOM   413  C  "C5'" . DT  D 2 4   ? 5.467   -13.603 0.516   1.00 21.38 ? 10  DT  F "C5'" 1 
ATOM   414  C  "C4'" . DT  D 2 4   ? 4.537   -14.795 0.496   1.00 29.17 ? 10  DT  F "C4'" 1 
ATOM   415  O  "O4'" . DT  D 2 4   ? 3.546   -14.692 -0.488  1.00 28.83 ? 10  DT  F "O4'" 1 
ATOM   416  C  "C3'" . DT  D 2 4   ? 5.321   -16.029 0.147   1.00 33.72 ? 10  DT  F "C3'" 1 
ATOM   417  O  "O3'" . DT  D 2 4   ? 5.060   -16.941 1.179   1.00 47.91 ? 10  DT  F "O3'" 1 
ATOM   418  C  "C2'" . DT  D 2 4   ? 4.780   -16.519 -1.166  1.00 31.32 ? 10  DT  F "C2'" 1 
ATOM   419  C  "C1'" . DT  D 2 4   ? 3.373   -15.973 -1.109  1.00 24.97 ? 10  DT  F "C1'" 1 
ATOM   420  N  N1    . DT  D 2 4   ? 2.747   -15.619 -2.398  1.00 27.57 ? 10  DT  F N1    1 
ATOM   421  C  C2    . DT  D 2 4   ? 1.406   -15.964 -2.545  1.00 26.42 ? 10  DT  F C2    1 
ATOM   422  O  O2    . DT  D 2 4   ? 0.763   -16.573 -1.671  1.00 23.94 ? 10  DT  F O2    1 
ATOM   423  N  N3    . DT  D 2 4   ? 0.826   -15.582 -3.773  1.00 23.57 ? 10  DT  F N3    1 
ATOM   424  C  C4    . DT  D 2 4   ? 1.448   -14.913 -4.822  1.00 20.66 ? 10  DT  F C4    1 
ATOM   425  O  O4    . DT  D 2 4   ? 0.774   -14.640 -5.827  1.00 29.39 ? 10  DT  F O4    1 
ATOM   426  C  C5    . DT  D 2 4   ? 2.857   -14.594 -4.583  1.00 25.04 ? 10  DT  F C5    1 
ATOM   427  C  C7    . DT  D 2 4   ? 3.708   -13.841 -5.667  1.00 26.06 ? 10  DT  F C7    1 
ATOM   428  C  C6    . DT  D 2 4   ? 3.453   -14.948 -3.405  1.00 24.61 ? 10  DT  F C6    1 
ATOM   429  P  P     . DT  D 2 5   ? 6.119   -18.091 1.504   1.00 49.75 ? 11  DT  F P     1 
ATOM   430  O  OP1   . DT  D 2 5   ? 6.159   -18.092 2.997   1.00 51.95 ? 11  DT  F OP1   1 
ATOM   431  O  OP2   . DT  D 2 5   ? 7.352   -17.960 0.647   1.00 46.15 ? 11  DT  F OP2   1 
ATOM   432  O  "O5'" . DT  D 2 5   ? 5.297   -19.369 1.041   1.00 51.45 ? 11  DT  F "O5'" 1 
ATOM   433  C  "C5'" . DT  D 2 5   ? 4.168   -19.773 1.842   1.00 52.74 ? 11  DT  F "C5'" 1 
ATOM   434  C  "C4'" . DT  D 2 5   ? 3.251   -20.683 1.022   1.00 60.99 ? 11  DT  F "C4'" 1 
ATOM   435  O  "O4'" . DT  D 2 5   ? 2.672   -19.899 -0.049  1.00 59.21 ? 11  DT  F "O4'" 1 
ATOM   436  C  "C3'" . DT  D 2 5   ? 4.063   -21.890 0.394   1.00 64.80 ? 11  DT  F "C3'" 1 
ATOM   437  O  "O3'" . DT  D 2 5   ? 3.673   -23.185 0.968   1.00 68.26 ? 11  DT  F "O3'" 1 
ATOM   438  C  "C2'" . DT  D 2 5   ? 3.662   -21.882 -1.091  1.00 59.41 ? 11  DT  F "C2'" 1 
ATOM   439  C  "C1'" . DT  D 2 5   ? 2.563   -20.794 -1.175  1.00 57.01 ? 11  DT  F "C1'" 1 
ATOM   440  N  N1    . DT  D 2 5   ? 2.694   -19.980 -2.407  1.00 50.23 ? 11  DT  F N1    1 
ATOM   441  C  C2    . DT  D 2 5   ? 1.515   -19.736 -3.104  1.00 47.02 ? 11  DT  F C2    1 
ATOM   442  O  O2    . DT  D 2 5   ? 0.404   -20.148 -2.748  1.00 53.29 ? 11  DT  F O2    1 
ATOM   443  N  N3    . DT  D 2 5   ? 1.670   -18.980 -4.249  1.00 42.86 ? 11  DT  F N3    1 
ATOM   444  C  C4    . DT  D 2 5   ? 2.873   -18.456 -4.748  1.00 43.18 ? 11  DT  F C4    1 
ATOM   445  O  O4    . DT  D 2 5   ? 2.854   -17.793 -5.799  1.00 47.73 ? 11  DT  F O4    1 
ATOM   446  C  C5    . DT  D 2 5   ? 4.058   -18.770 -3.936  1.00 41.26 ? 11  DT  F C5    1 
ATOM   447  C  C7    . DT  D 2 5   ? 5.474   -18.268 -4.326  1.00 37.62 ? 11  DT  F C7    1 
ATOM   448  C  C6    . DT  D 2 5   ? 3.923   -19.505 -2.821  1.00 41.60 ? 11  DT  F C6    1 
ATOM   449  N  N     . SER E 3 1   ? 7.180   2.507   32.455  1.00 26.87 ? 2   SER A N     1 
ATOM   450  C  CA    . SER E 3 1   ? 7.061   1.219   31.722  1.00 27.64 ? 2   SER A CA    1 
ATOM   451  C  C     . SER E 3 1   ? 7.524   1.446   30.294  1.00 27.29 ? 2   SER A C     1 
ATOM   452  O  O     . SER E 3 1   ? 7.761   2.592   29.890  1.00 26.99 ? 2   SER A O     1 
ATOM   453  C  CB    . SER E 3 1   ? 5.596   0.755   31.703  1.00 29.79 ? 2   SER A CB    1 
ATOM   454  O  OG    . SER E 3 1   ? 4.732   1.739   31.133  1.00 29.86 ? 2   SER A OG    1 
ATOM   455  N  N     . LEU E 3 2   ? 7.655   0.356   29.541  1.00 29.24 ? 3   LEU A N     1 
ATOM   456  C  CA    . LEU E 3 2   ? 8.037   0.416   28.134  1.00 27.59 ? 3   LEU A CA    1 
ATOM   457  C  C     . LEU E 3 2   ? 6.931   1.194   27.412  1.00 25.67 ? 3   LEU A C     1 
ATOM   458  O  O     . LEU E 3 2   ? 7.197   2.084   26.610  1.00 27.56 ? 3   LEU A O     1 
ATOM   459  C  CB    . LEU E 3 2   ? 8.129   -1.000  27.569  1.00 27.76 ? 3   LEU A CB    1 
ATOM   460  C  CG    . LEU E 3 2   ? 8.305   -1.135  26.057  1.00 30.77 ? 3   LEU A CG    1 
ATOM   461  C  CD1   . LEU E 3 2   ? 9.715   -0.733  25.658  1.00 27.71 ? 3   LEU A CD1   1 
ATOM   462  C  CD2   . LEU E 3 2   ? 8.024   -2.567  25.648  1.00 28.87 ? 3   LEU A CD2   1 
ATOM   463  N  N     . ARG E 3 3   ? 5.688   0.849   27.729  1.00 25.12 ? 4   ARG A N     1 
ATOM   464  C  CA    . ARG E 3 3   ? 4.517   1.480   27.143  1.00 25.19 ? 4   ARG A CA    1 
ATOM   465  C  C     . ARG E 3 3   ? 4.414   2.995   27.344  1.00 27.96 ? 4   ARG A C     1 
ATOM   466  O  O     . ARG E 3 3   ? 4.197   3.730   26.377  1.00 28.01 ? 4   ARG A O     1 
ATOM   467  C  CB    . ARG E 3 3   ? 3.259   0.797   27.671  1.00 25.34 ? 4   ARG A CB    1 
ATOM   468  C  CG    . ARG E 3 3   ? 1.977   1.404   27.164  1.00 23.33 ? 4   ARG A CG    1 
ATOM   469  C  CD    . ARG E 3 3   ? 0.805   0.539   27.526  1.00 24.20 ? 4   ARG A CD    1 
ATOM   470  N  NE    . ARG E 3 3   ? -0.436  1.088   27.005  1.00 26.82 ? 4   ARG A NE    1 
ATOM   471  C  CZ    . ARG E 3 3   ? -1.437  0.341   26.559  1.00 27.37 ? 4   ARG A CZ    1 
ATOM   472  N  NH1   . ARG E 3 3   ? -1.334  -0.982  26.572  1.00 31.05 ? 4   ARG A NH1   1 
ATOM   473  N  NH2   . ARG E 3 3   ? -2.537  0.913   26.102  1.00 25.76 ? 4   ARG A NH2   1 
ATOM   474  N  N     . SER E 3 4   ? 4.557   3.468   28.583  1.00 27.13 ? 5   SER A N     1 
ATOM   475  C  CA    . SER E 3 4   ? 4.472   4.908   28.864  1.00 27.96 ? 5   SER A CA    1 
ATOM   476  C  C     . SER E 3 4   ? 5.613   5.682   28.177  1.00 26.10 ? 5   SER A C     1 
ATOM   477  O  O     . SER E 3 4   ? 5.424   6.808   27.704  1.00 25.64 ? 5   SER A O     1 
ATOM   478  C  CB    . SER E 3 4   ? 4.501   5.158   30.383  1.00 28.09 ? 5   SER A CB    1 
ATOM   479  O  OG    . SER E 3 4   ? 5.697   4.647   30.973  1.00 37.44 ? 5   SER A OG    1 
ATOM   480  N  N     . ASP E 3 5   ? 6.794   5.067   28.130  1.00 25.53 ? 6   ASP A N     1 
ATOM   481  C  CA    . ASP E 3 5   ? 7.957   5.677   27.495  1.00 27.31 ? 6   ASP A CA    1 
ATOM   482  C  C     . ASP E 3 5   ? 7.774   5.787   25.988  1.00 26.35 ? 6   ASP A C     1 
ATOM   483  O  O     . ASP E 3 5   ? 8.049   6.837   25.396  1.00 25.50 ? 6   ASP A O     1 
ATOM   484  C  CB    . ASP E 3 5   ? 9.220   4.867   27.791  1.00 32.16 ? 6   ASP A CB    1 
ATOM   485  C  CG    . ASP E 3 5   ? 9.797   5.164   29.159  1.00 36.21 ? 6   ASP A CG    1 
ATOM   486  O  OD1   . ASP E 3 5   ? 9.365   6.146   29.805  1.00 32.58 ? 6   ASP A OD1   1 
ATOM   487  O  OD2   . ASP E 3 5   ? 10.691  4.408   29.580  1.00 32.98 ? 6   ASP A OD2   1 
ATOM   488  N  N     . LEU E 3 6   ? 7.312   4.700   25.380  1.00 25.17 ? 7   LEU A N     1 
ATOM   489  C  CA    . LEU E 3 6   ? 7.077   4.662   23.944  1.00 25.63 ? 7   LEU A CA    1 
ATOM   490  C  C     . LEU E 3 6   ? 6.065   5.745   23.556  1.00 24.46 ? 7   LEU A C     1 
ATOM   491  O  O     . LEU E 3 6   ? 6.294   6.482   22.601  1.00 25.84 ? 7   LEU A O     1 
ATOM   492  C  CB    . LEU E 3 6   ? 6.576   3.276   23.528  1.00 22.97 ? 7   LEU A CB    1 
ATOM   493  C  CG    . LEU E 3 6   ? 6.484   3.017   22.024  1.00 32.38 ? 7   LEU A CG    1 
ATOM   494  C  CD1   . LEU E 3 6   ? 7.838   3.261   21.378  1.00 34.65 ? 7   LEU A CD1   1 
ATOM   495  C  CD2   . LEU E 3 6   ? 6.027   1.596   21.777  1.00 23.23 ? 7   LEU A CD2   1 
ATOM   496  N  N     . ILE E 3 7   ? 4.961   5.847   24.299  1.00 25.68 ? 8   ILE A N     1 
ATOM   497  C  CA    . ILE E 3 7   ? 3.932   6.857   24.025  1.00 26.90 ? 8   ILE A CA    1 
ATOM   498  C  C     . ILE E 3 7   ? 4.518   8.269   24.101  1.00 27.59 ? 8   ILE A C     1 
ATOM   499  O  O     . ILE E 3 7   ? 4.277   9.109   23.220  1.00 27.50 ? 8   ILE A O     1 
ATOM   500  C  CB    . ILE E 3 7   ? 2.757   6.797   25.036  1.00 31.16 ? 8   ILE A CB    1 
ATOM   501  C  CG1   . ILE E 3 7   ? 2.054   5.443   24.973  1.00 41.29 ? 8   ILE A CG1   1 
ATOM   502  C  CG2   . ILE E 3 7   ? 1.748   7.882   24.715  1.00 38.20 ? 8   ILE A CG2   1 
ATOM   503  C  CD1   . ILE E 3 7   ? 0.901   5.305   25.956  1.00 40.71 ? 8   ILE A CD1   1 
ATOM   504  N  N     . ASN E 3 8   ? 5.283   8.529   25.156  1.00 25.37 ? 9   ASN A N     1 
ATOM   505  C  CA    . ASN E 3 8   ? 5.890   9.845   25.339  1.00 23.20 ? 9   ASN A CA    1 
ATOM   506  C  C     . ASN E 3 8   ? 6.845   10.192  24.207  1.00 17.76 ? 9   ASN A C     1 
ATOM   507  O  O     . ASN E 3 8   ? 6.836   11.317  23.716  1.00 17.54 ? 9   ASN A O     1 
ATOM   508  C  CB    . ASN E 3 8   ? 6.631   9.919   26.676  1.00 24.15 ? 9   ASN A CB    1 
ATOM   509  C  CG    . ASN E 3 8   ? 5.713   10.247  27.837  1.00 32.80 ? 9   ASN A CG    1 
ATOM   510  O  OD1   . ASN E 3 8   ? 4.511   9.976   27.802  1.00 29.50 ? 9   ASN A OD1   1 
ATOM   511  N  ND2   . ASN E 3 8   ? 6.278   10.840  28.878  1.00 32.40 ? 9   ASN A ND2   1 
ATOM   512  N  N     . ALA E 3 9   ? 7.661   9.221   23.803  1.00 18.65 ? 10  ALA A N     1 
ATOM   513  C  CA    . ALA E 3 9   ? 8.631   9.415   22.725  1.00 21.47 ? 10  ALA A CA    1 
ATOM   514  C  C     . ALA E 3 9   ? 7.943   9.688   21.391  1.00 23.88 ? 10  ALA A C     1 
ATOM   515  O  O     . ALA E 3 9   ? 8.358   10.584  20.652  1.00 27.93 ? 10  ALA A O     1 
ATOM   516  C  CB    . ALA E 3 9   ? 9.540   8.210   22.605  1.00 13.61 ? 10  ALA A CB    1 
ATOM   517  N  N     . LEU E 3 10  ? 6.895   8.924   21.085  1.00 23.13 ? 11  LEU A N     1 
ATOM   518  C  CA    . LEU E 3 10  ? 6.159   9.106   19.834  1.00 23.79 ? 11  LEU A CA    1 
ATOM   519  C  C     . LEU E 3 10  ? 5.508   10.481  19.810  1.00 24.52 ? 11  LEU A C     1 
ATOM   520  O  O     . LEU E 3 10  ? 5.623   11.218  18.822  1.00 26.67 ? 11  LEU A O     1 
ATOM   521  C  CB    . LEU E 3 10  ? 5.090   8.008   19.659  1.00 20.14 ? 11  LEU A CB    1 
ATOM   522  C  CG    . LEU E 3 10  ? 5.587   6.589   19.310  1.00 25.89 ? 11  LEU A CG    1 
ATOM   523  C  CD1   . LEU E 3 10  ? 4.446   5.609   19.414  1.00 24.25 ? 11  LEU A CD1   1 
ATOM   524  C  CD2   . LEU E 3 10  ? 6.187   6.557   17.913  1.00 22.43 ? 11  LEU A CD2   1 
ATOM   525  N  N     . TYR E 3 11  ? 4.835   10.817  20.909  1.00 23.65 ? 12  TYR A N     1 
ATOM   526  C  CA    . TYR E 3 11  ? 4.142   12.098  21.072  1.00 23.43 ? 12  TYR A CA    1 
ATOM   527  C  C     . TYR E 3 11  ? 5.105   13.269  20.935  1.00 23.01 ? 12  TYR A C     1 
ATOM   528  O  O     . TYR E 3 11  ? 4.778   14.295  20.336  1.00 22.31 ? 12  TYR A O     1 
ATOM   529  C  CB    . TYR E 3 11  ? 3.493   12.161  22.457  1.00 23.82 ? 12  TYR A CB    1 
ATOM   530  C  CG    . TYR E 3 11  ? 2.575   13.344  22.671  1.00 25.68 ? 12  TYR A CG    1 
ATOM   531  C  CD1   . TYR E 3 11  ? 1.275   13.342  22.155  1.00 29.00 ? 12  TYR A CD1   1 
ATOM   532  C  CD2   . TYR E 3 11  ? 2.993   14.459  23.404  1.00 33.96 ? 12  TYR A CD2   1 
ATOM   533  C  CE1   . TYR E 3 11  ? 0.409   14.423  22.364  1.00 33.14 ? 12  TYR A CE1   1 
ATOM   534  C  CE2   . TYR E 3 11  ? 2.134   15.549  23.621  1.00 30.43 ? 12  TYR A CE2   1 
ATOM   535  C  CZ    . TYR E 3 11  ? 0.844   15.521  23.098  1.00 30.85 ? 12  TYR A CZ    1 
ATOM   536  O  OH    . TYR E 3 11  ? -0.019  16.576  23.318  1.00 32.25 ? 12  TYR A OH    1 
ATOM   537  N  N     . ASP E 3 12  ? 6.292   13.104  21.502  1.00 24.62 ? 13  ASP A N     1 
ATOM   538  C  CA    . ASP E 3 12  ? 7.309   14.140  21.470  1.00 27.54 ? 13  ASP A CA    1 
ATOM   539  C  C     . ASP E 3 12  ? 7.897   14.298  20.070  1.00 28.82 ? 13  ASP A C     1 
ATOM   540  O  O     . ASP E 3 12  ? 7.976   15.410  19.541  1.00 29.06 ? 13  ASP A O     1 
ATOM   541  C  CB    . ASP E 3 12  ? 8.418   13.817  22.478  1.00 26.42 ? 13  ASP A CB    1 
ATOM   542  C  CG    . ASP E 3 12  ? 9.454   14.923  22.580  1.00 36.33 ? 13  ASP A CG    1 
ATOM   543  O  OD1   . ASP E 3 12  ? 9.060   16.091  22.805  1.00 41.62 ? 13  ASP A OD1   1 
ATOM   544  O  OD2   . ASP E 3 12  ? 10.661  14.622  22.432  1.00 39.26 ? 13  ASP A OD2   1 
ATOM   545  N  N     . GLU E 3 13  ? 8.304   13.185  19.471  1.00 30.00 ? 14  GLU A N     1 
ATOM   546  C  CA    . GLU E 3 13  ? 8.896   13.215  18.140  1.00 31.91 ? 14  GLU A CA    1 
ATOM   547  C  C     . GLU E 3 13  ? 7.937   13.838  17.135  1.00 32.42 ? 14  GLU A C     1 
ATOM   548  O  O     . GLU E 3 13  ? 8.341   14.641  16.290  1.00 36.15 ? 14  GLU A O     1 
ATOM   549  C  CB    . GLU E 3 13  ? 9.253   11.803  17.688  1.00 29.83 ? 14  GLU A CB    1 
ATOM   550  C  CG    . GLU E 3 13  ? 10.123  11.752  16.439  1.00 35.13 ? 14  GLU A CG    1 
ATOM   551  C  CD    . GLU E 3 13  ? 11.611  11.903  16.732  1.00 41.09 ? 14  GLU A CD    1 
ATOM   552  O  OE1   . GLU E 3 13  ? 11.984  12.136  17.905  1.00 37.18 ? 14  GLU A OE1   1 
ATOM   553  O  OE2   . GLU E 3 13  ? 12.410  11.783  15.776  1.00 37.56 ? 14  GLU A OE2   1 
ATOM   554  N  N     . ASN E 3 14  ? 6.666   13.467  17.243  1.00 32.76 ? 15  ASN A N     1 
ATOM   555  C  CA    . ASN E 3 14  ? 5.626   13.958  16.351  1.00 33.07 ? 15  ASN A CA    1 
ATOM   556  C  C     . ASN E 3 14  ? 5.402   15.477  16.382  1.00 35.58 ? 15  ASN A C     1 
ATOM   557  O  O     . ASN E 3 14  ? 5.037   16.084  15.373  1.00 34.58 ? 15  ASN A O     1 
ATOM   558  C  CB    . ASN E 3 14  ? 4.320   13.236  16.656  1.00 33.70 ? 15  ASN A CB    1 
ATOM   559  C  CG    . ASN E 3 14  ? 3.250   13.549  15.652  1.00 40.79 ? 15  ASN A CG    1 
ATOM   560  O  OD1   . ASN E 3 14  ? 3.361   13.184  14.483  1.00 49.12 ? 15  ASN A OD1   1 
ATOM   561  N  ND2   . ASN E 3 14  ? 2.202   14.229  16.096  1.00 40.47 ? 15  ASN A ND2   1 
ATOM   562  N  N     . GLN E 3 15  ? 5.613   16.097  17.537  1.00 37.32 ? 16  GLN A N     1 
ATOM   563  C  CA    . GLN E 3 15  ? 5.430   17.537  17.650  1.00 39.35 ? 16  GLN A CA    1 
ATOM   564  C  C     . GLN E 3 15  ? 6.643   18.315  17.162  1.00 40.05 ? 16  GLN A C     1 
ATOM   565  O  O     . GLN E 3 15  ? 6.510   19.386  16.578  1.00 41.97 ? 16  GLN A O     1 
ATOM   566  C  CB    . GLN E 3 15  ? 5.143   17.919  19.092  1.00 40.55 ? 16  GLN A CB    1 
ATOM   567  C  CG    . GLN E 3 15  ? 3.834   17.391  19.601  1.00 53.34 ? 16  GLN A CG    1 
ATOM   568  C  CD    . GLN E 3 15  ? 3.458   17.991  20.933  1.00 67.68 ? 16  GLN A CD    1 
ATOM   569  O  OE1   . GLN E 3 15  ? 4.248   18.701  21.557  1.00 73.92 ? 16  GLN A OE1   1 
ATOM   570  N  NE2   . GLN E 3 15  ? 2.246   17.711  21.380  1.00 71.21 ? 16  GLN A NE2   1 
ATOM   571  N  N     . LYS E 3 16  ? 7.827   17.769  17.398  1.00 43.63 ? 17  LYS A N     1 
ATOM   572  C  CA    . LYS E 3 16  ? 9.067   18.432  17.017  1.00 47.41 ? 17  LYS A CA    1 
ATOM   573  C  C     . LYS E 3 16  ? 9.581   18.181  15.598  1.00 48.49 ? 17  LYS A C     1 
ATOM   574  O  O     . LYS E 3 16  ? 10.470  18.900  15.125  1.00 49.46 ? 17  LYS A O     1 
ATOM   575  C  CB    . LYS E 3 16  ? 10.155  18.096  18.048  1.00 52.62 ? 17  LYS A CB    1 
ATOM   576  C  CG    . LYS E 3 16  ? 9.837   18.669  19.422  1.00 62.47 ? 17  LYS A CG    1 
ATOM   577  C  CD    . LYS E 3 16  ? 10.806  18.231  20.501  1.00 73.39 ? 17  LYS A CD    1 
ATOM   578  C  CE    . LYS E 3 16  ? 10.429  18.898  21.824  1.00 77.33 ? 17  LYS A CE    1 
ATOM   579  N  NZ    . LYS E 3 16  ? 11.226  18.394  22.979  1.00 80.71 ? 17  LYS A NZ    1 
ATOM   580  N  N     . TYR E 3 17  ? 9.037   17.179  14.911  1.00 46.42 ? 18  TYR A N     1 
ATOM   581  C  CA    . TYR E 3 17  ? 9.497   16.882  13.556  1.00 44.21 ? 18  TYR A CA    1 
ATOM   582  C  C     . TYR E 3 17  ? 8.387   16.761  12.523  1.00 43.12 ? 18  TYR A C     1 
ATOM   583  O  O     . TYR E 3 17  ? 7.334   16.173  12.783  1.00 44.13 ? 18  TYR A O     1 
ATOM   584  C  CB    . TYR E 3 17  ? 10.376  15.621  13.552  1.00 43.45 ? 18  TYR A CB    1 
ATOM   585  C  CG    . TYR E 3 17  ? 11.684  15.815  14.290  1.00 44.18 ? 18  TYR A CG    1 
ATOM   586  C  CD1   . TYR E 3 17  ? 12.727  16.549  13.719  1.00 41.13 ? 18  TYR A CD1   1 
ATOM   587  C  CD2   . TYR E 3 17  ? 11.872  15.291  15.569  1.00 42.77 ? 18  TYR A CD2   1 
ATOM   588  C  CE1   . TYR E 3 17  ? 13.926  16.761  14.403  1.00 46.61 ? 18  TYR A CE1   1 
ATOM   589  C  CE2   . TYR E 3 17  ? 13.069  15.497  16.264  1.00 47.88 ? 18  TYR A CE2   1 
ATOM   590  C  CZ    . TYR E 3 17  ? 14.090  16.233  15.676  1.00 47.90 ? 18  TYR A CZ    1 
ATOM   591  O  OH    . TYR E 3 17  ? 15.267  16.442  16.362  1.00 51.68 ? 18  TYR A OH    1 
ATOM   592  N  N     . ASP E 3 18  ? 8.640   17.335  11.350  1.00 39.75 ? 19  ASP A N     1 
ATOM   593  C  CA    . ASP E 3 18  ? 7.697   17.314  10.237  1.00 35.75 ? 19  ASP A CA    1 
ATOM   594  C  C     . ASP E 3 18  ? 8.365   16.783  8.972   1.00 32.39 ? 19  ASP A C     1 
ATOM   595  O  O     . ASP E 3 18  ? 9.251   17.439  8.410   1.00 28.94 ? 19  ASP A O     1 
ATOM   596  C  CB    . ASP E 3 18  ? 7.162   18.723  9.967   1.00 38.31 ? 19  ASP A CB    1 
ATOM   597  C  CG    . ASP E 3 18  ? 5.961   19.076  10.833  1.00 49.25 ? 19  ASP A CG    1 
ATOM   598  O  OD1   . ASP E 3 18  ? 5.582   18.280  11.724  1.00 52.85 ? 19  ASP A OD1   1 
ATOM   599  O  OD2   . ASP E 3 18  ? 5.388   20.165  10.614  1.00 57.80 ? 19  ASP A OD2   1 
ATOM   600  N  N     . VAL E 3 19  ? 7.944   15.597  8.537   1.00 26.44 ? 20  VAL A N     1 
ATOM   601  C  CA    . VAL E 3 19  ? 8.490   14.972  7.333   1.00 25.90 ? 20  VAL A CA    1 
ATOM   602  C  C     . VAL E 3 19  ? 7.975   15.736  6.107   1.00 21.99 ? 20  VAL A C     1 
ATOM   603  O  O     . VAL E 3 19  ? 6.786   16.030  6.010   1.00 20.66 ? 20  VAL A O     1 
ATOM   604  C  CB    . VAL E 3 19  ? 8.081   13.480  7.237   1.00 25.66 ? 20  VAL A CB    1 
ATOM   605  C  CG1   . VAL E 3 19  ? 8.626   12.874  5.955   1.00 38.62 ? 20  VAL A CG1   1 
ATOM   606  C  CG2   . VAL E 3 19  ? 8.618   12.711  8.438   1.00 21.62 ? 20  VAL A CG2   1 
ATOM   607  N  N     . CYS E 3 20  ? 8.864   16.059  5.174   1.00 22.20 ? 21  CYS A N     1 
ATOM   608  C  CA    . CYS E 3 20  ? 8.445   16.818  4.003   1.00 24.35 ? 21  CYS A CA    1 
ATOM   609  C  C     . CYS E 3 20  ? 8.865   16.278  2.637   1.00 24.96 ? 21  CYS A C     1 
ATOM   610  O  O     . CYS E 3 20  ? 8.442   16.812  1.614   1.00 24.82 ? 21  CYS A O     1 
ATOM   611  C  CB    . CYS E 3 20  ? 8.893   18.273  4.153   1.00 24.33 ? 21  CYS A CB    1 
ATOM   612  S  SG    . CYS E 3 20  ? 10.644  18.459  4.466   1.00 30.29 ? 21  CYS A SG    1 
ATOM   613  N  N     . GLY E 3 21  ? 9.689   15.233  2.608   1.00 23.32 ? 22  GLY A N     1 
ATOM   614  C  CA    . GLY E 3 21  ? 10.096  14.672  1.331   1.00 21.88 ? 22  GLY A CA    1 
ATOM   615  C  C     . GLY E 3 21  ? 11.044  13.498  1.444   1.00 22.71 ? 22  GLY A C     1 
ATOM   616  O  O     . GLY E 3 21  ? 11.454  13.126  2.546   1.00 21.92 ? 22  GLY A O     1 
ATOM   617  N  N     . ILE E 3 22  ? 11.383  12.900  0.306   1.00 21.03 ? 23  ILE A N     1 
ATOM   618  C  CA    . ILE E 3 22  ? 12.321  11.790  0.278   1.00 19.79 ? 23  ILE A CA    1 
ATOM   619  C  C     . ILE E 3 22  ? 13.608  12.379  -0.283  1.00 21.07 ? 23  ILE A C     1 
ATOM   620  O  O     . ILE E 3 22  ? 13.576  13.179  -1.219  1.00 22.27 ? 23  ILE A O     1 
ATOM   621  C  CB    . ILE E 3 22  ? 11.820  10.613  -0.591  1.00 23.01 ? 23  ILE A CB    1 
ATOM   622  C  CG1   . ILE E 3 22  ? 11.701  11.034  -2.049  1.00 32.48 ? 23  ILE A CG1   1 
ATOM   623  C  CG2   . ILE E 3 22  ? 10.466  10.131  -0.082  1.00 21.20 ? 23  ILE A CG2   1 
ATOM   624  C  CD1   . ILE E 3 22  ? 11.383  9.887   -2.997  1.00 52.05 ? 23  ILE A CD1   1 
ATOM   625  N  N     . ILE E 3 23  ? 14.742  12.004  0.287   1.00 20.01 ? 24  ILE A N     1 
ATOM   626  C  CA    . ILE E 3 23  ? 16.000  12.560  -0.163  1.00 22.48 ? 24  ILE A CA    1 
ATOM   627  C  C     . ILE E 3 23  ? 16.863  11.516  -0.850  1.00 23.02 ? 24  ILE A C     1 
ATOM   628  O  O     . ILE E 3 23  ? 16.875  10.343  -0.452  1.00 22.56 ? 24  ILE A O     1 
ATOM   629  C  CB    . ILE E 3 23  ? 16.770  13.214  1.030   1.00 27.78 ? 24  ILE A CB    1 
ATOM   630  C  CG1   . ILE E 3 23  ? 18.017  13.944  0.526   1.00 19.66 ? 24  ILE A CG1   1 
ATOM   631  C  CG2   . ILE E 3 23  ? 17.157  12.155  2.072   1.00 23.09 ? 24  ILE A CG2   1 
ATOM   632  C  CD1   . ILE E 3 23  ? 18.680  14.786  1.569   1.00 22.35 ? 24  ILE A CD1   1 
ATOM   633  N  N     . SER E 3 24  ? 17.566  11.945  -1.896  1.00 21.46 ? 25  SER A N     1 
ATOM   634  C  CA    . SER E 3 24  ? 18.467  11.073  -2.628  1.00 24.13 ? 25  SER A CA    1 
ATOM   635  C  C     . SER E 3 24  ? 19.885  11.295  -2.068  1.00 27.02 ? 25  SER A C     1 
ATOM   636  O  O     . SER E 3 24  ? 20.168  12.343  -1.467  1.00 24.99 ? 25  SER A O     1 
ATOM   637  C  CB    . SER E 3 24  ? 18.408  11.381  -4.135  1.00 25.32 ? 25  SER A CB    1 
ATOM   638  O  OG    . SER E 3 24  ? 19.113  12.562  -4.480  1.00 26.78 ? 25  SER A OG    1 
ATOM   639  N  N     . ALA E 3 25  ? 20.770  10.318  -2.260  1.00 28.77 ? 26  ALA A N     1 
ATOM   640  C  CA    . ALA E 3 25  ? 22.146  10.404  -1.766  1.00 31.65 ? 26  ALA A CA    1 
ATOM   641  C  C     . ALA E 3 25  ? 22.910  11.612  -2.324  1.00 33.85 ? 26  ALA A C     1 
ATOM   642  O  O     . ALA E 3 25  ? 23.880  12.079  -1.720  1.00 33.35 ? 26  ALA A O     1 
ATOM   643  C  CB    . ALA E 3 25  ? 22.892  9.109   -2.091  1.00 32.30 ? 26  ALA A CB    1 
ATOM   644  N  N     . GLU E 3 26  ? 22.457  12.112  -3.474  1.00 34.43 ? 27  GLU A N     1 
ATOM   645  C  CA    . GLU E 3 26  ? 23.072  13.255  -4.150  1.00 34.57 ? 27  GLU A CA    1 
ATOM   646  C  C     . GLU E 3 26  ? 22.519  14.588  -3.638  1.00 35.49 ? 27  GLU A C     1 
ATOM   647  O  O     . GLU E 3 26  ? 22.928  15.655  -4.102  1.00 37.08 ? 27  GLU A O     1 
ATOM   648  C  CB    . GLU E 3 26  ? 22.853  13.159  -5.664  1.00 34.32 ? 27  GLU A CB    1 
ATOM   649  C  CG    . GLU E 3 26  ? 23.396  11.883  -6.308  1.00 36.62 ? 27  GLU A CG    1 
ATOM   650  C  CD    . GLU E 3 26  ? 22.597  10.627  -5.944  1.00 42.86 ? 27  GLU A CD    1 
ATOM   651  O  OE1   . GLU E 3 26  ? 21.385  10.733  -5.636  1.00 46.81 ? 27  GLU A OE1   1 
ATOM   652  O  OE2   . GLU E 3 26  ? 23.185  9.526   -5.968  1.00 40.73 ? 27  GLU A OE2   1 
ATOM   653  N  N     . GLY E 3 27  ? 21.581  14.521  -2.696  1.00 32.79 ? 28  GLY A N     1 
ATOM   654  C  CA    . GLY E 3 27  ? 21.018  15.728  -2.123  1.00 28.35 ? 28  GLY A CA    1 
ATOM   655  C  C     . GLY E 3 27  ? 19.750  16.269  -2.751  1.00 28.26 ? 28  GLY A C     1 
ATOM   656  O  O     . GLY E 3 27  ? 19.277  17.330  -2.340  1.00 27.00 ? 28  GLY A O     1 
ATOM   657  N  N     . LYS E 3 28  ? 19.183  15.570  -3.729  1.00 26.77 ? 29  LYS A N     1 
ATOM   658  C  CA    . LYS E 3 28  ? 17.957  16.061  -4.355  1.00 27.93 ? 29  LYS A CA    1 
ATOM   659  C  C     . LYS E 3 28  ? 16.748  15.604  -3.529  1.00 25.97 ? 29  LYS A C     1 
ATOM   660  O  O     . LYS E 3 28  ? 16.688  14.454  -3.088  1.00 26.80 ? 29  LYS A O     1 
ATOM   661  C  CB    . LYS E 3 28  ? 17.861  15.562  -5.797  1.00 30.12 ? 29  LYS A CB    1 
ATOM   662  C  CG    . LYS E 3 28  ? 17.021  16.436  -6.715  1.00 38.53 ? 29  LYS A CG    1 
ATOM   663  C  CD    . LYS E 3 28  ? 17.054  15.871  -8.127  1.00 47.80 ? 29  LYS A CD    1 
ATOM   664  C  CE    . LYS E 3 28  ? 16.301  16.742  -9.112  1.00 52.20 ? 29  LYS A CE    1 
ATOM   665  N  NZ    . LYS E 3 28  ? 16.187  16.086  -10.452 1.00 47.53 ? 29  LYS A NZ    1 
ATOM   666  N  N     . ILE E 3 29  ? 15.792  16.500  -3.318  1.00 22.16 ? 30  ILE A N     1 
ATOM   667  C  CA    . ILE E 3 29  ? 14.613  16.184  -2.522  1.00 21.17 ? 30  ILE A CA    1 
ATOM   668  C  C     . ILE E 3 29  ? 13.334  16.150  -3.356  1.00 22.29 ? 30  ILE A C     1 
ATOM   669  O  O     . ILE E 3 29  ? 13.092  17.047  -4.169  1.00 23.16 ? 30  ILE A O     1 
ATOM   670  C  CB    . ILE E 3 29  ? 14.441  17.216  -1.390  1.00 22.73 ? 30  ILE A CB    1 
ATOM   671  C  CG1   . ILE E 3 29  ? 15.749  17.335  -0.600  1.00 23.24 ? 30  ILE A CG1   1 
ATOM   672  C  CG2   . ILE E 3 29  ? 13.285  16.810  -0.469  1.00 22.94 ? 30  ILE A CG2   1 
ATOM   673  C  CD1   . ILE E 3 29  ? 15.774  18.500  0.354   1.00 27.52 ? 30  ILE A CD1   1 
ATOM   674  N  N     . TYR E 3 30  ? 12.525  15.112  -3.154  1.00 18.98 ? 31  TYR A N     1 
ATOM   675  C  CA    . TYR E 3 30  ? 11.260  14.954  -3.867  1.00 18.35 ? 31  TYR A CA    1 
ATOM   676  C  C     . TYR E 3 30  ? 10.142  15.106  -2.840  1.00 18.72 ? 31  TYR A C     1 
ATOM   677  O  O     . TYR E 3 30  ? 10.192  14.492  -1.773  1.00 19.38 ? 31  TYR A O     1 
ATOM   678  C  CB    . TYR E 3 30  ? 11.187  13.571  -4.540  1.00 20.19 ? 31  TYR A CB    1 
ATOM   679  C  CG    . TYR E 3 30  ? 12.353  13.285  -5.464  1.00 22.89 ? 31  TYR A CG    1 
ATOM   680  C  CD1   . TYR E 3 30  ? 13.610  12.964  -4.949  1.00 18.63 ? 31  TYR A CD1   1 
ATOM   681  C  CD2   . TYR E 3 30  ? 12.211  13.376  -6.854  1.00 20.54 ? 31  TYR A CD2   1 
ATOM   682  C  CE1   . TYR E 3 30  ? 14.705  12.747  -5.789  1.00 19.06 ? 31  TYR A CE1   1 
ATOM   683  C  CE2   . TYR E 3 30  ? 13.303  13.160  -7.706  1.00 16.85 ? 31  TYR A CE2   1 
ATOM   684  C  CZ    . TYR E 3 30  ? 14.545  12.849  -7.164  1.00 24.24 ? 31  TYR A CZ    1 
ATOM   685  O  OH    . TYR E 3 30  ? 15.631  12.647  -7.989  1.00 27.85 ? 31  TYR A OH    1 
ATOM   686  N  N     . PRO E 3 31  ? 9.130   15.939  -3.137  1.00 19.71 ? 32  PRO A N     1 
ATOM   687  C  CA    . PRO E 3 31  ? 7.976   16.201  -2.265  1.00 20.66 ? 32  PRO A CA    1 
ATOM   688  C  C     . PRO E 3 31  ? 7.076   14.994  -2.072  1.00 20.62 ? 32  PRO A C     1 
ATOM   689  O  O     . PRO E 3 31  ? 7.111   14.045  -2.853  1.00 16.74 ? 32  PRO A O     1 
ATOM   690  C  CB    . PRO E 3 31  ? 7.232   17.321  -2.994  1.00 20.90 ? 32  PRO A CB    1 
ATOM   691  C  CG    . PRO E 3 31  ? 8.290   17.946  -3.847  1.00 27.94 ? 32  PRO A CG    1 
ATOM   692  C  CD    . PRO E 3 31  ? 9.024   16.745  -4.360  1.00 20.80 ? 32  PRO A CD    1 
ATOM   693  N  N     . LEU E 3 32  ? 6.263   15.046  -1.025  1.00 22.35 ? 33  LEU A N     1 
ATOM   694  C  CA    . LEU E 3 32  ? 5.341   13.964  -0.700  1.00 23.09 ? 33  LEU A CA    1 
ATOM   695  C  C     . LEU E 3 32  ? 3.958   14.212  -1.288  1.00 22.35 ? 33  LEU A C     1 
ATOM   696  O  O     . LEU E 3 32  ? 3.575   15.354  -1.525  1.00 25.15 ? 33  LEU A O     1 
ATOM   697  C  CB    . LEU E 3 32  ? 5.203   13.820  0.826   1.00 22.18 ? 33  LEU A CB    1 
ATOM   698  C  CG    . LEU E 3 32  ? 6.454   13.511  1.646   1.00 24.24 ? 33  LEU A CG    1 
ATOM   699  C  CD1   . LEU E 3 32  ? 6.087   13.458  3.116   1.00 26.20 ? 33  LEU A CD1   1 
ATOM   700  C  CD2   . LEU E 3 32  ? 7.064   12.198  1.190   1.00 20.70 ? 33  LEU A CD2   1 
ATOM   701  N  N     . GLY E 3 33  ? 3.224   13.125  -1.521  1.00 23.54 ? 34  GLY A N     1 
ATOM   702  C  CA    . GLY E 3 33  ? 1.859   13.203  -2.017  1.00 23.95 ? 34  GLY A CA    1 
ATOM   703  C  C     . GLY E 3 33  ? 0.974   13.231  -0.780  1.00 25.87 ? 34  GLY A C     1 
ATOM   704  O  O     . GLY E 3 33  ? 1.451   12.952  0.323   1.00 26.99 ? 34  GLY A O     1 
ATOM   705  N  N     . SER E 3 34  ? -0.308  13.539  -0.935  1.00 28.41 ? 35  SER A N     1 
ATOM   706  C  CA    . SER E 3 34  ? -1.198  13.654  0.223   1.00 30.80 ? 35  SER A CA    1 
ATOM   707  C  C     . SER E 3 34  ? -2.181  12.531  0.576   1.00 29.56 ? 35  SER A C     1 
ATOM   708  O  O     . SER E 3 34  ? -3.081  12.743  1.388   1.00 31.00 ? 35  SER A O     1 
ATOM   709  C  CB    . SER E 3 34  ? -1.971  14.970  0.115   1.00 34.51 ? 35  SER A CB    1 
ATOM   710  O  OG    . SER E 3 34  ? -2.572  15.084  -1.168  1.00 51.16 ? 35  SER A OG    1 
ATOM   711  N  N     . ASP E 3 35  ? -2.038  11.349  -0.012  1.00 27.72 ? 36  ASP A N     1 
ATOM   712  C  CA    . ASP E 3 35  ? -2.962  10.283  0.337   1.00 26.40 ? 36  ASP A CA    1 
ATOM   713  C  C     . ASP E 3 35  ? -2.364  9.255   1.309   1.00 24.27 ? 36  ASP A C     1 
ATOM   714  O  O     . ASP E 3 35  ? -1.141  9.196   1.500   1.00 24.43 ? 36  ASP A O     1 
ATOM   715  C  CB    . ASP E 3 35  ? -3.594  9.643   -0.910  1.00 30.20 ? 36  ASP A CB    1 
ATOM   716  C  CG    . ASP E 3 35  ? -2.598  9.288   -1.982  1.00 39.97 ? 36  ASP A CG    1 
ATOM   717  O  OD1   . ASP E 3 35  ? -1.404  9.060   -1.682  1.00 41.24 ? 36  ASP A OD1   1 
ATOM   718  O  OD2   . ASP E 3 35  ? -3.040  9.235   -3.150  1.00 45.81 ? 36  ASP A OD2   1 
ATOM   719  N  N     . THR E 3 36  ? -3.227  8.454   1.925   1.00 21.36 ? 37  THR A N     1 
ATOM   720  C  CA    . THR E 3 36  ? -2.791  7.487   2.926   1.00 21.15 ? 37  THR A CA    1 
ATOM   721  C  C     . THR E 3 36  ? -1.739  6.521   2.429   1.00 17.92 ? 37  THR A C     1 
ATOM   722  O  O     . THR E 3 36  ? -0.834  6.165   3.178   1.00 16.60 ? 37  THR A O     1 
ATOM   723  C  CB    . THR E 3 36  ? -3.987  6.742   3.522   1.00 19.57 ? 37  THR A CB    1 
ATOM   724  O  OG1   . THR E 3 36  ? -5.057  7.678   3.687   1.00 13.26 ? 37  THR A OG1   1 
ATOM   725  C  CG2   . THR E 3 36  ? -3.631  6.156   4.894   1.00 18.69 ? 37  THR A CG2   1 
ATOM   726  N  N     . LYS E 3 37  ? -1.851  6.110   1.170   1.00 17.36 ? 38  LYS A N     1 
ATOM   727  C  CA    . LYS E 3 37  ? -0.880  5.207   0.555   1.00 17.46 ? 38  LYS A CA    1 
ATOM   728  C  C     . LYS E 3 37  ? 0.543   5.718   0.849   1.00 18.09 ? 38  LYS A C     1 
ATOM   729  O  O     . LYS E 3 37  ? 1.444   4.947   1.184   1.00 21.41 ? 38  LYS A O     1 
ATOM   730  C  CB    . LYS E 3 37  ? -1.144  5.170   -0.957  1.00 24.30 ? 38  LYS A CB    1 
ATOM   731  C  CG    . LYS E 3 37  ? -0.020  4.633   -1.817  1.00 25.42 ? 38  LYS A CG    1 
ATOM   732  C  CD    . LYS E 3 37  ? -0.317  4.889   -3.283  1.00 33.42 ? 38  LYS A CD    1 
ATOM   733  C  CE    . LYS E 3 37  ? -0.565  6.366   -3.540  1.00 25.25 ? 38  LYS A CE    1 
ATOM   734  N  NZ    . LYS E 3 37  ? -0.927  6.638   -4.958  1.00 31.57 ? 38  LYS A NZ    1 
ATOM   735  N  N     . VAL E 3 38  ? 0.727   7.028   0.726   1.00 16.95 ? 39  VAL A N     1 
ATOM   736  C  CA    . VAL E 3 38  ? 2.014   7.659   0.970   1.00 16.20 ? 39  VAL A CA    1 
ATOM   737  C  C     . VAL E 3 38  ? 2.299   7.859   2.451   1.00 17.73 ? 39  VAL A C     1 
ATOM   738  O  O     . VAL E 3 38  ? 3.352   7.455   2.953   1.00 16.03 ? 39  VAL A O     1 
ATOM   739  C  CB    . VAL E 3 38  ? 2.096   9.048   0.286   1.00 19.26 ? 39  VAL A CB    1 
ATOM   740  C  CG1   . VAL E 3 38  ? 3.386   9.780   0.710   1.00 13.38 ? 39  VAL A CG1   1 
ATOM   741  C  CG2   . VAL E 3 38  ? 2.040   8.883   -1.231  1.00 23.82 ? 39  VAL A CG2   1 
ATOM   742  N  N     . LEU E 3 39  ? 1.360   8.487   3.149   1.00 17.80 ? 40  LEU A N     1 
ATOM   743  C  CA    . LEU E 3 39  ? 1.550   8.772   4.565   1.00 19.92 ? 40  LEU A CA    1 
ATOM   744  C  C     . LEU E 3 39  ? 1.685   7.568   5.488   1.00 19.49 ? 40  LEU A C     1 
ATOM   745  O  O     . LEU E 3 39  ? 2.474   7.618   6.432   1.00 21.78 ? 40  LEU A O     1 
ATOM   746  C  CB    . LEU E 3 39  ? 0.495   9.769   5.033   1.00 18.36 ? 40  LEU A CB    1 
ATOM   747  C  CG    . LEU E 3 39  ? 0.833   11.058  4.269   1.00 24.76 ? 40  LEU A CG    1 
ATOM   748  C  CD1   . LEU E 3 39  ? -0.265  12.061  4.353   1.00 20.54 ? 40  LEU A CD1   1 
ATOM   749  C  CD2   . LEU E 3 39  ? 2.136   11.630  4.816   1.00 29.59 ? 40  LEU A CD2   1 
ATOM   750  N  N     . SER E 3 40  ? 0.952   6.486   5.230   1.00 17.05 ? 41  SER A N     1 
ATOM   751  C  CA    . SER E 3 40  ? 1.089   5.288   6.062   1.00 18.82 ? 41  SER A CA    1 
ATOM   752  C  C     . SER E 3 40  ? 2.532   4.764   5.962   1.00 18.97 ? 41  SER A C     1 
ATOM   753  O  O     . SER E 3 40  ? 3.115   4.344   6.957   1.00 21.94 ? 41  SER A O     1 
ATOM   754  C  CB    . SER E 3 40  ? 0.091   4.201   5.634   1.00 22.45 ? 41  SER A CB    1 
ATOM   755  O  OG    . SER E 3 40  ? 0.288   3.794   4.290   1.00 30.09 ? 41  SER A OG    1 
ATOM   756  N  N     . THR E 3 41  ? 3.106   4.797   4.761   1.00 16.82 ? 42  THR A N     1 
ATOM   757  C  CA    . THR E 3 41  ? 4.480   4.351   4.543   1.00 17.01 ? 42  THR A CA    1 
ATOM   758  C  C     . THR E 3 41  ? 5.460   5.244   5.310   1.00 16.07 ? 42  THR A C     1 
ATOM   759  O  O     . THR E 3 41  ? 6.385   4.755   5.957   1.00 16.62 ? 42  THR A O     1 
ATOM   760  C  CB    . THR E 3 41  ? 4.844   4.399   3.035   1.00 19.07 ? 42  THR A CB    1 
ATOM   761  O  OG1   . THR E 3 41  ? 4.023   3.476   2.320   1.00 24.97 ? 42  THR A OG1   1 
ATOM   762  C  CG2   . THR E 3 41  ? 6.300   4.043   2.808   1.00 15.80 ? 42  THR A CG2   1 
ATOM   763  N  N     . ILE E 3 42  ? 5.246   6.554   5.230   1.00 16.91 ? 43  ILE A N     1 
ATOM   764  C  CA    . ILE E 3 42  ? 6.103   7.531   5.901   1.00 19.33 ? 43  ILE A CA    1 
ATOM   765  C  C     . ILE E 3 42  ? 6.034   7.411   7.432   1.00 18.82 ? 43  ILE A C     1 
ATOM   766  O  O     . ILE E 3 42  ? 7.068   7.440   8.100   1.00 17.03 ? 43  ILE A O     1 
ATOM   767  C  CB    . ILE E 3 42  ? 5.773   9.000   5.426   1.00 18.22 ? 43  ILE A CB    1 
ATOM   768  C  CG1   . ILE E 3 42  ? 6.717   9.419   4.292   1.00 25.74 ? 43  ILE A CG1   1 
ATOM   769  C  CG2   . ILE E 3 42  ? 5.971   10.007  6.549   1.00 27.69 ? 43  ILE A CG2   1 
ATOM   770  C  CD1   . ILE E 3 42  ? 6.738   8.480   3.115   1.00 19.42 ? 43  ILE A CD1   1 
ATOM   771  N  N     . PHE E 3 43  ? 4.828   7.266   7.978   1.00 18.74 ? 44  PHE A N     1 
ATOM   772  C  CA    . PHE E 3 43  ? 4.652   7.146   9.424   1.00 18.81 ? 44  PHE A CA    1 
ATOM   773  C  C     . PHE E 3 43  ? 5.309   5.894   9.996   1.00 19.22 ? 44  PHE A C     1 
ATOM   774  O  O     . PHE E 3 43  ? 5.842   5.926   11.104  1.00 22.01 ? 44  PHE A O     1 
ATOM   775  C  CB    . PHE E 3 43  ? 3.170   7.215   9.788   1.00 15.28 ? 44  PHE A CB    1 
ATOM   776  C  CG    . PHE E 3 43  ? 2.554   8.579   9.561   1.00 14.52 ? 44  PHE A CG    1 
ATOM   777  C  CD1   . PHE E 3 43  ? 3.318   9.735   9.696   1.00 11.98 ? 44  PHE A CD1   1 
ATOM   778  C  CD2   . PHE E 3 43  ? 1.214   8.701   9.201   1.00 19.19 ? 44  PHE A CD2   1 
ATOM   779  C  CE1   . PHE E 3 43  ? 2.757   10.988  9.474   1.00 13.97 ? 44  PHE A CE1   1 
ATOM   780  C  CE2   . PHE E 3 43  ? 0.642   9.948   8.978   1.00 21.85 ? 44  PHE A CE2   1 
ATOM   781  C  CZ    . PHE E 3 43  ? 1.415   11.095  9.113   1.00 22.74 ? 44  PHE A CZ    1 
ATOM   782  N  N     . GLU E 3 44  ? 5.283   4.796   9.248   1.00 18.75 ? 45  GLU A N     1 
ATOM   783  C  CA    . GLU E 3 44  ? 5.942   3.571   9.691   1.00 18.69 ? 45  GLU A CA    1 
ATOM   784  C  C     . GLU E 3 44  ? 7.434   3.831   9.791   1.00 18.83 ? 45  GLU A C     1 
ATOM   785  O  O     . GLU E 3 44  ? 8.056   3.545   10.810  1.00 20.05 ? 45  GLU A O     1 
ATOM   786  C  CB    . GLU E 3 44  ? 5.762   2.448   8.686   1.00 25.97 ? 45  GLU A CB    1 
ATOM   787  C  CG    . GLU E 3 44  ? 4.594   1.546   8.919   1.00 35.84 ? 45  GLU A CG    1 
ATOM   788  C  CD    . GLU E 3 44  ? 4.652   0.344   8.009   1.00 39.22 ? 45  GLU A CD    1 
ATOM   789  O  OE1   . GLU E 3 44  ? 4.807   0.535   6.780   1.00 43.33 ? 45  GLU A OE1   1 
ATOM   790  O  OE2   . GLU E 3 44  ? 4.547   -0.787  8.522   1.00 33.48 ? 45  GLU A OE2   1 
ATOM   791  N  N     . LEU E 3 45  ? 8.006   4.369   8.716   1.00 17.50 ? 46  LEU A N     1 
ATOM   792  C  CA    . LEU E 3 45  ? 9.441   4.662   8.669   1.00 19.18 ? 46  LEU A CA    1 
ATOM   793  C  C     . LEU E 3 45  ? 9.843   5.642   9.770   1.00 17.76 ? 46  LEU A C     1 
ATOM   794  O  O     . LEU E 3 45  ? 10.922  5.529   10.355  1.00 18.35 ? 46  LEU A O     1 
ATOM   795  C  CB    . LEU E 3 45  ? 9.836   5.226   7.292   1.00 21.62 ? 46  LEU A CB    1 
ATOM   796  C  CG    . LEU E 3 45  ? 9.628   4.320   6.073   1.00 21.78 ? 46  LEU A CG    1 
ATOM   797  C  CD1   . LEU E 3 45  ? 10.028  5.071   4.822   1.00 22.52 ? 46  LEU A CD1   1 
ATOM   798  C  CD2   . LEU E 3 45  ? 10.440  3.040   6.203   1.00 17.93 ? 46  LEU A CD2   1 
ATOM   799  N  N     . PHE E 3 46  ? 8.959   6.600   10.034  1.00 17.99 ? 47  PHE A N     1 
ATOM   800  C  CA    . PHE E 3 46  ? 9.141   7.623   11.056  1.00 17.52 ? 47  PHE A CA    1 
ATOM   801  C  C     . PHE E 3 46  ? 9.214   6.978   12.457  1.00 17.67 ? 47  PHE A C     1 
ATOM   802  O  O     . PHE E 3 46  ? 10.057  7.334   13.279  1.00 17.29 ? 47  PHE A O     1 
ATOM   803  C  CB    . PHE E 3 46  ? 7.960   8.592   10.975  1.00 17.47 ? 47  PHE A CB    1 
ATOM   804  C  CG    . PHE E 3 46  ? 8.018   9.712   11.959  1.00 24.93 ? 47  PHE A CG    1 
ATOM   805  C  CD1   . PHE E 3 46  ? 8.891   10.778  11.766  1.00 22.28 ? 47  PHE A CD1   1 
ATOM   806  C  CD2   . PHE E 3 46  ? 7.181   9.716   13.072  1.00 24.42 ? 47  PHE A CD2   1 
ATOM   807  C  CE1   . PHE E 3 46  ? 8.926   11.837  12.670  1.00 35.31 ? 47  PHE A CE1   1 
ATOM   808  C  CE2   . PHE E 3 46  ? 7.208   10.769  13.980  1.00 33.54 ? 47  PHE A CE2   1 
ATOM   809  C  CZ    . PHE E 3 46  ? 8.079   11.831  13.780  1.00 33.24 ? 47  PHE A CZ    1 
ATOM   810  N  N     . SER E 3 47  ? 8.328   6.020   12.699  1.00 16.58 ? 48  SER A N     1 
ATOM   811  C  CA    . SER E 3 47  ? 8.249   5.312   13.969  1.00 17.96 ? 48  SER A CA    1 
ATOM   812  C  C     . SER E 3 47  ? 9.389   4.335   14.278  1.00 19.99 ? 48  SER A C     1 
ATOM   813  O  O     . SER E 3 47  ? 9.758   4.185   15.446  1.00 17.25 ? 48  SER A O     1 
ATOM   814  C  CB    . SER E 3 47  ? 6.927   4.547   14.040  1.00 12.26 ? 48  SER A CB    1 
ATOM   815  O  OG    . SER E 3 47  ? 5.829   5.407   13.830  1.00 15.72 ? 48  SER A OG    1 
ATOM   816  N  N     . ARG E 3 48  ? 9.940   3.680   13.253  1.00 18.58 ? 49  ARG A N     1 
ATOM   817  C  CA    . ARG E 3 48  ? 10.999  2.678   13.436  1.00 21.01 ? 49  ARG A CA    1 
ATOM   818  C  C     . ARG E 3 48  ? 12.140  3.029   14.393  1.00 21.51 ? 49  ARG A C     1 
ATOM   819  O  O     . ARG E 3 48  ? 12.375  2.304   15.365  1.00 19.82 ? 49  ARG A O     1 
ATOM   820  C  CB    . ARG E 3 48  ? 11.581  2.225   12.084  1.00 22.62 ? 49  ARG A CB    1 
ATOM   821  C  CG    . ARG E 3 48  ? 10.580  1.541   11.166  1.00 35.84 ? 49  ARG A CG    1 
ATOM   822  C  CD    . ARG E 3 48  ? 11.177  1.202   9.796   1.00 44.64 ? 49  ARG A CD    1 
ATOM   823  N  NE    . ARG E 3 48  ? 12.194  0.150   9.848   1.00 44.27 ? 49  ARG A NE    1 
ATOM   824  C  CZ    . ARG E 3 48  ? 13.503  0.361   9.747   1.00 51.15 ? 49  ARG A CZ    1 
ATOM   825  N  NH1   . ARG E 3 48  ? 13.971  1.591   9.600   1.00 56.07 ? 49  ARG A NH1   1 
ATOM   826  N  NH2   . ARG E 3 48  ? 14.352  -0.656  9.796   1.00 51.80 ? 49  ARG A NH2   1 
ATOM   827  N  N     . PRO E 3 49  ? 12.873  4.130   14.136  1.00 23.24 ? 50  PRO A N     1 
ATOM   828  C  CA    . PRO E 3 49  ? 13.969  4.467   15.056  1.00 22.21 ? 50  PRO A CA    1 
ATOM   829  C  C     . PRO E 3 49  ? 13.540  4.746   16.504  1.00 22.51 ? 50  PRO A C     1 
ATOM   830  O  O     . PRO E 3 49  ? 14.273  4.415   17.430  1.00 23.83 ? 50  PRO A O     1 
ATOM   831  C  CB    . PRO E 3 49  ? 14.624  5.679   14.391  1.00 16.66 ? 50  PRO A CB    1 
ATOM   832  C  CG    . PRO E 3 49  ? 13.499  6.304   13.621  1.00 29.36 ? 50  PRO A CG    1 
ATOM   833  C  CD    . PRO E 3 49  ? 12.793  5.106   13.033  1.00 20.86 ? 50  PRO A CD    1 
ATOM   834  N  N     . ILE E 3 50  ? 12.364  5.342   16.691  1.00 22.44 ? 51  ILE A N     1 
ATOM   835  C  CA    . ILE E 3 50  ? 11.835  5.660   18.022  1.00 24.84 ? 51  ILE A CA    1 
ATOM   836  C  C     . ILE E 3 50  ? 11.547  4.381   18.804  1.00 25.84 ? 51  ILE A C     1 
ATOM   837  O  O     . ILE E 3 50  ? 11.941  4.252   19.965  1.00 26.80 ? 51  ILE A O     1 
ATOM   838  C  CB    . ILE E 3 50  ? 10.524  6.460   17.921  1.00 29.65 ? 51  ILE A CB    1 
ATOM   839  C  CG1   . ILE E 3 50  ? 10.769  7.774   17.194  1.00 33.02 ? 51  ILE A CG1   1 
ATOM   840  C  CG2   . ILE E 3 50  ? 9.941   6.721   19.302  1.00 28.57 ? 51  ILE A CG2   1 
ATOM   841  C  CD1   . ILE E 3 50  ? 9.482   8.445   16.784  1.00 41.47 ? 51  ILE A CD1   1 
ATOM   842  N  N     . ILE E 3 51  ? 10.852  3.448   18.158  1.00 24.37 ? 52  ILE A N     1 
ATOM   843  C  CA    . ILE E 3 51  ? 10.518  2.161   18.756  1.00 24.03 ? 52  ILE A CA    1 
ATOM   844  C  C     . ILE E 3 51  ? 11.805  1.428   19.143  1.00 27.02 ? 52  ILE A C     1 
ATOM   845  O  O     . ILE E 3 51  ? 11.941  0.944   20.267  1.00 27.43 ? 52  ILE A O     1 
ATOM   846  C  CB    . ILE E 3 51  ? 9.684   1.301   17.777  1.00 19.91 ? 52  ILE A CB    1 
ATOM   847  C  CG1   . ILE E 3 51  ? 8.275   1.892   17.663  1.00 25.34 ? 52  ILE A CG1   1 
ATOM   848  C  CG2   . ILE E 3 51  ? 9.651   -0.153  18.217  1.00 15.49 ? 52  ILE A CG2   1 
ATOM   849  C  CD1   . ILE E 3 51  ? 7.401   1.236   16.631  1.00 20.98 ? 52  ILE A CD1   1 
ATOM   850  N  N     . ASN E 3 52  ? 12.755  1.352   18.221  1.00 25.47 ? 53  ASN A N     1 
ATOM   851  C  CA    . ASN E 3 52  ? 14.011  0.677   18.514  1.00 28.23 ? 53  ASN A CA    1 
ATOM   852  C  C     . ASN E 3 52  ? 14.792  1.339   19.657  1.00 28.21 ? 53  ASN A C     1 
ATOM   853  O  O     . ASN E 3 52  ? 15.412  0.656   20.464  1.00 29.75 ? 53  ASN A O     1 
ATOM   854  C  CB    . ASN E 3 52  ? 14.886  0.608   17.270  1.00 34.48 ? 53  ASN A CB    1 
ATOM   855  C  CG    . ASN E 3 52  ? 16.219  -0.035  17.550  1.00 41.65 ? 53  ASN A CG    1 
ATOM   856  O  OD1   . ASN E 3 52  ? 16.305  -1.250  17.708  1.00 48.04 ? 53  ASN A OD1   1 
ATOM   857  N  ND2   . ASN E 3 52  ? 17.271  0.776   17.619  1.00 44.98 ? 53  ASN A ND2   1 
ATOM   858  N  N     . LYS E 3 53  ? 14.762  2.663   19.722  1.00 27.94 ? 54  LYS A N     1 
ATOM   859  C  CA    . LYS E 3 53  ? 15.457  3.394   20.773  1.00 31.32 ? 54  LYS A CA    1 
ATOM   860  C  C     . LYS E 3 53  ? 14.868  3.067   22.158  1.00 32.59 ? 54  LYS A C     1 
ATOM   861  O  O     . LYS E 3 53  ? 15.606  2.731   23.085  1.00 35.75 ? 54  LYS A O     1 
ATOM   862  C  CB    . LYS E 3 53  ? 15.368  4.900   20.506  1.00 32.06 ? 54  LYS A CB    1 
ATOM   863  C  CG    . LYS E 3 53  ? 16.041  5.758   21.550  1.00 40.74 ? 54  LYS A CG    1 
ATOM   864  C  CD    . LYS E 3 53  ? 15.693  7.224   21.360  1.00 53.63 ? 54  LYS A CD    1 
ATOM   865  C  CE    . LYS E 3 53  ? 16.255  8.067   22.498  1.00 60.26 ? 54  LYS A CE    1 
ATOM   866  N  NZ    . LYS E 3 53  ? 15.991  9.525   22.329  1.00 64.80 ? 54  LYS A NZ    1 
ATOM   867  N  N     . ILE E 3 54  ? 13.545  3.160   22.296  1.00 30.69 ? 55  ILE A N     1 
ATOM   868  C  CA    . ILE E 3 54  ? 12.880  2.879   23.573  1.00 29.93 ? 55  ILE A CA    1 
ATOM   869  C  C     . ILE E 3 54  ? 12.971  1.396   23.961  1.00 29.30 ? 55  ILE A C     1 
ATOM   870  O  O     . ILE E 3 54  ? 13.110  1.066   25.141  1.00 31.05 ? 55  ILE A O     1 
ATOM   871  C  CB    . ILE E 3 54  ? 11.382  3.314   23.555  1.00 29.52 ? 55  ILE A CB    1 
ATOM   872  C  CG1   . ILE E 3 54  ? 11.270  4.819   23.316  1.00 28.47 ? 55  ILE A CG1   1 
ATOM   873  C  CG2   . ILE E 3 54  ? 10.694  2.946   24.869  1.00 27.00 ? 55  ILE A CG2   1 
ATOM   874  C  CD1   . ILE E 3 54  ? 12.076  5.659   24.279  1.00 26.91 ? 55  ILE A CD1   1 
ATOM   875  N  N     . ALA E 3 55  ? 12.893  0.508   22.975  1.00 26.70 ? 56  ALA A N     1 
ATOM   876  C  CA    . ALA E 3 55  ? 12.974  -0.925  23.225  1.00 29.03 ? 56  ALA A CA    1 
ATOM   877  C  C     . ALA E 3 55  ? 14.336  -1.285  23.802  1.00 34.44 ? 56  ALA A C     1 
ATOM   878  O  O     . ALA E 3 55  ? 14.426  -2.035  24.776  1.00 38.16 ? 56  ALA A O     1 
ATOM   879  C  CB    . ALA E 3 55  ? 12.738  -1.689  21.951  1.00 24.57 ? 56  ALA A CB    1 
ATOM   880  N  N     . GLU E 3 56  ? 15.391  -0.740  23.201  1.00 37.13 ? 57  GLU A N     1 
ATOM   881  C  CA    . GLU E 3 56  ? 16.766  -0.985  23.641  1.00 38.89 ? 57  GLU A CA    1 
ATOM   882  C  C     . GLU E 3 56  ? 16.974  -0.512  25.086  1.00 38.71 ? 57  GLU A C     1 
ATOM   883  O  O     . GLU E 3 56  ? 17.687  -1.143  25.862  1.00 36.39 ? 57  GLU A O     1 
ATOM   884  C  CB    . GLU E 3 56  ? 17.747  -0.265  22.713  1.00 40.11 ? 57  GLU A CB    1 
ATOM   885  C  CG    . GLU E 3 56  ? 19.189  -0.706  22.863  1.00 60.01 ? 57  GLU A CG    1 
ATOM   886  C  CD    . GLU E 3 56  ? 20.143  0.136   22.036  1.00 74.94 ? 57  GLU A CD    1 
ATOM   887  O  OE1   . GLU E 3 56  ? 19.975  0.197   20.796  1.00 80.04 ? 57  GLU A OE1   1 
ATOM   888  O  OE2   . GLU E 3 56  ? 21.065  0.739   22.630  1.00 80.96 ? 57  GLU A OE2   1 
ATOM   889  N  N     . LYS E 3 57  ? 16.342  0.598   25.441  1.00 36.84 ? 58  LYS A N     1 
ATOM   890  C  CA    . LYS E 3 57  ? 16.448  1.143   26.784  1.00 39.47 ? 58  LYS A CA    1 
ATOM   891  C  C     . LYS E 3 57  ? 15.871  0.170   27.826  1.00 41.28 ? 58  LYS A C     1 
ATOM   892  O  O     . LYS E 3 57  ? 16.299  0.165   28.979  1.00 42.79 ? 58  LYS A O     1 
ATOM   893  C  CB    . LYS E 3 57  ? 15.717  2.489   26.845  1.00 44.85 ? 58  LYS A CB    1 
ATOM   894  C  CG    . LYS E 3 57  ? 15.681  3.146   28.215  1.00 57.73 ? 58  LYS A CG    1 
ATOM   895  C  CD    . LYS E 3 57  ? 14.784  4.369   28.200  1.00 61.51 ? 58  LYS A CD    1 
ATOM   896  C  CE    . LYS E 3 57  ? 14.661  4.989   29.584  1.00 65.15 ? 58  LYS A CE    1 
ATOM   897  N  NZ    . LYS E 3 57  ? 13.766  6.191   29.570  1.00 64.71 ? 58  LYS A NZ    1 
ATOM   898  N  N     . HIS E 3 58  ? 14.907  -0.655  27.425  1.00 39.58 ? 59  HIS A N     1 
ATOM   899  C  CA    . HIS E 3 58  ? 14.288  -1.611  28.344  1.00 37.13 ? 59  HIS A CA    1 
ATOM   900  C  C     . HIS E 3 58  ? 14.766  -3.043  28.157  1.00 36.56 ? 59  HIS A C     1 
ATOM   901  O  O     . HIS E 3 58  ? 14.160  -3.972  28.683  1.00 38.50 ? 59  HIS A O     1 
ATOM   902  C  CB    . HIS E 3 58  ? 12.759  -1.567  28.215  1.00 37.02 ? 59  HIS A CB    1 
ATOM   903  C  CG    . HIS E 3 58  ? 12.155  -0.274  28.661  1.00 37.57 ? 59  HIS A CG    1 
ATOM   904  N  ND1   . HIS E 3 58  ? 11.372  -0.167  29.789  1.00 34.58 ? 59  HIS A ND1   1 
ATOM   905  C  CD2   . HIS E 3 58  ? 12.239  0.975   28.143  1.00 37.34 ? 59  HIS A CD2   1 
ATOM   906  C  CE1   . HIS E 3 58  ? 10.999  1.091   29.948  1.00 31.35 ? 59  HIS A CE1   1 
ATOM   907  N  NE2   . HIS E 3 58  ? 11.512  1.804   28.962  1.00 35.76 ? 59  HIS A NE2   1 
ATOM   908  N  N     . GLY E 3 59  ? 15.845  -3.224  27.406  1.00 35.81 ? 60  GLY A N     1 
ATOM   909  C  CA    . GLY E 3 59  ? 16.374  -4.558  27.181  1.00 34.89 ? 60  GLY A CA    1 
ATOM   910  C  C     . GLY E 3 59  ? 15.581  -5.462  26.250  1.00 35.67 ? 60  GLY A C     1 
ATOM   911  O  O     . GLY E 3 59  ? 15.665  -6.694  26.350  1.00 36.72 ? 60  GLY A O     1 
ATOM   912  N  N     . TYR E 3 60  ? 14.812  -4.866  25.342  1.00 35.92 ? 61  TYR A N     1 
ATOM   913  C  CA    . TYR E 3 60  ? 14.016  -5.641  24.392  1.00 34.83 ? 61  TYR A CA    1 
ATOM   914  C  C     . TYR E 3 60  ? 14.674  -5.726  23.026  1.00 36.19 ? 61  TYR A C     1 
ATOM   915  O  O     . TYR E 3 60  ? 15.322  -4.776  22.582  1.00 38.37 ? 61  TYR A O     1 
ATOM   916  C  CB    . TYR E 3 60  ? 12.635  -5.016  24.209  1.00 29.70 ? 61  TYR A CB    1 
ATOM   917  C  CG    . TYR E 3 60  ? 11.661  -5.295  25.318  1.00 26.51 ? 61  TYR A CG    1 
ATOM   918  C  CD1   . TYR E 3 60  ? 11.563  -4.445  26.417  1.00 25.11 ? 61  TYR A CD1   1 
ATOM   919  C  CD2   . TYR E 3 60  ? 10.811  -6.398  25.256  1.00 29.59 ? 61  TYR A CD2   1 
ATOM   920  C  CE1   . TYR E 3 60  ? 10.637  -4.684  27.431  1.00 32.33 ? 61  TYR A CE1   1 
ATOM   921  C  CE2   . TYR E 3 60  ? 9.880   -6.651  26.262  1.00 32.36 ? 61  TYR A CE2   1 
ATOM   922  C  CZ    . TYR E 3 60  ? 9.795   -5.790  27.346  1.00 37.34 ? 61  TYR A CZ    1 
ATOM   923  O  OH    . TYR E 3 60  ? 8.861   -6.028  28.334  1.00 33.29 ? 61  TYR A OH    1 
ATOM   924  N  N     . ILE E 3 61  ? 14.511  -6.867  22.367  1.00 36.80 ? 62  ILE A N     1 
ATOM   925  C  CA    . ILE E 3 61  ? 15.029  -7.053  21.015  1.00 36.03 ? 62  ILE A CA    1 
ATOM   926  C  C     . ILE E 3 61  ? 13.859  -6.600  20.130  1.00 34.04 ? 62  ILE A C     1 
ATOM   927  O  O     . ILE E 3 61  ? 12.694  -6.810  20.497  1.00 32.21 ? 62  ILE A O     1 
ATOM   928  C  CB    . ILE E 3 61  ? 15.294  -8.551  20.678  1.00 39.50 ? 62  ILE A CB    1 
ATOM   929  C  CG1   . ILE E 3 61  ? 16.232  -9.180  21.699  1.00 43.42 ? 62  ILE A CG1   1 
ATOM   930  C  CG2   . ILE E 3 61  ? 15.898  -8.682  19.281  1.00 37.95 ? 62  ILE A CG2   1 
ATOM   931  C  CD1   . ILE E 3 61  ? 16.479  -10.652 21.432  1.00 47.19 ? 62  ILE A CD1   1 
ATOM   932  N  N     . VAL E 3 62  ? 14.161  -5.986  18.987  1.00 30.99 ? 63  VAL A N     1 
ATOM   933  C  CA    . VAL E 3 62  ? 13.132  -5.546  18.050  1.00 29.23 ? 63  VAL A CA    1 
ATOM   934  C  C     . VAL E 3 62  ? 13.351  -6.299  16.738  1.00 29.42 ? 63  VAL A C     1 
ATOM   935  O  O     . VAL E 3 62  ? 14.434  -6.250  16.159  1.00 31.31 ? 63  VAL A O     1 
ATOM   936  C  CB    . VAL E 3 62  ? 13.199  -4.026  17.778  1.00 27.36 ? 63  VAL A CB    1 
ATOM   937  C  CG1   . VAL E 3 62  ? 12.075  -3.606  16.845  1.00 32.75 ? 63  VAL A CG1   1 
ATOM   938  C  CG2   . VAL E 3 62  ? 13.070  -3.265  19.058  1.00 28.77 ? 63  VAL A CG2   1 
ATOM   939  N  N     . GLU E 3 63  ? 12.326  -7.001  16.274  1.00 28.30 ? 64  GLU A N     1 
ATOM   940  C  CA    . GLU E 3 63  ? 12.419  -7.748  15.036  1.00 24.66 ? 64  GLU A CA    1 
ATOM   941  C  C     . GLU E 3 63  ? 11.295  -7.384  14.088  1.00 25.23 ? 64  GLU A C     1 
ATOM   942  O  O     . GLU E 3 63  ? 10.145  -7.215  14.507  1.00 24.47 ? 64  GLU A O     1 
ATOM   943  C  CB    . GLU E 3 63  ? 12.360  -9.244  15.308  1.00 27.34 ? 64  GLU A CB    1 
ATOM   944  C  CG    . GLU E 3 63  ? 13.565  -9.804  16.019  1.00 38.63 ? 64  GLU A CG    1 
ATOM   945  C  CD    . GLU E 3 63  ? 13.528  -11.318 16.096  1.00 43.77 ? 64  GLU A CD    1 
ATOM   946  O  OE1   . GLU E 3 63  ? 12.802  -11.941 15.286  1.00 38.61 ? 64  GLU A OE1   1 
ATOM   947  O  OE2   . GLU E 3 63  ? 14.226  -11.883 16.964  1.00 44.88 ? 64  GLU A OE2   1 
ATOM   948  N  N     . GLU E 3 64  ? 11.638  -7.274  12.807  1.00 26.20 ? 65  GLU A N     1 
ATOM   949  C  CA    . GLU E 3 64  ? 10.680  -6.951  11.752  1.00 25.26 ? 65  GLU A CA    1 
ATOM   950  C  C     . GLU E 3 64  ? 10.479  -8.207  10.915  1.00 25.26 ? 65  GLU A C     1 
ATOM   951  O  O     . GLU E 3 64  ? 11.352  -9.073  10.889  1.00 24.14 ? 65  GLU A O     1 
ATOM   952  C  CB    . GLU E 3 64  ? 11.227  -5.822  10.888  1.00 26.11 ? 65  GLU A CB    1 
ATOM   953  C  CG    . GLU E 3 64  ? 11.510  -4.561  11.679  1.00 21.26 ? 65  GLU A CG    1 
ATOM   954  C  CD    . GLU E 3 64  ? 12.007  -3.427  10.817  1.00 21.86 ? 65  GLU A CD    1 
ATOM   955  O  OE1   . GLU E 3 64  ? 11.163  -2.726  10.227  1.00 36.81 ? 65  GLU A OE1   1 
ATOM   956  O  OE2   . GLU E 3 64  ? 13.234  -3.235  10.726  1.00 26.12 ? 65  GLU A OE2   1 
ATOM   957  N  N     . PRO E 3 65  ? 9.325   -8.330  10.226  1.00 24.95 ? 66  PRO A N     1 
ATOM   958  C  CA    . PRO E 3 65  ? 9.042   -9.501  9.399   1.00 26.70 ? 66  PRO A CA    1 
ATOM   959  C  C     . PRO E 3 65  ? 10.131  -9.788  8.367   1.00 32.26 ? 66  PRO A C     1 
ATOM   960  O  O     . PRO E 3 65  ? 10.721  -8.862  7.801   1.00 33.21 ? 66  PRO A O     1 
ATOM   961  C  CB    . PRO E 3 65  ? 7.717   -9.128  8.728   1.00 29.62 ? 66  PRO A CB    1 
ATOM   962  C  CG    . PRO E 3 65  ? 7.070   -8.252  9.715   1.00 23.79 ? 66  PRO A CG    1 
ATOM   963  C  CD    . PRO E 3 65  ? 8.202   -7.382  10.175  1.00 24.47 ? 66  PRO A CD    1 
ATOM   964  N  N     . LYS E 3 66  ? 10.394  -11.076 8.135   1.00 35.81 ? 67  LYS A N     1 
ATOM   965  C  CA    . LYS E 3 66  ? 11.386  -11.503 7.150   1.00 40.31 ? 67  LYS A CA    1 
ATOM   966  C  C     . LYS E 3 66  ? 10.668  -11.500 5.806   1.00 41.89 ? 67  LYS A C     1 
ATOM   967  O  O     . LYS E 3 66  ? 11.257  -11.185 4.771   1.00 42.21 ? 67  LYS A O     1 
ATOM   968  C  CB    . LYS E 3 66  ? 11.877  -12.919 7.436   1.00 43.26 ? 67  LYS A CB    1 
ATOM   969  C  CG    . LYS E 3 66  ? 12.703  -13.103 8.706   1.00 55.47 ? 67  LYS A CG    1 
ATOM   970  C  CD    . LYS E 3 66  ? 12.981  -14.598 8.897   1.00 64.88 ? 67  LYS A CD    1 
ATOM   971  C  CE    . LYS E 3 66  ? 13.869  -14.910 10.095  1.00 67.99 ? 67  LYS A CE    1 
ATOM   972  N  NZ    . LYS E 3 66  ? 14.143  -16.383 10.152  1.00 66.42 ? 67  LYS A NZ    1 
ATOM   973  N  N     . GLN E 3 67  ? 9.389   -11.866 5.837   1.00 41.19 ? 68  GLN A N     1 
ATOM   974  C  CA    . GLN E 3 67  ? 8.564   -11.898 4.644   1.00 39.23 ? 68  GLN A CA    1 
ATOM   975  C  C     . GLN E 3 67  ? 7.520   -10.795 4.695   1.00 37.12 ? 68  GLN A C     1 
ATOM   976  O  O     . GLN E 3 67  ? 6.979   -10.489 5.760   1.00 34.08 ? 68  GLN A O     1 
ATOM   977  C  CB    . GLN E 3 67  ? 7.888   -13.244 4.529   1.00 45.96 ? 68  GLN A CB    1 
ATOM   978  C  CG    . GLN E 3 67  ? 8.865   -14.372 4.590   1.00 53.02 ? 68  GLN A CG    1 
ATOM   979  C  CD    . GLN E 3 67  ? 8.157   -15.680 4.544   1.00 61.27 ? 68  GLN A CD    1 
ATOM   980  O  OE1   . GLN E 3 67  ? 8.140   -16.422 5.519   1.00 69.28 ? 68  GLN A OE1   1 
ATOM   981  N  NE2   . GLN E 3 67  ? 7.552   -15.977 3.411   1.00 62.57 ? 68  GLN A NE2   1 
ATOM   982  N  N     . GLN E 3 68  ? 7.229   -10.225 3.529   1.00 34.03 ? 69  GLN A N     1 
ATOM   983  C  CA    . GLN E 3 68  ? 6.296   -9.117  3.390   1.00 31.63 ? 69  GLN A CA    1 
ATOM   984  C  C     . GLN E 3 68  ? 4.853   -9.277  3.824   1.00 31.54 ? 69  GLN A C     1 
ATOM   985  O  O     . GLN E 3 68  ? 4.213   -8.292  4.180   1.00 33.44 ? 69  GLN A O     1 
ATOM   986  C  CB    . GLN E 3 68  ? 6.301   -8.618  1.949   1.00 30.00 ? 69  GLN A CB    1 
ATOM   987  C  CG    . GLN E 3 68  ? 7.630   -8.060  1.495   1.00 39.04 ? 69  GLN A CG    1 
ATOM   988  C  CD    . GLN E 3 68  ? 7.483   -7.108  0.319   1.00 42.01 ? 69  GLN A CD    1 
ATOM   989  O  OE1   . GLN E 3 68  ? 8.319   -7.094  -0.571  1.00 46.01 ? 69  GLN A OE1   1 
ATOM   990  N  NE2   . GLN E 3 68  ? 6.418   -6.302  0.317   1.00 37.98 ? 69  GLN A NE2   1 
ATOM   991  N  N     . ASN E 3 69  ? 4.327   -10.494 3.783   1.00 29.92 ? 70  ASN A N     1 
ATOM   992  C  CA    . ASN E 3 69  ? 2.930   -10.726 4.151   1.00 34.06 ? 70  ASN A CA    1 
ATOM   993  C  C     . ASN E 3 69  ? 2.750   -11.213 5.601   1.00 31.07 ? 70  ASN A C     1 
ATOM   994  O  O     . ASN E 3 69  ? 1.761   -11.881 5.930   1.00 33.89 ? 70  ASN A O     1 
ATOM   995  C  CB    . ASN E 3 69  ? 2.291   -11.722 3.160   1.00 41.52 ? 70  ASN A CB    1 
ATOM   996  C  CG    . ASN E 3 69  ? 2.954   -13.101 3.200   1.00 51.45 ? 70  ASN A CG    1 
ATOM   997  O  OD1   . ASN E 3 69  ? 4.104   -13.251 3.643   1.00 51.74 ? 70  ASN A OD1   1 
ATOM   998  N  ND2   . ASN E 3 69  ? 2.232   -14.113 2.745   1.00 59.50 ? 70  ASN A ND2   1 
ATOM   999  N  N     . HIS E 3 70  ? 3.705   -10.879 6.464   1.00 27.14 ? 71  HIS A N     1 
ATOM   1000 C  CA    . HIS E 3 70  ? 3.656   -11.280 7.868   1.00 26.70 ? 71  HIS A CA    1 
ATOM   1001 C  C     . HIS E 3 70  ? 3.360   -10.131 8.827   1.00 26.14 ? 71  HIS A C     1 
ATOM   1002 O  O     . HIS E 3 70  ? 3.801   -8.998  8.622   1.00 25.42 ? 71  HIS A O     1 
ATOM   1003 C  CB    . HIS E 3 70  ? 4.986   -11.903 8.306   1.00 29.44 ? 71  HIS A CB    1 
ATOM   1004 C  CG    . HIS E 3 70  ? 5.188   -13.316 7.848   1.00 41.41 ? 71  HIS A CG    1 
ATOM   1005 N  ND1   . HIS E 3 70  ? 4.297   -13.980 7.029   1.00 38.59 ? 71  HIS A ND1   1 
ATOM   1006 C  CD2   . HIS E 3 70  ? 6.192   -14.192 8.095   1.00 36.97 ? 71  HIS A CD2   1 
ATOM   1007 C  CE1   . HIS E 3 70  ? 4.742   -15.201 6.791   1.00 34.78 ? 71  HIS A CE1   1 
ATOM   1008 N  NE2   . HIS E 3 70  ? 5.891   -15.353 7.427   1.00 39.93 ? 71  HIS A NE2   1 
ATOM   1009 N  N     . TYR E 3 71  ? 2.615   -10.452 9.878   1.00 22.61 ? 72  TYR A N     1 
ATOM   1010 C  CA    . TYR E 3 71  ? 2.278   -9.519  10.943  1.00 16.68 ? 72  TYR A CA    1 
ATOM   1011 C  C     . TYR E 3 71  ? 3.199   -9.946  12.105  1.00 19.49 ? 72  TYR A C     1 
ATOM   1012 O  O     . TYR E 3 71  ? 3.574   -11.116 12.188  1.00 20.73 ? 72  TYR A O     1 
ATOM   1013 C  CB    . TYR E 3 71  ? 0.802   -9.701  11.302  1.00 17.13 ? 72  TYR A CB    1 
ATOM   1014 C  CG    . TYR E 3 71  ? 0.381   -9.211  12.680  1.00 25.25 ? 72  TYR A CG    1 
ATOM   1015 C  CD1   . TYR E 3 71  ? 0.514   -10.033 13.807  1.00 23.05 ? 72  TYR A CD1   1 
ATOM   1016 C  CD2   . TYR E 3 71  ? -0.178  -7.941  12.854  1.00 19.09 ? 72  TYR A CD2   1 
ATOM   1017 C  CE1   . TYR E 3 71  ? 0.100   -9.604  15.071  1.00 14.70 ? 72  TYR A CE1   1 
ATOM   1018 C  CE2   . TYR E 3 71  ? -0.597  -7.503  14.116  1.00 15.03 ? 72  TYR A CE2   1 
ATOM   1019 C  CZ    . TYR E 3 71  ? -0.453  -8.343  15.215  1.00 17.58 ? 72  TYR A CZ    1 
ATOM   1020 O  OH    . TYR E 3 71  ? -0.857  -7.927  16.458  1.00 15.35 ? 72  TYR A OH    1 
ATOM   1021 N  N     . PRO E 3 72  ? 3.594   -9.018  13.000  1.00 19.79 ? 73  PRO A N     1 
ATOM   1022 C  CA    . PRO E 3 72  ? 3.309   -7.582  13.082  1.00 19.35 ? 73  PRO A CA    1 
ATOM   1023 C  C     . PRO E 3 72  ? 4.488   -6.761  12.543  1.00 16.77 ? 73  PRO A C     1 
ATOM   1024 O  O     . PRO E 3 72  ? 5.545   -7.314  12.229  1.00 14.69 ? 73  PRO A O     1 
ATOM   1025 C  CB    . PRO E 3 72  ? 3.141   -7.379  14.587  1.00 12.52 ? 73  PRO A CB    1 
ATOM   1026 C  CG    . PRO E 3 72  ? 4.262   -8.240  15.132  1.00 15.22 ? 73  PRO A CG    1 
ATOM   1027 C  CD    . PRO E 3 72  ? 4.395   -9.436  14.169  1.00 14.74 ? 73  PRO A CD    1 
ATOM   1028 N  N     . ASP E 3 73  ? 4.304   -5.448  12.450  1.00 14.68 ? 74  ASP A N     1 
ATOM   1029 C  CA    . ASP E 3 73  ? 5.372   -4.564  11.994  1.00 14.99 ? 74  ASP A CA    1 
ATOM   1030 C  C     . ASP E 3 73  ? 6.601   -4.733  12.879  1.00 17.37 ? 74  ASP A C     1 
ATOM   1031 O  O     . ASP E 3 73  ? 7.725   -4.753  12.385  1.00 17.47 ? 74  ASP A O     1 
ATOM   1032 C  CB    . ASP E 3 73  ? 4.931   -3.094  12.040  1.00 11.83 ? 74  ASP A CB    1 
ATOM   1033 C  CG    . ASP E 3 73  ? 3.976   -2.725  10.910  1.00 13.53 ? 74  ASP A CG    1 
ATOM   1034 O  OD1   . ASP E 3 73  ? 4.000   -3.382  9.851   1.00 12.54 ? 74  ASP A OD1   1 
ATOM   1035 O  OD2   . ASP E 3 73  ? 3.193   -1.769  11.076  1.00 13.82 ? 74  ASP A OD2   1 
ATOM   1036 N  N     . PHE E 3 74  ? 6.385   -4.854  14.188  1.00 18.66 ? 75  PHE A N     1 
ATOM   1037 C  CA    . PHE E 3 74  ? 7.491   -5.009  15.130  1.00 20.67 ? 75  PHE A CA    1 
ATOM   1038 C  C     . PHE E 3 74  ? 7.167   -6.013  16.221  1.00 22.47 ? 75  PHE A C     1 
ATOM   1039 O  O     . PHE E 3 74  ? 6.084   -5.977  16.803  1.00 21.20 ? 75  PHE A O     1 
ATOM   1040 C  CB    . PHE E 3 74  ? 7.837   -3.671  15.789  1.00 21.26 ? 75  PHE A CB    1 
ATOM   1041 C  CG    . PHE E 3 74  ? 8.061   -2.552  14.812  1.00 27.04 ? 75  PHE A CG    1 
ATOM   1042 C  CD1   . PHE E 3 74  ? 9.313   -2.357  14.227  1.00 28.74 ? 75  PHE A CD1   1 
ATOM   1043 C  CD2   . PHE E 3 74  ? 7.016   -1.694  14.466  1.00 24.04 ? 75  PHE A CD2   1 
ATOM   1044 C  CE1   . PHE E 3 74  ? 9.517   -1.321  13.312  1.00 17.63 ? 75  PHE A CE1   1 
ATOM   1045 C  CE2   . PHE E 3 74  ? 7.212   -0.655  13.551  1.00 22.50 ? 75  PHE A CE2   1 
ATOM   1046 C  CZ    . PHE E 3 74  ? 8.464   -0.471  12.975  1.00 17.61 ? 75  PHE A CZ    1 
ATOM   1047 N  N     . THR E 3 75  ? 8.118   -6.906  16.477  1.00 24.72 ? 76  THR A N     1 
ATOM   1048 C  CA    . THR E 3 75  ? 8.009   -7.917  17.519  1.00 23.24 ? 76  THR A CA    1 
ATOM   1049 C  C     . THR E 3 75  ? 9.072   -7.544  18.561  1.00 23.55 ? 76  THR A C     1 
ATOM   1050 O  O     . THR E 3 75  ? 10.256  -7.403  18.238  1.00 19.37 ? 76  THR A O     1 
ATOM   1051 C  CB    . THR E 3 75  ? 8.286   -9.338  16.959  1.00 27.46 ? 76  THR A CB    1 
ATOM   1052 O  OG1   . THR E 3 75  ? 7.217   -9.724  16.089  1.00 23.08 ? 76  THR A OG1   1 
ATOM   1053 C  CG2   . THR E 3 75  ? 8.400   -10.366 18.087  1.00 27.94 ? 76  THR A CG2   1 
ATOM   1054 N  N     . LEU E 3 76  ? 8.643   -7.366  19.803  1.00 25.03 ? 77  LEU A N     1 
ATOM   1055 C  CA    . LEU E 3 76  ? 9.554   -7.012  20.891  1.00 29.51 ? 77  LEU A CA    1 
ATOM   1056 C  C     . LEU E 3 76  ? 9.525   -8.104  21.953  1.00 30.49 ? 77  LEU A C     1 
ATOM   1057 O  O     . LEU E 3 76  ? 8.465   -8.660  22.255  1.00 28.51 ? 77  LEU A O     1 
ATOM   1058 C  CB    . LEU E 3 76  ? 9.163   -5.670  21.535  1.00 27.70 ? 77  LEU A CB    1 
ATOM   1059 C  CG    . LEU E 3 76  ? 9.543   -4.349  20.860  1.00 31.27 ? 77  LEU A CG    1 
ATOM   1060 C  CD1   . LEU E 3 76  ? 8.824   -4.181  19.535  1.00 26.62 ? 77  LEU A CD1   1 
ATOM   1061 C  CD2   . LEU E 3 76  ? 9.185   -3.208  21.792  1.00 30.33 ? 77  LEU A CD2   1 
ATOM   1062 N  N     . TYR E 3 77  ? 10.689  -8.413  22.512  1.00 33.38 ? 78  TYR A N     1 
ATOM   1063 C  CA    . TYR E 3 77  ? 10.790  -9.431  23.546  1.00 35.09 ? 78  TYR A CA    1 
ATOM   1064 C  C     . TYR E 3 77  ? 12.190  -9.433  24.128  1.00 36.11 ? 78  TYR A C     1 
ATOM   1065 O  O     . TYR E 3 77  ? 13.154  -9.089  23.439  1.00 33.81 ? 78  TYR A O     1 
ATOM   1066 C  CB    . TYR E 3 77  ? 10.471  -10.818 22.979  1.00 31.80 ? 78  TYR A CB    1 
ATOM   1067 C  CG    . TYR E 3 77  ? 11.543  -11.378 22.076  1.00 40.51 ? 78  TYR A CG    1 
ATOM   1068 C  CD1   . TYR E 3 77  ? 11.592  -11.048 20.723  1.00 39.21 ? 78  TYR A CD1   1 
ATOM   1069 C  CD2   . TYR E 3 77  ? 12.514  -12.239 22.579  1.00 44.00 ? 78  TYR A CD2   1 
ATOM   1070 C  CE1   . TYR E 3 77  ? 12.583  -11.564 19.899  1.00 42.71 ? 78  TYR A CE1   1 
ATOM   1071 C  CE2   . TYR E 3 77  ? 13.505  -12.758 21.766  1.00 38.22 ? 78  TYR A CE2   1 
ATOM   1072 C  CZ    . TYR E 3 77  ? 13.536  -12.420 20.431  1.00 43.09 ? 78  TYR A CZ    1 
ATOM   1073 O  OH    . TYR E 3 77  ? 14.524  -12.945 19.635  1.00 51.54 ? 78  TYR A OH    1 
ATOM   1074 N  N     . LYS E 3 78  ? 12.288  -9.810  25.400  1.00 38.92 ? 79  LYS A N     1 
ATOM   1075 C  CA    . LYS E 3 78  ? 13.563  -9.901  26.099  1.00 38.41 ? 79  LYS A CA    1 
ATOM   1076 C  C     . LYS E 3 78  ? 14.097  -11.304 25.847  1.00 40.36 ? 79  LYS A C     1 
ATOM   1077 O  O     . LYS E 3 78  ? 13.326  -12.272 25.822  1.00 40.55 ? 79  LYS A O     1 
ATOM   1078 C  CB    . LYS E 3 78  ? 13.358  -9.695  27.592  1.00 38.87 ? 79  LYS A CB    1 
ATOM   1079 C  CG    . LYS E 3 78  ? 12.878  -8.314  27.957  1.00 45.33 ? 79  LYS A CG    1 
ATOM   1080 C  CD    . LYS E 3 78  ? 12.664  -8.223  29.445  1.00 56.87 ? 79  LYS A CD    1 
ATOM   1081 C  CE    . LYS E 3 78  ? 12.436  -6.802  29.879  1.00 58.11 ? 79  LYS A CE    1 
ATOM   1082 N  NZ    . LYS E 3 78  ? 12.106  -6.748  31.324  1.00 66.59 ? 79  LYS A NZ    1 
ATOM   1083 N  N     . PRO E 3 79  ? 15.422  -11.443 25.655  1.00 41.73 ? 80  PRO A N     1 
ATOM   1084 C  CA    . PRO E 3 79  ? 16.035  -12.758 25.403  1.00 41.05 ? 80  PRO A CA    1 
ATOM   1085 C  C     . PRO E 3 79  ? 15.717  -13.782 26.501  1.00 41.37 ? 80  PRO A C     1 
ATOM   1086 O  O     . PRO E 3 79  ? 15.666  -14.984 26.243  1.00 41.88 ? 80  PRO A O     1 
ATOM   1087 C  CB    . PRO E 3 79  ? 17.528  -12.436 25.350  1.00 41.67 ? 80  PRO A CB    1 
ATOM   1088 C  CG    . PRO E 3 79  ? 17.559  -11.010 24.884  1.00 43.79 ? 80  PRO A CG    1 
ATOM   1089 C  CD    . PRO E 3 79  ? 16.441  -10.377 25.665  1.00 42.92 ? 80  PRO A CD    1 
ATOM   1090 N  N     . SER E 3 80  ? 15.501  -13.285 27.717  1.00 40.81 ? 81  SER A N     1 
ATOM   1091 C  CA    . SER E 3 80  ? 15.194  -14.108 28.883  1.00 41.84 ? 81  SER A CA    1 
ATOM   1092 C  C     . SER E 3 80  ? 13.730  -14.562 29.003  1.00 44.14 ? 81  SER A C     1 
ATOM   1093 O  O     . SER E 3 80  ? 13.412  -15.427 29.825  1.00 46.12 ? 81  SER A O     1 
ATOM   1094 C  CB    . SER E 3 80  ? 15.594  -13.342 30.146  1.00 41.20 ? 81  SER A CB    1 
ATOM   1095 O  OG    . SER E 3 80  ? 14.953  -12.075 30.198  1.00 44.90 ? 81  SER A OG    1 
ATOM   1096 N  N     . GLU E 3 81  ? 12.842  -13.980 28.202  1.00 43.51 ? 82  GLU A N     1 
ATOM   1097 C  CA    . GLU E 3 81  ? 11.426  -14.338 28.233  1.00 43.51 ? 82  GLU A CA    1 
ATOM   1098 C  C     . GLU E 3 81  ? 10.840  -14.348 26.822  1.00 43.49 ? 82  GLU A C     1 
ATOM   1099 O  O     . GLU E 3 81  ? 10.018  -13.497 26.478  1.00 42.15 ? 82  GLU A O     1 
ATOM   1100 C  CB    . GLU E 3 81  ? 10.646  -13.346 29.098  1.00 46.88 ? 82  GLU A CB    1 
ATOM   1101 C  CG    . GLU E 3 81  ? 10.942  -13.419 30.580  1.00 54.99 ? 82  GLU A CG    1 
ATOM   1102 C  CD    . GLU E 3 81  ? 10.056  -12.488 31.386  1.00 66.02 ? 82  GLU A CD    1 
ATOM   1103 O  OE1   . GLU E 3 81  ? 10.345  -11.269 31.420  1.00 70.61 ? 82  GLU A OE1   1 
ATOM   1104 O  OE2   . GLU E 3 81  ? 9.068   -12.975 31.984  1.00 66.17 ? 82  GLU A OE2   1 
ATOM   1105 N  N     . PRO E 3 82  ? 11.252  -15.321 25.990  1.00 43.56 ? 83  PRO A N     1 
ATOM   1106 C  CA    . PRO E 3 82  ? 10.784  -15.455 24.608  1.00 41.66 ? 83  PRO A CA    1 
ATOM   1107 C  C     . PRO E 3 82  ? 9.290   -15.694 24.432  1.00 38.29 ? 83  PRO A C     1 
ATOM   1108 O  O     . PRO E 3 82  ? 8.751   -15.409 23.374  1.00 38.58 ? 83  PRO A O     1 
ATOM   1109 C  CB    . PRO E 3 82  ? 11.618  -16.624 24.068  1.00 46.82 ? 83  PRO A CB    1 
ATOM   1110 C  CG    . PRO E 3 82  ? 11.873  -17.447 25.280  1.00 46.54 ? 83  PRO A CG    1 
ATOM   1111 C  CD    . PRO E 3 82  ? 12.210  -16.394 26.313  1.00 47.16 ? 83  PRO A CD    1 
ATOM   1112 N  N     . ASN E 3 83  ? 8.612   -16.213 25.454  1.00 37.49 ? 84  ASN A N     1 
ATOM   1113 C  CA    . ASN E 3 83  ? 7.180   -16.476 25.350  1.00 38.04 ? 84  ASN A CA    1 
ATOM   1114 C  C     . ASN E 3 83  ? 6.289   -15.350 25.878  1.00 36.12 ? 84  ASN A C     1 
ATOM   1115 O  O     . ASN E 3 83  ? 5.108   -15.543 26.157  1.00 38.26 ? 84  ASN A O     1 
ATOM   1116 C  CB    . ASN E 3 83  ? 6.829   -17.817 25.998  1.00 45.63 ? 84  ASN A CB    1 
ATOM   1117 C  CG    . ASN E 3 83  ? 7.260   -18.995 25.141  1.00 56.01 ? 84  ASN A CG    1 
ATOM   1118 O  OD1   . ASN E 3 83  ? 8.357   -19.516 25.300  1.00 60.12 ? 84  ASN A OD1   1 
ATOM   1119 N  ND2   . ASN E 3 83  ? 6.400   -19.413 24.222  1.00 63.84 ? 84  ASN A ND2   1 
ATOM   1120 N  N     . LYS E 3 84  ? 6.869   -14.165 26.006  1.00 32.08 ? 85  LYS A N     1 
ATOM   1121 C  CA    . LYS E 3 84  ? 6.132   -12.980 26.402  1.00 32.20 ? 85  LYS A CA    1 
ATOM   1122 C  C     . LYS E 3 84  ? 6.509   -11.884 25.403  1.00 30.03 ? 85  LYS A C     1 
ATOM   1123 O  O     . LYS E 3 84  ? 7.156   -10.900 25.748  1.00 32.00 ? 85  LYS A O     1 
ATOM   1124 C  CB    . LYS E 3 84  ? 6.483   -12.583 27.839  1.00 32.52 ? 85  LYS A CB    1 
ATOM   1125 C  CG    . LYS E 3 84  ? 6.043   -13.665 28.805  1.00 42.97 ? 85  LYS A CG    1 
ATOM   1126 C  CD    . LYS E 3 84  ? 6.334   -13.355 30.249  1.00 61.91 ? 85  LYS A CD    1 
ATOM   1127 C  CE    . LYS E 3 84  ? 5.937   -14.560 31.112  1.00 70.94 ? 85  LYS A CE    1 
ATOM   1128 N  NZ    . LYS E 3 84  ? 6.158   -14.318 32.567  1.00 79.02 ? 85  LYS A NZ    1 
ATOM   1129 N  N     . LYS E 3 85  ? 6.109   -12.083 24.147  1.00 28.06 ? 86  LYS A N     1 
ATOM   1130 C  CA    . LYS E 3 85  ? 6.391   -11.147 23.066  1.00 24.83 ? 86  LYS A CA    1 
ATOM   1131 C  C     . LYS E 3 85  ? 5.310   -10.083 22.938  1.00 23.27 ? 86  LYS A C     1 
ATOM   1132 O  O     . LYS E 3 85  ? 4.141   -10.315 23.267  1.00 23.46 ? 86  LYS A O     1 
ATOM   1133 C  CB    . LYS E 3 85  ? 6.510   -11.898 21.737  1.00 23.76 ? 86  LYS A CB    1 
ATOM   1134 C  CG    . LYS E 3 85  ? 7.641   -12.886 21.664  1.00 23.45 ? 86  LYS A CG    1 
ATOM   1135 C  CD    . LYS E 3 85  ? 7.797   -13.411 20.249  1.00 18.51 ? 86  LYS A CD    1 
ATOM   1136 C  CE    . LYS E 3 85  ? 9.142   -14.106 20.078  1.00 22.02 ? 86  LYS A CE    1 
ATOM   1137 N  NZ    . LYS E 3 85  ? 9.130   -15.498 20.592  1.00 24.74 ? 86  LYS A NZ    1 
ATOM   1138 N  N     . ILE E 3 86  ? 5.721   -8.915  22.456  1.00 23.03 ? 87  ILE A N     1 
ATOM   1139 C  CA    . ILE E 3 86  ? 4.819   -7.787  22.250  1.00 22.99 ? 87  ILE A CA    1 
ATOM   1140 C  C     . ILE E 3 86  ? 4.767   -7.490  20.750  1.00 19.57 ? 87  ILE A C     1 
ATOM   1141 O  O     . ILE E 3 86  ? 5.808   -7.390  20.110  1.00 17.13 ? 87  ILE A O     1 
ATOM   1142 C  CB    . ILE E 3 86  ? 5.308   -6.527  23.013  1.00 21.98 ? 87  ILE A CB    1 
ATOM   1143 C  CG1   . ILE E 3 86  ? 5.341   -6.819  24.517  1.00 20.33 ? 87  ILE A CG1   1 
ATOM   1144 C  CG2   . ILE E 3 86  ? 4.391   -5.325  22.724  1.00 16.59 ? 87  ILE A CG2   1 
ATOM   1145 C  CD1   . ILE E 3 86  ? 5.855   -5.684  25.346  1.00 26.06 ? 87  ILE A CD1   1 
ATOM   1146 N  N     . ALA E 3 87  ? 3.560   -7.359  20.203  1.00 18.70 ? 88  ALA A N     1 
ATOM   1147 C  CA    . ALA E 3 87  ? 3.380   -7.064  18.780  1.00 19.33 ? 88  ALA A CA    1 
ATOM   1148 C  C     . ALA E 3 87  ? 2.971   -5.605  18.632  1.00 20.14 ? 88  ALA A C     1 
ATOM   1149 O  O     . ALA E 3 87  ? 2.078   -5.135  19.339  1.00 22.11 ? 88  ALA A O     1 
ATOM   1150 C  CB    . ALA E 3 87  ? 2.299   -7.961  18.189  1.00 14.89 ? 88  ALA A CB    1 
ATOM   1151 N  N     . ILE E 3 88  ? 3.623   -4.881  17.731  1.00 18.08 ? 89  ILE A N     1 
ATOM   1152 C  CA    . ILE E 3 88  ? 3.269   -3.488  17.497  1.00 17.16 ? 89  ILE A CA    1 
ATOM   1153 C  C     . ILE E 3 88  ? 2.983   -3.333  16.006  1.00 16.58 ? 89  ILE A C     1 
ATOM   1154 O  O     . ILE E 3 88  ? 3.812   -3.676  15.159  1.00 16.27 ? 89  ILE A O     1 
ATOM   1155 C  CB    . ILE E 3 88  ? 4.402   -2.507  17.905  1.00 18.23 ? 89  ILE A CB    1 
ATOM   1156 C  CG1   . ILE E 3 88  ? 4.740   -2.669  19.388  1.00 21.21 ? 89  ILE A CG1   1 
ATOM   1157 C  CG2   . ILE E 3 88  ? 3.960   -1.062  17.670  1.00 14.03 ? 89  ILE A CG2   1 
ATOM   1158 C  CD1   . ILE E 3 88  ? 5.783   -1.690  19.870  1.00 14.73 ? 89  ILE A CD1   1 
ATOM   1159 N  N     . ASP E 3 89  ? 1.803   -2.826  15.690  1.00 14.64 ? 90  ASP A N     1 
ATOM   1160 C  CA    . ASP E 3 89  ? 1.414   -2.620  14.309  1.00 15.84 ? 90  ASP A CA    1 
ATOM   1161 C  C     . ASP E 3 89  ? 1.049   -1.148  14.170  1.00 16.67 ? 90  ASP A C     1 
ATOM   1162 O  O     . ASP E 3 89  ? 0.393   -0.573  15.044  1.00 15.66 ? 90  ASP A O     1 
ATOM   1163 C  CB    . ASP E 3 89  ? 0.213   -3.502  13.964  1.00 18.66 ? 90  ASP A CB    1 
ATOM   1164 C  CG    . ASP E 3 89  ? 0.338   -4.174  12.601  1.00 18.85 ? 90  ASP A CG    1 
ATOM   1165 O  OD1   . ASP E 3 89  ? 1.472   -4.451  12.154  1.00 18.52 ? 90  ASP A OD1   1 
ATOM   1166 O  OD2   . ASP E 3 89  ? -0.715  -4.432  11.979  1.00 18.88 ? 90  ASP A OD2   1 
ATOM   1167 N  N     . ILE E 3 90  ? 1.488   -0.548  13.073  1.00 15.44 ? 91  ILE A N     1 
ATOM   1168 C  CA    . ILE E 3 90  ? 1.232   0.855   12.783  1.00 15.30 ? 91  ILE A CA    1 
ATOM   1169 C  C     . ILE E 3 90  ? 0.062   0.982   11.801  1.00 17.11 ? 91  ILE A C     1 
ATOM   1170 O  O     . ILE E 3 90  ? 0.056   0.340   10.745  1.00 18.47 ? 91  ILE A O     1 
ATOM   1171 C  CB    . ILE E 3 90  ? 2.516   1.508   12.221  1.00 19.81 ? 91  ILE A CB    1 
ATOM   1172 C  CG1   . ILE E 3 90  ? 3.626   1.388   13.274  1.00 18.04 ? 91  ILE A CG1   1 
ATOM   1173 C  CG2   . ILE E 3 90  ? 2.260   2.970   11.818  1.00 16.54 ? 91  ILE A CG2   1 
ATOM   1174 C  CD1   . ILE E 3 90  ? 4.943   1.906   12.839  1.00 37.62 ? 91  ILE A CD1   1 
ATOM   1175 N  N     . LYS E 3 91  ? -0.922  1.803   12.152  1.00 13.44 ? 92  LYS A N     1 
ATOM   1176 C  CA    . LYS E 3 91  ? -2.096  2.007   11.311  1.00 16.14 ? 92  LYS A CA    1 
ATOM   1177 C  C     . LYS E 3 91  ? -2.309  3.498   11.049  1.00 17.84 ? 92  LYS A C     1 
ATOM   1178 O  O     . LYS E 3 91  ? -2.088  4.317   11.939  1.00 17.51 ? 92  LYS A O     1 
ATOM   1179 C  CB    . LYS E 3 91  ? -3.342  1.399   11.968  1.00 17.76 ? 92  LYS A CB    1 
ATOM   1180 C  CG    . LYS E 3 91  ? -3.326  -0.137  12.068  1.00 23.33 ? 92  LYS A CG    1 
ATOM   1181 C  CD    . LYS E 3 91  ? -3.233  -0.782  10.690  1.00 31.30 ? 92  LYS A CD    1 
ATOM   1182 C  CE    . LYS E 3 91  ? -3.029  -2.287  10.768  1.00 28.09 ? 92  LYS A CE    1 
ATOM   1183 N  NZ    . LYS E 3 91  ? -2.139  -2.734  9.656   1.00 38.40 ? 92  LYS A NZ    1 
ATOM   1184 N  N     . THR E 3 92  ? -2.734  3.844   9.831   1.00 15.03 ? 93  THR A N     1 
ATOM   1185 C  CA    . THR E 3 92  ? -2.966  5.237   9.454   1.00 10.83 ? 93  THR A CA    1 
ATOM   1186 C  C     . THR E 3 92  ? -4.319  5.448   8.762   1.00 12.48 ? 93  THR A C     1 
ATOM   1187 O  O     . THR E 3 92  ? -4.838  4.568   8.069   1.00 12.75 ? 93  THR A O     1 
ATOM   1188 C  CB    . THR E 3 92  ? -1.863  5.741   8.482   1.00 11.38 ? 93  THR A CB    1 
ATOM   1189 O  OG1   . THR E 3 92  ? -0.566  5.479   9.024   1.00 13.60 ? 93  THR A OG1   1 
ATOM   1190 C  CG2   . THR E 3 92  ? -1.991  7.231   8.244   1.00 13.21 ? 93  THR A CG2   1 
ATOM   1191 N  N     . THR E 3 93  ? -4.896  6.621   8.974   1.00 12.69 ? 94  THR A N     1 
ATOM   1192 C  CA    . THR E 3 93  ? -6.138  7.007   8.327   1.00 14.56 ? 94  THR A CA    1 
ATOM   1193 C  C     . THR E 3 93  ? -6.100  8.522   8.266   1.00 15.30 ? 94  THR A C     1 
ATOM   1194 O  O     . THR E 3 93  ? -5.221  9.154   8.864   1.00 14.47 ? 94  THR A O     1 
ATOM   1195 C  CB    . THR E 3 93  ? -7.429  6.492   9.035   1.00 18.39 ? 94  THR A CB    1 
ATOM   1196 O  OG1   . THR E 3 93  ? -8.549  6.692   8.154   1.00 13.01 ? 94  THR A OG1   1 
ATOM   1197 C  CG2   . THR E 3 93  ? -7.689  7.220   10.363  1.00 17.91 ? 94  THR A CG2   1 
ATOM   1198 N  N     . TYR E 3 94  ? -7.037  9.111   7.539   1.00 17.82 ? 95  TYR A N     1 
ATOM   1199 C  CA    . TYR E 3 94  ? -7.038  10.552  7.388   1.00 19.60 ? 95  TYR A CA    1 
ATOM   1200 C  C     . TYR E 3 94  ? -8.361  11.160  7.794   1.00 20.37 ? 95  TYR A C     1 
ATOM   1201 O  O     . TYR E 3 94  ? -9.347  10.456  8.011   1.00 20.03 ? 95  TYR A O     1 
ATOM   1202 C  CB    . TYR E 3 94  ? -6.721  10.919  5.932   1.00 19.45 ? 95  TYR A CB    1 
ATOM   1203 C  CG    . TYR E 3 94  ? -7.901  10.807  4.998   1.00 18.10 ? 95  TYR A CG    1 
ATOM   1204 C  CD1   . TYR E 3 94  ? -8.291  9.577   4.470   1.00 21.99 ? 95  TYR A CD1   1 
ATOM   1205 C  CD2   . TYR E 3 94  ? -8.649  11.938  4.665   1.00 24.68 ? 95  TYR A CD2   1 
ATOM   1206 C  CE1   . TYR E 3 94  ? -9.404  9.476   3.633   1.00 20.75 ? 95  TYR A CE1   1 
ATOM   1207 C  CE2   . TYR E 3 94  ? -9.752  11.852  3.838   1.00 25.92 ? 95  TYR A CE2   1 
ATOM   1208 C  CZ    . TYR E 3 94  ? -10.128 10.624  3.327   1.00 25.87 ? 95  TYR A CZ    1 
ATOM   1209 O  OH    . TYR E 3 94  ? -11.235 10.557  2.527   1.00 31.85 ? 95  TYR A OH    1 
ATOM   1210 N  N     . THR E 3 95  ? -8.372  12.479  7.893   1.00 22.43 ? 96  THR A N     1 
ATOM   1211 C  CA    . THR E 3 95  ? -9.574  13.199  8.242   1.00 26.19 ? 96  THR A CA    1 
ATOM   1212 C  C     . THR E 3 95  ? -9.585  14.465  7.378   1.00 29.94 ? 96  THR A C     1 
ATOM   1213 O  O     . THR E 3 95  ? -8.522  14.971  7.005   1.00 28.57 ? 96  THR A O     1 
ATOM   1214 C  CB    . THR E 3 95  ? -9.591  13.506  9.755   1.00 23.30 ? 96  THR A CB    1 
ATOM   1215 O  OG1   . THR E 3 95  ? -10.937 13.735  10.172  1.00 37.09 ? 96  THR A OG1   1 
ATOM   1216 C  CG2   . THR E 3 95  ? -8.724  14.707  10.093  1.00 17.00 ? 96  THR A CG2   1 
ATOM   1217 N  N     . ASN E 3 96  ? -10.772 14.962  7.033   1.00 34.95 ? 97  ASN A N     1 
ATOM   1218 C  CA    . ASN E 3 96  ? -10.866 16.172  6.216   1.00 39.24 ? 97  ASN A CA    1 
ATOM   1219 C  C     . ASN E 3 96  ? -10.841 17.465  7.031   1.00 42.85 ? 97  ASN A C     1 
ATOM   1220 O  O     . ASN E 3 96  ? -10.332 18.487  6.572   1.00 42.46 ? 97  ASN A O     1 
ATOM   1221 C  CB    . ASN E 3 96  ? -12.091 16.119  5.308   1.00 41.26 ? 97  ASN A CB    1 
ATOM   1222 C  CG    . ASN E 3 96  ? -11.796 15.425  3.999   1.00 41.76 ? 97  ASN A CG    1 
ATOM   1223 O  OD1   . ASN E 3 96  ? -12.467 14.463  3.631   1.00 42.63 ? 97  ASN A OD1   1 
ATOM   1224 N  ND2   . ASN E 3 96  ? -10.781 15.909  3.287   1.00 46.29 ? 97  ASN A ND2   1 
ATOM   1225 N  N     . LYS E 3 97  ? -11.394 17.416  8.235   1.00 46.32 ? 98  LYS A N     1 
ATOM   1226 C  CA    . LYS E 3 97  ? -11.380 18.557  9.134   1.00 52.62 ? 98  LYS A CA    1 
ATOM   1227 C  C     . LYS E 3 97  ? -11.129 17.919  10.494  1.00 55.65 ? 98  LYS A C     1 
ATOM   1228 O  O     . LYS E 3 97  ? -11.490 16.763  10.714  1.00 55.20 ? 98  LYS A O     1 
ATOM   1229 C  CB    . LYS E 3 97  ? -12.714 19.330  9.112   1.00 56.34 ? 98  LYS A CB    1 
ATOM   1230 C  CG    . LYS E 3 97  ? -13.876 18.655  9.809   1.00 62.09 ? 98  LYS A CG    1 
ATOM   1231 C  CD    . LYS E 3 97  ? -15.122 19.533  9.848   1.00 67.00 ? 98  LYS A CD    1 
ATOM   1232 C  CE    . LYS E 3 97  ? -16.287 18.779  10.494  1.00 76.42 ? 98  LYS A CE    1 
ATOM   1233 N  NZ    . LYS E 3 97  ? -17.535 19.592  10.645  1.00 79.66 ? 98  LYS A NZ    1 
ATOM   1234 N  N     . GLU E 3 98  ? -10.499 18.663  11.395  1.00 59.80 ? 99  GLU A N     1 
ATOM   1235 C  CA    . GLU E 3 98  ? -10.191 18.146  12.727  1.00 64.67 ? 99  GLU A CA    1 
ATOM   1236 C  C     . GLU E 3 98  ? -11.472 17.872  13.516  1.00 64.41 ? 99  GLU A C     1 
ATOM   1237 O  O     . GLU E 3 98  ? -12.478 18.573  13.363  1.00 63.71 ? 99  GLU A O     1 
ATOM   1238 C  CB    . GLU E 3 98  ? -9.296  19.135  13.482  1.00 72.36 ? 99  GLU A CB    1 
ATOM   1239 C  CG    . GLU E 3 98  ? -7.916  19.353  12.834  1.00 81.20 ? 99  GLU A CG    1 
ATOM   1240 C  CD    . GLU E 3 98  ? -7.096  20.459  13.490  1.00 92.24 ? 99  GLU A CD    1 
ATOM   1241 O  OE1   . GLU E 3 98  ? -7.458  20.901  14.604  1.00 93.82 ? 99  GLU A OE1   1 
ATOM   1242 O  OE2   . GLU E 3 98  ? -6.083  20.886  12.882  1.00 96.19 ? 99  GLU A OE2   1 
ATOM   1243 N  N     . ASN E 3 99  ? -11.416 16.835  14.353  1.00 62.54 ? 100 ASN A N     1 
ATOM   1244 C  CA    . ASN E 3 99  ? -12.539 16.431  15.192  1.00 60.25 ? 100 ASN A CA    1 
ATOM   1245 C  C     . ASN E 3 99  ? -13.664 15.622  14.511  1.00 56.87 ? 100 ASN A C     1 
ATOM   1246 O  O     . ASN E 3 99  ? -14.755 15.480  15.070  1.00 58.44 ? 100 ASN A O     1 
ATOM   1247 C  CB    . ASN E 3 99  ? -13.119 17.664  15.913  1.00 67.98 ? 100 ASN A CB    1 
ATOM   1248 C  CG    . ASN E 3 99  ? -14.084 17.291  17.033  1.00 76.28 ? 100 ASN A CG    1 
ATOM   1249 O  OD1   . ASN E 3 99  ? -15.176 17.855  17.140  1.00 81.54 ? 100 ASN A OD1   1 
ATOM   1250 N  ND2   . ASN E 3 99  ? -13.690 16.336  17.869  1.00 79.71 ? 100 ASN A ND2   1 
ATOM   1251 N  N     . GLU E 3 100 ? -13.415 15.092  13.318  1.00 50.66 ? 101 GLU A N     1 
ATOM   1252 C  CA    . GLU E 3 100 ? -14.410 14.233  12.657  1.00 45.15 ? 101 GLU A CA    1 
ATOM   1253 C  C     . GLU E 3 100 ? -14.210 12.822  13.241  1.00 37.76 ? 101 GLU A C     1 
ATOM   1254 O  O     . GLU E 3 100 ? -13.199 12.557  13.902  1.00 32.37 ? 101 GLU A O     1 
ATOM   1255 C  CB    . GLU E 3 100 ? -14.168 14.144  11.147  1.00 49.19 ? 101 GLU A CB    1 
ATOM   1256 C  CG    . GLU E 3 100 ? -14.512 15.375  10.329  1.00 58.64 ? 101 GLU A CG    1 
ATOM   1257 C  CD    . GLU E 3 100 ? -14.213 15.190  8.834   1.00 67.59 ? 101 GLU A CD    1 
ATOM   1258 O  OE1   . GLU E 3 100 ? -13.607 14.160  8.445   1.00 64.23 ? 101 GLU A OE1   1 
ATOM   1259 O  OE2   . GLU E 3 100 ? -14.587 16.083  8.042   1.00 72.31 ? 101 GLU A OE2   1 
ATOM   1260 N  N     . LYS E 3 101 ? -15.157 11.918  13.006  1.00 34.49 ? 102 LYS A N     1 
ATOM   1261 C  CA    . LYS E 3 101 ? -15.011 10.542  13.497  1.00 30.03 ? 102 LYS A CA    1 
ATOM   1262 C  C     . LYS E 3 101 ? -14.061 9.826   12.539  1.00 27.94 ? 102 LYS A C     1 
ATOM   1263 O  O     . LYS E 3 101 ? -14.042 10.116  11.338  1.00 27.91 ? 102 LYS A O     1 
ATOM   1264 C  CB    . LYS E 3 101 ? -16.363 9.814   13.546  1.00 23.01 ? 102 LYS A CB    1 
ATOM   1265 C  CG    . LYS E 3 101 ? -17.330 10.406  14.558  1.00 36.55 ? 102 LYS A CG    1 
ATOM   1266 C  CD    . LYS E 3 101 ? -18.448 9.456   14.936  1.00 44.15 ? 102 LYS A CD    1 
ATOM   1267 C  CE    . LYS E 3 101 ? -19.304 10.095  16.024  1.00 58.81 ? 102 LYS A CE    1 
ATOM   1268 N  NZ    . LYS E 3 101 ? -20.327 9.181   16.598  1.00 60.91 ? 102 LYS A NZ    1 
ATOM   1269 N  N     . ILE E 3 102 ? -13.266 8.907   13.065  1.00 24.64 ? 103 ILE A N     1 
ATOM   1270 C  CA    . ILE E 3 102 ? -12.325 8.162   12.241  1.00 22.79 ? 103 ILE A CA    1 
ATOM   1271 C  C     . ILE E 3 102 ? -12.503 6.675   12.499  1.00 20.15 ? 103 ILE A C     1 
ATOM   1272 O  O     . ILE E 3 102 ? -13.186 6.282   13.446  1.00 18.45 ? 103 ILE A O     1 
ATOM   1273 C  CB    . ILE E 3 102 ? -10.866 8.558   12.561  1.00 22.72 ? 103 ILE A CB    1 
ATOM   1274 C  CG1   . ILE E 3 102 ? -10.591 8.363   14.050  1.00 25.63 ? 103 ILE A CG1   1 
ATOM   1275 C  CG2   . ILE E 3 102 ? -10.620 10.011  12.181  1.00 22.94 ? 103 ILE A CG2   1 
ATOM   1276 C  CD1   . ILE E 3 102 ? -9.157  8.585   14.448  1.00 25.65 ? 103 ILE A CD1   1 
ATOM   1277 N  N     . LYS E 3 103 ? -11.909 5.854   11.640  1.00 18.99 ? 104 LYS A N     1 
ATOM   1278 C  CA    . LYS E 3 103 ? -11.940 4.404   11.801  1.00 20.67 ? 104 LYS A CA    1 
ATOM   1279 C  C     . LYS E 3 103 ? -10.748 3.862   11.038  1.00 19.56 ? 104 LYS A C     1 
ATOM   1280 O  O     . LYS E 3 103 ? -10.316 4.461   10.051  1.00 22.24 ? 104 LYS A O     1 
ATOM   1281 C  CB    . LYS E 3 103 ? -13.258 3.786   11.316  1.00 22.17 ? 104 LYS A CB    1 
ATOM   1282 C  CG    . LYS E 3 103 ? -13.582 3.969   9.850   1.00 25.24 ? 104 LYS A CG    1 
ATOM   1283 C  CD    . LYS E 3 103 ? -15.015 3.517   9.568   1.00 35.02 ? 104 LYS A CD    1 
ATOM   1284 C  CE    . LYS E 3 103 ? -15.393 3.658   8.083   1.00 48.34 ? 104 LYS A CE    1 
ATOM   1285 N  NZ    . LYS E 3 103 ? -15.209 5.040   7.531   1.00 48.29 ? 104 LYS A NZ    1 
ATOM   1286 N  N     . PHE E 3 104 ? -10.212 2.742   11.508  1.00 17.94 ? 105 PHE A N     1 
ATOM   1287 C  CA    . PHE E 3 104 ? -9.039  2.107   10.909  1.00 16.94 ? 105 PHE A CA    1 
ATOM   1288 C  C     . PHE E 3 104 ? -9.368  0.687   10.472  1.00 16.76 ? 105 PHE A C     1 
ATOM   1289 O  O     . PHE E 3 104 ? -10.368 0.117   10.911  1.00 18.12 ? 105 PHE A O     1 
ATOM   1290 C  CB    . PHE E 3 104 ? -7.907  1.974   11.942  1.00 16.92 ? 105 PHE A CB    1 
ATOM   1291 C  CG    . PHE E 3 104 ? -7.412  3.273   12.499  1.00 12.79 ? 105 PHE A CG    1 
ATOM   1292 C  CD1   . PHE E 3 104 ? -8.053  3.870   13.577  1.00 9.31  ? 105 PHE A CD1   1 
ATOM   1293 C  CD2   . PHE E 3 104 ? -6.296  3.900   11.947  1.00 8.95  ? 105 PHE A CD2   1 
ATOM   1294 C  CE1   . PHE E 3 104 ? -7.591  5.069   14.098  1.00 13.16 ? 105 PHE A CE1   1 
ATOM   1295 C  CE2   . PHE E 3 104 ? -5.829  5.101   12.462  1.00 15.72 ? 105 PHE A CE2   1 
ATOM   1296 C  CZ    . PHE E 3 104 ? -6.482  5.687   13.543  1.00 14.14 ? 105 PHE A CZ    1 
ATOM   1297 N  N     . THR E 3 105 ? -8.524  0.126   9.611   1.00 14.37 ? 106 THR A N     1 
ATOM   1298 C  CA    . THR E 3 105 ? -8.658  -1.269  9.208   1.00 15.39 ? 106 THR A CA    1 
ATOM   1299 C  C     . THR E 3 105 ? -7.578  -1.836  10.128  1.00 13.19 ? 106 THR A C     1 
ATOM   1300 O  O     . THR E 3 105 ? -6.450  -1.369  10.112  1.00 13.81 ? 106 THR A O     1 
ATOM   1301 C  CB    . THR E 3 105 ? -8.308  -1.519  7.709   1.00 18.75 ? 106 THR A CB    1 
ATOM   1302 O  OG1   . THR E 3 105 ? -7.162  -0.747  7.329   1.00 25.27 ? 106 THR A OG1   1 
ATOM   1303 C  CG2   . THR E 3 105 ? -9.492  -1.173  6.808   1.00 14.71 ? 106 THR A CG2   1 
ATOM   1304 N  N     . LEU E 3 106 ? -7.916  -2.828  10.938  1.00 14.52 ? 107 LEU A N     1 
ATOM   1305 C  CA    . LEU E 3 106 ? -6.955  -3.359  11.892  1.00 17.16 ? 107 LEU A CA    1 
ATOM   1306 C  C     . LEU E 3 106 ? -6.240  -4.679  11.572  1.00 20.01 ? 107 LEU A C     1 
ATOM   1307 O  O     . LEU E 3 106 ? -5.611  -5.269  12.451  1.00 21.96 ? 107 LEU A O     1 
ATOM   1308 C  CB    . LEU E 3 106 ? -7.623  -3.430  13.275  1.00 18.90 ? 107 LEU A CB    1 
ATOM   1309 C  CG    . LEU E 3 106 ? -8.035  -2.085  13.890  1.00 19.70 ? 107 LEU A CG    1 
ATOM   1310 C  CD1   . LEU E 3 106 ? -8.802  -2.317  15.179  1.00 19.47 ? 107 LEU A CD1   1 
ATOM   1311 C  CD2   . LEU E 3 106 ? -6.794  -1.214  14.130  1.00 10.76 ? 107 LEU A CD2   1 
ATOM   1312 N  N     . GLY E 3 107 ? -6.307  -5.139  10.327  1.00 18.03 ? 108 GLY A N     1 
ATOM   1313 C  CA    . GLY E 3 107 ? -5.653  -6.392  9.991   1.00 13.63 ? 108 GLY A CA    1 
ATOM   1314 C  C     . GLY E 3 107 ? -6.693  -7.476  9.777   1.00 16.08 ? 108 GLY A C     1 
ATOM   1315 O  O     . GLY E 3 107 ? -7.880  -7.290  10.084  1.00 13.77 ? 108 GLY A O     1 
ATOM   1316 N  N     . GLY E 3 108 ? -6.265  -8.618  9.257   1.00 15.95 ? 109 GLY A N     1 
ATOM   1317 C  CA    . GLY E 3 108 ? -7.213  -9.679  8.983   1.00 16.40 ? 109 GLY A CA    1 
ATOM   1318 C  C     . GLY E 3 108 ? -7.806  -10.412 10.168  1.00 20.62 ? 109 GLY A C     1 
ATOM   1319 O  O     . GLY E 3 108 ? -7.215  -10.469 11.245  1.00 20.76 ? 109 GLY A O     1 
ATOM   1320 N  N     . TYR E 3 109 ? -8.993  -10.975 9.974   1.00 20.99 ? 110 TYR A N     1 
ATOM   1321 C  CA    . TYR E 3 109 ? -9.613  -11.757 11.027  1.00 22.90 ? 110 TYR A CA    1 
ATOM   1322 C  C     . TYR E 3 109 ? -9.676  -13.240 10.656  1.00 23.99 ? 110 TYR A C     1 
ATOM   1323 O  O     . TYR E 3 109 ? -10.303 -14.023 11.363  1.00 24.20 ? 110 TYR A O     1 
ATOM   1324 C  CB    . TYR E 3 109 ? -11.010 -11.233 11.380  1.00 18.06 ? 110 TYR A CB    1 
ATOM   1325 C  CG    . TYR E 3 109 ? -12.022 -11.190 10.260  1.00 18.65 ? 110 TYR A CG    1 
ATOM   1326 C  CD1   . TYR E 3 109 ? -12.728 -12.330 9.881   1.00 19.22 ? 110 TYR A CD1   1 
ATOM   1327 C  CD2   . TYR E 3 109 ? -12.307 -9.992  9.610   1.00 18.94 ? 110 TYR A CD2   1 
ATOM   1328 C  CE1   . TYR E 3 109 ? -13.698 -12.275 8.881   1.00 16.52 ? 110 TYR A CE1   1 
ATOM   1329 C  CE2   . TYR E 3 109 ? -13.272 -9.923  8.611   1.00 19.32 ? 110 TYR A CE2   1 
ATOM   1330 C  CZ    . TYR E 3 109 ? -13.962 -11.067 8.255   1.00 22.66 ? 110 TYR A CZ    1 
ATOM   1331 O  OH    . TYR E 3 109 ? -14.919 -10.995 7.284   1.00 17.71 ? 110 TYR A OH    1 
ATOM   1332 N  N     . THR E 3 110 ? -9.030  -13.629 9.556   1.00 18.84 ? 111 THR A N     1 
ATOM   1333 C  CA    . THR E 3 110 ? -9.051  -15.032 9.148   1.00 21.11 ? 111 THR A CA    1 
ATOM   1334 C  C     . THR E 3 110 ? -7.657  -15.662 9.118   1.00 20.07 ? 111 THR A C     1 
ATOM   1335 O  O     . THR E 3 110 ? -7.513  -16.821 8.735   1.00 22.19 ? 111 THR A O     1 
ATOM   1336 C  CB    . THR E 3 110 ? -9.753  -15.244 7.753   1.00 22.54 ? 111 THR A CB    1 
ATOM   1337 O  OG1   . THR E 3 110 ? -8.975  -14.645 6.712   1.00 19.24 ? 111 THR A OG1   1 
ATOM   1338 C  CG2   . THR E 3 110 ? -11.137 -14.627 7.740   1.00 13.80 ? 111 THR A CG2   1 
ATOM   1339 N  N     . SER E 3 111 ? -6.633  -14.910 9.521   1.00 21.03 ? 112 SER A N     1 
ATOM   1340 C  CA    . SER E 3 111 ? -5.277  -15.447 9.523   1.00 20.10 ? 112 SER A CA    1 
ATOM   1341 C  C     . SER E 3 111 ? -4.819  -15.938 10.918  1.00 22.92 ? 112 SER A C     1 
ATOM   1342 O  O     . SER E 3 111 ? -5.425  -16.856 11.470  1.00 20.01 ? 112 SER A O     1 
ATOM   1343 C  CB    . SER E 3 111 ? -4.293  -14.428 8.928   1.00 20.17 ? 112 SER A CB    1 
ATOM   1344 O  OG    . SER E 3 111 ? -4.350  -13.192 9.612   1.00 18.69 ? 112 SER A OG    1 
ATOM   1345 N  N     . PHE E 3 112 ? -3.774  -15.333 11.487  1.00 21.66 ? 113 PHE A N     1 
ATOM   1346 C  CA    . PHE E 3 112 ? -3.240  -15.745 12.788  1.00 23.56 ? 113 PHE A CA    1 
ATOM   1347 C  C     . PHE E 3 112 ? -4.212  -15.823 13.962  1.00 25.57 ? 113 PHE A C     1 
ATOM   1348 O  O     . PHE E 3 112 ? -3.941  -16.558 14.919  1.00 25.22 ? 113 PHE A O     1 
ATOM   1349 C  CB    . PHE E 3 112 ? -2.025  -14.897 13.181  1.00 20.75 ? 113 PHE A CB    1 
ATOM   1350 C  CG    . PHE E 3 112 ? -2.266  -13.426 13.094  1.00 26.08 ? 113 PHE A CG    1 
ATOM   1351 C  CD1   . PHE E 3 112 ? -2.884  -12.747 14.140  1.00 20.54 ? 113 PHE A CD1   1 
ATOM   1352 C  CD2   . PHE E 3 112 ? -1.907  -12.719 11.949  1.00 26.03 ? 113 PHE A CD2   1 
ATOM   1353 C  CE1   . PHE E 3 112 ? -3.146  -11.383 14.048  1.00 17.12 ? 113 PHE A CE1   1 
ATOM   1354 C  CE2   . PHE E 3 112 ? -2.165  -11.351 11.845  1.00 25.12 ? 113 PHE A CE2   1 
ATOM   1355 C  CZ    . PHE E 3 112 ? -2.787  -10.683 12.897  1.00 26.08 ? 113 PHE A CZ    1 
ATOM   1356 N  N     . ILE E 3 113 ? -5.328  -15.092 13.926  1.00 24.31 ? 114 ILE A N     1 
ATOM   1357 C  CA    . ILE E 3 113 ? -6.257  -15.210 15.045  1.00 26.94 ? 114 ILE A CA    1 
ATOM   1358 C  C     . ILE E 3 113 ? -7.066  -16.511 14.925  1.00 27.66 ? 114 ILE A C     1 
ATOM   1359 O  O     . ILE E 3 113 ? -7.637  -16.969 15.910  1.00 26.96 ? 114 ILE A O     1 
ATOM   1360 C  CB    . ILE E 3 113 ? -7.224  -13.993 15.227  1.00 28.12 ? 114 ILE A CB    1 
ATOM   1361 C  CG1   . ILE E 3 113 ? -8.324  -13.998 14.177  1.00 30.01 ? 114 ILE A CG1   1 
ATOM   1362 C  CG2   . ILE E 3 113 ? -6.454  -12.684 15.237  1.00 27.60 ? 114 ILE A CG2   1 
ATOM   1363 C  CD1   . ILE E 3 113 ? -9.497  -13.118 14.570  1.00 25.05 ? 114 ILE A CD1   1 
ATOM   1364 N  N     . ARG E 3 114 ? -7.119  -17.101 13.729  1.00 24.28 ? 115 ARG A N     1 
ATOM   1365 C  CA    . ARG E 3 114 ? -7.836  -18.366 13.542  1.00 26.37 ? 115 ARG A CA    1 
ATOM   1366 C  C     . ARG E 3 114 ? -6.878  -19.542 13.415  1.00 29.39 ? 115 ARG A C     1 
ATOM   1367 O  O     . ARG E 3 114 ? -7.262  -20.687 13.653  1.00 29.30 ? 115 ARG A O     1 
ATOM   1368 C  CB    . ARG E 3 114 ? -8.739  -18.324 12.315  1.00 17.74 ? 115 ARG A CB    1 
ATOM   1369 C  CG    . ARG E 3 114 ? -9.791  -17.273 12.413  1.00 17.82 ? 115 ARG A CG    1 
ATOM   1370 C  CD    . ARG E 3 114 ? -10.930 -17.491 11.443  1.00 13.77 ? 115 ARG A CD    1 
ATOM   1371 N  NE    . ARG E 3 114 ? -11.892 -16.401 11.592  1.00 19.09 ? 115 ARG A NE    1 
ATOM   1372 C  CZ    . ARG E 3 114 ? -13.167 -16.447 11.225  1.00 19.01 ? 115 ARG A CZ    1 
ATOM   1373 N  NH1   . ARG E 3 114 ? -13.674 -17.540 10.666  1.00 25.97 ? 115 ARG A NH1   1 
ATOM   1374 N  NH2   . ARG E 3 114 ? -13.940 -15.388 11.417  1.00 19.53 ? 115 ARG A NH2   1 
ATOM   1375 N  N     . ASN E 3 115 ? -5.635  -19.254 13.040  1.00 31.31 ? 116 ASN A N     1 
ATOM   1376 C  CA    . ASN E 3 115 ? -4.602  -20.273 12.857  1.00 31.72 ? 116 ASN A CA    1 
ATOM   1377 C  C     . ASN E 3 115 ? -3.312  -19.769 13.489  1.00 30.55 ? 116 ASN A C     1 
ATOM   1378 O  O     . ASN E 3 115 ? -2.645  -18.886 12.959  1.00 33.63 ? 116 ASN A O     1 
ATOM   1379 C  CB    . ASN E 3 115 ? -4.379  -20.536 11.363  1.00 35.66 ? 116 ASN A CB    1 
ATOM   1380 C  CG    . ASN E 3 115 ? -3.389  -21.668 11.109  1.00 47.13 ? 116 ASN A CG    1 
ATOM   1381 O  OD1   . ASN E 3 115 ? -2.201  -21.576 11.447  1.00 45.42 ? 116 ASN A OD1   1 
ATOM   1382 N  ND2   . ASN E 3 115 ? -3.877  -22.743 10.509  1.00 52.97 ? 116 ASN A ND2   1 
ATOM   1383 N  N     . ASN E 3 116 ? -2.962  -20.349 14.621  1.00 30.14 ? 117 ASN A N     1 
ATOM   1384 C  CA    . ASN E 3 116 ? -1.785  -19.963 15.387  1.00 29.61 ? 117 ASN A CA    1 
ATOM   1385 C  C     . ASN E 3 116 ? -0.481  -19.576 14.661  1.00 29.01 ? 117 ASN A C     1 
ATOM   1386 O  O     . ASN E 3 116 ? 0.301   -18.786 15.192  1.00 27.35 ? 117 ASN A O     1 
ATOM   1387 C  CB    . ASN E 3 116 ? -1.501  -21.066 16.410  1.00 35.77 ? 117 ASN A CB    1 
ATOM   1388 C  CG    . ASN E 3 116 ? -0.559  -20.623 17.510  1.00 40.90 ? 117 ASN A CG    1 
ATOM   1389 O  OD1   . ASN E 3 116 ? -0.842  -19.666 18.237  1.00 43.56 ? 117 ASN A OD1   1 
ATOM   1390 N  ND2   . ASN E 3 116 ? 0.571   -21.318 17.644  1.00 36.55 ? 117 ASN A ND2   1 
ATOM   1391 N  N     . THR E 3 117 ? -0.229  -20.108 13.467  1.00 29.70 ? 118 THR A N     1 
ATOM   1392 C  CA    . THR E 3 117 ? 1.029   -19.804 12.772  1.00 28.37 ? 118 THR A CA    1 
ATOM   1393 C  C     . THR E 3 117 ? 0.917   -19.176 11.384  1.00 26.95 ? 118 THR A C     1 
ATOM   1394 O  O     . THR E 3 117 ? 1.919   -19.024 10.682  1.00 27.89 ? 118 THR A O     1 
ATOM   1395 C  CB    . THR E 3 117 ? 1.893   -21.074 12.651  1.00 28.61 ? 118 THR A CB    1 
ATOM   1396 O  OG1   . THR E 3 117 ? 1.051   -22.184 12.323  1.00 34.73 ? 118 THR A OG1   1 
ATOM   1397 C  CG2   . THR E 3 117 ? 2.610   -21.364 13.956  1.00 30.40 ? 118 THR A CG2   1 
ATOM   1398 N  N     . LYS E 3 118 ? -0.296  -18.803 10.998  1.00 26.03 ? 119 LYS A N     1 
ATOM   1399 C  CA    . LYS E 3 118 ? -0.563  -18.221 9.686   1.00 26.12 ? 119 LYS A CA    1 
ATOM   1400 C  C     . LYS E 3 118 ? -0.282  -16.723 9.559   1.00 27.44 ? 119 LYS A C     1 
ATOM   1401 O  O     . LYS E 3 118 ? -0.888  -15.911 10.270  1.00 25.51 ? 119 LYS A O     1 
ATOM   1402 C  CB    . LYS E 3 118 ? -2.019  -18.478 9.332   1.00 24.64 ? 119 LYS A CB    1 
ATOM   1403 C  CG    . LYS E 3 118 ? -2.430  -18.168 7.916   1.00 32.13 ? 119 LYS A CG    1 
ATOM   1404 C  CD    . LYS E 3 118 ? -3.916  -18.327 7.894   1.00 40.88 ? 119 LYS A CD    1 
ATOM   1405 C  CE    . LYS E 3 118 ? -4.493  -18.438 6.534   1.00 40.85 ? 119 LYS A CE    1 
ATOM   1406 N  NZ    . LYS E 3 118 ? -5.948  -18.675 6.760   1.00 37.14 ? 119 LYS A NZ    1 
ATOM   1407 N  N     . ASN E 3 119 ? 0.631   -16.373 8.645   1.00 23.79 ? 120 ASN A N     1 
ATOM   1408 C  CA    . ASN E 3 119 ? 1.006   -14.983 8.355   1.00 24.24 ? 120 ASN A CA    1 
ATOM   1409 C  C     . ASN E 3 119 ? 1.470   -14.174 9.552   1.00 23.50 ? 120 ASN A C     1 
ATOM   1410 O  O     . ASN E 3 119 ? 1.153   -12.993 9.669   1.00 23.24 ? 120 ASN A O     1 
ATOM   1411 C  CB    . ASN E 3 119 ? -0.156  -14.238 7.668   1.00 25.76 ? 120 ASN A CB    1 
ATOM   1412 C  CG    . ASN E 3 119 ? -0.486  -14.809 6.303   1.00 29.76 ? 120 ASN A CG    1 
ATOM   1413 O  OD1   . ASN E 3 119 ? -1.354  -15.672 6.176   1.00 27.99 ? 120 ASN A OD1   1 
ATOM   1414 N  ND2   . ASN E 3 119 ? 0.209   -14.332 5.273   1.00 19.67 ? 120 ASN A ND2   1 
ATOM   1415 N  N     . ILE E 3 120 ? 2.233   -14.800 10.433  1.00 21.50 ? 121 ILE A N     1 
ATOM   1416 C  CA    . ILE E 3 120 ? 2.716   -14.113 11.614  1.00 22.22 ? 121 ILE A CA    1 
ATOM   1417 C  C     . ILE E 3 120 ? 4.168   -14.541 11.831  1.00 23.69 ? 121 ILE A C     1 
ATOM   1418 O  O     . ILE E 3 120 ? 4.527   -15.688 11.549  1.00 24.81 ? 121 ILE A O     1 
ATOM   1419 C  CB    . ILE E 3 120 ? 1.768   -14.414 12.826  1.00 22.83 ? 121 ILE A CB    1 
ATOM   1420 C  CG1   . ILE E 3 120 ? 2.192   -13.628 14.065  1.00 21.73 ? 121 ILE A CG1   1 
ATOM   1421 C  CG2   . ILE E 3 120 ? 1.680   -15.912 13.087  1.00 19.44 ? 121 ILE A CG2   1 
ATOM   1422 C  CD1   . ILE E 3 120 ? 1.146   -13.668 15.172  1.00 17.29 ? 121 ILE A CD1   1 
ATOM   1423 N  N     . VAL E 3 121 ? 5.002   -13.616 12.302  1.00 19.67 ? 122 VAL A N     1 
ATOM   1424 C  CA    . VAL E 3 121 ? 6.421   -13.891 12.511  1.00 21.45 ? 122 VAL A CA    1 
ATOM   1425 C  C     . VAL E 3 121 ? 6.662   -14.991 13.538  1.00 23.91 ? 122 VAL A C     1 
ATOM   1426 O  O     . VAL E 3 121 ? 7.520   -15.850 13.347  1.00 24.75 ? 122 VAL A O     1 
ATOM   1427 C  CB    . VAL E 3 121 ? 7.182   -12.604 12.897  1.00 20.10 ? 122 VAL A CB    1 
ATOM   1428 C  CG1   . VAL E 3 121 ? 8.671   -12.873 12.991  1.00 19.09 ? 122 VAL A CG1   1 
ATOM   1429 C  CG2   . VAL E 3 121 ? 6.922   -11.523 11.853  1.00 25.08 ? 122 VAL A CG2   1 
ATOM   1430 N  N     . TYR E 3 122 ? 5.904   -14.961 14.625  1.00 24.84 ? 123 TYR A N     1 
ATOM   1431 C  CA    . TYR E 3 122 ? 6.005   -15.969 15.662  1.00 25.35 ? 123 TYR A CA    1 
ATOM   1432 C  C     . TYR E 3 122 ? 4.608   -16.494 15.943  1.00 27.98 ? 123 TYR A C     1 
ATOM   1433 O  O     . TYR E 3 122 ? 3.617   -15.795 15.704  1.00 28.24 ? 123 TYR A O     1 
ATOM   1434 C  CB    . TYR E 3 122 ? 6.600   -15.371 16.929  1.00 25.62 ? 123 TYR A CB    1 
ATOM   1435 C  CG    . TYR E 3 122 ? 8.085   -15.150 16.835  1.00 28.48 ? 123 TYR A CG    1 
ATOM   1436 C  CD1   . TYR E 3 122 ? 8.974   -16.210 17.025  1.00 25.71 ? 123 TYR A CD1   1 
ATOM   1437 C  CD2   . TYR E 3 122 ? 8.609   -13.883 16.564  1.00 22.19 ? 123 TYR A CD2   1 
ATOM   1438 C  CE1   . TYR E 3 122 ? 10.350  -16.019 16.950  1.00 24.49 ? 123 TYR A CE1   1 
ATOM   1439 C  CE2   . TYR E 3 122 ? 9.983   -13.680 16.486  1.00 23.02 ? 123 TYR A CE2   1 
ATOM   1440 C  CZ    . TYR E 3 122 ? 10.846  -14.757 16.682  1.00 30.22 ? 123 TYR A CZ    1 
ATOM   1441 O  OH    . TYR E 3 122 ? 12.207  -14.573 16.616  1.00 38.46 ? 123 TYR A OH    1 
ATOM   1442 N  N     . PRO E 3 123 ? 4.501   -17.739 16.441  1.00 29.50 ? 124 PRO A N     1 
ATOM   1443 C  CA    . PRO E 3 123 ? 3.170   -18.284 16.733  1.00 28.04 ? 124 PRO A CA    1 
ATOM   1444 C  C     . PRO E 3 123 ? 2.389   -17.300 17.615  1.00 26.93 ? 124 PRO A C     1 
ATOM   1445 O  O     . PRO E 3 123 ? 2.917   -16.768 18.591  1.00 24.85 ? 124 PRO A O     1 
ATOM   1446 C  CB    . PRO E 3 123 ? 3.491   -19.587 17.457  1.00 27.77 ? 124 PRO A CB    1 
ATOM   1447 C  CG    . PRO E 3 123 ? 4.793   -20.010 16.811  1.00 29.80 ? 124 PRO A CG    1 
ATOM   1448 C  CD    . PRO E 3 123 ? 5.559   -18.715 16.758  1.00 27.01 ? 124 PRO A CD    1 
ATOM   1449 N  N     . PHE E 3 124 ? 1.136   -17.067 17.254  1.00 26.56 ? 125 PHE A N     1 
ATOM   1450 C  CA    . PHE E 3 124 ? 0.247   -16.154 17.958  1.00 27.18 ? 125 PHE A CA    1 
ATOM   1451 C  C     . PHE E 3 124 ? 0.251   -16.297 19.487  1.00 28.76 ? 125 PHE A C     1 
ATOM   1452 O  O     . PHE E 3 124 ? 0.171   -15.296 20.204  1.00 28.24 ? 125 PHE A O     1 
ATOM   1453 C  CB    . PHE E 3 124 ? -1.176  -16.332 17.407  1.00 25.02 ? 125 PHE A CB    1 
ATOM   1454 C  CG    . PHE E 3 124 ? -2.162  -15.299 17.887  1.00 21.79 ? 125 PHE A CG    1 
ATOM   1455 C  CD1   . PHE E 3 124 ? -2.079  -13.982 17.456  1.00 21.27 ? 125 PHE A CD1   1 
ATOM   1456 C  CD2   . PHE E 3 124 ? -3.193  -15.654 18.757  1.00 26.74 ? 125 PHE A CD2   1 
ATOM   1457 C  CE1   . PHE E 3 124 ? -3.008  -13.029 17.880  1.00 23.11 ? 125 PHE A CE1   1 
ATOM   1458 C  CE2   . PHE E 3 124 ? -4.127  -14.707 19.186  1.00 23.62 ? 125 PHE A CE2   1 
ATOM   1459 C  CZ    . PHE E 3 124 ? -4.032  -13.395 18.745  1.00 26.14 ? 125 PHE A CZ    1 
ATOM   1460 N  N     . ASP E 3 125 ? 0.344   -17.526 19.993  1.00 29.75 ? 126 ASP A N     1 
ATOM   1461 C  CA    . ASP E 3 125 ? 0.338   -17.731 21.445  1.00 30.93 ? 126 ASP A CA    1 
ATOM   1462 C  C     . ASP E 3 125 ? 1.589   -17.271 22.212  1.00 28.35 ? 126 ASP A C     1 
ATOM   1463 O  O     . ASP E 3 125 ? 1.601   -17.290 23.442  1.00 29.59 ? 126 ASP A O     1 
ATOM   1464 C  CB    . ASP E 3 125 ? -0.048  -19.184 21.815  1.00 32.14 ? 126 ASP A CB    1 
ATOM   1465 C  CG    . ASP E 3 125 ? 0.870   -20.245 21.201  1.00 38.79 ? 126 ASP A CG    1 
ATOM   1466 O  OD1   . ASP E 3 125 ? 1.856   -19.914 20.511  1.00 46.52 ? 126 ASP A OD1   1 
ATOM   1467 O  OD2   . ASP E 3 125 ? 0.589   -21.440 21.419  1.00 43.99 ? 126 ASP A OD2   1 
ATOM   1468 N  N     . GLN E 3 126 ? 2.631   -16.852 21.495  1.00 25.81 ? 127 GLN A N     1 
ATOM   1469 C  CA    . GLN E 3 126 ? 3.853   -16.365 22.141  1.00 26.10 ? 127 GLN A CA    1 
ATOM   1470 C  C     . GLN E 3 126 ? 3.778   -14.869 22.435  1.00 25.50 ? 127 GLN A C     1 
ATOM   1471 O  O     . GLN E 3 126 ? 4.678   -14.305 23.068  1.00 24.72 ? 127 GLN A O     1 
ATOM   1472 C  CB    . GLN E 3 126 ? 5.086   -16.650 21.279  1.00 27.38 ? 127 GLN A CB    1 
ATOM   1473 C  CG    . GLN E 3 126 ? 5.438   -18.121 21.198  1.00 28.77 ? 127 GLN A CG    1 
ATOM   1474 C  CD    . GLN E 3 126 ? 6.652   -18.402 20.342  1.00 32.28 ? 127 GLN A CD    1 
ATOM   1475 O  OE1   . GLN E 3 126 ? 7.457   -17.519 20.064  1.00 29.84 ? 127 GLN A OE1   1 
ATOM   1476 N  NE2   . GLN E 3 126 ? 6.787   -19.646 19.918  1.00 35.13 ? 127 GLN A NE2   1 
ATOM   1477 N  N     . TYR E 3 127 ? 2.703   -14.230 21.976  1.00 25.73 ? 128 TYR A N     1 
ATOM   1478 C  CA    . TYR E 3 127 ? 2.505   -12.790 22.175  1.00 24.36 ? 128 TYR A CA    1 
ATOM   1479 C  C     . TYR E 3 127 ? 1.559   -12.524 23.336  1.00 21.51 ? 128 TYR A C     1 
ATOM   1480 O  O     . TYR E 3 127 ? 0.460   -13.078 23.378  1.00 22.22 ? 128 TYR A O     1 
ATOM   1481 C  CB    . TYR E 3 127 ? 1.922   -12.142 20.903  1.00 19.62 ? 128 TYR A CB    1 
ATOM   1482 C  CG    . TYR E 3 127 ? 2.867   -12.087 19.722  1.00 16.27 ? 128 TYR A CG    1 
ATOM   1483 C  CD1   . TYR E 3 127 ? 3.705   -10.990 19.526  1.00 17.07 ? 128 TYR A CD1   1 
ATOM   1484 C  CD2   . TYR E 3 127 ? 2.919   -13.130 18.794  1.00 15.39 ? 128 TYR A CD2   1 
ATOM   1485 C  CE1   . TYR E 3 127 ? 4.573   -10.931 18.429  1.00 18.73 ? 128 TYR A CE1   1 
ATOM   1486 C  CE2   . TYR E 3 127 ? 3.780   -13.084 17.696  1.00 11.88 ? 128 TYR A CE2   1 
ATOM   1487 C  CZ    . TYR E 3 127 ? 4.602   -11.984 17.518  1.00 19.74 ? 128 TYR A CZ    1 
ATOM   1488 O  OH    . TYR E 3 127 ? 5.446   -11.934 16.430  1.00 19.06 ? 128 TYR A OH    1 
ATOM   1489 N  N     . ILE E 3 128 ? 1.978   -11.680 24.273  1.00 21.04 ? 129 ILE A N     1 
ATOM   1490 C  CA    . ILE E 3 128 ? 1.128   -11.341 25.415  1.00 23.43 ? 129 ILE A CA    1 
ATOM   1491 C  C     . ILE E 3 128 ? 0.425   -10.002 25.217  1.00 21.38 ? 129 ILE A C     1 
ATOM   1492 O  O     . ILE E 3 128 ? -0.486  -9.660  25.965  1.00 21.81 ? 129 ILE A O     1 
ATOM   1493 C  CB    . ILE E 3 128 ? 1.919   -11.286 26.740  1.00 22.64 ? 129 ILE A CB    1 
ATOM   1494 C  CG1   . ILE E 3 128 ? 3.075   -10.301 26.620  1.00 21.84 ? 129 ILE A CG1   1 
ATOM   1495 C  CG2   . ILE E 3 128 ? 2.423   -12.662 27.093  1.00 32.17 ? 129 ILE A CG2   1 
ATOM   1496 C  CD1   . ILE E 3 128 ? 3.623   -9.866  27.941  1.00 35.97 ? 129 ILE A CD1   1 
ATOM   1497 N  N     . ALA E 3 129 ? 0.853   -9.243  24.212  1.00 21.78 ? 130 ALA A N     1 
ATOM   1498 C  CA    . ALA E 3 129 ? 0.249   -7.950  23.927  1.00 19.31 ? 130 ALA A CA    1 
ATOM   1499 C  C     . ALA E 3 129 ? 0.278   -7.621  22.437  1.00 18.46 ? 130 ALA A C     1 
ATOM   1500 O  O     . ALA E 3 129 ? 1.217   -7.983  21.725  1.00 17.61 ? 130 ALA A O     1 
ATOM   1501 C  CB    . ALA E 3 129 ? 0.958   -6.861  24.709  1.00 18.01 ? 130 ALA A CB    1 
ATOM   1502 N  N     . HIS E 3 130 ? -0.766  -6.935  21.982  1.00 15.96 ? 131 HIS A N     1 
ATOM   1503 C  CA    . HIS E 3 130 ? -0.900  -6.501  20.593  1.00 15.27 ? 131 HIS A CA    1 
ATOM   1504 C  C     . HIS E 3 130 ? -1.290  -5.026  20.650  1.00 13.86 ? 131 HIS A C     1 
ATOM   1505 O  O     . HIS E 3 130 ? -2.435  -4.678  20.954  1.00 13.48 ? 131 HIS A O     1 
ATOM   1506 C  CB    . HIS E 3 130 ? -1.963  -7.330  19.852  1.00 13.16 ? 131 HIS A CB    1 
ATOM   1507 C  CG    . HIS E 3 130 ? -1.614  -8.783  19.739  1.00 17.05 ? 131 HIS A CG    1 
ATOM   1508 N  ND1   . HIS E 3 130 ? -0.770  -9.274  18.765  1.00 18.90 ? 131 HIS A ND1   1 
ATOM   1509 C  CD2   . HIS E 3 130 ? -1.965  -9.848  20.502  1.00 16.29 ? 131 HIS A CD2   1 
ATOM   1510 C  CE1   . HIS E 3 130 ? -0.613  -10.575 18.933  1.00 19.75 ? 131 HIS A CE1   1 
ATOM   1511 N  NE2   . HIS E 3 130 ? -1.328  -10.948 19.980  1.00 21.42 ? 131 HIS A NE2   1 
ATOM   1512 N  N     . TRP E 3 131 ? -0.309  -4.173  20.370  1.00 13.88 ? 132 TRP A N     1 
ATOM   1513 C  CA    . TRP E 3 131 ? -0.475  -2.730  20.392  1.00 15.87 ? 132 TRP A CA    1 
ATOM   1514 C  C     . TRP E 3 131 ? -0.584  -2.141  18.992  1.00 18.36 ? 132 TRP A C     1 
ATOM   1515 O  O     . TRP E 3 131 ? 0.056   -2.614  18.048  1.00 18.72 ? 132 TRP A O     1 
ATOM   1516 C  CB    . TRP E 3 131 ? 0.727   -2.073  21.072  1.00 16.56 ? 132 TRP A CB    1 
ATOM   1517 C  CG    . TRP E 3 131 ? 0.917   -2.413  22.507  1.00 22.58 ? 132 TRP A CG    1 
ATOM   1518 C  CD1   . TRP E 3 131 ? 0.020   -3.030  23.342  1.00 20.31 ? 132 TRP A CD1   1 
ATOM   1519 C  CD2   . TRP E 3 131 ? 2.081   -2.140  23.296  1.00 24.01 ? 132 TRP A CD2   1 
ATOM   1520 N  NE1   . TRP E 3 131 ? 0.560   -3.155  24.601  1.00 22.47 ? 132 TRP A NE1   1 
ATOM   1521 C  CE2   . TRP E 3 131 ? 1.822   -2.619  24.603  1.00 20.47 ? 132 TRP A CE2   1 
ATOM   1522 C  CE3   . TRP E 3 131 ? 3.318   -1.537  23.026  1.00 20.82 ? 132 TRP A CE3   1 
ATOM   1523 C  CZ2   . TRP E 3 131 ? 2.758   -2.512  25.640  1.00 20.76 ? 132 TRP A CZ2   1 
ATOM   1524 C  CZ3   . TRP E 3 131 ? 4.254   -1.431  24.064  1.00 24.44 ? 132 TRP A CZ3   1 
ATOM   1525 C  CH2   . TRP E 3 131 ? 3.964   -1.918  25.353  1.00 23.76 ? 132 TRP A CH2   1 
ATOM   1526 N  N     . ILE E 3 132 ? -1.392  -1.098  18.882  1.00 15.93 ? 133 ILE A N     1 
ATOM   1527 C  CA    . ILE E 3 132 ? -1.583  -0.385  17.640  1.00 17.56 ? 133 ILE A CA    1 
ATOM   1528 C  C     . ILE E 3 132 ? -1.108  1.049   17.850  1.00 18.64 ? 133 ILE A C     1 
ATOM   1529 O  O     . ILE E 3 132 ? -1.534  1.721   18.797  1.00 16.04 ? 133 ILE A O     1 
ATOM   1530 C  CB    . ILE E 3 132 ? -3.076  -0.308  17.235  1.00 17.35 ? 133 ILE A CB    1 
ATOM   1531 C  CG1   . ILE E 3 132 ? -3.631  -1.710  16.962  1.00 15.21 ? 133 ILE A CG1   1 
ATOM   1532 C  CG2   . ILE E 3 132 ? -3.249  0.630   16.029  1.00 10.51 ? 133 ILE A CG2   1 
ATOM   1533 C  CD1   . ILE E 3 132 ? -2.904  -2.454  15.872  1.00 13.56 ? 133 ILE A CD1   1 
ATOM   1534 N  N     . ILE E 3 133 ? -0.212  1.510   16.988  1.00 16.40 ? 134 ILE A N     1 
ATOM   1535 C  CA    . ILE E 3 133 ? 0.216   2.900   17.039  1.00 16.79 ? 134 ILE A CA    1 
ATOM   1536 C  C     . ILE E 3 133 ? -0.571  3.453   15.850  1.00 15.89 ? 134 ILE A C     1 
ATOM   1537 O  O     . ILE E 3 133 ? -0.336  3.056   14.712  1.00 16.36 ? 134 ILE A O     1 
ATOM   1538 C  CB    . ILE E 3 133 ? 1.738   3.072   16.832  1.00 11.72 ? 134 ILE A CB    1 
ATOM   1539 C  CG1   . ILE E 3 133 ? 2.483   2.472   18.025  1.00 12.61 ? 134 ILE A CG1   1 
ATOM   1540 C  CG2   . ILE E 3 133 ? 2.089   4.564   16.671  1.00 10.53 ? 134 ILE A CG2   1 
ATOM   1541 C  CD1   . ILE E 3 133 ? 3.978   2.501   17.904  1.00 16.94 ? 134 ILE A CD1   1 
ATOM   1542 N  N     . GLY E 3 134 ? -1.519  4.341   16.116  1.00 13.27 ? 135 GLY A N     1 
ATOM   1543 C  CA    . GLY E 3 134 ? -2.332  4.889   15.051  1.00 14.61 ? 135 GLY A CA    1 
ATOM   1544 C  C     . GLY E 3 134 ? -2.036  6.345   14.794  1.00 17.43 ? 135 GLY A C     1 
ATOM   1545 O  O     . GLY E 3 134 ? -1.859  7.119   15.739  1.00 17.07 ? 135 GLY A O     1 
ATOM   1546 N  N     . TYR E 3 135 ? -1.970  6.711   13.514  1.00 18.38 ? 136 TYR A N     1 
ATOM   1547 C  CA    . TYR E 3 135 ? -1.722  8.088   13.089  1.00 16.31 ? 136 TYR A CA    1 
ATOM   1548 C  C     . TYR E 3 135 ? -2.956  8.591   12.338  1.00 17.41 ? 136 TYR A C     1 
ATOM   1549 O  O     . TYR E 3 135 ? -3.564  7.854   11.550  1.00 17.64 ? 136 TYR A O     1 
ATOM   1550 C  CB    . TYR E 3 135 ? -0.512  8.169   12.169  1.00 13.39 ? 136 TYR A CB    1 
ATOM   1551 C  CG    . TYR E 3 135 ? 0.822   7.993   12.842  1.00 14.62 ? 136 TYR A CG    1 
ATOM   1552 C  CD1   . TYR E 3 135 ? 1.375   6.726   13.029  1.00 15.57 ? 136 TYR A CD1   1 
ATOM   1553 C  CD2   . TYR E 3 135 ? 1.549   9.098   13.268  1.00 18.24 ? 136 TYR A CD2   1 
ATOM   1554 C  CE1   . TYR E 3 135 ? 2.630   6.567   13.629  1.00 13.74 ? 136 TYR A CE1   1 
ATOM   1555 C  CE2   . TYR E 3 135 ? 2.798   8.956   13.865  1.00 12.74 ? 136 TYR A CE2   1 
ATOM   1556 C  CZ    . TYR E 3 135 ? 3.337   7.693   14.045  1.00 16.29 ? 136 TYR A CZ    1 
ATOM   1557 O  OH    . TYR E 3 135 ? 4.580   7.578   14.639  1.00 14.10 ? 136 TYR A OH    1 
ATOM   1558 N  N     . VAL E 3 136 ? -3.328  9.840   12.591  1.00 16.58 ? 137 VAL A N     1 
ATOM   1559 C  CA    . VAL E 3 136 ? -4.485  10.455  11.950  1.00 17.28 ? 137 VAL A CA    1 
ATOM   1560 C  C     . VAL E 3 136 ? -3.963  11.771  11.423  1.00 18.68 ? 137 VAL A C     1 
ATOM   1561 O  O     . VAL E 3 136 ? -3.411  12.552  12.188  1.00 18.02 ? 137 VAL A O     1 
ATOM   1562 C  CB    . VAL E 3 136 ? -5.605  10.789  12.963  1.00 20.43 ? 137 VAL A CB    1 
ATOM   1563 C  CG1   . VAL E 3 136 ? -6.866  11.199  12.229  1.00 20.61 ? 137 VAL A CG1   1 
ATOM   1564 C  CG2   . VAL E 3 136 ? -5.874  9.611   13.865  1.00 27.62 ? 137 VAL A CG2   1 
ATOM   1565 N  N     . TYR E 3 137 ? -4.114  12.024  10.130  1.00 18.74 ? 138 TYR A N     1 
ATOM   1566 C  CA    . TYR E 3 137 ? -3.641  13.288  9.584   1.00 20.16 ? 138 TYR A CA    1 
ATOM   1567 C  C     . TYR E 3 137 ? -4.813  13.982  8.896   1.00 19.12 ? 138 TYR A C     1 
ATOM   1568 O  O     . TYR E 3 137 ? -5.748  13.329  8.429   1.00 18.77 ? 138 TYR A O     1 
ATOM   1569 C  CB    . TYR E 3 137 ? -2.449  13.075  8.613   1.00 20.42 ? 138 TYR A CB    1 
ATOM   1570 C  CG    . TYR E 3 137 ? -2.807  12.387  7.306   1.00 22.85 ? 138 TYR A CG    1 
ATOM   1571 C  CD1   . TYR E 3 137 ? -2.871  10.991  7.221   1.00 17.94 ? 138 TYR A CD1   1 
ATOM   1572 C  CD2   . TYR E 3 137 ? -3.136  13.132  6.171   1.00 23.72 ? 138 TYR A CD2   1 
ATOM   1573 C  CE1   . TYR E 3 137 ? -3.262  10.356  6.046   1.00 21.82 ? 138 TYR A CE1   1 
ATOM   1574 C  CE2   . TYR E 3 137 ? -3.530  12.507  4.985   1.00 28.31 ? 138 TYR A CE2   1 
ATOM   1575 C  CZ    . TYR E 3 137 ? -3.596  11.116  4.932   1.00 30.68 ? 138 TYR A CZ    1 
ATOM   1576 O  OH    . TYR E 3 137 ? -4.042  10.493  3.785   1.00 25.93 ? 138 TYR A OH    1 
ATOM   1577 N  N     . THR E 3 138 ? -4.776  15.305  8.859   1.00 21.72 ? 139 THR A N     1 
ATOM   1578 C  CA    . THR E 3 138 ? -5.817  16.069  8.184   1.00 25.30 ? 139 THR A CA    1 
ATOM   1579 C  C     . THR E 3 138 ? -5.263  16.291  6.781   1.00 25.74 ? 139 THR A C     1 
ATOM   1580 O  O     . THR E 3 138 ? -4.191  16.887  6.619   1.00 23.56 ? 139 THR A O     1 
ATOM   1581 C  CB    . THR E 3 138 ? -6.062  17.423  8.874   1.00 27.33 ? 139 THR A CB    1 
ATOM   1582 O  OG1   . THR E 3 138 ? -6.303  17.210  10.267  1.00 36.84 ? 139 THR A OG1   1 
ATOM   1583 C  CG2   . THR E 3 138 ? -7.270  18.107  8.277   1.00 28.35 ? 139 THR A CG2   1 
ATOM   1584 N  N     . ARG E 3 139 ? -5.984  15.802  5.778   1.00 29.76 ? 140 ARG A N     1 
ATOM   1585 C  CA    . ARG E 3 139 ? -5.564  15.911  4.379   1.00 35.80 ? 140 ARG A CA    1 
ATOM   1586 C  C     . ARG E 3 139 ? -5.570  17.350  3.842   1.00 38.96 ? 140 ARG A C     1 
ATOM   1587 O  O     . ARG E 3 139 ? -6.483  18.132  4.134   1.00 37.62 ? 140 ARG A O     1 
ATOM   1588 C  CB    . ARG E 3 139 ? -6.458  15.023  3.511   1.00 40.53 ? 140 ARG A CB    1 
ATOM   1589 C  CG    . ARG E 3 139 ? -5.871  14.690  2.162   1.00 46.17 ? 140 ARG A CG    1 
ATOM   1590 C  CD    . ARG E 3 139 ? -6.745  13.702  1.425   1.00 56.57 ? 140 ARG A CD    1 
ATOM   1591 N  NE    . ARG E 3 139 ? -6.092  13.198  0.218   1.00 65.89 ? 140 ARG A NE    1 
ATOM   1592 C  CZ    . ARG E 3 139 ? -6.742  12.789  -0.871  1.00 70.73 ? 140 ARG A CZ    1 
ATOM   1593 N  NH1   . ARG E 3 139 ? -8.071  12.819  -0.912  1.00 71.45 ? 140 ARG A NH1   1 
ATOM   1594 N  NH2   . ARG E 3 139 ? -6.063  12.347  -1.922  1.00 70.62 ? 140 ARG A NH2   1 
ATOM   1595 N  N     . VAL E 3 140 ? -4.547  17.685  3.058   1.00 43.38 ? 141 VAL A N     1 
ATOM   1596 C  CA    . VAL E 3 140 ? -4.408  19.020  2.472   1.00 49.38 ? 141 VAL A CA    1 
ATOM   1597 C  C     . VAL E 3 140 ? -4.296  18.975  0.938   1.00 55.47 ? 141 VAL A C     1 
ATOM   1598 O  O     . VAL E 3 140 ? -3.637  18.095  0.380   1.00 55.45 ? 141 VAL A O     1 
ATOM   1599 C  CB    . VAL E 3 140 ? -3.180  19.744  3.066   1.00 44.64 ? 141 VAL A CB    1 
ATOM   1600 C  CG1   . VAL E 3 140 ? -2.962  21.078  2.382   1.00 55.17 ? 141 VAL A CG1   1 
ATOM   1601 C  CG2   . VAL E 3 140 ? -3.395  19.971  4.542   1.00 44.55 ? 141 VAL A CG2   1 
ATOM   1602 N  N     . ALA E 3 141 ? -4.945  19.932  0.272   1.00 62.44 ? 142 ALA A N     1 
ATOM   1603 C  CA    . ALA E 3 141 ? -4.957  20.027  -1.193  1.00 66.91 ? 142 ALA A CA    1 
ATOM   1604 C  C     . ALA E 3 141 ? -3.582  20.298  -1.795  1.00 69.21 ? 142 ALA A C     1 
ATOM   1605 O  O     . ALA E 3 141 ? -2.954  21.320  -1.502  1.00 69.13 ? 142 ALA A O     1 
ATOM   1606 C  CB    . ALA E 3 141 ? -5.942  21.107  -1.644  1.00 68.36 ? 142 ALA A CB    1 
ATOM   1607 N  N     . THR E 3 142 ? -3.135  19.371  -2.641  1.00 72.29 ? 143 THR A N     1 
ATOM   1608 C  CA    . THR E 3 142 ? -1.844  19.456  -3.324  1.00 76.03 ? 143 THR A CA    1 
ATOM   1609 C  C     . THR E 3 142 ? -1.778  20.692  -4.226  1.00 77.77 ? 143 THR A C     1 
ATOM   1610 O  O     . THR E 3 142 ? -2.785  21.102  -4.816  1.00 79.09 ? 143 THR A O     1 
ATOM   1611 C  CB    . THR E 3 142 ? -1.600  18.183  -4.182  1.00 78.58 ? 143 THR A CB    1 
ATOM   1612 O  OG1   . THR E 3 142 ? -1.672  17.019  -3.347  1.00 81.26 ? 143 THR A OG1   1 
ATOM   1613 C  CG2   . THR E 3 142 ? -0.232  18.229  -4.855  1.00 81.23 ? 143 THR A CG2   1 
ATOM   1614 N  N     . ARG E 3 143 ? -0.592  21.284  -4.329  1.00 78.72 ? 144 ARG A N     1 
ATOM   1615 C  CA    . ARG E 3 143 ? -0.386  22.468  -5.160  1.00 79.42 ? 144 ARG A CA    1 
ATOM   1616 C  C     . ARG E 3 143 ? 0.659   22.195  -6.245  1.00 78.26 ? 144 ARG A C     1 
ATOM   1617 O  O     . ARG E 3 143 ? 1.205   21.100  -6.326  1.00 79.22 ? 144 ARG A O     1 
ATOM   1618 C  CB    . ARG E 3 143 ? 0.058   23.637  -4.287  1.00 83.34 ? 144 ARG A CB    1 
ATOM   1619 C  CG    . ARG E 3 143 ? -0.873  23.894  -3.116  1.00 88.79 ? 144 ARG A CG    1 
ATOM   1620 C  CD    . ARG E 3 143 ? -0.305  24.925  -2.168  1.00 91.66 ? 144 ARG A CD    1 
ATOM   1621 N  NE    . ARG E 3 143 ? -1.242  25.203  -1.080  1.00 95.94 ? 144 ARG A NE    1 
ATOM   1622 C  CZ    . ARG E 3 143 ? -1.095  26.168  -0.176  1.00 97.61 ? 144 ARG A CZ    1 
ATOM   1623 N  NH1   . ARG E 3 143 ? -0.039  26.966  -0.217  1.00 95.66 ? 144 ARG A NH1   1 
ATOM   1624 N  NH2   . ARG E 3 143 ? -2.011  26.336  0.774   1.00 98.43 ? 144 ARG A NH2   1 
ATOM   1625 N  N     . LYS E 3 144 ? 0.934   23.197  -7.073  1.00 76.50 ? 145 LYS A N     1 
ATOM   1626 C  CA    . LYS E 3 144 ? 1.915   23.071  -8.150  1.00 74.85 ? 145 LYS A CA    1 
ATOM   1627 C  C     . LYS E 3 144 ? 3.349   23.008  -7.609  1.00 72.50 ? 145 LYS A C     1 
ATOM   1628 O  O     . LYS E 3 144 ? 4.232   22.417  -8.236  1.00 71.87 ? 145 LYS A O     1 
ATOM   1629 C  CB    . LYS E 3 144 ? 1.764   24.247  -9.122  1.00 78.80 ? 145 LYS A CB    1 
ATOM   1630 C  CG    . LYS E 3 144 ? 2.706   24.205  -10.317 1.00 88.27 ? 145 LYS A CG    1 
ATOM   1631 C  CD    . LYS E 3 144 ? 2.668   25.509  -11.118 1.00 93.61 ? 145 LYS A CD    1 
ATOM   1632 C  CE    . LYS E 3 144 ? 3.745   25.524  -12.210 1.00 95.71 ? 145 LYS A CE    1 
ATOM   1633 N  NZ    . LYS E 3 144 ? 3.811   26.833  -12.924 1.00 93.91 ? 145 LYS A NZ    1 
ATOM   1634 N  N     . SER E 3 145 ? 3.567   23.612  -6.441  1.00 70.45 ? 146 SER A N     1 
ATOM   1635 C  CA    . SER E 3 145 ? 4.887   23.620  -5.812  1.00 68.50 ? 146 SER A CA    1 
ATOM   1636 C  C     . SER E 3 145 ? 5.343   22.216  -5.413  1.00 66.37 ? 146 SER A C     1 
ATOM   1637 O  O     . SER E 3 145 ? 6.530   21.904  -5.483  1.00 67.11 ? 146 SER A O     1 
ATOM   1638 C  CB    . SER E 3 145 ? 4.895   24.554  -4.587  1.00 70.64 ? 146 SER A CB    1 
ATOM   1639 O  OG    . SER E 3 145 ? 3.804   24.304  -3.712  1.00 66.95 ? 146 SER A OG    1 
ATOM   1640 N  N     . SER E 3 146 ? 4.400   21.370  -5.004  1.00 63.70 ? 147 SER A N     1 
ATOM   1641 C  CA    . SER E 3 146 ? 4.716   20.000  -4.608  1.00 60.82 ? 147 SER A CA    1 
ATOM   1642 C  C     . SER E 3 146 ? 4.993   19.084  -5.806  1.00 57.66 ? 147 SER A C     1 
ATOM   1643 O  O     . SER E 3 146 ? 5.083   17.868  -5.651  1.00 58.22 ? 147 SER A O     1 
ATOM   1644 C  CB    . SER E 3 146 ? 3.575   19.425  -3.759  1.00 63.17 ? 147 SER A CB    1 
ATOM   1645 O  OG    . SER E 3 146 ? 2.306   19.798  -4.274  1.00 69.04 ? 147 SER A OG    1 
ATOM   1646 N  N     . LEU E 3 147 ? 5.131   19.673  -6.993  1.00 54.32 ? 148 LEU A N     1 
ATOM   1647 C  CA    . LEU E 3 147 ? 5.385   18.912  -8.212  1.00 48.73 ? 148 LEU A CA    1 
ATOM   1648 C  C     . LEU E 3 147 ? 6.769   19.133  -8.821  1.00 44.28 ? 148 LEU A C     1 
ATOM   1649 O  O     . LEU E 3 147 ? 7.026   18.696  -9.940  1.00 44.55 ? 148 LEU A O     1 
ATOM   1650 C  CB    . LEU E 3 147 ? 4.300   19.221  -9.241  1.00 53.15 ? 148 LEU A CB    1 
ATOM   1651 C  CG    . LEU E 3 147 ? 2.922   18.659  -8.885  1.00 58.72 ? 148 LEU A CG    1 
ATOM   1652 C  CD1   . LEU E 3 147 ? 1.840   19.377  -9.674  1.00 61.62 ? 148 LEU A CD1   1 
ATOM   1653 C  CD2   . LEU E 3 147 ? 2.910   17.162  -9.153  1.00 55.63 ? 148 LEU A CD2   1 
ATOM   1654 N  N     . LYS E 3 148 ? 7.655   19.804  -8.090  1.00 41.05 ? 149 LYS A N     1 
ATOM   1655 C  CA    . LYS E 3 148 ? 9.020   20.052  -8.552  1.00 39.54 ? 149 LYS A CA    1 
ATOM   1656 C  C     . LYS E 3 148 ? 9.982   19.506  -7.498  1.00 38.75 ? 149 LYS A C     1 
ATOM   1657 O  O     . LYS E 3 148 ? 9.561   19.178  -6.390  1.00 37.36 ? 149 LYS A O     1 
ATOM   1658 C  CB    . LYS E 3 148 ? 9.257   21.552  -8.755  1.00 35.99 ? 149 LYS A CB    1 
ATOM   1659 C  CG    . LYS E 3 148 ? 9.042   22.395  -7.510  1.00 44.46 ? 149 LYS A CG    1 
ATOM   1660 C  CD    . LYS E 3 148 ? 9.166   23.894  -7.788  1.00 52.43 ? 149 LYS A CD    1 
ATOM   1661 C  CE    . LYS E 3 148 ? 10.586  24.290  -8.177  1.00 59.33 ? 149 LYS A CE    1 
ATOM   1662 N  NZ    . LYS E 3 148 ? 11.579  24.019  -7.094  1.00 62.43 ? 149 LYS A NZ    1 
ATOM   1663 N  N     . THR E 3 149 ? 11.262  19.393  -7.834  1.00 36.88 ? 150 THR A N     1 
ATOM   1664 C  CA    . THR E 3 149 ? 12.236  18.908  -6.867  1.00 35.60 ? 150 THR A CA    1 
ATOM   1665 C  C     . THR E 3 149 ? 12.864  20.088  -6.123  1.00 35.74 ? 150 THR A C     1 
ATOM   1666 O  O     . THR E 3 149 ? 12.718  21.244  -6.533  1.00 34.48 ? 150 THR A O     1 
ATOM   1667 C  CB    . THR E 3 149 ? 13.332  18.062  -7.534  1.00 34.97 ? 150 THR A CB    1 
ATOM   1668 O  OG1   . THR E 3 149 ? 13.948  18.811  -8.584  1.00 30.53 ? 150 THR A OG1   1 
ATOM   1669 C  CG2   . THR E 3 149 ? 12.733  16.791  -8.112  1.00 38.78 ? 150 THR A CG2   1 
ATOM   1670 N  N     . TYR E 3 150 ? 13.560  19.794  -5.031  1.00 34.25 ? 151 TYR A N     1 
ATOM   1671 C  CA    . TYR E 3 150 ? 14.186  20.825  -4.215  1.00 32.57 ? 151 TYR A CA    1 
ATOM   1672 C  C     . TYR E 3 150 ? 15.598  20.432  -3.801  1.00 34.45 ? 151 TYR A C     1 
ATOM   1673 O  O     . TYR E 3 150 ? 16.042  19.307  -4.054  1.00 35.15 ? 151 TYR A O     1 
ATOM   1674 C  CB    . TYR E 3 150 ? 13.359  21.056  -2.955  1.00 23.58 ? 151 TYR A CB    1 
ATOM   1675 C  CG    . TYR E 3 150 ? 11.982  21.612  -3.194  1.00 27.27 ? 151 TYR A CG    1 
ATOM   1676 C  CD1   . TYR E 3 150 ? 10.912  20.773  -3.514  1.00 22.98 ? 151 TYR A CD1   1 
ATOM   1677 C  CD2   . TYR E 3 150 ? 11.741  22.983  -3.085  1.00 26.31 ? 151 TYR A CD2   1 
ATOM   1678 C  CE1   . TYR E 3 150 ? 9.631   21.290  -3.717  1.00 30.38 ? 151 TYR A CE1   1 
ATOM   1679 C  CE2   . TYR E 3 150 ? 10.465  23.510  -3.286  1.00 24.68 ? 151 TYR A CE2   1 
ATOM   1680 C  CZ    . TYR E 3 150 ? 9.418   22.661  -3.601  1.00 28.61 ? 151 TYR A CZ    1 
ATOM   1681 O  OH    . TYR E 3 150 ? 8.164   23.185  -3.795  1.00 31.65 ? 151 TYR A OH    1 
ATOM   1682 N  N     . ASN E 3 151 ? 16.289  21.371  -3.157  1.00 35.58 ? 152 ASN A N     1 
ATOM   1683 C  CA    . ASN E 3 151 ? 17.649  21.167  -2.664  1.00 33.44 ? 152 ASN A CA    1 
ATOM   1684 C  C     . ASN E 3 151 ? 17.629  21.340  -1.152  1.00 34.13 ? 152 ASN A C     1 
ATOM   1685 O  O     . ASN E 3 151 ? 16.687  21.913  -0.604  1.00 31.74 ? 152 ASN A O     1 
ATOM   1686 C  CB    . ASN E 3 151 ? 18.607  22.186  -3.284  1.00 41.24 ? 152 ASN A CB    1 
ATOM   1687 C  CG    . ASN E 3 151 ? 18.880  21.911  -4.750  1.00 48.90 ? 152 ASN A CG    1 
ATOM   1688 O  OD1   . ASN E 3 151 ? 19.481  20.890  -5.104  1.00 51.88 ? 152 ASN A OD1   1 
ATOM   1689 N  ND2   . ASN E 3 151 ? 18.439  22.817  -5.612  1.00 44.87 ? 152 ASN A ND2   1 
ATOM   1690 N  N     . ILE E 3 152 ? 18.672  20.853  -0.486  1.00 35.44 ? 153 ILE A N     1 
ATOM   1691 C  CA    . ILE E 3 152 ? 18.793  20.927  0.969   1.00 37.86 ? 153 ILE A CA    1 
ATOM   1692 C  C     . ILE E 3 152 ? 18.555  22.336  1.534   1.00 40.83 ? 153 ILE A C     1 
ATOM   1693 O  O     . ILE E 3 152 ? 17.866  22.502  2.548   1.00 40.85 ? 153 ILE A O     1 
ATOM   1694 C  CB    . ILE E 3 152 ? 20.182  20.401  1.424   1.00 42.64 ? 153 ILE A CB    1 
ATOM   1695 C  CG1   . ILE E 3 152 ? 20.385  18.964  0.931   1.00 42.23 ? 153 ILE A CG1   1 
ATOM   1696 C  CG2   . ILE E 3 152 ? 20.285  20.418  2.944   1.00 46.41 ? 153 ILE A CG2   1 
ATOM   1697 C  CD1   . ILE E 3 152 ? 21.795  18.435  1.125   1.00 49.53 ? 153 ILE A CD1   1 
ATOM   1698 N  N     . ASN E 3 153 ? 19.109  23.352  0.878   1.00 42.16 ? 154 ASN A N     1 
ATOM   1699 C  CA    . ASN E 3 153 ? 18.951  24.731  1.339   1.00 41.53 ? 154 ASN A CA    1 
ATOM   1700 C  C     . ASN E 3 153 ? 17.527  25.276  1.183   1.00 40.98 ? 154 ASN A C     1 
ATOM   1701 O  O     . ASN E 3 153 ? 17.278  26.440  1.490   1.00 41.21 ? 154 ASN A O     1 
ATOM   1702 C  CB    . ASN E 3 153 ? 19.950  25.654  0.620   1.00 43.36 ? 154 ASN A CB    1 
ATOM   1703 C  CG    . ASN E 3 153 ? 19.694  25.758  -0.887  1.00 55.86 ? 154 ASN A CG    1 
ATOM   1704 O  OD1   . ASN E 3 153 ? 18.993  24.930  -1.483  1.00 58.89 ? 154 ASN A OD1   1 
ATOM   1705 N  ND2   . ASN E 3 153 ? 20.273  26.778  -1.508  1.00 53.22 ? 154 ASN A ND2   1 
ATOM   1706 N  N     . GLU E 3 154 ? 16.601  24.434  0.712   1.00 41.35 ? 155 GLU A N     1 
ATOM   1707 C  CA    . GLU E 3 154 ? 15.199  24.829  0.506   1.00 38.72 ? 155 GLU A CA    1 
ATOM   1708 C  C     . GLU E 3 154 ? 14.208  24.013  1.339   1.00 36.92 ? 155 GLU A C     1 
ATOM   1709 O  O     . GLU E 3 154 ? 12.996  24.087  1.100   1.00 34.51 ? 155 GLU A O     1 
ATOM   1710 C  CB    . GLU E 3 154 ? 14.798  24.682  -0.967  1.00 36.58 ? 155 GLU A CB    1 
ATOM   1711 C  CG    . GLU E 3 154 ? 15.672  25.404  -1.960  1.00 41.54 ? 155 GLU A CG    1 
ATOM   1712 C  CD    . GLU E 3 154 ? 15.150  25.261  -3.370  1.00 53.07 ? 155 GLU A CD    1 
ATOM   1713 O  OE1   . GLU E 3 154 ? 15.505  24.269  -4.045  1.00 58.86 ? 155 GLU A OE1   1 
ATOM   1714 O  OE2   . GLU E 3 154 ? 14.379  26.143  -3.803  1.00 62.89 ? 155 GLU A OE2   1 
ATOM   1715 N  N     . LEU E 3 155 ? 14.714  23.245  2.307   1.00 37.59 ? 156 LEU A N     1 
ATOM   1716 C  CA    . LEU E 3 155 ? 13.872  22.403  3.163   1.00 35.57 ? 156 LEU A CA    1 
ATOM   1717 C  C     . LEU E 3 155 ? 12.620  23.070  3.701   1.00 36.14 ? 156 LEU A C     1 
ATOM   1718 O  O     . LEU E 3 155 ? 11.539  22.492  3.653   1.00 35.22 ? 156 LEU A O     1 
ATOM   1719 C  CB    . LEU E 3 155 ? 14.672  21.847  4.338   1.00 33.62 ? 156 LEU A CB    1 
ATOM   1720 C  CG    . LEU E 3 155 ? 15.450  20.551  4.096   1.00 41.46 ? 156 LEU A CG    1 
ATOM   1721 C  CD1   . LEU E 3 155 ? 16.046  20.076  5.424   1.00 37.62 ? 156 LEU A CD1   1 
ATOM   1722 C  CD2   . LEU E 3 155 ? 14.525  19.476  3.500   1.00 31.22 ? 156 LEU A CD2   1 
ATOM   1723 N  N     . ASN E 3 156 ? 12.767  24.291  4.205   1.00 39.56 ? 157 ASN A N     1 
ATOM   1724 C  CA    . ASN E 3 156 ? 11.642  25.036  4.773   1.00 39.98 ? 157 ASN A CA    1 
ATOM   1725 C  C     . ASN E 3 156 ? 10.619  25.509  3.750   1.00 38.90 ? 157 ASN A C     1 
ATOM   1726 O  O     . ASN E 3 156 ? 9.512   25.909  4.116   1.00 39.13 ? 157 ASN A O     1 
ATOM   1727 C  CB    . ASN E 3 156 ? 12.149  26.251  5.551   1.00 49.34 ? 157 ASN A CB    1 
ATOM   1728 C  CG    . ASN E 3 156 ? 13.129  25.878  6.636   1.00 58.56 ? 157 ASN A CG    1 
ATOM   1729 O  OD1   . ASN E 3 156 ? 14.333  26.104  6.497   1.00 61.70 ? 157 ASN A OD1   1 
ATOM   1730 N  ND2   . ASN E 3 156 ? 12.625  25.303  7.724   1.00 59.44 ? 157 ASN A ND2   1 
ATOM   1731 N  N     . GLU E 3 157 ? 10.988  25.470  2.476   1.00 37.62 ? 158 GLU A N     1 
ATOM   1732 C  CA    . GLU E 3 157 ? 10.097  25.916  1.410   1.00 38.33 ? 158 GLU A CA    1 
ATOM   1733 C  C     . GLU E 3 157 ? 9.180   24.826  0.863   1.00 33.80 ? 158 GLU A C     1 
ATOM   1734 O  O     . GLU E 3 157 ? 8.148   25.134  0.268   1.00 32.30 ? 158 GLU A O     1 
ATOM   1735 C  CB    . GLU E 3 157 ? 10.915  26.513  0.265   1.00 45.26 ? 158 GLU A CB    1 
ATOM   1736 C  CG    . GLU E 3 157 ? 11.668  27.784  0.625   1.00 54.61 ? 158 GLU A CG    1 
ATOM   1737 C  CD    . GLU E 3 157 ? 12.630  28.205  -0.467  1.00 66.79 ? 158 GLU A CD    1 
ATOM   1738 O  OE1   . GLU E 3 157 ? 12.184  28.388  -1.622  1.00 73.21 ? 158 GLU A OE1   1 
ATOM   1739 O  OE2   . GLU E 3 157 ? 13.836  28.349  -0.172  1.00 76.36 ? 158 GLU A OE2   1 
ATOM   1740 N  N     . ILE E 3 158 ? 9.559   23.563  1.057   1.00 32.33 ? 159 ILE A N     1 
ATOM   1741 C  CA    . ILE E 3 158 ? 8.769   22.427  0.572   1.00 29.84 ? 159 ILE A CA    1 
ATOM   1742 C  C     . ILE E 3 158 ? 7.426   22.351  1.299   1.00 31.91 ? 159 ILE A C     1 
ATOM   1743 O  O     . ILE E 3 158 ? 7.378   22.271  2.534   1.00 34.18 ? 159 ILE A O     1 
ATOM   1744 C  CB    . ILE E 3 158 ? 9.514   21.087  0.773   1.00 22.56 ? 159 ILE A CB    1 
ATOM   1745 C  CG1   . ILE E 3 158 ? 10.913  21.171  0.174   1.00 21.33 ? 159 ILE A CG1   1 
ATOM   1746 C  CG2   . ILE E 3 158 ? 8.747   19.956  0.108   1.00 24.55 ? 159 ILE A CG2   1 
ATOM   1747 C  CD1   . ILE E 3 158 ? 11.746  19.940  0.415   1.00 24.20 ? 159 ILE A CD1   1 
ATOM   1748 N  N     . PRO E 3 159 ? 6.317   22.378  0.540   1.00 31.50 ? 160 PRO A N     1 
ATOM   1749 C  CA    . PRO E 3 159 ? 4.978   22.314  1.134   1.00 30.89 ? 160 PRO A CA    1 
ATOM   1750 C  C     . PRO E 3 159 ? 4.652   20.920  1.669   1.00 31.50 ? 160 PRO A C     1 
ATOM   1751 O  O     . PRO E 3 159 ? 4.913   19.910  1.007   1.00 31.47 ? 160 PRO A O     1 
ATOM   1752 C  CB    . PRO E 3 159 ? 4.074   22.720  -0.027  1.00 31.68 ? 160 PRO A CB    1 
ATOM   1753 C  CG    . PRO E 3 159 ? 4.788   22.136  -1.206  1.00 36.19 ? 160 PRO A CG    1 
ATOM   1754 C  CD    . PRO E 3 159 ? 6.240   22.477  -0.930  1.00 33.77 ? 160 PRO A CD    1 
ATOM   1755 N  N     . LYS E 3 160 ? 4.087   20.875  2.873   1.00 33.69 ? 161 LYS A N     1 
ATOM   1756 C  CA    . LYS E 3 160 ? 3.708   19.622  3.523   1.00 34.23 ? 161 LYS A CA    1 
ATOM   1757 C  C     . LYS E 3 160 ? 2.291   19.222  3.105   1.00 34.75 ? 161 LYS A C     1 
ATOM   1758 O  O     . LYS E 3 160 ? 1.399   20.066  3.015   1.00 33.29 ? 161 LYS A O     1 
ATOM   1759 C  CB    . LYS E 3 160 ? 3.824   19.772  5.044   1.00 36.82 ? 161 LYS A CB    1 
ATOM   1760 C  CG    . LYS E 3 160 ? 5.258   20.027  5.490   1.00 39.85 ? 161 LYS A CG    1 
ATOM   1761 C  CD    . LYS E 3 160 ? 5.335   20.711  6.831   1.00 47.95 ? 161 LYS A CD    1 
ATOM   1762 C  CE    . LYS E 3 160 ? 6.748   21.195  7.086   1.00 54.45 ? 161 LYS A CE    1 
ATOM   1763 N  NZ    . LYS E 3 160 ? 6.875   21.807  8.431   1.00 63.40 ? 161 LYS A NZ    1 
ATOM   1764 N  N     . PRO E 3 161 ? 2.074   17.922  2.839   1.00 39.83 ? 162 PRO A N     1 
ATOM   1765 C  CA    . PRO E 3 161 ? 0.792   17.342  2.418   1.00 42.02 ? 162 PRO A CA    1 
ATOM   1766 C  C     . PRO E 3 161 ? -0.218  17.047  3.535   1.00 41.41 ? 162 PRO A C     1 
ATOM   1767 O  O     . PRO E 3 161 ? -1.273  16.464  3.280   1.00 45.78 ? 162 PRO A O     1 
ATOM   1768 C  CB    . PRO E 3 161 ? 1.231   16.065  1.723   1.00 44.61 ? 162 PRO A CB    1 
ATOM   1769 C  CG    . PRO E 3 161 ? 2.332   15.594  2.636   1.00 44.11 ? 162 PRO A CG    1 
ATOM   1770 C  CD    . PRO E 3 161 ? 3.114   16.873  2.921   1.00 43.85 ? 162 PRO A CD    1 
ATOM   1771 N  N     . TYR E 3 162 ? 0.103   17.439  4.762   1.00 36.89 ? 163 TYR A N     1 
ATOM   1772 C  CA    . TYR E 3 162 ? -0.785  17.205  5.894   1.00 35.34 ? 163 TYR A CA    1 
ATOM   1773 C  C     . TYR E 3 162 ? -0.900  18.490  6.697   1.00 36.21 ? 163 TYR A C     1 
ATOM   1774 O  O     . TYR E 3 162 ? 0.050   19.270  6.767   1.00 35.88 ? 163 TYR A O     1 
ATOM   1775 C  CB    . TYR E 3 162 ? -0.260  16.061  6.774   1.00 35.82 ? 163 TYR A CB    1 
ATOM   1776 C  CG    . TYR E 3 162 ? 1.181   16.220  7.211   1.00 32.36 ? 163 TYR A CG    1 
ATOM   1777 C  CD1   . TYR E 3 162 ? 1.507   16.902  8.386   1.00 27.03 ? 163 TYR A CD1   1 
ATOM   1778 C  CD2   . TYR E 3 162 ? 2.220   15.704  6.438   1.00 35.32 ? 163 TYR A CD2   1 
ATOM   1779 C  CE1   . TYR E 3 162 ? 2.828   17.067  8.774   1.00 28.89 ? 163 TYR A CE1   1 
ATOM   1780 C  CE2   . TYR E 3 162 ? 3.546   15.864  6.817   1.00 38.62 ? 163 TYR A CE2   1 
ATOM   1781 C  CZ    . TYR E 3 162 ? 3.844   16.547  7.985   1.00 39.37 ? 163 TYR A CZ    1 
ATOM   1782 O  OH    . TYR E 3 162 ? 5.154   16.721  8.363   1.00 42.22 ? 163 TYR A OH    1 
ATOM   1783 N  N     . LYS E 3 163 ? -2.063  18.706  7.296   1.00 37.70 ? 164 LYS A N     1 
ATOM   1784 C  CA    . LYS E 3 163 ? -2.315  19.907  8.079   1.00 40.58 ? 164 LYS A CA    1 
ATOM   1785 C  C     . LYS E 3 163 ? -1.896  19.703  9.526   1.00 40.90 ? 164 LYS A C     1 
ATOM   1786 O  O     . LYS E 3 163 ? -1.283  20.578  10.132  1.00 43.37 ? 164 LYS A O     1 
ATOM   1787 C  CB    . LYS E 3 163 ? -3.801  20.263  8.005   1.00 38.88 ? 164 LYS A CB    1 
ATOM   1788 C  CG    . LYS E 3 163 ? -4.150  21.648  8.499   1.00 50.25 ? 164 LYS A CG    1 
ATOM   1789 C  CD    . LYS E 3 163 ? -5.630  21.931  8.264   1.00 60.14 ? 164 LYS A CD    1 
ATOM   1790 C  CE    . LYS E 3 163 ? -6.047  23.283  8.828   1.00 68.93 ? 164 LYS A CE    1 
ATOM   1791 N  NZ    . LYS E 3 163 ? -7.529  23.460  8.764   1.00 70.78 ? 164 LYS A NZ    1 
ATOM   1792 N  N     . GLY E 3 164 ? -2.232  18.542  10.073  1.00 38.66 ? 165 GLY A N     1 
ATOM   1793 C  CA    . GLY E 3 164 ? -1.894  18.239  11.449  1.00 37.77 ? 165 GLY A CA    1 
ATOM   1794 C  C     . GLY E 3 164 ? -1.838  16.736  11.571  1.00 37.72 ? 165 GLY A C     1 
ATOM   1795 O  O     . GLY E 3 164 ? -2.494  16.033  10.793  1.00 39.96 ? 165 GLY A O     1 
ATOM   1796 N  N     . VAL E 3 165 ? -1.057  16.240  12.524  1.00 28.79 ? 166 VAL A N     1 
ATOM   1797 C  CA    . VAL E 3 165 ? -0.921  14.806  12.725  1.00 25.30 ? 166 VAL A CA    1 
ATOM   1798 C  C     . VAL E 3 165 ? -1.091  14.478  14.204  1.00 24.99 ? 166 VAL A C     1 
ATOM   1799 O  O     . VAL E 3 165 ? -0.464  15.107  15.060  1.00 25.61 ? 166 VAL A O     1 
ATOM   1800 C  CB    . VAL E 3 165 ? 0.471   14.289  12.250  1.00 19.47 ? 166 VAL A CB    1 
ATOM   1801 C  CG1   . VAL E 3 165 ? 0.600   12.805  12.510  1.00 22.15 ? 166 VAL A CG1   1 
ATOM   1802 C  CG2   . VAL E 3 165 ? 0.655   14.544  10.767  1.00 25.51 ? 166 VAL A CG2   1 
ATOM   1803 N  N     . LYS E 3 166 ? -1.949  13.505  14.500  1.00 22.35 ? 167 LYS A N     1 
ATOM   1804 C  CA    . LYS E 3 166 ? -2.175  13.057  15.870  1.00 20.13 ? 167 LYS A CA    1 
ATOM   1805 C  C     . LYS E 3 166 ? -1.771  11.586  15.934  1.00 21.76 ? 167 LYS A C     1 
ATOM   1806 O  O     . LYS E 3 166 ? -1.975  10.834  14.968  1.00 21.27 ? 167 LYS A O     1 
ATOM   1807 C  CB    . LYS E 3 166 ? -3.641  13.226  16.263  1.00 19.43 ? 167 LYS A CB    1 
ATOM   1808 C  CG    . LYS E 3 166 ? -4.077  14.670  16.356  1.00 21.10 ? 167 LYS A CG    1 
ATOM   1809 C  CD    . LYS E 3 166 ? -5.553  14.748  16.593  1.00 32.69 ? 167 LYS A CD    1 
ATOM   1810 C  CE    . LYS E 3 166 ? -6.020  16.182  16.589  1.00 42.12 ? 167 LYS A CE    1 
ATOM   1811 N  NZ    . LYS E 3 166 ? -7.509  16.256  16.626  1.00 50.94 ? 167 LYS A NZ    1 
ATOM   1812 N  N     . VAL E 3 167 ? -1.193  11.182  17.059  1.00 19.03 ? 168 VAL A N     1 
ATOM   1813 C  CA    . VAL E 3 167 ? -0.758  9.806   17.241  1.00 21.57 ? 168 VAL A CA    1 
ATOM   1814 C  C     . VAL E 3 167 ? -1.268  9.235   18.573  1.00 22.51 ? 168 VAL A C     1 
ATOM   1815 O  O     . VAL E 3 167 ? -1.469  9.973   19.537  1.00 21.41 ? 168 VAL A O     1 
ATOM   1816 C  CB    . VAL E 3 167 ? 0.802   9.712   17.181  1.00 25.16 ? 168 VAL A CB    1 
ATOM   1817 C  CG1   . VAL E 3 167 ? 1.439   10.532  18.307  1.00 23.82 ? 168 VAL A CG1   1 
ATOM   1818 C  CG2   . VAL E 3 167 ? 1.257   8.252   17.241  1.00 24.51 ? 168 VAL A CG2   1 
ATOM   1819 N  N     . PHE E 3 168 ? -1.501  7.927   18.617  1.00 21.77 ? 169 PHE A N     1 
ATOM   1820 C  CA    . PHE E 3 168 ? -1.926  7.266   19.851  1.00 20.20 ? 169 PHE A CA    1 
ATOM   1821 C  C     . PHE E 3 168 ? -1.390  5.836   19.869  1.00 19.53 ? 169 PHE A C     1 
ATOM   1822 O  O     . PHE E 3 168 ? -1.059  5.278   18.816  1.00 19.17 ? 169 PHE A O     1 
ATOM   1823 C  CB    . PHE E 3 168 ? -3.464  7.271   20.009  1.00 20.55 ? 169 PHE A CB    1 
ATOM   1824 C  CG    . PHE E 3 168 ? -4.193  6.349   19.062  1.00 16.04 ? 169 PHE A CG    1 
ATOM   1825 C  CD1   . PHE E 3 168 ? -4.167  4.967   19.246  1.00 16.67 ? 169 PHE A CD1   1 
ATOM   1826 C  CD2   . PHE E 3 168 ? -4.912  6.864   17.990  1.00 15.26 ? 169 PHE A CD2   1 
ATOM   1827 C  CE1   . PHE E 3 168 ? -4.842  4.106   18.381  1.00 15.34 ? 169 PHE A CE1   1 
ATOM   1828 C  CE2   . PHE E 3 168 ? -5.596  6.008   17.113  1.00 16.68 ? 169 PHE A CE2   1 
ATOM   1829 C  CZ    . PHE E 3 168 ? -5.557  4.624   17.314  1.00 13.50 ? 169 PHE A CZ    1 
ATOM   1830 N  N     . LEU E 3 169 ? -1.288  5.258   21.062  1.00 15.24 ? 170 LEU A N     1 
ATOM   1831 C  CA    . LEU E 3 169 ? -0.858  3.873   21.222  1.00 14.28 ? 170 LEU A CA    1 
ATOM   1832 C  C     . LEU E 3 169 ? -1.965  3.267   22.091  1.00 16.16 ? 170 LEU A C     1 
ATOM   1833 O  O     . LEU E 3 169 ? -2.342  3.824   23.120  1.00 15.95 ? 170 LEU A O     1 
ATOM   1834 C  CB    . LEU E 3 169 ? 0.518   3.774   21.890  1.00 13.65 ? 170 LEU A CB    1 
ATOM   1835 C  CG    . LEU E 3 169 ? 1.140   2.376   22.002  1.00 14.41 ? 170 LEU A CG    1 
ATOM   1836 C  CD1   . LEU E 3 169 ? 2.628   2.495   22.173  1.00 12.55 ? 170 LEU A CD1   1 
ATOM   1837 C  CD2   . LEU E 3 169 ? 0.546   1.611   23.172  1.00 21.52 ? 170 LEU A CD2   1 
ATOM   1838 N  N     . GLN E 3 170 ? -2.496  2.131   21.668  1.00 16.01 ? 171 GLN A N     1 
ATOM   1839 C  CA    . GLN E 3 170 ? -3.573  1.484   22.395  1.00 14.52 ? 171 GLN A CA    1 
ATOM   1840 C  C     . GLN E 3 170 ? -3.594  -0.009  22.039  1.00 16.97 ? 171 GLN A C     1 
ATOM   1841 O  O     . GLN E 3 170 ? -3.045  -0.424  21.015  1.00 18.35 ? 171 GLN A O     1 
ATOM   1842 C  CB    . GLN E 3 170 ? -4.898  2.172   22.025  1.00 11.14 ? 171 GLN A CB    1 
ATOM   1843 C  CG    . GLN E 3 170 ? -6.122  1.748   22.825  1.00 16.15 ? 171 GLN A CG    1 
ATOM   1844 C  CD    . GLN E 3 170 ? -5.931  1.919   24.328  1.00 14.69 ? 171 GLN A CD    1 
ATOM   1845 O  OE1   . GLN E 3 170 ? -5.435  1.016   25.011  1.00 10.99 ? 171 GLN A OE1   1 
ATOM   1846 N  NE2   . GLN E 3 170 ? -6.319  3.070   24.843  1.00 14.55 ? 171 GLN A NE2   1 
ATOM   1847 N  N     . ASP E 3 171 ? -4.211  -0.818  22.890  1.00 16.10 ? 172 ASP A N     1 
ATOM   1848 C  CA    . ASP E 3 171 ? -4.311  -2.249  22.635  1.00 15.57 ? 172 ASP A CA    1 
ATOM   1849 C  C     . ASP E 3 171 ? -5.286  -2.450  21.485  1.00 15.91 ? 172 ASP A C     1 
ATOM   1850 O  O     . ASP E 3 171 ? -6.306  -1.751  21.389  1.00 11.54 ? 172 ASP A O     1 
ATOM   1851 C  CB    . ASP E 3 171 ? -4.821  -2.986  23.875  1.00 14.91 ? 172 ASP A CB    1 
ATOM   1852 C  CG    . ASP E 3 171 ? -3.807  -2.993  24.999  1.00 17.69 ? 172 ASP A CG    1 
ATOM   1853 O  OD1   . ASP E 3 171 ? -2.947  -3.896  25.024  1.00 22.38 ? 172 ASP A OD1   1 
ATOM   1854 O  OD2   . ASP E 3 171 ? -3.867  -2.091  25.854  1.00 21.15 ? 172 ASP A OD2   1 
ATOM   1855 N  N     . LYS E 3 172 ? -4.962  -3.403  20.617  1.00 16.80 ? 173 LYS A N     1 
ATOM   1856 C  CA    . LYS E 3 172 ? -5.811  -3.707  19.477  1.00 16.74 ? 173 LYS A CA    1 
ATOM   1857 C  C     . LYS E 3 172 ? -7.222  -4.106  19.920  1.00 12.91 ? 173 LYS A C     1 
ATOM   1858 O  O     . LYS E 3 172 ? -8.211  -3.594  19.396  1.00 14.54 ? 173 LYS A O     1 
ATOM   1859 C  CB    . LYS E 3 172 ? -5.204  -4.834  18.621  1.00 16.56 ? 173 LYS A CB    1 
ATOM   1860 C  CG    . LYS E 3 172 ? -6.055  -5.124  17.390  1.00 26.00 ? 173 LYS A CG    1 
ATOM   1861 C  CD    . LYS E 3 172 ? -5.688  -6.403  16.674  1.00 30.52 ? 173 LYS A CD    1 
ATOM   1862 C  CE    . LYS E 3 172 ? -4.485  -6.235  15.807  1.00 34.59 ? 173 LYS A CE    1 
ATOM   1863 N  NZ    . LYS E 3 172 ? -4.433  -7.345  14.830  1.00 26.32 ? 173 LYS A NZ    1 
ATOM   1864 N  N     . TRP E 3 173 ? -7.325  -5.008  20.894  1.00 13.71 ? 174 TRP A N     1 
ATOM   1865 C  CA    . TRP E 3 173 ? -8.644  -5.458  21.338  1.00 14.07 ? 174 TRP A CA    1 
ATOM   1866 C  C     . TRP E 3 173 ? -9.511  -4.326  21.880  1.00 13.24 ? 174 TRP A C     1 
ATOM   1867 O  O     . TRP E 3 173 ? -10.728 -4.343  21.715  1.00 12.88 ? 174 TRP A O     1 
ATOM   1868 C  CB    . TRP E 3 173 ? -8.523  -6.609  22.361  1.00 15.90 ? 174 TRP A CB    1 
ATOM   1869 C  CG    . TRP E 3 173 ? -8.197  -6.207  23.770  1.00 18.02 ? 174 TRP A CG    1 
ATOM   1870 C  CD1   . TRP E 3 173 ? -6.961  -6.184  24.360  1.00 14.37 ? 174 TRP A CD1   1 
ATOM   1871 C  CD2   . TRP E 3 173 ? -9.130  -5.794  24.778  1.00 15.70 ? 174 TRP A CD2   1 
ATOM   1872 N  NE1   . TRP E 3 173 ? -7.069  -5.784  25.675  1.00 13.07 ? 174 TRP A NE1   1 
ATOM   1873 C  CE2   . TRP E 3 173 ? -8.387  -5.539  25.958  1.00 20.50 ? 174 TRP A CE2   1 
ATOM   1874 C  CE3   . TRP E 3 173 ? -10.521 -5.616  24.800  1.00 9.54  ? 174 TRP A CE3   1 
ATOM   1875 C  CZ2   . TRP E 3 173 ? -8.991  -5.117  27.150  1.00 14.36 ? 174 TRP A CZ2   1 
ATOM   1876 C  CZ3   . TRP E 3 173 ? -11.125 -5.195  25.987  1.00 18.21 ? 174 TRP A CZ3   1 
ATOM   1877 C  CH2   . TRP E 3 173 ? -10.356 -4.952  27.144  1.00 14.42 ? 174 TRP A CH2   1 
ATOM   1878 N  N     . VAL E 3 174 ? -8.879  -3.338  22.512  1.00 16.04 ? 175 VAL A N     1 
ATOM   1879 C  CA    . VAL E 3 174 ? -9.597  -2.200  23.095  1.00 14.83 ? 175 VAL A CA    1 
ATOM   1880 C  C     . VAL E 3 174 ? -10.267 -1.307  22.047  1.00 15.86 ? 175 VAL A C     1 
ATOM   1881 O  O     . VAL E 3 174 ? -11.377 -0.817  22.266  1.00 15.15 ? 175 VAL A O     1 
ATOM   1882 C  CB    . VAL E 3 174 ? -8.641  -1.349  23.988  1.00 20.31 ? 175 VAL A CB    1 
ATOM   1883 C  CG1   . VAL E 3 174 ? -9.328  -0.074  24.470  1.00 16.19 ? 175 VAL A CG1   1 
ATOM   1884 C  CG2   . VAL E 3 174 ? -8.196  -2.167  25.175  1.00 13.69 ? 175 VAL A CG2   1 
ATOM   1885 N  N     . ILE E 3 175 ? -9.600  -1.101  20.911  1.00 16.43 ? 176 ILE A N     1 
ATOM   1886 C  CA    . ILE E 3 175 ? -10.156 -0.245  19.857  1.00 19.89 ? 176 ILE A CA    1 
ATOM   1887 C  C     . ILE E 3 175 ? -10.866 -0.991  18.721  1.00 19.53 ? 176 ILE A C     1 
ATOM   1888 O  O     . ILE E 3 175 ? -11.393 -0.359  17.803  1.00 19.53 ? 176 ILE A O     1 
ATOM   1889 C  CB    . ILE E 3 175 ? -9.077  0.698   19.249  1.00 20.28 ? 176 ILE A CB    1 
ATOM   1890 C  CG1   . ILE E 3 175 ? -7.946  -0.111  18.600  1.00 19.60 ? 176 ILE A CG1   1 
ATOM   1891 C  CG2   . ILE E 3 175 ? -8.510  1.606   20.337  1.00 21.11 ? 176 ILE A CG2   1 
ATOM   1892 C  CD1   . ILE E 3 175 ? -7.002  0.731   17.761  1.00 16.05 ? 176 ILE A CD1   1 
ATOM   1893 N  N     . ALA E 3 176 ? -10.873 -2.321  18.790  1.00 20.71 ? 177 ALA A N     1 
ATOM   1894 C  CA    . ALA E 3 176 ? -11.529 -3.166  17.795  1.00 19.33 ? 177 ALA A CA    1 
ATOM   1895 C  C     . ALA E 3 176 ? -13.033 -2.935  17.837  1.00 18.90 ? 177 ALA A C     1 
ATOM   1896 O  O     . ALA E 3 176 ? -13.610 -2.755  18.914  1.00 18.95 ? 177 ALA A O     1 
ATOM   1897 C  CB    . ALA E 3 176 ? -11.225 -4.628  18.068  1.00 16.35 ? 177 ALA A CB    1 
ATOM   1898 N  N     . GLY E 3 177 ? -13.659 -2.935  16.661  1.00 13.72 ? 178 GLY A N     1 
ATOM   1899 C  CA    . GLY E 3 177 ? -15.097 -2.733  16.569  1.00 10.98 ? 178 GLY A CA    1 
ATOM   1900 C  C     . GLY E 3 177 ? -15.791 -4.053  16.279  1.00 10.28 ? 178 GLY A C     1 
ATOM   1901 O  O     . GLY E 3 177 ? -15.177 -5.119  16.365  1.00 9.53  ? 178 GLY A O     1 
ATOM   1902 N  N     . ASP E 3 178 ? -17.068 -3.991  15.924  1.00 11.70 ? 179 ASP A N     1 
ATOM   1903 C  CA    . ASP E 3 178 ? -17.839 -5.201  15.636  1.00 15.83 ? 179 ASP A CA    1 
ATOM   1904 C  C     . ASP E 3 178 ? -18.283 -5.353  14.171  1.00 18.78 ? 179 ASP A C     1 
ATOM   1905 O  O     . ASP E 3 178 ? -19.050 -6.261  13.846  1.00 17.31 ? 179 ASP A O     1 
ATOM   1906 C  CB    . ASP E 3 178 ? -19.066 -5.298  16.570  1.00 9.43  ? 179 ASP A CB    1 
ATOM   1907 C  CG    . ASP E 3 178 ? -20.009 -4.095  16.456  1.00 20.81 ? 179 ASP A CG    1 
ATOM   1908 O  OD1   . ASP E 3 178 ? -19.676 -3.103  15.774  1.00 23.72 ? 179 ASP A OD1   1 
ATOM   1909 O  OD2   . ASP E 3 178 ? -21.101 -4.145  17.059  1.00 13.69 ? 179 ASP A OD2   1 
ATOM   1910 N  N     . LEU E 3 179 ? -17.810 -4.467  13.298  1.00 20.39 ? 180 LEU A N     1 
ATOM   1911 C  CA    . LEU E 3 179 ? -18.143 -4.529  11.868  1.00 18.94 ? 180 LEU A CA    1 
ATOM   1912 C  C     . LEU E 3 179 ? -16.815 -4.629  11.121  1.00 19.00 ? 180 LEU A C     1 
ATOM   1913 O  O     . LEU E 3 179 ? -15.815 -4.051  11.551  1.00 18.79 ? 180 LEU A O     1 
ATOM   1914 C  CB    . LEU E 3 179 ? -18.901 -3.271  11.423  1.00 18.14 ? 180 LEU A CB    1 
ATOM   1915 C  CG    . LEU E 3 179 ? -20.117 -2.802  12.242  1.00 28.47 ? 180 LEU A CG    1 
ATOM   1916 C  CD1   . LEU E 3 179 ? -20.680 -1.551  11.606  1.00 24.68 ? 180 LEU A CD1   1 
ATOM   1917 C  CD2   . LEU E 3 179 ? -21.193 -3.874  12.328  1.00 20.30 ? 180 LEU A CD2   1 
ATOM   1918 N  N     . ALA E 3 180 ? -16.785 -5.364  10.016  1.00 19.32 ? 181 ALA A N     1 
ATOM   1919 C  CA    . ALA E 3 180 ? -15.548 -5.505  9.251   1.00 20.16 ? 181 ALA A CA    1 
ATOM   1920 C  C     . ALA E 3 180 ? -15.086 -4.153  8.703   1.00 18.15 ? 181 ALA A C     1 
ATOM   1921 O  O     . ALA E 3 180 ? -15.900 -3.283  8.427   1.00 21.30 ? 181 ALA A O     1 
ATOM   1922 C  CB    . ALA E 3 180 ? -15.746 -6.495  8.111   1.00 23.61 ? 181 ALA A CB    1 
ATOM   1923 N  N     . GLY E 3 181 ? -13.779 -3.983  8.562   1.00 18.65 ? 182 GLY A N     1 
ATOM   1924 C  CA    . GLY E 3 181 ? -13.230 -2.753  8.020   1.00 18.27 ? 182 GLY A CA    1 
ATOM   1925 C  C     . GLY E 3 181 ? -13.051 -2.843  6.508   1.00 20.74 ? 182 GLY A C     1 
ATOM   1926 O  O     . GLY E 3 181 ? -12.849 -1.824  5.841   1.00 20.17 ? 182 GLY A O     1 
ATOM   1927 N  N     . SER E 3 182 ? -13.110 -4.059  5.964   1.00 19.73 ? 183 SER A N     1 
ATOM   1928 C  CA    . SER E 3 182 ? -12.994 -4.275  4.517   1.00 21.08 ? 183 SER A CA    1 
ATOM   1929 C  C     . SER E 3 182 ? -13.712 -5.563  4.139   1.00 22.53 ? 183 SER A C     1 
ATOM   1930 O  O     . SER E 3 182 ? -13.868 -6.467  4.974   1.00 21.42 ? 183 SER A O     1 
ATOM   1931 C  CB    . SER E 3 182 ? -11.525 -4.313  4.045   1.00 11.12 ? 183 SER A CB    1 
ATOM   1932 O  OG    . SER E 3 182 ? -10.808 -5.435  4.535   1.00 17.79 ? 183 SER A OG    1 
ATOM   1933 N  N     . GLY E 3 183 ? -14.157 -5.637  2.887   1.00 20.46 ? 184 GLY A N     1 
ATOM   1934 C  CA    . GLY E 3 183 ? -14.868 -6.811  2.419   1.00 17.90 ? 184 GLY A CA    1 
ATOM   1935 C  C     . GLY E 3 183 ? -13.963 -7.900  1.868   1.00 20.81 ? 184 GLY A C     1 
ATOM   1936 O  O     . GLY E 3 183 ? -13.643 -8.861  2.573   1.00 21.67 ? 184 GLY A O     1 
ATOM   1937 N  N     . ASN E 3 184 ? -13.538 -7.756  0.614   1.00 19.56 ? 185 ASN A N     1 
ATOM   1938 C  CA    . ASN E 3 184 ? -12.702 -8.767  -0.025  1.00 19.07 ? 185 ASN A CA    1 
ATOM   1939 C  C     . ASN E 3 184 ? -11.377 -9.091  0.668   1.00 19.44 ? 185 ASN A C     1 
ATOM   1940 O  O     . ASN E 3 184 ? -10.864 -10.203 0.540   1.00 18.77 ? 185 ASN A O     1 
ATOM   1941 C  CB    . ASN E 3 184 ? -12.488 -8.447  -1.522  1.00 22.87 ? 185 ASN A CB    1 
ATOM   1942 C  CG    . ASN E 3 184 ? -11.866 -7.067  -1.781  1.00 25.26 ? 185 ASN A CG    1 
ATOM   1943 O  OD1   . ASN E 3 184 ? -11.446 -6.351  -0.865  1.00 21.17 ? 185 ASN A OD1   1 
ATOM   1944 N  ND2   . ASN E 3 184 ? -11.812 -6.695  -3.054  1.00 15.17 ? 185 ASN A ND2   1 
ATOM   1945 N  N     . THR E 3 185 ? -10.821 -8.133  1.402   1.00 16.98 ? 186 THR A N     1 
ATOM   1946 C  CA    . THR E 3 185 ? -9.572  -8.376  2.114   1.00 17.50 ? 186 THR A CA    1 
ATOM   1947 C  C     . THR E 3 185 ? -9.816  -8.741  3.601   1.00 19.65 ? 186 THR A C     1 
ATOM   1948 O  O     . THR E 3 185 ? -8.881  -8.750  4.410   1.00 20.03 ? 186 THR A O     1 
ATOM   1949 C  CB    . THR E 3 185 ? -8.611  -7.167  1.993   1.00 17.30 ? 186 THR A CB    1 
ATOM   1950 O  OG1   . THR E 3 185 ? -9.321  -5.960  2.292   1.00 18.27 ? 186 THR A OG1   1 
ATOM   1951 C  CG2   . THR E 3 185 ? -8.028  -7.079  0.576   1.00 20.89 ? 186 THR A CG2   1 
ATOM   1952 N  N     . THR E 3 186 ? -11.074 -9.035  3.940   1.00 15.97 ? 187 THR A N     1 
ATOM   1953 C  CA    . THR E 3 186 ? -11.490 -9.451  5.286   1.00 18.45 ? 187 THR A CA    1 
ATOM   1954 C  C     . THR E 3 186 ? -10.711 -8.839  6.481   1.00 18.13 ? 187 THR A C     1 
ATOM   1955 O  O     . THR E 3 186 ? -9.977  -9.547  7.192   1.00 17.87 ? 187 THR A O     1 
ATOM   1956 C  CB    . THR E 3 186 ? -11.447 -11.012 5.389   1.00 9.34  ? 187 THR A CB    1 
ATOM   1957 O  OG1   . THR E 3 186 ? -10.152 -11.481 5.014   1.00 12.89 ? 187 THR A OG1   1 
ATOM   1958 C  CG2   . THR E 3 186 ? -12.473 -11.649 4.471   1.00 13.45 ? 187 THR A CG2   1 
ATOM   1959 N  N     . ASN E 3 187 ? -10.872 -7.537  6.700   1.00 17.77 ? 188 ASN A N     1 
ATOM   1960 C  CA    . ASN E 3 187 ? -10.175 -6.847  7.789   1.00 17.01 ? 188 ASN A CA    1 
ATOM   1961 C  C     . ASN E 3 187 ? -11.098 -6.500  8.952   1.00 16.89 ? 188 ASN A C     1 
ATOM   1962 O  O     . ASN E 3 187 ? -12.292 -6.243  8.762   1.00 15.97 ? 188 ASN A O     1 
ATOM   1963 C  CB    . ASN E 3 187 ? -9.530  -5.543  7.282   1.00 15.34 ? 188 ASN A CB    1 
ATOM   1964 C  CG    . ASN E 3 187 ? -8.027  -5.660  7.071   1.00 18.54 ? 188 ASN A CG    1 
ATOM   1965 O  OD1   . ASN E 3 187 ? -7.261  -4.871  7.618   1.00 20.05 ? 188 ASN A OD1   1 
ATOM   1966 N  ND2   . ASN E 3 187 ? -7.598  -6.633  6.274   1.00 20.39 ? 188 ASN A ND2   1 
ATOM   1967 N  N     . ILE E 3 188 ? -10.532 -6.497  10.158  1.00 19.43 ? 189 ILE A N     1 
ATOM   1968 C  CA    . ILE E 3 188 ? -11.258 -6.129  11.371  1.00 15.59 ? 189 ILE A CA    1 
ATOM   1969 C  C     . ILE E 3 188 ? -11.407 -4.605  11.300  1.00 12.79 ? 189 ILE A C     1 
ATOM   1970 O  O     . ILE E 3 188 ? -10.445 -3.899  10.989  1.00 12.31 ? 189 ILE A O     1 
ATOM   1971 C  CB    . ILE E 3 188 ? -10.425 -6.470  12.649  1.00 20.91 ? 189 ILE A CB    1 
ATOM   1972 C  CG1   . ILE E 3 188 ? -10.290 -7.985  12.803  1.00 21.23 ? 189 ILE A CG1   1 
ATOM   1973 C  CG2   . ILE E 3 188 ? -11.059 -5.829  13.902  1.00 12.91 ? 189 ILE A CG2   1 
ATOM   1974 C  CD1   . ILE E 3 188 ? -9.200  -8.401  13.766  1.00 24.48 ? 189 ILE A CD1   1 
ATOM   1975 N  N     . GLY E 3 189 ? -12.597 -4.096  11.560  1.00 12.29 ? 190 GLY A N     1 
ATOM   1976 C  CA    . GLY E 3 189 ? -12.768 -2.655  11.561  1.00 16.72 ? 190 GLY A CA    1 
ATOM   1977 C  C     . GLY E 3 189 ? -12.637 -2.163  12.999  1.00 19.98 ? 190 GLY A C     1 
ATOM   1978 O  O     . GLY E 3 189 ? -13.021 -2.874  13.934  1.00 17.74 ? 190 GLY A O     1 
ATOM   1979 N  N     . SER E 3 190 ? -12.088 -0.968  13.198  1.00 20.34 ? 191 SER A N     1 
ATOM   1980 C  CA    . SER E 3 190 ? -11.964 -0.420  14.547  1.00 17.68 ? 191 SER A CA    1 
ATOM   1981 C  C     . SER E 3 190 ? -13.291 0.250   14.873  1.00 20.16 ? 191 SER A C     1 
ATOM   1982 O  O     . SER E 3 190 ? -14.188 0.314   14.019  1.00 19.48 ? 191 SER A O     1 
ATOM   1983 C  CB    . SER E 3 190 ? -10.852 0.634   14.608  1.00 13.96 ? 191 SER A CB    1 
ATOM   1984 O  OG    . SER E 3 190 ? -11.278 1.845   14.006  1.00 13.80 ? 191 SER A OG    1 
ATOM   1985 N  N     . ILE E 3 191 ? -13.429 0.741   16.105  1.00 19.39 ? 192 ILE A N     1 
ATOM   1986 C  CA    . ILE E 3 191 ? -14.634 1.470   16.486  1.00 15.51 ? 192 ILE A CA    1 
ATOM   1987 C  C     . ILE E 3 191 ? -14.634 2.737   15.603  1.00 15.59 ? 192 ILE A C     1 
ATOM   1988 O  O     . ILE E 3 191 ? -13.574 3.197   15.152  1.00 15.19 ? 192 ILE A O     1 
ATOM   1989 C  CB    . ILE E 3 191 ? -14.610 1.912   17.996  1.00 18.40 ? 192 ILE A CB    1 
ATOM   1990 C  CG1   . ILE E 3 191 ? -13.298 2.650   18.312  1.00 19.69 ? 192 ILE A CG1   1 
ATOM   1991 C  CG2   . ILE E 3 191 ? -14.808 0.708   18.909  1.00 19.49 ? 192 ILE A CG2   1 
ATOM   1992 C  CD1   . ILE E 3 191 ? -13.238 3.304   19.673  1.00 20.25 ? 192 ILE A CD1   1 
ATOM   1993 N  N     . HIS E 3 192 ? -15.812 3.290   15.357  1.00 13.97 ? 193 HIS A N     1 
ATOM   1994 C  CA    . HIS E 3 192 ? -15.951 4.495   14.555  1.00 16.73 ? 193 HIS A CA    1 
ATOM   1995 C  C     . HIS E 3 192 ? -16.160 5.601   15.579  1.00 19.04 ? 193 HIS A C     1 
ATOM   1996 O  O     . HIS E 3 192 ? -17.271 5.814   16.040  1.00 20.91 ? 193 HIS A O     1 
ATOM   1997 C  CB    . HIS E 3 192 ? -17.173 4.342   13.639  1.00 22.76 ? 193 HIS A CB    1 
ATOM   1998 C  CG    . HIS E 3 192 ? -17.346 5.457   12.653  1.00 32.40 ? 193 HIS A CG    1 
ATOM   1999 N  ND1   . HIS E 3 192 ? -16.295 6.001   11.946  1.00 38.29 ? 193 HIS A ND1   1 
ATOM   2000 C  CD2   . HIS E 3 192 ? -18.454 6.123   12.249  1.00 33.09 ? 193 HIS A CD2   1 
ATOM   2001 C  CE1   . HIS E 3 192 ? -16.745 6.953   11.149  1.00 29.11 ? 193 HIS A CE1   1 
ATOM   2002 N  NE2   . HIS E 3 192 ? -18.052 7.048   11.313  1.00 35.22 ? 193 HIS A NE2   1 
ATOM   2003 N  N     . ALA E 3 193 ? -15.093 6.307   15.934  1.00 20.82 ? 194 ALA A N     1 
ATOM   2004 C  CA    . ALA E 3 193 ? -15.190 7.345   16.952  1.00 21.12 ? 194 ALA A CA    1 
ATOM   2005 C  C     . ALA E 3 193 ? -14.185 8.490   16.784  1.00 22.25 ? 194 ALA A C     1 
ATOM   2006 O  O     . ALA E 3 193 ? -13.435 8.540   15.815  1.00 20.55 ? 194 ALA A O     1 
ATOM   2007 C  CB    . ALA E 3 193 ? -15.010 6.706   18.314  1.00 18.70 ? 194 ALA A CB    1 
ATOM   2008 N  N     . HIS E 3 194 ? -14.180 9.414   17.740  1.00 23.16 ? 195 HIS A N     1 
ATOM   2009 C  CA    . HIS E 3 194 ? -13.258 10.547  17.715  1.00 23.03 ? 195 HIS A CA    1 
ATOM   2010 C  C     . HIS E 3 194 ? -11.940 10.101  18.312  1.00 22.34 ? 195 HIS A C     1 
ATOM   2011 O  O     . HIS E 3 194 ? -11.900 9.166   19.120  1.00 22.65 ? 195 HIS A O     1 
ATOM   2012 C  CB    . HIS E 3 194 ? -13.796 11.715  18.542  1.00 28.52 ? 195 HIS A CB    1 
ATOM   2013 C  CG    . HIS E 3 194 ? -15.056 12.314  17.999  1.00 35.96 ? 195 HIS A CG    1 
ATOM   2014 N  ND1   . HIS E 3 194 ? -15.057 13.306  17.040  1.00 35.81 ? 195 HIS A ND1   1 
ATOM   2015 C  CD2   . HIS E 3 194 ? -16.356 12.064  18.284  1.00 39.21 ? 195 HIS A CD2   1 
ATOM   2016 C  CE1   . HIS E 3 194 ? -16.305 13.641  16.758  1.00 44.30 ? 195 HIS A CE1   1 
ATOM   2017 N  NE2   . HIS E 3 194 ? -17.111 12.902  17.499  1.00 45.06 ? 195 HIS A NE2   1 
ATOM   2018 N  N     . TYR E 3 195 ? -10.871 10.787  17.926  1.00 19.92 ? 196 TYR A N     1 
ATOM   2019 C  CA    . TYR E 3 195 ? -9.522  10.487  18.390  1.00 18.46 ? 196 TYR A CA    1 
ATOM   2020 C  C     . TYR E 3 195 ? -9.391  10.279  19.913  1.00 18.33 ? 196 TYR A C     1 
ATOM   2021 O  O     . TYR E 3 195 ? -8.693  9.366   20.357  1.00 20.52 ? 196 TYR A O     1 
ATOM   2022 C  CB    . TYR E 3 195 ? -8.576  11.598  17.915  1.00 15.65 ? 196 TYR A CB    1 
ATOM   2023 C  CG    . TYR E 3 195 ? -7.208  11.598  18.567  1.00 17.02 ? 196 TYR A CG    1 
ATOM   2024 C  CD1   . TYR E 3 195 ? -6.202  10.729  18.137  1.00 15.78 ? 196 TYR A CD1   1 
ATOM   2025 C  CD2   . TYR E 3 195 ? -6.917  12.478  19.617  1.00 22.07 ? 196 TYR A CD2   1 
ATOM   2026 C  CE1   . TYR E 3 195 ? -4.932  10.739  18.741  1.00 16.46 ? 196 TYR A CE1   1 
ATOM   2027 C  CE2   . TYR E 3 195 ? -5.652  12.495  20.228  1.00 17.87 ? 196 TYR A CE2   1 
ATOM   2028 C  CZ    . TYR E 3 195 ? -4.670  11.627  19.785  1.00 16.32 ? 196 TYR A CZ    1 
ATOM   2029 O  OH    . TYR E 3 195 ? -3.437  11.653  20.390  1.00 18.93 ? 196 TYR A OH    1 
ATOM   2030 N  N     . LYS E 3 196 ? -10.055 11.107  20.709  1.00 19.37 ? 197 LYS A N     1 
ATOM   2031 C  CA    . LYS E 3 196 ? -9.947  10.985  22.164  1.00 25.16 ? 197 LYS A CA    1 
ATOM   2032 C  C     . LYS E 3 196 ? -10.414 9.623   22.674  1.00 22.14 ? 197 LYS A C     1 
ATOM   2033 O  O     . LYS E 3 196 ? -9.894  9.123   23.667  1.00 23.34 ? 197 LYS A O     1 
ATOM   2034 C  CB    . LYS E 3 196 ? -10.726 12.109  22.861  1.00 32.28 ? 197 LYS A CB    1 
ATOM   2035 C  CG    . LYS E 3 196 ? -12.240 11.972  22.768  1.00 43.67 ? 197 LYS A CG    1 
ATOM   2036 C  CD    . LYS E 3 196 ? -12.950 13.177  23.353  1.00 55.55 ? 197 LYS A CD    1 
ATOM   2037 C  CE    . LYS E 3 196 ? -14.443 12.917  23.511  1.00 63.72 ? 197 LYS A CE    1 
ATOM   2038 N  NZ    . LYS E 3 196 ? -14.726 11.929  24.598  1.00 69.00 ? 197 LYS A NZ    1 
ATOM   2039 N  N     . ASP E 3 197 ? -11.385 9.019   21.991  1.00 22.91 ? 198 ASP A N     1 
ATOM   2040 C  CA    . ASP E 3 197 ? -11.903 7.710   22.395  1.00 21.61 ? 198 ASP A CA    1 
ATOM   2041 C  C     . ASP E 3 197 ? -10.868 6.607   22.180  1.00 20.06 ? 198 ASP A C     1 
ATOM   2042 O  O     . ASP E 3 197 ? -10.858 5.618   22.914  1.00 20.39 ? 198 ASP A O     1 
ATOM   2043 C  CB    . ASP E 3 197 ? -13.205 7.383   21.652  1.00 23.65 ? 198 ASP A CB    1 
ATOM   2044 C  CG    . ASP E 3 197 ? -14.299 8.412   21.909  1.00 33.35 ? 198 ASP A CG    1 
ATOM   2045 O  OD1   . ASP E 3 197 ? -14.449 8.854   23.070  1.00 40.62 ? 198 ASP A OD1   1 
ATOM   2046 O  OD2   . ASP E 3 197 ? -15.010 8.783   20.950  1.00 43.37 ? 198 ASP A OD2   1 
ATOM   2047 N  N     . PHE E 3 198 ? -10.001 6.776   21.181  1.00 15.36 ? 199 PHE A N     1 
ATOM   2048 C  CA    . PHE E 3 198 ? -8.944  5.804   20.920  1.00 13.88 ? 199 PHE A CA    1 
ATOM   2049 C  C     . PHE E 3 198 ? -7.890  5.934   22.036  1.00 16.32 ? 199 PHE A C     1 
ATOM   2050 O  O     . PHE E 3 198 ? -7.419  4.935   22.587  1.00 17.04 ? 199 PHE A O     1 
ATOM   2051 C  CB    . PHE E 3 198 ? -8.304  6.052   19.544  1.00 14.51 ? 199 PHE A CB    1 
ATOM   2052 C  CG    . PHE E 3 198 ? -9.188  5.671   18.385  1.00 15.16 ? 199 PHE A CG    1 
ATOM   2053 C  CD1   . PHE E 3 198 ? -9.196  4.366   17.903  1.00 14.19 ? 199 PHE A CD1   1 
ATOM   2054 C  CD2   . PHE E 3 198 ? -10.033 6.603   17.798  1.00 15.34 ? 199 PHE A CD2   1 
ATOM   2055 C  CE1   . PHE E 3 198 ? -10.033 3.994   16.857  1.00 12.66 ? 199 PHE A CE1   1 
ATOM   2056 C  CE2   . PHE E 3 198 ? -10.878 6.239   16.747  1.00 12.45 ? 199 PHE A CE2   1 
ATOM   2057 C  CZ    . PHE E 3 198 ? -10.878 4.933   16.277  1.00 8.50  ? 199 PHE A CZ    1 
ATOM   2058 N  N     . VAL E 3 199 ? -7.535  7.173   22.368  1.00 17.08 ? 200 VAL A N     1 
ATOM   2059 C  CA    . VAL E 3 199 ? -6.558  7.450   23.422  1.00 18.97 ? 200 VAL A CA    1 
ATOM   2060 C  C     . VAL E 3 199 ? -7.049  6.906   24.768  1.00 16.08 ? 200 VAL A C     1 
ATOM   2061 O  O     . VAL E 3 199 ? -6.328  6.183   25.448  1.00 18.14 ? 200 VAL A O     1 
ATOM   2062 C  CB    . VAL E 3 199 ? -6.290  8.978   23.576  1.00 17.25 ? 200 VAL A CB    1 
ATOM   2063 C  CG1   . VAL E 3 199 ? -5.454  9.236   24.834  1.00 15.44 ? 200 VAL A CG1   1 
ATOM   2064 C  CG2   . VAL E 3 199 ? -5.564  9.513   22.355  1.00 16.64 ? 200 VAL A CG2   1 
ATOM   2065 N  N     . GLU E 3 200 ? -8.279  7.250   25.136  1.00 17.91 ? 201 GLU A N     1 
ATOM   2066 C  CA    . GLU E 3 200 ? -8.866  6.809   26.404  1.00 22.98 ? 201 GLU A CA    1 
ATOM   2067 C  C     . GLU E 3 200 ? -9.228  5.328   26.453  1.00 24.01 ? 201 GLU A C     1 
ATOM   2068 O  O     . GLU E 3 200 ? -9.305  4.740   27.531  1.00 23.28 ? 201 GLU A O     1 
ATOM   2069 C  CB    . GLU E 3 200 ? -10.099 7.648   26.724  1.00 21.28 ? 201 GLU A CB    1 
ATOM   2070 C  CG    . GLU E 3 200 ? -9.768  9.096   27.053  1.00 36.10 ? 201 GLU A CG    1 
ATOM   2071 C  CD    . GLU E 3 200 ? -11.004 9.965   27.196  1.00 40.28 ? 201 GLU A CD    1 
ATOM   2072 O  OE1   . GLU E 3 200 ? -12.016 9.482   27.751  1.00 45.67 ? 201 GLU A OE1   1 
ATOM   2073 O  OE2   . GLU E 3 200 ? -10.958 11.132  26.750  1.00 42.78 ? 201 GLU A OE2   1 
ATOM   2074 N  N     . GLY E 3 201 ? -9.455  4.727   25.290  1.00 24.78 ? 202 GLY A N     1 
ATOM   2075 C  CA    . GLY E 3 201 ? -9.793  3.315   25.243  1.00 22.37 ? 202 GLY A CA    1 
ATOM   2076 C  C     . GLY E 3 201 ? -11.267 2.992   25.419  1.00 22.33 ? 202 GLY A C     1 
ATOM   2077 O  O     . GLY E 3 201 ? -11.610 1.943   25.969  1.00 23.07 ? 202 GLY A O     1 
ATOM   2078 N  N     . LYS E 3 202 ? -12.141 3.880   24.954  1.00 22.98 ? 203 LYS A N     1 
ATOM   2079 C  CA    . LYS E 3 202 ? -13.578 3.665   25.052  1.00 25.62 ? 203 LYS A CA    1 
ATOM   2080 C  C     . LYS E 3 202 ? -14.078 2.816   23.882  1.00 27.94 ? 203 LYS A C     1 
ATOM   2081 O  O     . LYS E 3 202 ? -14.584 3.351   22.892  1.00 29.46 ? 203 LYS A O     1 
ATOM   2082 C  CB    . LYS E 3 202 ? -14.303 5.010   25.096  1.00 23.32 ? 203 LYS A CB    1 
ATOM   2083 C  CG    . LYS E 3 202 ? -14.012 5.775   26.371  1.00 47.26 ? 203 LYS A CG    1 
ATOM   2084 C  CD    . LYS E 3 202 ? -14.907 6.986   26.543  1.00 62.46 ? 203 LYS A CD    1 
ATOM   2085 C  CE    . LYS E 3 202 ? -14.705 7.606   27.922  1.00 68.11 ? 203 LYS A CE    1 
ATOM   2086 N  NZ    . LYS E 3 202 ? -15.573 8.796   28.142  1.00 68.45 ? 203 LYS A NZ    1 
ATOM   2087 N  N     . GLY E 3 203 ? -13.929 1.495   24.006  1.00 28.49 ? 204 GLY A N     1 
ATOM   2088 C  CA    . GLY E 3 203 ? -14.352 0.581   22.954  1.00 28.22 ? 204 GLY A CA    1 
ATOM   2089 C  C     . GLY E 3 203 ? -15.640 -0.153  23.265  1.00 25.05 ? 204 GLY A C     1 
ATOM   2090 O  O     . GLY E 3 203 ? -16.425 0.307   24.091  1.00 26.10 ? 204 GLY A O     1 
ATOM   2091 N  N     . ILE E 3 204 ? -15.863 -1.290  22.606  1.00 23.36 ? 205 ILE A N     1 
ATOM   2092 C  CA    . ILE E 3 204 ? -17.070 -2.080  22.833  1.00 22.32 ? 205 ILE A CA    1 
ATOM   2093 C  C     . ILE E 3 204 ? -16.849 -3.447  23.498  1.00 18.98 ? 205 ILE A C     1 
ATOM   2094 O  O     . ILE E 3 204 ? -17.753 -3.967  24.142  1.00 18.92 ? 205 ILE A O     1 
ATOM   2095 C  CB    . ILE E 3 204 ? -17.887 -2.300  21.533  1.00 25.92 ? 205 ILE A CB    1 
ATOM   2096 C  CG1   . ILE E 3 204 ? -17.036 -2.987  20.471  1.00 25.43 ? 205 ILE A CG1   1 
ATOM   2097 C  CG2   . ILE E 3 204 ? -18.425 -0.980  21.022  1.00 31.83 ? 205 ILE A CG2   1 
ATOM   2098 C  CD1   . ILE E 3 204 ? -17.813 -3.329  19.224  1.00 30.75 ? 205 ILE A CD1   1 
ATOM   2099 N  N     . PHE E 3 205 ? -15.668 -4.033  23.348  1.00 16.79 ? 206 PHE A N     1 
ATOM   2100 C  CA    . PHE E 3 205 ? -15.407 -5.327  23.962  1.00 19.24 ? 206 PHE A CA    1 
ATOM   2101 C  C     . PHE E 3 205 ? -15.038 -5.209  25.446  1.00 21.63 ? 206 PHE A C     1 
ATOM   2102 O  O     . PHE E 3 205 ? -14.317 -4.289  25.847  1.00 20.47 ? 206 PHE A O     1 
ATOM   2103 C  CB    . PHE E 3 205 ? -14.311 -6.076  23.190  1.00 17.03 ? 206 PHE A CB    1 
ATOM   2104 C  CG    . PHE E 3 205 ? -14.728 -6.488  21.806  1.00 21.12 ? 206 PHE A CG    1 
ATOM   2105 C  CD1   . PHE E 3 205 ? -15.740 -7.429  21.623  1.00 26.79 ? 206 PHE A CD1   1 
ATOM   2106 C  CD2   . PHE E 3 205 ? -14.133 -5.918  20.686  1.00 19.40 ? 206 PHE A CD2   1 
ATOM   2107 C  CE1   . PHE E 3 205 ? -16.155 -7.797  20.340  1.00 23.28 ? 206 PHE A CE1   1 
ATOM   2108 C  CE2   . PHE E 3 205 ? -14.541 -6.278  19.401  1.00 18.56 ? 206 PHE A CE2   1 
ATOM   2109 C  CZ    . PHE E 3 205 ? -15.555 -7.220  19.232  1.00 19.96 ? 206 PHE A CZ    1 
ATOM   2110 N  N     . ASP E 3 206 ? -15.543 -6.150  26.248  1.00 22.66 ? 207 ASP A N     1 
ATOM   2111 C  CA    . ASP E 3 206 ? -15.287 -6.196  27.694  1.00 23.88 ? 207 ASP A CA    1 
ATOM   2112 C  C     . ASP E 3 206 ? -13.940 -6.803  28.046  1.00 22.28 ? 207 ASP A C     1 
ATOM   2113 O  O     . ASP E 3 206 ? -13.347 -6.457  29.062  1.00 24.68 ? 207 ASP A O     1 
ATOM   2114 C  CB    . ASP E 3 206 ? -16.388 -6.981  28.418  1.00 27.72 ? 207 ASP A CB    1 
ATOM   2115 C  CG    . ASP E 3 206 ? -17.711 -6.234  28.470  1.00 35.45 ? 207 ASP A CG    1 
ATOM   2116 O  OD1   . ASP E 3 206 ? -17.719 -4.986  28.365  1.00 35.25 ? 207 ASP A OD1   1 
ATOM   2117 O  OD2   . ASP E 3 206 ? -18.755 -6.905  28.618  1.00 47.38 ? 207 ASP A OD2   1 
ATOM   2118 N  N     . SER E 3 207 ? -13.459 -7.708  27.209  1.00 21.34 ? 208 SER A N     1 
ATOM   2119 C  CA    . SER E 3 207 ? -12.175 -8.345  27.445  1.00 20.93 ? 208 SER A CA    1 
ATOM   2120 C  C     . SER E 3 207 ? -11.552 -8.715  26.116  1.00 22.93 ? 208 SER A C     1 
ATOM   2121 O  O     . SER E 3 207 ? -12.212 -8.691  25.070  1.00 22.85 ? 208 SER A O     1 
ATOM   2122 C  CB    . SER E 3 207 ? -12.352 -9.615  28.271  1.00 21.40 ? 208 SER A CB    1 
ATOM   2123 O  OG    . SER E 3 207 ? -13.170 -10.548 27.578  1.00 21.51 ? 208 SER A OG    1 
ATOM   2124 N  N     . GLU E 3 208 ? -10.277 -9.067  26.163  1.00 22.03 ? 209 GLU A N     1 
ATOM   2125 C  CA    . GLU E 3 208 ? -9.564  -9.460  24.974  1.00 25.06 ? 209 GLU A CA    1 
ATOM   2126 C  C     . GLU E 3 208 ? -10.126 -10.788 24.497  1.00 26.14 ? 209 GLU A C     1 
ATOM   2127 O  O     . GLU E 3 208 ? -10.171 -11.073 23.297  1.00 27.51 ? 209 GLU A O     1 
ATOM   2128 C  CB    . GLU E 3 208 ? -8.095  -9.599  25.298  1.00 22.35 ? 209 GLU A CB    1 
ATOM   2129 C  CG    . GLU E 3 208 ? -7.226  -9.885  24.103  1.00 26.77 ? 209 GLU A CG    1 
ATOM   2130 C  CD    . GLU E 3 208 ? -5.770  -9.678  24.432  1.00 32.22 ? 209 GLU A CD    1 
ATOM   2131 O  OE1   . GLU E 3 208 ? -5.413  -9.786  25.627  1.00 36.66 ? 209 GLU A OE1   1 
ATOM   2132 O  OE2   . GLU E 3 208 ? -4.986  -9.405  23.503  1.00 29.67 ? 209 GLU A OE2   1 
ATOM   2133 N  N     . ASP E 3 209 ? -10.561 -11.599 25.452  1.00 22.99 ? 210 ASP A N     1 
ATOM   2134 C  CA    . ASP E 3 209 ? -11.125 -12.901 25.147  1.00 21.48 ? 210 ASP A CA    1 
ATOM   2135 C  C     . ASP E 3 209 ? -12.428 -12.784 24.370  1.00 18.86 ? 210 ASP A C     1 
ATOM   2136 O  O     . ASP E 3 209 ? -12.721 -13.638 23.538  1.00 20.88 ? 210 ASP A O     1 
ATOM   2137 C  CB    . ASP E 3 209 ? -11.338 -13.702 26.435  1.00 25.55 ? 210 ASP A CB    1 
ATOM   2138 C  CG    . ASP E 3 209 ? -10.030 -14.071 27.109  1.00 35.21 ? 210 ASP A CG    1 
ATOM   2139 O  OD1   . ASP E 3 209 ? -9.102  -14.531 26.401  1.00 42.26 ? 210 ASP A OD1   1 
ATOM   2140 O  OD2   . ASP E 3 209 ? -9.926  -13.898 28.343  1.00 49.46 ? 210 ASP A OD2   1 
ATOM   2141 N  N     . GLU E 3 210 ? -13.201 -11.735 24.640  1.00 15.47 ? 211 GLU A N     1 
ATOM   2142 C  CA    . GLU E 3 210 ? -14.466 -11.526 23.951  1.00 15.95 ? 211 GLU A CA    1 
ATOM   2143 C  C     . GLU E 3 210 ? -14.196 -11.047 22.521  1.00 19.04 ? 211 GLU A C     1 
ATOM   2144 O  O     . GLU E 3 210 ? -14.900 -11.428 21.582  1.00 19.32 ? 211 GLU A O     1 
ATOM   2145 C  CB    . GLU E 3 210 ? -15.323 -10.498 24.685  1.00 11.49 ? 211 GLU A CB    1 
ATOM   2146 C  CG    . GLU E 3 210 ? -16.748 -10.442 24.161  1.00 13.44 ? 211 GLU A CG    1 
ATOM   2147 C  CD    . GLU E 3 210 ? -17.589 -9.335  24.775  1.00 20.59 ? 211 GLU A CD    1 
ATOM   2148 O  OE1   . GLU E 3 210 ? -17.081 -8.206  24.935  1.00 20.16 ? 211 GLU A OE1   1 
ATOM   2149 O  OE2   . GLU E 3 210 ? -18.771 -9.594  25.094  1.00 16.22 ? 211 GLU A OE2   1 
ATOM   2150 N  N     . PHE E 3 211 ? -13.175 -10.205 22.377  1.00 16.11 ? 212 PHE A N     1 
ATOM   2151 C  CA    . PHE E 3 211 ? -12.764 -9.674  21.087  1.00 15.13 ? 212 PHE A CA    1 
ATOM   2152 C  C     . PHE E 3 211 ? -12.331 -10.853 20.213  1.00 15.17 ? 212 PHE A C     1 
ATOM   2153 O  O     . PHE E 3 211 ? -12.784 -10.992 19.074  1.00 17.05 ? 212 PHE A O     1 
ATOM   2154 C  CB    . PHE E 3 211 ? -11.616 -8.663  21.291  1.00 14.03 ? 212 PHE A CB    1 
ATOM   2155 C  CG    . PHE E 3 211 ? -10.639 -8.579  20.142  1.00 13.16 ? 212 PHE A CG    1 
ATOM   2156 C  CD1   . PHE E 3 211 ? -10.966 -7.894  18.972  1.00 20.87 ? 212 PHE A CD1   1 
ATOM   2157 C  CD2   . PHE E 3 211 ? -9.387  -9.182  20.235  1.00 15.02 ? 212 PHE A CD2   1 
ATOM   2158 C  CE1   . PHE E 3 211 ? -10.061 -7.812  17.913  1.00 17.19 ? 212 PHE A CE1   1 
ATOM   2159 C  CE2   . PHE E 3 211 ? -8.467  -9.106  19.175  1.00 17.05 ? 212 PHE A CE2   1 
ATOM   2160 C  CZ    . PHE E 3 211 ? -8.808  -8.419  18.014  1.00 16.56 ? 212 PHE A CZ    1 
ATOM   2161 N  N     . LEU E 3 212 ? -11.463 -11.705 20.749  1.00 17.04 ? 213 LEU A N     1 
ATOM   2162 C  CA    . LEU E 3 212 ? -10.993 -12.863 20.001  1.00 18.24 ? 213 LEU A CA    1 
ATOM   2163 C  C     . LEU E 3 212 ? -12.136 -13.785 19.575  1.00 20.78 ? 213 LEU A C     1 
ATOM   2164 O  O     . LEU E 3 212 ? -12.242 -14.153 18.404  1.00 22.74 ? 213 LEU A O     1 
ATOM   2165 C  CB    . LEU E 3 212 ? -9.971  -13.652 20.812  1.00 14.49 ? 213 LEU A CB    1 
ATOM   2166 C  CG    . LEU E 3 212 ? -8.568  -13.067 20.917  1.00 22.99 ? 213 LEU A CG    1 
ATOM   2167 C  CD1   . LEU E 3 212 ? -7.709  -14.028 21.716  1.00 26.33 ? 213 LEU A CD1   1 
ATOM   2168 C  CD2   . LEU E 3 212 ? -7.963  -12.859 19.527  1.00 26.49 ? 213 LEU A CD2   1 
ATOM   2169 N  N     . ASP E 3 213 ? -12.993 -14.151 20.520  1.00 16.71 ? 214 ASP A N     1 
ATOM   2170 C  CA    . ASP E 3 213 ? -14.103 -15.038 20.217  1.00 17.41 ? 214 ASP A CA    1 
ATOM   2171 C  C     . ASP E 3 213 ? -15.042 -14.443 19.170  1.00 16.36 ? 214 ASP A C     1 
ATOM   2172 O  O     . ASP E 3 213 ? -15.501 -15.147 18.266  1.00 15.88 ? 214 ASP A O     1 
ATOM   2173 C  CB    . ASP E 3 213 ? -14.890 -15.379 21.490  1.00 18.52 ? 214 ASP A CB    1 
ATOM   2174 C  CG    . ASP E 3 213 ? -15.904 -16.495 21.270  1.00 18.42 ? 214 ASP A CG    1 
ATOM   2175 O  OD1   . ASP E 3 213 ? -15.499 -17.586 20.809  1.00 20.71 ? 214 ASP A OD1   1 
ATOM   2176 O  OD2   . ASP E 3 213 ? -17.103 -16.283 21.556  1.00 25.21 ? 214 ASP A OD2   1 
ATOM   2177 N  N     . TYR E 3 214 ? -15.325 -13.151 19.292  1.00 15.75 ? 215 TYR A N     1 
ATOM   2178 C  CA    . TYR E 3 214 ? -16.209 -12.476 18.351  1.00 17.55 ? 215 TYR A CA    1 
ATOM   2179 C  C     . TYR E 3 214 ? -15.643 -12.580 16.935  1.00 18.01 ? 215 TYR A C     1 
ATOM   2180 O  O     . TYR E 3 214 ? -16.342 -12.984 16.008  1.00 18.09 ? 215 TYR A O     1 
ATOM   2181 C  CB    . TYR E 3 214 ? -16.381 -10.991 18.724  1.00 15.61 ? 215 TYR A CB    1 
ATOM   2182 C  CG    . TYR E 3 214 ? -17.324 -10.235 17.810  1.00 17.66 ? 215 TYR A CG    1 
ATOM   2183 C  CD1   . TYR E 3 214 ? -16.884 -9.720  16.580  1.00 20.39 ? 215 TYR A CD1   1 
ATOM   2184 C  CD2   . TYR E 3 214 ? -18.665 -10.059 18.155  1.00 18.43 ? 215 TYR A CD2   1 
ATOM   2185 C  CE1   . TYR E 3 214 ? -17.764 -9.053  15.720  1.00 12.01 ? 215 TYR A CE1   1 
ATOM   2186 C  CE2   . TYR E 3 214 ? -19.550 -9.398  17.309  1.00 16.62 ? 215 TYR A CE2   1 
ATOM   2187 C  CZ    . TYR E 3 214 ? -19.092 -8.900  16.092  1.00 17.99 ? 215 TYR A CZ    1 
ATOM   2188 O  OH    . TYR E 3 214 ? -19.976 -8.265  15.259  1.00 11.79 ? 215 TYR A OH    1 
ATOM   2189 N  N     . TRP E 3 215 ? -14.377 -12.220 16.774  1.00 15.81 ? 216 TRP A N     1 
ATOM   2190 C  CA    . TRP E 3 215 ? -13.763 -12.246 15.463  1.00 20.26 ? 216 TRP A CA    1 
ATOM   2191 C  C     . TRP E 3 215 ? -13.394 -13.619 14.903  1.00 23.54 ? 216 TRP A C     1 
ATOM   2192 O  O     . TRP E 3 215 ? -13.257 -13.779 13.690  1.00 22.94 ? 216 TRP A O     1 
ATOM   2193 C  CB    . TRP E 3 215 ? -12.600 -11.254 15.422  1.00 13.84 ? 216 TRP A CB    1 
ATOM   2194 C  CG    . TRP E 3 215 ? -13.138 -9.842  15.357  1.00 20.66 ? 216 TRP A CG    1 
ATOM   2195 C  CD1   . TRP E 3 215 ? -13.150 -8.919  16.363  1.00 16.38 ? 216 TRP A CD1   1 
ATOM   2196 C  CD2   . TRP E 3 215 ? -13.788 -9.216  14.231  1.00 22.43 ? 216 TRP A CD2   1 
ATOM   2197 N  NE1   . TRP E 3 215 ? -13.766 -7.764  15.938  1.00 17.48 ? 216 TRP A NE1   1 
ATOM   2198 C  CE2   . TRP E 3 215 ? -14.167 -7.916  14.638  1.00 17.14 ? 216 TRP A CE2   1 
ATOM   2199 C  CE3   . TRP E 3 215 ? -14.088 -9.631  12.921  1.00 14.92 ? 216 TRP A CE3   1 
ATOM   2200 C  CZ2   . TRP E 3 215 ? -14.832 -7.024  13.785  1.00 16.97 ? 216 TRP A CZ2   1 
ATOM   2201 C  CZ3   . TRP E 3 215 ? -14.749 -8.744  12.073  1.00 15.71 ? 216 TRP A CZ3   1 
ATOM   2202 C  CH2   . TRP E 3 215 ? -15.114 -7.453  12.512  1.00 15.33 ? 216 TRP A CH2   1 
ATOM   2203 N  N     . ARG E 3 216 ? -13.243 -14.610 15.776  1.00 23.57 ? 217 ARG A N     1 
ATOM   2204 C  CA    . ARG E 3 216 ? -12.948 -15.966 15.323  1.00 22.30 ? 217 ARG A CA    1 
ATOM   2205 C  C     . ARG E 3 216 ? -14.201 -16.650 14.765  1.00 22.78 ? 217 ARG A C     1 
ATOM   2206 O  O     . ARG E 3 216 ? -14.098 -17.660 14.080  1.00 23.71 ? 217 ARG A O     1 
ATOM   2207 C  CB    . ARG E 3 216 ? -12.416 -16.813 16.468  1.00 13.08 ? 217 ARG A CB    1 
ATOM   2208 C  CG    . ARG E 3 216 ? -10.955 -16.641 16.716  1.00 20.22 ? 217 ARG A CG    1 
ATOM   2209 C  CD    . ARG E 3 216 ? -10.555 -17.380 17.966  1.00 17.02 ? 217 ARG A CD    1 
ATOM   2210 N  NE    . ARG E 3 216 ? -9.124  -17.271 18.172  1.00 19.28 ? 217 ARG A NE    1 
ATOM   2211 C  CZ    . ARG E 3 216 ? -8.533  -17.274 19.358  1.00 30.12 ? 217 ARG A CZ    1 
ATOM   2212 N  NH1   . ARG E 3 216 ? -9.260  -17.376 20.462  1.00 25.47 ? 217 ARG A NH1   1 
ATOM   2213 N  NH2   . ARG E 3 216 ? -7.212  -17.171 19.436  1.00 28.89 ? 217 ARG A NH2   1 
ATOM   2214 N  N     . ASN E 3 217 ? -15.378 -16.104 15.064  1.00 21.98 ? 218 ASN A N     1 
ATOM   2215 C  CA    . ASN E 3 217 ? -16.639 -16.689 14.604  1.00 20.53 ? 218 ASN A CA    1 
ATOM   2216 C  C     . ASN E 3 217 ? -17.465 -15.773 13.709  1.00 18.85 ? 218 ASN A C     1 
ATOM   2217 O  O     . ASN E 3 217 ? -18.596 -16.095 13.348  1.00 18.86 ? 218 ASN A O     1 
ATOM   2218 C  CB    . ASN E 3 217 ? -17.479 -17.113 15.811  1.00 19.13 ? 218 ASN A CB    1 
ATOM   2219 C  CG    . ASN E 3 217 ? -16.875 -18.285 16.550  1.00 27.23 ? 218 ASN A CG    1 
ATOM   2220 O  OD1   . ASN E 3 217 ? -17.156 -19.439 16.238  1.00 32.98 ? 218 ASN A OD1   1 
ATOM   2221 N  ND2   . ASN E 3 217 ? -16.034 -17.997 17.535  1.00 25.57 ? 218 ASN A ND2   1 
ATOM   2222 N  N     . TYR E 3 218 ? -16.899 -14.625 13.362  1.00 18.76 ? 219 TYR A N     1 
ATOM   2223 C  CA    . TYR E 3 218 ? -17.577 -13.659 12.507  1.00 22.62 ? 219 TYR A CA    1 
ATOM   2224 C  C     . TYR E 3 218 ? -17.594 -14.235 11.076  1.00 20.94 ? 219 TYR A C     1 
ATOM   2225 O  O     . TYR E 3 218 ? -16.562 -14.670 10.582  1.00 21.11 ? 219 TYR A O     1 
ATOM   2226 C  CB    . TYR E 3 218 ? -16.794 -12.344 12.565  1.00 21.84 ? 219 TYR A CB    1 
ATOM   2227 C  CG    . TYR E 3 218 ? -17.392 -11.179 11.807  1.00 19.71 ? 219 TYR A CG    1 
ATOM   2228 C  CD1   . TYR E 3 218 ? -18.335 -10.349 12.402  1.00 17.36 ? 219 TYR A CD1   1 
ATOM   2229 C  CD2   . TYR E 3 218 ? -16.985 -10.888 10.508  1.00 16.65 ? 219 TYR A CD2   1 
ATOM   2230 C  CE1   . TYR E 3 218 ? -18.858 -9.254  11.728  1.00 22.76 ? 219 TYR A CE1   1 
ATOM   2231 C  CE2   . TYR E 3 218 ? -17.499 -9.798  9.825   1.00 16.90 ? 219 TYR A CE2   1 
ATOM   2232 C  CZ    . TYR E 3 218 ? -18.432 -8.984  10.439  1.00 22.24 ? 219 TYR A CZ    1 
ATOM   2233 O  OH    . TYR E 3 218 ? -18.931 -7.895  9.765   1.00 26.15 ? 219 TYR A OH    1 
ATOM   2234 N  N     . GLU E 3 219 ? -18.754 -14.254 10.424  1.00 21.29 ? 220 GLU A N     1 
ATOM   2235 C  CA    . GLU E 3 219 ? -18.846 -14.777 9.055   1.00 23.80 ? 220 GLU A CA    1 
ATOM   2236 C  C     . GLU E 3 219 ? -18.499 -13.708 8.009   1.00 26.22 ? 220 GLU A C     1 
ATOM   2237 O  O     . GLU E 3 219 ? -18.800 -12.528 8.199   1.00 26.72 ? 220 GLU A O     1 
ATOM   2238 C  CB    . GLU E 3 219 ? -20.246 -15.318 8.788   1.00 17.13 ? 220 GLU A CB    1 
ATOM   2239 C  CG    . GLU E 3 219 ? -20.684 -16.424 9.728   1.00 26.29 ? 220 GLU A CG    1 
ATOM   2240 C  CD    . GLU E 3 219 ? -19.915 -17.733 9.549   1.00 33.45 ? 220 GLU A CD    1 
ATOM   2241 O  OE1   . GLU E 3 219 ? -19.168 -17.901 8.558   1.00 38.38 ? 220 GLU A OE1   1 
ATOM   2242 O  OE2   . GLU E 3 219 ? -20.066 -18.612 10.417  1.00 34.68 ? 220 GLU A OE2   1 
ATOM   2243 N  N     . ARG E 3 220 ? -17.887 -14.127 6.902   1.00 27.54 ? 221 ARG A N     1 
ATOM   2244 C  CA    . ARG E 3 220 ? -17.462 -13.211 5.835   1.00 27.91 ? 221 ARG A CA    1 
ATOM   2245 C  C     . ARG E 3 220 ? -18.510 -12.373 5.087   1.00 27.93 ? 221 ARG A C     1 
ATOM   2246 O  O     . ARG E 3 220 ? -18.183 -11.291 4.588   1.00 27.31 ? 221 ARG A O     1 
ATOM   2247 C  CB    . ARG E 3 220 ? -16.616 -13.963 4.816   1.00 27.06 ? 221 ARG A CB    1 
ATOM   2248 C  CG    . ARG E 3 220 ? -15.366 -14.558 5.401   1.00 33.97 ? 221 ARG A CG    1 
ATOM   2249 C  CD    . ARG E 3 220 ? -14.625 -15.385 4.373   1.00 43.43 ? 221 ARG A CD    1 
ATOM   2250 N  NE    . ARG E 3 220 ? -13.503 -16.097 4.982   1.00 57.96 ? 221 ARG A NE    1 
ATOM   2251 C  CZ    . ARG E 3 220 ? -12.376 -16.411 4.346   1.00 67.55 ? 221 ARG A CZ    1 
ATOM   2252 N  NH1   . ARG E 3 220 ? -12.210 -16.075 3.070   1.00 70.92 ? 221 ARG A NH1   1 
ATOM   2253 N  NH2   . ARG E 3 220 ? -11.411 -17.062 4.987   1.00 69.95 ? 221 ARG A NH2   1 
ATOM   2254 N  N     . THR E 3 221 ? -19.749 -12.846 4.991   1.00 26.12 ? 222 THR A N     1 
ATOM   2255 C  CA    . THR E 3 221 ? -20.779 -12.077 4.286   1.00 28.30 ? 222 THR A CA    1 
ATOM   2256 C  C     . THR E 3 221 ? -22.010 -11.888 5.161   1.00 28.51 ? 222 THR A C     1 
ATOM   2257 O  O     . THR E 3 221 ? -22.257 -12.688 6.067   1.00 28.30 ? 222 THR A O     1 
ATOM   2258 C  CB    . THR E 3 221 ? -21.206 -12.762 2.959   1.00 28.76 ? 222 THR A CB    1 
ATOM   2259 O  OG1   . THR E 3 221 ? -21.887 -13.993 3.244   1.00 27.04 ? 222 THR A OG1   1 
ATOM   2260 C  CG2   . THR E 3 221 ? -19.985 -13.047 2.082   1.00 21.08 ? 222 THR A CG2   1 
ATOM   2261 N  N     . SER E 3 222 ? -22.787 -10.841 4.887   1.00 28.50 ? 223 SER A N     1 
ATOM   2262 C  CA    . SER E 3 222 ? -23.983 -10.563 5.674   1.00 30.55 ? 223 SER A CA    1 
ATOM   2263 C  C     . SER E 3 222 ? -24.996 -11.703 5.552   1.00 33.38 ? 223 SER A C     1 
ATOM   2264 O  O     . SER E 3 222 ? -25.766 -11.966 6.481   1.00 32.37 ? 223 SER A O     1 
ATOM   2265 C  CB    . SER E 3 222 ? -24.603 -9.210  5.273   1.00 21.29 ? 223 SER A CB    1 
ATOM   2266 O  OG    . SER E 3 222 ? -25.171 -9.241  3.983   1.00 34.52 ? 223 SER A OG    1 
ATOM   2267 N  N     . GLN E 3 223 ? -24.980 -12.386 4.411   1.00 35.10 ? 224 GLN A N     1 
ATOM   2268 C  CA    . GLN E 3 223 ? -25.881 -13.509 4.171   1.00 39.10 ? 224 GLN A CA    1 
ATOM   2269 C  C     . GLN E 3 223 ? -25.600 -14.619 5.198   1.00 38.61 ? 224 GLN A C     1 
ATOM   2270 O  O     . GLN E 3 223 ? -26.528 -15.199 5.760   1.00 37.61 ? 224 GLN A O     1 
ATOM   2271 C  CB    . GLN E 3 223 ? -25.683 -14.034 2.750   1.00 43.14 ? 224 GLN A CB    1 
ATOM   2272 C  CG    . GLN E 3 223 ? -26.631 -15.148 2.350   1.00 60.76 ? 224 GLN A CG    1 
ATOM   2273 C  CD    . GLN E 3 223 ? -26.218 -15.856 1.061   1.00 76.25 ? 224 GLN A CD    1 
ATOM   2274 O  OE1   . GLN E 3 223 ? -26.768 -16.907 0.723   1.00 81.84 ? 224 GLN A OE1   1 
ATOM   2275 N  NE2   . GLN E 3 223 ? -25.248 -15.288 0.338   1.00 82.09 ? 224 GLN A NE2   1 
ATOM   2276 N  N     . LEU E 3 224 ? -24.320 -14.900 5.436   1.00 37.02 ? 225 LEU A N     1 
ATOM   2277 C  CA    . LEU E 3 224 ? -23.908 -15.911 6.407   1.00 37.09 ? 225 LEU A CA    1 
ATOM   2278 C  C     . LEU E 3 224 ? -24.024 -15.398 7.852   1.00 38.04 ? 225 LEU A C     1 
ATOM   2279 O  O     . LEU E 3 224 ? -24.081 -16.196 8.794   1.00 36.04 ? 225 LEU A O     1 
ATOM   2280 C  CB    . LEU E 3 224 ? -22.460 -16.344 6.159   1.00 38.66 ? 225 LEU A CB    1 
ATOM   2281 C  CG    . LEU E 3 224 ? -22.097 -17.182 4.936   1.00 38.32 ? 225 LEU A CG    1 
ATOM   2282 C  CD1   . LEU E 3 224 ? -20.639 -17.615 5.043   1.00 44.56 ? 225 LEU A CD1   1 
ATOM   2283 C  CD2   . LEU E 3 224 ? -22.998 -18.398 4.871   1.00 37.33 ? 225 LEU A CD2   1 
ATOM   2284 N  N     . ARG E 3 225 ? -24.046 -14.075 8.026   1.00 35.92 ? 226 ARG A N     1 
ATOM   2285 C  CA    . ARG E 3 225 ? -24.157 -13.479 9.354   1.00 35.42 ? 226 ARG A CA    1 
ATOM   2286 C  C     . ARG E 3 225 ? -25.602 -13.270 9.796   1.00 38.31 ? 226 ARG A C     1 
ATOM   2287 O  O     . ARG E 3 225 ? -25.863 -13.106 10.986  1.00 39.58 ? 226 ARG A O     1 
ATOM   2288 C  CB    . ARG E 3 225 ? -23.400 -12.148 9.429   1.00 28.06 ? 226 ARG A CB    1 
ATOM   2289 C  CG    . ARG E 3 225 ? -21.902 -12.265 9.272   1.00 22.38 ? 226 ARG A CG    1 
ATOM   2290 C  CD    . ARG E 3 225 ? -21.194 -10.971 9.631   1.00 24.19 ? 226 ARG A CD    1 
ATOM   2291 N  NE    . ARG E 3 225 ? -21.567 -9.834  8.787   1.00 27.88 ? 226 ARG A NE    1 
ATOM   2292 C  CZ    . ARG E 3 225 ? -20.911 -9.457  7.686   1.00 29.13 ? 226 ARG A CZ    1 
ATOM   2293 N  NH1   . ARG E 3 225 ? -19.843 -10.126 7.267   1.00 21.02 ? 226 ARG A NH1   1 
ATOM   2294 N  NH2   . ARG E 3 225 ? -21.325 -8.404  6.992   1.00 22.33 ? 226 ARG A NH2   1 
ATOM   2295 N  N     . ASN E 3 226 ? -26.534 -13.276 8.845   1.00 41.63 ? 227 ASN A N     1 
ATOM   2296 C  CA    . ASN E 3 226 ? -27.968 -13.097 9.128   1.00 46.47 ? 227 ASN A CA    1 
ATOM   2297 C  C     . ASN E 3 226 ? -28.509 -14.048 10.200  1.00 46.53 ? 227 ASN A C     1 
ATOM   2298 O  O     . ASN E 3 226 ? -29.293 -13.647 11.063  1.00 47.06 ? 227 ASN A O     1 
ATOM   2299 C  CB    . ASN E 3 226 ? -28.803 -13.288 7.851   1.00 52.38 ? 227 ASN A CB    1 
ATOM   2300 C  CG    . ASN E 3 226 ? -28.929 -12.018 7.025   1.00 62.19 ? 227 ASN A CG    1 
ATOM   2301 O  OD1   . ASN E 3 226 ? -28.791 -10.905 7.536   1.00 69.17 ? 227 ASN A OD1   1 
ATOM   2302 N  ND2   . ASN E 3 226 ? -29.198 -12.183 5.733   1.00 65.54 ? 227 ASN A ND2   1 
ATOM   2303 N  N     . ASP E 3 227 ? -28.088 -15.307 10.132  1.00 46.85 ? 228 ASP A N     1 
ATOM   2304 C  CA    . ASP E 3 227 ? -28.537 -16.320 11.081  1.00 48.40 ? 228 ASP A CA    1 
ATOM   2305 C  C     . ASP E 3 227 ? -27.633 -16.466 12.311  1.00 44.59 ? 228 ASP A C     1 
ATOM   2306 O  O     . ASP E 3 227 ? -27.940 -17.245 13.213  1.00 45.30 ? 228 ASP A O     1 
ATOM   2307 C  CB    . ASP E 3 227 ? -28.666 -17.679 10.368  1.00 60.39 ? 228 ASP A CB    1 
ATOM   2308 C  CG    . ASP E 3 227 ? -27.337 -18.164 9.737   1.00 73.05 ? 228 ASP A CG    1 
ATOM   2309 O  OD1   . ASP E 3 227 ? -26.265 -17.543 9.962   1.00 74.30 ? 228 ASP A OD1   1 
ATOM   2310 O  OD2   . ASP E 3 227 ? -27.368 -19.182 9.006   1.00 79.47 ? 228 ASP A OD2   1 
ATOM   2311 N  N     . LYS E 3 228 ? -26.528 -15.723 12.342  1.00 39.96 ? 229 LYS A N     1 
ATOM   2312 C  CA    . LYS E 3 228 ? -25.572 -15.782 13.448  1.00 35.38 ? 229 LYS A CA    1 
ATOM   2313 C  C     . LYS E 3 228 ? -25.573 -14.423 14.164  1.00 33.49 ? 229 LYS A C     1 
ATOM   2314 O  O     . LYS E 3 228 ? -26.488 -14.135 14.932  1.00 36.42 ? 229 LYS A O     1 
ATOM   2315 C  CB    . LYS E 3 228 ? -24.192 -16.118 12.893  1.00 33.06 ? 229 LYS A CB    1 
ATOM   2316 C  CG    . LYS E 3 228 ? -23.387 -17.051 13.749  1.00 32.04 ? 229 LYS A CG    1 
ATOM   2317 C  CD    . LYS E 3 228 ? -22.100 -17.392 13.059  1.00 31.93 ? 229 LYS A CD    1 
ATOM   2318 C  CE    . LYS E 3 228 ? -21.240 -18.259 13.939  1.00 33.01 ? 229 LYS A CE    1 
ATOM   2319 N  NZ    . LYS E 3 228 ? -19.932 -18.549 13.304  1.00 26.41 ? 229 LYS A NZ    1 
ATOM   2320 N  N     . TYR E 3 229 ? -24.561 -13.595 13.929  1.00 28.65 ? 230 TYR A N     1 
ATOM   2321 C  CA    . TYR E 3 229 ? -24.533 -12.271 14.541  1.00 26.24 ? 230 TYR A CA    1 
ATOM   2322 C  C     . TYR E 3 229 ? -23.849 -11.253 13.626  1.00 26.05 ? 230 TYR A C     1 
ATOM   2323 O  O     . TYR E 3 229 ? -22.873 -11.564 12.932  1.00 24.46 ? 230 TYR A O     1 
ATOM   2324 C  CB    . TYR E 3 229 ? -23.876 -12.294 15.931  1.00 15.43 ? 230 TYR A CB    1 
ATOM   2325 C  CG    . TYR E 3 229 ? -22.462 -12.807 15.972  1.00 13.63 ? 230 TYR A CG    1 
ATOM   2326 C  CD1   . TYR E 3 229 ? -21.383 -11.959 15.729  1.00 15.93 ? 230 TYR A CD1   1 
ATOM   2327 C  CD2   . TYR E 3 229 ? -22.196 -14.143 16.261  1.00 11.38 ? 230 TYR A CD2   1 
ATOM   2328 C  CE1   . TYR E 3 229 ? -20.071 -12.433 15.774  1.00 14.28 ? 230 TYR A CE1   1 
ATOM   2329 C  CE2   . TYR E 3 229 ? -20.891 -14.627 16.310  1.00 11.13 ? 230 TYR A CE2   1 
ATOM   2330 C  CZ    . TYR E 3 229 ? -19.836 -13.766 16.066  1.00 15.56 ? 230 TYR A CZ    1 
ATOM   2331 O  OH    . TYR E 3 229 ? -18.547 -14.236 16.117  1.00 13.94 ? 230 TYR A OH    1 
ATOM   2332 N  N     . ASN E 3 230 ? -24.382 -10.039 13.634  1.00 26.48 ? 231 ASN A N     1 
ATOM   2333 C  CA    . ASN E 3 230 ? -23.876 -8.950  12.812  1.00 29.67 ? 231 ASN A CA    1 
ATOM   2334 C  C     . ASN E 3 230 ? -23.238 -7.823  13.605  1.00 28.70 ? 231 ASN A C     1 
ATOM   2335 O  O     . ASN E 3 230 ? -22.594 -6.950  13.029  1.00 25.62 ? 231 ASN A O     1 
ATOM   2336 C  CB    . ASN E 3 230 ? -25.002 -8.373  11.959  1.00 34.46 ? 231 ASN A CB    1 
ATOM   2337 C  CG    . ASN E 3 230 ? -25.284 -9.213  10.746  1.00 46.68 ? 231 ASN A CG    1 
ATOM   2338 O  OD1   . ASN E 3 230 ? -24.428 -9.358  9.875   1.00 53.61 ? 231 ASN A OD1   1 
ATOM   2339 N  ND2   . ASN E 3 230 ? -26.480 -9.778  10.677  1.00 55.83 ? 231 ASN A ND2   1 
ATOM   2340 N  N     . ASN E 3 231 ? -23.432 -7.840  14.920  1.00 24.70 ? 232 ASN A N     1 
ATOM   2341 C  CA    . ASN E 3 231 ? -22.880 -6.825  15.803  1.00 22.36 ? 232 ASN A CA    1 
ATOM   2342 C  C     . ASN E 3 231 ? -22.722 -7.390  17.214  1.00 22.67 ? 232 ASN A C     1 
ATOM   2343 O  O     . ASN E 3 231 ? -23.078 -8.546  17.478  1.00 20.60 ? 232 ASN A O     1 
ATOM   2344 C  CB    . ASN E 3 231 ? -23.760 -5.568  15.813  1.00 19.57 ? 232 ASN A CB    1 
ATOM   2345 C  CG    . ASN E 3 231 ? -25.192 -5.855  16.226  1.00 26.42 ? 232 ASN A CG    1 
ATOM   2346 O  OD1   . ASN E 3 231 ? -25.449 -6.608  17.162  1.00 27.75 ? 232 ASN A OD1   1 
ATOM   2347 N  ND2   . ASN E 3 231 ? -26.133 -5.247  15.527  1.00 24.62 ? 232 ASN A ND2   1 
ATOM   2348 N  N     . ILE E 3 232 ? -22.194 -6.567  18.113  1.00 21.80 ? 233 ILE A N     1 
ATOM   2349 C  CA    . ILE E 3 232 ? -21.935 -6.970  19.491  1.00 22.69 ? 233 ILE A CA    1 
ATOM   2350 C  C     . ILE E 3 232 ? -23.193 -7.403  20.273  1.00 21.89 ? 233 ILE A C     1 
ATOM   2351 O  O     . ILE E 3 232 ? -23.131 -8.361  21.038  1.00 20.58 ? 233 ILE A O     1 
ATOM   2352 C  CB    . ILE E 3 232 ? -21.151 -5.852  20.241  1.00 20.27 ? 233 ILE A CB    1 
ATOM   2353 C  CG1   . ILE E 3 232 ? -20.548 -6.399  21.532  1.00 17.43 ? 233 ILE A CG1   1 
ATOM   2354 C  CG2   . ILE E 3 232 ? -22.053 -4.645  20.495  1.00 16.11 ? 233 ILE A CG2   1 
ATOM   2355 C  CD1   . ILE E 3 232 ? -19.513 -7.474  21.317  1.00 14.81 ? 233 ILE A CD1   1 
ATOM   2356 N  N     . SER E 3 233 ? -24.323 -6.722  20.079  1.00 20.37 ? 234 SER A N     1 
ATOM   2357 C  CA    . SER E 3 233 ? -25.548 -7.096  20.783  1.00 23.08 ? 234 SER A CA    1 
ATOM   2358 C  C     . SER E 3 233 ? -25.974 -8.501  20.405  1.00 23.97 ? 234 SER A C     1 
ATOM   2359 O  O     . SER E 3 233 ? -26.215 -9.329  21.283  1.00 26.30 ? 234 SER A O     1 
ATOM   2360 C  CB    . SER E 3 233 ? -26.694 -6.137  20.466  1.00 24.51 ? 234 SER A CB    1 
ATOM   2361 O  OG    . SER E 3 233 ? -26.429 -4.846  20.969  1.00 38.85 ? 234 SER A OG    1 
ATOM   2362 N  N     . GLU E 3 234 ? -26.063 -8.764  19.100  1.00 20.62 ? 235 GLU A N     1 
ATOM   2363 C  CA    . GLU E 3 234 ? -26.467 -10.074 18.593  1.00 20.09 ? 235 GLU A CA    1 
ATOM   2364 C  C     . GLU E 3 234 ? -25.480 -11.148 19.010  1.00 21.09 ? 235 GLU A C     1 
ATOM   2365 O  O     . GLU E 3 234 ? -25.871 -12.286 19.271  1.00 23.35 ? 235 GLU A O     1 
ATOM   2366 C  CB    . GLU E 3 234 ? -26.598 -10.051 17.066  1.00 19.80 ? 235 GLU A CB    1 
ATOM   2367 C  CG    . GLU E 3 234 ? -27.598 -9.027  16.568  1.00 19.38 ? 235 GLU A CG    1 
ATOM   2368 C  CD    . GLU E 3 234 ? -27.863 -9.103  15.068  1.00 28.69 ? 235 GLU A CD    1 
ATOM   2369 O  OE1   . GLU E 3 234 ? -27.121 -9.787  14.331  1.00 22.89 ? 235 GLU A OE1   1 
ATOM   2370 O  OE2   . GLU E 3 234 ? -28.834 -8.465  14.620  1.00 32.19 ? 235 GLU A OE2   1 
ATOM   2371 N  N     . TYR E 3 235 ? -24.201 -10.792 19.077  1.00 18.44 ? 236 TYR A N     1 
ATOM   2372 C  CA    . TYR E 3 235 ? -23.195 -11.752 19.495  1.00 20.05 ? 236 TYR A CA    1 
ATOM   2373 C  C     . TYR E 3 235 ? -23.430 -12.161 20.957  1.00 21.47 ? 236 TYR A C     1 
ATOM   2374 O  O     . TYR E 3 235 ? -23.296 -13.332 21.304  1.00 24.53 ? 236 TYR A O     1 
ATOM   2375 C  CB    . TYR E 3 235 ? -21.784 -11.180 19.317  1.00 19.28 ? 236 TYR A CB    1 
ATOM   2376 C  CG    . TYR E 3 235 ? -20.742 -11.930 20.108  1.00 15.79 ? 236 TYR A CG    1 
ATOM   2377 C  CD1   . TYR E 3 235 ? -20.141 -13.079 19.600  1.00 18.43 ? 236 TYR A CD1   1 
ATOM   2378 C  CD2   . TYR E 3 235 ? -20.385 -11.506 21.391  1.00 17.23 ? 236 TYR A CD2   1 
ATOM   2379 C  CE1   . TYR E 3 235 ? -19.208 -13.800 20.351  1.00 19.14 ? 236 TYR A CE1   1 
ATOM   2380 C  CE2   . TYR E 3 235 ? -19.456 -12.216 22.152  1.00 18.24 ? 236 TYR A CE2   1 
ATOM   2381 C  CZ    . TYR E 3 235 ? -18.872 -13.360 21.631  1.00 19.43 ? 236 TYR A CZ    1 
ATOM   2382 O  OH    . TYR E 3 235 ? -17.964 -14.059 22.398  1.00 18.16 ? 236 TYR A OH    1 
ATOM   2383 N  N     . ARG E 3 236 ? -23.777 -11.206 21.812  1.00 19.39 ? 237 ARG A N     1 
ATOM   2384 C  CA    . ARG E 3 236 ? -24.028 -11.510 23.218  1.00 22.30 ? 237 ARG A CA    1 
ATOM   2385 C  C     . ARG E 3 236 ? -25.294 -12.353 23.405  1.00 23.26 ? 237 ARG A C     1 
ATOM   2386 O  O     . ARG E 3 236 ? -25.313 -13.263 24.234  1.00 23.56 ? 237 ARG A O     1 
ATOM   2387 C  CB    . ARG E 3 236 ? -24.050 -10.220 24.040  1.00 17.25 ? 237 ARG A CB    1 
ATOM   2388 C  CG    . ARG E 3 236 ? -22.631 -9.697  24.229  1.00 15.52 ? 237 ARG A CG    1 
ATOM   2389 C  CD    . ARG E 3 236 ? -22.531 -8.293  24.775  1.00 18.90 ? 237 ARG A CD    1 
ATOM   2390 N  NE    . ARG E 3 236 ? -21.120 -7.949  24.976  1.00 22.83 ? 237 ARG A NE    1 
ATOM   2391 C  CZ    . ARG E 3 236 ? -20.638 -6.710  25.076  1.00 24.60 ? 237 ARG A CZ    1 
ATOM   2392 N  NH1   . ARG E 3 236 ? -21.443 -5.662  25.001  1.00 19.55 ? 237 ARG A NH1   1 
ATOM   2393 N  NH2   . ARG E 3 236 ? -19.337 -6.517  25.252  1.00 18.44 ? 237 ARG A NH2   1 
ATOM   2394 N  N     . ASN E 3 237 ? -26.343 -12.070 22.635  1.00 21.95 ? 238 ASN A N     1 
ATOM   2395 C  CA    . ASN E 3 237 ? -27.572 -12.864 22.711  1.00 22.61 ? 238 ASN A CA    1 
ATOM   2396 C  C     . ASN E 3 237 ? -27.290 -14.288 22.230  1.00 21.21 ? 238 ASN A C     1 
ATOM   2397 O  O     . ASN E 3 237 ? -27.822 -15.251 22.776  1.00 24.35 ? 238 ASN A O     1 
ATOM   2398 C  CB    . ASN E 3 237 ? -28.674 -12.247 21.853  1.00 23.69 ? 238 ASN A CB    1 
ATOM   2399 C  CG    . ASN E 3 237 ? -29.061 -10.871 22.327  1.00 36.36 ? 238 ASN A CG    1 
ATOM   2400 O  OD1   . ASN E 3 237 ? -28.912 -10.543 23.506  1.00 38.28 ? 238 ASN A OD1   1 
ATOM   2401 N  ND2   . ASN E 3 237 ? -29.558 -10.050 21.416  1.00 43.98 ? 238 ASN A ND2   1 
ATOM   2402 N  N     . TRP E 3 238 ? -26.447 -14.403 21.207  1.00 19.20 ? 239 TRP A N     1 
ATOM   2403 C  CA    . TRP E 3 238 ? -26.043 -15.683 20.623  1.00 19.55 ? 239 TRP A CA    1 
ATOM   2404 C  C     . TRP E 3 238 ? -25.301 -16.547 21.657  1.00 21.80 ? 239 TRP A C     1 
ATOM   2405 O  O     . TRP E 3 238 ? -25.517 -17.760 21.746  1.00 21.00 ? 239 TRP A O     1 
ATOM   2406 C  CB    . TRP E 3 238 ? -25.150 -15.396 19.414  1.00 19.68 ? 239 TRP A CB    1 
ATOM   2407 C  CG    . TRP E 3 238 ? -24.653 -16.585 18.659  1.00 17.76 ? 239 TRP A CG    1 
ATOM   2408 C  CD1   . TRP E 3 238 ? -25.385 -17.413 17.860  1.00 14.15 ? 239 TRP A CD1   1 
ATOM   2409 C  CD2   . TRP E 3 238 ? -23.298 -17.050 18.591  1.00 12.95 ? 239 TRP A CD2   1 
ATOM   2410 N  NE1   . TRP E 3 238 ? -24.567 -18.363 17.296  1.00 16.45 ? 239 TRP A NE1   1 
ATOM   2411 C  CE2   . TRP E 3 238 ? -23.282 -18.162 17.726  1.00 8.93  ? 239 TRP A CE2   1 
ATOM   2412 C  CE3   . TRP E 3 238 ? -22.098 -16.632 19.176  1.00 17.44 ? 239 TRP A CE3   1 
ATOM   2413 C  CZ2   . TRP E 3 238 ? -22.109 -18.865 17.430  1.00 13.35 ? 239 TRP A CZ2   1 
ATOM   2414 C  CZ3   . TRP E 3 238 ? -20.926 -17.334 18.880  1.00 17.61 ? 239 TRP A CZ3   1 
ATOM   2415 C  CH2   . TRP E 3 238 ? -20.945 -18.437 18.015  1.00 14.84 ? 239 TRP A CH2   1 
ATOM   2416 N  N     . ILE E 3 239 ? -24.420 -15.909 22.425  1.00 23.51 ? 240 ILE A N     1 
ATOM   2417 C  CA    . ILE E 3 239 ? -23.648 -16.559 23.488  1.00 22.54 ? 240 ILE A CA    1 
ATOM   2418 C  C     . ILE E 3 239 ? -24.617 -17.017 24.593  1.00 22.94 ? 240 ILE A C     1 
ATOM   2419 O  O     . ILE E 3 239 ? -24.520 -18.133 25.105  1.00 22.93 ? 240 ILE A O     1 
ATOM   2420 C  CB    . ILE E 3 239 ? -22.605 -15.561 24.089  1.00 25.67 ? 240 ILE A CB    1 
ATOM   2421 C  CG1   . ILE E 3 239 ? -21.428 -15.399 23.130  1.00 22.30 ? 240 ILE A CG1   1 
ATOM   2422 C  CG2   . ILE E 3 239 ? -22.130 -16.010 25.473  1.00 22.24 ? 240 ILE A CG2   1 
ATOM   2423 C  CD1   . ILE E 3 239 ? -20.730 -16.692 22.800  1.00 30.46 ? 240 ILE A CD1   1 
ATOM   2424 N  N     . TYR E 3 240 ? -25.554 -16.142 24.942  1.00 22.35 ? 241 TYR A N     1 
ATOM   2425 C  CA    . TYR E 3 240 ? -26.546 -16.416 25.974  1.00 22.08 ? 241 TYR A CA    1 
ATOM   2426 C  C     . TYR E 3 240 ? -27.346 -17.685 25.696  1.00 22.77 ? 241 TYR A C     1 
ATOM   2427 O  O     . TYR E 3 240 ? -27.573 -18.494 26.603  1.00 18.70 ? 241 TYR A O     1 
ATOM   2428 C  CB    . TYR E 3 240 ? -27.507 -15.232 26.099  1.00 19.05 ? 241 TYR A CB    1 
ATOM   2429 C  CG    . TYR E 3 240 ? -28.463 -15.371 27.251  1.00 24.64 ? 241 TYR A CG    1 
ATOM   2430 C  CD1   . TYR E 3 240 ? -28.095 -14.958 28.530  1.00 29.55 ? 241 TYR A CD1   1 
ATOM   2431 C  CD2   . TYR E 3 240 ? -29.728 -15.926 27.073  1.00 23.25 ? 241 TYR A CD2   1 
ATOM   2432 C  CE1   . TYR E 3 240 ? -28.951 -15.093 29.599  1.00 28.64 ? 241 TYR A CE1   1 
ATOM   2433 C  CE2   . TYR E 3 240 ? -30.600 -16.067 28.143  1.00 25.37 ? 241 TYR A CE2   1 
ATOM   2434 C  CZ    . TYR E 3 240 ? -30.200 -15.647 29.405  1.00 29.18 ? 241 TYR A CZ    1 
ATOM   2435 O  OH    . TYR E 3 240 ? -31.043 -15.779 30.478  1.00 32.87 ? 241 TYR A OH    1 
ATOM   2436 N  N     . ARG E 3 241 ? -27.773 -17.846 24.445  1.00 23.43 ? 242 ARG A N     1 
ATOM   2437 C  CA    . ARG E 3 241 ? -28.556 -19.003 24.022  1.00 24.63 ? 242 ARG A CA    1 
ATOM   2438 C  C     . ARG E 3 241 ? -27.751 -20.287 23.810  1.00 25.85 ? 242 ARG A C     1 
ATOM   2439 O  O     . ARG E 3 241 ? -28.332 -21.341 23.550  1.00 31.91 ? 242 ARG A O     1 
ATOM   2440 C  CB    . ARG E 3 241 ? -29.303 -18.708 22.726  1.00 29.61 ? 242 ARG A CB    1 
ATOM   2441 C  CG    . ARG E 3 241 ? -30.302 -17.587 22.762  1.00 34.48 ? 242 ARG A CG    1 
ATOM   2442 C  CD    . ARG E 3 241 ? -31.077 -17.609 21.449  1.00 43.51 ? 242 ARG A CD    1 
ATOM   2443 N  NE    . ARG E 3 241 ? -30.182 -17.801 20.306  1.00 52.81 ? 242 ARG A NE    1 
ATOM   2444 C  CZ    . ARG E 3 241 ? -29.677 -16.813 19.568  1.00 58.49 ? 242 ARG A CZ    1 
ATOM   2445 N  NH1   . ARG E 3 241 ? -29.986 -15.549 19.834  1.00 61.34 ? 242 ARG A NH1   1 
ATOM   2446 N  NH2   . ARG E 3 241 ? -28.864 -17.086 18.555  1.00 56.86 ? 242 ARG A NH2   1 
ATOM   2447 N  N     . GLY E 3 242 ? -26.430 -20.216 23.908  1.00 24.88 ? 243 GLY A N     1 
ATOM   2448 C  CA    . GLY E 3 242 ? -25.635 -21.416 23.725  1.00 25.81 ? 243 GLY A CA    1 
ATOM   2449 C  C     . GLY E 3 242 ? -24.978 -21.561 22.364  1.00 30.82 ? 243 GLY A C     1 
ATOM   2450 O  O     . GLY E 3 242 ? -24.665 -22.678 21.941  1.00 29.70 ? 243 GLY A O     1 
ATOM   2451 N  N     . ARG E 3 243 ? -24.767 -20.437 21.681  1.00 32.45 ? 244 ARG A N     1 
ATOM   2452 C  CA    . ARG E 3 243 ? -24.116 -20.425 20.372  1.00 33.70 ? 244 ARG A CA    1 
ATOM   2453 C  C     . ARG E 3 243 ? -24.875 -21.240 19.324  1.00 35.54 ? 244 ARG A C     1 
ATOM   2454 O  O     . ARG E 3 243 ? -24.298 -22.073 18.627  1.00 37.18 ? 244 ARG A O     1 
ATOM   2455 C  CB    . ARG E 3 243 ? -22.671 -20.922 20.519  1.00 25.58 ? 244 ARG A CB    1 
ATOM   2456 C  CG    . ARG E 3 243 ? -21.899 -20.149 21.572  1.00 25.87 ? 244 ARG A CG    1 
ATOM   2457 C  CD    . ARG E 3 243 ? -20.629 -20.852 21.983  1.00 30.46 ? 244 ARG A CD    1 
ATOM   2458 N  NE    . ARG E 3 243 ? -19.535 -20.613 21.045  1.00 39.25 ? 244 ARG A NE    1 
ATOM   2459 C  CZ    . ARG E 3 243 ? -18.579 -19.700 21.216  1.00 41.73 ? 244 ARG A CZ    1 
ATOM   2460 N  NH1   . ARG E 3 243 ? -18.569 -18.925 22.298  1.00 31.22 ? 244 ARG A NH1   1 
ATOM   2461 N  NH2   . ARG E 3 243 ? -17.626 -19.562 20.300  1.00 33.45 ? 244 ARG A NH2   1 
ATOM   2462 N  N     . LYS E 3 244 ? -26.171 -20.976 19.214  1.00 39.56 ? 245 LYS A N     1 
ATOM   2463 C  CA    . LYS E 3 244 ? -27.038 -21.674 18.276  1.00 45.28 ? 245 LYS A CA    1 
ATOM   2464 C  C     . LYS E 3 244 ? -28.264 -20.808 17.998  1.00 49.99 ? 245 LYS A C     1 
ATOM   2465 O  O     . LYS E 3 244 ? -28.933 -21.049 16.972  1.00 54.59 ? 245 LYS A O     1 
ATOM   2466 C  CB    . LYS E 3 244 ? -27.473 -23.023 18.867  1.00 48.16 ? 245 LYS A CB    1 
ATOM   2467 C  CG    . LYS E 3 244 ? -28.193 -22.904 20.209  1.00 52.64 ? 245 LYS A CG    1 
ATOM   2468 C  CD    . LYS E 3 244 ? -28.575 -24.258 20.787  1.00 58.67 ? 245 LYS A CD    1 
ATOM   2469 C  CE    . LYS E 3 244 ? -29.406 -24.092 22.059  1.00 60.60 ? 245 LYS A CE    1 
ATOM   2470 N  NZ    . LYS E 3 244 ? -30.606 -23.223 21.834  1.00 65.92 ? 245 LYS A NZ    1 
ATOM   2471 O  OXT   . LYS E 3 244 ? -28.544 -19.896 18.808  1.00 50.12 ? 245 LYS A OXT   1 
ATOM   2472 N  N     . SER F 3 1   ? 8.871   12.957  -29.074 1.00 16.37 ? 2   SER B N     1 
ATOM   2473 C  CA    . SER F 3 1   ? 7.435   13.023  -28.686 1.00 19.52 ? 2   SER B CA    1 
ATOM   2474 C  C     . SER F 3 1   ? 7.361   13.002  -27.155 1.00 19.41 ? 2   SER B C     1 
ATOM   2475 O  O     . SER F 3 1   ? 8.385   12.856  -26.480 1.00 19.06 ? 2   SER B O     1 
ATOM   2476 C  CB    . SER F 3 1   ? 6.725   11.786  -29.233 1.00 19.55 ? 2   SER B CB    1 
ATOM   2477 O  OG    . SER F 3 1   ? 7.427   10.620  -28.816 1.00 16.22 ? 2   SER B OG    1 
ATOM   2478 N  N     . LEU F 3 2   ? 6.156   13.141  -26.622 1.00 19.00 ? 3   LEU B N     1 
ATOM   2479 C  CA    . LEU F 3 2   ? 5.936   13.094  -25.184 1.00 22.68 ? 3   LEU B CA    1 
ATOM   2480 C  C     . LEU F 3 2   ? 6.484   11.755  -24.680 1.00 23.62 ? 3   LEU B C     1 
ATOM   2481 O  O     . LEU F 3 2   ? 7.236   11.711  -23.702 1.00 22.49 ? 3   LEU B O     1 
ATOM   2482 C  CB    . LEU F 3 2   ? 4.430   13.205  -24.886 1.00 25.44 ? 3   LEU B CB    1 
ATOM   2483 C  CG    . LEU F 3 2   ? 3.921   13.033  -23.447 1.00 31.22 ? 3   LEU B CG    1 
ATOM   2484 C  CD1   . LEU F 3 2   ? 4.422   14.164  -22.556 1.00 28.84 ? 3   LEU B CD1   1 
ATOM   2485 C  CD2   . LEU F 3 2   ? 2.405   13.008  -23.452 1.00 23.30 ? 3   LEU B CD2   1 
ATOM   2486 N  N     . ARG F 3 3   ? 6.119   10.675  -25.372 1.00 21.64 ? 4   ARG B N     1 
ATOM   2487 C  CA    . ARG F 3 3   ? 6.553   9.335   -24.999 1.00 20.05 ? 4   ARG B CA    1 
ATOM   2488 C  C     . ARG F 3 3   ? 8.070   9.135   -25.026 1.00 21.76 ? 4   ARG B C     1 
ATOM   2489 O  O     . ARG F 3 3   ? 8.649   8.623   -24.055 1.00 21.78 ? 4   ARG B O     1 
ATOM   2490 C  CB    . ARG F 3 3   ? 5.859   8.288   -25.877 1.00 21.32 ? 4   ARG B CB    1 
ATOM   2491 C  CG    . ARG F 3 3   ? 6.091   6.868   -25.435 1.00 20.51 ? 4   ARG B CG    1 
ATOM   2492 C  CD    . ARG F 3 3   ? 5.646   5.888   -26.499 1.00 26.03 ? 4   ARG B CD    1 
ATOM   2493 N  NE    . ARG F 3 3   ? 5.962   4.507   -26.137 1.00 21.55 ? 4   ARG B NE    1 
ATOM   2494 C  CZ    . ARG F 3 3   ? 5.047   3.547   -26.010 1.00 23.12 ? 4   ARG B CZ    1 
ATOM   2495 N  NH1   . ARG F 3 3   ? 3.765   3.820   -26.220 1.00 24.70 ? 4   ARG B NH1   1 
ATOM   2496 N  NH2   . ARG F 3 3   ? 5.408   2.313   -25.673 1.00 12.14 ? 4   ARG B NH2   1 
ATOM   2497 N  N     . SER F 3 4   ? 8.724   9.530   -26.117 1.00 21.29 ? 5   SER B N     1 
ATOM   2498 C  CA    . SER F 3 4   ? 10.180  9.369   -26.209 1.00 20.59 ? 5   SER B CA    1 
ATOM   2499 C  C     . SER F 3 4   ? 10.894  10.256  -25.173 1.00 16.35 ? 5   SER B C     1 
ATOM   2500 O  O     . SER F 3 4   ? 11.906  9.867   -24.589 1.00 14.96 ? 5   SER B O     1 
ATOM   2501 C  CB    . SER F 3 4   ? 10.684  9.678   -27.638 1.00 17.80 ? 5   SER B CB    1 
ATOM   2502 O  OG    . SER F 3 4   ? 10.446  11.031  -28.018 1.00 21.81 ? 5   SER B OG    1 
ATOM   2503 N  N     . ASP F 3 5   ? 10.365  11.449  -24.950 1.00 16.74 ? 6   ASP B N     1 
ATOM   2504 C  CA    . ASP F 3 5   ? 10.962  12.356  -23.983 1.00 21.70 ? 6   ASP B CA    1 
ATOM   2505 C  C     . ASP F 3 5   ? 10.817  11.827  -22.566 1.00 25.12 ? 6   ASP B C     1 
ATOM   2506 O  O     . ASP F 3 5   ? 11.761  11.899  -21.770 1.00 26.12 ? 6   ASP B O     1 
ATOM   2507 C  CB    . ASP F 3 5   ? 10.340  13.742  -24.097 1.00 22.98 ? 6   ASP B CB    1 
ATOM   2508 C  CG    . ASP F 3 5   ? 10.943  14.553  -25.226 1.00 23.62 ? 6   ASP B CG    1 
ATOM   2509 O  OD1   . ASP F 3 5   ? 11.983  14.134  -25.784 1.00 23.91 ? 6   ASP B OD1   1 
ATOM   2510 O  OD2   . ASP F 3 5   ? 10.376  15.611  -25.549 1.00 23.89 ? 6   ASP B OD2   1 
ATOM   2511 N  N     . LEU F 3 6   ? 9.641   11.292  -22.261 1.00 25.05 ? 7   LEU B N     1 
ATOM   2512 C  CA    . LEU F 3 6   ? 9.380   10.735  -20.945 1.00 25.27 ? 7   LEU B CA    1 
ATOM   2513 C  C     . LEU F 3 6   ? 10.325  9.565   -20.672 1.00 25.72 ? 7   LEU B C     1 
ATOM   2514 O  O     . LEU F 3 6   ? 10.921  9.481   -19.597 1.00 28.35 ? 7   LEU B O     1 
ATOM   2515 C  CB    . LEU F 3 6   ? 7.924   10.292  -20.848 1.00 23.72 ? 7   LEU B CB    1 
ATOM   2516 C  CG    . LEU F 3 6   ? 7.430   9.907   -19.455 1.00 34.82 ? 7   LEU B CG    1 
ATOM   2517 C  CD1   . LEU F 3 6   ? 7.860   10.951  -18.426 1.00 30.52 ? 7   LEU B CD1   1 
ATOM   2518 C  CD2   . LEU F 3 6   ? 5.919   9.770   -19.490 1.00 24.99 ? 7   LEU B CD2   1 
ATOM   2519 N  N     . ILE F 3 7   ? 10.477  8.676   -21.649 1.00 25.34 ? 8   ILE B N     1 
ATOM   2520 C  CA    . ILE F 3 7   ? 11.358  7.519   -21.503 1.00 27.17 ? 8   ILE B CA    1 
ATOM   2521 C  C     . ILE F 3 7   ? 12.821  7.912   -21.287 1.00 27.81 ? 8   ILE B C     1 
ATOM   2522 O  O     . ILE F 3 7   ? 13.523  7.282   -20.493 1.00 30.03 ? 8   ILE B O     1 
ATOM   2523 C  CB    . ILE F 3 7   ? 11.269  6.565   -22.732 1.00 30.48 ? 8   ILE B CB    1 
ATOM   2524 C  CG1   . ILE F 3 7   ? 9.896   5.890   -22.791 1.00 34.10 ? 8   ILE B CG1   1 
ATOM   2525 C  CG2   . ILE F 3 7   ? 12.353  5.497   -22.657 1.00 29.70 ? 8   ILE B CG2   1 
ATOM   2526 C  CD1   . ILE F 3 7   ? 9.744   4.915   -23.960 1.00 33.60 ? 8   ILE B CD1   1 
ATOM   2527 N  N     . ASN F 3 8   ? 13.288  8.941   -21.990 1.00 28.52 ? 9   ASN B N     1 
ATOM   2528 C  CA    . ASN F 3 8   ? 14.679  9.389   -21.831 1.00 29.62 ? 9   ASN B CA    1 
ATOM   2529 C  C     . ASN F 3 8   ? 14.863  9.985   -20.437 1.00 26.64 ? 9   ASN B C     1 
ATOM   2530 O  O     . ASN F 3 8   ? 15.850  9.695   -19.758 1.00 25.23 ? 9   ASN B O     1 
ATOM   2531 C  CB    . ASN F 3 8   ? 15.056  10.453  -22.874 1.00 36.99 ? 9   ASN B CB    1 
ATOM   2532 C  CG    . ASN F 3 8   ? 15.167  9.892   -24.285 1.00 44.33 ? 9   ASN B CG    1 
ATOM   2533 O  OD1   . ASN F 3 8   ? 15.408  8.701   -24.487 1.00 45.14 ? 9   ASN B OD1   1 
ATOM   2534 N  ND2   . ASN F 3 8   ? 14.991  10.760  -25.273 1.00 47.24 ? 9   ASN B ND2   1 
ATOM   2535 N  N     . ALA F 3 9   ? 13.905  10.816  -20.025 1.00 25.06 ? 10  ALA B N     1 
ATOM   2536 C  CA    . ALA F 3 9   ? 13.933  11.465  -18.716 1.00 25.57 ? 10  ALA B CA    1 
ATOM   2537 C  C     . ALA F 3 9   ? 13.947  10.440  -17.579 1.00 27.42 ? 10  ALA B C     1 
ATOM   2538 O  O     . ALA F 3 9   ? 14.724  10.578  -16.635 1.00 30.14 ? 10  ALA B O     1 
ATOM   2539 C  CB    . ALA F 3 9   ? 12.745  12.402  -18.575 1.00 20.53 ? 10  ALA B CB    1 
ATOM   2540 N  N     . LEU F 3 10  ? 13.098  9.413   -17.672 1.00 27.70 ? 11  LEU B N     1 
ATOM   2541 C  CA    . LEU F 3 10  ? 13.041  8.368   -16.651 1.00 25.88 ? 11  LEU B CA    1 
ATOM   2542 C  C     . LEU F 3 10  ? 14.372  7.643   -16.521 1.00 27.45 ? 11  LEU B C     1 
ATOM   2543 O  O     . LEU F 3 10  ? 14.843  7.417   -15.404 1.00 27.28 ? 11  LEU B O     1 
ATOM   2544 C  CB    . LEU F 3 10  ? 11.931  7.358   -16.955 1.00 20.82 ? 11  LEU B CB    1 
ATOM   2545 C  CG    . LEU F 3 10  ? 10.520  7.928   -16.807 1.00 28.20 ? 11  LEU B CG    1 
ATOM   2546 C  CD1   . LEU F 3 10  ? 9.515   7.028   -17.509 1.00 29.36 ? 11  LEU B CD1   1 
ATOM   2547 C  CD2   . LEU F 3 10  ? 10.180  8.094   -15.343 1.00 27.39 ? 11  LEU B CD2   1 
ATOM   2548 N  N     . TYR F 3 11  ? 14.979  7.281   -17.651 1.00 27.13 ? 12  TYR B N     1 
ATOM   2549 C  CA    . TYR F 3 11  ? 16.269  6.583   -17.639 1.00 32.31 ? 12  TYR B CA    1 
ATOM   2550 C  C     . TYR F 3 11  ? 17.333  7.446   -16.976 1.00 33.63 ? 12  TYR B C     1 
ATOM   2551 O  O     . TYR F 3 11  ? 18.088  6.986   -16.114 1.00 33.18 ? 12  TYR B O     1 
ATOM   2552 C  CB    . TYR F 3 11  ? 16.754  6.265   -19.066 1.00 36.57 ? 12  TYR B CB    1 
ATOM   2553 C  CG    . TYR F 3 11  ? 16.029  5.142   -19.772 1.00 46.53 ? 12  TYR B CG    1 
ATOM   2554 C  CD1   . TYR F 3 11  ? 15.438  4.100   -19.056 1.00 52.80 ? 12  TYR B CD1   1 
ATOM   2555 C  CD2   . TYR F 3 11  ? 15.935  5.119   -21.168 1.00 52.45 ? 12  TYR B CD2   1 
ATOM   2556 C  CE1   . TYR F 3 11  ? 14.770  3.059   -19.710 1.00 50.35 ? 12  TYR B CE1   1 
ATOM   2557 C  CE2   . TYR F 3 11  ? 15.270  4.084   -21.832 1.00 48.59 ? 12  TYR B CE2   1 
ATOM   2558 C  CZ    . TYR F 3 11  ? 14.689  3.057   -21.095 1.00 52.76 ? 12  TYR B CZ    1 
ATOM   2559 O  OH    . TYR F 3 11  ? 14.027  2.033   -21.738 1.00 48.46 ? 12  TYR B OH    1 
ATOM   2560 N  N     . ASP F 3 12  ? 17.380  8.703   -17.395 1.00 34.45 ? 13  ASP B N     1 
ATOM   2561 C  CA    . ASP F 3 12  ? 18.356  9.649   -16.901 1.00 36.90 ? 13  ASP B CA    1 
ATOM   2562 C  C     . ASP F 3 12  ? 18.275  9.843   -15.388 1.00 36.73 ? 13  ASP B C     1 
ATOM   2563 O  O     . ASP F 3 12  ? 19.259  9.624   -14.670 1.00 37.31 ? 13  ASP B O     1 
ATOM   2564 C  CB    . ASP F 3 12  ? 18.175  10.981  -17.632 1.00 40.80 ? 13  ASP B CB    1 
ATOM   2565 C  CG    . ASP F 3 12  ? 19.343  11.922  -17.424 1.00 52.27 ? 13  ASP B CG    1 
ATOM   2566 O  OD1   . ASP F 3 12  ? 20.505  11.452  -17.475 1.00 58.30 ? 13  ASP B OD1   1 
ATOM   2567 O  OD2   . ASP F 3 12  ? 19.098  13.132  -17.208 1.00 55.93 ? 13  ASP B OD2   1 
ATOM   2568 N  N     . GLU F 3 13  ? 17.102  10.248  -14.912 1.00 35.44 ? 14  GLU B N     1 
ATOM   2569 C  CA    . GLU F 3 13  ? 16.874  10.482  -13.494 1.00 32.95 ? 14  GLU B CA    1 
ATOM   2570 C  C     . GLU F 3 13  ? 17.224  9.254   -12.648 1.00 33.32 ? 14  GLU B C     1 
ATOM   2571 O  O     . GLU F 3 13  ? 17.909  9.363   -11.628 1.00 30.16 ? 14  GLU B O     1 
ATOM   2572 C  CB    . GLU F 3 13  ? 15.413  10.874  -13.264 1.00 30.87 ? 14  GLU B CB    1 
ATOM   2573 C  CG    . GLU F 3 13  ? 15.101  11.336  -11.843 1.00 44.23 ? 14  GLU B CG    1 
ATOM   2574 C  CD    . GLU F 3 13  ? 15.490  12.786  -11.575 1.00 51.27 ? 14  GLU B CD    1 
ATOM   2575 O  OE1   . GLU F 3 13  ? 16.355  13.330  -12.292 1.00 56.80 ? 14  GLU B OE1   1 
ATOM   2576 O  OE2   . GLU F 3 13  ? 14.922  13.387  -10.639 1.00 53.25 ? 14  GLU B OE2   1 
ATOM   2577 N  N     . ASN F 3 14  ? 16.761  8.087   -13.081 1.00 34.37 ? 15  ASN B N     1 
ATOM   2578 C  CA    . ASN F 3 14  ? 17.008  6.840   -12.362 1.00 38.43 ? 15  ASN B CA    1 
ATOM   2579 C  C     . ASN F 3 14  ? 18.495  6.493   -12.285 1.00 40.64 ? 15  ASN B C     1 
ATOM   2580 O  O     . ASN F 3 14  ? 18.974  5.914   -11.306 1.00 39.88 ? 15  ASN B O     1 
ATOM   2581 C  CB    . ASN F 3 14  ? 16.251  5.693   -13.035 1.00 42.58 ? 15  ASN B CB    1 
ATOM   2582 C  CG    . ASN F 3 14  ? 16.342  4.399   -12.253 1.00 45.74 ? 15  ASN B CG    1 
ATOM   2583 O  OD1   . ASN F 3 14  ? 15.796  4.290   -11.153 1.00 48.28 ? 15  ASN B OD1   1 
ATOM   2584 N  ND2   . ASN F 3 14  ? 17.032  3.411   -12.815 1.00 40.22 ? 15  ASN B ND2   1 
ATOM   2585 N  N     . GLN F 3 15  ? 19.222  6.853   -13.330 1.00 40.97 ? 16  GLN B N     1 
ATOM   2586 C  CA    . GLN F 3 15  ? 20.640  6.570   -13.391 1.00 43.56 ? 16  GLN B CA    1 
ATOM   2587 C  C     . GLN F 3 15  ? 21.464  7.555   -12.561 1.00 42.28 ? 16  GLN B C     1 
ATOM   2588 O  O     . GLN F 3 15  ? 22.546  7.212   -12.083 1.00 42.64 ? 16  GLN B O     1 
ATOM   2589 C  CB    . GLN F 3 15  ? 21.083  6.596   -14.842 1.00 49.01 ? 16  GLN B CB    1 
ATOM   2590 C  CG    . GLN F 3 15  ? 22.462  6.071   -15.080 1.00 64.52 ? 16  GLN B CG    1 
ATOM   2591 C  CD    . GLN F 3 15  ? 22.726  5.889   -16.547 1.00 76.96 ? 16  GLN B CD    1 
ATOM   2592 O  OE1   . GLN F 3 15  ? 23.285  4.879   -16.962 1.00 84.03 ? 16  GLN B OE1   1 
ATOM   2593 N  NE2   . GLN F 3 15  ? 22.318  6.866   -17.352 1.00 81.82 ? 16  GLN B NE2   1 
ATOM   2594 N  N     . LYS F 3 16  ? 20.955  8.771   -12.384 1.00 38.53 ? 17  LYS B N     1 
ATOM   2595 C  CA    . LYS F 3 16  ? 21.671  9.787   -11.618 1.00 39.43 ? 17  LYS B CA    1 
ATOM   2596 C  C     . LYS F 3 16  ? 21.385  9.834   -10.111 1.00 40.70 ? 17  LYS B C     1 
ATOM   2597 O  O     . LYS F 3 16  ? 22.285  10.129  -9.322  1.00 42.47 ? 17  LYS B O     1 
ATOM   2598 C  CB    . LYS F 3 16  ? 21.418  11.169  -12.219 1.00 38.00 ? 17  LYS B CB    1 
ATOM   2599 C  CG    . LYS F 3 16  ? 22.040  11.371  -13.583 1.00 52.77 ? 17  LYS B CG    1 
ATOM   2600 C  CD    . LYS F 3 16  ? 21.594  12.683  -14.202 1.00 63.69 ? 17  LYS B CD    1 
ATOM   2601 C  CE    . LYS F 3 16  ? 22.418  12.995  -15.447 1.00 74.25 ? 17  LYS B CE    1 
ATOM   2602 N  NZ    . LYS F 3 16  ? 21.865  14.151  -16.223 1.00 79.02 ? 17  LYS B NZ    1 
ATOM   2603 N  N     . TYR F 3 17  ? 20.149  9.550   -9.703  1.00 38.81 ? 18  TYR B N     1 
ATOM   2604 C  CA    . TYR F 3 17  ? 19.798  9.622   -8.282  1.00 37.72 ? 18  TYR B CA    1 
ATOM   2605 C  C     . TYR F 3 17  ? 19.342  8.325   -7.621  1.00 35.56 ? 18  TYR B C     1 
ATOM   2606 O  O     . TYR F 3 17  ? 18.624  7.522   -8.214  1.00 37.06 ? 18  TYR B O     1 
ATOM   2607 C  CB    . TYR F 3 17  ? 18.734  10.712  -8.049  1.00 37.13 ? 18  TYR B CB    1 
ATOM   2608 C  CG    . TYR F 3 17  ? 19.120  12.051  -8.635  1.00 42.12 ? 18  TYR B CG    1 
ATOM   2609 C  CD1   . TYR F 3 17  ? 20.038  12.877  -7.990  1.00 44.46 ? 18  TYR B CD1   1 
ATOM   2610 C  CD2   . TYR F 3 17  ? 18.595  12.476  -9.857  1.00 47.19 ? 18  TYR B CD2   1 
ATOM   2611 C  CE1   . TYR F 3 17  ? 20.430  14.087  -8.546  1.00 47.34 ? 18  TYR B CE1   1 
ATOM   2612 C  CE2   . TYR F 3 17  ? 18.979  13.685  -10.423 1.00 43.74 ? 18  TYR B CE2   1 
ATOM   2613 C  CZ    . TYR F 3 17  ? 19.898  14.484  -9.765  1.00 47.80 ? 18  TYR B CZ    1 
ATOM   2614 O  OH    . TYR F 3 17  ? 20.289  15.676  -10.329 1.00 50.16 ? 18  TYR B OH    1 
ATOM   2615 N  N     . ASP F 3 18  ? 19.779  8.143   -6.377  1.00 32.95 ? 19  ASP B N     1 
ATOM   2616 C  CA    . ASP F 3 18  ? 19.420  6.986   -5.568  1.00 31.40 ? 19  ASP B CA    1 
ATOM   2617 C  C     . ASP F 3 18  ? 18.729  7.525   -4.326  1.00 29.02 ? 19  ASP B C     1 
ATOM   2618 O  O     . ASP F 3 18  ? 19.325  8.299   -3.573  1.00 28.03 ? 19  ASP B O     1 
ATOM   2619 C  CB    . ASP F 3 18  ? 20.666  6.208   -5.141  1.00 34.08 ? 19  ASP B CB    1 
ATOM   2620 C  CG    . ASP F 3 18  ? 21.242  5.351   -6.259  1.00 47.91 ? 19  ASP B CG    1 
ATOM   2621 O  OD1   . ASP F 3 18  ? 20.462  4.655   -6.946  1.00 60.57 ? 19  ASP B OD1   1 
ATOM   2622 O  OD2   . ASP F 3 18  ? 22.480  5.370   -6.447  1.00 51.85 ? 19  ASP B OD2   1 
ATOM   2623 N  N     . VAL F 3 19  ? 17.480  7.132   -4.116  1.00 26.38 ? 20  VAL B N     1 
ATOM   2624 C  CA    . VAL F 3 19  ? 16.728  7.578   -2.946  1.00 26.85 ? 20  VAL B CA    1 
ATOM   2625 C  C     . VAL F 3 19  ? 17.227  6.794   -1.726  1.00 25.27 ? 20  VAL B C     1 
ATOM   2626 O  O     . VAL F 3 19  ? 17.406  5.573   -1.805  1.00 21.34 ? 20  VAL B O     1 
ATOM   2627 C  CB    . VAL F 3 19  ? 15.209  7.350   -3.137  1.00 30.10 ? 20  VAL B CB    1 
ATOM   2628 C  CG1   . VAL F 3 19  ? 14.456  7.746   -1.878  1.00 41.76 ? 20  VAL B CG1   1 
ATOM   2629 C  CG2   . VAL F 3 19  ? 14.707  8.174   -4.305  1.00 30.74 ? 20  VAL B CG2   1 
ATOM   2630 N  N     . CYS F 3 20  ? 17.454  7.481   -0.604  1.00 24.58 ? 21  CYS B N     1 
ATOM   2631 C  CA    . CYS F 3 20  ? 17.958  6.792   0.584   1.00 26.04 ? 21  CYS B CA    1 
ATOM   2632 C  C     . CYS F 3 20  ? 17.261  7.068   1.916   1.00 23.78 ? 21  CYS B C     1 
ATOM   2633 O  O     . CYS F 3 20  ? 17.596  6.446   2.919   1.00 25.02 ? 21  CYS B O     1 
ATOM   2634 C  CB    . CYS F 3 20  ? 19.467  7.016   0.727   1.00 25.81 ? 21  CYS B CB    1 
ATOM   2635 S  SG    . CYS F 3 20  ? 19.933  8.726   0.955   1.00 30.49 ? 21  CYS B SG    1 
ATOM   2636 N  N     . GLY F 3 21  ? 16.299  7.980   1.949   1.00 21.86 ? 22  GLY B N     1 
ATOM   2637 C  CA    . GLY F 3 21  ? 15.616  8.217   3.206   1.00 19.50 ? 22  GLY B CA    1 
ATOM   2638 C  C     . GLY F 3 21  ? 14.532  9.257   3.110   1.00 19.46 ? 22  GLY B C     1 
ATOM   2639 O  O     . GLY F 3 21  ? 14.369  9.893   2.062   1.00 17.88 ? 22  GLY B O     1 
ATOM   2640 N  N     . ILE F 3 22  ? 13.765  9.420   4.183   1.00 15.88 ? 23  ILE B N     1 
ATOM   2641 C  CA    . ILE F 3 22  ? 12.746  10.454  4.205   1.00 16.43 ? 23  ILE B CA    1 
ATOM   2642 C  C     . ILE F 3 22  ? 13.367  11.545  5.080   1.00 18.20 ? 23  ILE B C     1 
ATOM   2643 O  O     . ILE F 3 22  ? 14.062  11.250  6.058   1.00 15.79 ? 23  ILE B O     1 
ATOM   2644 C  CB    . ILE F 3 22  ? 11.382  9.953   4.755   1.00 22.66 ? 23  ILE B CB    1 
ATOM   2645 C  CG1   . ILE F 3 22  ? 11.535  9.403   6.167   1.00 35.24 ? 23  ILE B CG1   1 
ATOM   2646 C  CG2   . ILE F 3 22  ? 10.804  8.866   3.827   1.00 16.98 ? 23  ILE B CG2   1 
ATOM   2647 C  CD1   . ILE F 3 22  ? 10.241  8.852   6.741   1.00 48.56 ? 23  ILE B CD1   1 
ATOM   2648 N  N     . ILE F 3 23  ? 13.141  12.800  4.726   1.00 18.38 ? 24  ILE B N     1 
ATOM   2649 C  CA    . ILE F 3 23  ? 13.736  13.889  5.474   1.00 19.81 ? 24  ILE B CA    1 
ATOM   2650 C  C     . ILE F 3 23  ? 12.711  14.830  6.082   1.00 20.18 ? 24  ILE B C     1 
ATOM   2651 O  O     . ILE F 3 23  ? 11.675  15.111  5.477   1.00 18.36 ? 24  ILE B O     1 
ATOM   2652 C  CB    . ILE F 3 23  ? 14.725  14.665  4.580   1.00 22.73 ? 24  ILE B CB    1 
ATOM   2653 C  CG1   . ILE F 3 23  ? 15.429  15.749  5.397   1.00 23.25 ? 24  ILE B CG1   1 
ATOM   2654 C  CG2   . ILE F 3 23  ? 14.000  15.241  3.365   1.00 20.96 ? 24  ILE B CG2   1 
ATOM   2655 C  CD1   . ILE F 3 23  ? 16.673  16.271  4.737   1.00 24.39 ? 24  ILE B CD1   1 
ATOM   2656 N  N     . SER F 3 24  ? 12.996  15.302  7.293   1.00 21.85 ? 25  SER B N     1 
ATOM   2657 C  CA    . SER F 3 24  ? 12.099  16.220  7.970   1.00 24.70 ? 25  SER B CA    1 
ATOM   2658 C  C     . SER F 3 24  ? 12.606  17.631  7.699   1.00 27.64 ? 25  SER B C     1 
ATOM   2659 O  O     . SER F 3 24  ? 13.784  17.819  7.380   1.00 27.18 ? 25  SER B O     1 
ATOM   2660 C  CB    . SER F 3 24  ? 12.062  15.929  9.477   1.00 20.58 ? 25  SER B CB    1 
ATOM   2661 O  OG    . SER F 3 24  ? 13.305  16.190  10.096  1.00 26.76 ? 25  SER B OG    1 
ATOM   2662 N  N     . ALA F 3 25  ? 11.719  18.614  7.822   1.00 30.09 ? 26  ALA B N     1 
ATOM   2663 C  CA    . ALA F 3 25  ? 12.065  20.019  7.591   1.00 32.86 ? 26  ALA B CA    1 
ATOM   2664 C  C     . ALA F 3 25  ? 13.177  20.502  8.523   1.00 32.74 ? 26  ALA B C     1 
ATOM   2665 O  O     . ALA F 3 25  ? 13.841  21.504  8.251   1.00 34.18 ? 26  ALA B O     1 
ATOM   2666 C  CB    . ALA F 3 25  ? 10.817  20.894  7.763   1.00 32.96 ? 26  ALA B CB    1 
ATOM   2667 N  N     . GLU F 3 26  ? 13.364  19.773  9.619   1.00 32.67 ? 27  GLU B N     1 
ATOM   2668 C  CA    . GLU F 3 26  ? 14.361  20.086  10.630  1.00 30.97 ? 27  GLU B CA    1 
ATOM   2669 C  C     . GLU F 3 26  ? 15.735  19.530  10.253  1.00 32.03 ? 27  GLU B C     1 
ATOM   2670 O  O     . GLU F 3 26  ? 16.718  19.799  10.943  1.00 31.68 ? 27  GLU B O     1 
ATOM   2671 C  CB    . GLU F 3 26  ? 13.916  19.519  11.987  1.00 32.36 ? 27  GLU B CB    1 
ATOM   2672 C  CG    . GLU F 3 26  ? 12.563  20.062  12.513  1.00 36.09 ? 27  GLU B CG    1 
ATOM   2673 C  CD    . GLU F 3 26  ? 11.334  19.650  11.680  1.00 39.39 ? 27  GLU B CD    1 
ATOM   2674 O  OE1   . GLU F 3 26  ? 11.312  18.540  11.105  1.00 41.40 ? 27  GLU B OE1   1 
ATOM   2675 O  OE2   . GLU F 3 26  ? 10.375  20.446  11.601  1.00 36.39 ? 27  GLU B OE2   1 
ATOM   2676 N  N     . GLY F 3 27  ? 15.799  18.756  9.167   1.00 29.38 ? 28  GLY B N     1 
ATOM   2677 C  CA    . GLY F 3 27  ? 17.063  18.189  8.717   1.00 27.59 ? 28  GLY B CA    1 
ATOM   2678 C  C     . GLY F 3 27  ? 17.405  16.782  9.196   1.00 28.86 ? 28  GLY B C     1 
ATOM   2679 O  O     . GLY F 3 27  ? 18.513  16.281  8.930   1.00 28.46 ? 28  GLY B O     1 
ATOM   2680 N  N     . LYS F 3 28  ? 16.476  16.138  9.901   1.00 26.53 ? 29  LYS B N     1 
ATOM   2681 C  CA    . LYS F 3 28  ? 16.704  14.782  10.394  1.00 28.23 ? 29  LYS B CA    1 
ATOM   2682 C  C     . LYS F 3 28  ? 16.275  13.801  9.291   1.00 24.74 ? 29  LYS B C     1 
ATOM   2683 O  O     . LYS F 3 28  ? 15.229  13.981  8.674   1.00 26.00 ? 29  LYS B O     1 
ATOM   2684 C  CB    . LYS F 3 28  ? 15.895  14.553  11.668  1.00 28.71 ? 29  LYS B CB    1 
ATOM   2685 C  CG    . LYS F 3 28  ? 16.369  13.398  12.516  1.00 33.15 ? 29  LYS B CG    1 
ATOM   2686 C  CD    . LYS F 3 28  ? 15.521  13.310  13.775  1.00 46.27 ? 29  LYS B CD    1 
ATOM   2687 C  CE    . LYS F 3 28  ? 16.100  12.353  14.800  1.00 50.28 ? 29  LYS B CE    1 
ATOM   2688 N  NZ    . LYS F 3 28  ? 15.175  12.193  15.955  1.00 47.96 ? 29  LYS B NZ    1 
ATOM   2689 N  N     . ILE F 3 29  ? 17.079  12.772  9.050   1.00 23.29 ? 30  ILE B N     1 
ATOM   2690 C  CA    . ILE F 3 29  ? 16.799  11.792  8.000   1.00 20.85 ? 30  ILE B CA    1 
ATOM   2691 C  C     . ILE F 3 29  ? 16.497  10.385  8.529   1.00 20.77 ? 30  ILE B C     1 
ATOM   2692 O  O     . ILE F 3 29  ? 17.296  9.802   9.258   1.00 20.26 ? 30  ILE B O     1 
ATOM   2693 C  CB    . ILE F 3 29  ? 17.989  11.733  7.005   1.00 19.83 ? 30  ILE B CB    1 
ATOM   2694 C  CG1   . ILE F 3 29  ? 18.160  13.100  6.324   1.00 18.71 ? 30  ILE B CG1   1 
ATOM   2695 C  CG2   . ILE F 3 29  ? 17.767  10.645  5.963   1.00 18.60 ? 30  ILE B CG2   1 
ATOM   2696 C  CD1   . ILE F 3 29  ? 19.441  13.242  5.518   1.00 24.62 ? 30  ILE B CD1   1 
ATOM   2697 N  N     . TYR F 3 30  ? 15.339  9.848   8.154   1.00 19.22 ? 31  TYR B N     1 
ATOM   2698 C  CA    . TYR F 3 30  ? 14.923  8.506   8.573   1.00 20.80 ? 31  TYR B CA    1 
ATOM   2699 C  C     . TYR F 3 30  ? 15.175  7.542   7.403   1.00 22.55 ? 31  TYR B C     1 
ATOM   2700 O  O     . TYR F 3 30  ? 14.690  7.773   6.288   1.00 21.36 ? 31  TYR B O     1 
ATOM   2701 C  CB    . TYR F 3 30  ? 13.432  8.510   8.957   1.00 19.00 ? 31  TYR B CB    1 
ATOM   2702 C  CG    . TYR F 3 30  ? 13.076  9.534   10.015  1.00 23.39 ? 31  TYR B CG    1 
ATOM   2703 C  CD1   . TYR F 3 30  ? 12.980  10.890  9.690   1.00 18.64 ? 31  TYR B CD1   1 
ATOM   2704 C  CD2   . TYR F 3 30  ? 12.862  9.154   11.349  1.00 20.63 ? 31  TYR B CD2   1 
ATOM   2705 C  CE1   . TYR F 3 30  ? 12.683  11.849  10.666  1.00 24.04 ? 31  TYR B CE1   1 
ATOM   2706 C  CE2   . TYR F 3 30  ? 12.563  10.107  12.333  1.00 22.66 ? 31  TYR B CE2   1 
ATOM   2707 C  CZ    . TYR F 3 30  ? 12.477  11.450  11.981  1.00 27.87 ? 31  TYR B CZ    1 
ATOM   2708 O  OH    . TYR F 3 30  ? 12.184  12.398  12.932  1.00 31.80 ? 31  TYR B OH    1 
ATOM   2709 N  N     . PRO F 3 31  ? 15.931  6.452   7.641   1.00 22.42 ? 32  PRO B N     1 
ATOM   2710 C  CA    . PRO F 3 31  ? 16.231  5.482   6.584   1.00 22.21 ? 32  PRO B CA    1 
ATOM   2711 C  C     . PRO F 3 31  ? 15.003  4.716   6.066   1.00 21.27 ? 32  PRO B C     1 
ATOM   2712 O  O     . PRO F 3 31  ? 13.927  4.757   6.667   1.00 17.41 ? 32  PRO B O     1 
ATOM   2713 C  CB    . PRO F 3 31  ? 17.288  4.581   7.233   1.00 22.49 ? 32  PRO B CB    1 
ATOM   2714 C  CG    . PRO F 3 31  ? 16.905  4.586   8.646   1.00 23.22 ? 32  PRO B CG    1 
ATOM   2715 C  CD    . PRO F 3 31  ? 16.550  6.039   8.912   1.00 26.25 ? 32  PRO B CD    1 
ATOM   2716 N  N     . LEU F 3 32  ? 15.179  4.028   4.943   1.00 25.00 ? 33  LEU B N     1 
ATOM   2717 C  CA    . LEU F 3 32  ? 14.105  3.282   4.302   1.00 27.63 ? 33  LEU B CA    1 
ATOM   2718 C  C     . LEU F 3 32  ? 14.093  1.801   4.668   1.00 31.02 ? 33  LEU B C     1 
ATOM   2719 O  O     . LEU F 3 32  ? 15.069  1.261   5.196   1.00 33.83 ? 33  LEU B O     1 
ATOM   2720 C  CB    . LEU F 3 32  ? 14.224  3.416   2.771   1.00 26.98 ? 33  LEU B CB    1 
ATOM   2721 C  CG    . LEU F 3 32  ? 14.243  4.810   2.113   1.00 33.59 ? 33  LEU B CG    1 
ATOM   2722 C  CD1   . LEU F 3 32  ? 14.584  4.675   0.633   1.00 27.26 ? 33  LEU B CD1   1 
ATOM   2723 C  CD2   . LEU F 3 32  ? 12.896  5.523   2.291   1.00 27.48 ? 33  LEU B CD2   1 
ATOM   2724 N  N     . GLY F 3 33  ? 12.962  1.160   4.386   1.00 34.84 ? 34  GLY B N     1 
ATOM   2725 C  CA    . GLY F 3 33  ? 12.808  -0.272  4.597   1.00 36.48 ? 34  GLY B CA    1 
ATOM   2726 C  C     . GLY F 3 33  ? 13.016  -0.917  3.221   1.00 37.98 ? 34  GLY B C     1 
ATOM   2727 O  O     . GLY F 3 33  ? 12.951  -0.216  2.203   1.00 35.16 ? 34  GLY B O     1 
ATOM   2728 N  N     . SER F 3 34  ? 13.248  -2.229  3.173   1.00 39.96 ? 35  SER B N     1 
ATOM   2729 C  CA    . SER F 3 34  ? 13.504  -2.930  1.906   1.00 40.27 ? 35  SER B CA    1 
ATOM   2730 C  C     . SER F 3 34  ? 12.347  -3.687  1.219   1.00 39.36 ? 35  SER B C     1 
ATOM   2731 O  O     . SER F 3 34  ? 12.556  -4.361  0.211   1.00 39.34 ? 35  SER B O     1 
ATOM   2732 C  CB    . SER F 3 34  ? 14.694  -3.879  2.106   1.00 43.32 ? 35  SER B CB    1 
ATOM   2733 O  OG    . SER F 3 34  ? 14.587  -4.567  3.352   1.00 50.17 ? 35  SER B OG    1 
ATOM   2734 N  N     . ASP F 3 35  ? 11.137  -3.579  1.754   1.00 36.96 ? 36  ASP B N     1 
ATOM   2735 C  CA    . ASP F 3 35  ? 9.996   -4.270  1.176   1.00 36.11 ? 36  ASP B CA    1 
ATOM   2736 C  C     . ASP F 3 35  ? 9.328   -3.429  0.086   1.00 34.66 ? 36  ASP B C     1 
ATOM   2737 O  O     . ASP F 3 35  ? 9.479   -2.205  0.049   1.00 35.52 ? 36  ASP B O     1 
ATOM   2738 C  CB    . ASP F 3 35  ? 8.999   -4.627  2.275   1.00 43.36 ? 36  ASP B CB    1 
ATOM   2739 C  CG    . ASP F 3 35  ? 8.699   -3.461  3.184   1.00 59.55 ? 36  ASP B CG    1 
ATOM   2740 O  OD1   . ASP F 3 35  ? 7.843   -2.638  2.811   1.00 73.85 ? 36  ASP B OD1   1 
ATOM   2741 O  OD2   . ASP F 3 35  ? 9.317   -3.361  4.266   1.00 68.03 ? 36  ASP B OD2   1 
ATOM   2742 N  N     . THR F 3 36  ? 8.586   -4.087  -0.799  1.00 31.39 ? 37  THR B N     1 
ATOM   2743 C  CA    . THR F 3 36  ? 7.915   -3.400  -1.898  1.00 29.72 ? 37  THR B CA    1 
ATOM   2744 C  C     . THR F 3 36  ? 6.881   -2.399  -1.407  1.00 30.58 ? 37  THR B C     1 
ATOM   2745 O  O     . THR F 3 36  ? 6.603   -1.416  -2.095  1.00 30.53 ? 37  THR B O     1 
ATOM   2746 C  CB    . THR F 3 36  ? 7.252   -4.397  -2.877  1.00 28.47 ? 37  THR B CB    1 
ATOM   2747 O  OG1   . THR F 3 36  ? 8.169   -5.468  -3.152  1.00 20.70 ? 37  THR B OG1   1 
ATOM   2748 C  CG2   . THR F 3 36  ? 6.879   -3.697  -4.192  1.00 25.58 ? 37  THR B CG2   1 
ATOM   2749 N  N     . LYS F 3 37  ? 6.321   -2.644  -0.223  1.00 28.05 ? 38  LYS B N     1 
ATOM   2750 C  CA    . LYS F 3 37  ? 5.340   -1.739  0.362   1.00 24.43 ? 38  LYS B CA    1 
ATOM   2751 C  C     . LYS F 3 37  ? 5.973   -0.340  0.461   1.00 24.60 ? 38  LYS B C     1 
ATOM   2752 O  O     . LYS F 3 37  ? 5.327   0.680   0.174   1.00 24.66 ? 38  LYS B O     1 
ATOM   2753 C  CB    . LYS F 3 37  ? 4.936   -2.243  1.752   1.00 27.94 ? 38  LYS B CB    1 
ATOM   2754 C  CG    . LYS F 3 37  ? 4.130   -1.251  2.585   1.00 29.72 ? 38  LYS B CG    1 
ATOM   2755 C  CD    . LYS F 3 37  ? 4.052   -1.696  4.035   1.00 32.49 ? 38  LYS B CD    1 
ATOM   2756 C  CE    . LYS F 3 37  ? 5.442   -1.830  4.634   1.00 29.34 ? 38  LYS B CE    1 
ATOM   2757 N  NZ    . LYS F 3 37  ? 5.416   -2.405  6.002   1.00 31.50 ? 38  LYS B NZ    1 
ATOM   2758 N  N     . VAL F 3 38  ? 7.242   -0.300  0.862   1.00 19.91 ? 39  VAL B N     1 
ATOM   2759 C  CA    . VAL F 3 38  ? 7.950   0.957   0.992   1.00 21.28 ? 39  VAL B CA    1 
ATOM   2760 C  C     . VAL F 3 38  ? 8.414   1.493   -0.371  1.00 20.02 ? 39  VAL B C     1 
ATOM   2761 O  O     . VAL F 3 38  ? 8.141   2.644   -0.719  1.00 17.23 ? 39  VAL B O     1 
ATOM   2762 C  CB    . VAL F 3 38  ? 9.141   0.802   1.974   1.00 23.51 ? 39  VAL B CB    1 
ATOM   2763 C  CG1   . VAL F 3 38  ? 10.168  1.921   1.779   1.00 23.86 ? 39  VAL B CG1   1 
ATOM   2764 C  CG2   . VAL F 3 38  ? 8.612   0.831   3.406   1.00 25.67 ? 39  VAL B CG2   1 
ATOM   2765 N  N     . LEU F 3 39  ? 9.102   0.652   -1.137  1.00 17.18 ? 40  LEU B N     1 
ATOM   2766 C  CA    . LEU F 3 39  ? 9.625   1.046   -2.436  1.00 18.24 ? 40  LEU B CA    1 
ATOM   2767 C  C     . LEU F 3 39  ? 8.591   1.401   -3.505  1.00 18.59 ? 40  LEU B C     1 
ATOM   2768 O  O     . LEU F 3 39  ? 8.835   2.278   -4.333  1.00 19.20 ? 40  LEU B O     1 
ATOM   2769 C  CB    . LEU F 3 39  ? 10.615  -0.010  -2.923  1.00 19.91 ? 40  LEU B CB    1 
ATOM   2770 C  CG    . LEU F 3 39  ? 11.845  0.015   -2.006  1.00 24.68 ? 40  LEU B CG    1 
ATOM   2771 C  CD1   . LEU F 3 39  ? 12.732  -1.169  -2.237  1.00 21.35 ? 40  LEU B CD1   1 
ATOM   2772 C  CD2   . LEU F 3 39  ? 12.609  1.305   -2.238  1.00 29.45 ? 40  LEU B CD2   1 
ATOM   2773 N  N     . SER F 3 40  ? 7.434   0.752   -3.494  1.00 16.61 ? 41  SER B N     1 
ATOM   2774 C  CA    . SER F 3 40  ? 6.416   1.091   -4.477  1.00 19.86 ? 41  SER B CA    1 
ATOM   2775 C  C     . SER F 3 40  ? 6.002   2.547   -4.256  1.00 19.29 ? 41  SER B C     1 
ATOM   2776 O  O     . SER F 3 40  ? 5.803   3.297   -5.213  1.00 21.00 ? 41  SER B O     1 
ATOM   2777 C  CB    . SER F 3 40  ? 5.196   0.165   -4.360  1.00 22.97 ? 41  SER B CB    1 
ATOM   2778 O  OG    . SER F 3 40  ? 4.608   0.233   -3.070  1.00 26.69 ? 41  SER B OG    1 
ATOM   2779 N  N     . THR F 3 41  ? 5.878   2.948   -2.993  1.00 18.58 ? 42  THR B N     1 
ATOM   2780 C  CA    . THR F 3 41  ? 5.488   4.319   -2.668  1.00 17.51 ? 42  THR B CA    1 
ATOM   2781 C  C     . THR F 3 41  ? 6.595   5.306   -3.058  1.00 15.24 ? 42  THR B C     1 
ATOM   2782 O  O     . THR F 3 41  ? 6.322   6.363   -3.627  1.00 16.99 ? 42  THR B O     1 
ATOM   2783 C  CB    . THR F 3 41  ? 5.156   4.479   -1.156  1.00 22.88 ? 42  THR B CB    1 
ATOM   2784 O  OG1   . THR F 3 41  ? 4.047   3.638   -0.811  1.00 23.34 ? 42  THR B OG1   1 
ATOM   2785 C  CG2   . THR F 3 41  ? 4.785   5.917   -0.843  1.00 21.55 ? 42  THR B CG2   1 
ATOM   2786 N  N     . ILE F 3 42  ? 7.840   4.960   -2.759  1.00 13.98 ? 43  ILE B N     1 
ATOM   2787 C  CA    . ILE F 3 42  ? 8.968   5.827   -3.087  1.00 17.92 ? 43  ILE B CA    1 
ATOM   2788 C  C     . ILE F 3 42  ? 9.117   6.065   -4.605  1.00 21.53 ? 43  ILE B C     1 
ATOM   2789 O  O     . ILE F 3 42  ? 9.225   7.213   -5.047  1.00 22.10 ? 43  ILE B O     1 
ATOM   2790 C  CB    . ILE F 3 42  ? 10.292  5.272   -2.459  1.00 20.96 ? 43  ILE B CB    1 
ATOM   2791 C  CG1   . ILE F 3 42  ? 10.478  5.839   -1.049  1.00 26.10 ? 43  ILE B CG1   1 
ATOM   2792 C  CG2   . ILE F 3 42  ? 11.510  5.682   -3.263  1.00 27.72 ? 43  ILE B CG2   1 
ATOM   2793 C  CD1   . ILE F 3 42  ? 9.371   5.529   -0.110  1.00 23.61 ? 43  ILE B CD1   1 
ATOM   2794 N  N     . PHE F 3 43  ? 9.109   4.990   -5.393  1.00 20.39 ? 44  PHE B N     1 
ATOM   2795 C  CA    . PHE F 3 43  ? 9.249   5.088   -6.847  1.00 19.66 ? 44  PHE B CA    1 
ATOM   2796 C  C     . PHE F 3 43  ? 8.147   5.902   -7.498  1.00 18.62 ? 44  PHE B C     1 
ATOM   2797 O  O     . PHE F 3 43  ? 8.365   6.576   -8.498  1.00 19.62 ? 44  PHE B O     1 
ATOM   2798 C  CB    . PHE F 3 43  ? 9.328   3.697   -7.458  1.00 17.29 ? 44  PHE B CB    1 
ATOM   2799 C  CG    . PHE F 3 43  ? 10.574  2.958   -7.082  1.00 19.57 ? 44  PHE B CG    1 
ATOM   2800 C  CD1   . PHE F 3 43  ? 11.788  3.632   -6.985  1.00 15.80 ? 44  PHE B CD1   1 
ATOM   2801 C  CD2   . PHE F 3 43  ? 10.539  1.594   -6.814  1.00 19.83 ? 44  PHE B CD2   1 
ATOM   2802 C  CE1   . PHE F 3 43  ? 12.943  2.955   -6.624  1.00 20.08 ? 44  PHE B CE1   1 
ATOM   2803 C  CE2   . PHE F 3 43  ? 11.690  0.907   -6.452  1.00 18.80 ? 44  PHE B CE2   1 
ATOM   2804 C  CZ    . PHE F 3 43  ? 12.895  1.585   -6.355  1.00 15.05 ? 44  PHE B CZ    1 
ATOM   2805 N  N     . GLU F 3 44  ? 6.958   5.846   -6.924  1.00 19.29 ? 45  GLU B N     1 
ATOM   2806 C  CA    . GLU F 3 44  ? 5.846   6.626   -7.437  1.00 20.02 ? 45  GLU B CA    1 
ATOM   2807 C  C     . GLU F 3 44  ? 6.133   8.124   -7.202  1.00 21.22 ? 45  GLU B C     1 
ATOM   2808 O  O     . GLU F 3 44  ? 5.954   8.951   -8.102  1.00 19.99 ? 45  GLU B O     1 
ATOM   2809 C  CB    . GLU F 3 44  ? 4.579   6.186   -6.724  1.00 20.51 ? 45  GLU B CB    1 
ATOM   2810 C  CG    . GLU F 3 44  ? 3.303   6.701   -7.312  1.00 29.58 ? 45  GLU B CG    1 
ATOM   2811 C  CD    . GLU F 3 44  ? 2.104   6.027   -6.689  1.00 33.84 ? 45  GLU B CD    1 
ATOM   2812 O  OE1   . GLU F 3 44  ? 2.065   5.884   -5.444  1.00 41.59 ? 45  GLU B OE1   1 
ATOM   2813 O  OE2   . GLU F 3 44  ? 1.202   5.634   -7.448  1.00 26.34 ? 45  GLU B OE2   1 
ATOM   2814 N  N     . LEU F 3 45  ? 6.589   8.470   -5.995  1.00 19.29 ? 46  LEU B N     1 
ATOM   2815 C  CA    . LEU F 3 45  ? 6.919   9.862   -5.653  1.00 17.90 ? 46  LEU B CA    1 
ATOM   2816 C  C     . LEU F 3 45  ? 8.118   10.370  -6.467  1.00 15.70 ? 46  LEU B C     1 
ATOM   2817 O  O     . LEU F 3 45  ? 8.177   11.532  -6.854  1.00 17.52 ? 46  LEU B O     1 
ATOM   2818 C  CB    . LEU F 3 45  ? 7.238   9.988   -4.153  1.00 23.18 ? 46  LEU B CB    1 
ATOM   2819 C  CG    . LEU F 3 45  ? 6.092   9.856   -3.145  1.00 25.84 ? 46  LEU B CG    1 
ATOM   2820 C  CD1   . LEU F 3 45  ? 6.653   9.871   -1.729  1.00 25.28 ? 46  LEU B CD1   1 
ATOM   2821 C  CD2   . LEU F 3 45  ? 5.091   10.979  -3.346  1.00 21.35 ? 46  LEU B CD2   1 
ATOM   2822 N  N     . PHE F 3 46  ? 9.074   9.485   -6.711  1.00 14.14 ? 47  PHE B N     1 
ATOM   2823 C  CA    . PHE F 3 46  ? 10.272  9.790   -7.484  1.00 18.01 ? 47  PHE B CA    1 
ATOM   2824 C  C     . PHE F 3 46  ? 9.902   10.144  -8.948  1.00 18.36 ? 47  PHE B C     1 
ATOM   2825 O  O     . PHE F 3 46  ? 10.587  10.943  -9.598  1.00 17.97 ? 47  PHE B O     1 
ATOM   2826 C  CB    . PHE F 3 46  ? 11.203  8.566   -7.432  1.00 12.14 ? 47  PHE B CB    1 
ATOM   2827 C  CG    . PHE F 3 46  ? 12.503  8.730   -8.177  1.00 21.79 ? 47  PHE B CG    1 
ATOM   2828 C  CD1   . PHE F 3 46  ? 13.537  9.501   -7.653  1.00 21.03 ? 47  PHE B CD1   1 
ATOM   2829 C  CD2   . PHE F 3 46  ? 12.706  8.083   -9.395  1.00 30.35 ? 47  PHE B CD2   1 
ATOM   2830 C  CE1   . PHE F 3 46  ? 14.757  9.623   -8.331  1.00 24.60 ? 47  PHE B CE1   1 
ATOM   2831 C  CE2   . PHE F 3 46  ? 13.921  8.199   -10.080 1.00 28.09 ? 47  PHE B CE2   1 
ATOM   2832 C  CZ    . PHE F 3 46  ? 14.946  8.970   -9.544  1.00 23.58 ? 47  PHE B CZ    1 
ATOM   2833 N  N     . SER F 3 47  ? 8.818   9.553   -9.445  1.00 18.10 ? 48  SER B N     1 
ATOM   2834 C  CA    . SER F 3 47  ? 8.349   9.772   -10.813 1.00 17.47 ? 48  SER B CA    1 
ATOM   2835 C  C     . SER F 3 47  ? 7.533   11.045  -11.060 1.00 19.22 ? 48  SER B C     1 
ATOM   2836 O  O     . SER F 3 47  ? 7.637   11.630  -12.143 1.00 18.75 ? 48  SER B O     1 
ATOM   2837 C  CB    . SER F 3 47  ? 7.508   8.576   -11.267 1.00 15.16 ? 48  SER B CB    1 
ATOM   2838 O  OG    . SER F 3 47  ? 8.199   7.361   -11.090 1.00 21.02 ? 48  SER B OG    1 
ATOM   2839 N  N     . ARG F 3 48  ? 6.727   11.469  -10.076 1.00 16.78 ? 49  ARG B N     1 
ATOM   2840 C  CA    . ARG F 3 48  ? 5.859   12.654  -10.212 1.00 15.41 ? 49  ARG B CA    1 
ATOM   2841 C  C     . ARG F 3 48  ? 6.508   13.898  -10.801 1.00 16.78 ? 49  ARG B C     1 
ATOM   2842 O  O     . ARG F 3 48  ? 5.972   14.484  -11.742 1.00 14.69 ? 49  ARG B O     1 
ATOM   2843 C  CB    . ARG F 3 48  ? 5.207   13.030  -8.874  1.00 23.20 ? 49  ARG B CB    1 
ATOM   2844 C  CG    . ARG F 3 48  ? 4.302   11.970  -8.302  1.00 36.29 ? 49  ARG B CG    1 
ATOM   2845 C  CD    . ARG F 3 48  ? 3.948   12.250  -6.846  1.00 39.02 ? 49  ARG B CD    1 
ATOM   2846 N  NE    . ARG F 3 48  ? 2.844   13.189  -6.686  1.00 34.19 ? 49  ARG B NE    1 
ATOM   2847 C  CZ    . ARG F 3 48  ? 2.965   14.409  -6.173  1.00 34.46 ? 49  ARG B CZ    1 
ATOM   2848 N  NH1   . ARG F 3 48  ? 4.145   14.862  -5.784  1.00 39.42 ? 49  ARG B NH1   1 
ATOM   2849 N  NH2   . ARG F 3 48  ? 1.903   15.186  -6.053  1.00 42.42 ? 49  ARG B NH2   1 
ATOM   2850 N  N     . PRO F 3 49  ? 7.663   14.331  -10.253 1.00 18.74 ? 50  PRO B N     1 
ATOM   2851 C  CA    . PRO F 3 49  ? 8.337   15.525  -10.781 1.00 19.98 ? 50  PRO B CA    1 
ATOM   2852 C  C     . PRO F 3 49  ? 8.735   15.391  -12.270 1.00 22.66 ? 50  PRO B C     1 
ATOM   2853 O  O     . PRO F 3 49  ? 8.567   16.335  -13.057 1.00 20.54 ? 50  PRO B O     1 
ATOM   2854 C  CB    . PRO F 3 49  ? 9.573   15.653  -9.879  1.00 18.95 ? 50  PRO B CB    1 
ATOM   2855 C  CG    . PRO F 3 49  ? 9.148   14.979  -8.600  1.00 24.76 ? 50  PRO B CG    1 
ATOM   2856 C  CD    . PRO F 3 49  ? 8.419   13.770  -9.115  1.00 15.37 ? 50  PRO B CD    1 
ATOM   2857 N  N     . ILE F 3 50  ? 9.262   14.223  -12.642 1.00 20.11 ? 51  ILE B N     1 
ATOM   2858 C  CA    . ILE F 3 50  ? 9.681   13.963  -14.016 1.00 24.19 ? 51  ILE B CA    1 
ATOM   2859 C  C     . ILE F 3 50  ? 8.497   14.073  -14.979 1.00 23.78 ? 51  ILE B C     1 
ATOM   2860 O  O     . ILE F 3 50  ? 8.531   14.844  -15.938 1.00 24.77 ? 51  ILE B O     1 
ATOM   2861 C  CB    . ILE F 3 50  ? 10.267  12.562  -14.154 1.00 26.16 ? 51  ILE B CB    1 
ATOM   2862 C  CG1   . ILE F 3 50  ? 11.360  12.347  -13.110 1.00 35.71 ? 51  ILE B CG1   1 
ATOM   2863 C  CG2   . ILE F 3 50  ? 10.825  12.376  -15.551 1.00 25.76 ? 51  ILE B CG2   1 
ATOM   2864 C  CD1   . ILE F 3 50  ? 11.802  10.892  -12.999 1.00 39.64 ? 51  ILE B CD1   1 
ATOM   2865 N  N     . ILE F 3 51  ? 7.455   13.296  -14.706 1.00 23.46 ? 52  ILE B N     1 
ATOM   2866 C  CA    . ILE F 3 51  ? 6.242   13.283  -15.515 1.00 22.36 ? 52  ILE B CA    1 
ATOM   2867 C  C     . ILE F 3 51  ? 5.691   14.687  -15.724 1.00 23.90 ? 52  ILE B C     1 
ATOM   2868 O  O     . ILE F 3 51  ? 5.380   15.085  -16.840 1.00 25.83 ? 52  ILE B O     1 
ATOM   2869 C  CB    . ILE F 3 51  ? 5.155   12.382  -14.853 1.00 22.77 ? 52  ILE B CB    1 
ATOM   2870 C  CG1   . ILE F 3 51  ? 5.599   10.918  -14.932 1.00 18.10 ? 52  ILE B CG1   1 
ATOM   2871 C  CG2   . ILE F 3 51  ? 3.777   12.609  -15.500 1.00 17.42 ? 52  ILE B CG2   1 
ATOM   2872 C  CD1   . ILE F 3 51  ? 4.686   9.973   -14.236 1.00 24.18 ? 52  ILE B CD1   1 
ATOM   2873 N  N     . ASN F 3 52  ? 5.575   15.442  -14.647 1.00 22.11 ? 53  ASN B N     1 
ATOM   2874 C  CA    . ASN F 3 52  ? 5.047   16.790  -14.721 1.00 23.11 ? 53  ASN B CA    1 
ATOM   2875 C  C     . ASN F 3 52  ? 5.946   17.733  -15.540 1.00 25.45 ? 53  ASN B C     1 
ATOM   2876 O  O     . ASN F 3 52  ? 5.454   18.611  -16.255 1.00 26.04 ? 53  ASN B O     1 
ATOM   2877 C  CB    . ASN F 3 52  ? 4.855   17.337  -13.308 1.00 27.95 ? 53  ASN B CB    1 
ATOM   2878 C  CG    . ASN F 3 52  ? 4.004   18.570  -13.287 1.00 37.54 ? 53  ASN B CG    1 
ATOM   2879 O  OD1   . ASN F 3 52  ? 2.777   18.489  -13.358 1.00 40.57 ? 53  ASN B OD1   1 
ATOM   2880 N  ND2   . ASN F 3 52  ? 4.644   19.731  -13.189 1.00 39.06 ? 53  ASN B ND2   1 
ATOM   2881 N  N     . LYS F 3 53  ? 7.258   17.545  -15.438 1.00 24.53 ? 54  LYS B N     1 
ATOM   2882 C  CA    . LYS F 3 53  ? 8.209   18.374  -16.164 1.00 25.83 ? 54  LYS B CA    1 
ATOM   2883 C  C     . LYS F 3 53  ? 8.053   18.164  -17.668 1.00 28.12 ? 54  LYS B C     1 
ATOM   2884 O  O     . LYS F 3 53  ? 7.908   19.127  -18.430 1.00 25.13 ? 54  LYS B O     1 
ATOM   2885 C  CB    . LYS F 3 53  ? 9.632   18.022  -15.747 1.00 22.93 ? 54  LYS B CB    1 
ATOM   2886 C  CG    . LYS F 3 53  ? 10.689  18.948  -16.292 1.00 31.11 ? 54  LYS B CG    1 
ATOM   2887 C  CD    . LYS F 3 53  ? 12.063  18.382  -16.013 1.00 38.93 ? 54  LYS B CD    1 
ATOM   2888 C  CE    . LYS F 3 53  ? 13.154  19.271  -16.577 1.00 48.37 ? 54  LYS B CE    1 
ATOM   2889 N  NZ    . LYS F 3 53  ? 14.500  18.624  -16.473 1.00 48.76 ? 54  LYS B NZ    1 
ATOM   2890 N  N     . ILE F 3 54  ? 8.079   16.900  -18.085 1.00 27.63 ? 55  ILE B N     1 
ATOM   2891 C  CA    . ILE F 3 54  ? 7.946   16.543  -19.494 1.00 27.01 ? 55  ILE B CA    1 
ATOM   2892 C  C     . ILE F 3 54  ? 6.569   16.887  -20.046 1.00 25.91 ? 55  ILE B C     1 
ATOM   2893 O  O     . ILE F 3 54  ? 6.443   17.363  -21.175 1.00 26.92 ? 55  ILE B O     1 
ATOM   2894 C  CB    . ILE F 3 54  ? 8.242   15.049  -19.712 1.00 30.96 ? 55  ILE B CB    1 
ATOM   2895 C  CG1   . ILE F 3 54  ? 9.664   14.735  -19.236 1.00 28.45 ? 55  ILE B CG1   1 
ATOM   2896 C  CG2   . ILE F 3 54  ? 8.068   14.676  -21.187 1.00 34.58 ? 55  ILE B CG2   1 
ATOM   2897 C  CD1   . ILE F 3 54  ? 10.732  15.631  -19.853 1.00 31.26 ? 55  ILE B CD1   1 
ATOM   2898 N  N     . ALA F 3 55  ? 5.536   16.654  -19.249 1.00 25.16 ? 56  ALA B N     1 
ATOM   2899 C  CA    . ALA F 3 55  ? 4.184   16.953  -19.668 1.00 24.81 ? 56  ALA B CA    1 
ATOM   2900 C  C     . ALA F 3 55  ? 4.042   18.437  -19.973 1.00 28.93 ? 56  ALA B C     1 
ATOM   2901 O  O     . ALA F 3 55  ? 3.539   18.805  -21.036 1.00 29.04 ? 56  ALA B O     1 
ATOM   2902 C  CB    . ALA F 3 55  ? 3.201   16.542  -18.602 1.00 21.63 ? 56  ALA B CB    1 
ATOM   2903 N  N     . GLU F 3 56  ? 4.486   19.289  -19.052 1.00 31.01 ? 57  GLU B N     1 
ATOM   2904 C  CA    . GLU F 3 56  ? 4.388   20.732  -19.259 1.00 33.78 ? 57  GLU B CA    1 
ATOM   2905 C  C     . GLU F 3 56  ? 5.126   21.163  -20.522 1.00 33.89 ? 57  GLU B C     1 
ATOM   2906 O  O     . GLU F 3 56  ? 4.635   21.997  -21.281 1.00 32.39 ? 57  GLU B O     1 
ATOM   2907 C  CB    . GLU F 3 56  ? 4.931   21.501  -18.056 1.00 37.40 ? 57  GLU B CB    1 
ATOM   2908 C  CG    . GLU F 3 56  ? 3.932   21.648  -16.907 1.00 58.02 ? 57  GLU B CG    1 
ATOM   2909 C  CD    . GLU F 3 56  ? 4.397   22.628  -15.822 1.00 66.52 ? 57  GLU B CD    1 
ATOM   2910 O  OE1   . GLU F 3 56  ? 5.363   23.394  -16.060 1.00 66.82 ? 57  GLU B OE1   1 
ATOM   2911 O  OE2   . GLU F 3 56  ? 3.790   22.630  -14.725 1.00 69.08 ? 57  GLU B OE2   1 
ATOM   2912 N  N     . LYS F 3 57  ? 6.300   20.582  -20.743 1.00 33.38 ? 58  LYS B N     1 
ATOM   2913 C  CA    . LYS F 3 57  ? 7.108   20.884  -21.915 1.00 33.53 ? 58  LYS B CA    1 
ATOM   2914 C  C     . LYS F 3 57  ? 6.326   20.624  -23.209 1.00 32.94 ? 58  LYS B C     1 
ATOM   2915 O  O     . LYS F 3 57  ? 6.608   21.230  -24.236 1.00 36.26 ? 58  LYS B O     1 
ATOM   2916 C  CB    . LYS F 3 57  ? 8.383   20.036  -21.887 1.00 35.35 ? 58  LYS B CB    1 
ATOM   2917 C  CG    . LYS F 3 57  ? 9.262   20.161  -23.117 1.00 50.76 ? 58  LYS B CG    1 
ATOM   2918 C  CD    . LYS F 3 57  ? 10.372  19.121  -23.112 1.00 59.23 ? 58  LYS B CD    1 
ATOM   2919 C  CE    . LYS F 3 57  ? 11.144  19.139  -24.424 1.00 65.17 ? 58  LYS B CE    1 
ATOM   2920 N  NZ    . LYS F 3 57  ? 12.165  18.054  -24.493 1.00 67.11 ? 58  LYS B NZ    1 
ATOM   2921 N  N     . HIS F 3 58  ? 5.346   19.722  -23.158 1.00 31.04 ? 59  HIS B N     1 
ATOM   2922 C  CA    . HIS F 3 58  ? 4.538   19.387  -24.330 1.00 27.20 ? 59  HIS B CA    1 
ATOM   2923 C  C     . HIS F 3 58  ? 3.128   19.947  -24.310 1.00 27.60 ? 59  HIS B C     1 
ATOM   2924 O  O     . HIS F 3 58  ? 2.305   19.565  -25.133 1.00 32.43 ? 59  HIS B O     1 
ATOM   2925 C  CB    . HIS F 3 58  ? 4.467   17.871  -24.529 1.00 22.54 ? 59  HIS B CB    1 
ATOM   2926 C  CG    . HIS F 3 58  ? 5.766   17.259  -24.947 1.00 21.67 ? 59  HIS B CG    1 
ATOM   2927 N  ND1   . HIS F 3 58  ? 6.082   17.007  -26.265 1.00 27.68 ? 59  HIS B ND1   1 
ATOM   2928 C  CD2   . HIS F 3 58  ? 6.831   16.845  -24.220 1.00 27.70 ? 59  HIS B CD2   1 
ATOM   2929 C  CE1   . HIS F 3 58  ? 7.285   16.464  -26.332 1.00 22.21 ? 59  HIS B CE1   1 
ATOM   2930 N  NE2   . HIS F 3 58  ? 7.761   16.355  -25.105 1.00 27.85 ? 59  HIS B NE2   1 
ATOM   2931 N  N     . GLY F 3 59  ? 2.843   20.842  -23.375 1.00 27.45 ? 60  GLY B N     1 
ATOM   2932 C  CA    . GLY F 3 59  ? 1.525   21.446  -23.313 1.00 27.30 ? 60  GLY B CA    1 
ATOM   2933 C  C     . GLY F 3 59  ? 0.422   20.579  -22.752 1.00 28.43 ? 60  GLY B C     1 
ATOM   2934 O  O     . GLY F 3 59  ? -0.761  20.801  -23.041 1.00 29.64 ? 60  GLY B O     1 
ATOM   2935 N  N     . TYR F 3 60  ? 0.804   19.592  -21.949 1.00 28.27 ? 61  TYR B N     1 
ATOM   2936 C  CA    . TYR F 3 60  ? -0.157  18.696  -21.317 1.00 27.27 ? 61  TYR B CA    1 
ATOM   2937 C  C     . TYR F 3 60  ? -0.393  19.057  -19.857 1.00 25.90 ? 61  TYR B C     1 
ATOM   2938 O  O     . TYR F 3 60  ? 0.538   19.385  -19.121 1.00 26.12 ? 61  TYR B O     1 
ATOM   2939 C  CB    . TYR F 3 60  ? 0.334   17.246  -21.374 1.00 24.86 ? 61  TYR B CB    1 
ATOM   2940 C  CG    . TYR F 3 60  ? 0.095   16.554  -22.694 1.00 29.17 ? 61  TYR B CG    1 
ATOM   2941 C  CD1   . TYR F 3 60  ? 1.021   16.649  -23.735 1.00 26.54 ? 61  TYR B CD1   1 
ATOM   2942 C  CD2   . TYR F 3 60  ? -1.055  15.790  -22.899 1.00 26.83 ? 61  TYR B CD2   1 
ATOM   2943 C  CE1   . TYR F 3 60  ? 0.803   15.998  -24.950 1.00 35.51 ? 61  TYR B CE1   1 
ATOM   2944 C  CE2   . TYR F 3 60  ? -1.282  15.137  -24.104 1.00 27.73 ? 61  TYR B CE2   1 
ATOM   2945 C  CZ    . TYR F 3 60  ? -0.353  15.244  -25.124 1.00 33.19 ? 61  TYR B CZ    1 
ATOM   2946 O  OH    . TYR F 3 60  ? -0.581  14.595  -26.312 1.00 36.52 ? 61  TYR B OH    1 
ATOM   2947 N  N     . ILE F 3 61  ? -1.650  18.998  -19.455 1.00 27.54 ? 62  ILE B N     1 
ATOM   2948 C  CA    . ILE F 3 61  ? -2.048  19.234  -18.077 1.00 28.29 ? 62  ILE B CA    1 
ATOM   2949 C  C     . ILE F 3 61  ? -1.931  17.859  -17.387 1.00 27.59 ? 62  ILE B C     1 
ATOM   2950 O  O     . ILE F 3 61  ? -2.254  16.833  -17.992 1.00 23.78 ? 62  ILE B O     1 
ATOM   2951 C  CB    . ILE F 3 61  ? -3.514  19.730  -18.016 1.00 30.83 ? 62  ILE B CB    1 
ATOM   2952 C  CG1   . ILE F 3 61  ? -3.562  21.228  -18.322 1.00 42.11 ? 62  ILE B CG1   1 
ATOM   2953 C  CG2   . ILE F 3 61  ? -4.134  19.435  -16.663 1.00 37.70 ? 62  ILE B CG2   1 
ATOM   2954 C  CD1   . ILE F 3 61  ? -4.950  21.831  -18.208 1.00 50.05 ? 62  ILE B CD1   1 
ATOM   2955 N  N     . VAL F 3 62  ? -1.461  17.833  -16.141 1.00 26.02 ? 63  VAL B N     1 
ATOM   2956 C  CA    . VAL F 3 62  ? -1.338  16.582  -15.399 1.00 24.61 ? 63  VAL B CA    1 
ATOM   2957 C  C     . VAL F 3 62  ? -2.336  16.593  -14.241 1.00 25.80 ? 63  VAL B C     1 
ATOM   2958 O  O     . VAL F 3 62  ? -2.391  17.555  -13.479 1.00 26.39 ? 63  VAL B O     1 
ATOM   2959 C  CB    . VAL F 3 62  ? 0.085   16.385  -14.835 1.00 23.10 ? 63  VAL B CB    1 
ATOM   2960 C  CG1   . VAL F 3 62  ? 0.188   15.039  -14.114 1.00 14.65 ? 63  VAL B CG1   1 
ATOM   2961 C  CG2   . VAL F 3 62  ? 1.109   16.452  -15.953 1.00 18.29 ? 63  VAL B CG2   1 
ATOM   2962 N  N     . GLU F 3 63  ? -3.124  15.527  -14.120 1.00 24.10 ? 64  GLU B N     1 
ATOM   2963 C  CA    . GLU F 3 63  ? -4.107  15.396  -13.053 1.00 22.45 ? 64  GLU B CA    1 
ATOM   2964 C  C     . GLU F 3 63  ? -3.969  14.091  -12.277 1.00 24.28 ? 64  GLU B C     1 
ATOM   2965 O  O     . GLU F 3 63  ? -3.705  13.034  -12.856 1.00 25.25 ? 64  GLU B O     1 
ATOM   2966 C  CB    . GLU F 3 63  ? -5.516  15.481  -13.611 1.00 26.06 ? 64  GLU B CB    1 
ATOM   2967 C  CG    . GLU F 3 63  ? -6.016  16.883  -13.748 1.00 30.55 ? 64  GLU B CG    1 
ATOM   2968 C  CD    . GLU F 3 63  ? -7.489  16.936  -14.062 1.00 33.40 ? 64  GLU B CD    1 
ATOM   2969 O  OE1   . GLU F 3 63  ? -8.263  16.109  -13.524 1.00 36.05 ? 64  GLU B OE1   1 
ATOM   2970 O  OE2   . GLU F 3 63  ? -7.872  17.817  -14.852 1.00 37.11 ? 64  GLU B OE2   1 
ATOM   2971 N  N     . GLU F 3 64  ? -4.151  14.175  -10.962 1.00 23.40 ? 65  GLU B N     1 
ATOM   2972 C  CA    . GLU F 3 64  ? -4.065  13.015  -10.080 1.00 21.26 ? 65  GLU B CA    1 
ATOM   2973 C  C     . GLU F 3 64  ? -5.472  12.772  -9.542  1.00 19.69 ? 65  GLU B C     1 
ATOM   2974 O  O     . GLU F 3 64  ? -6.298  13.687  -9.543  1.00 19.45 ? 65  GLU B O     1 
ATOM   2975 C  CB    . GLU F 3 64  ? -3.075  13.294  -8.949  1.00 21.13 ? 65  GLU B CB    1 
ATOM   2976 C  CG    . GLU F 3 64  ? -1.655  13.525  -9.444  1.00 29.20 ? 65  GLU B CG    1 
ATOM   2977 C  CD    . GLU F 3 64  ? -0.684  13.857  -8.330  1.00 27.65 ? 65  GLU B CD    1 
ATOM   2978 O  OE1   . GLU F 3 64  ? -0.113  12.922  -7.746  1.00 34.74 ? 65  GLU B OE1   1 
ATOM   2979 O  OE2   . GLU F 3 64  ? -0.486  15.052  -8.035  1.00 39.71 ? 65  GLU B OE2   1 
ATOM   2980 N  N     . PRO F 3 65  ? -5.774  11.541  -9.093  1.00 19.17 ? 66  PRO B N     1 
ATOM   2981 C  CA    . PRO F 3 65  ? -7.115  11.241  -8.567  1.00 21.14 ? 66  PRO B CA    1 
ATOM   2982 C  C     . PRO F 3 65  ? -7.497  12.037  -7.311  1.00 24.77 ? 66  PRO B C     1 
ATOM   2983 O  O     . PRO F 3 65  ? -6.632  12.401  -6.510  1.00 24.25 ? 66  PRO B O     1 
ATOM   2984 C  CB    . PRO F 3 65  ? -7.038  9.741   -8.250  1.00 17.74 ? 66  PRO B CB    1 
ATOM   2985 C  CG    . PRO F 3 65  ? -5.931  9.237   -9.117  1.00 19.52 ? 66  PRO B CG    1 
ATOM   2986 C  CD    . PRO F 3 65  ? -4.915  10.345  -9.043  1.00 16.82 ? 66  PRO B CD    1 
ATOM   2987 N  N     . LYS F 3 66  ? -8.791  12.305  -7.153  1.00 26.89 ? 67  LYS B N     1 
ATOM   2988 C  CA    . LYS F 3 66  ? -9.311  12.997  -5.973  1.00 29.15 ? 67  LYS B CA    1 
ATOM   2989 C  C     . LYS F 3 66  ? -9.722  11.869  -5.005  1.00 29.88 ? 67  LYS B C     1 
ATOM   2990 O  O     . LYS F 3 66  ? -9.403  11.921  -3.822  1.00 33.72 ? 67  LYS B O     1 
ATOM   2991 C  CB    . LYS F 3 66  ? -10.511 13.878  -6.336  1.00 35.23 ? 67  LYS B CB    1 
ATOM   2992 C  CG    . LYS F 3 66  ? -10.170 15.037  -7.264  1.00 48.82 ? 67  LYS B CG    1 
ATOM   2993 C  CD    . LYS F 3 66  ? -11.427 15.782  -7.708  1.00 64.79 ? 67  LYS B CD    1 
ATOM   2994 C  CE    . LYS F 3 66  ? -11.098 16.944  -8.653  1.00 67.09 ? 67  LYS B CE    1 
ATOM   2995 N  NZ    . LYS F 3 66  ? -12.313 17.755  -9.003  1.00 66.64 ? 67  LYS B NZ    1 
ATOM   2996 N  N     . GLN F 3 67  ? -10.430 10.854  -5.505  1.00 25.36 ? 68  GLN B N     1 
ATOM   2997 C  CA    . GLN F 3 67  ? -10.791 9.708   -4.676  1.00 25.74 ? 68  GLN B CA    1 
ATOM   2998 C  C     . GLN F 3 67  ? -9.553  8.831   -4.714  1.00 26.48 ? 68  GLN B C     1 
ATOM   2999 O  O     . GLN F 3 67  ? -9.019  8.538   -5.793  1.00 24.19 ? 68  GLN B O     1 
ATOM   3000 C  CB    . GLN F 3 67  ? -11.982 8.932   -5.230  1.00 30.33 ? 68  GLN B CB    1 
ATOM   3001 C  CG    . GLN F 3 67  ? -13.316 9.497   -4.831  1.00 39.27 ? 68  GLN B CG    1 
ATOM   3002 C  CD    . GLN F 3 67  ? -13.817 10.512  -5.818  1.00 47.21 ? 68  GLN B CD    1 
ATOM   3003 O  OE1   . GLN F 3 67  ? -13.093 11.420  -6.221  1.00 52.01 ? 68  GLN B OE1   1 
ATOM   3004 N  NE2   . GLN F 3 67  ? -15.069 10.365  -6.223  1.00 56.50 ? 68  GLN B NE2   1 
ATOM   3005 N  N     . GLN F 3 68  ? -9.111  8.406   -3.539  1.00 21.22 ? 69  GLN B N     1 
ATOM   3006 C  CA    . GLN F 3 68  ? -7.898  7.622   -3.397  1.00 20.13 ? 69  GLN B CA    1 
ATOM   3007 C  C     . GLN F 3 68  ? -7.804  6.255   -4.066  1.00 19.98 ? 69  GLN B C     1 
ATOM   3008 O  O     . GLN F 3 68  ? -6.702  5.805   -4.373  1.00 23.92 ? 69  GLN B O     1 
ATOM   3009 C  CB    . GLN F 3 68  ? -7.530  7.529   -1.911  1.00 22.30 ? 69  GLN B CB    1 
ATOM   3010 C  CG    . GLN F 3 68  ? -7.297  8.907   -1.289  1.00 21.54 ? 69  GLN B CG    1 
ATOM   3011 C  CD    . GLN F 3 68  ? -6.781  8.843   0.130   1.00 27.10 ? 69  GLN B CD    1 
ATOM   3012 O  OE1   . GLN F 3 68  ? -5.813  8.142   0.418   1.00 27.22 ? 69  GLN B OE1   1 
ATOM   3013 N  NE2   . GLN F 3 68  ? -7.422  9.578   1.027   1.00 29.29 ? 69  GLN B NE2   1 
ATOM   3014 N  N     . ASN F 3 69  ? -8.924  5.584   -4.303  1.00 18.20 ? 70  ASN B N     1 
ATOM   3015 C  CA    . ASN F 3 69  ? -8.847  4.283   -4.959  1.00 18.50 ? 70  ASN B CA    1 
ATOM   3016 C  C     . ASN F 3 69  ? -9.302  4.356   -6.429  1.00 19.28 ? 70  ASN B C     1 
ATOM   3017 O  O     . ASN F 3 69  ? -10.006 3.471   -6.933  1.00 21.10 ? 70  ASN B O     1 
ATOM   3018 C  CB    . ASN F 3 69  ? -9.636  3.230   -4.170  1.00 15.18 ? 70  ASN B CB    1 
ATOM   3019 C  CG    . ASN F 3 69  ? -11.086 3.601   -3.988  1.00 19.95 ? 70  ASN B CG    1 
ATOM   3020 O  OD1   . ASN F 3 69  ? -11.532 4.664   -4.435  1.00 19.31 ? 70  ASN B OD1   1 
ATOM   3021 N  ND2   . ASN F 3 69  ? -11.837 2.729   -3.329  1.00 23.49 ? 70  ASN B ND2   1 
ATOM   3022 N  N     . HIS F 3 70  ? -8.894  5.426   -7.110  1.00 19.80 ? 71  HIS B N     1 
ATOM   3023 C  CA    . HIS F 3 70  ? -9.225  5.646   -8.529  1.00 17.47 ? 71  HIS B CA    1 
ATOM   3024 C  C     . HIS F 3 70  ? -7.988  5.443   -9.410  1.00 15.99 ? 71  HIS B C     1 
ATOM   3025 O  O     . HIS F 3 70  ? -6.857  5.610   -8.959  1.00 14.77 ? 71  HIS B O     1 
ATOM   3026 C  CB    . HIS F 3 70  ? -9.722  7.077   -8.752  1.00 16.05 ? 71  HIS B CB    1 
ATOM   3027 C  CG    . HIS F 3 70  ? -11.206 7.252   -8.635  1.00 23.88 ? 71  HIS B CG    1 
ATOM   3028 N  ND1   . HIS F 3 70  ? -11.996 6.478   -7.810  1.00 24.77 ? 71  HIS B ND1   1 
ATOM   3029 C  CD2   . HIS F 3 70  ? -12.042 8.132   -9.236  1.00 26.84 ? 71  HIS B CD2   1 
ATOM   3030 C  CE1   . HIS F 3 70  ? -13.253 6.874   -7.908  1.00 22.73 ? 71  HIS B CE1   1 
ATOM   3031 N  NE2   . HIS F 3 70  ? -13.307 7.876   -8.767  1.00 25.57 ? 71  HIS B NE2   1 
ATOM   3032 N  N     . TYR F 3 71  ? -8.213  5.090   -10.669 1.00 16.70 ? 72  TYR B N     1 
ATOM   3033 C  CA    . TYR F 3 71  ? -7.135  4.909   -11.640 1.00 15.16 ? 72  TYR B CA    1 
ATOM   3034 C  C     . TYR F 3 71  ? -7.261  6.095   -12.610 1.00 13.08 ? 72  TYR B C     1 
ATOM   3035 O  O     . TYR F 3 71  ? -8.359  6.613   -12.806 1.00 14.71 ? 72  TYR B O     1 
ATOM   3036 C  CB    . TYR F 3 71  ? -7.348  3.580   -12.377 1.00 13.08 ? 72  TYR B CB    1 
ATOM   3037 C  CG    . TYR F 3 71  ? -6.618  3.417   -13.708 1.00 16.08 ? 72  TYR B CG    1 
ATOM   3038 C  CD1   . TYR F 3 71  ? -7.186  3.874   -14.913 1.00 11.90 ? 72  TYR B CD1   1 
ATOM   3039 C  CD2   . TYR F 3 71  ? -5.374  2.782   -13.768 1.00 13.64 ? 72  TYR B CD2   1 
ATOM   3040 C  CE1   . TYR F 3 71  ? -6.521  3.695   -16.147 1.00 13.69 ? 72  TYR B CE1   1 
ATOM   3041 C  CE2   . TYR F 3 71  ? -4.705  2.599   -14.990 1.00 17.73 ? 72  TYR B CE2   1 
ATOM   3042 C  CZ    . TYR F 3 71  ? -5.283  3.056   -16.168 1.00 13.15 ? 72  TYR B CZ    1 
ATOM   3043 O  OH    . TYR F 3 71  ? -4.618  2.867   -17.349 1.00 14.38 ? 72  TYR B OH    1 
ATOM   3044 N  N     . PRO F 3 72  ? -6.150  6.569   -13.202 1.00 12.78 ? 73  PRO B N     1 
ATOM   3045 C  CA    . PRO F 3 72  ? -4.738  6.173   -13.101 1.00 12.61 ? 73  PRO B CA    1 
ATOM   3046 C  C     . PRO F 3 72  ? -3.963  7.137   -12.190 1.00 12.30 ? 73  PRO B C     1 
ATOM   3047 O  O     . PRO F 3 72  ? -4.508  8.138   -11.725 1.00 15.24 ? 73  PRO B O     1 
ATOM   3048 C  CB    . PRO F 3 72  ? -4.262  6.290   -14.548 1.00 7.17  ? 73  PRO B CB    1 
ATOM   3049 C  CG    . PRO F 3 72  ? -5.005  7.571   -15.018 1.00 6.46  ? 73  PRO B CG    1 
ATOM   3050 C  CD    . PRO F 3 72  ? -6.324  7.618   -14.236 1.00 10.85 ? 73  PRO B CD    1 
ATOM   3051 N  N     . ASP F 3 73  ? -2.689  6.844   -11.946 1.00 14.57 ? 74  ASP B N     1 
ATOM   3052 C  CA    . ASP F 3 73  ? -1.863  7.718   -11.114 1.00 14.18 ? 74  ASP B CA    1 
ATOM   3053 C  C     . ASP F 3 73  ? -1.822  9.113   -11.724 1.00 14.77 ? 74  ASP B C     1 
ATOM   3054 O  O     . ASP F 3 73  ? -1.997  10.112  -11.019 1.00 15.80 ? 74  ASP B O     1 
ATOM   3055 C  CB    . ASP F 3 73  ? -0.435  7.176   -10.992 1.00 7.62  ? 74  ASP B CB    1 
ATOM   3056 C  CG    . ASP F 3 73  ? -0.340  5.978   -10.078 1.00 11.98 ? 74  ASP B CG    1 
ATOM   3057 O  OD1   . ASP F 3 73  ? -1.146  5.872   -9.124  1.00 11.79 ? 74  ASP B OD1   1 
ATOM   3058 O  OD2   . ASP F 3 73  ? 0.551   5.139   -10.315 1.00 11.46 ? 74  ASP B OD2   1 
ATOM   3059 N  N     . PHE F 3 74  ? -1.592  9.178   -13.035 1.00 15.93 ? 75  PHE B N     1 
ATOM   3060 C  CA    . PHE F 3 74  ? -1.537  10.461  -13.725 1.00 16.18 ? 75  PHE B CA    1 
ATOM   3061 C  C     . PHE F 3 74  ? -2.358  10.432  -15.002 1.00 15.30 ? 75  PHE B C     1 
ATOM   3062 O  O     . PHE F 3 74  ? -2.268  9.485   -15.784 1.00 15.50 ? 75  PHE B O     1 
ATOM   3063 C  CB    . PHE F 3 74  ? -0.087  10.819  -14.061 1.00 19.32 ? 75  PHE B CB    1 
ATOM   3064 C  CG    . PHE F 3 74  ? 0.852   10.690  -12.896 1.00 19.24 ? 75  PHE B CG    1 
ATOM   3065 C  CD1   . PHE F 3 74  ? 1.495   9.479   -12.635 1.00 20.69 ? 75  PHE B CD1   1 
ATOM   3066 C  CD2   . PHE F 3 74  ? 1.076   11.765  -12.039 1.00 21.54 ? 75  PHE B CD2   1 
ATOM   3067 C  CE1   . PHE F 3 74  ? 2.353   9.336   -11.531 1.00 14.59 ? 75  PHE B CE1   1 
ATOM   3068 C  CE2   . PHE F 3 74  ? 1.928   11.633  -10.939 1.00 17.39 ? 75  PHE B CE2   1 
ATOM   3069 C  CZ    . PHE F 3 74  ? 2.566   10.413  -10.688 1.00 16.93 ? 75  PHE B CZ    1 
ATOM   3070 N  N     . THR F 3 75  ? -3.167  11.465  -15.192 1.00 15.28 ? 76  THR B N     1 
ATOM   3071 C  CA    . THR F 3 75  ? -3.970  11.627  -16.392 1.00 20.37 ? 76  THR B CA    1 
ATOM   3072 C  C     . THR F 3 75  ? -3.382  12.858  -17.088 1.00 23.45 ? 76  THR B C     1 
ATOM   3073 O  O     . THR F 3 75  ? -3.297  13.926  -16.473 1.00 20.83 ? 76  THR B O     1 
ATOM   3074 C  CB    . THR F 3 75  ? -5.453  11.893  -16.067 1.00 19.39 ? 76  THR B CB    1 
ATOM   3075 O  OG1   . THR F 3 75  ? -6.055  10.692  -15.578 1.00 23.32 ? 76  THR B OG1   1 
ATOM   3076 C  CG2   . THR F 3 75  ? -6.205  12.347  -17.314 1.00 20.86 ? 76  THR B CG2   1 
ATOM   3077 N  N     . LEU F 3 76  ? -2.967  12.699  -18.347 1.00 22.58 ? 77  LEU B N     1 
ATOM   3078 C  CA    . LEU F 3 76  ? -2.385  13.785  -19.142 1.00 22.93 ? 77  LEU B CA    1 
ATOM   3079 C  C     . LEU F 3 76  ? -3.269  14.120  -20.334 1.00 26.22 ? 77  LEU B C     1 
ATOM   3080 O  O     . LEU F 3 76  ? -3.799  13.220  -20.992 1.00 26.49 ? 77  LEU B O     1 
ATOM   3081 C  CB    . LEU F 3 76  ? -1.005  13.395  -19.671 1.00 14.12 ? 77  LEU B CB    1 
ATOM   3082 C  CG    . LEU F 3 76  ? 0.217   13.471  -18.766 1.00 20.17 ? 77  LEU B CG    1 
ATOM   3083 C  CD1   . LEU F 3 76  ? 0.089   12.518  -17.589 1.00 23.63 ? 77  LEU B CD1   1 
ATOM   3084 C  CD2   . LEU F 3 76  ? 1.438   13.126  -19.589 1.00 14.57 ? 77  LEU B CD2   1 
ATOM   3085 N  N     . TYR F 3 77  ? -3.430  15.410  -20.612 1.00 28.99 ? 78  TYR B N     1 
ATOM   3086 C  CA    . TYR F 3 77  ? -4.239  15.851  -21.741 1.00 33.14 ? 78  TYR B CA    1 
ATOM   3087 C  C     . TYR F 3 77  ? -4.046  17.332  -22.079 1.00 35.78 ? 78  TYR B C     1 
ATOM   3088 O  O     . TYR F 3 77  ? -3.683  18.142  -21.216 1.00 32.60 ? 78  TYR B O     1 
ATOM   3089 C  CB    . TYR F 3 77  ? -5.723  15.579  -21.468 1.00 30.76 ? 78  TYR B CB    1 
ATOM   3090 C  CG    . TYR F 3 77  ? -6.330  16.450  -20.396 1.00 31.76 ? 78  TYR B CG    1 
ATOM   3091 C  CD1   . TYR F 3 77  ? -6.110  16.190  -19.042 1.00 31.90 ? 78  TYR B CD1   1 
ATOM   3092 C  CD2   . TYR F 3 77  ? -7.121  17.544  -20.737 1.00 34.35 ? 78  TYR B CD2   1 
ATOM   3093 C  CE1   . TYR F 3 77  ? -6.664  17.000  -18.056 1.00 34.68 ? 78  TYR B CE1   1 
ATOM   3094 C  CE2   . TYR F 3 77  ? -7.679  18.361  -19.764 1.00 30.48 ? 78  TYR B CE2   1 
ATOM   3095 C  CZ    . TYR F 3 77  ? -7.448  18.086  -18.427 1.00 40.33 ? 78  TYR B CZ    1 
ATOM   3096 O  OH    . TYR F 3 77  ? -8.001  18.906  -17.471 1.00 32.66 ? 78  TYR B OH    1 
ATOM   3097 N  N     . LYS F 3 78  ? -4.276  17.668  -23.345 1.00 36.95 ? 79  LYS B N     1 
ATOM   3098 C  CA    . LYS F 3 78  ? -4.199  19.048  -23.815 1.00 36.44 ? 79  LYS B CA    1 
ATOM   3099 C  C     . LYS F 3 78  ? -5.636  19.523  -23.655 1.00 37.88 ? 79  LYS B C     1 
ATOM   3100 O  O     . LYS F 3 78  ? -6.578  18.794  -23.990 1.00 37.08 ? 79  LYS B O     1 
ATOM   3101 C  CB    . LYS F 3 78  ? -3.798  19.099  -25.283 1.00 33.96 ? 79  LYS B CB    1 
ATOM   3102 C  CG    . LYS F 3 78  ? -2.395  18.636  -25.540 1.00 38.97 ? 79  LYS B CG    1 
ATOM   3103 C  CD    . LYS F 3 78  ? -2.080  18.673  -27.010 1.00 44.92 ? 79  LYS B CD    1 
ATOM   3104 C  CE    . LYS F 3 78  ? -0.628  18.339  -27.246 1.00 51.31 ? 79  LYS B CE    1 
ATOM   3105 N  NZ    . LYS F 3 78  ? -0.303  18.247  -28.697 1.00 62.10 ? 79  LYS B NZ    1 
ATOM   3106 N  N     . PRO F 3 79  ? -5.835  20.745  -23.141 1.00 39.85 ? 80  PRO B N     1 
ATOM   3107 C  CA    . PRO F 3 79  ? -7.195  21.271  -22.946 1.00 42.98 ? 80  PRO B CA    1 
ATOM   3108 C  C     . PRO F 3 79  ? -8.045  21.281  -24.221 1.00 45.49 ? 80  PRO B C     1 
ATOM   3109 O  O     . PRO F 3 79  ? -9.272  21.191  -24.165 1.00 45.56 ? 80  PRO B O     1 
ATOM   3110 C  CB    . PRO F 3 79  ? -6.941  22.683  -22.413 1.00 42.36 ? 80  PRO B CB    1 
ATOM   3111 C  CG    . PRO F 3 79  ? -5.608  22.560  -21.731 1.00 40.91 ? 80  PRO B CG    1 
ATOM   3112 C  CD    . PRO F 3 79  ? -4.824  21.723  -22.707 1.00 39.18 ? 80  PRO B CD    1 
ATOM   3113 N  N     . SER F 3 80  ? -7.371  21.385  -25.362 1.00 47.57 ? 81  SER B N     1 
ATOM   3114 C  CA    . SER F 3 80  ? -8.010  21.421  -26.672 1.00 48.72 ? 81  SER B CA    1 
ATOM   3115 C  C     . SER F 3 80  ? -8.429  20.040  -27.192 1.00 50.67 ? 81  SER B C     1 
ATOM   3116 O  O     . SER F 3 80  ? -9.271  19.934  -28.086 1.00 52.64 ? 81  SER B O     1 
ATOM   3117 C  CB    . SER F 3 80  ? -7.053  22.083  -27.663 1.00 47.54 ? 81  SER B CB    1 
ATOM   3118 O  OG    . SER F 3 80  ? -5.733  21.569  -27.515 1.00 52.06 ? 81  SER B OG    1 
ATOM   3119 N  N     . GLU F 3 81  ? -7.838  18.989  -26.631 1.00 49.92 ? 82  GLU B N     1 
ATOM   3120 C  CA    . GLU F 3 81  ? -8.133  17.621  -27.043 1.00 49.05 ? 82  GLU B CA    1 
ATOM   3121 C  C     . GLU F 3 81  ? -8.592  16.817  -25.827 1.00 47.07 ? 82  GLU B C     1 
ATOM   3122 O  O     . GLU F 3 81  ? -7.896  15.907  -25.374 1.00 48.11 ? 82  GLU B O     1 
ATOM   3123 C  CB    . GLU F 3 81  ? -6.875  16.982  -27.648 1.00 51.16 ? 82  GLU B CB    1 
ATOM   3124 C  CG    . GLU F 3 81  ? -6.401  17.608  -28.957 1.00 59.28 ? 82  GLU B CG    1 
ATOM   3125 C  CD    . GLU F 3 81  ? -7.033  16.977  -30.189 1.00 67.22 ? 82  GLU B CD    1 
ATOM   3126 O  OE1   . GLU F 3 81  ? -8.267  16.768  -30.214 1.00 68.45 ? 82  GLU B OE1   1 
ATOM   3127 O  OE2   . GLU F 3 81  ? -6.284  16.687  -31.144 1.00 72.75 ? 82  GLU B OE2   1 
ATOM   3128 N  N     . PRO F 3 82  ? -9.778  17.135  -25.287 1.00 46.28 ? 83  PRO B N     1 
ATOM   3129 C  CA    . PRO F 3 82  ? -10.295 16.425  -24.112 1.00 44.11 ? 83  PRO B CA    1 
ATOM   3130 C  C     . PRO F 3 82  ? -10.534 14.921  -24.252 1.00 42.31 ? 83  PRO B C     1 
ATOM   3131 O  O     . PRO F 3 82  ? -10.606 14.220  -23.252 1.00 41.71 ? 83  PRO B O     1 
ATOM   3132 C  CB    . PRO F 3 82  ? -11.585 17.184  -23.794 1.00 47.20 ? 83  PRO B CB    1 
ATOM   3133 C  CG    . PRO F 3 82  ? -12.028 17.686  -25.139 1.00 49.81 ? 83  PRO B CG    1 
ATOM   3134 C  CD    . PRO F 3 82  ? -10.730 18.170  -25.732 1.00 46.00 ? 83  PRO B CD    1 
ATOM   3135 N  N     . ASN F 3 83  ? -10.650 14.416  -25.476 1.00 39.24 ? 84  ASN B N     1 
ATOM   3136 C  CA    . ASN F 3 83  ? -10.904 12.989  -25.663 1.00 37.53 ? 84  ASN B CA    1 
ATOM   3137 C  C     . ASN F 3 83  ? -9.684  12.225  -26.132 1.00 35.72 ? 84  ASN B C     1 
ATOM   3138 O  O     . ASN F 3 83  ? -9.797  11.120  -26.656 1.00 37.50 ? 84  ASN B O     1 
ATOM   3139 C  CB    . ASN F 3 83  ? -12.067 12.758  -26.632 1.00 39.19 ? 84  ASN B CB    1 
ATOM   3140 C  CG    . ASN F 3 83  ? -13.376 13.307  -26.106 1.00 46.50 ? 84  ASN B CG    1 
ATOM   3141 O  OD1   . ASN F 3 83  ? -14.158 12.589  -25.487 1.00 59.63 ? 84  ASN B OD1   1 
ATOM   3142 N  ND2   . ASN F 3 83  ? -13.624 14.590  -26.352 1.00 51.07 ? 84  ASN B ND2   1 
ATOM   3143 N  N     . LYS F 3 84  ? -8.514  12.818  -25.951 1.00 32.33 ? 85  LYS B N     1 
ATOM   3144 C  CA    . LYS F 3 84  ? -7.273  12.166  -26.327 1.00 33.31 ? 85  LYS B CA    1 
ATOM   3145 C  C     . LYS F 3 84  ? -6.383  12.123  -25.087 1.00 30.84 ? 85  LYS B C     1 
ATOM   3146 O  O     . LYS F 3 84  ? -5.206  12.489  -25.137 1.00 30.35 ? 85  LYS B O     1 
ATOM   3147 C  CB    . LYS F 3 84  ? -6.585  12.922  -27.465 1.00 40.16 ? 85  LYS B CB    1 
ATOM   3148 C  CG    . LYS F 3 84  ? -7.290  12.811  -28.817 1.00 52.29 ? 85  LYS B CG    1 
ATOM   3149 C  CD    . LYS F 3 84  ? -6.410  13.400  -29.916 1.00 66.07 ? 85  LYS B CD    1 
ATOM   3150 C  CE    . LYS F 3 84  ? -6.977  13.158  -31.313 1.00 75.87 ? 85  LYS B CE    1 
ATOM   3151 N  NZ    . LYS F 3 84  ? -6.060  13.715  -32.360 1.00 74.30 ? 85  LYS B NZ    1 
ATOM   3152 N  N     . LYS F 3 85  ? -6.968  11.670  -23.978 1.00 28.76 ? 86  LYS B N     1 
ATOM   3153 C  CA    . LYS F 3 85  ? -6.273  11.573  -22.693 1.00 24.49 ? 86  LYS B CA    1 
ATOM   3154 C  C     . LYS F 3 85  ? -5.331  10.380  -22.599 1.00 20.72 ? 86  LYS B C     1 
ATOM   3155 O  O     . LYS F 3 85  ? -5.616  9.308   -23.131 1.00 21.45 ? 86  LYS B O     1 
ATOM   3156 C  CB    . LYS F 3 85  ? -7.291  11.504  -21.550 1.00 24.09 ? 86  LYS B CB    1 
ATOM   3157 C  CG    . LYS F 3 85  ? -8.237  12.690  -21.485 1.00 20.92 ? 86  LYS B CG    1 
ATOM   3158 C  CD    . LYS F 3 85  ? -8.871  12.797  -20.117 1.00 25.12 ? 86  LYS B CD    1 
ATOM   3159 C  CE    . LYS F 3 85  ? -9.505  14.160  -19.915 1.00 21.36 ? 86  LYS B CE    1 
ATOM   3160 N  NZ    . LYS F 3 85  ? -10.894 14.209  -20.432 1.00 21.00 ? 86  LYS B NZ    1 
ATOM   3161 N  N     . ILE F 3 86  ? -4.206  10.574  -21.924 1.00 17.28 ? 87  ILE B N     1 
ATOM   3162 C  CA    . ILE F 3 86  ? -3.230  9.513   -21.739 1.00 17.77 ? 87  ILE B CA    1 
ATOM   3163 C  C     . ILE F 3 86  ? -3.225  9.123   -20.256 1.00 18.94 ? 87  ILE B C     1 
ATOM   3164 O  O     . ILE F 3 86  ? -3.215  9.993   -19.386 1.00 18.82 ? 87  ILE B O     1 
ATOM   3165 C  CB    . ILE F 3 86  ? -1.825  9.982   -22.147 1.00 16.50 ? 87  ILE B CB    1 
ATOM   3166 C  CG1   . ILE F 3 86  ? -1.810  10.358  -23.627 1.00 23.44 ? 87  ILE B CG1   1 
ATOM   3167 C  CG2   . ILE F 3 86  ? -0.803  8.891   -21.896 1.00 16.98 ? 87  ILE B CG2   1 
ATOM   3168 C  CD1   . ILE F 3 86  ? -0.523  11.008  -24.057 1.00 22.39 ? 87  ILE B CD1   1 
ATOM   3169 N  N     . ALA F 3 87  ? -3.242  7.826   -19.975 1.00 16.86 ? 88  ALA B N     1 
ATOM   3170 C  CA    . ALA F 3 87  ? -3.226  7.330   -18.607 1.00 16.31 ? 88  ALA B CA    1 
ATOM   3171 C  C     . ALA F 3 87  ? -1.848  6.771   -18.307 1.00 18.68 ? 88  ALA B C     1 
ATOM   3172 O  O     . ALA F 3 87  ? -1.270  6.048   -19.127 1.00 19.30 ? 88  ALA B O     1 
ATOM   3173 C  CB    . ALA F 3 87  ? -4.274  6.240   -18.427 1.00 18.39 ? 88  ALA B CB    1 
ATOM   3174 N  N     . ILE F 3 88  ? -1.309  7.111   -17.141 1.00 18.08 ? 89  ILE B N     1 
ATOM   3175 C  CA    . ILE F 3 88  ? -0.012  6.595   -16.731 1.00 14.82 ? 89  ILE B CA    1 
ATOM   3176 C  C     . ILE F 3 88  ? -0.168  6.021   -15.321 1.00 17.80 ? 89  ILE B C     1 
ATOM   3177 O  O     . ILE F 3 88  ? -0.648  6.704   -14.397 1.00 15.13 ? 89  ILE B O     1 
ATOM   3178 C  CB    . ILE F 3 88  ? 1.078   7.679   -16.733 1.00 15.49 ? 89  ILE B CB    1 
ATOM   3179 C  CG1   . ILE F 3 88  ? 1.187   8.316   -18.121 1.00 16.36 ? 89  ILE B CG1   1 
ATOM   3180 C  CG2   . ILE F 3 88  ? 2.411   7.065   -16.345 1.00 16.08 ? 89  ILE B CG2   1 
ATOM   3181 C  CD1   . ILE F 3 88  ? 2.283   9.353   -18.223 1.00 19.13 ? 89  ILE B CD1   1 
ATOM   3182 N  N     . ASP F 3 89  ? 0.225   4.761   -15.167 1.00 16.02 ? 90  ASP B N     1 
ATOM   3183 C  CA    . ASP F 3 89  ? 0.138   4.076   -13.884 1.00 16.44 ? 90  ASP B CA    1 
ATOM   3184 C  C     . ASP F 3 89  ? 1.511   3.489   -13.583 1.00 15.37 ? 90  ASP B C     1 
ATOM   3185 O  O     . ASP F 3 89  ? 2.175   2.932   -14.473 1.00 15.07 ? 90  ASP B O     1 
ATOM   3186 C  CB    . ASP F 3 89  ? -0.927  2.966   -13.941 1.00 17.87 ? 90  ASP B CB    1 
ATOM   3187 C  CG    . ASP F 3 89  ? -1.769  2.881   -12.666 1.00 20.14 ? 90  ASP B CG    1 
ATOM   3188 O  OD1   . ASP F 3 89  ? -1.966  3.913   -11.998 1.00 18.94 ? 90  ASP B OD1   1 
ATOM   3189 O  OD2   . ASP F 3 89  ? -2.243  1.776   -12.330 1.00 23.83 ? 90  ASP B OD2   1 
ATOM   3190 N  N     . ILE F 3 90  ? 1.937   3.623   -12.331 1.00 14.06 ? 91  ILE B N     1 
ATOM   3191 C  CA    . ILE F 3 90  ? 3.237   3.124   -11.897 1.00 13.45 ? 91  ILE B CA    1 
ATOM   3192 C  C     . ILE F 3 90  ? 3.068   1.796   -11.166 1.00 13.48 ? 91  ILE B C     1 
ATOM   3193 O  O     . ILE F 3 90  ? 2.161   1.648   -10.358 1.00 15.46 ? 91  ILE B O     1 
ATOM   3194 C  CB    . ILE F 3 90  ? 3.936   4.175   -11.019 1.00 19.67 ? 91  ILE B CB    1 
ATOM   3195 C  CG1   . ILE F 3 90  ? 4.062   5.479   -11.818 1.00 17.57 ? 91  ILE B CG1   1 
ATOM   3196 C  CG2   . ILE F 3 90  ? 5.320   3.683   -10.588 1.00 16.21 ? 91  ILE B CG2   1 
ATOM   3197 C  CD1   . ILE F 3 90  ? 4.573   6.627   -11.030 1.00 33.32 ? 91  ILE B CD1   1 
ATOM   3198 N  N     . LYS F 3 91  ? 3.936   0.834   -11.467 1.00 13.62 ? 92  LYS B N     1 
ATOM   3199 C  CA    . LYS F 3 91  ? 3.892   -0.503  -10.870 1.00 13.72 ? 92  LYS B CA    1 
ATOM   3200 C  C     . LYS F 3 91  ? 5.302   -0.885  -10.459 1.00 15.68 ? 92  LYS B C     1 
ATOM   3201 O  O     . LYS F 3 91  ? 6.264   -0.564  -11.157 1.00 18.10 ? 92  LYS B O     1 
ATOM   3202 C  CB    . LYS F 3 91  ? 3.366   -1.532  -11.876 1.00 10.54 ? 92  LYS B CB    1 
ATOM   3203 C  CG    . LYS F 3 91  ? 1.976   -1.227  -12.406 1.00 13.30 ? 92  LYS B CG    1 
ATOM   3204 C  CD    . LYS F 3 91  ? 0.927   -1.381  -11.325 1.00 23.51 ? 92  LYS B CD    1 
ATOM   3205 C  CE    . LYS F 3 91  ? -0.394  -0.800  -11.784 1.00 29.61 ? 92  LYS B CE    1 
ATOM   3206 N  NZ    . LYS F 3 91  ? -1.525  -1.102  -10.866 1.00 36.28 ? 92  LYS B NZ    1 
ATOM   3207 N  N     . THR F 3 92  ? 5.421   -1.577  -9.330  1.00 16.24 ? 93  THR B N     1 
ATOM   3208 C  CA    . THR F 3 92  ? 6.719   -1.977  -8.806  1.00 15.41 ? 93  THR B CA    1 
ATOM   3209 C  C     . THR F 3 92  ? 6.717   -3.456  -8.435  1.00 17.33 ? 93  THR B C     1 
ATOM   3210 O  O     . THR F 3 92  ? 5.686   -4.002  -8.045  1.00 16.92 ? 93  THR B O     1 
ATOM   3211 C  CB    . THR F 3 92  ? 7.053   -1.164  -7.526  1.00 19.89 ? 93  THR B CB    1 
ATOM   3212 O  OG1   . THR F 3 92  ? 6.914   0.236   -7.801  1.00 22.44 ? 93  THR B OG1   1 
ATOM   3213 C  CG2   . THR F 3 92  ? 8.481   -1.440  -7.058  1.00 23.13 ? 93  THR B CG2   1 
ATOM   3214 N  N     . THR F 3 93  ? 7.876   -4.092  -8.568  1.00 15.95 ? 94  THR B N     1 
ATOM   3215 C  CA    . THR F 3 93  ? 8.065   -5.484  -8.200  1.00 16.63 ? 94  THR B CA    1 
ATOM   3216 C  C     . THR F 3 93  ? 9.564   -5.633  -7.969  1.00 17.30 ? 94  THR B C     1 
ATOM   3217 O  O     . THR F 3 93  ? 10.319  -4.688  -8.195  1.00 18.64 ? 94  THR B O     1 
ATOM   3218 C  CB    . THR F 3 93  ? 7.559   -6.462  -9.283  1.00 19.44 ? 94  THR B CB    1 
ATOM   3219 O  OG1   . THR F 3 93  ? 7.486   -7.780  -8.723  1.00 20.04 ? 94  THR B OG1   1 
ATOM   3220 C  CG2   . THR F 3 93  ? 8.490   -6.481  -10.499 1.00 23.25 ? 94  THR B CG2   1 
ATOM   3221 N  N     . TYR F 3 94  ? 10.004  -6.803  -7.526  1.00 21.80 ? 95  TYR B N     1 
ATOM   3222 C  CA    . TYR F 3 94  ? 11.416  -7.012  -7.230  1.00 23.57 ? 95  TYR B CA    1 
ATOM   3223 C  C     . TYR F 3 94  ? 11.950  -8.304  -7.829  1.00 25.67 ? 95  TYR B C     1 
ATOM   3224 O  O     . TYR F 3 94  ? 11.190  -9.110  -8.374  1.00 25.41 ? 95  TYR B O     1 
ATOM   3225 C  CB    . TYR F 3 94  ? 11.591  -7.105  -5.704  1.00 31.15 ? 95  TYR B CB    1 
ATOM   3226 C  CG    . TYR F 3 94  ? 11.133  -8.447  -5.149  1.00 35.83 ? 95  TYR B CG    1 
ATOM   3227 C  CD1   . TYR F 3 94  ? 9.801   -8.664  -4.792  1.00 38.46 ? 95  TYR B CD1   1 
ATOM   3228 C  CD2   . TYR F 3 94  ? 12.022  -9.522  -5.051  1.00 40.59 ? 95  TYR B CD2   1 
ATOM   3229 C  CE1   . TYR F 3 94  ? 9.364   -9.917  -4.359  1.00 43.42 ? 95  TYR B CE1   1 
ATOM   3230 C  CE2   . TYR F 3 94  ? 11.598  -10.775 -4.621  1.00 52.66 ? 95  TYR B CE2   1 
ATOM   3231 C  CZ    . TYR F 3 94  ? 10.269  -10.968 -4.279  1.00 56.68 ? 95  TYR B CZ    1 
ATOM   3232 O  OH    . TYR F 3 94  ? 9.859   -12.217 -3.874  1.00 60.51 ? 95  TYR B OH    1 
ATOM   3233 N  N     . THR F 3 95  ? 13.265  -8.480  -7.704  1.00 28.64 ? 96  THR B N     1 
ATOM   3234 C  CA    . THR F 3 95  ? 13.983  -9.694  -8.102  1.00 35.84 ? 96  THR B CA    1 
ATOM   3235 C  C     . THR F 3 95  ? 15.072  -9.884  -7.063  1.00 39.52 ? 96  THR B C     1 
ATOM   3236 O  O     . THR F 3 95  ? 15.478  -8.930  -6.378  1.00 34.46 ? 96  THR B O     1 
ATOM   3237 C  CB    . THR F 3 95  ? 14.722  -9.621  -9.458  1.00 34.25 ? 96  THR B CB    1 
ATOM   3238 O  OG1   . THR F 3 95  ? 15.182  -8.290  -9.698  1.00 47.08 ? 96  THR B OG1   1 
ATOM   3239 C  CG2   . THR F 3 95  ? 13.859  -10.123 -10.570 1.00 36.38 ? 96  THR B CG2   1 
ATOM   3240 N  N     . ASN F 3 96  ? 15.542  -11.122 -6.952  1.00 44.72 ? 97  ASN B N     1 
ATOM   3241 C  CA    . ASN F 3 96  ? 16.611  -11.461 -6.022  1.00 47.42 ? 97  ASN B CA    1 
ATOM   3242 C  C     . ASN F 3 96  ? 17.926  -11.450 -6.776  1.00 50.76 ? 97  ASN B C     1 
ATOM   3243 O  O     . ASN F 3 96  ? 18.963  -11.093 -6.224  1.00 52.25 ? 97  ASN B O     1 
ATOM   3244 C  CB    . ASN F 3 96  ? 16.359  -12.831 -5.416  1.00 42.84 ? 97  ASN B CB    1 
ATOM   3245 C  CG    . ASN F 3 96  ? 15.126  -12.851 -4.547  1.00 50.97 ? 97  ASN B CG    1 
ATOM   3246 O  OD1   . ASN F 3 96  ? 15.049  -12.150 -3.540  1.00 51.57 ? 97  ASN B OD1   1 
ATOM   3247 N  ND2   . ASN F 3 96  ? 14.150  -13.651 -4.931  1.00 52.79 ? 97  ASN B ND2   1 
ATOM   3248 N  N     . LYS F 3 97  ? 17.870  -11.859 -8.040  1.00 54.72 ? 98  LYS B N     1 
ATOM   3249 C  CA    . LYS F 3 97  ? 19.037  -11.876 -8.910  1.00 60.43 ? 98  LYS B CA    1 
ATOM   3250 C  C     . LYS F 3 97  ? 18.640  -11.203 -10.209 1.00 63.07 ? 98  LYS B C     1 
ATOM   3251 O  O     . LYS F 3 97  ? 17.620  -11.535 -10.811 1.00 63.92 ? 98  LYS B O     1 
ATOM   3252 C  CB    . LYS F 3 97  ? 19.519  -13.304 -9.165  1.00 65.52 ? 98  LYS B CB    1 
ATOM   3253 C  CG    . LYS F 3 97  ? 20.122  -13.938 -7.930  1.00 72.97 ? 98  LYS B CG    1 
ATOM   3254 C  CD    . LYS F 3 97  ? 20.718  -15.307 -8.190  1.00 81.86 ? 98  LYS B CD    1 
ATOM   3255 C  CE    . LYS F 3 97  ? 21.360  -15.849 -6.908  1.00 88.07 ? 98  LYS B CE    1 
ATOM   3256 N  NZ    . LYS F 3 97  ? 22.033  -17.164 -7.105  1.00 86.13 ? 98  LYS B NZ    1 
ATOM   3257 N  N     . GLU F 3 98  ? 19.460  -10.250 -10.625 1.00 65.42 ? 99  GLU B N     1 
ATOM   3258 C  CA    . GLU F 3 98  ? 19.249  -9.446  -11.826 1.00 67.56 ? 99  GLU B CA    1 
ATOM   3259 C  C     . GLU F 3 98  ? 18.793  -10.111 -13.146 1.00 66.36 ? 99  GLU B C     1 
ATOM   3260 O  O     . GLU F 3 98  ? 18.125  -9.466  -13.963 1.00 67.00 ? 99  GLU B O     1 
ATOM   3261 C  CB    . GLU F 3 98  ? 20.522  -8.648  -12.078 1.00 72.17 ? 99  GLU B CB    1 
ATOM   3262 C  CG    . GLU F 3 98  ? 20.311  -7.254  -12.647 1.00 78.78 ? 99  GLU B CG    1 
ATOM   3263 C  CD    . GLU F 3 98  ? 21.624  -6.504  -12.799 1.00 87.84 ? 99  GLU B CD    1 
ATOM   3264 O  OE1   . GLU F 3 98  ? 22.567  -6.766  -12.012 1.00 93.11 ? 99  GLU B OE1   1 
ATOM   3265 O  OE2   . GLU F 3 98  ? 21.714  -5.653  -13.709 1.00 91.99 ? 99  GLU B OE2   1 
ATOM   3266 N  N     . ASN F 3 99  ? 19.136  -11.380 -13.356 1.00 63.57 ? 100 ASN B N     1 
ATOM   3267 C  CA    . ASN F 3 99  ? 18.786  -12.080 -14.597 1.00 62.22 ? 100 ASN B CA    1 
ATOM   3268 C  C     . ASN F 3 99  ? 17.553  -12.993 -14.533 1.00 59.09 ? 100 ASN B C     1 
ATOM   3269 O  O     . ASN F 3 99  ? 17.385  -13.866 -15.391 1.00 59.85 ? 100 ASN B O     1 
ATOM   3270 C  CB    . ASN F 3 99  ? 19.998  -12.897 -15.099 1.00 69.60 ? 100 ASN B CB    1 
ATOM   3271 C  CG    . ASN F 3 99  ? 21.275  -12.048 -15.236 1.00 78.47 ? 100 ASN B CG    1 
ATOM   3272 O  OD1   . ASN F 3 99  ? 21.210  -10.829 -15.413 1.00 83.47 ? 100 ASN B OD1   1 
ATOM   3273 N  ND2   . ASN F 3 99  ? 22.441  -12.698 -15.151 1.00 77.20 ? 100 ASN B ND2   1 
ATOM   3274 N  N     . GLU F 3 100 ? 16.696  -12.795 -13.532 1.00 54.08 ? 101 GLU B N     1 
ATOM   3275 C  CA    . GLU F 3 100 ? 15.486  -13.605 -13.354 1.00 48.89 ? 101 GLU B CA    1 
ATOM   3276 C  C     . GLU F 3 100 ? 14.223  -13.023 -13.987 1.00 43.98 ? 101 GLU B C     1 
ATOM   3277 O  O     . GLU F 3 100 ? 14.180  -11.852 -14.368 1.00 42.63 ? 101 GLU B O     1 
ATOM   3278 C  CB    . GLU F 3 100 ? 15.197  -13.813 -11.872 1.00 51.47 ? 101 GLU B CB    1 
ATOM   3279 C  CG    . GLU F 3 100 ? 16.230  -14.628 -11.131 1.00 59.13 ? 101 GLU B CG    1 
ATOM   3280 C  CD    . GLU F 3 100 ? 15.902  -14.759 -9.651  1.00 67.83 ? 101 GLU B CD    1 
ATOM   3281 O  OE1   . GLU F 3 100 ? 15.125  -13.924 -9.128  1.00 73.59 ? 101 GLU B OE1   1 
ATOM   3282 O  OE2   . GLU F 3 100 ? 16.423  -15.698 -9.014  1.00 69.84 ? 101 GLU B OE2   1 
ATOM   3283 N  N     . LYS F 3 101 ? 13.195  -13.863 -14.084 1.00 41.22 ? 102 LYS B N     1 
ATOM   3284 C  CA    . LYS F 3 101 ? 11.905  -13.460 -14.634 1.00 37.45 ? 102 LYS B CA    1 
ATOM   3285 C  C     . LYS F 3 101 ? 11.101  -12.714 -13.576 1.00 34.01 ? 102 LYS B C     1 
ATOM   3286 O  O     . LYS F 3 101 ? 11.187  -13.020 -12.384 1.00 33.76 ? 102 LYS B O     1 
ATOM   3287 C  CB    . LYS F 3 101 ? 11.113  -14.676 -15.106 1.00 38.64 ? 102 LYS B CB    1 
ATOM   3288 C  CG    . LYS F 3 101 ? 11.625  -15.289 -16.395 1.00 47.45 ? 102 LYS B CG    1 
ATOM   3289 C  CD    . LYS F 3 101 ? 10.790  -16.498 -16.778 1.00 52.80 ? 102 LYS B CD    1 
ATOM   3290 C  CE    . LYS F 3 101 ? 11.320  -17.184 -18.032 1.00 57.39 ? 102 LYS B CE    1 
ATOM   3291 N  NZ    . LYS F 3 101 ? 10.553  -18.430 -18.336 1.00 62.06 ? 102 LYS B NZ    1 
ATOM   3292 N  N     . ILE F 3 102 ? 10.319  -11.739 -14.021 1.00 31.75 ? 103 ILE B N     1 
ATOM   3293 C  CA    . ILE F 3 102 ? 9.491   -10.917 -13.141 1.00 28.62 ? 103 ILE B CA    1 
ATOM   3294 C  C     . ILE F 3 102 ? 8.076   -10.868 -13.698 1.00 25.87 ? 103 ILE B C     1 
ATOM   3295 O  O     . ILE F 3 102 ? 7.840   -11.248 -14.843 1.00 23.03 ? 103 ILE B O     1 
ATOM   3296 C  CB    . ILE F 3 102 ? 10.035  -9.470  -13.081 1.00 28.58 ? 103 ILE B CB    1 
ATOM   3297 C  CG1   . ILE F 3 102 ? 9.984   -8.840  -14.477 1.00 28.79 ? 103 ILE B CG1   1 
ATOM   3298 C  CG2   . ILE F 3 102 ? 11.470  -9.475  -12.604 1.00 28.01 ? 103 ILE B CG2   1 
ATOM   3299 C  CD1   . ILE F 3 102 ? 10.695  -7.518  -14.605 1.00 31.92 ? 103 ILE B CD1   1 
ATOM   3300 N  N     . LYS F 3 103 ? 7.139   -10.409 -12.881 1.00 22.48 ? 104 LYS B N     1 
ATOM   3301 C  CA    . LYS F 3 103 ? 5.749   -10.268 -13.292 1.00 23.91 ? 104 LYS B CA    1 
ATOM   3302 C  C     . LYS F 3 103 ? 5.195   -9.149  -12.418 1.00 20.79 ? 104 LYS B C     1 
ATOM   3303 O  O     . LYS F 3 103 ? 5.709   -8.914  -11.325 1.00 23.47 ? 104 LYS B O     1 
ATOM   3304 C  CB    . LYS F 3 103 ? 4.970   -11.576 -13.082 1.00 24.65 ? 104 LYS B CB    1 
ATOM   3305 C  CG    . LYS F 3 103 ? 5.002   -12.083 -11.667 1.00 32.23 ? 104 LYS B CG    1 
ATOM   3306 C  CD    . LYS F 3 103 ? 4.188   -13.351 -11.467 1.00 50.00 ? 104 LYS B CD    1 
ATOM   3307 C  CE    . LYS F 3 103 ? 4.303   -13.812 -10.003 1.00 55.87 ? 104 LYS B CE    1 
ATOM   3308 N  NZ    . LYS F 3 103 ? 3.572   -15.076 -9.693  1.00 59.60 ? 104 LYS B NZ    1 
ATOM   3309 N  N     . PHE F 3 104 ? 4.170   -8.460  -12.899 1.00 18.32 ? 105 PHE B N     1 
ATOM   3310 C  CA    . PHE F 3 104 ? 3.549   -7.356  -12.172 1.00 15.46 ? 105 PHE B CA    1 
ATOM   3311 C  C     . PHE F 3 104 ? 2.055   -7.622  -12.023 1.00 18.70 ? 105 PHE B C     1 
ATOM   3312 O  O     . PHE F 3 104 ? 1.488   -8.457  -12.738 1.00 19.61 ? 105 PHE B O     1 
ATOM   3313 C  CB    . PHE F 3 104 ? 3.666   -6.048  -12.966 1.00 12.33 ? 105 PHE B CB    1 
ATOM   3314 C  CG    . PHE F 3 104 ? 5.070   -5.534  -13.137 1.00 19.23 ? 105 PHE B CG    1 
ATOM   3315 C  CD1   . PHE F 3 104 ? 5.875   -5.990  -14.183 1.00 20.40 ? 105 PHE B CD1   1 
ATOM   3316 C  CD2   . PHE F 3 104 ? 5.587   -4.579  -12.262 1.00 17.01 ? 105 PHE B CD2   1 
ATOM   3317 C  CE1   . PHE F 3 104 ? 7.179   -5.499  -14.356 1.00 18.83 ? 105 PHE B CE1   1 
ATOM   3318 C  CE2   . PHE F 3 104 ? 6.888   -4.082  -12.426 1.00 19.51 ? 105 PHE B CE2   1 
ATOM   3319 C  CZ    . PHE F 3 104 ? 7.686   -4.546  -13.477 1.00 19.07 ? 105 PHE B CZ    1 
ATOM   3320 N  N     . THR F 3 105 ? 1.426   -6.910  -11.092 1.00 17.11 ? 106 THR B N     1 
ATOM   3321 C  CA    . THR F 3 105 ? -0.019  -6.960  -10.904 1.00 15.91 ? 106 THR B CA    1 
ATOM   3322 C  C     . THR F 3 105 ? -0.314  -5.651  -11.637 1.00 16.09 ? 106 THR B C     1 
ATOM   3323 O  O     . THR F 3 105 ? 0.227   -4.611  -11.278 1.00 17.14 ? 106 THR B O     1 
ATOM   3324 C  CB    . THR F 3 105 ? -0.430  -6.871  -9.405  1.00 17.34 ? 106 THR B CB    1 
ATOM   3325 O  OG1   . THR F 3 105 ? 0.466   -6.002  -8.703  1.00 23.17 ? 106 THR B OG1   1 
ATOM   3326 C  CG2   . THR F 3 105 ? -0.401  -8.243  -8.755  1.00 16.81 ? 106 THR B CG2   1 
ATOM   3327 N  N     . LEU F 3 106 ? -1.153  -5.695  -12.664 1.00 15.86 ? 107 LEU B N     1 
ATOM   3328 C  CA    . LEU F 3 106 ? -1.406  -4.506  -13.477 1.00 17.55 ? 107 LEU B CA    1 
ATOM   3329 C  C     . LEU F 3 106 ? -2.687  -3.722  -13.252 1.00 17.93 ? 107 LEU B C     1 
ATOM   3330 O  O     . LEU F 3 106 ? -2.963  -2.782  -13.984 1.00 19.64 ? 107 LEU B O     1 
ATOM   3331 C  CB    . LEU F 3 106 ? -1.284  -4.872  -14.967 1.00 16.42 ? 107 LEU B CB    1 
ATOM   3332 C  CG    . LEU F 3 106 ? 0.096   -5.353  -15.425 1.00 19.60 ? 107 LEU B CG    1 
ATOM   3333 C  CD1   . LEU F 3 106 ? 0.037   -5.828  -16.870 1.00 23.23 ? 107 LEU B CD1   1 
ATOM   3334 C  CD2   . LEU F 3 106 ? 1.106   -4.225  -15.261 1.00 13.52 ? 107 LEU B CD2   1 
ATOM   3335 N  N     . GLY F 3 107 ? -3.466  -4.092  -12.247 1.00 16.82 ? 108 GLY B N     1 
ATOM   3336 C  CA    . GLY F 3 107 ? -4.702  -3.378  -11.994 1.00 15.49 ? 108 GLY B CA    1 
ATOM   3337 C  C     . GLY F 3 107 ? -5.862  -4.343  -12.092 1.00 14.95 ? 108 GLY B C     1 
ATOM   3338 O  O     . GLY F 3 107 ? -5.703  -5.466  -12.576 1.00 15.88 ? 108 GLY B O     1 
ATOM   3339 N  N     . GLY F 3 108 ? -7.030  -3.912  -11.642 1.00 12.72 ? 109 GLY B N     1 
ATOM   3340 C  CA    . GLY F 3 108 ? -8.181  -4.784  -11.670 1.00 16.30 ? 109 GLY B CA    1 
ATOM   3341 C  C     . GLY F 3 108 ? -8.752  -5.020  -13.051 1.00 19.55 ? 109 GLY B C     1 
ATOM   3342 O  O     . GLY F 3 108 ? -8.582  -4.199  -13.961 1.00 18.41 ? 109 GLY B O     1 
ATOM   3343 N  N     . TYR F 3 109 ? -9.434  -6.152  -13.205 1.00 19.83 ? 110 TYR B N     1 
ATOM   3344 C  CA    . TYR F 3 109 ? -10.074 -6.482  -14.467 1.00 16.54 ? 110 TYR B CA    1 
ATOM   3345 C  C     . TYR F 3 109 ? -11.595 -6.424  -14.356 1.00 16.65 ? 110 TYR B C     1 
ATOM   3346 O  O     . TYR F 3 109 ? -12.292 -6.774  -15.297 1.00 15.88 ? 110 TYR B O     1 
ATOM   3347 C  CB    . TYR F 3 109 ? -9.604  -7.848  -14.994 1.00 14.12 ? 110 TYR B CB    1 
ATOM   3348 C  CG    . TYR F 3 109 ? -9.837  -9.052  -14.097 1.00 17.40 ? 110 TYR B CG    1 
ATOM   3349 C  CD1   . TYR F 3 109 ? -11.103 -9.637  -13.981 1.00 15.52 ? 110 TYR B CD1   1 
ATOM   3350 C  CD2   . TYR F 3 109 ? -8.781  -9.631  -13.395 1.00 18.52 ? 110 TYR B CD2   1 
ATOM   3351 C  CE1   . TYR F 3 109 ? -11.305 -10.765 -13.193 1.00 14.33 ? 110 TYR B CE1   1 
ATOM   3352 C  CE2   . TYR F 3 109 ? -8.972  -10.756 -12.607 1.00 17.44 ? 110 TYR B CE2   1 
ATOM   3353 C  CZ    . TYR F 3 109 ? -10.234 -11.318 -12.510 1.00 17.09 ? 110 TYR B CZ    1 
ATOM   3354 O  OH    . TYR F 3 109 ? -10.423 -12.430 -11.727 1.00 19.58 ? 110 TYR B OH    1 
ATOM   3355 N  N     . THR F 3 110 ? -12.111 -5.972  -13.211 1.00 14.09 ? 111 THR B N     1 
ATOM   3356 C  CA    . THR F 3 110 ? -13.556 -5.880  -13.026 1.00 16.05 ? 111 THR B CA    1 
ATOM   3357 C  C     . THR F 3 110 ? -14.053 -4.453  -12.806 1.00 17.11 ? 111 THR B C     1 
ATOM   3358 O  O     . THR F 3 110 ? -15.236 -4.249  -12.530 1.00 19.65 ? 111 THR B O     1 
ATOM   3359 C  CB    . THR F 3 110 ? -14.054 -6.751  -11.839 1.00 19.08 ? 111 THR B CB    1 
ATOM   3360 O  OG1   . THR F 3 110 ? -13.500 -6.260  -10.616 1.00 20.27 ? 111 THR B OG1   1 
ATOM   3361 C  CG2   . THR F 3 110 ? -13.638 -8.200  -12.018 1.00 18.27 ? 111 THR B CG2   1 
ATOM   3362 N  N     . SER F 3 111 ? -13.171 -3.463  -12.923 1.00 15.00 ? 112 SER B N     1 
ATOM   3363 C  CA    . SER F 3 111 ? -13.609 -2.093  -12.717 1.00 18.28 ? 112 SER B CA    1 
ATOM   3364 C  C     . SER F 3 111 ? -13.882 -1.348  -14.033 1.00 20.29 ? 112 SER B C     1 
ATOM   3365 O  O     . SER F 3 111 ? -14.788 -1.739  -14.776 1.00 20.29 ? 112 SER B O     1 
ATOM   3366 C  CB    . SER F 3 111 ? -12.621 -1.340  -11.819 1.00 17.92 ? 112 SER B CB    1 
ATOM   3367 O  OG    . SER F 3 111 ? -11.295 -1.460  -12.299 1.00 25.45 ? 112 SER B OG    1 
ATOM   3368 N  N     . PHE F 3 112 ? -13.110 -0.300  -14.330 1.00 18.76 ? 113 PHE B N     1 
ATOM   3369 C  CA    . PHE F 3 112 ? -13.313 0.511   -15.537 1.00 20.20 ? 113 PHE B CA    1 
ATOM   3370 C  C     . PHE F 3 112 ? -13.264 -0.189  -16.896 1.00 22.39 ? 113 PHE B C     1 
ATOM   3371 O  O     . PHE F 3 112 ? -13.858 0.317   -17.853 1.00 21.47 ? 113 PHE B O     1 
ATOM   3372 C  CB    . PHE F 3 112 ? -12.369 1.726   -15.557 1.00 16.51 ? 113 PHE B CB    1 
ATOM   3373 C  CG    . PHE F 3 112 ? -10.940 1.380   -15.310 1.00 15.08 ? 113 PHE B CG    1 
ATOM   3374 C  CD1   . PHE F 3 112 ? -10.438 1.343   -14.009 1.00 14.54 ? 113 PHE B CD1   1 
ATOM   3375 C  CD2   . PHE F 3 112 ? -10.097 1.071   -16.367 1.00 11.44 ? 113 PHE B CD2   1 
ATOM   3376 C  CE1   . PHE F 3 112 ? -9.116  0.998   -13.768 1.00 15.25 ? 113 PHE B CE1   1 
ATOM   3377 C  CE2   . PHE F 3 112 ? -8.774  0.725   -16.141 1.00 16.48 ? 113 PHE B CE2   1 
ATOM   3378 C  CZ    . PHE F 3 112 ? -8.278  0.686   -14.836 1.00 22.87 ? 113 PHE B CZ    1 
ATOM   3379 N  N     . ILE F 3 113 ? -12.574 -1.327  -17.013 1.00 21.31 ? 114 ILE B N     1 
ATOM   3380 C  CA    . ILE F 3 113 ? -12.564 -2.009  -18.309 1.00 23.80 ? 114 ILE B CA    1 
ATOM   3381 C  C     . ILE F 3 113 ? -13.917 -2.692  -18.562 1.00 23.21 ? 114 ILE B C     1 
ATOM   3382 O  O     . ILE F 3 113 ? -14.223 -3.035  -19.688 1.00 24.45 ? 114 ILE B O     1 
ATOM   3383 C  CB    . ILE F 3 113 ? -11.406 -3.050  -18.486 1.00 25.17 ? 114 ILE B CB    1 
ATOM   3384 C  CG1   . ILE F 3 113 ? -11.719 -4.345  -17.747 1.00 25.45 ? 114 ILE B CG1   1 
ATOM   3385 C  CG2   . ILE F 3 113 ? -10.060 -2.451  -18.051 1.00 22.23 ? 114 ILE B CG2   1 
ATOM   3386 C  CD1   . ILE F 3 113 ? -10.726 -5.437  -18.041 1.00 25.86 ? 114 ILE B CD1   1 
ATOM   3387 N  N     . ARG F 3 114 ? -14.719 -2.885  -17.517 1.00 20.34 ? 115 ARG B N     1 
ATOM   3388 C  CA    . ARG F 3 114 ? -16.037 -3.499  -17.662 1.00 20.16 ? 115 ARG B CA    1 
ATOM   3389 C  C     . ARG F 3 114 ? -17.129 -2.479  -17.422 1.00 26.81 ? 115 ARG B C     1 
ATOM   3390 O  O     . ARG F 3 114 ? -18.258 -2.658  -17.868 1.00 29.55 ? 115 ARG B O     1 
ATOM   3391 C  CB    . ARG F 3 114 ? -16.233 -4.632  -16.673 1.00 16.67 ? 115 ARG B CB    1 
ATOM   3392 C  CG    . ARG F 3 114 ? -15.261 -5.749  -16.839 1.00 15.32 ? 115 ARG B CG    1 
ATOM   3393 C  CD    . ARG F 3 114 ? -15.682 -6.949  -16.029 1.00 15.25 ? 115 ARG B CD    1 
ATOM   3394 N  NE    . ARG F 3 114 ? -14.671 -7.992  -16.143 1.00 16.42 ? 115 ARG B NE    1 
ATOM   3395 C  CZ    . ARG F 3 114 ? -14.917 -9.291  -16.059 1.00 19.78 ? 115 ARG B CZ    1 
ATOM   3396 N  NH1   . ARG F 3 114 ? -16.152 -9.722  -15.845 1.00 16.05 ? 115 ARG B NH1   1 
ATOM   3397 N  NH2   . ARG F 3 114 ? -13.923 -10.156 -16.187 1.00 16.39 ? 115 ARG B NH2   1 
ATOM   3398 N  N     . ASN F 3 115 ? -16.796 -1.415  -16.702 1.00 29.59 ? 116 ASN B N     1 
ATOM   3399 C  CA    . ASN F 3 115 ? -17.756 -0.361  -16.410 1.00 31.67 ? 116 ASN B CA    1 
ATOM   3400 C  C     . ASN F 3 115 ? -17.070 0.975   -16.667 1.00 32.79 ? 116 ASN B C     1 
ATOM   3401 O  O     . ASN F 3 115 ? -16.274 1.447   -15.850 1.00 35.16 ? 116 ASN B O     1 
ATOM   3402 C  CB    . ASN F 3 115 ? -18.216 -0.454  -14.960 1.00 30.81 ? 116 ASN B CB    1 
ATOM   3403 C  CG    . ASN F 3 115 ? -19.266 0.586   -14.620 1.00 48.81 ? 116 ASN B CG    1 
ATOM   3404 O  OD1   . ASN F 3 115 ? -19.299 1.679   -15.200 1.00 52.05 ? 116 ASN B OD1   1 
ATOM   3405 N  ND2   . ASN F 3 115 ? -20.131 0.257   -13.673 1.00 51.02 ? 116 ASN B ND2   1 
ATOM   3406 N  N     . ASN F 3 116 ? -17.402 1.573   -17.806 1.00 31.24 ? 117 ASN B N     1 
ATOM   3407 C  CA    . ASN F 3 116 ? -16.834 2.840   -18.284 1.00 31.08 ? 117 ASN B CA    1 
ATOM   3408 C  C     . ASN F 3 116 ? -16.447 3.959   -17.290 1.00 30.36 ? 117 ASN B C     1 
ATOM   3409 O  O     . ASN F 3 116 ? -15.478 4.695   -17.528 1.00 27.46 ? 117 ASN B O     1 
ATOM   3410 C  CB    . ASN F 3 116 ? -17.767 3.417   -19.351 1.00 32.34 ? 117 ASN B CB    1 
ATOM   3411 C  CG    . ASN F 3 116 ? -17.090 4.451   -20.228 1.00 38.31 ? 117 ASN B CG    1 
ATOM   3412 O  OD1   . ASN F 3 116 ? -16.015 4.207   -20.781 1.00 42.80 ? 117 ASN B OD1   1 
ATOM   3413 N  ND2   . ASN F 3 116 ? -17.720 5.615   -20.367 1.00 33.76 ? 117 ASN B ND2   1 
ATOM   3414 N  N     . THR F 3 117 ? -17.186 4.093   -16.193 1.00 27.75 ? 118 THR B N     1 
ATOM   3415 C  CA    . THR F 3 117 ? -16.916 5.145   -15.219 1.00 27.98 ? 118 THR B CA    1 
ATOM   3416 C  C     . THR F 3 117 ? -16.567 4.682   -13.800 1.00 28.20 ? 118 THR B C     1 
ATOM   3417 O  O     . THR F 3 117 ? -16.447 5.508   -12.894 1.00 28.93 ? 118 THR B O     1 
ATOM   3418 C  CB    . THR F 3 117 ? -18.128 6.077   -15.124 1.00 30.56 ? 118 THR B CB    1 
ATOM   3419 O  OG1   . THR F 3 117 ? -19.321 5.286   -15.115 1.00 30.70 ? 118 THR B OG1   1 
ATOM   3420 C  CG2   . THR F 3 117 ? -18.175 7.023   -16.298 1.00 31.73 ? 118 THR B CG2   1 
ATOM   3421 N  N     . LYS F 3 118 ? -16.401 3.378   -13.600 1.00 26.89 ? 119 LYS B N     1 
ATOM   3422 C  CA    . LYS F 3 118 ? -16.099 2.844   -12.276 1.00 26.60 ? 119 LYS B CA    1 
ATOM   3423 C  C     . LYS F 3 118 ? -14.631 2.970   -11.871 1.00 24.39 ? 119 LYS B C     1 
ATOM   3424 O  O     . LYS F 3 118 ? -13.747 2.439   -12.545 1.00 21.56 ? 119 LYS B O     1 
ATOM   3425 C  CB    . LYS F 3 118 ? -16.515 1.370   -12.180 1.00 29.59 ? 119 LYS B CB    1 
ATOM   3426 C  CG    . LYS F 3 118 ? -16.564 0.846   -10.742 1.00 43.91 ? 119 LYS B CG    1 
ATOM   3427 C  CD    . LYS F 3 118 ? -16.425 -0.660  -10.660 1.00 47.28 ? 119 LYS B CD    1 
ATOM   3428 C  CE    . LYS F 3 118 ? -17.604 -1.368  -11.300 1.00 54.98 ? 119 LYS B CE    1 
ATOM   3429 N  NZ    . LYS F 3 118 ? -17.448 -2.854  -11.293 1.00 47.51 ? 119 LYS B NZ    1 
ATOM   3430 N  N     . ASN F 3 119 ? -14.388 3.668   -10.762 1.00 22.17 ? 120 ASN B N     1 
ATOM   3431 C  CA    . ASN F 3 119 ? -13.041 3.865   -10.203 1.00 23.74 ? 120 ASN B CA    1 
ATOM   3432 C  C     . ASN F 3 119 ? -12.009 4.433   -11.168 1.00 20.46 ? 120 ASN B C     1 
ATOM   3433 O  O     . ASN F 3 119 ? -10.845 4.003   -11.187 1.00 18.32 ? 120 ASN B O     1 
ATOM   3434 C  CB    . ASN F 3 119 ? -12.506 2.555   -9.603  1.00 20.57 ? 120 ASN B CB    1 
ATOM   3435 C  CG    . ASN F 3 119 ? -13.294 2.108   -8.393  1.00 31.98 ? 120 ASN B CG    1 
ATOM   3436 O  OD1   . ASN F 3 119 ? -14.354 1.497   -8.523  1.00 34.62 ? 120 ASN B OD1   1 
ATOM   3437 N  ND2   . ASN F 3 119 ? -12.784 2.412   -7.205  1.00 28.97 ? 120 ASN B ND2   1 
ATOM   3438 N  N     . ILE F 3 120 ? -12.430 5.408   -11.959 1.00 17.43 ? 121 ILE B N     1 
ATOM   3439 C  CA    . ILE F 3 120 ? -11.533 6.024   -12.923 1.00 18.05 ? 121 ILE B CA    1 
ATOM   3440 C  C     . ILE F 3 120 ? -11.806 7.529   -12.897 1.00 18.78 ? 121 ILE B C     1 
ATOM   3441 O  O     . ILE F 3 120 ? -12.952 7.946   -12.765 1.00 19.23 ? 121 ILE B O     1 
ATOM   3442 C  CB    . ILE F 3 120 ? -11.701 5.349   -14.338 1.00 14.73 ? 121 ILE B CB    1 
ATOM   3443 C  CG1   . ILE F 3 120 ? -10.691 5.917   -15.333 1.00 15.93 ? 121 ILE B CG1   1 
ATOM   3444 C  CG2   . ILE F 3 120 ? -13.145 5.445   -14.823 1.00 11.64 ? 121 ILE B CG2   1 
ATOM   3445 C  CD1   . ILE F 3 120 ? -10.534 5.063   -16.573 1.00 14.12 ? 121 ILE B CD1   1 
ATOM   3446 N  N     . VAL F 3 121 ? -10.747 8.334   -12.990 1.00 17.92 ? 122 VAL B N     1 
ATOM   3447 C  CA    . VAL F 3 121 ? -10.874 9.792   -12.929 1.00 20.06 ? 122 VAL B CA    1 
ATOM   3448 C  C     . VAL F 3 121 ? -11.799 10.354  -14.011 1.00 21.54 ? 122 VAL B C     1 
ATOM   3449 O  O     . VAL F 3 121 ? -12.660 11.189  -13.730 1.00 21.15 ? 122 VAL B O     1 
ATOM   3450 C  CB    . VAL F 3 121 ? -9.476  10.461  -12.982 1.00 23.47 ? 122 VAL B CB    1 
ATOM   3451 C  CG1   . VAL F 3 121 ? -9.593  11.975  -12.880 1.00 21.35 ? 122 VAL B CG1   1 
ATOM   3452 C  CG2   . VAL F 3 121 ? -8.613  9.929   -11.838 1.00 19.66 ? 122 VAL B CG2   1 
ATOM   3453 N  N     . TYR F 3 122 ? -11.614 9.886   -15.241 1.00 21.60 ? 123 TYR B N     1 
ATOM   3454 C  CA    . TYR F 3 122 ? -12.437 10.284  -16.383 1.00 22.50 ? 123 TYR B CA    1 
ATOM   3455 C  C     . TYR F 3 122 ? -12.933 8.994   -17.035 1.00 20.14 ? 123 TYR B C     1 
ATOM   3456 O  O     . TYR F 3 122 ? -12.269 7.960   -16.941 1.00 19.54 ? 123 TYR B O     1 
ATOM   3457 C  CB    . TYR F 3 122 ? -11.601 11.069  -17.399 1.00 22.21 ? 123 TYR B CB    1 
ATOM   3458 C  CG    . TYR F 3 122 ? -11.260 12.467  -16.950 1.00 27.24 ? 123 TYR B CG    1 
ATOM   3459 C  CD1   . TYR F 3 122 ? -12.189 13.499  -17.082 1.00 24.86 ? 123 TYR B CD1   1 
ATOM   3460 C  CD2   . TYR F 3 122 ? -10.010 12.765  -16.392 1.00 21.53 ? 123 TYR B CD2   1 
ATOM   3461 C  CE1   . TYR F 3 122 ? -11.888 14.792  -16.673 1.00 24.15 ? 123 TYR B CE1   1 
ATOM   3462 C  CE2   . TYR F 3 122 ? -9.699  14.065  -15.977 1.00 19.34 ? 123 TYR B CE2   1 
ATOM   3463 C  CZ    . TYR F 3 122 ? -10.649 15.068  -16.123 1.00 23.82 ? 123 TYR B CZ    1 
ATOM   3464 O  OH    . TYR F 3 122 ? -10.374 16.348  -15.714 1.00 31.39 ? 123 TYR B OH    1 
ATOM   3465 N  N     . PRO F 3 123 ? -14.104 9.028   -17.691 1.00 18.74 ? 124 PRO B N     1 
ATOM   3466 C  CA    . PRO F 3 123 ? -14.637 7.827   -18.353 1.00 19.76 ? 124 PRO B CA    1 
ATOM   3467 C  C     . PRO F 3 123 ? -13.552 7.152   -19.209 1.00 19.64 ? 124 PRO B C     1 
ATOM   3468 O  O     . PRO F 3 123 ? -12.808 7.831   -19.922 1.00 19.70 ? 124 PRO B O     1 
ATOM   3469 C  CB    . PRO F 3 123 ? -15.774 8.392   -19.206 1.00 17.49 ? 124 PRO B CB    1 
ATOM   3470 C  CG    . PRO F 3 123 ? -16.303 9.498   -18.334 1.00 21.77 ? 124 PRO B CG    1 
ATOM   3471 C  CD    . PRO F 3 123 ? -15.017 10.173  -17.860 1.00 19.42 ? 124 PRO B CD    1 
ATOM   3472 N  N     . PHE F 3 124 ? -13.466 5.827   -19.127 1.00 17.64 ? 125 PHE B N     1 
ATOM   3473 C  CA    . PHE F 3 124 ? -12.476 5.039   -19.861 1.00 18.32 ? 125 PHE B CA    1 
ATOM   3474 C  C     . PHE F 3 124 ? -12.345 5.399   -21.350 1.00 18.89 ? 125 PHE B C     1 
ATOM   3475 O  O     . PHE F 3 124 ? -11.244 5.416   -21.902 1.00 19.29 ? 125 PHE B O     1 
ATOM   3476 C  CB    . PHE F 3 124 ? -12.819 3.550   -19.719 1.00 17.14 ? 125 PHE B CB    1 
ATOM   3477 C  CG    . PHE F 3 124 ? -11.772 2.612   -20.274 1.00 15.51 ? 125 PHE B CG    1 
ATOM   3478 C  CD1   . PHE F 3 124 ? -10.538 2.463   -19.639 1.00 13.99 ? 125 PHE B CD1   1 
ATOM   3479 C  CD2   . PHE F 3 124 ? -12.033 1.853   -21.413 1.00 18.82 ? 125 PHE B CD2   1 
ATOM   3480 C  CE1   . PHE F 3 124 ? -9.577  1.572   -20.120 1.00 16.89 ? 125 PHE B CE1   1 
ATOM   3481 C  CE2   . PHE F 3 124 ? -11.077 0.952   -21.911 1.00 14.87 ? 125 PHE B CE2   1 
ATOM   3482 C  CZ    . PHE F 3 124 ? -9.845  0.813   -21.258 1.00 22.07 ? 125 PHE B CZ    1 
ATOM   3483 N  N     . ASP F 3 125 ? -13.464 5.690   -22.000 1.00 20.49 ? 126 ASP B N     1 
ATOM   3484 C  CA    . ASP F 3 125 ? -13.430 6.021   -23.419 1.00 24.80 ? 126 ASP B CA    1 
ATOM   3485 C  C     . ASP F 3 125 ? -12.709 7.321   -23.785 1.00 25.56 ? 126 ASP B C     1 
ATOM   3486 O  O     . ASP F 3 125 ? -12.431 7.551   -24.958 1.00 29.25 ? 126 ASP B O     1 
ATOM   3487 C  CB    . ASP F 3 125 ? -14.845 5.991   -24.031 1.00 26.75 ? 126 ASP B CB    1 
ATOM   3488 C  CG    . ASP F 3 125 ? -15.857 6.841   -23.268 1.00 34.30 ? 126 ASP B CG    1 
ATOM   3489 O  OD1   . ASP F 3 125 ? -15.468 7.783   -22.541 1.00 46.34 ? 126 ASP B OD1   1 
ATOM   3490 O  OD2   . ASP F 3 125 ? -17.065 6.556   -23.404 1.00 44.54 ? 126 ASP B OD2   1 
ATOM   3491 N  N     . GLN F 3 126 ? -12.398 8.166   -22.803 1.00 23.16 ? 127 GLN B N     1 
ATOM   3492 C  CA    . GLN F 3 126 ? -11.696 9.417   -23.097 1.00 23.42 ? 127 GLN B CA    1 
ATOM   3493 C  C     . GLN F 3 126 ? -10.183 9.237   -23.181 1.00 23.14 ? 127 GLN B C     1 
ATOM   3494 O  O     . GLN F 3 126 ? -9.460  10.153  -23.588 1.00 23.67 ? 127 GLN B O     1 
ATOM   3495 C  CB    . GLN F 3 126 ? -12.033 10.488  -22.061 1.00 22.37 ? 127 GLN B CB    1 
ATOM   3496 C  CG    . GLN F 3 126 ? -13.488 10.908  -22.097 1.00 23.96 ? 127 GLN B CG    1 
ATOM   3497 C  CD    . GLN F 3 126 ? -13.803 12.011  -21.120 1.00 26.53 ? 127 GLN B CD    1 
ATOM   3498 O  OE1   . GLN F 3 126 ? -12.909 12.580  -20.495 1.00 32.69 ? 127 GLN B OE1   1 
ATOM   3499 N  NE2   . GLN F 3 126 ? -15.083 12.321  -20.978 1.00 25.63 ? 127 GLN B NE2   1 
ATOM   3500 N  N     . TYR F 3 127 ? -9.708  8.055   -22.798 1.00 23.18 ? 128 TYR B N     1 
ATOM   3501 C  CA    . TYR F 3 127 ? -8.279  7.754   -22.825 1.00 24.31 ? 128 TYR B CA    1 
ATOM   3502 C  C     . TYR F 3 127 ? -7.904  6.999   -24.098 1.00 25.41 ? 128 TYR B C     1 
ATOM   3503 O  O     . TYR F 3 127 ? -8.540  6.001   -24.433 1.00 26.86 ? 128 TYR B O     1 
ATOM   3504 C  CB    . TYR F 3 127 ? -7.891  6.903   -21.605 1.00 24.45 ? 128 TYR B CB    1 
ATOM   3505 C  CG    . TYR F 3 127 ? -8.009  7.598   -20.260 1.00 17.00 ? 128 TYR B CG    1 
ATOM   3506 C  CD1   . TYR F 3 127 ? -9.202  7.576   -19.537 1.00 13.45 ? 128 TYR B CD1   1 
ATOM   3507 C  CD2   . TYR F 3 127 ? -6.913  8.261   -19.703 1.00 16.97 ? 128 TYR B CD2   1 
ATOM   3508 C  CE1   . TYR F 3 127 ? -9.302  8.203   -18.277 1.00 16.97 ? 128 TYR B CE1   1 
ATOM   3509 C  CE2   . TYR F 3 127 ? -7.001  8.886   -18.454 1.00 16.12 ? 128 TYR B CE2   1 
ATOM   3510 C  CZ    . TYR F 3 127 ? -8.192  8.854   -17.747 1.00 14.39 ? 128 TYR B CZ    1 
ATOM   3511 O  OH    . TYR F 3 127 ? -8.257  9.476   -16.517 1.00 20.55 ? 128 TYR B OH    1 
ATOM   3512 N  N     . ILE F 3 128 ? -6.874  7.468   -24.798 1.00 25.01 ? 129 ILE B N     1 
ATOM   3513 C  CA    . ILE F 3 128 ? -6.422  6.819   -26.032 1.00 25.11 ? 129 ILE B CA    1 
ATOM   3514 C  C     . ILE F 3 128 ? -5.132  6.028   -25.846 1.00 22.40 ? 129 ILE B C     1 
ATOM   3515 O  O     . ILE F 3 128 ? -4.650  5.389   -26.780 1.00 26.55 ? 129 ILE B O     1 
ATOM   3516 C  CB    . ILE F 3 128 ? -6.238  7.847   -27.186 1.00 28.81 ? 129 ILE B CB    1 
ATOM   3517 C  CG1   . ILE F 3 128 ? -5.294  8.980   -26.761 1.00 32.03 ? 129 ILE B CG1   1 
ATOM   3518 C  CG2   . ILE F 3 128 ? -7.593  8.420   -27.583 1.00 30.84 ? 129 ILE B CG2   1 
ATOM   3519 C  CD1   . ILE F 3 128 ? -3.954  8.970   -27.462 1.00 35.99 ? 129 ILE B CD1   1 
ATOM   3520 N  N     . ALA F 3 129 ? -4.572  6.070   -24.641 1.00 20.43 ? 130 ALA B N     1 
ATOM   3521 C  CA    . ALA F 3 129 ? -3.345  5.347   -24.342 1.00 17.48 ? 130 ALA B CA    1 
ATOM   3522 C  C     . ALA F 3 129 ? -3.285  5.055   -22.851 1.00 17.78 ? 130 ALA B C     1 
ATOM   3523 O  O     . ALA F 3 129 ? -3.741  5.865   -22.034 1.00 16.80 ? 130 ALA B O     1 
ATOM   3524 C  CB    . ALA F 3 129 ? -2.129  6.160   -24.765 1.00 17.25 ? 130 ALA B CB    1 
ATOM   3525 N  N     . HIS F 3 130 ? -2.733  3.892   -22.511 1.00 14.35 ? 131 HIS B N     1 
ATOM   3526 C  CA    . HIS F 3 130 ? -2.587  3.466   -21.122 1.00 15.03 ? 131 HIS B CA    1 
ATOM   3527 C  C     . HIS F 3 130 ? -1.169  2.957   -20.984 1.00 14.22 ? 131 HIS B C     1 
ATOM   3528 O  O     . HIS F 3 130 ? -0.849  1.853   -21.430 1.00 18.33 ? 131 HIS B O     1 
ATOM   3529 C  CB    . HIS F 3 130 ? -3.596  2.358   -20.765 1.00 12.26 ? 131 HIS B CB    1 
ATOM   3530 C  CG    . HIS F 3 130 ? -5.026  2.791   -20.873 1.00 16.75 ? 131 HIS B CG    1 
ATOM   3531 N  ND1   . HIS F 3 130 ? -5.724  3.343   -19.818 1.00 19.93 ? 131 HIS B ND1   1 
ATOM   3532 C  CD2   . HIS F 3 130 ? -5.888  2.772   -21.921 1.00 14.85 ? 131 HIS B CD2   1 
ATOM   3533 C  CE1   . HIS F 3 130 ? -6.950  3.647   -20.208 1.00 17.67 ? 131 HIS B CE1   1 
ATOM   3534 N  NE2   . HIS F 3 130 ? -7.075  3.310   -21.480 1.00 18.48 ? 131 HIS B NE2   1 
ATOM   3535 N  N     . TRP F 3 131 ? -0.315  3.780   -20.385 1.00 13.49 ? 132 TRP B N     1 
ATOM   3536 C  CA    . TRP F 3 131 ? 1.080   3.430   -20.186 1.00 14.15 ? 132 TRP B CA    1 
ATOM   3537 C  C     . TRP F 3 131 ? 1.362   2.976   -18.760 1.00 16.82 ? 132 TRP B C     1 
ATOM   3538 O  O     . TRP F 3 131 ? 0.749   3.444   -17.794 1.00 15.37 ? 132 TRP B O     1 
ATOM   3539 C  CB    . TRP F 3 131 ? 1.982   4.624   -20.479 1.00 12.42 ? 132 TRP B CB    1 
ATOM   3540 C  CG    . TRP F 3 131 ? 1.882   5.165   -21.863 1.00 21.25 ? 132 TRP B CG    1 
ATOM   3541 C  CD1   . TRP F 3 131 ? 1.390   4.526   -22.974 1.00 17.96 ? 132 TRP B CD1   1 
ATOM   3542 C  CD2   . TRP F 3 131 ? 2.296   6.469   -22.298 1.00 21.06 ? 132 TRP B CD2   1 
ATOM   3543 N  NE1   . TRP F 3 131 ? 1.476   5.357   -24.070 1.00 24.98 ? 132 TRP B NE1   1 
ATOM   3544 C  CE2   . TRP F 3 131 ? 2.027   6.552   -23.687 1.00 21.72 ? 132 TRP B CE2   1 
ATOM   3545 C  CE3   . TRP F 3 131 ? 2.868   7.575   -21.649 1.00 17.21 ? 132 TRP B CE3   1 
ATOM   3546 C  CZ2   . TRP F 3 131 ? 2.311   7.700   -24.441 1.00 25.49 ? 132 TRP B CZ2   1 
ATOM   3547 C  CZ3   . TRP F 3 131 ? 3.151   8.722   -22.402 1.00 22.75 ? 132 TRP B CZ3   1 
ATOM   3548 C  CH2   . TRP F 3 131 ? 2.871   8.770   -23.785 1.00 22.55 ? 132 TRP B CH2   1 
ATOM   3549 N  N     . ILE F 3 132 ? 2.307   2.061   -18.649 1.00 15.96 ? 133 ILE B N     1 
ATOM   3550 C  CA    . ILE F 3 132 ? 2.728   1.541   -17.377 1.00 16.88 ? 133 ILE B CA    1 
ATOM   3551 C  C     . ILE F 3 132 ? 4.198   1.904   -17.250 1.00 18.02 ? 133 ILE B C     1 
ATOM   3552 O  O     . ILE F 3 132 ? 4.979   1.632   -18.169 1.00 13.78 ? 133 ILE B O     1 
ATOM   3553 C  CB    . ILE F 3 132 ? 2.612   -0.012  -17.327 1.00 19.15 ? 133 ILE B CB    1 
ATOM   3554 C  CG1   . ILE F 3 132 ? 1.143   -0.457  -17.338 1.00 12.42 ? 133 ILE B CG1   1 
ATOM   3555 C  CG2   . ILE F 3 132 ? 3.348   -0.554  -16.112 1.00 11.13 ? 133 ILE B CG2   1 
ATOM   3556 C  CD1   . ILE F 3 132 ? 0.323   0.042   -16.175 1.00 27.08 ? 133 ILE B CD1   1 
ATOM   3557 N  N     . ILE F 3 133 ? 4.568   2.533   -16.133 1.00 17.32 ? 134 ILE B N     1 
ATOM   3558 C  CA    . ILE F 3 133 ? 5.973   2.841   -15.852 1.00 15.45 ? 134 ILE B CA    1 
ATOM   3559 C  C     . ILE F 3 133 ? 6.271   1.808   -14.778 1.00 17.89 ? 134 ILE B C     1 
ATOM   3560 O  O     . ILE F 3 133 ? 5.713   1.863   -13.674 1.00 15.24 ? 134 ILE B O     1 
ATOM   3561 C  CB    . ILE F 3 133 ? 6.194   4.270   -15.292 1.00 18.21 ? 134 ILE B CB    1 
ATOM   3562 C  CG1   . ILE F 3 133 ? 5.891   5.311   -16.373 1.00 16.78 ? 134 ILE B CG1   1 
ATOM   3563 C  CG2   . ILE F 3 133 ? 7.637   4.434   -14.823 1.00 12.47 ? 134 ILE B CG2   1 
ATOM   3564 C  CD1   . ILE F 3 133 ? 5.986   6.741   -15.891 1.00 18.11 ? 134 ILE B CD1   1 
ATOM   3565 N  N     . GLY F 3 134 ? 7.129   0.854   -15.111 1.00 15.56 ? 135 GLY B N     1 
ATOM   3566 C  CA    . GLY F 3 134 ? 7.448   -0.203  -14.180 1.00 14.78 ? 135 GLY B CA    1 
ATOM   3567 C  C     . GLY F 3 134 ? 8.842   -0.113  -13.614 1.00 19.57 ? 135 GLY B C     1 
ATOM   3568 O  O     . GLY F 3 134 ? 9.802   0.152   -14.338 1.00 19.98 ? 135 GLY B O     1 
ATOM   3569 N  N     . TYR F 3 135 ? 8.947   -0.330  -12.308 1.00 19.70 ? 136 TYR B N     1 
ATOM   3570 C  CA    . TYR F 3 135 ? 10.223  -0.299  -11.620 1.00 17.30 ? 136 TYR B CA    1 
ATOM   3571 C  C     . TYR F 3 135 ? 10.484  -1.694  -11.098 1.00 17.79 ? 136 TYR B C     1 
ATOM   3572 O  O     . TYR F 3 135 ? 9.588   -2.330  -10.537 1.00 18.72 ? 136 TYR B O     1 
ATOM   3573 C  CB    . TYR F 3 135 ? 10.182  0.673   -10.442 1.00 17.43 ? 136 TYR B CB    1 
ATOM   3574 C  CG    . TYR F 3 135 ? 10.237  2.124   -10.833 1.00 12.90 ? 136 TYR B CG    1 
ATOM   3575 C  CD1   . TYR F 3 135 ? 11.464  2.779   -10.956 1.00 15.22 ? 136 TYR B CD1   1 
ATOM   3576 C  CD2   . TYR F 3 135 ? 9.069   2.846   -11.080 1.00 9.59  ? 136 TYR B CD2   1 
ATOM   3577 C  CE1   . TYR F 3 135 ? 11.535  4.122   -11.319 1.00 10.80 ? 136 TYR B CE1   1 
ATOM   3578 C  CE2   . TYR F 3 135 ? 9.123   4.200   -11.446 1.00 10.83 ? 136 TYR B CE2   1 
ATOM   3579 C  CZ    . TYR F 3 135 ? 10.366  4.826   -11.564 1.00 12.98 ? 136 TYR B CZ    1 
ATOM   3580 O  OH    . TYR F 3 135 ? 10.449  6.145   -11.946 1.00 11.11 ? 136 TYR B OH    1 
ATOM   3581 N  N     . VAL F 3 136 ? 11.708  -2.170  -11.288 1.00 17.19 ? 137 VAL B N     1 
ATOM   3582 C  CA    . VAL F 3 136 ? 12.103  -3.483  -10.804 1.00 16.47 ? 137 VAL B CA    1 
ATOM   3583 C  C     . VAL F 3 136 ? 13.362  -3.211  -10.011 1.00 17.03 ? 137 VAL B C     1 
ATOM   3584 O  O     . VAL F 3 136 ? 14.317  -2.668  -10.551 1.00 17.34 ? 137 VAL B O     1 
ATOM   3585 C  CB    . VAL F 3 136 ? 12.482  -4.460  -11.947 1.00 21.07 ? 137 VAL B CB    1 
ATOM   3586 C  CG1   . VAL F 3 136 ? 12.625  -5.887  -11.386 1.00 17.49 ? 137 VAL B CG1   1 
ATOM   3587 C  CG2   . VAL F 3 136 ? 11.452  -4.403  -13.065 1.00 25.26 ? 137 VAL B CG2   1 
ATOM   3588 N  N     . TYR F 3 137 ? 13.370  -3.566  -8.734  1.00 16.23 ? 138 TYR B N     1 
ATOM   3589 C  CA    . TYR F 3 137 ? 14.561  -3.359  -7.926  1.00 16.70 ? 138 TYR B CA    1 
ATOM   3590 C  C     . TYR F 3 137 ? 15.053  -4.723  -7.481  1.00 16.08 ? 138 TYR B C     1 
ATOM   3591 O  O     . TYR F 3 137 ? 14.276  -5.673  -7.391  1.00 18.42 ? 138 TYR B O     1 
ATOM   3592 C  CB    . TYR F 3 137 ? 14.263  -2.466  -6.705  1.00 13.66 ? 138 TYR B CB    1 
ATOM   3593 C  CG    . TYR F 3 137 ? 13.360  -3.099  -5.659  1.00 17.84 ? 138 TYR B CG    1 
ATOM   3594 C  CD1   . TYR F 3 137 ? 11.969  -3.040  -5.780  1.00 21.16 ? 138 TYR B CD1   1 
ATOM   3595 C  CD2   . TYR F 3 137 ? 13.897  -3.761  -4.550  1.00 21.49 ? 138 TYR B CD2   1 
ATOM   3596 C  CE1   . TYR F 3 137 ? 11.132  -3.624  -4.826  1.00 20.05 ? 138 TYR B CE1   1 
ATOM   3597 C  CE2   . TYR F 3 137 ? 13.065  -4.348  -3.590  1.00 21.94 ? 138 TYR B CE2   1 
ATOM   3598 C  CZ    . TYR F 3 137 ? 11.686  -4.271  -3.740  1.00 25.58 ? 138 TYR B CZ    1 
ATOM   3599 O  OH    . TYR F 3 137 ? 10.857  -4.841  -2.806  1.00 25.32 ? 138 TYR B OH    1 
ATOM   3600 N  N     . THR F 3 138 ? 16.344  -4.821  -7.215  1.00 18.84 ? 139 THR B N     1 
ATOM   3601 C  CA    . THR F 3 138 ? 16.933  -6.059  -6.730  1.00 23.38 ? 139 THR B CA    1 
ATOM   3602 C  C     . THR F 3 138 ? 17.016  -5.919  -5.198  1.00 25.76 ? 139 THR B C     1 
ATOM   3603 O  O     . THR F 3 138 ? 17.590  -4.946  -4.704  1.00 22.15 ? 139 THR B O     1 
ATOM   3604 C  CB    . THR F 3 138 ? 18.355  -6.236  -7.292  1.00 26.07 ? 139 THR B CB    1 
ATOM   3605 O  OG1   . THR F 3 138 ? 18.336  -6.070  -8.716  1.00 36.62 ? 139 THR B OG1   1 
ATOM   3606 C  CG2   . THR F 3 138 ? 18.889  -7.609  -6.950  1.00 26.16 ? 139 THR B CG2   1 
ATOM   3607 N  N     . ARG F 3 139 ? 16.448  -6.867  -4.453  1.00 27.27 ? 140 ARG B N     1 
ATOM   3608 C  CA    . ARG F 3 139 ? 16.486  -6.817  -2.988  1.00 35.71 ? 140 ARG B CA    1 
ATOM   3609 C  C     . ARG F 3 139 ? 17.894  -6.999  -2.407  1.00 39.10 ? 140 ARG B C     1 
ATOM   3610 O  O     . ARG F 3 139 ? 18.727  -7.710  -2.976  1.00 39.13 ? 140 ARG B O     1 
ATOM   3611 C  CB    . ARG F 3 139 ? 15.584  -7.892  -2.388  1.00 39.79 ? 140 ARG B CB    1 
ATOM   3612 C  CG    . ARG F 3 139 ? 14.110  -7.628  -2.493  1.00 48.87 ? 140 ARG B CG    1 
ATOM   3613 C  CD    . ARG F 3 139 ? 13.362  -8.694  -1.722  1.00 63.82 ? 140 ARG B CD    1 
ATOM   3614 N  NE    . ARG F 3 139 ? 11.912  -8.567  -1.838  1.00 73.06 ? 140 ARG B NE    1 
ATOM   3615 C  CZ    . ARG F 3 139 ? 11.045  -9.450  -1.346  1.00 80.84 ? 140 ARG B CZ    1 
ATOM   3616 N  NH1   . ARG F 3 139 ? 11.478  -10.528 -0.703  1.00 82.92 ? 140 ARG B NH1   1 
ATOM   3617 N  NH2   . ARG F 3 139 ? 9.742   -9.258  -1.497  1.00 79.88 ? 140 ARG B NH2   1 
ATOM   3618 N  N     . VAL F 3 140 ? 18.157  -6.353  -1.273  1.00 42.43 ? 141 VAL B N     1 
ATOM   3619 C  CA    . VAL F 3 140 ? 19.455  -6.479  -0.609  1.00 46.35 ? 141 VAL B CA    1 
ATOM   3620 C  C     . VAL F 3 140 ? 19.442  -7.750  0.251   1.00 48.46 ? 141 VAL B C     1 
ATOM   3621 O  O     . VAL F 3 140 ? 18.410  -8.101  0.829   1.00 48.36 ? 141 VAL B O     1 
ATOM   3622 C  CB    . VAL F 3 140 ? 19.773  -5.241  0.278   1.00 45.82 ? 141 VAL B CB    1 
ATOM   3623 C  CG1   . VAL F 3 140 ? 21.057  -5.467  1.068   1.00 52.29 ? 141 VAL B CG1   1 
ATOM   3624 C  CG2   . VAL F 3 140 ? 19.950  -4.020  -0.591  1.00 46.12 ? 141 VAL B CG2   1 
ATOM   3625 N  N     . ALA F 3 141 ? 20.587  -8.431  0.326   1.00 50.92 ? 142 ALA B N     1 
ATOM   3626 C  CA    . ALA F 3 141 ? 20.732  -9.671  1.102   1.00 55.28 ? 142 ALA B CA    1 
ATOM   3627 C  C     . ALA F 3 141 ? 20.416  -9.544  2.604   1.00 56.03 ? 142 ALA B C     1 
ATOM   3628 O  O     . ALA F 3 141 ? 19.799  -10.439 3.195   1.00 56.51 ? 142 ALA B O     1 
ATOM   3629 C  CB    . ALA F 3 141 ? 22.149  -10.247 0.912   1.00 54.51 ? 142 ALA B CB    1 
ATOM   3630 N  N     . THR F 3 142 ? 20.840  -8.443  3.219   1.00 56.74 ? 143 THR B N     1 
ATOM   3631 C  CA    . THR F 3 142 ? 20.605  -8.232  4.641   1.00 57.95 ? 143 THR B CA    1 
ATOM   3632 C  C     . THR F 3 142 ? 19.126  -7.953  4.949   1.00 59.68 ? 143 THR B C     1 
ATOM   3633 O  O     . THR F 3 142 ? 18.544  -6.976  4.471   1.00 58.78 ? 143 THR B O     1 
ATOM   3634 C  CB    . THR F 3 142 ? 21.535  -7.099  5.202   1.00 58.82 ? 143 THR B CB    1 
ATOM   3635 O  OG1   . THR F 3 142 ? 21.325  -6.949  6.612   1.00 61.05 ? 143 THR B OG1   1 
ATOM   3636 C  CG2   . THR F 3 142 ? 21.289  -5.768  4.499   1.00 54.80 ? 143 THR B CG2   1 
ATOM   3637 N  N     . ARG F 3 143 ? 18.527  -8.833  5.748   1.00 63.13 ? 144 ARG B N     1 
ATOM   3638 C  CA    . ARG F 3 143 ? 17.125  -8.706  6.147   1.00 68.67 ? 144 ARG B CA    1 
ATOM   3639 C  C     . ARG F 3 143 ? 16.967  -7.759  7.347   1.00 70.96 ? 144 ARG B C     1 
ATOM   3640 O  O     . ARG F 3 143 ? 15.876  -7.641  7.917   1.00 71.60 ? 144 ARG B O     1 
ATOM   3641 C  CB    . ARG F 3 143 ? 16.536  -10.085 6.499   1.00 71.85 ? 144 ARG B CB    1 
ATOM   3642 C  CG    . ARG F 3 143 ? 16.312  -11.023 5.308   1.00 79.96 ? 144 ARG B CG    1 
ATOM   3643 C  CD    . ARG F 3 143 ? 15.768  -12.393 5.749   1.00 85.10 ? 144 ARG B CD    1 
ATOM   3644 N  NE    . ARG F 3 143 ? 16.766  -13.206 6.457   1.00 90.83 ? 144 ARG B NE    1 
ATOM   3645 C  CZ    . ARG F 3 143 ? 16.524  -14.408 6.982   1.00 91.36 ? 144 ARG B CZ    1 
ATOM   3646 N  NH1   . ARG F 3 143 ? 15.308  -14.941 6.902   1.00 91.39 ? 144 ARG B NH1   1 
ATOM   3647 N  NH2   . ARG F 3 143 ? 17.496  -15.081 7.595   1.00 88.02 ? 144 ARG B NH2   1 
ATOM   3648 N  N     . LYS F 3 144 ? 18.056  -7.091  7.727   1.00 72.29 ? 145 LYS B N     1 
ATOM   3649 C  CA    . LYS F 3 144 ? 18.044  -6.158  8.852   1.00 73.02 ? 145 LYS B CA    1 
ATOM   3650 C  C     . LYS F 3 144 ? 18.450  -4.760  8.393   1.00 73.11 ? 145 LYS B C     1 
ATOM   3651 O  O     . LYS F 3 144 ? 19.622  -4.497  8.116   1.00 74.35 ? 145 LYS B O     1 
ATOM   3652 C  CB    . LYS F 3 144 ? 18.983  -6.662  9.955   1.00 75.49 ? 145 LYS B CB    1 
ATOM   3653 C  CG    . LYS F 3 144 ? 18.529  -7.984  10.562  1.00 77.49 ? 145 LYS B CG    1 
ATOM   3654 C  CD    . LYS F 3 144 ? 19.666  -8.723  11.228  1.00 77.00 ? 145 LYS B CD    1 
ATOM   3655 C  CE    . LYS F 3 144 ? 19.241  -10.133 11.614  1.00 73.77 ? 145 LYS B CE    1 
ATOM   3656 N  NZ    . LYS F 3 144 ? 20.400  -10.927 12.112  1.00 74.80 ? 145 LYS B NZ    1 
ATOM   3657 N  N     . SER F 3 145 ? 17.467  -3.871  8.307   1.00 73.52 ? 146 SER B N     1 
ATOM   3658 C  CA    . SER F 3 145 ? 17.699  -2.492  7.883   1.00 73.06 ? 146 SER B CA    1 
ATOM   3659 C  C     . SER F 3 145 ? 18.224  -1.661  9.063   1.00 70.23 ? 146 SER B C     1 
ATOM   3660 O  O     . SER F 3 145 ? 18.225  -2.129  10.209  1.00 70.75 ? 146 SER B O     1 
ATOM   3661 C  CB    . SER F 3 145 ? 16.393  -1.885  7.348   1.00 77.40 ? 146 SER B CB    1 
ATOM   3662 O  OG    . SER F 3 145 ? 15.797  -2.716  6.359   1.00 81.93 ? 146 SER B OG    1 
ATOM   3663 N  N     . SER F 3 146 ? 18.672  -0.439  8.777   1.00 66.67 ? 147 SER B N     1 
ATOM   3664 C  CA    . SER F 3 146 ? 19.192  0.469   9.806   1.00 61.02 ? 147 SER B CA    1 
ATOM   3665 C  C     . SER F 3 146 ? 18.034  0.930   10.693  1.00 56.49 ? 147 SER B C     1 
ATOM   3666 O  O     . SER F 3 146 ? 16.944  1.222   10.191  1.00 55.41 ? 147 SER B O     1 
ATOM   3667 C  CB    . SER F 3 146 ? 19.857  1.684   9.148   1.00 58.80 ? 147 SER B CB    1 
ATOM   3668 O  OG    . SER F 3 146 ? 20.509  2.498   10.106  1.00 50.21 ? 147 SER B OG    1 
ATOM   3669 N  N     . LEU F 3 147 ? 18.262  0.993   12.002  1.00 51.69 ? 148 LEU B N     1 
ATOM   3670 C  CA    . LEU F 3 147 ? 17.209  1.416   12.921  1.00 48.74 ? 148 LEU B CA    1 
ATOM   3671 C  C     . LEU F 3 147 ? 17.531  2.699   13.697  1.00 44.67 ? 148 LEU B C     1 
ATOM   3672 O  O     . LEU F 3 147 ? 17.087  2.885   14.835  1.00 44.47 ? 148 LEU B O     1 
ATOM   3673 C  CB    . LEU F 3 147 ? 16.847  0.265   13.872  1.00 51.15 ? 148 LEU B CB    1 
ATOM   3674 C  CG    . LEU F 3 147 ? 15.861  -0.769  13.311  1.00 48.04 ? 148 LEU B CG    1 
ATOM   3675 C  CD1   . LEU F 3 147 ? 16.115  -2.133  13.909  1.00 52.07 ? 148 LEU B CD1   1 
ATOM   3676 C  CD2   . LEU F 3 147 ? 14.441  -0.319  13.584  1.00 52.60 ? 148 LEU B CD2   1 
ATOM   3677 N  N     . LYS F 3 148 ? 18.299  3.585   13.071  1.00 40.21 ? 149 LYS B N     1 
ATOM   3678 C  CA    . LYS F 3 148 ? 18.668  4.853   13.685  1.00 39.15 ? 149 LYS B CA    1 
ATOM   3679 C  C     . LYS F 3 148 ? 18.432  5.967   12.673  1.00 38.23 ? 149 LYS B C     1 
ATOM   3680 O  O     . LYS F 3 148 ? 18.025  5.698   11.545  1.00 37.53 ? 149 LYS B O     1 
ATOM   3681 C  CB    . LYS F 3 148 ? 20.132  4.847   14.128  1.00 41.86 ? 149 LYS B CB    1 
ATOM   3682 C  CG    . LYS F 3 148 ? 21.143  4.808   13.006  1.00 47.45 ? 149 LYS B CG    1 
ATOM   3683 C  CD    . LYS F 3 148 ? 22.526  5.111   13.543  1.00 57.50 ? 149 LYS B CD    1 
ATOM   3684 C  CE    . LYS F 3 148 ? 23.542  5.180   12.424  1.00 62.32 ? 149 LYS B CE    1 
ATOM   3685 N  NZ    . LYS F 3 148 ? 24.845  5.715   12.898  1.00 62.08 ? 149 LYS B NZ    1 
ATOM   3686 N  N     . THR F 3 149 ? 18.679  7.210   13.073  1.00 36.08 ? 150 THR B N     1 
ATOM   3687 C  CA    . THR F 3 149 ? 18.480  8.341   12.182  1.00 31.32 ? 150 THR B CA    1 
ATOM   3688 C  C     . THR F 3 149 ? 19.815  8.945   11.785  1.00 29.73 ? 150 THR B C     1 
ATOM   3689 O  O     . THR F 3 149 ? 20.852  8.615   12.358  1.00 30.08 ? 150 THR B O     1 
ATOM   3690 C  CB    . THR F 3 149 ? 17.572  9.413   12.823  1.00 31.63 ? 150 THR B CB    1 
ATOM   3691 O  OG1   . THR F 3 149 ? 18.117  9.822   14.082  1.00 34.73 ? 150 THR B OG1   1 
ATOM   3692 C  CG2   . THR F 3 149 ? 16.178  8.854   13.047  1.00 22.84 ? 150 THR B CG2   1 
ATOM   3693 N  N     . TYR F 3 150 ? 19.779  9.831   10.800  1.00 27.80 ? 151 TYR B N     1 
ATOM   3694 C  CA    . TYR F 3 150 ? 20.976  10.470  10.286  1.00 26.07 ? 151 TYR B CA    1 
ATOM   3695 C  C     . TYR F 3 150 ? 20.733  11.950  10.107  1.00 28.89 ? 151 TYR B C     1 
ATOM   3696 O  O     . TYR F 3 150 ? 19.600  12.424  10.227  1.00 28.08 ? 151 TYR B O     1 
ATOM   3697 C  CB    . TYR F 3 150 ? 21.337  9.881   8.925   1.00 22.94 ? 151 TYR B CB    1 
ATOM   3698 C  CG    . TYR F 3 150 ? 21.611  8.405   8.953   1.00 19.93 ? 151 TYR B CG    1 
ATOM   3699 C  CD1   . TYR F 3 150 ? 20.576  7.484   8.862   1.00 17.19 ? 151 TYR B CD1   1 
ATOM   3700 C  CD2   . TYR F 3 150 ? 22.915  7.925   9.074   1.00 27.85 ? 151 TYR B CD2   1 
ATOM   3701 C  CE1   . TYR F 3 150 ? 20.831  6.115   8.893   1.00 23.15 ? 151 TYR B CE1   1 
ATOM   3702 C  CE2   . TYR F 3 150 ? 23.182  6.564   9.105   1.00 24.10 ? 151 TYR B CE2   1 
ATOM   3703 C  CZ    . TYR F 3 150 ? 22.136  5.664   9.015   1.00 23.21 ? 151 TYR B CZ    1 
ATOM   3704 O  OH    . TYR F 3 150 ? 22.402  4.314   9.059   1.00 29.84 ? 151 TYR B OH    1 
ATOM   3705 N  N     . ASN F 3 151 ? 21.803  12.685  9.826   1.00 30.15 ? 152 ASN B N     1 
ATOM   3706 C  CA    . ASN F 3 151 ? 21.675  14.116  9.581   1.00 33.69 ? 152 ASN B CA    1 
ATOM   3707 C  C     . ASN F 3 151 ? 22.252  14.351  8.187   1.00 32.88 ? 152 ASN B C     1 
ATOM   3708 O  O     . ASN F 3 151 ? 22.922  13.473  7.632   1.00 29.61 ? 152 ASN B O     1 
ATOM   3709 C  CB    . ASN F 3 151 ? 22.386  14.959  10.661  1.00 39.57 ? 152 ASN B CB    1 
ATOM   3710 C  CG    . ASN F 3 151 ? 23.897  14.782  10.660  1.00 49.73 ? 152 ASN B CG    1 
ATOM   3711 O  OD1   . ASN F 3 151 ? 24.613  15.415  9.879   1.00 53.78 ? 152 ASN B OD1   1 
ATOM   3712 N  ND2   . ASN F 3 151 ? 24.390  13.923  11.541  1.00 57.00 ? 152 ASN B ND2   1 
ATOM   3713 N  N     . ILE F 3 152 ? 21.983  15.525  7.630   1.00 35.36 ? 153 ILE B N     1 
ATOM   3714 C  CA    . ILE F 3 152 ? 22.434  15.888  6.288   1.00 40.62 ? 153 ILE B CA    1 
ATOM   3715 C  C     . ILE F 3 152 ? 23.888  15.526  5.948   1.00 40.93 ? 153 ILE B C     1 
ATOM   3716 O  O     . ILE F 3 152 ? 24.186  15.134  4.820   1.00 39.86 ? 153 ILE B O     1 
ATOM   3717 C  CB    . ILE F 3 152 ? 22.231  17.398  6.043   1.00 47.12 ? 153 ILE B CB    1 
ATOM   3718 C  CG1   . ILE F 3 152 ? 20.809  17.810  6.438   1.00 55.70 ? 153 ILE B CG1   1 
ATOM   3719 C  CG2   . ILE F 3 152 ? 22.470  17.721  4.577   1.00 51.60 ? 153 ILE B CG2   1 
ATOM   3720 C  CD1   . ILE F 3 152 ? 20.617  19.314  6.592   1.00 62.54 ? 153 ILE B CD1   1 
ATOM   3721 N  N     . ASN F 3 153 ? 24.785  15.652  6.922   1.00 41.82 ? 154 ASN B N     1 
ATOM   3722 C  CA    . ASN F 3 153 ? 26.206  15.367  6.712   1.00 45.53 ? 154 ASN B CA    1 
ATOM   3723 C  C     . ASN F 3 153 ? 26.526  13.889  6.514   1.00 46.80 ? 154 ASN B C     1 
ATOM   3724 O  O     . ASN F 3 153 ? 27.587  13.541  5.993   1.00 47.08 ? 154 ASN B O     1 
ATOM   3725 C  CB    . ASN F 3 153 ? 27.023  15.908  7.889   1.00 52.69 ? 154 ASN B CB    1 
ATOM   3726 C  CG    . ASN F 3 153 ? 26.752  17.383  8.157   1.00 65.93 ? 154 ASN B CG    1 
ATOM   3727 O  OD1   . ASN F 3 153 ? 27.062  18.247  7.333   1.00 67.78 ? 154 ASN B OD1   1 
ATOM   3728 N  ND2   . ASN F 3 153 ? 26.165  17.678  9.313   1.00 69.32 ? 154 ASN B ND2   1 
ATOM   3729 N  N     . GLU F 3 154 ? 25.602  13.024  6.921   1.00 44.96 ? 155 GLU B N     1 
ATOM   3730 C  CA    . GLU F 3 154 ? 25.798  11.582  6.829   1.00 41.60 ? 155 GLU B CA    1 
ATOM   3731 C  C     . GLU F 3 154 ? 25.174  10.882  5.618   1.00 39.46 ? 155 GLU B C     1 
ATOM   3732 O  O     . GLU F 3 154 ? 25.134  9.651   5.578   1.00 35.72 ? 155 GLU B O     1 
ATOM   3733 C  CB    . GLU F 3 154 ? 25.286  10.929  8.114   1.00 42.26 ? 155 GLU B CB    1 
ATOM   3734 C  CG    . GLU F 3 154 ? 25.882  11.523  9.383   1.00 50.51 ? 155 GLU B CG    1 
ATOM   3735 C  CD    . GLU F 3 154 ? 25.297  10.927  10.646  1.00 53.11 ? 155 GLU B CD    1 
ATOM   3736 O  OE1   . GLU F 3 154 ? 24.086  11.105  10.880  1.00 54.59 ? 155 GLU B OE1   1 
ATOM   3737 O  OE2   . GLU F 3 154 ? 26.045  10.282  11.408  1.00 59.74 ? 155 GLU B OE2   1 
ATOM   3738 N  N     . LEU F 3 155 ? 24.704  11.644  4.631   1.00 39.31 ? 156 LEU B N     1 
ATOM   3739 C  CA    . LEU F 3 155 ? 24.062  11.067  3.444   1.00 40.02 ? 156 LEU B CA    1 
ATOM   3740 C  C     . LEU F 3 155 ? 24.760  9.883   2.793   1.00 42.98 ? 156 LEU B C     1 
ATOM   3741 O  O     . LEU F 3 155 ? 24.092  8.968   2.311   1.00 44.91 ? 156 LEU B O     1 
ATOM   3742 C  CB    . LEU F 3 155 ? 23.816  12.129  2.369   1.00 34.56 ? 156 LEU B CB    1 
ATOM   3743 C  CG    . LEU F 3 155 ? 22.529  12.947  2.459   1.00 34.35 ? 156 LEU B CG    1 
ATOM   3744 C  CD1   . LEU F 3 155 ? 22.426  13.842  1.238   1.00 33.76 ? 156 LEU B CD1   1 
ATOM   3745 C  CD2   . LEU F 3 155 ? 21.323  12.021  2.545   1.00 34.98 ? 156 LEU B CD2   1 
ATOM   3746 N  N     . ASN F 3 156 ? 26.091  9.891   2.772   1.00 43.65 ? 157 ASN B N     1 
ATOM   3747 C  CA    . ASN F 3 156 ? 26.843  8.801   2.144   1.00 44.09 ? 157 ASN B CA    1 
ATOM   3748 C  C     . ASN F 3 156 ? 27.008  7.530   2.969   1.00 40.05 ? 157 ASN B C     1 
ATOM   3749 O  O     . ASN F 3 156 ? 27.524  6.528   2.471   1.00 40.46 ? 157 ASN B O     1 
ATOM   3750 C  CB    . ASN F 3 156 ? 28.219  9.293   1.680   1.00 55.77 ? 157 ASN B CB    1 
ATOM   3751 C  CG    . ASN F 3 156 ? 28.167  10.004  0.329   1.00 68.48 ? 157 ASN B CG    1 
ATOM   3752 O  OD1   . ASN F 3 156 ? 29.029  10.831  0.023   1.00 75.93 ? 157 ASN B OD1   1 
ATOM   3753 N  ND2   . ASN F 3 156 ? 27.156  9.684   -0.485  1.00 69.76 ? 157 ASN B ND2   1 
ATOM   3754 N  N     . GLU F 3 157 ? 26.572  7.576   4.221   1.00 37.51 ? 158 GLU B N     1 
ATOM   3755 C  CA    . GLU F 3 157 ? 26.661  6.434   5.122   1.00 35.34 ? 158 GLU B CA    1 
ATOM   3756 C  C     . GLU F 3 157 ? 25.315  5.712   5.283   1.00 33.14 ? 158 GLU B C     1 
ATOM   3757 O  O     . GLU F 3 157 ? 25.231  4.685   5.959   1.00 31.23 ? 158 GLU B O     1 
ATOM   3758 C  CB    . GLU F 3 157 ? 27.139  6.904   6.494   1.00 40.38 ? 158 GLU B CB    1 
ATOM   3759 C  CG    . GLU F 3 157 ? 28.512  7.572   6.491   1.00 54.30 ? 158 GLU B CG    1 
ATOM   3760 C  CD    . GLU F 3 157 ? 28.837  8.273   7.811   1.00 59.45 ? 158 GLU B CD    1 
ATOM   3761 O  OE1   . GLU F 3 157 ? 28.167  7.994   8.837   1.00 54.26 ? 158 GLU B OE1   1 
ATOM   3762 O  OE2   . GLU F 3 157 ? 29.768  9.110   7.820   1.00 63.05 ? 158 GLU B OE2   1 
ATOM   3763 N  N     . ILE F 3 158 ? 24.266  6.250   4.670   1.00 30.58 ? 159 ILE B N     1 
ATOM   3764 C  CA    . ILE F 3 158 ? 22.937  5.653   4.778   1.00 30.52 ? 159 ILE B CA    1 
ATOM   3765 C  C     . ILE F 3 158 ? 22.797  4.449   3.846   1.00 31.94 ? 159 ILE B C     1 
ATOM   3766 O  O     . ILE F 3 158 ? 22.933  4.568   2.623   1.00 34.30 ? 159 ILE B O     1 
ATOM   3767 C  CB    . ILE F 3 158 ? 21.819  6.698   4.473   1.00 25.04 ? 159 ILE B CB    1 
ATOM   3768 C  CG1   . ILE F 3 158 ? 21.942  7.878   5.445   1.00 18.74 ? 159 ILE B CG1   1 
ATOM   3769 C  CG2   . ILE F 3 158 ? 20.437  6.052   4.592   1.00 24.86 ? 159 ILE B CG2   1 
ATOM   3770 C  CD1   . ILE F 3 158 ? 20.885  8.944   5.290   1.00 16.66 ? 159 ILE B CD1   1 
ATOM   3771 N  N     . PRO F 3 159 ? 22.546  3.262   4.415   1.00 30.12 ? 160 PRO B N     1 
ATOM   3772 C  CA    . PRO F 3 159 ? 22.394  2.076   3.571   1.00 32.37 ? 160 PRO B CA    1 
ATOM   3773 C  C     . PRO F 3 159 ? 21.145  2.166   2.681   1.00 34.13 ? 160 PRO B C     1 
ATOM   3774 O  O     . PRO F 3 159 ? 20.068  2.552   3.144   1.00 33.27 ? 160 PRO B O     1 
ATOM   3775 C  CB    . PRO F 3 159 ? 22.310  0.935   4.593   1.00 29.91 ? 160 PRO B CB    1 
ATOM   3776 C  CG    . PRO F 3 159 ? 21.713  1.586   5.793   1.00 35.75 ? 160 PRO B CG    1 
ATOM   3777 C  CD    . PRO F 3 159 ? 22.410  2.924   5.843   1.00 32.02 ? 160 PRO B CD    1 
ATOM   3778 N  N     . LYS F 3 160 ? 21.303  1.822   1.405   1.00 35.97 ? 161 LYS B N     1 
ATOM   3779 C  CA    . LYS F 3 160 ? 20.194  1.839   0.451   1.00 36.40 ? 161 LYS B CA    1 
ATOM   3780 C  C     . LYS F 3 160 ? 19.518  0.472   0.538   1.00 33.75 ? 161 LYS B C     1 
ATOM   3781 O  O     . LYS F 3 160 ? 20.192  -0.553  0.609   1.00 31.85 ? 161 LYS B O     1 
ATOM   3782 C  CB    . LYS F 3 160 ? 20.716  2.117   -0.960  1.00 39.75 ? 161 LYS B CB    1 
ATOM   3783 C  CG    . LYS F 3 160 ? 21.391  3.470   -1.067  1.00 47.72 ? 161 LYS B CG    1 
ATOM   3784 C  CD    . LYS F 3 160 ? 22.132  3.650   -2.371  1.00 54.54 ? 161 LYS B CD    1 
ATOM   3785 C  CE    . LYS F 3 160 ? 22.931  4.952   -2.342  1.00 62.75 ? 161 LYS B CE    1 
ATOM   3786 N  NZ    . LYS F 3 160 ? 23.680  5.203   -3.612  1.00 67.13 ? 161 LYS B NZ    1 
ATOM   3787 N  N     . PRO F 3 161 ? 18.176  0.441   0.545   1.00 34.39 ? 162 PRO B N     1 
ATOM   3788 C  CA    . PRO F 3 161 ? 17.378  -0.791  0.635   1.00 34.30 ? 162 PRO B CA    1 
ATOM   3789 C  C     . PRO F 3 161 ? 17.316  -1.700  -0.620  1.00 34.46 ? 162 PRO B C     1 
ATOM   3790 O  O     . PRO F 3 161 ? 16.648  -2.750  -0.618  1.00 34.83 ? 162 PRO B O     1 
ATOM   3791 C  CB    . PRO F 3 161 ? 16.008  -0.259  1.032   1.00 35.11 ? 162 PRO B CB    1 
ATOM   3792 C  CG    . PRO F 3 161 ? 15.933  1.024   0.265   1.00 36.18 ? 162 PRO B CG    1 
ATOM   3793 C  CD    . PRO F 3 161 ? 17.303  1.629   0.473   1.00 36.03 ? 162 PRO B CD    1 
ATOM   3794 N  N     . TYR F 3 162 ? 18.017  -1.303  -1.678  1.00 30.57 ? 163 TYR B N     1 
ATOM   3795 C  CA    . TYR F 3 162 ? 18.038  -2.063  -2.920  1.00 30.29 ? 163 TYR B CA    1 
ATOM   3796 C  C     . TYR F 3 162 ? 19.453  -2.109  -3.475  1.00 30.30 ? 163 TYR B C     1 
ATOM   3797 O  O     . TYR F 3 162 ? 20.262  -1.224  -3.209  1.00 28.62 ? 163 TYR B O     1 
ATOM   3798 C  CB    . TYR F 3 162 ? 17.092  -1.435  -3.953  1.00 31.23 ? 163 TYR B CB    1 
ATOM   3799 C  CG    . TYR F 3 162 ? 17.310  0.048   -4.170  1.00 31.82 ? 163 TYR B CG    1 
ATOM   3800 C  CD1   . TYR F 3 162 ? 18.345  0.511   -4.982  1.00 28.60 ? 163 TYR B CD1   1 
ATOM   3801 C  CD2   . TYR F 3 162 ? 16.486  0.990   -3.555  1.00 31.31 ? 163 TYR B CD2   1 
ATOM   3802 C  CE1   . TYR F 3 162 ? 18.556  1.866   -5.172  1.00 33.40 ? 163 TYR B CE1   1 
ATOM   3803 C  CE2   . TYR F 3 162 ? 16.690  2.352   -3.740  1.00 32.94 ? 163 TYR B CE2   1 
ATOM   3804 C  CZ    . TYR F 3 162 ? 17.729  2.785   -4.549  1.00 41.80 ? 163 TYR B CZ    1 
ATOM   3805 O  OH    . TYR F 3 162 ? 17.949  4.130   -4.743  1.00 49.75 ? 163 TYR B OH    1 
ATOM   3806 N  N     . LYS F 3 163 ? 19.740  -3.148  -4.246  1.00 33.34 ? 164 LYS B N     1 
ATOM   3807 C  CA    . LYS F 3 163 ? 21.049  -3.320  -4.850  1.00 34.50 ? 164 LYS B CA    1 
ATOM   3808 C  C     . LYS F 3 163 ? 21.087  -2.607  -6.201  1.00 33.26 ? 164 LYS B C     1 
ATOM   3809 O  O     . LYS F 3 163 ? 22.141  -2.138  -6.632  1.00 34.54 ? 164 LYS B O     1 
ATOM   3810 C  CB    . LYS F 3 163 ? 21.358  -4.817  -5.004  1.00 38.49 ? 164 LYS B CB    1 
ATOM   3811 C  CG    . LYS F 3 163 ? 22.811  -5.129  -5.316  1.00 52.25 ? 164 LYS B CG    1 
ATOM   3812 C  CD    . LYS F 3 163 ? 23.139  -6.589  -5.037  1.00 64.63 ? 164 LYS B CD    1 
ATOM   3813 C  CE    . LYS F 3 163 ? 24.586  -6.932  -5.426  1.00 72.68 ? 164 LYS B CE    1 
ATOM   3814 N  NZ    . LYS F 3 163 ? 25.632  -6.189  -4.643  1.00 70.10 ? 164 LYS B NZ    1 
ATOM   3815 N  N     . GLY F 3 164 ? 19.935  -2.515  -6.862  1.00 28.20 ? 165 GLY B N     1 
ATOM   3816 C  CA    . GLY F 3 164 ? 19.876  -1.853  -8.152  1.00 24.95 ? 165 GLY B CA    1 
ATOM   3817 C  C     . GLY F 3 164 ? 18.437  -1.637  -8.551  1.00 26.94 ? 165 GLY B C     1 
ATOM   3818 O  O     . GLY F 3 164 ? 17.552  -2.228  -7.929  1.00 28.54 ? 165 GLY B O     1 
ATOM   3819 N  N     . VAL F 3 165 ? 18.192  -0.803  -9.562  1.00 24.89 ? 166 VAL B N     1 
ATOM   3820 C  CA    . VAL F 3 165 ? 16.830  -0.527  -10.016 1.00 24.45 ? 166 VAL B CA    1 
ATOM   3821 C  C     . VAL F 3 165 ? 16.803  -0.323  -11.522 1.00 25.37 ? 166 VAL B C     1 
ATOM   3822 O  O     . VAL F 3 165 ? 17.687  0.323   -12.086 1.00 27.05 ? 166 VAL B O     1 
ATOM   3823 C  CB    . VAL F 3 165 ? 16.232  0.770   -9.363  1.00 26.48 ? 166 VAL B CB    1 
ATOM   3824 C  CG1   . VAL F 3 165 ? 14.791  0.984   -9.833  1.00 19.11 ? 166 VAL B CG1   1 
ATOM   3825 C  CG2   . VAL F 3 165 ? 16.250  0.660   -7.852  1.00 30.89 ? 166 VAL B CG2   1 
ATOM   3826 N  N     . LYS F 3 166 ? 15.781  -0.877  -12.167 1.00 25.18 ? 167 LYS B N     1 
ATOM   3827 C  CA    . LYS F 3 166 ? 15.576  -0.742  -13.607 1.00 22.43 ? 167 LYS B CA    1 
ATOM   3828 C  C     . LYS F 3 166 ? 14.161  -0.203  -13.814 1.00 21.69 ? 167 LYS B C     1 
ATOM   3829 O  O     . LYS F 3 166 ? 13.249  -0.527  -13.053 1.00 22.09 ? 167 LYS B O     1 
ATOM   3830 C  CB    . LYS F 3 166 ? 15.718  -2.096  -14.312 1.00 17.69 ? 167 LYS B CB    1 
ATOM   3831 C  CG    . LYS F 3 166 ? 17.112  -2.668  -14.356 1.00 22.36 ? 167 LYS B CG    1 
ATOM   3832 C  CD    . LYS F 3 166 ? 17.051  -4.037  -14.995 1.00 37.56 ? 167 LYS B CD    1 
ATOM   3833 C  CE    . LYS F 3 166 ? 18.349  -4.810  -14.874 1.00 42.50 ? 167 LYS B CE    1 
ATOM   3834 N  NZ    . LYS F 3 166 ? 18.147  -6.227  -15.320 1.00 55.37 ? 167 LYS B NZ    1 
ATOM   3835 N  N     . VAL F 3 167 ? 13.983  0.618   -14.842 1.00 21.87 ? 168 VAL B N     1 
ATOM   3836 C  CA    . VAL F 3 167 ? 12.686  1.203   -15.146 1.00 21.24 ? 168 VAL B CA    1 
ATOM   3837 C  C     . VAL F 3 167 ? 12.369  1.083   -16.641 1.00 22.86 ? 168 VAL B C     1 
ATOM   3838 O  O     . VAL F 3 167 ? 13.276  1.036   -17.471 1.00 27.05 ? 168 VAL B O     1 
ATOM   3839 C  CB    . VAL F 3 167 ? 12.653  2.698   -14.708 1.00 18.60 ? 168 VAL B CB    1 
ATOM   3840 C  CG1   . VAL F 3 167 ? 13.703  3.502   -15.457 1.00 18.11 ? 168 VAL B CG1   1 
ATOM   3841 C  CG2   . VAL F 3 167 ? 11.259  3.282   -14.899 1.00 16.89 ? 168 VAL B CG2   1 
ATOM   3842 N  N     . PHE F 3 168 ? 11.089  1.014   -16.988 1.00 20.96 ? 169 PHE B N     1 
ATOM   3843 C  CA    . PHE F 3 168 ? 10.678  0.940   -18.394 1.00 18.83 ? 169 PHE B CA    1 
ATOM   3844 C  C     . PHE F 3 168 ? 9.297   1.578   -18.524 1.00 19.39 ? 169 PHE B C     1 
ATOM   3845 O  O     . PHE F 3 168 ? 8.580   1.729   -17.516 1.00 17.07 ? 169 PHE B O     1 
ATOM   3846 C  CB    . PHE F 3 168 ? 10.622  -0.522  -18.885 1.00 19.80 ? 169 PHE B CB    1 
ATOM   3847 C  CG    . PHE F 3 168 ? 9.519   -1.357  -18.250 1.00 18.18 ? 169 PHE B CG    1 
ATOM   3848 C  CD1   . PHE F 3 168 ? 8.180   -1.173  -18.606 1.00 21.59 ? 169 PHE B CD1   1 
ATOM   3849 C  CD2   . PHE F 3 168 ? 9.823   -2.315  -17.294 1.00 16.63 ? 169 PHE B CD2   1 
ATOM   3850 C  CE1   . PHE F 3 168 ? 7.169   -1.922  -18.022 1.00 12.55 ? 169 PHE B CE1   1 
ATOM   3851 C  CE2   . PHE F 3 168 ? 8.817   -3.072  -16.705 1.00 14.88 ? 169 PHE B CE2   1 
ATOM   3852 C  CZ    . PHE F 3 168 ? 7.491   -2.873  -17.070 1.00 13.67 ? 169 PHE B CZ    1 
ATOM   3853 N  N     . LEU F 3 169 ? 8.931   1.960   -19.747 1.00 12.40 ? 170 LEU B N     1 
ATOM   3854 C  CA    . LEU F 3 169 ? 7.607   2.517   -20.010 1.00 14.33 ? 170 LEU B CA    1 
ATOM   3855 C  C     . LEU F 3 169 ? 7.069   1.675   -21.156 1.00 18.83 ? 170 LEU B C     1 
ATOM   3856 O  O     . LEU F 3 169 ? 7.767   1.440   -22.151 1.00 19.58 ? 170 LEU B O     1 
ATOM   3857 C  CB    . LEU F 3 169 ? 7.661   3.995   -20.404 1.00 10.20 ? 170 LEU B CB    1 
ATOM   3858 C  CG    . LEU F 3 169 ? 6.290   4.672   -20.567 1.00 7.94  ? 170 LEU B CG    1 
ATOM   3859 C  CD1   . LEU F 3 169 ? 6.439   6.148   -20.299 1.00 18.74 ? 170 LEU B CD1   1 
ATOM   3860 C  CD2   . LEU F 3 169 ? 5.709   4.441   -21.959 1.00 15.65 ? 170 LEU B CD2   1 
ATOM   3861 N  N     . GLN F 3 170 ? 5.834   1.221   -21.031 1.00 15.78 ? 171 GLN B N     1 
ATOM   3862 C  CA    . GLN F 3 170 ? 5.277   0.381   -22.063 1.00 17.84 ? 171 GLN B CA    1 
ATOM   3863 C  C     . GLN F 3 170 ? 3.763   0.454   -22.002 1.00 17.83 ? 171 GLN B C     1 
ATOM   3864 O  O     . GLN F 3 170 ? 3.190   0.807   -20.963 1.00 15.62 ? 171 GLN B O     1 
ATOM   3865 C  CB    . GLN F 3 170 ? 5.784   -1.058  -21.847 1.00 18.05 ? 171 GLN B CB    1 
ATOM   3866 C  CG    . GLN F 3 170 ? 5.457   -2.053  -22.955 1.00 24.04 ? 171 GLN B CG    1 
ATOM   3867 C  CD    . GLN F 3 170 ? 5.992   -1.616  -24.304 1.00 23.47 ? 171 GLN B CD    1 
ATOM   3868 O  OE1   . GLN F 3 170 ? 5.271   -1.013  -25.099 1.00 18.72 ? 171 GLN B OE1   1 
ATOM   3869 N  NE2   . GLN F 3 170 ? 7.256   -1.915  -24.565 1.00 18.91 ? 171 GLN B NE2   1 
ATOM   3870 N  N     . ASP F 3 171 ? 3.109   0.141   -23.118 1.00 16.09 ? 172 ASP B N     1 
ATOM   3871 C  CA    . ASP F 3 171 ? 1.651   0.147   -23.150 1.00 15.12 ? 172 ASP B CA    1 
ATOM   3872 C  C     . ASP F 3 171 ? 1.182   -1.039  -22.322 1.00 14.27 ? 172 ASP B C     1 
ATOM   3873 O  O     . ASP F 3 171 ? 1.773   -2.122  -22.374 1.00 12.16 ? 172 ASP B O     1 
ATOM   3874 C  CB    . ASP F 3 171 ? 1.135   0.017   -24.583 1.00 15.48 ? 172 ASP B CB    1 
ATOM   3875 C  CG    . ASP F 3 171 ? 1.465   1.226   -25.423 1.00 15.17 ? 172 ASP B CG    1 
ATOM   3876 O  OD1   . ASP F 3 171 ? 2.566   1.270   -26.002 1.00 21.65 ? 172 ASP B OD1   1 
ATOM   3877 O  OD2   . ASP F 3 171 ? 0.623   2.136   -25.500 1.00 24.70 ? 172 ASP B OD2   1 
ATOM   3878 N  N     . LYS F 3 172 ? 0.120   -0.832  -21.558 1.00 17.93 ? 173 LYS B N     1 
ATOM   3879 C  CA    . LYS F 3 172 ? -0.413  -1.878  -20.702 1.00 17.83 ? 173 LYS B CA    1 
ATOM   3880 C  C     . LYS F 3 172 ? -0.796  -3.151  -21.466 1.00 17.41 ? 173 LYS B C     1 
ATOM   3881 O  O     . LYS F 3 172 ? -0.418  -4.249  -21.066 1.00 18.24 ? 173 LYS B O     1 
ATOM   3882 C  CB    . LYS F 3 172 ? -1.628  -1.356  -19.914 1.00 15.16 ? 173 LYS B CB    1 
ATOM   3883 C  CG    . LYS F 3 172 ? -2.147  -2.363  -18.890 1.00 24.11 ? 173 LYS B CG    1 
ATOM   3884 C  CD    . LYS F 3 172 ? -3.528  -2.018  -18.359 1.00 23.99 ? 173 LYS B CD    1 
ATOM   3885 C  CE    . LYS F 3 172 ? -3.449  -1.097  -17.161 1.00 32.81 ? 173 LYS B CE    1 
ATOM   3886 N  NZ    . LYS F 3 172 ? -4.713  -1.118  -16.344 1.00 17.70 ? 173 LYS B NZ    1 
ATOM   3887 N  N     . TRP F 3 173 ? -1.534  -3.012  -22.564 1.00 19.27 ? 174 TRP B N     1 
ATOM   3888 C  CA    . TRP F 3 173 ? -1.980  -4.186  -23.308 1.00 15.04 ? 174 TRP B CA    1 
ATOM   3889 C  C     . TRP F 3 173 ? -0.858  -5.068  -23.794 1.00 13.12 ? 174 TRP B C     1 
ATOM   3890 O  O     . TRP F 3 173 ? -1.000  -6.282  -23.829 1.00 15.60 ? 174 TRP B O     1 
ATOM   3891 C  CB    . TRP F 3 173 ? -2.909  -3.780  -24.464 1.00 23.25 ? 174 TRP B CB    1 
ATOM   3892 C  CG    . TRP F 3 173 ? -2.247  -3.237  -25.691 1.00 21.35 ? 174 TRP B CG    1 
ATOM   3893 C  CD1   . TRP F 3 173 ? -2.077  -1.925  -26.020 1.00 23.93 ? 174 TRP B CD1   1 
ATOM   3894 C  CD2   . TRP F 3 173 ? -1.696  -4.000  -26.778 1.00 25.85 ? 174 TRP B CD2   1 
ATOM   3895 N  NE1   . TRP F 3 173 ? -1.458  -1.823  -27.245 1.00 23.09 ? 174 TRP B NE1   1 
ATOM   3896 C  CE2   . TRP F 3 173 ? -1.213  -3.081  -27.731 1.00 24.48 ? 174 TRP B CE2   1 
ATOM   3897 C  CE3   . TRP F 3 173 ? -1.565  -5.377  -27.037 1.00 23.05 ? 174 TRP B CE3   1 
ATOM   3898 C  CZ2   . TRP F 3 173 ? -0.611  -3.488  -28.925 1.00 23.62 ? 174 TRP B CZ2   1 
ATOM   3899 C  CZ3   . TRP F 3 173 ? -0.966  -5.782  -28.223 1.00 21.98 ? 174 TRP B CZ3   1 
ATOM   3900 C  CH2   . TRP F 3 173 ? -0.496  -4.839  -29.151 1.00 25.48 ? 174 TRP B CH2   1 
ATOM   3901 N  N     . VAL F 3 174 ? 0.264   -4.451  -24.147 1.00 16.76 ? 175 VAL B N     1 
ATOM   3902 C  CA    . VAL F 3 174 ? 1.441   -5.154  -24.664 1.00 17.57 ? 175 VAL B CA    1 
ATOM   3903 C  C     . VAL F 3 174 ? 2.113   -6.075  -23.648 1.00 19.43 ? 175 VAL B C     1 
ATOM   3904 O  O     . VAL F 3 174 ? 2.582   -7.161  -24.009 1.00 18.02 ? 175 VAL B O     1 
ATOM   3905 C  CB    . VAL F 3 174 ? 2.486   -4.129  -25.204 1.00 22.26 ? 175 VAL B CB    1 
ATOM   3906 C  CG1   . VAL F 3 174 ? 3.765   -4.813  -25.607 1.00 22.65 ? 175 VAL B CG1   1 
ATOM   3907 C  CG2   . VAL F 3 174 ? 1.912   -3.385  -26.388 1.00 21.70 ? 175 VAL B CG2   1 
ATOM   3908 N  N     . ILE F 3 175 ? 2.167   -5.646  -22.385 1.00 18.99 ? 176 ILE B N     1 
ATOM   3909 C  CA    . ILE F 3 175 ? 2.793   -6.456  -21.336 1.00 18.90 ? 176 ILE B CA    1 
ATOM   3910 C  C     . ILE F 3 175 ? 1.804   -7.283  -20.517 1.00 16.60 ? 176 ILE B C     1 
ATOM   3911 O  O     . ILE F 3 175 ? 2.205   -7.983  -19.594 1.00 17.45 ? 176 ILE B O     1 
ATOM   3912 C  CB    . ILE F 3 175 ? 3.687   -5.603  -20.362 1.00 21.50 ? 176 ILE B CB    1 
ATOM   3913 C  CG1   . ILE F 3 175 ? 2.868   -4.510  -19.666 1.00 20.96 ? 176 ILE B CG1   1 
ATOM   3914 C  CG2   . ILE F 3 175 ? 4.849   -4.994  -21.129 1.00 24.05 ? 176 ILE B CG2   1 
ATOM   3915 C  CD1   . ILE F 3 175 ? 3.627   -3.804  -18.575 1.00 18.42 ? 176 ILE B CD1   1 
ATOM   3916 N  N     . ALA F 3 176 ? 0.521   -7.201  -20.854 1.00 17.45 ? 177 ALA B N     1 
ATOM   3917 C  CA    . ALA F 3 176 ? -0.502  -7.962  -20.147 1.00 18.63 ? 177 ALA B CA    1 
ATOM   3918 C  C     . ALA F 3 176 ? -0.366  -9.453  -20.460 1.00 19.21 ? 177 ALA B C     1 
ATOM   3919 O  O     . ALA F 3 176 ? 0.010   -9.832  -21.566 1.00 20.30 ? 177 ALA B O     1 
ATOM   3920 C  CB    . ALA F 3 176 ? -1.887  -7.470  -20.527 1.00 13.77 ? 177 ALA B CB    1 
ATOM   3921 N  N     . GLY F 3 177 ? -0.664  -10.290 -19.471 1.00 17.73 ? 178 GLY B N     1 
ATOM   3922 C  CA    . GLY F 3 177 ? -0.585  -11.731 -19.642 1.00 11.20 ? 178 GLY B CA    1 
ATOM   3923 C  C     . GLY F 3 177 ? -1.984  -12.313 -19.655 1.00 11.72 ? 178 GLY B C     1 
ATOM   3924 O  O     . GLY F 3 177 ? -2.974  -11.586 -19.758 1.00 13.46 ? 178 GLY B O     1 
ATOM   3925 N  N     . ASP F 3 178 ? -2.086  -13.628 -19.545 1.00 15.48 ? 179 ASP B N     1 
ATOM   3926 C  CA    . ASP F 3 178 ? -3.394  -14.271 -19.571 1.00 18.60 ? 179 ASP B CA    1 
ATOM   3927 C  C     . ASP F 3 178 ? -3.806  -14.911 -18.249 1.00 18.64 ? 179 ASP B C     1 
ATOM   3928 O  O     . ASP F 3 178 ? -4.863  -15.526 -18.167 1.00 19.39 ? 179 ASP B O     1 
ATOM   3929 C  CB    . ASP F 3 178 ? -3.480  -15.300 -20.723 1.00 11.88 ? 179 ASP B CB    1 
ATOM   3930 C  CG    . ASP F 3 178 ? -2.369  -16.356 -20.680 1.00 17.47 ? 179 ASP B CG    1 
ATOM   3931 O  OD1   . ASP F 3 178 ? -1.412  -16.243 -19.879 1.00 19.24 ? 179 ASP B OD1   1 
ATOM   3932 O  OD2   . ASP F 3 178 ? -2.455  -17.320 -21.467 1.00 21.94 ? 179 ASP B OD2   1 
ATOM   3933 N  N     . LEU F 3 179 ? -2.978  -14.770 -17.219 1.00 17.50 ? 180 LEU B N     1 
ATOM   3934 C  CA    . LEU F 3 179 ? -3.298  -15.340 -15.913 1.00 18.46 ? 180 LEU B CA    1 
ATOM   3935 C  C     . LEU F 3 179 ? -3.485  -14.211 -14.908 1.00 18.82 ? 180 LEU B C     1 
ATOM   3936 O  O     . LEU F 3 179 ? -2.697  -13.261 -14.897 1.00 20.86 ? 180 LEU B O     1 
ATOM   3937 C  CB    . LEU F 3 179 ? -2.170  -16.262 -15.435 1.00 16.36 ? 180 LEU B CB    1 
ATOM   3938 C  CG    . LEU F 3 179 ? -1.780  -17.433 -16.341 1.00 28.44 ? 180 LEU B CG    1 
ATOM   3939 C  CD1   . LEU F 3 179 ? -0.621  -18.171 -15.697 1.00 33.37 ? 180 LEU B CD1   1 
ATOM   3940 C  CD2   . LEU F 3 179 ? -2.967  -18.386 -16.577 1.00 27.54 ? 180 LEU B CD2   1 
ATOM   3941 N  N     . ALA F 3 180 ? -4.516  -14.305 -14.073 1.00 16.63 ? 181 ALA B N     1 
ATOM   3942 C  CA    . ALA F 3 180 ? -4.767  -13.285 -13.057 1.00 18.66 ? 181 ALA B CA    1 
ATOM   3943 C  C     . ALA F 3 180 ? -3.528  -13.069 -12.171 1.00 19.89 ? 181 ALA B C     1 
ATOM   3944 O  O     . ALA F 3 180 ? -2.803  -14.015 -11.856 1.00 20.54 ? 181 ALA B O     1 
ATOM   3945 C  CB    . ALA F 3 180 ? -5.959  -13.681 -12.205 1.00 18.27 ? 181 ALA B CB    1 
ATOM   3946 N  N     . GLY F 3 181 ? -3.287  -11.816 -11.789 1.00 21.01 ? 182 GLY B N     1 
ATOM   3947 C  CA    . GLY F 3 181 ? -2.151  -11.479 -10.945 1.00 18.44 ? 182 GLY B CA    1 
ATOM   3948 C  C     . GLY F 3 181 ? -2.435  -11.545 -9.449  1.00 17.34 ? 182 GLY B C     1 
ATOM   3949 O  O     . GLY F 3 181 ? -1.504  -11.536 -8.642  1.00 17.63 ? 182 GLY B O     1 
ATOM   3950 N  N     . SER F 3 182 ? -3.713  -11.597 -9.079  1.00 15.72 ? 183 SER B N     1 
ATOM   3951 C  CA    . SER F 3 182 ? -4.133  -11.698 -7.681  1.00 17.26 ? 183 SER B CA    1 
ATOM   3952 C  C     . SER F 3 182 ? -5.517  -12.340 -7.638  1.00 16.57 ? 183 SER B C     1 
ATOM   3953 O  O     . SER F 3 182 ? -6.280  -12.256 -8.606  1.00 17.92 ? 183 SER B O     1 
ATOM   3954 C  CB    . SER F 3 182 ? -4.167  -10.320 -7.002  1.00 14.73 ? 183 SER B CB    1 
ATOM   3955 O  OG    . SER F 3 182 ? -5.207  -9.502  -7.523  1.00 19.80 ? 183 SER B OG    1 
ATOM   3956 N  N     . GLY F 3 183 ? -5.843  -12.975 -6.518  1.00 18.28 ? 184 GLY B N     1 
ATOM   3957 C  CA    . GLY F 3 183 ? -7.129  -13.635 -6.381  1.00 14.96 ? 184 GLY B CA    1 
ATOM   3958 C  C     . GLY F 3 183 ? -8.258  -12.760 -5.879  1.00 18.16 ? 184 GLY B C     1 
ATOM   3959 O  O     . GLY F 3 183 ? -9.063  -12.270 -6.678  1.00 18.20 ? 184 GLY B O     1 
ATOM   3960 N  N     . ASN F 3 184 ? -8.333  -12.553 -4.563  1.00 15.52 ? 185 ASN B N     1 
ATOM   3961 C  CA    . ASN F 3 184 ? -9.404  -11.739 -3.987  1.00 15.40 ? 185 ASN B CA    1 
ATOM   3962 C  C     . ASN F 3 184 ? -9.463  -10.298 -4.510  1.00 14.79 ? 185 ASN B C     1 
ATOM   3963 O  O     . ASN F 3 184 ? -10.528 -9.681  -4.514  1.00 15.77 ? 185 ASN B O     1 
ATOM   3964 C  CB    . ASN F 3 184 ? -9.367  -11.765 -2.435  1.00 16.35 ? 185 ASN B CB    1 
ATOM   3965 C  CG    . ASN F 3 184 ? -7.993  -11.414 -1.842  1.00 15.91 ? 185 ASN B CG    1 
ATOM   3966 O  OD1   . ASN F 3 184 ? -7.085  -10.927 -2.531  1.00 16.07 ? 185 ASN B OD1   1 
ATOM   3967 N  ND2   . ASN F 3 184 ? -7.840  -11.667 -0.545  1.00 19.39 ? 185 ASN B ND2   1 
ATOM   3968 N  N     . THR F 3 185 ? -8.335  -9.755  -4.963  1.00 16.53 ? 186 THR B N     1 
ATOM   3969 C  CA    . THR F 3 185 ? -8.331  -8.386  -5.482  1.00 15.33 ? 186 THR B CA    1 
ATOM   3970 C  C     . THR F 3 185 ? -8.415  -8.307  -7.018  1.00 19.16 ? 186 THR B C     1 
ATOM   3971 O  O     . THR F 3 185 ? -8.172  -7.252  -7.610  1.00 16.66 ? 186 THR B O     1 
ATOM   3972 C  CB    . THR F 3 185 ? -7.116  -7.606  -4.963  1.00 14.56 ? 186 THR B CB    1 
ATOM   3973 O  OG1   . THR F 3 185 ? -5.920  -8.335  -5.262  1.00 14.69 ? 186 THR B OG1   1 
ATOM   3974 C  CG2   . THR F 3 185 ? -7.224  -7.414  -3.442  1.00 12.85 ? 186 THR B CG2   1 
ATOM   3975 N  N     . THR F 3 186 ? -8.756  -9.436  -7.642  1.00 17.28 ? 187 THR B N     1 
ATOM   3976 C  CA    . THR F 3 186 ? -8.958  -9.558  -9.088  1.00 13.13 ? 187 THR B CA    1 
ATOM   3977 C  C     . THR F 3 186 ? -8.133  -8.635  -9.985  1.00 10.86 ? 187 THR B C     1 
ATOM   3978 O  O     . THR F 3 186 ? -8.673  -7.731  -10.640 1.00 11.74 ? 187 THR B O     1 
ATOM   3979 C  CB    . THR F 3 186 ? -10.459 -9.378  -9.432  1.00 12.38 ? 187 THR B CB    1 
ATOM   3980 O  OG1   . THR F 3 186 ? -10.935 -8.135  -8.907  1.00 14.67 ? 187 THR B OG1   1 
ATOM   3981 C  CG2   . THR F 3 186 ? -11.289 -10.505 -8.830  1.00 11.96 ? 187 THR B CG2   1 
ATOM   3982 N  N     . ASN F 3 187 ? -6.830  -8.871  -10.006 1.00 10.79 ? 188 ASN B N     1 
ATOM   3983 C  CA    . ASN F 3 187 ? -5.908  -8.084  -10.805 1.00 13.40 ? 188 ASN B CA    1 
ATOM   3984 C  C     . ASN F 3 187 ? -5.464  -8.826  -12.056 1.00 18.49 ? 188 ASN B C     1 
ATOM   3985 O  O     . ASN F 3 187 ? -5.382  -10.061 -12.077 1.00 18.35 ? 188 ASN B O     1 
ATOM   3986 C  CB    . ASN F 3 187 ? -4.650  -7.740  -9.994  1.00 10.59 ? 188 ASN B CB    1 
ATOM   3987 C  CG    . ASN F 3 187 ? -4.618  -6.288  -9.532  1.00 16.36 ? 188 ASN B CG    1 
ATOM   3988 O  OD1   . ASN F 3 187 ? -3.657  -5.560  -9.805  1.00 13.39 ? 188 ASN B OD1   1 
ATOM   3989 N  ND2   . ASN F 3 187 ? -5.664  -5.860  -8.824  1.00 15.46 ? 188 ASN B ND2   1 
ATOM   3990 N  N     . ILE F 3 188 ? -5.171  -8.054  -13.096 1.00 19.25 ? 189 ILE B N     1 
ATOM   3991 C  CA    . ILE F 3 188 ? -4.661  -8.573  -14.355 1.00 15.20 ? 189 ILE B CA    1 
ATOM   3992 C  C     . ILE F 3 188 ? -3.188  -8.882  -14.064 1.00 14.46 ? 189 ILE B C     1 
ATOM   3993 O  O     . ILE F 3 188 ? -2.496  -8.068  -13.443 1.00 13.89 ? 189 ILE B O     1 
ATOM   3994 C  CB    . ILE F 3 188 ? -4.725  -7.470  -15.451 1.00 15.93 ? 189 ILE B CB    1 
ATOM   3995 C  CG1   . ILE F 3 188 ? -6.178  -7.193  -15.830 1.00 15.45 ? 189 ILE B CG1   1 
ATOM   3996 C  CG2   . ILE F 3 188 ? -3.881  -7.851  -16.662 1.00 16.84 ? 189 ILE B CG2   1 
ATOM   3997 C  CD1   . ILE F 3 188 ? -6.361  -5.941  -16.660 1.00 19.91 ? 189 ILE B CD1   1 
ATOM   3998 N  N     . GLY F 3 189 ? -2.709  -10.046 -14.489 1.00 11.27 ? 190 GLY B N     1 
ATOM   3999 C  CA    . GLY F 3 189 ? -1.307  -10.365 -14.296 1.00 12.27 ? 190 GLY B CA    1 
ATOM   4000 C  C     . GLY F 3 189 ? -0.545  -10.011 -15.570 1.00 15.47 ? 190 GLY B C     1 
ATOM   4001 O  O     . GLY F 3 189 ? -1.103  -10.127 -16.668 1.00 14.44 ? 190 GLY B O     1 
ATOM   4002 N  N     . SER F 3 190 ? 0.707   -9.572  -15.451 1.00 12.72 ? 191 SER B N     1 
ATOM   4003 C  CA    . SER F 3 190 ? 1.507   -9.239  -16.629 1.00 13.83 ? 191 SER B CA    1 
ATOM   4004 C  C     . SER F 3 190 ? 2.141   -10.530 -17.127 1.00 18.89 ? 191 SER B C     1 
ATOM   4005 O  O     . SER F 3 190 ? 1.953   -11.594 -16.522 1.00 20.16 ? 191 SER B O     1 
ATOM   4006 C  CB    . SER F 3 190 ? 2.631   -8.257  -16.273 1.00 18.47 ? 191 SER B CB    1 
ATOM   4007 O  OG    . SER F 3 190 ? 3.707   -8.905  -15.595 1.00 17.50 ? 191 SER B OG    1 
ATOM   4008 N  N     . ILE F 3 191 ? 2.893   -10.447 -18.221 1.00 17.35 ? 192 ILE B N     1 
ATOM   4009 C  CA    . ILE F 3 191 ? 3.582   -11.621 -18.729 1.00 20.28 ? 192 ILE B CA    1 
ATOM   4010 C  C     . ILE F 3 191 ? 4.666   -11.950 -17.698 1.00 22.52 ? 192 ILE B C     1 
ATOM   4011 O  O     . ILE F 3 191 ? 5.148   -11.060 -16.995 1.00 25.51 ? 192 ILE B O     1 
ATOM   4012 C  CB    . ILE F 3 191 ? 4.253   -11.339 -20.107 1.00 27.53 ? 192 ILE B CB    1 
ATOM   4013 C  CG1   . ILE F 3 191 ? 5.216   -10.150 -20.001 1.00 19.39 ? 192 ILE B CG1   1 
ATOM   4014 C  CG2   . ILE F 3 191 ? 3.188   -11.097 -21.180 1.00 23.15 ? 192 ILE B CG2   1 
ATOM   4015 C  CD1   . ILE F 3 191 ? 5.822   -9.732  -21.330 1.00 16.13 ? 192 ILE B CD1   1 
ATOM   4016 N  N     . HIS F 3 192 ? 5.038   -13.218 -17.587 1.00 22.60 ? 193 HIS B N     1 
ATOM   4017 C  CA    . HIS F 3 192 ? 6.083   -13.623 -16.662 1.00 23.54 ? 193 HIS B CA    1 
ATOM   4018 C  C     . HIS F 3 192 ? 7.309   -13.748 -17.555 1.00 25.86 ? 193 HIS B C     1 
ATOM   4019 O  O     . HIS F 3 192 ? 7.540   -14.795 -18.146 1.00 28.46 ? 193 HIS B O     1 
ATOM   4020 C  CB    . HIS F 3 192 ? 5.721   -14.968 -16.015 1.00 27.73 ? 193 HIS B CB    1 
ATOM   4021 C  CG    . HIS F 3 192 ? 6.704   -15.433 -14.980 1.00 36.18 ? 193 HIS B CG    1 
ATOM   4022 N  ND1   . HIS F 3 192 ? 7.316   -14.577 -14.089 1.00 44.19 ? 193 HIS B ND1   1 
ATOM   4023 C  CD2   . HIS F 3 192 ? 7.177   -16.670 -14.694 1.00 33.82 ? 193 HIS B CD2   1 
ATOM   4024 C  CE1   . HIS F 3 192 ? 8.121   -15.263 -13.298 1.00 40.12 ? 193 HIS B CE1   1 
ATOM   4025 N  NE2   . HIS F 3 192 ? 8.055   -16.537 -13.645 1.00 37.74 ? 193 HIS B NE2   1 
ATOM   4026 N  N     . ALA F 3 193 ? 8.091   -12.675 -17.646 1.00 27.06 ? 194 ALA B N     1 
ATOM   4027 C  CA    . ALA F 3 193 ? 9.252   -12.638 -18.525 1.00 27.02 ? 194 ALA B CA    1 
ATOM   4028 C  C     . ALA F 3 193 ? 10.449  -11.866 -17.965 1.00 30.53 ? 194 ALA B C     1 
ATOM   4029 O  O     . ALA F 3 193 ? 10.440  -11.430 -16.817 1.00 28.92 ? 194 ALA B O     1 
ATOM   4030 C  CB    . ALA F 3 193 ? 8.833   -12.031 -19.846 1.00 25.47 ? 194 ALA B CB    1 
ATOM   4031 N  N     . HIS F 3 194 ? 11.485  -11.708 -18.787 1.00 31.83 ? 195 HIS B N     1 
ATOM   4032 C  CA    . HIS F 3 194 ? 12.685  -10.977 -18.384 1.00 32.21 ? 195 HIS B CA    1 
ATOM   4033 C  C     . HIS F 3 194 ? 12.475  -9.509  -18.692 1.00 31.81 ? 195 HIS B C     1 
ATOM   4034 O  O     . HIS F 3 194 ? 11.685  -9.172  -19.573 1.00 32.40 ? 195 HIS B O     1 
ATOM   4035 C  CB    . HIS F 3 194 ? 13.915  -11.466 -19.150 1.00 33.24 ? 195 HIS B CB    1 
ATOM   4036 C  CG    . HIS F 3 194 ? 14.354  -12.842 -18.770 1.00 37.54 ? 195 HIS B CG    1 
ATOM   4037 N  ND1   . HIS F 3 194 ? 15.240  -13.083 -17.743 1.00 45.19 ? 195 HIS B ND1   1 
ATOM   4038 C  CD2   . HIS F 3 194 ? 14.017  -14.055 -19.269 1.00 42.51 ? 195 HIS B CD2   1 
ATOM   4039 C  CE1   . HIS F 3 194 ? 15.430  -14.386 -17.625 1.00 46.86 ? 195 HIS B CE1   1 
ATOM   4040 N  NE2   . HIS F 3 194 ? 14.701  -14.996 -18.537 1.00 47.89 ? 195 HIS B NE2   1 
ATOM   4041 N  N     . TYR F 3 195 ? 13.187  -8.646  -17.971 1.00 29.18 ? 196 TYR B N     1 
ATOM   4042 C  CA    . TYR F 3 195 ? 13.102  -7.198  -18.148 1.00 29.17 ? 196 TYR B CA    1 
ATOM   4043 C  C     . TYR F 3 195 ? 13.105  -6.760  -19.617 1.00 28.96 ? 196 TYR B C     1 
ATOM   4044 O  O     . TYR F 3 195 ? 12.274  -5.949  -20.036 1.00 28.93 ? 196 TYR B O     1 
ATOM   4045 C  CB    . TYR F 3 195 ? 14.267  -6.538  -17.410 1.00 24.10 ? 196 TYR B CB    1 
ATOM   4046 C  CG    . TYR F 3 195 ? 14.426  -5.054  -17.655 1.00 26.22 ? 196 TYR B CG    1 
ATOM   4047 C  CD1   . TYR F 3 195 ? 13.504  -4.131  -17.147 1.00 21.84 ? 196 TYR B CD1   1 
ATOM   4048 C  CD2   . TYR F 3 195 ? 15.507  -4.570  -18.390 1.00 24.04 ? 196 TYR B CD2   1 
ATOM   4049 C  CE1   . TYR F 3 195 ? 13.658  -2.766  -17.363 1.00 16.51 ? 196 TYR B CE1   1 
ATOM   4050 C  CE2   . TYR F 3 195 ? 15.672  -3.208  -18.612 1.00 25.88 ? 196 TYR B CE2   1 
ATOM   4051 C  CZ    . TYR F 3 195 ? 14.748  -2.310  -18.097 1.00 26.64 ? 196 TYR B CZ    1 
ATOM   4052 O  OH    . TYR F 3 195 ? 14.936  -0.963  -18.327 1.00 29.00 ? 196 TYR B OH    1 
ATOM   4053 N  N     . LYS F 3 196 ? 14.044  -7.307  -20.384 1.00 30.85 ? 197 LYS B N     1 
ATOM   4054 C  CA    . LYS F 3 196 ? 14.204  -7.001  -21.806 1.00 30.70 ? 197 LYS B CA    1 
ATOM   4055 C  C     . LYS F 3 196 ? 12.898  -7.129  -22.586 1.00 29.31 ? 197 LYS B C     1 
ATOM   4056 O  O     . LYS F 3 196 ? 12.591  -6.295  -23.450 1.00 28.19 ? 197 LYS B O     1 
ATOM   4057 C  CB    . LYS F 3 196 ? 15.235  -7.950  -22.416 1.00 37.28 ? 197 LYS B CB    1 
ATOM   4058 C  CG    . LYS F 3 196 ? 15.480  -7.741  -23.903 1.00 53.92 ? 197 LYS B CG    1 
ATOM   4059 C  CD    . LYS F 3 196 ? 16.238  -8.923  -24.490 1.00 63.84 ? 197 LYS B CD    1 
ATOM   4060 C  CE    . LYS F 3 196 ? 16.984  -8.545  -25.765 1.00 66.46 ? 197 LYS B CE    1 
ATOM   4061 N  NZ    . LYS F 3 196 ? 17.679  -9.731  -26.347 1.00 64.33 ? 197 LYS B NZ    1 
ATOM   4062 N  N     . ASP F 3 197 ? 12.135  -8.176  -22.272 1.00 26.30 ? 198 ASP B N     1 
ATOM   4063 C  CA    . ASP F 3 197 ? 10.870  -8.438  -22.947 1.00 25.52 ? 198 ASP B CA    1 
ATOM   4064 C  C     . ASP F 3 197 ? 9.825   -7.362  -22.681 1.00 23.64 ? 198 ASP B C     1 
ATOM   4065 O  O     . ASP F 3 197 ? 8.962   -7.115  -23.520 1.00 25.08 ? 198 ASP B O     1 
ATOM   4066 C  CB    . ASP F 3 197 ? 10.329  -9.816  -22.553 1.00 30.35 ? 198 ASP B CB    1 
ATOM   4067 C  CG    . ASP F 3 197 ? 11.250  -10.955 -22.976 1.00 39.55 ? 198 ASP B CG    1 
ATOM   4068 O  OD1   . ASP F 3 197 ? 12.031  -10.786 -23.940 1.00 47.39 ? 198 ASP B OD1   1 
ATOM   4069 O  OD2   . ASP F 3 197 ? 11.192  -12.027 -22.338 1.00 47.83 ? 198 ASP B OD2   1 
ATOM   4070 N  N     . PHE F 3 198 ? 9.895   -6.721  -21.520 1.00 23.85 ? 199 PHE B N     1 
ATOM   4071 C  CA    . PHE F 3 198 ? 8.944   -5.654  -21.192 1.00 22.18 ? 199 PHE B CA    1 
ATOM   4072 C  C     . PHE F 3 198 ? 9.324   -4.398  -21.968 1.00 20.32 ? 199 PHE B C     1 
ATOM   4073 O  O     . PHE F 3 198 ? 8.459   -3.694  -22.497 1.00 20.77 ? 199 PHE B O     1 
ATOM   4074 C  CB    . PHE F 3 198 ? 8.960   -5.348  -19.690 1.00 24.94 ? 199 PHE B CB    1 
ATOM   4075 C  CG    . PHE F 3 198 ? 8.333   -6.417  -18.848 1.00 18.14 ? 199 PHE B CG    1 
ATOM   4076 C  CD1   . PHE F 3 198 ? 9.084   -7.487  -18.392 1.00 21.66 ? 199 PHE B CD1   1 
ATOM   4077 C  CD2   . PHE F 3 198 ? 6.987   -6.356  -18.519 1.00 17.98 ? 199 PHE B CD2   1 
ATOM   4078 C  CE1   . PHE F 3 198 ? 8.505   -8.482  -17.618 1.00 22.55 ? 199 PHE B CE1   1 
ATOM   4079 C  CE2   . PHE F 3 198 ? 6.400   -7.348  -17.744 1.00 21.89 ? 199 PHE B CE2   1 
ATOM   4080 C  CZ    . PHE F 3 198 ? 7.163   -8.413  -17.295 1.00 18.50 ? 199 PHE B CZ    1 
ATOM   4081 N  N     . VAL F 3 199 ? 10.623  -4.122  -22.033 1.00 21.01 ? 200 VAL B N     1 
ATOM   4082 C  CA    . VAL F 3 199 ? 11.116  -2.958  -22.763 1.00 22.71 ? 200 VAL B CA    1 
ATOM   4083 C  C     . VAL F 3 199 ? 10.784  -3.116  -24.249 1.00 24.69 ? 200 VAL B C     1 
ATOM   4084 O  O     . VAL F 3 199 ? 10.171  -2.233  -24.849 1.00 26.41 ? 200 VAL B O     1 
ATOM   4085 C  CB    . VAL F 3 199 ? 12.642  -2.805  -22.609 1.00 24.39 ? 200 VAL B CB    1 
ATOM   4086 C  CG1   . VAL F 3 199 ? 13.144  -1.617  -23.433 1.00 19.78 ? 200 VAL B CG1   1 
ATOM   4087 C  CG2   . VAL F 3 199 ? 12.996  -2.628  -21.146 1.00 25.09 ? 200 VAL B CG2   1 
ATOM   4088 N  N     . GLU F 3 200 ? 11.183  -4.243  -24.833 1.00 25.38 ? 201 GLU B N     1 
ATOM   4089 C  CA    . GLU F 3 200 ? 10.924  -4.503  -26.251 1.00 32.54 ? 201 GLU B CA    1 
ATOM   4090 C  C     . GLU F 3 200 ? 9.460   -4.776  -26.553 1.00 32.27 ? 201 GLU B C     1 
ATOM   4091 O  O     . GLU F 3 200 ? 9.029   -4.640  -27.694 1.00 35.72 ? 201 GLU B O     1 
ATOM   4092 C  CB    . GLU F 3 200 ? 11.774  -5.665  -26.754 1.00 34.36 ? 201 GLU B CB    1 
ATOM   4093 C  CG    . GLU F 3 200 ? 13.254  -5.336  -26.826 1.00 46.90 ? 201 GLU B CG    1 
ATOM   4094 C  CD    . GLU F 3 200 ? 14.086  -6.464  -27.411 1.00 53.04 ? 201 GLU B CD    1 
ATOM   4095 O  OE1   . GLU F 3 200 ? 13.503  -7.446  -27.927 1.00 57.73 ? 201 GLU B OE1   1 
ATOM   4096 O  OE2   . GLU F 3 200 ? 15.331  -6.364  -27.353 1.00 60.68 ? 201 GLU B OE2   1 
ATOM   4097 N  N     . GLY F 3 201 ? 8.706   -5.170  -25.531 1.00 31.23 ? 202 GLY B N     1 
ATOM   4098 C  CA    . GLY F 3 201 ? 7.287   -5.419  -25.699 1.00 29.49 ? 202 GLY B CA    1 
ATOM   4099 C  C     . GLY F 3 201 ? 6.891   -6.726  -26.351 1.00 28.69 ? 202 GLY B C     1 
ATOM   4100 O  O     . GLY F 3 201 ? 6.009   -6.754  -27.211 1.00 31.08 ? 202 GLY B O     1 
ATOM   4101 N  N     . LYS F 3 202 ? 7.535   -7.813  -25.953 1.00 28.95 ? 203 LYS B N     1 
ATOM   4102 C  CA    . LYS F 3 202 ? 7.207   -9.112  -26.508 1.00 31.27 ? 203 LYS B CA    1 
ATOM   4103 C  C     . LYS F 3 202 ? 6.097   -9.691  -25.648 1.00 29.50 ? 203 LYS B C     1 
ATOM   4104 O  O     . LYS F 3 202 ? 6.370   -10.414 -24.693 1.00 30.33 ? 203 LYS B O     1 
ATOM   4105 C  CB    . LYS F 3 202 ? 8.425   -10.029 -26.480 1.00 38.85 ? 203 LYS B CB    1 
ATOM   4106 C  CG    . LYS F 3 202 ? 9.563   -9.592  -27.369 1.00 51.70 ? 203 LYS B CG    1 
ATOM   4107 C  CD    . LYS F 3 202 ? 10.696  -10.581 -27.212 1.00 68.77 ? 203 LYS B CD    1 
ATOM   4108 C  CE    . LYS F 3 202 ? 11.905  -10.232 -28.058 1.00 75.20 ? 203 LYS B CE    1 
ATOM   4109 N  NZ    . LYS F 3 202 ? 13.032  -11.174 -27.752 1.00 77.63 ? 203 LYS B NZ    1 
ATOM   4110 N  N     . GLY F 3 203 ? 4.853   -9.358  -25.987 1.00 28.21 ? 204 GLY B N     1 
ATOM   4111 C  CA    . GLY F 3 203 ? 3.705   -9.838  -25.235 1.00 29.01 ? 204 GLY B CA    1 
ATOM   4112 C  C     . GLY F 3 203 ? 3.018   -11.044 -25.852 1.00 28.12 ? 204 GLY B C     1 
ATOM   4113 O  O     . GLY F 3 203 ? 3.578   -11.693 -26.736 1.00 29.60 ? 204 GLY B O     1 
ATOM   4114 N  N     . ILE F 3 204 ? 1.806   -11.350 -25.398 1.00 25.45 ? 205 ILE B N     1 
ATOM   4115 C  CA    . ILE F 3 204 ? 1.073   -12.498 -25.925 1.00 23.83 ? 205 ILE B CA    1 
ATOM   4116 C  C     . ILE F 3 204 ? -0.208  -12.155 -26.696 1.00 22.16 ? 205 ILE B C     1 
ATOM   4117 O  O     . ILE F 3 204 ? -0.708  -12.979 -27.471 1.00 23.39 ? 205 ILE B O     1 
ATOM   4118 C  CB    . ILE F 3 204 ? 0.726   -13.515 -24.811 1.00 29.66 ? 205 ILE B CB    1 
ATOM   4119 C  CG1   . ILE F 3 204 ? -0.240  -12.898 -23.803 1.00 29.70 ? 205 ILE B CG1   1 
ATOM   4120 C  CG2   . ILE F 3 204 ? 1.998   -13.960 -24.110 1.00 36.36 ? 205 ILE B CG2   1 
ATOM   4121 C  CD1   . ILE F 3 204 ? -1.289  -13.853 -23.319 1.00 35.81 ? 205 ILE B CD1   1 
ATOM   4122 N  N     . PHE F 3 205 ? -0.739  -10.954 -26.489 1.00 17.59 ? 206 PHE B N     1 
ATOM   4123 C  CA    . PHE F 3 205 ? -1.951  -10.538 -27.177 1.00 19.12 ? 206 PHE B CA    1 
ATOM   4124 C  C     . PHE F 3 205 ? -1.635  -9.987  -28.572 1.00 19.55 ? 206 PHE B C     1 
ATOM   4125 O  O     . PHE F 3 205 ? -0.594  -9.368  -28.778 1.00 18.94 ? 206 PHE B O     1 
ATOM   4126 C  CB    . PHE F 3 205 ? -2.717  -9.501  -26.340 1.00 17.93 ? 206 PHE B CB    1 
ATOM   4127 C  CG    . PHE F 3 205 ? -3.410  -10.089 -25.145 1.00 21.87 ? 206 PHE B CG    1 
ATOM   4128 C  CD1   . PHE F 3 205 ? -4.522  -10.909 -25.306 1.00 17.71 ? 206 PHE B CD1   1 
ATOM   4129 C  CD2   . PHE F 3 205 ? -2.940  -9.847  -23.859 1.00 17.88 ? 206 PHE B CD2   1 
ATOM   4130 C  CE1   . PHE F 3 205 ? -5.156  -11.483 -24.201 1.00 23.25 ? 206 PHE B CE1   1 
ATOM   4131 C  CE2   . PHE F 3 205 ? -3.568  -10.417 -22.746 1.00 19.04 ? 206 PHE B CE2   1 
ATOM   4132 C  CZ    . PHE F 3 205 ? -4.677  -11.238 -22.916 1.00 14.86 ? 206 PHE B CZ    1 
ATOM   4133 N  N     . ASP F 3 206 ? -2.541  -10.225 -29.519 1.00 21.64 ? 207 ASP B N     1 
ATOM   4134 C  CA    . ASP F 3 206 ? -2.389  -9.763  -30.908 1.00 26.24 ? 207 ASP B CA    1 
ATOM   4135 C  C     . ASP F 3 206 ? -2.699  -8.288  -31.076 1.00 25.36 ? 207 ASP B C     1 
ATOM   4136 O  O     . ASP F 3 206 ? -2.186  -7.642  -31.984 1.00 26.19 ? 207 ASP B O     1 
ATOM   4137 C  CB    . ASP F 3 206 ? -3.315  -10.540 -31.852 1.00 30.12 ? 207 ASP B CB    1 
ATOM   4138 C  CG    . ASP F 3 206 ? -2.817  -11.946 -32.147 1.00 44.89 ? 207 ASP B CG    1 
ATOM   4139 O  OD1   . ASP F 3 206 ? -1.585  -12.133 -32.285 1.00 47.84 ? 207 ASP B OD1   1 
ATOM   4140 O  OD2   . ASP F 3 206 ? -3.668  -12.863 -32.244 1.00 49.66 ? 207 ASP B OD2   1 
ATOM   4141 N  N     . SER F 3 207 ? -3.548  -7.763  -30.202 1.00 23.80 ? 208 SER B N     1 
ATOM   4142 C  CA    . SER F 3 207 ? -3.940  -6.371  -30.271 1.00 20.13 ? 208 SER B CA    1 
ATOM   4143 C  C     . SER F 3 207 ? -4.511  -5.963  -28.938 1.00 22.63 ? 208 SER B C     1 
ATOM   4144 O  O     . SER F 3 207 ? -4.762  -6.807  -28.075 1.00 23.53 ? 208 SER B O     1 
ATOM   4145 C  CB    . SER F 3 207 ? -5.026  -6.182  -31.328 1.00 18.62 ? 208 SER B CB    1 
ATOM   4146 O  OG    . SER F 3 207 ? -6.209  -6.880  -30.971 1.00 21.01 ? 208 SER B OG    1 
ATOM   4147 N  N     . GLU F 3 208 ? -4.723  -4.662  -28.788 1.00 19.96 ? 209 GLU B N     1 
ATOM   4148 C  CA    . GLU F 3 208 ? -5.296  -4.102  -27.584 1.00 20.48 ? 209 GLU B CA    1 
ATOM   4149 C  C     . GLU F 3 208 ? -6.759  -4.532  -27.493 1.00 19.21 ? 209 GLU B C     1 
ATOM   4150 O  O     . GLU F 3 208 ? -7.296  -4.705  -26.405 1.00 16.65 ? 209 GLU B O     1 
ATOM   4151 C  CB    . GLU F 3 208 ? -5.174  -2.586  -27.624 1.00 23.66 ? 209 GLU B CB    1 
ATOM   4152 C  CG    . GLU F 3 208 ? -5.754  -1.867  -26.425 1.00 28.96 ? 209 GLU B CG    1 
ATOM   4153 C  CD    . GLU F 3 208 ? -5.320  -0.416  -26.367 1.00 31.32 ? 209 GLU B CD    1 
ATOM   4154 O  OE1   . GLU F 3 208 ? -5.117  0.205   -27.435 1.00 25.71 ? 209 GLU B OE1   1 
ATOM   4155 O  OE2   . GLU F 3 208 ? -5.176  0.108   -25.246 1.00 31.02 ? 209 GLU B OE2   1 
ATOM   4156 N  N     . ASP F 3 209 ? -7.400  -4.708  -28.641 1.00 15.81 ? 210 ASP B N     1 
ATOM   4157 C  CA    . ASP F 3 209 ? -8.791  -5.149  -28.674 1.00 16.97 ? 210 ASP B CA    1 
ATOM   4158 C  C     . ASP F 3 209 ? -8.906  -6.589  -28.150 1.00 14.57 ? 210 ASP B C     1 
ATOM   4159 O  O     . ASP F 3 209 ? -9.900  -6.945  -27.510 1.00 15.84 ? 210 ASP B O     1 
ATOM   4160 C  CB    . ASP F 3 209 ? -9.335  -5.059  -30.104 1.00 24.73 ? 210 ASP B CB    1 
ATOM   4161 C  CG    . ASP F 3 209 ? -10.771 -5.524  -30.217 1.00 27.85 ? 210 ASP B CG    1 
ATOM   4162 O  OD1   . ASP F 3 209 ? -11.654 -4.947  -29.542 1.00 39.61 ? 210 ASP B OD1   1 
ATOM   4163 O  OD2   . ASP F 3 209 ? -11.006 -6.474  -30.987 1.00 39.97 ? 210 ASP B OD2   1 
ATOM   4164 N  N     . GLU F 3 210 ? -7.898  -7.417  -28.424 1.00 11.85 ? 211 GLU B N     1 
ATOM   4165 C  CA    . GLU F 3 210 ? -7.927  -8.787  -27.949 1.00 12.45 ? 211 GLU B CA    1 
ATOM   4166 C  C     . GLU F 3 210 ? -7.669  -8.810  -26.434 1.00 16.26 ? 211 GLU B C     1 
ATOM   4167 O  O     . GLU F 3 210 ? -8.295  -9.581  -25.694 1.00 14.81 ? 211 GLU B O     1 
ATOM   4168 C  CB    . GLU F 3 210 ? -6.884  -9.648  -28.662 1.00 12.31 ? 211 GLU B CB    1 
ATOM   4169 C  CG    . GLU F 3 210 ? -7.109  -11.124 -28.386 1.00 10.45 ? 211 GLU B CG    1 
ATOM   4170 C  CD    . GLU F 3 210 ? -6.095  -12.029 -29.038 1.00 17.51 ? 211 GLU B CD    1 
ATOM   4171 O  OE1   . GLU F 3 210 ? -4.884  -11.741 -28.952 1.00 18.41 ? 211 GLU B OE1   1 
ATOM   4172 O  OE2   . GLU F 3 210 ? -6.512  -13.044 -29.636 1.00 21.48 ? 211 GLU B OE2   1 
ATOM   4173 N  N     . PHE F 3 211 ? -6.743  -7.963  -25.989 1.00 15.70 ? 212 PHE B N     1 
ATOM   4174 C  CA    . PHE F 3 211 ? -6.405  -7.834  -24.575 1.00 16.18 ? 212 PHE B CA    1 
ATOM   4175 C  C     . PHE F 3 211 ? -7.662  -7.466  -23.775 1.00 13.93 ? 212 PHE B C     1 
ATOM   4176 O  O     . PHE F 3 211 ? -7.960  -8.083  -22.746 1.00 15.02 ? 212 PHE B O     1 
ATOM   4177 C  CB    . PHE F 3 211 ? -5.313  -6.766  -24.421 1.00 17.61 ? 212 PHE B CB    1 
ATOM   4178 C  CG    . PHE F 3 211 ? -5.334  -6.046  -23.103 1.00 14.60 ? 212 PHE B CG    1 
ATOM   4179 C  CD1   . PHE F 3 211 ? -4.863  -6.660  -21.947 1.00 23.89 ? 212 PHE B CD1   1 
ATOM   4180 C  CD2   . PHE F 3 211 ? -5.830  -4.751  -23.019 1.00 15.50 ? 212 PHE B CD2   1 
ATOM   4181 C  CE1   . PHE F 3 211 ? -4.885  -5.994  -20.721 1.00 15.70 ? 212 PHE B CE1   1 
ATOM   4182 C  CE2   . PHE F 3 211 ? -5.858  -4.073  -21.797 1.00 14.22 ? 212 PHE B CE2   1 
ATOM   4183 C  CZ    . PHE F 3 211 ? -5.384  -4.697  -20.645 1.00 13.40 ? 212 PHE B CZ    1 
ATOM   4184 N  N     . LEU F 3 212 ? -8.399  -6.468  -24.258 1.00 13.48 ? 213 LEU B N     1 
ATOM   4185 C  CA    . LEU F 3 212 ? -9.615  -6.013  -23.597 1.00 16.37 ? 213 LEU B CA    1 
ATOM   4186 C  C     . LEU F 3 212 ? -10.712 -7.065  -23.579 1.00 19.70 ? 213 LEU B C     1 
ATOM   4187 O  O     . LEU F 3 212 ? -11.342 -7.299  -22.546 1.00 18.64 ? 213 LEU B O     1 
ATOM   4188 C  CB    . LEU F 3 212 ? -10.152 -4.739  -24.251 1.00 12.95 ? 213 LEU B CB    1 
ATOM   4189 C  CG    . LEU F 3 212 ? -9.467  -3.410  -23.912 1.00 22.98 ? 213 LEU B CG    1 
ATOM   4190 C  CD1   . LEU F 3 212 ? -10.000 -2.327  -24.838 1.00 23.78 ? 213 LEU B CD1   1 
ATOM   4191 C  CD2   . LEU F 3 212 ? -9.721  -3.032  -22.455 1.00 15.92 ? 213 LEU B CD2   1 
ATOM   4192 N  N     . ASP F 3 213 ? -10.949 -7.701  -24.720 1.00 17.98 ? 214 ASP B N     1 
ATOM   4193 C  CA    . ASP F 3 213 ? -11.986 -8.713  -24.786 1.00 16.65 ? 214 ASP B CA    1 
ATOM   4194 C  C     . ASP F 3 213 ? -11.685 -9.890  -23.854 1.00 15.02 ? 214 ASP B C     1 
ATOM   4195 O  O     . ASP F 3 213 ? -12.581 -10.396 -23.179 1.00 14.56 ? 214 ASP B O     1 
ATOM   4196 C  CB    . ASP F 3 213 ? -12.169 -9.214  -26.215 1.00 18.15 ? 214 ASP B CB    1 
ATOM   4197 C  CG    . ASP F 3 213 ? -13.364 -10.134 -26.343 1.00 17.98 ? 214 ASP B CG    1 
ATOM   4198 O  OD1   . ASP F 3 213 ? -14.477 -9.699  -25.985 1.00 17.57 ? 214 ASP B OD1   1 
ATOM   4199 O  OD2   . ASP F 3 213 ? -13.192 -11.282 -26.790 1.00 23.60 ? 214 ASP B OD2   1 
ATOM   4200 N  N     . TYR F 3 214 ? -10.428 -10.316 -23.823 1.00 13.29 ? 215 TYR B N     1 
ATOM   4201 C  CA    . TYR F 3 214 ? -9.999  -11.407 -22.965 1.00 12.05 ? 215 TYR B CA    1 
ATOM   4202 C  C     . TYR F 3 214 ? -10.277 -11.075 -21.473 1.00 16.33 ? 215 TYR B C     1 
ATOM   4203 O  O     . TYR F 3 214 ? -10.854 -11.887 -20.743 1.00 14.20 ? 215 TYR B O     1 
ATOM   4204 C  CB    . TYR F 3 214 ? -8.499  -11.677 -23.178 1.00 6.70  ? 215 TYR B CB    1 
ATOM   4205 C  CG    . TYR F 3 214 ? -7.950  -12.797 -22.322 1.00 15.50 ? 215 TYR B CG    1 
ATOM   4206 C  CD1   . TYR F 3 214 ? -7.589  -12.580 -20.981 1.00 16.72 ? 215 TYR B CD1   1 
ATOM   4207 C  CD2   . TYR F 3 214 ? -7.832  -14.088 -22.835 1.00 11.76 ? 215 TYR B CD2   1 
ATOM   4208 C  CE1   . TYR F 3 214 ? -7.133  -13.631 -20.177 1.00 14.66 ? 215 TYR B CE1   1 
ATOM   4209 C  CE2   . TYR F 3 214 ? -7.381  -15.136 -22.048 1.00 14.62 ? 215 TYR B CE2   1 
ATOM   4210 C  CZ    . TYR F 3 214 ? -7.038  -14.909 -20.722 1.00 22.81 ? 215 TYR B CZ    1 
ATOM   4211 O  OH    . TYR F 3 214 ? -6.632  -15.981 -19.962 1.00 16.09 ? 215 TYR B OH    1 
ATOM   4212 N  N     . TRP F 3 215 ? -9.874  -9.889  -21.025 1.00 16.20 ? 216 TRP B N     1 
ATOM   4213 C  CA    . TRP F 3 215 ? -10.066 -9.514  -19.624 1.00 18.01 ? 216 TRP B CA    1 
ATOM   4214 C  C     . TRP F 3 215 ? -11.471 -9.072  -19.222 1.00 18.45 ? 216 TRP B C     1 
ATOM   4215 O  O     . TRP F 3 215 ? -11.821 -9.106  -18.046 1.00 20.34 ? 216 TRP B O     1 
ATOM   4216 C  CB    . TRP F 3 215 ? -8.986  -8.516  -19.194 1.00 10.88 ? 216 TRP B CB    1 
ATOM   4217 C  CG    . TRP F 3 215 ? -7.661  -9.224  -19.024 1.00 12.40 ? 216 TRP B CG    1 
ATOM   4218 C  CD1   . TRP F 3 215 ? -6.585  -9.177  -19.865 1.00 16.34 ? 216 TRP B CD1   1 
ATOM   4219 C  CD2   . TRP F 3 215 ? -7.299  -10.127 -17.965 1.00 19.71 ? 216 TRP B CD2   1 
ATOM   4220 N  NE1   . TRP F 3 215 ? -5.576  -9.996  -19.399 1.00 16.92 ? 216 TRP B NE1   1 
ATOM   4221 C  CE2   . TRP F 3 215 ? -5.988  -10.590 -18.236 1.00 14.74 ? 216 TRP B CE2   1 
ATOM   4222 C  CE3   . TRP F 3 215 ? -7.959  -10.592 -16.813 1.00 14.02 ? 216 TRP B CE3   1 
ATOM   4223 C  CZ2   . TRP F 3 215 ? -5.324  -11.494 -17.402 1.00 12.25 ? 216 TRP B CZ2   1 
ATOM   4224 C  CZ3   . TRP F 3 215 ? -7.299  -11.491 -15.987 1.00 9.91  ? 216 TRP B CZ3   1 
ATOM   4225 C  CH2   . TRP F 3 215 ? -5.994  -11.932 -16.288 1.00 13.02 ? 216 TRP B CH2   1 
ATOM   4226 N  N     . ARG F 3 216 ? -12.280 -8.670  -20.193 1.00 16.68 ? 217 ARG B N     1 
ATOM   4227 C  CA    . ARG F 3 216 ? -13.661 -8.291  -19.912 1.00 18.94 ? 217 ARG B CA    1 
ATOM   4228 C  C     . ARG F 3 216 ? -14.529 -9.537  -19.745 1.00 20.44 ? 217 ARG B C     1 
ATOM   4229 O  O     . ARG F 3 216 ? -15.650 -9.446  -19.237 1.00 20.47 ? 217 ARG B O     1 
ATOM   4230 C  CB    . ARG F 3 216 ? -14.254 -7.470  -21.059 1.00 17.23 ? 217 ARG B CB    1 
ATOM   4231 C  CG    . ARG F 3 216 ? -13.804 -6.049  -21.109 1.00 22.99 ? 217 ARG B CG    1 
ATOM   4232 C  CD    . ARG F 3 216 ? -14.278 -5.398  -22.379 1.00 24.29 ? 217 ARG B CD    1 
ATOM   4233 N  NE    . ARG F 3 216 ? -14.109 -3.959  -22.289 1.00 24.81 ? 217 ARG B NE    1 
ATOM   4234 C  CZ    . ARG F 3 216 ? -13.959 -3.142  -23.323 1.00 31.90 ? 217 ARG B CZ    1 
ATOM   4235 N  NH1   . ARG F 3 216 ? -13.961 -3.615  -24.564 1.00 28.88 ? 217 ARG B NH1   1 
ATOM   4236 N  NH2   . ARG F 3 216 ? -13.808 -1.843  -23.106 1.00 28.57 ? 217 ARG B NH2   1 
ATOM   4237 N  N     . ASN F 3 217 ? -14.014 -10.689 -20.186 1.00 19.76 ? 218 ASN B N     1 
ATOM   4238 C  CA    . ASN F 3 217 ? -14.758 -11.948 -20.117 1.00 22.18 ? 218 ASN B CA    1 
ATOM   4239 C  C     . ASN F 3 217 ? -14.093 -13.033 -19.278 1.00 20.60 ? 218 ASN B C     1 
ATOM   4240 O  O     . ASN F 3 217 ? -14.558 -14.175 -19.237 1.00 20.98 ? 218 ASN B O     1 
ATOM   4241 C  CB    . ASN F 3 217 ? -15.033 -12.471 -21.537 1.00 17.44 ? 218 ASN B CB    1 
ATOM   4242 C  CG    . ASN F 3 217 ? -15.966 -11.561 -22.315 1.00 21.68 ? 218 ASN B CG    1 
ATOM   4243 O  OD1   . ASN F 3 217 ? -17.178 -11.597 -22.134 1.00 25.24 ? 218 ASN B OD1   1 
ATOM   4244 N  ND2   . ASN F 3 217 ? -15.400 -10.733 -23.183 1.00 20.90 ? 218 ASN B ND2   1 
ATOM   4245 N  N     . TYR F 3 218 ? -13.006 -12.677 -18.610 1.00 16.50 ? 219 TYR B N     1 
ATOM   4246 C  CA    . TYR F 3 218 ? -12.287 -13.608 -17.760 1.00 19.08 ? 219 TYR B CA    1 
ATOM   4247 C  C     . TYR F 3 218 ? -13.115 -13.831 -16.476 1.00 22.54 ? 219 TYR B C     1 
ATOM   4248 O  O     . TYR F 3 218 ? -13.590 -12.867 -15.876 1.00 24.08 ? 219 TYR B O     1 
ATOM   4249 C  CB    . TYR F 3 218 ? -10.928 -12.998 -17.432 1.00 17.16 ? 219 TYR B CB    1 
ATOM   4250 C  CG    . TYR F 3 218 ? -9.970  -13.879 -16.658 1.00 16.68 ? 219 TYR B CG    1 
ATOM   4251 C  CD1   . TYR F 3 218 ? -9.136  -14.783 -17.318 1.00 14.72 ? 219 TYR B CD1   1 
ATOM   4252 C  CD2   . TYR F 3 218 ? -9.848  -13.765 -15.268 1.00 13.40 ? 219 TYR B CD2   1 
ATOM   4253 C  CE1   . TYR F 3 218 ? -8.196  -15.546 -16.615 1.00 18.04 ? 219 TYR B CE1   1 
ATOM   4254 C  CE2   . TYR F 3 218 ? -8.909  -14.525 -14.559 1.00 13.33 ? 219 TYR B CE2   1 
ATOM   4255 C  CZ    . TYR F 3 218 ? -8.087  -15.404 -15.234 1.00 15.97 ? 219 TYR B CZ    1 
ATOM   4256 O  OH    . TYR F 3 218 ? -7.128  -16.111 -14.550 1.00 21.24 ? 219 TYR B OH    1 
ATOM   4257 N  N     . GLU F 3 219 ? -13.305 -15.086 -16.066 1.00 20.64 ? 220 GLU B N     1 
ATOM   4258 C  CA    . GLU F 3 219 ? -14.070 -15.380 -14.847 1.00 24.88 ? 220 GLU B CA    1 
ATOM   4259 C  C     . GLU F 3 219 ? -13.167 -15.332 -13.603 1.00 26.08 ? 220 GLU B C     1 
ATOM   4260 O  O     . GLU F 3 219 ? -11.968 -15.600 -13.696 1.00 25.12 ? 220 GLU B O     1 
ATOM   4261 C  CB    . GLU F 3 219 ? -14.732 -16.758 -14.944 1.00 26.90 ? 220 GLU B CB    1 
ATOM   4262 C  CG    . GLU F 3 219 ? -15.741 -16.918 -16.061 1.00 25.95 ? 220 GLU B CG    1 
ATOM   4263 C  CD    . GLU F 3 219 ? -17.006 -16.115 -15.846 1.00 35.11 ? 220 GLU B CD    1 
ATOM   4264 O  OE1   . GLU F 3 219 ? -17.416 -15.927 -14.682 1.00 41.59 ? 220 GLU B OE1   1 
ATOM   4265 O  OE2   . GLU F 3 219 ? -17.598 -15.670 -16.849 1.00 37.29 ? 220 GLU B OE2   1 
ATOM   4266 N  N     . ARG F 3 220 ? -13.759 -15.006 -12.451 1.00 28.68 ? 221 ARG B N     1 
ATOM   4267 C  CA    . ARG F 3 220 ? -13.048 -14.878 -11.171 1.00 31.28 ? 221 ARG B CA    1 
ATOM   4268 C  C     . ARG F 3 220 ? -12.417 -16.135 -10.557 1.00 33.57 ? 221 ARG B C     1 
ATOM   4269 O  O     . ARG F 3 220 ? -11.304 -16.080 -10.034 1.00 35.70 ? 221 ARG B O     1 
ATOM   4270 C  CB    . ARG F 3 220 ? -13.974 -14.233 -10.131 1.00 34.28 ? 221 ARG B CB    1 
ATOM   4271 C  CG    . ARG F 3 220 ? -14.375 -12.812 -10.459 1.00 32.71 ? 221 ARG B CG    1 
ATOM   4272 C  CD    . ARG F 3 220 ? -15.424 -12.288 -9.502  1.00 37.77 ? 221 ARG B CD    1 
ATOM   4273 N  NE    . ARG F 3 220 ? -15.823 -10.915 -9.822  1.00 46.25 ? 221 ARG B NE    1 
ATOM   4274 C  CZ    . ARG F 3 220 ? -16.539 -10.562 -10.892 1.00 51.32 ? 221 ARG B CZ    1 
ATOM   4275 N  NH1   . ARG F 3 220 ? -16.944 -11.475 -11.768 1.00 57.34 ? 221 ARG B NH1   1 
ATOM   4276 N  NH2   . ARG F 3 220 ? -16.855 -9.288  -11.094 1.00 52.91 ? 221 ARG B NH2   1 
ATOM   4277 N  N     . THR F 3 221 ? -13.123 -17.259 -10.603 1.00 36.53 ? 222 THR B N     1 
ATOM   4278 C  CA    . THR F 3 221 ? -12.609 -18.508 -10.033 1.00 38.83 ? 222 THR B CA    1 
ATOM   4279 C  C     . THR F 3 221 ? -12.332 -19.529 -11.125 1.00 39.04 ? 222 THR B C     1 
ATOM   4280 O  O     . THR F 3 221 ? -12.953 -19.476 -12.196 1.00 35.37 ? 222 THR B O     1 
ATOM   4281 C  CB    . THR F 3 221 ? -13.613 -19.132 -9.051  1.00 39.98 ? 222 THR B CB    1 
ATOM   4282 O  OG1   . THR F 3 221 ? -14.896 -19.245 -9.684  1.00 42.35 ? 222 THR B OG1   1 
ATOM   4283 C  CG2   . THR F 3 221 ? -13.732 -18.274 -7.801  1.00 40.90 ? 222 THR B CG2   1 
ATOM   4284 N  N     . SER F 3 222 ? -11.416 -20.458 -10.857 1.00 37.71 ? 223 SER B N     1 
ATOM   4285 C  CA    . SER F 3 222 ? -11.082 -21.485 -11.839 1.00 44.15 ? 223 SER B CA    1 
ATOM   4286 C  C     . SER F 3 222 ? -12.307 -22.352 -12.141 1.00 45.64 ? 223 SER B C     1 
ATOM   4287 O  O     . SER F 3 222 ? -12.451 -22.876 -13.245 1.00 45.76 ? 223 SER B O     1 
ATOM   4288 C  CB    . SER F 3 222 ? -9.925  -22.346 -11.342 1.00 41.82 ? 223 SER B CB    1 
ATOM   4289 O  OG    . SER F 3 222 ? -10.229 -22.880 -10.074 1.00 50.16 ? 223 SER B OG    1 
ATOM   4290 N  N     . GLN F 3 223 ? -13.193 -22.490 -11.160 1.00 47.75 ? 224 GLN B N     1 
ATOM   4291 C  CA    . GLN F 3 223 ? -14.404 -23.280 -11.334 1.00 50.12 ? 224 GLN B CA    1 
ATOM   4292 C  C     . GLN F 3 223 ? -15.213 -22.720 -12.509 1.00 48.41 ? 224 GLN B C     1 
ATOM   4293 O  O     . GLN F 3 223 ? -15.629 -23.462 -13.397 1.00 47.57 ? 224 GLN B O     1 
ATOM   4294 C  CB    . GLN F 3 223 ? -15.240 -23.262 -10.047 1.00 59.12 ? 224 GLN B CB    1 
ATOM   4295 C  CG    . GLN F 3 223 ? -16.390 -24.269 -10.041 1.00 70.83 ? 224 GLN B CG    1 
ATOM   4296 C  CD    . GLN F 3 223 ? -17.257 -24.184 -8.792  1.00 82.86 ? 224 GLN B CD    1 
ATOM   4297 O  OE1   . GLN F 3 223 ? -16.846 -24.594 -7.703  1.00 91.63 ? 224 GLN B OE1   1 
ATOM   4298 N  NE2   . GLN F 3 223 ? -18.464 -23.651 -8.945  1.00 86.04 ? 224 GLN B NE2   1 
ATOM   4299 N  N     . LEU F 3 224 ? -15.429 -21.409 -12.510 1.00 47.19 ? 225 LEU B N     1 
ATOM   4300 C  CA    . LEU F 3 224 ? -16.176 -20.761 -13.583 1.00 46.66 ? 225 LEU B CA    1 
ATOM   4301 C  C     . LEU F 3 224 ? -15.367 -20.676 -14.872 1.00 44.63 ? 225 LEU B C     1 
ATOM   4302 O  O     . LEU F 3 224 ? -15.925 -20.691 -15.968 1.00 45.75 ? 225 LEU B O     1 
ATOM   4303 C  CB    . LEU F 3 224 ? -16.606 -19.366 -13.147 1.00 46.22 ? 225 LEU B CB    1 
ATOM   4304 C  CG    . LEU F 3 224 ? -17.678 -19.381 -12.059 1.00 53.86 ? 225 LEU B CG    1 
ATOM   4305 C  CD1   . LEU F 3 224 ? -17.822 -17.999 -11.459 1.00 57.62 ? 225 LEU B CD1   1 
ATOM   4306 C  CD2   . LEU F 3 224 ? -18.995 -19.865 -12.645 1.00 51.28 ? 225 LEU B CD2   1 
ATOM   4307 N  N     . ARG F 3 225 ? -14.049 -20.591 -14.732 1.00 42.77 ? 226 ARG B N     1 
ATOM   4308 C  CA    . ARG F 3 225 ? -13.158 -20.497 -15.875 1.00 40.83 ? 226 ARG B CA    1 
ATOM   4309 C  C     . ARG F 3 225 ? -13.015 -21.786 -16.666 1.00 43.14 ? 226 ARG B C     1 
ATOM   4310 O  O     . ARG F 3 225 ? -12.810 -21.743 -17.880 1.00 42.78 ? 226 ARG B O     1 
ATOM   4311 C  CB    . ARG F 3 225 ? -11.770 -20.041 -15.440 1.00 35.51 ? 226 ARG B CB    1 
ATOM   4312 C  CG    . ARG F 3 225 ? -11.658 -18.567 -15.143 1.00 28.99 ? 226 ARG B CG    1 
ATOM   4313 C  CD    . ARG F 3 225 ? -10.222 -18.093 -15.286 1.00 25.53 ? 226 ARG B CD    1 
ATOM   4314 N  NE    . ARG F 3 225 ? -9.292  -18.687 -14.321 1.00 27.65 ? 226 ARG B NE    1 
ATOM   4315 C  CZ    . ARG F 3 225 ? -9.185  -18.318 -13.044 1.00 32.22 ? 226 ARG B CZ    1 
ATOM   4316 N  NH1   . ARG F 3 225 ? -9.965  -17.364 -12.546 1.00 26.59 ? 226 ARG B NH1   1 
ATOM   4317 N  NH2   . ARG F 3 225 ? -8.300  -18.909 -12.252 1.00 32.42 ? 226 ARG B NH2   1 
ATOM   4318 N  N     . ASN F 3 226 ? -13.118 -22.931 -15.998 1.00 42.84 ? 227 ASN B N     1 
ATOM   4319 C  CA    . ASN F 3 226 ? -12.965 -24.212 -16.685 1.00 45.90 ? 227 ASN B CA    1 
ATOM   4320 C  C     . ASN F 3 226 ? -14.000 -24.509 -17.761 1.00 45.37 ? 227 ASN B C     1 
ATOM   4321 O  O     . ASN F 3 226 ? -13.818 -25.417 -18.572 1.00 47.74 ? 227 ASN B O     1 
ATOM   4322 C  CB    . ASN F 3 226 ? -12.891 -25.359 -15.683 1.00 49.27 ? 227 ASN B CB    1 
ATOM   4323 C  CG    . ASN F 3 226 ? -11.482 -25.571 -15.158 1.00 58.53 ? 227 ASN B CG    1 
ATOM   4324 O  OD1   . ASN F 3 226 ? -10.563 -24.819 -15.493 1.00 59.75 ? 227 ASN B OD1   1 
ATOM   4325 N  ND2   . ASN F 3 226 ? -11.301 -26.597 -14.334 1.00 64.80 ? 227 ASN B ND2   1 
ATOM   4326 N  N     . ASP F 3 227 ? -15.082 -23.741 -17.770 1.00 44.88 ? 228 ASP B N     1 
ATOM   4327 C  CA    . ASP F 3 227 ? -16.124 -23.906 -18.771 1.00 45.72 ? 228 ASP B CA    1 
ATOM   4328 C  C     . ASP F 3 227 ? -16.070 -22.794 -19.811 1.00 43.22 ? 228 ASP B C     1 
ATOM   4329 O  O     . ASP F 3 227 ? -16.911 -22.737 -20.710 1.00 46.34 ? 228 ASP B O     1 
ATOM   4330 C  CB    . ASP F 3 227 ? -17.496 -23.927 -18.104 1.00 54.79 ? 228 ASP B CB    1 
ATOM   4331 C  CG    . ASP F 3 227 ? -17.697 -25.159 -17.255 1.00 67.80 ? 228 ASP B CG    1 
ATOM   4332 O  OD1   . ASP F 3 227 ? -17.485 -26.280 -17.775 1.00 71.92 ? 228 ASP B OD1   1 
ATOM   4333 O  OD2   . ASP F 3 227 ? -18.062 -25.004 -16.070 1.00 75.62 ? 228 ASP B OD2   1 
ATOM   4334 N  N     . LYS F 3 228 ? -15.080 -21.914 -19.680 1.00 36.74 ? 229 LYS B N     1 
ATOM   4335 C  CA    . LYS F 3 228 ? -14.901 -20.794 -20.598 1.00 32.54 ? 229 LYS B CA    1 
ATOM   4336 C  C     . LYS F 3 228 ? -13.472 -20.862 -21.129 1.00 28.05 ? 229 LYS B C     1 
ATOM   4337 O  O     . LYS F 3 228 ? -13.230 -21.436 -22.188 1.00 30.14 ? 229 LYS B O     1 
ATOM   4338 C  CB    . LYS F 3 228 ? -15.154 -19.476 -19.864 1.00 34.27 ? 229 LYS B CB    1 
ATOM   4339 C  CG    . LYS F 3 228 ? -16.008 -18.490 -20.623 1.00 29.44 ? 229 LYS B CG    1 
ATOM   4340 C  CD    . LYS F 3 228 ? -16.301 -17.291 -19.762 1.00 33.47 ? 229 LYS B CD    1 
ATOM   4341 C  CE    . LYS F 3 228 ? -17.043 -16.233 -20.529 1.00 32.35 ? 229 LYS B CE    1 
ATOM   4342 N  NZ    . LYS F 3 228 ? -17.226 -15.017 -19.708 1.00 33.63 ? 229 LYS B NZ    1 
ATOM   4343 N  N     . TYR F 3 229 ? -12.530 -20.282 -20.393 1.00 22.26 ? 230 TYR B N     1 
ATOM   4344 C  CA    . TYR F 3 229 ? -11.119 -20.310 -20.776 1.00 21.23 ? 230 TYR B CA    1 
ATOM   4345 C  C     . TYR F 3 229 ? -10.236 -19.911 -19.602 1.00 20.96 ? 230 TYR B C     1 
ATOM   4346 O  O     . TYR F 3 229 ? -10.632 -19.079 -18.775 1.00 18.49 ? 230 TYR B O     1 
ATOM   4347 C  CB    . TYR F 3 229 ? -10.837 -19.390 -21.984 1.00 17.42 ? 230 TYR B CB    1 
ATOM   4348 C  CG    . TYR F 3 229 ? -11.245 -17.931 -21.833 1.00 12.90 ? 230 TYR B CG    1 
ATOM   4349 C  CD1   . TYR F 3 229 ? -10.359 -16.987 -21.310 1.00 10.97 ? 230 TYR B CD1   1 
ATOM   4350 C  CD2   . TYR F 3 229 ? -12.503 -17.496 -22.235 1.00 9.99  ? 230 TYR B CD2   1 
ATOM   4351 C  CE1   . TYR F 3 229 ? -10.718 -15.648 -21.194 1.00 8.13  ? 230 TYR B CE1   1 
ATOM   4352 C  CE2   . TYR F 3 229 ? -12.873 -16.158 -22.125 1.00 15.53 ? 230 TYR B CE2   1 
ATOM   4353 C  CZ    . TYR F 3 229 ? -11.969 -15.244 -21.603 1.00 16.70 ? 230 TYR B CZ    1 
ATOM   4354 O  OH    . TYR F 3 229 ? -12.313 -13.922 -21.500 1.00 14.24 ? 230 TYR B OH    1 
ATOM   4355 N  N     . ASN F 3 230 ? -9.048  -20.509 -19.544 1.00 20.42 ? 231 ASN B N     1 
ATOM   4356 C  CA    . ASN F 3 230 ? -8.069  -20.243 -18.489 1.00 22.99 ? 231 ASN B CA    1 
ATOM   4357 C  C     . ASN F 3 230 ? -6.791  -19.621 -19.040 1.00 22.83 ? 231 ASN B C     1 
ATOM   4358 O  O     . ASN F 3 230 ? -5.901  -19.256 -18.275 1.00 24.58 ? 231 ASN B O     1 
ATOM   4359 C  CB    . ASN F 3 230 ? -7.683  -21.538 -17.754 1.00 32.56 ? 231 ASN B CB    1 
ATOM   4360 C  CG    . ASN F 3 230 ? -8.830  -22.129 -16.956 1.00 45.19 ? 231 ASN B CG    1 
ATOM   4361 O  OD1   . ASN F 3 230 ? -9.196  -21.617 -15.898 1.00 56.18 ? 231 ASN B OD1   1 
ATOM   4362 N  ND2   . ASN F 3 230 ? -9.403  -23.216 -17.462 1.00 54.68 ? 231 ASN B ND2   1 
ATOM   4363 N  N     . ASN F 3 231 ? -6.686  -19.511 -20.361 1.00 21.18 ? 232 ASN B N     1 
ATOM   4364 C  CA    . ASN F 3 231 ? -5.492  -18.937 -20.983 1.00 18.43 ? 232 ASN B CA    1 
ATOM   4365 C  C     . ASN F 3 231 ? -5.799  -18.465 -22.404 1.00 19.44 ? 232 ASN B C     1 
ATOM   4366 O  O     . ASN F 3 231 ? -6.919  -18.645 -22.889 1.00 20.11 ? 232 ASN B O     1 
ATOM   4367 C  CB    . ASN F 3 231 ? -4.334  -19.947 -20.980 1.00 18.49 ? 232 ASN B CB    1 
ATOM   4368 C  CG    . ASN F 3 231 ? -4.679  -21.248 -21.689 1.00 23.71 ? 232 ASN B CG    1 
ATOM   4369 O  OD1   . ASN F 3 231 ? -5.361  -21.254 -22.711 1.00 24.78 ? 232 ASN B OD1   1 
ATOM   4370 N  ND2   . ASN F 3 231 ? -4.203  -22.355 -21.147 1.00 25.77 ? 232 ASN B ND2   1 
ATOM   4371 N  N     . ILE F 3 232 ? -4.808  -17.867 -23.065 1.00 17.16 ? 233 ILE B N     1 
ATOM   4372 C  CA    . ILE F 3 232 ? -4.984  -17.332 -24.413 1.00 19.51 ? 233 ILE B CA    1 
ATOM   4373 C  C     . ILE F 3 232 ? -5.444  -18.399 -25.438 1.00 20.35 ? 233 ILE B C     1 
ATOM   4374 O  O     . ILE F 3 232 ? -6.352  -18.137 -26.233 1.00 19.45 ? 233 ILE B O     1 
ATOM   4375 C  CB    . ILE F 3 232 ? -3.685  -16.548 -24.870 1.00 22.71 ? 233 ILE B CB    1 
ATOM   4376 C  CG1   . ILE F 3 232 ? -3.986  -15.655 -26.069 1.00 22.70 ? 233 ILE B CG1   1 
ATOM   4377 C  CG2   . ILE F 3 232 ? -2.549  -17.492 -25.196 1.00 18.27 ? 233 ILE B CG2   1 
ATOM   4378 C  CD1   . ILE F 3 232 ? -5.002  -14.599 -25.786 1.00 24.22 ? 233 ILE B CD1   1 
ATOM   4379 N  N     . SER F 3 233 ? -4.840  -19.590 -25.405 1.00 20.57 ? 234 SER B N     1 
ATOM   4380 C  CA    . SER F 3 233 ? -5.205  -20.682 -26.317 1.00 21.16 ? 234 SER B CA    1 
ATOM   4381 C  C     . SER F 3 233 ? -6.681  -21.014 -26.205 1.00 20.96 ? 234 SER B C     1 
ATOM   4382 O  O     . SER F 3 233 ? -7.398  -21.063 -27.203 1.00 21.99 ? 234 SER B O     1 
ATOM   4383 C  CB    . SER F 3 233 ? -4.400  -21.945 -25.998 1.00 21.30 ? 234 SER B CB    1 
ATOM   4384 O  OG    . SER F 3 233 ? -3.014  -21.710 -26.151 1.00 38.09 ? 234 SER B OG    1 
ATOM   4385 N  N     . GLU F 3 234 ? -7.126  -21.241 -24.977 1.00 17.90 ? 235 GLU B N     1 
ATOM   4386 C  CA    . GLU F 3 234 ? -8.511  -21.565 -24.706 1.00 17.45 ? 235 GLU B CA    1 
ATOM   4387 C  C     . GLU F 3 234 ? -9.446  -20.412 -25.017 1.00 18.61 ? 235 GLU B C     1 
ATOM   4388 O  O     . GLU F 3 234 ? -10.622 -20.618 -25.329 1.00 21.05 ? 235 GLU B O     1 
ATOM   4389 C  CB    . GLU F 3 234 ? -8.663  -21.978 -23.252 1.00 22.15 ? 235 GLU B CB    1 
ATOM   4390 C  CG    . GLU F 3 234 ? -7.869  -23.210 -22.925 1.00 20.03 ? 235 GLU B CG    1 
ATOM   4391 C  CD    . GLU F 3 234 ? -8.093  -23.685 -21.512 1.00 29.53 ? 235 GLU B CD    1 
ATOM   4392 O  OE1   . GLU F 3 234 ? -8.984  -23.143 -20.817 1.00 30.98 ? 235 GLU B OE1   1 
ATOM   4393 O  OE2   . GLU F 3 234 ? -7.369  -24.610 -21.095 1.00 32.28 ? 235 GLU B OE2   1 
ATOM   4394 N  N     . TYR F 3 235 ? -8.937  -19.192 -24.927 1.00 15.35 ? 236 TYR B N     1 
ATOM   4395 C  CA    . TYR F 3 235 ? -9.758  -18.036 -25.235 1.00 15.49 ? 236 TYR B CA    1 
ATOM   4396 C  C     . TYR F 3 235 ? -10.038 -18.034 -26.748 1.00 16.11 ? 236 TYR B C     1 
ATOM   4397 O  O     . TYR F 3 235 ? -11.168 -17.815 -27.185 1.00 14.81 ? 236 TYR B O     1 
ATOM   4398 C  CB    . TYR F 3 235 ? -9.030  -16.757 -24.808 1.00 16.53 ? 236 TYR B CB    1 
ATOM   4399 C  CG    . TYR F 3 235 ? -9.549  -15.516 -25.472 1.00 13.39 ? 236 TYR B CG    1 
ATOM   4400 C  CD1   . TYR F 3 235 ? -10.750 -14.932 -25.073 1.00 14.00 ? 236 TYR B CD1   1 
ATOM   4401 C  CD2   . TYR F 3 235 ? -8.841  -14.927 -26.516 1.00 21.78 ? 236 TYR B CD2   1 
ATOM   4402 C  CE1   . TYR F 3 235 ? -11.239 -13.783 -25.703 1.00 17.69 ? 236 TYR B CE1   1 
ATOM   4403 C  CE2   . TYR F 3 235 ? -9.318  -13.781 -27.153 1.00 17.24 ? 236 TYR B CE2   1 
ATOM   4404 C  CZ    . TYR F 3 235 ? -10.507 -13.219 -26.746 1.00 15.37 ? 236 TYR B CZ    1 
ATOM   4405 O  OH    . TYR F 3 235 ? -10.956 -12.098 -27.392 1.00 16.64 ? 236 TYR B OH    1 
ATOM   4406 N  N     . ARG F 3 236 ? -9.005  -18.283 -27.545 1.00 18.15 ? 237 ARG B N     1 
ATOM   4407 C  CA    . ARG F 3 236 ? -9.163  -18.307 -28.998 1.00 22.17 ? 237 ARG B CA    1 
ATOM   4408 C  C     . ARG F 3 236 ? -10.089 -19.439 -29.462 1.00 22.84 ? 237 ARG B C     1 
ATOM   4409 O  O     . ARG F 3 236 ? -10.838 -19.282 -30.434 1.00 20.87 ? 237 ARG B O     1 
ATOM   4410 C  CB    . ARG F 3 236 ? -7.793  -18.372 -29.671 1.00 19.71 ? 237 ARG B CB    1 
ATOM   4411 C  CG    . ARG F 3 236 ? -7.085  -17.027 -29.595 1.00 17.33 ? 237 ARG B CG    1 
ATOM   4412 C  CD    . ARG F 3 236 ? -5.630  -17.096 -29.987 1.00 15.23 ? 237 ARG B CD    1 
ATOM   4413 N  NE    . ARG F 3 236 ? -5.005  -15.783 -29.827 1.00 19.82 ? 237 ARG B NE    1 
ATOM   4414 C  CZ    . ARG F 3 236 ? -3.719  -15.590 -29.542 1.00 19.88 ? 237 ARG B CZ    1 
ATOM   4415 N  NH1   . ARG F 3 236 ? -2.900  -16.622 -29.398 1.00 25.74 ? 237 ARG B NH1   1 
ATOM   4416 N  NH2   . ARG F 3 236 ? -3.246  -14.361 -29.401 1.00 18.41 ? 237 ARG B NH2   1 
ATOM   4417 N  N     . ASN F 3 237 ? -10.047 -20.567 -28.756 1.00 20.29 ? 238 ASN B N     1 
ATOM   4418 C  CA    . ASN F 3 237 ? -10.910 -21.690 -29.079 1.00 20.31 ? 238 ASN B CA    1 
ATOM   4419 C  C     . ASN F 3 237 ? -12.350 -21.325 -28.713 1.00 21.13 ? 238 ASN B C     1 
ATOM   4420 O  O     . ASN F 3 237 ? -13.299 -21.739 -29.384 1.00 21.97 ? 238 ASN B O     1 
ATOM   4421 C  CB    . ASN F 3 237 ? -10.456 -22.940 -28.338 1.00 17.98 ? 238 ASN B CB    1 
ATOM   4422 C  CG    . ASN F 3 237 ? -11.072 -24.197 -28.908 1.00 27.29 ? 238 ASN B CG    1 
ATOM   4423 O  OD1   . ASN F 3 237 ? -12.213 -24.535 -28.602 1.00 24.92 ? 238 ASN B OD1   1 
ATOM   4424 N  ND2   . ASN F 3 237 ? -10.320 -24.896 -29.747 1.00 27.40 ? 238 ASN B ND2   1 
ATOM   4425 N  N     . TRP F 3 238 ? -12.497 -20.536 -27.650 1.00 19.42 ? 239 TRP B N     1 
ATOM   4426 C  CA    . TRP F 3 238 ? -13.792 -20.044 -27.165 1.00 18.94 ? 239 TRP B CA    1 
ATOM   4427 C  C     . TRP F 3 238 ? -14.415 -19.082 -28.199 1.00 19.49 ? 239 TRP B C     1 
ATOM   4428 O  O     . TRP F 3 238 ? -15.636 -19.025 -28.359 1.00 17.34 ? 239 TRP B O     1 
ATOM   4429 C  CB    . TRP F 3 238 ? -13.574 -19.327 -25.823 1.00 19.65 ? 239 TRP B CB    1 
ATOM   4430 C  CG    . TRP F 3 238 ? -14.797 -18.708 -25.198 1.00 18.90 ? 239 TRP B CG    1 
ATOM   4431 C  CD1   . TRP F 3 238 ? -15.821 -19.361 -24.572 1.00 15.90 ? 239 TRP B CD1   1 
ATOM   4432 C  CD2   . TRP F 3 238 ? -15.105 -17.309 -25.115 1.00 12.36 ? 239 TRP B CD2   1 
ATOM   4433 N  NE1   . TRP F 3 238 ? -16.745 -18.456 -24.105 1.00 13.93 ? 239 TRP B NE1   1 
ATOM   4434 C  CE2   . TRP F 3 238 ? -16.329 -17.190 -24.424 1.00 11.89 ? 239 TRP B CE2   1 
ATOM   4435 C  CE3   . TRP F 3 238 ? -14.463 -16.148 -25.559 1.00 20.00 ? 239 TRP B CE3   1 
ATOM   4436 C  CZ2   . TRP F 3 238 ? -16.926 -15.958 -24.166 1.00 15.19 ? 239 TRP B CZ2   1 
ATOM   4437 C  CZ3   . TRP F 3 238 ? -15.057 -14.924 -25.303 1.00 21.46 ? 239 TRP B CZ3   1 
ATOM   4438 C  CH2   . TRP F 3 238 ? -16.275 -14.838 -24.612 1.00 21.74 ? 239 TRP B CH2   1 
ATOM   4439 N  N     . ILE F 3 239 ? -13.568 -18.315 -28.887 1.00 19.12 ? 240 ILE B N     1 
ATOM   4440 C  CA    . ILE F 3 239 ? -14.029 -17.395 -29.932 1.00 19.82 ? 240 ILE B CA    1 
ATOM   4441 C  C     . ILE F 3 239 ? -14.548 -18.256 -31.100 1.00 20.29 ? 240 ILE B C     1 
ATOM   4442 O  O     . ILE F 3 239 ? -15.640 -18.021 -31.620 1.00 20.07 ? 240 ILE B O     1 
ATOM   4443 C  CB    . ILE F 3 239 ? -12.874 -16.466 -30.446 1.00 25.25 ? 240 ILE B CB    1 
ATOM   4444 C  CG1   . ILE F 3 239 ? -12.530 -15.399 -29.396 1.00 17.13 ? 240 ILE B CG1   1 
ATOM   4445 C  CG2   . ILE F 3 239 ? -13.278 -15.787 -31.767 1.00 18.37 ? 240 ILE B CG2   1 
ATOM   4446 C  CD1   . ILE F 3 239 ? -13.706 -14.510 -29.023 1.00 21.06 ? 240 ILE B CD1   1 
ATOM   4447 N  N     . TYR F 3 240 ? -13.758 -19.256 -31.495 1.00 19.72 ? 241 TYR B N     1 
ATOM   4448 C  CA    . TYR F 3 240 ? -14.130 -20.162 -32.576 1.00 18.86 ? 241 TYR B CA    1 
ATOM   4449 C  C     . TYR F 3 240 ? -15.488 -20.800 -32.289 1.00 20.05 ? 241 TYR B C     1 
ATOM   4450 O  O     . TYR F 3 240 ? -16.345 -20.874 -33.173 1.00 20.95 ? 241 TYR B O     1 
ATOM   4451 C  CB    . TYR F 3 240 ? -13.057 -21.249 -32.755 1.00 22.21 ? 241 TYR B CB    1 
ATOM   4452 C  CG    . TYR F 3 240 ? -13.562 -22.481 -33.473 1.00 29.79 ? 241 TYR B CG    1 
ATOM   4453 C  CD1   . TYR F 3 240 ? -13.664 -22.511 -34.867 1.00 31.04 ? 241 TYR B CD1   1 
ATOM   4454 C  CD2   . TYR F 3 240 ? -13.980 -23.601 -32.755 1.00 22.98 ? 241 TYR B CD2   1 
ATOM   4455 C  CE1   . TYR F 3 240 ? -14.173 -23.622 -35.520 1.00 25.68 ? 241 TYR B CE1   1 
ATOM   4456 C  CE2   . TYR F 3 240 ? -14.490 -24.712 -33.395 1.00 24.28 ? 241 TYR B CE2   1 
ATOM   4457 C  CZ    . TYR F 3 240 ? -14.586 -24.718 -34.779 1.00 27.02 ? 241 TYR B CZ    1 
ATOM   4458 O  OH    . TYR F 3 240 ? -15.106 -25.816 -35.418 1.00 19.41 ? 241 TYR B OH    1 
ATOM   4459 N  N     . ARG F 3 241 ? -15.681 -21.247 -31.048 1.00 19.96 ? 242 ARG B N     1 
ATOM   4460 C  CA    . ARG F 3 241 ? -16.919 -21.893 -30.614 1.00 19.03 ? 242 ARG B CA    1 
ATOM   4461 C  C     . ARG F 3 241 ? -18.158 -21.015 -30.682 1.00 21.71 ? 242 ARG B C     1 
ATOM   4462 O  O     . ARG F 3 241 ? -19.286 -21.516 -30.576 1.00 26.62 ? 242 ARG B O     1 
ATOM   4463 C  CB    . ARG F 3 241 ? -16.757 -22.431 -29.192 1.00 20.14 ? 242 ARG B CB    1 
ATOM   4464 C  CG    . ARG F 3 241 ? -16.400 -23.899 -29.117 1.00 25.69 ? 242 ARG B CG    1 
ATOM   4465 C  CD    . ARG F 3 241 ? -15.462 -24.203 -27.961 1.00 31.97 ? 242 ARG B CD    1 
ATOM   4466 N  NE    . ARG F 3 241 ? -15.845 -23.552 -26.706 1.00 31.14 ? 242 ARG B NE    1 
ATOM   4467 C  CZ    . ARG F 3 241 ? -14.975 -23.245 -25.748 1.00 28.43 ? 242 ARG B CZ    1 
ATOM   4468 N  NH1   . ARG F 3 241 ? -13.692 -23.532 -25.907 1.00 25.94 ? 242 ARG B NH1   1 
ATOM   4469 N  NH2   . ARG F 3 241 ? -15.374 -22.653 -24.631 1.00 33.77 ? 242 ARG B NH2   1 
ATOM   4470 N  N     . GLY F 3 242 ? -17.962 -19.713 -30.860 1.00 20.31 ? 243 GLY B N     1 
ATOM   4471 C  CA    . GLY F 3 242 ? -19.094 -18.806 -30.936 1.00 21.21 ? 243 GLY B CA    1 
ATOM   4472 C  C     . GLY F 3 242 ? -19.362 -18.095 -29.627 1.00 25.78 ? 243 GLY B C     1 
ATOM   4473 O  O     . GLY F 3 242 ? -20.483 -17.641 -29.383 1.00 26.27 ? 243 GLY B O     1 
ATOM   4474 N  N     . ARG F 3 243 ? -18.322 -18.005 -28.794 1.00 28.70 ? 244 ARG B N     1 
ATOM   4475 C  CA    . ARG F 3 243 ? -18.372 -17.345 -27.482 1.00 31.70 ? 244 ARG B CA    1 
ATOM   4476 C  C     . ARG F 3 243 ? -19.387 -17.984 -26.535 1.00 32.46 ? 244 ARG B C     1 
ATOM   4477 O  O     . ARG F 3 243 ? -20.199 -17.311 -25.895 1.00 30.48 ? 244 ARG B O     1 
ATOM   4478 C  CB    . ARG F 3 243 ? -18.618 -15.837 -27.647 1.00 25.84 ? 244 ARG B CB    1 
ATOM   4479 C  CG    . ARG F 3 243 ? -17.600 -15.186 -28.588 1.00 32.13 ? 244 ARG B CG    1 
ATOM   4480 C  CD    . ARG F 3 243 ? -17.952 -13.756 -28.934 1.00 28.06 ? 244 ARG B CD    1 
ATOM   4481 N  NE    . ARG F 3 243 ? -17.834 -12.890 -27.771 1.00 30.07 ? 244 ARG B NE    1 
ATOM   4482 C  CZ    . ARG F 3 243 ? -16.725 -12.237 -27.426 1.00 34.95 ? 244 ARG B CZ    1 
ATOM   4483 N  NH1   . ARG F 3 243 ? -15.622 -12.341 -28.160 1.00 29.72 ? 244 ARG B NH1   1 
ATOM   4484 N  NH2   . ARG F 3 243 ? -16.721 -11.473 -26.340 1.00 28.81 ? 244 ARG B NH2   1 
ATOM   4485 N  N     . LYS F 3 244 ? -19.310 -19.308 -26.470 1.00 36.27 ? 245 LYS B N     1 
ATOM   4486 C  CA    . LYS F 3 244 ? -20.153 -20.132 -25.618 1.00 40.23 ? 245 LYS B CA    1 
ATOM   4487 C  C     . LYS F 3 244 ? -19.426 -21.471 -25.468 1.00 42.86 ? 245 LYS B C     1 
ATOM   4488 O  O     . LYS F 3 244 ? -18.459 -21.709 -26.233 1.00 43.30 ? 245 LYS B O     1 
ATOM   4489 C  CB    . LYS F 3 244 ? -21.554 -20.326 -26.236 1.00 44.19 ? 245 LYS B CB    1 
ATOM   4490 C  CG    . LYS F 3 244 ? -21.638 -21.244 -27.464 1.00 47.36 ? 245 LYS B CG    1 
ATOM   4491 C  CD    . LYS F 3 244 ? -23.036 -21.207 -28.085 1.00 46.94 ? 245 LYS B CD    1 
ATOM   4492 C  CE    . LYS F 3 244 ? -23.334 -19.830 -28.665 1.00 57.97 ? 245 LYS B CE    1 
ATOM   4493 N  NZ    . LYS F 3 244 ? -24.691 -19.719 -29.266 1.00 62.99 ? 245 LYS B NZ    1 
ATOM   4494 O  OXT   . LYS F 3 244 ? -19.818 -22.262 -24.587 1.00 48.92 ? 245 LYS B OXT   1 
HETATM 4495 MG MG    . MG  G 4 .   ? 4.327   -6.139  5.190   1.00 47.06 ? 402 MG  D MG    1 
HETATM 4496 MG MG    . MG  H 4 .   ? -4.797  5.121   -4.749  1.00 21.26 ? 404 MG  F MG    1 
HETATM 4497 MG MG    . MG  I 4 .   ? 2.618   -1.942  8.833   1.00 24.11 ? 401 MG  A MG    1 
HETATM 4498 MG MG    . MG  J 4 .   ? 0.038   4.273   -8.304  1.00 14.75 ? 403 MG  B MG    1 
HETATM 4499 O  O     . HOH K 5 .   ? -3.371  -8.602  9.933   1.00 27.33 ? 17  HOH C O     1 
HETATM 4500 O  O     . HOH K 5 .   ? -4.945  -7.350  6.030   1.00 29.13 ? 21  HOH C O     1 
HETATM 4501 O  O     . HOH K 5 .   ? 2.168   -7.637  0.083   1.00 22.88 ? 64  HOH C O     1 
HETATM 4502 O  O     . HOH K 5 .   ? -10.121 -15.057 -2.286  1.00 36.57 ? 85  HOH C O     1 
HETATM 4503 O  O     . HOH K 5 .   ? -3.291  -15.137 -8.930  1.00 37.43 ? 95  HOH C O     1 
HETATM 4504 O  O     . HOH K 5 .   ? -10.184 -15.921 -5.757  1.00 33.26 ? 110 HOH C O     1 
HETATM 4505 O  O     . HOH K 5 .   ? -8.716  -17.236 -7.611  1.00 36.43 ? 154 HOH C O     1 
HETATM 4506 O  O     . HOH K 5 .   ? -1.690  -6.431  9.645   1.00 46.47 ? 176 HOH C O     1 
HETATM 4507 O  O     . HOH K 5 .   ? -2.565  -16.450 1.523   1.00 45.59 ? 194 HOH C O     1 
HETATM 4508 O  O     . HOH K 5 .   ? -12.173 -13.714 -3.509  1.00 33.57 ? 206 HOH C O     1 
HETATM 4509 O  O     . HOH L 5 .   ? -9.529  3.206   7.506   1.00 35.97 ? 54  HOH D O     1 
HETATM 4510 O  O     . HOH L 5 .   ? -7.273  2.790   -1.094  1.00 25.16 ? 82  HOH D O     1 
HETATM 4511 O  O     . HOH L 5 .   ? -11.273 4.852   5.516   1.00 33.54 ? 106 HOH D O     1 
HETATM 4512 O  O     . HOH L 5 .   ? -2.155  1.834   0.294   1.00 22.88 ? 127 HOH D O     1 
HETATM 4513 O  O     . HOH L 5 .   ? 0.384   2.886   8.640   1.00 21.63 ? 147 HOH D O     1 
HETATM 4514 O  O     . HOH L 5 .   ? 0.971   -3.087  9.280   1.00 23.94 ? 153 HOH D O     1 
HETATM 4515 O  O     . HOH L 5 .   ? -12.068 1.894   7.041   1.00 32.32 ? 156 HOH D O     1 
HETATM 4516 O  O     . HOH L 5 .   ? 5.691   -6.534  6.690   1.00 31.32 ? 184 HOH D O     1 
HETATM 4517 O  O     . HOH L 5 .   ? 1.541   -4.214  2.090   1.00 21.97 ? 212 HOH D O     1 
HETATM 4518 O  O     . HOH L 5 .   ? 2.873   -7.325  6.429   1.00 28.31 ? 240 HOH D O     1 
HETATM 4519 O  O     . HOH L 5 .   ? -3.583  -5.301  5.040   1.00 37.63 ? 294 HOH D O     1 
HETATM 4520 O  O     . HOH L 5 .   ? 5.709   -5.268  3.830   1.00 45.51 ? 299 HOH D O     1 
HETATM 4521 O  O     . HOH M 5 .   ? -9.866  -5.072  -8.088  1.00 21.54 ? 7   HOH E O     1 
HETATM 4522 O  O     . HOH M 5 .   ? -13.471 -7.403  -7.509  1.00 25.12 ? 8   HOH E O     1 
HETATM 4523 O  O     . HOH M 5 .   ? -6.780  -0.789  -11.808 1.00 17.51 ? 9   HOH E O     1 
HETATM 4524 O  O     . HOH M 5 .   ? -15.926 -8.547  -1.963  1.00 46.15 ? 10  HOH E O     1 
HETATM 4525 O  O     . HOH M 5 .   ? -18.984 -8.328  2.746   1.00 37.33 ? 11  HOH E O     1 
HETATM 4526 O  O     . HOH M 5 .   ? -23.835 -11.687 1.804   1.00 39.28 ? 12  HOH E O     1 
HETATM 4527 O  O     . HOH M 5 .   ? -16.700 -4.600  4.998   1.00 43.63 ? 13  HOH E O     1 
HETATM 4528 O  O     . HOH M 5 .   ? -18.776 -1.983  -3.447  1.00 31.58 ? 14  HOH E O     1 
HETATM 4529 O  O     . HOH M 5 .   ? -14.636 1.596   -4.261  1.00 32.31 ? 15  HOH E O     1 
HETATM 4530 O  O     . HOH M 5 .   ? -16.062 -0.866  -4.526  1.00 32.60 ? 16  HOH E O     1 
HETATM 4531 O  O     . HOH M 5 .   ? -18.118 -7.603  5.325   1.00 36.17 ? 17  HOH E O     1 
HETATM 4532 O  O     . HOH M 5 .   ? -22.553 -2.763  -0.163  1.00 41.26 ? 18  HOH E O     1 
HETATM 4533 O  O     . HOH M 5 .   ? -24.156 -7.770  7.755   1.00 39.30 ? 19  HOH E O     1 
HETATM 4534 O  O     . HOH M 5 .   ? -17.199 -9.298  0.927   1.00 46.45 ? 20  HOH E O     1 
HETATM 4535 O  O     . HOH N 5 .   ? 5.261   -10.748 -6.502  1.00 34.42 ? 120 HOH F O     1 
HETATM 4536 O  O     . HOH N 5 .   ? -4.521  7.022   -6.023  1.00 22.25 ? 126 HOH F O     1 
HETATM 4537 O  O     . HOH N 5 .   ? 4.554   1.618   -7.594  1.00 24.05 ? 151 HOH F O     1 
HETATM 4538 O  O     . HOH N 5 .   ? 3.550   -4.726  -1.064  1.00 40.75 ? 186 HOH F O     1 
HETATM 4539 O  O     . HOH N 5 .   ? 1.665   -2.672  -0.189  1.00 31.04 ? 197 HOH F O     1 
HETATM 4540 O  O     . HOH N 5 .   ? -3.244  2.211   -2.401  1.00 21.03 ? 275 HOH F O     1 
HETATM 4541 O  O     . HOH N 5 .   ? -1.372  3.057   -9.299  1.00 12.24 ? 291 HOH F O     1 
HETATM 4542 O  O     . HOH O 5 .   ? -3.019  -6.414  23.693  1.00 21.41 ? 402 HOH A O     1 
HETATM 4543 O  O     . HOH O 5 .   ? -15.098 -8.818  5.583   1.00 17.98 ? 403 HOH A O     1 
HETATM 4544 O  O     . HOH O 5 .   ? -5.011  -6.798  21.848  1.00 16.35 ? 404 HOH A O     1 
HETATM 4545 O  O     . HOH O 5 .   ? -6.068  -12.872 11.874  1.00 15.56 ? 405 HOH A O     1 
HETATM 4546 O  O     . HOH O 5 .   ? -7.079  -10.588 5.196   1.00 23.09 ? 406 HOH A O     1 
HETATM 4547 O  O     . HOH O 5 .   ? -6.237  2.077   8.840   1.00 25.25 ? 407 HOH A O     1 
HETATM 4548 O  O     . HOH O 5 .   ? -13.561 -2.578  21.771  1.00 21.50 ? 408 HOH A O     1 
HETATM 4549 O  O     . HOH O 5 .   ? -9.694  -13.707 3.395   1.00 25.94 ? 409 HOH A O     1 
HETATM 4550 O  O     . HOH O 5 .   ? -21.297 -13.832 12.605  1.00 19.80 ? 410 HOH A O     1 
HETATM 4551 O  O     . HOH O 5 .   ? -7.685  -12.268 7.180   1.00 27.51 ? 411 HOH A O     1 
HETATM 4552 O  O     . HOH O 5 .   ? -1.500  -13.343 21.509  1.00 21.98 ? 412 HOH A O     1 
HETATM 4553 O  O     . HOH O 5 .   ? -15.882 -10.861 2.854   1.00 28.90 ? 413 HOH A O     1 
HETATM 4554 O  O     . HOH O 5 .   ? -11.652 -5.739  -6.180  1.00 20.25 ? 414 HOH A O     1 
HETATM 4555 O  O     . HOH O 5 .   ? -17.562 -16.975 6.586   1.00 37.29 ? 415 HOH A O     1 
HETATM 4556 O  O     . HOH O 5 .   ? 13.076  4.298   9.335   1.00 19.76 ? 416 HOH A O     1 
HETATM 4557 O  O     . HOH O 5 .   ? 7.769   -8.608  13.584  1.00 19.76 ? 417 HOH A O     1 
HETATM 4558 O  O     . HOH O 5 .   ? 6.132   17.362  0.762   1.00 17.40 ? 418 HOH A O     1 
HETATM 4559 O  O     . HOH O 5 .   ? -12.831 0.374   9.566   1.00 30.82 ? 419 HOH A O     1 
HETATM 4560 O  O     . HOH O 5 .   ? -12.014 -16.366 23.654  1.00 40.93 ? 420 HOH A O     1 
HETATM 4561 O  O     . HOH O 5 .   ? -4.591  -3.867  7.056   1.00 30.31 ? 421 HOH A O     1 
HETATM 4562 O  O     . HOH O 5 .   ? -16.576 -4.031  31.146  1.00 23.53 ? 422 HOH A O     1 
HETATM 4563 O  O     . HOH O 5 .   ? -22.468 -19.741 25.432  1.00 26.37 ? 423 HOH A O     1 
HETATM 4564 O  O     . HOH O 5 .   ? -2.610  -10.432 23.990  1.00 40.17 ? 424 HOH A O     1 
HETATM 4565 O  O     . HOH O 5 .   ? -8.716  -8.622  28.597  1.00 27.10 ? 425 HOH A O     1 
HETATM 4566 O  O     . HOH O 5 .   ? -5.466  -8.586  12.574  1.00 20.55 ? 426 HOH A O     1 
HETATM 4567 O  O     . HOH O 5 .   ? -11.933 -17.642 21.024  1.00 39.07 ? 427 HOH A O     1 
HETATM 4568 O  O     . HOH O 5 .   ? -21.218 -6.893  10.813  1.00 28.18 ? 428 HOH A O     1 
HETATM 4569 O  O     . HOH O 5 .   ? 10.260  8.584   26.217  1.00 31.01 ? 429 HOH A O     1 
HETATM 4570 O  O     . HOH O 5 .   ? -24.438 -12.844 27.006  1.00 24.84 ? 430 HOH A O     1 
HETATM 4571 O  O     . HOH O 5 .   ? -16.468 -1.521  13.748  1.00 34.18 ? 431 HOH A O     1 
HETATM 4572 O  O     . HOH O 5 .   ? -11.200 7.335   8.845   1.00 24.24 ? 432 HOH A O     1 
HETATM 4573 O  O     . HOH O 5 .   ? -1.310  -4.498  27.081  1.00 28.19 ? 433 HOH A O     1 
HETATM 4574 O  O     . HOH O 5 .   ? -17.680 -13.883 25.444  1.00 34.46 ? 434 HOH A O     1 
HETATM 4575 O  O     . HOH O 5 .   ? 8.370   -3.617  9.766   1.00 27.38 ? 435 HOH A O     1 
HETATM 4576 O  O     . HOH O 5 .   ? -3.534  -9.234  16.836  1.00 27.43 ? 436 HOH A O     1 
HETATM 4577 O  O     . HOH O 5 .   ? -5.115  -10.844 21.153  1.00 36.53 ? 437 HOH A O     1 
HETATM 4578 O  O     . HOH O 5 .   ? -3.346  -19.280 18.667  1.00 36.37 ? 438 HOH A O     1 
HETATM 4579 O  O     . HOH O 5 .   ? -3.259  -7.770  25.959  1.00 29.58 ? 439 HOH A O     1 
HETATM 4580 O  O     . HOH O 5 .   ? -31.140 -13.836 32.597  1.00 33.26 ? 440 HOH A O     1 
HETATM 4581 O  O     . HOH O 5 .   ? -12.991 -1.951  25.025  1.00 34.91 ? 441 HOH A O     1 
HETATM 4582 O  O     . HOH O 5 .   ? -19.908 -12.258 25.941  1.00 35.28 ? 442 HOH A O     1 
HETATM 4583 O  O     . HOH O 5 .   ? 1.628   -6.275  10.027  1.00 19.58 ? 443 HOH A O     1 
HETATM 4584 O  O     . HOH O 5 .   ? -4.998  -18.172 17.019  1.00 28.83 ? 444 HOH A O     1 
HETATM 4585 O  O     . HOH O 5 .   ? -11.104 13.737  19.803  1.00 30.68 ? 445 HOH A O     1 
HETATM 4586 O  O     . HOH O 5 .   ? 8.850   -13.412 8.989   1.00 37.02 ? 446 HOH A O     1 
HETATM 4587 O  O     . HOH O 5 .   ? -0.670  13.391  19.046  1.00 31.78 ? 447 HOH A O     1 
HETATM 4588 O  O     . HOH O 5 .   ? -11.403 -1.011  27.064  1.00 30.19 ? 448 HOH A O     1 
HETATM 4589 O  O     . HOH O 5 .   ? -18.146 2.057   16.451  1.00 21.51 ? 449 HOH A O     1 
HETATM 4590 O  O     . HOH O 5 .   ? -2.948  -5.400  13.391  1.00 18.95 ? 450 HOH A O     1 
HETATM 4591 O  O     . HOH O 5 .   ? -1.052  -5.161  17.017  1.00 31.59 ? 451 HOH A O     1 
HETATM 4592 O  O     . HOH O 5 .   ? 4.979   -1.930  29.175  1.00 28.89 ? 452 HOH A O     1 
HETATM 4593 O  O     . HOH O 5 .   ? -20.334 -2.772  24.651  1.00 34.91 ? 453 HOH A O     1 
HETATM 4594 O  O     . HOH O 5 .   ? -4.163  6.015   -0.461  1.00 14.21 ? 454 HOH A O     1 
HETATM 4595 O  O     . HOH O 5 .   ? -22.744 -2.320  17.879  1.00 34.03 ? 455 HOH A O     1 
HETATM 4596 O  O     . HOH O 5 .   ? -15.152 -14.589 26.083  1.00 34.64 ? 456 HOH A O     1 
HETATM 4597 O  O     . HOH O 5 .   ? 9.738   -10.602 26.549  1.00 31.77 ? 457 HOH A O     1 
HETATM 4598 O  O     . HOH O 5 .   ? -11.434 13.122  16.163  1.00 43.53 ? 458 HOH A O     1 
HETATM 4599 O  O     . HOH O 5 .   ? 17.625  -3.458  16.552  1.00 47.27 ? 459 HOH A O     1 
HETATM 4600 O  O     . HOH O 5 .   ? -24.874 -3.674  19.002  1.00 42.88 ? 460 HOH A O     1 
HETATM 4601 O  O     . HOH O 5 .   ? -33.780 -13.918 33.775  1.00 47.64 ? 461 HOH A O     1 
HETATM 4602 O  O     . HOH O 5 .   ? -18.925 -20.805 14.535  1.00 41.68 ? 462 HOH A O     1 
HETATM 4603 O  O     . HOH O 5 .   ? 8.320   19.489  -12.332 1.00 37.83 ? 463 HOH A O     1 
HETATM 4604 O  O     . HOH O 5 .   ? 1.984   14.719  19.224  1.00 44.98 ? 464 HOH A O     1 
HETATM 4605 O  O     . HOH O 5 .   ? 9.786   3.279   32.319  1.00 38.98 ? 465 HOH A O     1 
HETATM 4606 O  O     . HOH O 5 .   ? 4.186   -21.562 20.546  1.00 36.35 ? 466 HOH A O     1 
HETATM 4607 O  O     . HOH O 5 .   ? 11.752  -16.778 20.121  1.00 51.57 ? 467 HOH A O     1 
HETATM 4608 O  O     . HOH O 5 .   ? -4.805  -5.509  27.486  1.00 48.32 ? 468 HOH A O     1 
HETATM 4609 O  O     . HOH O 5 .   ? 0.219   -2.813  28.906  1.00 54.78 ? 469 HOH A O     1 
HETATM 4610 O  O     . HOH O 5 .   ? -0.039  -15.217 2.262   1.00 39.87 ? 470 HOH A O     1 
HETATM 4611 O  O     . HOH O 5 .   ? -21.691 -1.245  15.265  1.00 44.33 ? 471 HOH A O     1 
HETATM 4612 O  O     . HOH O 5 .   ? -6.060  -0.200  27.638  1.00 49.09 ? 472 HOH A O     1 
HETATM 4613 O  O     . HOH O 5 .   ? 4.356   15.866  12.460  1.00 45.70 ? 473 HOH A O     1 
HETATM 4614 O  O     . HOH O 5 .   ? -12.120 -19.464 8.434   1.00 39.50 ? 474 HOH A O     1 
HETATM 4615 O  O     . HOH O 5 .   ? 2.931   23.225  3.973   1.00 49.03 ? 475 HOH A O     1 
HETATM 4616 O  O     . HOH O 5 .   ? 20.731  19.756  -2.382  1.00 43.62 ? 476 HOH A O     1 
HETATM 4617 O  O     . HOH O 5 .   ? -20.599 -6.023  31.024  1.00 37.65 ? 477 HOH A O     1 
HETATM 4618 O  O     . HOH O 5 .   ? 4.339   -6.058  8.988   1.00 27.40 ? 478 HOH A O     1 
HETATM 4619 O  O     . HOH O 5 .   ? 8.710   -3.064  31.069  1.00 50.32 ? 479 HOH A O     1 
HETATM 4620 O  O     . HOH O 5 .   ? 8.624   -16.458 28.582  1.00 46.74 ? 480 HOH A O     1 
HETATM 4621 O  O     . HOH O 5 .   ? -10.581 14.103  1.030   1.00 55.88 ? 481 HOH A O     1 
HETATM 4622 O  O     . HOH O 5 .   ? 2.028   -17.800 6.342   1.00 39.54 ? 482 HOH A O     1 
HETATM 4623 O  O     . HOH O 5 .   ? -3.909  6.505   -3.240  1.00 18.68 ? 483 HOH A O     1 
HETATM 4624 O  O     . HOH O 5 .   ? 1.957   1.417   6.508   1.00 37.29 ? 484 HOH A O     1 
HETATM 4625 O  O     . HOH O 5 .   ? -4.962  3.791   0.729   1.00 29.37 ? 485 HOH A O     1 
HETATM 4626 O  O     . HOH O 5 .   ? 3.024   -6.120  3.179   1.00 21.47 ? 486 HOH A O     1 
HETATM 4627 O  O     . HOH O 5 .   ? 1.315   -0.422  8.455   1.00 23.88 ? 487 HOH A O     1 
HETATM 4628 O  O     . HOH O 5 .   ? 1.745   1.400   3.808   1.00 40.06 ? 488 HOH A O     1 
HETATM 4629 O  O     . HOH O 5 .   ? 0.441   1.999   0.754   1.00 37.93 ? 489 HOH A O     1 
HETATM 4630 O  O     . HOH O 5 .   ? -0.957  -7.543  27.940  1.00 41.21 ? 490 HOH A O     1 
HETATM 4631 O  O     . HOH O 5 .   ? -24.847 -20.732 11.544  1.00 59.23 ? 491 HOH A O     1 
HETATM 4632 O  O     . HOH P 5 .   ? -10.760 -2.579  -14.742 1.00 16.17 ? 404 HOH B O     1 
HETATM 4633 O  O     . HOH P 5 .   ? -3.108  -0.368  -23.245 1.00 15.72 ? 405 HOH B O     1 
HETATM 4634 O  O     . HOH P 5 .   ? -12.725 -17.158 -18.418 1.00 17.32 ? 406 HOH B O     1 
HETATM 4635 O  O     . HOH P 5 .   ? -8.573  -13.337 -9.992  1.00 16.76 ? 407 HOH B O     1 
HETATM 4636 O  O     . HOH P 5 .   ? 0.445   -9.132  -24.352 1.00 19.23 ? 408 HOH B O     1 
HETATM 4637 O  O     . HOH P 5 .   ? -9.360  3.858   -23.012 1.00 16.82 ? 409 HOH B O     1 
HETATM 4638 O  O     . HOH P 5 .   ? -6.138  -3.242  -8.003  1.00 24.13 ? 410 HOH B O     1 
HETATM 4639 O  O     . HOH P 5 .   ? -3.222  -2.754  -8.670  1.00 39.59 ? 411 HOH B O     1 
HETATM 4640 O  O     . HOH P 5 .   ? 17.648  3.916   3.436   1.00 17.09 ? 412 HOH B O     1 
HETATM 4641 O  O     . HOH P 5 .   ? -5.436  10.617  -12.849 1.00 14.18 ? 413 HOH B O     1 
HETATM 4642 O  O     . HOH P 5 .   ? -7.078  -0.421  -23.327 1.00 20.65 ? 414 HOH B O     1 
HETATM 4643 O  O     . HOH P 5 .   ? -16.660 -27.601 -33.958 1.00 15.94 ? 415 HOH B O     1 
HETATM 4644 O  O     . HOH P 5 .   ? -3.295  -2.952  -30.687 1.00 21.32 ? 416 HOH B O     1 
HETATM 4645 O  O     . HOH P 5 .   ? 8.277   -10.154 -9.739  1.00 22.12 ? 417 HOH B O     1 
HETATM 4646 O  O     . HOH P 5 .   ? -5.893  2.636   -25.669 1.00 36.59 ? 418 HOH B O     1 
HETATM 4647 O  O     . HOH P 5 .   ? -3.726  -0.474  -29.791 1.00 24.78 ? 419 HOH B O     1 
HETATM 4648 O  O     . HOH P 5 .   ? -7.790  -11.829 2.607   1.00 28.85 ? 420 HOH B O     1 
HETATM 4649 O  O     . HOH P 5 .   ? 11.270  1.798   -21.547 1.00 20.36 ? 421 HOH B O     1 
HETATM 4650 O  O     . HOH P 5 .   ? -6.632  -2.206  -14.752 1.00 17.35 ? 422 HOH B O     1 
HETATM 4651 O  O     . HOH P 5 .   ? -11.060 -5.153  -10.475 1.00 18.31 ? 423 HOH B O     1 
HETATM 4652 O  O     . HOH P 5 .   ? -2.169  1.994   -24.605 1.00 24.65 ? 424 HOH B O     1 
HETATM 4653 O  O     . HOH P 5 .   ? 7.083   13.564  -5.590  1.00 25.28 ? 425 HOH B O     1 
HETATM 4654 O  O     . HOH P 5 .   ? 1.372   -11.123 -11.980 1.00 42.81 ? 426 HOH B O     1 
HETATM 4655 O  O     . HOH P 5 .   ? -6.217  -18.395 -15.734 1.00 29.81 ? 427 HOH B O     1 
HETATM 4656 O  O     . HOH P 5 .   ? -16.162 -20.021 -35.733 1.00 32.55 ? 428 HOH B O     1 
HETATM 4657 O  O     . HOH P 5 .   ? -4.027  3.661   -10.382 1.00 24.75 ? 429 HOH B O     1 
HETATM 4658 O  O     . HOH P 5 .   ? -3.218  2.479   -27.116 1.00 36.05 ? 430 HOH B O     1 
HETATM 4659 O  O     . HOH P 5 .   ? -5.647  -0.497  -20.948 1.00 20.32 ? 431 HOH B O     1 
HETATM 4660 O  O     . HOH P 5 .   ? -11.337 -14.139 -7.700  1.00 28.37 ? 432 HOH B O     1 
HETATM 4661 O  O     . HOH P 5 .   ? -1.857  2.406   -17.530 1.00 26.27 ? 433 HOH B O     1 
HETATM 4662 O  O     . HOH P 5 .   ? -10.570 -11.518 -30.240 1.00 30.99 ? 434 HOH B O     1 
HETATM 4663 O  O     . HOH P 5 .   ? 3.419   -5.403  -9.508  1.00 27.70 ? 435 HOH B O     1 
HETATM 4664 O  O     . HOH P 5 .   ? -5.036  15.656  -25.237 1.00 31.61 ? 436 HOH B O     1 
HETATM 4665 O  O     . HOH P 5 .   ? -16.566 -14.479 -12.515 1.00 30.31 ? 437 HOH B O     1 
HETATM 4666 O  O     . HOH P 5 .   ? -0.270  -13.415 -16.832 1.00 33.06 ? 438 HOH B O     1 
HETATM 4667 O  O     . HOH P 5 .   ? -16.182 5.053   -9.209  1.00 30.19 ? 439 HOH B O     1 
HETATM 4668 O  O     . HOH P 5 .   ? -15.224 0.014   -20.403 1.00 27.18 ? 440 HOH B O     1 
HETATM 4669 O  O     . HOH P 5 .   ? 1.357   -11.207 -9.117  1.00 43.25 ? 441 HOH B O     1 
HETATM 4670 O  O     . HOH P 5 .   ? -0.561  0.434   -9.033  1.00 32.97 ? 442 HOH B O     1 
HETATM 4671 O  O     . HOH P 5 .   ? -2.979  -0.181  -14.350 1.00 14.62 ? 443 HOH B O     1 
HETATM 4672 O  O     . HOH P 5 .   ? -6.128  0.461   -18.519 1.00 23.09 ? 444 HOH B O     1 
HETATM 4673 O  O     . HOH P 5 .   ? -0.061  4.411   -27.177 1.00 39.68 ? 445 HOH B O     1 
HETATM 4674 O  O     . HOH P 5 .   ? -15.454 2.077   -22.439 1.00 41.09 ? 446 HOH B O     1 
HETATM 4675 O  O     . HOH P 5 .   ? 4.191   -14.963 -19.508 1.00 45.25 ? 447 HOH B O     1 
HETATM 4676 O  O     . HOH P 5 .   ? -1.112  0.745   -28.402 1.00 46.68 ? 448 HOH B O     1 
HETATM 4677 O  O     . HOH P 5 .   ? 10.052  15.318  -28.364 1.00 29.12 ? 449 HOH B O     1 
HETATM 4678 O  O     . HOH P 5 .   ? -1.005  10.045  -8.339  1.00 20.72 ? 450 HOH B O     1 
HETATM 4679 O  O     . HOH P 5 .   ? -10.911 11.000  -9.050  1.00 35.29 ? 451 HOH B O     1 
HETATM 4680 O  O     . HOH P 5 .   ? -8.021  -16.122 -9.935  1.00 30.81 ? 452 HOH B O     1 
HETATM 4681 O  O     . HOH P 5 .   ? -13.053 -8.755  -4.930  1.00 32.49 ? 453 HOH B O     1 
HETATM 4682 O  O     . HOH P 5 .   ? -10.288 15.273  -28.323 1.00 41.20 ? 454 HOH B O     1 
HETATM 4683 O  O     . HOH P 5 .   ? 17.094  4.424   17.130  1.00 46.23 ? 455 HOH B O     1 
HETATM 4684 O  O     . HOH P 5 .   ? 25.276  3.983   8.374   1.00 45.60 ? 456 HOH B O     1 
HETATM 4685 O  O     . HOH P 5 .   ? 1.684   -8.126  -27.088 1.00 47.17 ? 457 HOH B O     1 
HETATM 4686 O  O     . HOH P 5 .   ? 16.403  1.388   -16.181 1.00 32.12 ? 458 HOH B O     1 
HETATM 4687 O  O     . HOH P 5 .   ? 16.433  -8.827  -19.528 1.00 38.82 ? 459 HOH B O     1 
HETATM 4688 O  O     . HOH P 5 .   ? -5.744  4.421   -6.736  1.00 19.84 ? 460 HOH B O     1 
HETATM 4689 O  O     . HOH P 5 .   ? -19.426 -19.775 -34.640 1.00 55.43 ? 461 HOH B O     1 
HETATM 4690 O  O     . HOH P 5 .   ? 13.865  13.698  -22.014 1.00 39.49 ? 462 HOH B O     1 
HETATM 4691 O  O     . HOH P 5 .   ? -11.236 -23.611 -24.845 1.00 39.77 ? 463 HOH B O     1 
HETATM 4692 O  O     . HOH P 5 .   ? 17.279  -4.459  -10.560 1.00 34.86 ? 464 HOH B O     1 
HETATM 4693 O  O     . HOH P 5 .   ? -16.741 -12.600 -16.528 1.00 33.61 ? 465 HOH B O     1 
HETATM 4694 O  O     . HOH P 5 .   ? 17.950  3.994   -15.704 1.00 42.52 ? 466 HOH B O     1 
HETATM 4695 O  O     . HOH P 5 .   ? -15.719 14.127  -18.690 1.00 35.70 ? 467 HOH B O     1 
HETATM 4696 O  O     . HOH P 5 .   ? -10.087 -13.136 0.598   1.00 38.39 ? 468 HOH B O     1 
HETATM 4697 O  O     . HOH P 5 .   ? 12.817  7.356   -26.269 1.00 38.46 ? 469 HOH B O     1 
HETATM 4698 O  O     . HOH P 5 .   ? 8.571   22.125  -18.482 1.00 54.54 ? 470 HOH B O     1 
HETATM 4699 O  O     . HOH P 5 .   ? 14.884  -9.698  -15.803 1.00 41.06 ? 471 HOH B O     1 
HETATM 4700 O  O     . HOH P 5 .   ? 2.390   5.713   -27.913 1.00 35.95 ? 472 HOH B O     1 
HETATM 4701 O  O     . HOH P 5 .   ? 4.187   13.920  -28.528 1.00 39.68 ? 473 HOH B O     1 
HETATM 4702 O  O     . HOH P 5 .   ? -21.035 -20.975 -32.645 1.00 40.10 ? 474 HOH B O     1 
HETATM 4703 O  O     . HOH P 5 .   ? -13.358 -4.027  -31.872 1.00 47.60 ? 475 HOH B O     1 
HETATM 4704 O  O     . HOH P 5 .   ? -5.148  3.762   -3.404  1.00 19.00 ? 476 HOH B O     1 
HETATM 4705 O  O     . HOH P 5 .   ? 10.832  -12.115 -9.250  1.00 51.25 ? 477 HOH B O     1 
HETATM 4706 O  O     . HOH P 5 .   ? -10.487 5.306   -26.538 1.00 35.11 ? 478 HOH B O     1 
HETATM 4707 O  O     . HOH P 5 .   ? -4.516  0.490   -10.925 1.00 23.34 ? 479 HOH B O     1 
HETATM 4708 O  O     . HOH P 5 .   ? -3.778  6.360   -8.583  1.00 21.52 ? 480 HOH B O     1 
HETATM 4709 O  O     . HOH P 5 .   ? 1.335   2.778   -8.107  1.00 15.25 ? 481 HOH B O     1 
HETATM 4710 O  O     . HOH P 5 .   ? 6.214   -4.093  8.078   1.00 63.93 ? 482 HOH B O     1 
HETATM 4711 O  O     . HOH P 5 .   ? -0.551  -3.784  -7.629  1.00 33.17 ? 483 HOH B O     1 
HETATM 4712 O  O     . HOH P 5 .   ? 2.640   2.907   -5.297  1.00 35.26 ? 484 HOH B O     1 
HETATM 4713 O  O     . HOH P 5 .   ? 2.290   0.118   -0.241  1.00 41.96 ? 485 HOH B O     1 
HETATM 4714 O  O     . HOH P 5 .   ? 0.518   -13.360 -13.770 1.00 42.17 ? 486 HOH B O     1 
HETATM 4715 O  O     . HOH P 5 .   ? 9.998   0.508   -23.842 1.00 43.88 ? 487 HOH B O     1 
HETATM 4716 O  O     . HOH P 5 .   ? 8.183   -6.463  4.816   1.00 39.88 ? 488 HOH B O     1 
HETATM 4717 O  O     . HOH P 5 .   ? 2.478   2.077   -2.423  1.00 38.15 ? 489 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DG  4   4   4   DG  G   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
B 2 1   DA  1   7   7   DA  A   D . n 
B 2 2   DT  2   8   8   DT  T   D . n 
B 2 3   DC  3   9   9   DC  C   D . n 
B 2 4   DT  4   10  10  DT  T   D . n 
B 2 5   DT  5   11  11  DT  T   D . n 
C 1 1   DA  1   1   1   DA  A   E . n 
C 1 2   DA  2   2   2   DA  A   E . n 
C 1 3   DA  3   3   3   DA  A   E . n 
C 1 4   DG  4   4   4   DG  G   E . n 
C 1 5   DA  5   5   5   DA  A   E . n 
C 1 6   DT  6   6   6   DT  T   E . n 
D 2 1   DA  1   7   7   DA  A   F . n 
D 2 2   DT  2   8   8   DT  T   F . n 
D 2 3   DC  3   9   9   DC  C   F . n 
D 2 4   DT  4   10  10  DT  T   F . n 
D 2 5   DT  5   11  11  DT  T   F . n 
E 3 1   SER 1   2   2   SER SER A . n 
E 3 2   LEU 2   3   3   LEU LEU A . n 
E 3 3   ARG 3   4   4   ARG ARG A . n 
E 3 4   SER 4   5   5   SER SER A . n 
E 3 5   ASP 5   6   6   ASP ASP A . n 
E 3 6   LEU 6   7   7   LEU LEU A . n 
E 3 7   ILE 7   8   8   ILE ILE A . n 
E 3 8   ASN 8   9   9   ASN ASN A . n 
E 3 9   ALA 9   10  10  ALA ALA A . n 
E 3 10  LEU 10  11  11  LEU LEU A . n 
E 3 11  TYR 11  12  12  TYR TYR A . n 
E 3 12  ASP 12  13  13  ASP ASP A . n 
E 3 13  GLU 13  14  14  GLU GLU A . n 
E 3 14  ASN 14  15  15  ASN ASN A . n 
E 3 15  GLN 15  16  16  GLN GLN A . n 
E 3 16  LYS 16  17  17  LYS LYS A . n 
E 3 17  TYR 17  18  18  TYR TYR A . n 
E 3 18  ASP 18  19  19  ASP ASP A . n 
E 3 19  VAL 19  20  20  VAL VAL A . n 
E 3 20  CYS 20  21  21  CYS CYS A . n 
E 3 21  GLY 21  22  22  GLY GLY A . n 
E 3 22  ILE 22  23  23  ILE ILE A . n 
E 3 23  ILE 23  24  24  ILE ILE A . n 
E 3 24  SER 24  25  25  SER SER A . n 
E 3 25  ALA 25  26  26  ALA ALA A . n 
E 3 26  GLU 26  27  27  GLU GLU A . n 
E 3 27  GLY 27  28  28  GLY GLY A . n 
E 3 28  LYS 28  29  29  LYS LYS A . n 
E 3 29  ILE 29  30  30  ILE ILE A . n 
E 3 30  TYR 30  31  31  TYR TYR A . n 
E 3 31  PRO 31  32  32  PRO PRO A . n 
E 3 32  LEU 32  33  33  LEU LEU A . n 
E 3 33  GLY 33  34  34  GLY GLY A . n 
E 3 34  SER 34  35  35  SER SER A . n 
E 3 35  ASP 35  36  36  ASP ASP A . n 
E 3 36  THR 36  37  37  THR THR A . n 
E 3 37  LYS 37  38  38  LYS LYS A . n 
E 3 38  VAL 38  39  39  VAL VAL A . n 
E 3 39  LEU 39  40  40  LEU LEU A . n 
E 3 40  SER 40  41  41  SER SER A . n 
E 3 41  THR 41  42  42  THR THR A . n 
E 3 42  ILE 42  43  43  ILE ILE A . n 
E 3 43  PHE 43  44  44  PHE PHE A . n 
E 3 44  GLU 44  45  45  GLU GLU A . n 
E 3 45  LEU 45  46  46  LEU LEU A . n 
E 3 46  PHE 46  47  47  PHE PHE A . n 
E 3 47  SER 47  48  48  SER SER A . n 
E 3 48  ARG 48  49  49  ARG ARG A . n 
E 3 49  PRO 49  50  50  PRO PRO A . n 
E 3 50  ILE 50  51  51  ILE ILE A . n 
E 3 51  ILE 51  52  52  ILE ILE A . n 
E 3 52  ASN 52  53  53  ASN ASN A . n 
E 3 53  LYS 53  54  54  LYS LYS A . n 
E 3 54  ILE 54  55  55  ILE ILE A . n 
E 3 55  ALA 55  56  56  ALA ALA A . n 
E 3 56  GLU 56  57  57  GLU GLU A . n 
E 3 57  LYS 57  58  58  LYS LYS A . n 
E 3 58  HIS 58  59  59  HIS HIS A . n 
E 3 59  GLY 59  60  60  GLY GLY A . n 
E 3 60  TYR 60  61  61  TYR TYR A . n 
E 3 61  ILE 61  62  62  ILE ILE A . n 
E 3 62  VAL 62  63  63  VAL VAL A . n 
E 3 63  GLU 63  64  64  GLU GLU A . n 
E 3 64  GLU 64  65  65  GLU GLU A . n 
E 3 65  PRO 65  66  66  PRO PRO A . n 
E 3 66  LYS 66  67  67  LYS LYS A . n 
E 3 67  GLN 67  68  68  GLN GLN A . n 
E 3 68  GLN 68  69  69  GLN GLN A . n 
E 3 69  ASN 69  70  70  ASN ASN A . n 
E 3 70  HIS 70  71  71  HIS HIS A . n 
E 3 71  TYR 71  72  72  TYR TYR A . n 
E 3 72  PRO 72  73  73  PRO PRO A . n 
E 3 73  ASP 73  74  74  ASP ASP A . n 
E 3 74  PHE 74  75  75  PHE PHE A . n 
E 3 75  THR 75  76  76  THR THR A . n 
E 3 76  LEU 76  77  77  LEU LEU A . n 
E 3 77  TYR 77  78  78  TYR TYR A . n 
E 3 78  LYS 78  79  79  LYS LYS A . n 
E 3 79  PRO 79  80  80  PRO PRO A . n 
E 3 80  SER 80  81  81  SER SER A . n 
E 3 81  GLU 81  82  82  GLU GLU A . n 
E 3 82  PRO 82  83  83  PRO PRO A . n 
E 3 83  ASN 83  84  84  ASN ASN A . n 
E 3 84  LYS 84  85  85  LYS LYS A . n 
E 3 85  LYS 85  86  86  LYS LYS A . n 
E 3 86  ILE 86  87  87  ILE ILE A . n 
E 3 87  ALA 87  88  88  ALA ALA A . n 
E 3 88  ILE 88  89  89  ILE ILE A . n 
E 3 89  ASP 89  90  90  ASP ASP A . n 
E 3 90  ILE 90  91  91  ILE ILE A . n 
E 3 91  LYS 91  92  92  LYS LYS A . n 
E 3 92  THR 92  93  93  THR THR A . n 
E 3 93  THR 93  94  94  THR THR A . n 
E 3 94  TYR 94  95  95  TYR TYR A . n 
E 3 95  THR 95  96  96  THR THR A . n 
E 3 96  ASN 96  97  97  ASN ASN A . n 
E 3 97  LYS 97  98  98  LYS LYS A . n 
E 3 98  GLU 98  99  99  GLU GLU A . n 
E 3 99  ASN 99  100 100 ASN ASN A . n 
E 3 100 GLU 100 101 101 GLU GLU A . n 
E 3 101 LYS 101 102 102 LYS LYS A . n 
E 3 102 ILE 102 103 103 ILE ILE A . n 
E 3 103 LYS 103 104 104 LYS LYS A . n 
E 3 104 PHE 104 105 105 PHE PHE A . n 
E 3 105 THR 105 106 106 THR THR A . n 
E 3 106 LEU 106 107 107 LEU LEU A . n 
E 3 107 GLY 107 108 108 GLY GLY A . n 
E 3 108 GLY 108 109 109 GLY GLY A . n 
E 3 109 TYR 109 110 110 TYR TYR A . n 
E 3 110 THR 110 111 111 THR THR A . n 
E 3 111 SER 111 112 112 SER SER A . n 
E 3 112 PHE 112 113 113 PHE PHE A . n 
E 3 113 ILE 113 114 114 ILE ILE A . n 
E 3 114 ARG 114 115 115 ARG ARG A . n 
E 3 115 ASN 115 116 116 ASN ASN A . n 
E 3 116 ASN 116 117 117 ASN ASN A . n 
E 3 117 THR 117 118 118 THR THR A . n 
E 3 118 LYS 118 119 119 LYS LYS A . n 
E 3 119 ASN 119 120 120 ASN ASN A . n 
E 3 120 ILE 120 121 121 ILE ILE A . n 
E 3 121 VAL 121 122 122 VAL VAL A . n 
E 3 122 TYR 122 123 123 TYR TYR A . n 
E 3 123 PRO 123 124 124 PRO PRO A . n 
E 3 124 PHE 124 125 125 PHE PHE A . n 
E 3 125 ASP 125 126 126 ASP ASP A . n 
E 3 126 GLN 126 127 127 GLN GLN A . n 
E 3 127 TYR 127 128 128 TYR TYR A . n 
E 3 128 ILE 128 129 129 ILE ILE A . n 
E 3 129 ALA 129 130 130 ALA ALA A . n 
E 3 130 HIS 130 131 131 HIS HIS A . n 
E 3 131 TRP 131 132 132 TRP TRP A . n 
E 3 132 ILE 132 133 133 ILE ILE A . n 
E 3 133 ILE 133 134 134 ILE ILE A . n 
E 3 134 GLY 134 135 135 GLY GLY A . n 
E 3 135 TYR 135 136 136 TYR TYR A . n 
E 3 136 VAL 136 137 137 VAL VAL A . n 
E 3 137 TYR 137 138 138 TYR TYR A . n 
E 3 138 THR 138 139 139 THR THR A . n 
E 3 139 ARG 139 140 140 ARG ARG A . n 
E 3 140 VAL 140 141 141 VAL VAL A . n 
E 3 141 ALA 141 142 142 ALA ALA A . n 
E 3 142 THR 142 143 143 THR THR A . n 
E 3 143 ARG 143 144 144 ARG ARG A . n 
E 3 144 LYS 144 145 145 LYS LYS A . n 
E 3 145 SER 145 146 146 SER SER A . n 
E 3 146 SER 146 147 147 SER SER A . n 
E 3 147 LEU 147 148 148 LEU LEU A . n 
E 3 148 LYS 148 149 149 LYS LYS A . n 
E 3 149 THR 149 150 150 THR THR A . n 
E 3 150 TYR 150 151 151 TYR TYR A . n 
E 3 151 ASN 151 152 152 ASN ASN A . n 
E 3 152 ILE 152 153 153 ILE ILE A . n 
E 3 153 ASN 153 154 154 ASN ASN A . n 
E 3 154 GLU 154 155 155 GLU GLU A . n 
E 3 155 LEU 155 156 156 LEU LEU A . n 
E 3 156 ASN 156 157 157 ASN ASN A . n 
E 3 157 GLU 157 158 158 GLU GLU A . n 
E 3 158 ILE 158 159 159 ILE ILE A . n 
E 3 159 PRO 159 160 160 PRO PRO A . n 
E 3 160 LYS 160 161 161 LYS LYS A . n 
E 3 161 PRO 161 162 162 PRO PRO A . n 
E 3 162 TYR 162 163 163 TYR TYR A . n 
E 3 163 LYS 163 164 164 LYS LYS A . n 
E 3 164 GLY 164 165 165 GLY GLY A . n 
E 3 165 VAL 165 166 166 VAL VAL A . n 
E 3 166 LYS 166 167 167 LYS LYS A . n 
E 3 167 VAL 167 168 168 VAL VAL A . n 
E 3 168 PHE 168 169 169 PHE PHE A . n 
E 3 169 LEU 169 170 170 LEU LEU A . n 
E 3 170 GLN 170 171 171 GLN GLN A . n 
E 3 171 ASP 171 172 172 ASP ASP A . n 
E 3 172 LYS 172 173 173 LYS LYS A . n 
E 3 173 TRP 173 174 174 TRP TRP A . n 
E 3 174 VAL 174 175 175 VAL VAL A . n 
E 3 175 ILE 175 176 176 ILE ILE A . n 
E 3 176 ALA 176 177 177 ALA ALA A . n 
E 3 177 GLY 177 178 178 GLY GLY A . n 
E 3 178 ASP 178 179 179 ASP ASP A . n 
E 3 179 LEU 179 180 180 LEU LEU A . n 
E 3 180 ALA 180 181 181 ALA ALA A . n 
E 3 181 GLY 181 182 182 GLY GLY A . n 
E 3 182 SER 182 183 183 SER SER A . n 
E 3 183 GLY 183 184 184 GLY GLY A . n 
E 3 184 ASN 184 185 185 ASN ASN A . n 
E 3 185 THR 185 186 186 THR THR A . n 
E 3 186 THR 186 187 187 THR THR A . n 
E 3 187 ASN 187 188 188 ASN ASN A . n 
E 3 188 ILE 188 189 189 ILE ILE A . n 
E 3 189 GLY 189 190 190 GLY GLY A . n 
E 3 190 SER 190 191 191 SER SER A . n 
E 3 191 ILE 191 192 192 ILE ILE A . n 
E 3 192 HIS 192 193 193 HIS HIS A . n 
E 3 193 ALA 193 194 194 ALA ALA A . n 
E 3 194 HIS 194 195 195 HIS HIS A . n 
E 3 195 TYR 195 196 196 TYR TYR A . n 
E 3 196 LYS 196 197 197 LYS LYS A . n 
E 3 197 ASP 197 198 198 ASP ASP A . n 
E 3 198 PHE 198 199 199 PHE PHE A . n 
E 3 199 VAL 199 200 200 VAL VAL A . n 
E 3 200 GLU 200 201 201 GLU GLU A . n 
E 3 201 GLY 201 202 202 GLY GLY A . n 
E 3 202 LYS 202 203 203 LYS LYS A . n 
E 3 203 GLY 203 204 204 GLY GLY A . n 
E 3 204 ILE 204 205 205 ILE ILE A . n 
E 3 205 PHE 205 206 206 PHE PHE A . n 
E 3 206 ASP 206 207 207 ASP ASP A . n 
E 3 207 SER 207 208 208 SER SER A . n 
E 3 208 GLU 208 209 209 GLU GLU A . n 
E 3 209 ASP 209 210 210 ASP ASP A . n 
E 3 210 GLU 210 211 211 GLU GLU A . n 
E 3 211 PHE 211 212 212 PHE PHE A . n 
E 3 212 LEU 212 213 213 LEU LEU A . n 
E 3 213 ASP 213 214 214 ASP ASP A . n 
E 3 214 TYR 214 215 215 TYR TYR A . n 
E 3 215 TRP 215 216 216 TRP TRP A . n 
E 3 216 ARG 216 217 217 ARG ARG A . n 
E 3 217 ASN 217 218 218 ASN ASN A . n 
E 3 218 TYR 218 219 219 TYR TYR A . n 
E 3 219 GLU 219 220 220 GLU GLU A . n 
E 3 220 ARG 220 221 221 ARG ARG A . n 
E 3 221 THR 221 222 222 THR THR A . n 
E 3 222 SER 222 223 223 SER SER A . n 
E 3 223 GLN 223 224 224 GLN GLN A . n 
E 3 224 LEU 224 225 225 LEU LEU A . n 
E 3 225 ARG 225 226 226 ARG ARG A . n 
E 3 226 ASN 226 227 227 ASN ASN A . n 
E 3 227 ASP 227 228 228 ASP ASP A . n 
E 3 228 LYS 228 229 229 LYS LYS A . n 
E 3 229 TYR 229 230 230 TYR TYR A . n 
E 3 230 ASN 230 231 231 ASN ASN A . n 
E 3 231 ASN 231 232 232 ASN ASN A . n 
E 3 232 ILE 232 233 233 ILE ILE A . n 
E 3 233 SER 233 234 234 SER SER A . n 
E 3 234 GLU 234 235 235 GLU GLU A . n 
E 3 235 TYR 235 236 236 TYR TYR A . n 
E 3 236 ARG 236 237 237 ARG ARG A . n 
E 3 237 ASN 237 238 238 ASN ASN A . n 
E 3 238 TRP 238 239 239 TRP TRP A . n 
E 3 239 ILE 239 240 240 ILE ILE A . n 
E 3 240 TYR 240 241 241 TYR TYR A . n 
E 3 241 ARG 241 242 242 ARG ARG A . n 
E 3 242 GLY 242 243 243 GLY GLY A . n 
E 3 243 ARG 243 244 244 ARG ARG A . n 
E 3 244 LYS 244 245 245 LYS LYS A . n 
F 3 1   SER 1   2   2   SER SER B . n 
F 3 2   LEU 2   3   3   LEU LEU B . n 
F 3 3   ARG 3   4   4   ARG ARG B . n 
F 3 4   SER 4   5   5   SER SER B . n 
F 3 5   ASP 5   6   6   ASP ASP B . n 
F 3 6   LEU 6   7   7   LEU LEU B . n 
F 3 7   ILE 7   8   8   ILE ILE B . n 
F 3 8   ASN 8   9   9   ASN ASN B . n 
F 3 9   ALA 9   10  10  ALA ALA B . n 
F 3 10  LEU 10  11  11  LEU LEU B . n 
F 3 11  TYR 11  12  12  TYR TYR B . n 
F 3 12  ASP 12  13  13  ASP ASP B . n 
F 3 13  GLU 13  14  14  GLU GLU B . n 
F 3 14  ASN 14  15  15  ASN ASN B . n 
F 3 15  GLN 15  16  16  GLN GLN B . n 
F 3 16  LYS 16  17  17  LYS LYS B . n 
F 3 17  TYR 17  18  18  TYR TYR B . n 
F 3 18  ASP 18  19  19  ASP ASP B . n 
F 3 19  VAL 19  20  20  VAL VAL B . n 
F 3 20  CYS 20  21  21  CYS CYS B . n 
F 3 21  GLY 21  22  22  GLY GLY B . n 
F 3 22  ILE 22  23  23  ILE ILE B . n 
F 3 23  ILE 23  24  24  ILE ILE B . n 
F 3 24  SER 24  25  25  SER SER B . n 
F 3 25  ALA 25  26  26  ALA ALA B . n 
F 3 26  GLU 26  27  27  GLU GLU B . n 
F 3 27  GLY 27  28  28  GLY GLY B . n 
F 3 28  LYS 28  29  29  LYS LYS B . n 
F 3 29  ILE 29  30  30  ILE ILE B . n 
F 3 30  TYR 30  31  31  TYR TYR B . n 
F 3 31  PRO 31  32  32  PRO PRO B . n 
F 3 32  LEU 32  33  33  LEU LEU B . n 
F 3 33  GLY 33  34  34  GLY GLY B . n 
F 3 34  SER 34  35  35  SER SER B . n 
F 3 35  ASP 35  36  36  ASP ASP B . n 
F 3 36  THR 36  37  37  THR THR B . n 
F 3 37  LYS 37  38  38  LYS LYS B . n 
F 3 38  VAL 38  39  39  VAL VAL B . n 
F 3 39  LEU 39  40  40  LEU LEU B . n 
F 3 40  SER 40  41  41  SER SER B . n 
F 3 41  THR 41  42  42  THR THR B . n 
F 3 42  ILE 42  43  43  ILE ILE B . n 
F 3 43  PHE 43  44  44  PHE PHE B . n 
F 3 44  GLU 44  45  45  GLU GLU B . n 
F 3 45  LEU 45  46  46  LEU LEU B . n 
F 3 46  PHE 46  47  47  PHE PHE B . n 
F 3 47  SER 47  48  48  SER SER B . n 
F 3 48  ARG 48  49  49  ARG ARG B . n 
F 3 49  PRO 49  50  50  PRO PRO B . n 
F 3 50  ILE 50  51  51  ILE ILE B . n 
F 3 51  ILE 51  52  52  ILE ILE B . n 
F 3 52  ASN 52  53  53  ASN ASN B . n 
F 3 53  LYS 53  54  54  LYS LYS B . n 
F 3 54  ILE 54  55  55  ILE ILE B . n 
F 3 55  ALA 55  56  56  ALA ALA B . n 
F 3 56  GLU 56  57  57  GLU GLU B . n 
F 3 57  LYS 57  58  58  LYS LYS B . n 
F 3 58  HIS 58  59  59  HIS HIS B . n 
F 3 59  GLY 59  60  60  GLY GLY B . n 
F 3 60  TYR 60  61  61  TYR TYR B . n 
F 3 61  ILE 61  62  62  ILE ILE B . n 
F 3 62  VAL 62  63  63  VAL VAL B . n 
F 3 63  GLU 63  64  64  GLU GLU B . n 
F 3 64  GLU 64  65  65  GLU GLU B . n 
F 3 65  PRO 65  66  66  PRO PRO B . n 
F 3 66  LYS 66  67  67  LYS LYS B . n 
F 3 67  GLN 67  68  68  GLN GLN B . n 
F 3 68  GLN 68  69  69  GLN GLN B . n 
F 3 69  ASN 69  70  70  ASN ASN B . n 
F 3 70  HIS 70  71  71  HIS HIS B . n 
F 3 71  TYR 71  72  72  TYR TYR B . n 
F 3 72  PRO 72  73  73  PRO PRO B . n 
F 3 73  ASP 73  74  74  ASP ASP B . n 
F 3 74  PHE 74  75  75  PHE PHE B . n 
F 3 75  THR 75  76  76  THR THR B . n 
F 3 76  LEU 76  77  77  LEU LEU B . n 
F 3 77  TYR 77  78  78  TYR TYR B . n 
F 3 78  LYS 78  79  79  LYS LYS B . n 
F 3 79  PRO 79  80  80  PRO PRO B . n 
F 3 80  SER 80  81  81  SER SER B . n 
F 3 81  GLU 81  82  82  GLU GLU B . n 
F 3 82  PRO 82  83  83  PRO PRO B . n 
F 3 83  ASN 83  84  84  ASN ASN B . n 
F 3 84  LYS 84  85  85  LYS LYS B . n 
F 3 85  LYS 85  86  86  LYS LYS B . n 
F 3 86  ILE 86  87  87  ILE ILE B . n 
F 3 87  ALA 87  88  88  ALA ALA B . n 
F 3 88  ILE 88  89  89  ILE ILE B . n 
F 3 89  ASP 89  90  90  ASP ASP B . n 
F 3 90  ILE 90  91  91  ILE ILE B . n 
F 3 91  LYS 91  92  92  LYS LYS B . n 
F 3 92  THR 92  93  93  THR THR B . n 
F 3 93  THR 93  94  94  THR THR B . n 
F 3 94  TYR 94  95  95  TYR TYR B . n 
F 3 95  THR 95  96  96  THR THR B . n 
F 3 96  ASN 96  97  97  ASN ASN B . n 
F 3 97  LYS 97  98  98  LYS LYS B . n 
F 3 98  GLU 98  99  99  GLU GLU B . n 
F 3 99  ASN 99  100 100 ASN ASN B . n 
F 3 100 GLU 100 101 101 GLU GLU B . n 
F 3 101 LYS 101 102 102 LYS LYS B . n 
F 3 102 ILE 102 103 103 ILE ILE B . n 
F 3 103 LYS 103 104 104 LYS LYS B . n 
F 3 104 PHE 104 105 105 PHE PHE B . n 
F 3 105 THR 105 106 106 THR THR B . n 
F 3 106 LEU 106 107 107 LEU LEU B . n 
F 3 107 GLY 107 108 108 GLY GLY B . n 
F 3 108 GLY 108 109 109 GLY GLY B . n 
F 3 109 TYR 109 110 110 TYR TYR B . n 
F 3 110 THR 110 111 111 THR THR B . n 
F 3 111 SER 111 112 112 SER SER B . n 
F 3 112 PHE 112 113 113 PHE PHE B . n 
F 3 113 ILE 113 114 114 ILE ILE B . n 
F 3 114 ARG 114 115 115 ARG ARG B . n 
F 3 115 ASN 115 116 116 ASN ASN B . n 
F 3 116 ASN 116 117 117 ASN ASN B . n 
F 3 117 THR 117 118 118 THR THR B . n 
F 3 118 LYS 118 119 119 LYS LYS B . n 
F 3 119 ASN 119 120 120 ASN ASN B . n 
F 3 120 ILE 120 121 121 ILE ILE B . n 
F 3 121 VAL 121 122 122 VAL VAL B . n 
F 3 122 TYR 122 123 123 TYR TYR B . n 
F 3 123 PRO 123 124 124 PRO PRO B . n 
F 3 124 PHE 124 125 125 PHE PHE B . n 
F 3 125 ASP 125 126 126 ASP ASP B . n 
F 3 126 GLN 126 127 127 GLN GLN B . n 
F 3 127 TYR 127 128 128 TYR TYR B . n 
F 3 128 ILE 128 129 129 ILE ILE B . n 
F 3 129 ALA 129 130 130 ALA ALA B . n 
F 3 130 HIS 130 131 131 HIS HIS B . n 
F 3 131 TRP 131 132 132 TRP TRP B . n 
F 3 132 ILE 132 133 133 ILE ILE B . n 
F 3 133 ILE 133 134 134 ILE ILE B . n 
F 3 134 GLY 134 135 135 GLY GLY B . n 
F 3 135 TYR 135 136 136 TYR TYR B . n 
F 3 136 VAL 136 137 137 VAL VAL B . n 
F 3 137 TYR 137 138 138 TYR TYR B . n 
F 3 138 THR 138 139 139 THR THR B . n 
F 3 139 ARG 139 140 140 ARG ARG B . n 
F 3 140 VAL 140 141 141 VAL VAL B . n 
F 3 141 ALA 141 142 142 ALA ALA B . n 
F 3 142 THR 142 143 143 THR THR B . n 
F 3 143 ARG 143 144 144 ARG ARG B . n 
F 3 144 LYS 144 145 145 LYS LYS B . n 
F 3 145 SER 145 146 146 SER SER B . n 
F 3 146 SER 146 147 147 SER SER B . n 
F 3 147 LEU 147 148 148 LEU LEU B . n 
F 3 148 LYS 148 149 149 LYS LYS B . n 
F 3 149 THR 149 150 150 THR THR B . n 
F 3 150 TYR 150 151 151 TYR TYR B . n 
F 3 151 ASN 151 152 152 ASN ASN B . n 
F 3 152 ILE 152 153 153 ILE ILE B . n 
F 3 153 ASN 153 154 154 ASN ASN B . n 
F 3 154 GLU 154 155 155 GLU GLU B . n 
F 3 155 LEU 155 156 156 LEU LEU B . n 
F 3 156 ASN 156 157 157 ASN ASN B . n 
F 3 157 GLU 157 158 158 GLU GLU B . n 
F 3 158 ILE 158 159 159 ILE ILE B . n 
F 3 159 PRO 159 160 160 PRO PRO B . n 
F 3 160 LYS 160 161 161 LYS LYS B . n 
F 3 161 PRO 161 162 162 PRO PRO B . n 
F 3 162 TYR 162 163 163 TYR TYR B . n 
F 3 163 LYS 163 164 164 LYS LYS B . n 
F 3 164 GLY 164 165 165 GLY GLY B . n 
F 3 165 VAL 165 166 166 VAL VAL B . n 
F 3 166 LYS 166 167 167 LYS LYS B . n 
F 3 167 VAL 167 168 168 VAL VAL B . n 
F 3 168 PHE 168 169 169 PHE PHE B . n 
F 3 169 LEU 169 170 170 LEU LEU B . n 
F 3 170 GLN 170 171 171 GLN GLN B . n 
F 3 171 ASP 171 172 172 ASP ASP B . n 
F 3 172 LYS 172 173 173 LYS LYS B . n 
F 3 173 TRP 173 174 174 TRP TRP B . n 
F 3 174 VAL 174 175 175 VAL VAL B . n 
F 3 175 ILE 175 176 176 ILE ILE B . n 
F 3 176 ALA 176 177 177 ALA ALA B . n 
F 3 177 GLY 177 178 178 GLY GLY B . n 
F 3 178 ASP 178 179 179 ASP ASP B . n 
F 3 179 LEU 179 180 180 LEU LEU B . n 
F 3 180 ALA 180 181 181 ALA ALA B . n 
F 3 181 GLY 181 182 182 GLY GLY B . n 
F 3 182 SER 182 183 183 SER SER B . n 
F 3 183 GLY 183 184 184 GLY GLY B . n 
F 3 184 ASN 184 185 185 ASN ASN B . n 
F 3 185 THR 185 186 186 THR THR B . n 
F 3 186 THR 186 187 187 THR THR B . n 
F 3 187 ASN 187 188 188 ASN ASN B . n 
F 3 188 ILE 188 189 189 ILE ILE B . n 
F 3 189 GLY 189 190 190 GLY GLY B . n 
F 3 190 SER 190 191 191 SER SER B . n 
F 3 191 ILE 191 192 192 ILE ILE B . n 
F 3 192 HIS 192 193 193 HIS HIS B . n 
F 3 193 ALA 193 194 194 ALA ALA B . n 
F 3 194 HIS 194 195 195 HIS HIS B . n 
F 3 195 TYR 195 196 196 TYR TYR B . n 
F 3 196 LYS 196 197 197 LYS LYS B . n 
F 3 197 ASP 197 198 198 ASP ASP B . n 
F 3 198 PHE 198 199 199 PHE PHE B . n 
F 3 199 VAL 199 200 200 VAL VAL B . n 
F 3 200 GLU 200 201 201 GLU GLU B . n 
F 3 201 GLY 201 202 202 GLY GLY B . n 
F 3 202 LYS 202 203 203 LYS LYS B . n 
F 3 203 GLY 203 204 204 GLY GLY B . n 
F 3 204 ILE 204 205 205 ILE ILE B . n 
F 3 205 PHE 205 206 206 PHE PHE B . n 
F 3 206 ASP 206 207 207 ASP ASP B . n 
F 3 207 SER 207 208 208 SER SER B . n 
F 3 208 GLU 208 209 209 GLU GLU B . n 
F 3 209 ASP 209 210 210 ASP ASP B . n 
F 3 210 GLU 210 211 211 GLU GLU B . n 
F 3 211 PHE 211 212 212 PHE PHE B . n 
F 3 212 LEU 212 213 213 LEU LEU B . n 
F 3 213 ASP 213 214 214 ASP ASP B . n 
F 3 214 TYR 214 215 215 TYR TYR B . n 
F 3 215 TRP 215 216 216 TRP TRP B . n 
F 3 216 ARG 216 217 217 ARG ARG B . n 
F 3 217 ASN 217 218 218 ASN ASN B . n 
F 3 218 TYR 218 219 219 TYR TYR B . n 
F 3 219 GLU 219 220 220 GLU GLU B . n 
F 3 220 ARG 220 221 221 ARG ARG B . n 
F 3 221 THR 221 222 222 THR THR B . n 
F 3 222 SER 222 223 223 SER SER B . n 
F 3 223 GLN 223 224 224 GLN GLN B . n 
F 3 224 LEU 224 225 225 LEU LEU B . n 
F 3 225 ARG 225 226 226 ARG ARG B . n 
F 3 226 ASN 226 227 227 ASN ASN B . n 
F 3 227 ASP 227 228 228 ASP ASP B . n 
F 3 228 LYS 228 229 229 LYS LYS B . n 
F 3 229 TYR 229 230 230 TYR TYR B . n 
F 3 230 ASN 230 231 231 ASN ASN B . n 
F 3 231 ASN 231 232 232 ASN ASN B . n 
F 3 232 ILE 232 233 233 ILE ILE B . n 
F 3 233 SER 233 234 234 SER SER B . n 
F 3 234 GLU 234 235 235 GLU GLU B . n 
F 3 235 TYR 235 236 236 TYR TYR B . n 
F 3 236 ARG 236 237 237 ARG ARG B . n 
F 3 237 ASN 237 238 238 ASN ASN B . n 
F 3 238 TRP 238 239 239 TRP TRP B . n 
F 3 239 ILE 239 240 240 ILE ILE B . n 
F 3 240 TYR 240 241 241 TYR TYR B . n 
F 3 241 ARG 241 242 242 ARG ARG B . n 
F 3 242 GLY 242 243 243 GLY GLY B . n 
F 3 243 ARG 243 244 244 ARG ARG B . n 
F 3 244 LYS 244 245 245 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 MG  1  402 402 MG  MG  D . 
H 4 MG  1  404 404 MG  MG  F . 
I 4 MG  1  401 401 MG  MG  A . 
J 4 MG  1  403 403 MG  MG  B . 
K 5 HOH 1  17  17  HOH HOH C . 
K 5 HOH 2  21  21  HOH HOH C . 
K 5 HOH 3  64  64  HOH HOH C . 
K 5 HOH 4  85  85  HOH HOH C . 
K 5 HOH 5  95  95  HOH HOH C . 
K 5 HOH 6  110 110 HOH HOH C . 
K 5 HOH 7  154 154 HOH HOH C . 
K 5 HOH 8  176 176 HOH HOH C . 
K 5 HOH 9  194 194 HOH HOH C . 
K 5 HOH 10 206 206 HOH HOH C . 
L 5 HOH 1  54  54  HOH HOH D . 
L 5 HOH 2  82  82  HOH HOH D . 
L 5 HOH 3  106 106 HOH HOH D . 
L 5 HOH 4  127 127 HOH HOH D . 
L 5 HOH 5  147 147 HOH HOH D . 
L 5 HOH 6  153 153 HOH HOH D . 
L 5 HOH 7  156 156 HOH HOH D . 
L 5 HOH 8  184 184 HOH HOH D . 
L 5 HOH 9  212 212 HOH HOH D . 
L 5 HOH 10 240 240 HOH HOH D . 
L 5 HOH 11 294 294 HOH HOH D . 
L 5 HOH 12 299 299 HOH HOH D . 
M 5 HOH 1  7   2   HOH HOH E . 
M 5 HOH 2  8   27  HOH HOH E . 
M 5 HOH 3  9   38  HOH HOH E . 
M 5 HOH 4  10  57  HOH HOH E . 
M 5 HOH 5  11  62  HOH HOH E . 
M 5 HOH 6  12  63  HOH HOH E . 
M 5 HOH 7  13  90  HOH HOH E . 
M 5 HOH 8  14  134 HOH HOH E . 
M 5 HOH 9  15  143 HOH HOH E . 
M 5 HOH 10 16  157 HOH HOH E . 
M 5 HOH 11 17  159 HOH HOH E . 
M 5 HOH 12 18  162 HOH HOH E . 
M 5 HOH 13 19  188 HOH HOH E . 
M 5 HOH 14 20  189 HOH HOH E . 
N 5 HOH 1  120 120 HOH HOH F . 
N 5 HOH 2  126 126 HOH HOH F . 
N 5 HOH 3  151 151 HOH HOH F . 
N 5 HOH 4  186 186 HOH HOH F . 
N 5 HOH 5  197 197 HOH HOH F . 
N 5 HOH 6  275 275 HOH HOH F . 
N 5 HOH 7  291 291 HOH HOH F . 
O 5 HOH 1  402 4   HOH HOH A . 
O 5 HOH 2  403 5   HOH HOH A . 
O 5 HOH 3  404 8   HOH HOH A . 
O 5 HOH 4  405 10  HOH HOH A . 
O 5 HOH 5  406 13  HOH HOH A . 
O 5 HOH 6  407 14  HOH HOH A . 
O 5 HOH 7  408 15  HOH HOH A . 
O 5 HOH 8  409 16  HOH HOH A . 
O 5 HOH 9  410 22  HOH HOH A . 
O 5 HOH 10 411 25  HOH HOH A . 
O 5 HOH 11 412 26  HOH HOH A . 
O 5 HOH 12 413 28  HOH HOH A . 
O 5 HOH 13 414 29  HOH HOH A . 
O 5 HOH 14 415 30  HOH HOH A . 
O 5 HOH 15 416 31  HOH HOH A . 
O 5 HOH 16 417 34  HOH HOH A . 
O 5 HOH 17 418 35  HOH HOH A . 
O 5 HOH 18 419 43  HOH HOH A . 
O 5 HOH 19 420 45  HOH HOH A . 
O 5 HOH 20 421 46  HOH HOH A . 
O 5 HOH 21 422 47  HOH HOH A . 
O 5 HOH 22 423 49  HOH HOH A . 
O 5 HOH 23 424 50  HOH HOH A . 
O 5 HOH 24 425 51  HOH HOH A . 
O 5 HOH 25 426 52  HOH HOH A . 
O 5 HOH 26 427 53  HOH HOH A . 
O 5 HOH 27 428 55  HOH HOH A . 
O 5 HOH 28 429 58  HOH HOH A . 
O 5 HOH 29 430 61  HOH HOH A . 
O 5 HOH 30 431 65  HOH HOH A . 
O 5 HOH 31 432 68  HOH HOH A . 
O 5 HOH 32 433 69  HOH HOH A . 
O 5 HOH 33 434 78  HOH HOH A . 
O 5 HOH 34 435 79  HOH HOH A . 
O 5 HOH 35 436 81  HOH HOH A . 
O 5 HOH 36 437 83  HOH HOH A . 
O 5 HOH 37 438 84  HOH HOH A . 
O 5 HOH 38 439 91  HOH HOH A . 
O 5 HOH 39 440 92  HOH HOH A . 
O 5 HOH 40 441 93  HOH HOH A . 
O 5 HOH 41 442 96  HOH HOH A . 
O 5 HOH 42 443 97  HOH HOH A . 
O 5 HOH 43 444 98  HOH HOH A . 
O 5 HOH 44 445 99  HOH HOH A . 
O 5 HOH 45 446 100 HOH HOH A . 
O 5 HOH 46 447 102 HOH HOH A . 
O 5 HOH 47 448 103 HOH HOH A . 
O 5 HOH 48 449 104 HOH HOH A . 
O 5 HOH 49 450 108 HOH HOH A . 
O 5 HOH 50 451 115 HOH HOH A . 
O 5 HOH 51 452 117 HOH HOH A . 
O 5 HOH 52 453 124 HOH HOH A . 
O 5 HOH 53 454 133 HOH HOH A . 
O 5 HOH 54 455 140 HOH HOH A . 
O 5 HOH 55 456 141 HOH HOH A . 
O 5 HOH 56 457 142 HOH HOH A . 
O 5 HOH 57 458 160 HOH HOH A . 
O 5 HOH 58 459 166 HOH HOH A . 
O 5 HOH 59 460 174 HOH HOH A . 
O 5 HOH 60 461 177 HOH HOH A . 
O 5 HOH 61 462 178 HOH HOH A . 
O 5 HOH 62 463 182 HOH HOH A . 
O 5 HOH 63 464 196 HOH HOH A . 
O 5 HOH 64 465 201 HOH HOH A . 
O 5 HOH 65 466 202 HOH HOH A . 
O 5 HOH 66 467 204 HOH HOH A . 
O 5 HOH 67 468 210 HOH HOH A . 
O 5 HOH 68 469 211 HOH HOH A . 
O 5 HOH 69 470 213 HOH HOH A . 
O 5 HOH 70 471 215 HOH HOH A . 
O 5 HOH 71 472 219 HOH HOH A . 
O 5 HOH 72 473 221 HOH HOH A . 
O 5 HOH 73 474 225 HOH HOH A . 
O 5 HOH 74 475 226 HOH HOH A . 
O 5 HOH 75 476 228 HOH HOH A . 
O 5 HOH 76 477 237 HOH HOH A . 
O 5 HOH 77 478 242 HOH HOH A . 
O 5 HOH 78 479 245 HOH HOH A . 
O 5 HOH 79 480 262 HOH HOH A . 
O 5 HOH 80 481 263 HOH HOH A . 
O 5 HOH 81 482 266 HOH HOH A . 
O 5 HOH 82 483 290 HOH HOH A . 
O 5 HOH 83 484 293 HOH HOH A . 
O 5 HOH 84 485 295 HOH HOH A . 
O 5 HOH 85 486 296 HOH HOH A . 
O 5 HOH 86 487 297 HOH HOH A . 
O 5 HOH 87 488 298 HOH HOH A . 
O 5 HOH 88 489 303 HOH HOH A . 
O 5 HOH 89 490 304 HOH HOH A . 
O 5 HOH 90 491 305 HOH HOH A . 
P 5 HOH 1  404 1   HOH HOH B . 
P 5 HOH 2  405 3   HOH HOH B . 
P 5 HOH 3  406 6   HOH HOH B . 
P 5 HOH 4  407 7   HOH HOH B . 
P 5 HOH 5  408 9   HOH HOH B . 
P 5 HOH 6  409 11  HOH HOH B . 
P 5 HOH 7  410 12  HOH HOH B . 
P 5 HOH 8  411 18  HOH HOH B . 
P 5 HOH 9  412 19  HOH HOH B . 
P 5 HOH 10 413 20  HOH HOH B . 
P 5 HOH 11 414 23  HOH HOH B . 
P 5 HOH 12 415 24  HOH HOH B . 
P 5 HOH 13 416 32  HOH HOH B . 
P 5 HOH 14 417 33  HOH HOH B . 
P 5 HOH 15 418 36  HOH HOH B . 
P 5 HOH 16 419 37  HOH HOH B . 
P 5 HOH 17 420 39  HOH HOH B . 
P 5 HOH 18 421 40  HOH HOH B . 
P 5 HOH 19 422 41  HOH HOH B . 
P 5 HOH 20 423 42  HOH HOH B . 
P 5 HOH 21 424 44  HOH HOH B . 
P 5 HOH 22 425 48  HOH HOH B . 
P 5 HOH 23 426 56  HOH HOH B . 
P 5 HOH 24 427 59  HOH HOH B . 
P 5 HOH 25 428 60  HOH HOH B . 
P 5 HOH 26 429 66  HOH HOH B . 
P 5 HOH 27 430 67  HOH HOH B . 
P 5 HOH 28 431 71  HOH HOH B . 
P 5 HOH 29 432 72  HOH HOH B . 
P 5 HOH 30 433 74  HOH HOH B . 
P 5 HOH 31 434 75  HOH HOH B . 
P 5 HOH 32 435 76  HOH HOH B . 
P 5 HOH 33 436 77  HOH HOH B . 
P 5 HOH 34 437 80  HOH HOH B . 
P 5 HOH 35 438 87  HOH HOH B . 
P 5 HOH 36 439 89  HOH HOH B . 
P 5 HOH 37 440 94  HOH HOH B . 
P 5 HOH 38 441 101 HOH HOH B . 
P 5 HOH 39 442 105 HOH HOH B . 
P 5 HOH 40 443 109 HOH HOH B . 
P 5 HOH 41 444 111 HOH HOH B . 
P 5 HOH 42 445 112 HOH HOH B . 
P 5 HOH 43 446 113 HOH HOH B . 
P 5 HOH 44 447 116 HOH HOH B . 
P 5 HOH 45 448 118 HOH HOH B . 
P 5 HOH 46 449 119 HOH HOH B . 
P 5 HOH 47 450 121 HOH HOH B . 
P 5 HOH 48 451 125 HOH HOH B . 
P 5 HOH 49 452 129 HOH HOH B . 
P 5 HOH 50 453 130 HOH HOH B . 
P 5 HOH 51 454 131 HOH HOH B . 
P 5 HOH 52 455 145 HOH HOH B . 
P 5 HOH 53 456 150 HOH HOH B . 
P 5 HOH 54 457 161 HOH HOH B . 
P 5 HOH 55 458 163 HOH HOH B . 
P 5 HOH 56 459 165 HOH HOH B . 
P 5 HOH 57 460 168 HOH HOH B . 
P 5 HOH 58 461 170 HOH HOH B . 
P 5 HOH 59 462 172 HOH HOH B . 
P 5 HOH 60 463 173 HOH HOH B . 
P 5 HOH 61 464 179 HOH HOH B . 
P 5 HOH 62 465 190 HOH HOH B . 
P 5 HOH 63 466 192 HOH HOH B . 
P 5 HOH 64 467 200 HOH HOH B . 
P 5 HOH 65 468 203 HOH HOH B . 
P 5 HOH 66 469 207 HOH HOH B . 
P 5 HOH 67 470 214 HOH HOH B . 
P 5 HOH 68 471 218 HOH HOH B . 
P 5 HOH 69 472 231 HOH HOH B . 
P 5 HOH 70 473 235 HOH HOH B . 
P 5 HOH 71 474 244 HOH HOH B . 
P 5 HOH 72 475 246 HOH HOH B . 
P 5 HOH 73 476 254 HOH HOH B . 
P 5 HOH 74 477 256 HOH HOH B . 
P 5 HOH 75 478 270 HOH HOH B . 
P 5 HOH 76 479 280 HOH HOH B . 
P 5 HOH 77 480 285 HOH HOH B . 
P 5 HOH 78 481 292 HOH HOH B . 
P 5 HOH 79 482 300 HOH HOH B . 
P 5 HOH 80 483 301 HOH HOH B . 
P 5 HOH 81 484 302 HOH HOH B . 
P 5 HOH 82 485 306 HOH HOH B . 
P 5 HOH 83 486 307 HOH HOH B . 
P 5 HOH 84 487 308 HOH HOH B . 
P 5 HOH 85 488 309 HOH HOH B . 
P 5 HOH 86 489 310 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP2 ? B DA  1  ? D DA  7   ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 OE2 ? E GLU 44 ? A GLU 45  ? 1_555 93.1  ? 
2  OP2 ? B DA  1  ? D DA  7   ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 OD1 ? E ASP 73 ? A ASP 74  ? 1_555 94.7  ? 
3  OE2 ? E GLU 44 ? A GLU 45  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 OD1 ? E ASP 73 ? A ASP 74  ? 1_555 82.2  ? 
4  OP2 ? B DA  1  ? D DA  7   ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 OD2 ? E ASP 73 ? A ASP 74  ? 1_555 151.8 ? 
5  OE2 ? E GLU 44 ? A GLU 45  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 OD2 ? E ASP 73 ? A ASP 74  ? 1_555 83.3  ? 
6  OD1 ? E ASP 73 ? A ASP 74  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 OD2 ? E ASP 73 ? A ASP 74  ? 1_555 57.1  ? 
7  OP2 ? B DA  1  ? D DA  7   ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? L HOH .  ? D HOH 153 ? 1_555 89.6  ? 
8  OE2 ? E GLU 44 ? A GLU 45  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? L HOH .  ? D HOH 153 ? 1_555 173.9 ? 
9  OD1 ? E ASP 73 ? A ASP 74  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? L HOH .  ? D HOH 153 ? 1_555 92.1  ? 
10 OD2 ? E ASP 73 ? A ASP 74  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? L HOH .  ? D HOH 153 ? 1_555 91.7  ? 
11 OP2 ? B DA  1  ? D DA  7   ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? O HOH .  ? A HOH 487 ? 1_555 101.8 ? 
12 OE2 ? E GLU 44 ? A GLU 45  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? O HOH .  ? A HOH 487 ? 1_555 98.0  ? 
13 OD1 ? E ASP 73 ? A ASP 74  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? O HOH .  ? A HOH 487 ? 1_555 163.4 ? 
14 OD2 ? E ASP 73 ? A ASP 74  ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? O HOH .  ? A HOH 487 ? 1_555 106.4 ? 
15 O   ? L HOH .  ? D HOH 153 ? 1_555 MG ? I MG . ? A MG 401 ? 1_555 O   ? O HOH .  ? A HOH 487 ? 1_555 86.8  ? 
16 OE2 ? F GLU 44 ? B GLU 45  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 O   ? P HOH .  ? B HOH 481 ? 1_555 95.2  ? 
17 OE2 ? F GLU 44 ? B GLU 45  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OD2 ? F ASP 73 ? B ASP 74  ? 1_555 89.3  ? 
18 O   ? P HOH .  ? B HOH 481 ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OD2 ? F ASP 73 ? B ASP 74  ? 1_555 103.3 ? 
19 OE2 ? F GLU 44 ? B GLU 45  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OD1 ? F ASP 73 ? B ASP 74  ? 1_555 88.7  ? 
20 O   ? P HOH .  ? B HOH 481 ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OD1 ? F ASP 73 ? B ASP 74  ? 1_555 162.7 ? 
21 OD2 ? F ASP 73 ? B ASP 74  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OD1 ? F ASP 73 ? B ASP 74  ? 1_555 59.9  ? 
22 OE2 ? F GLU 44 ? B GLU 45  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OP2 ? D DA  1  ? F DA  7   ? 1_555 94.9  ? 
23 O   ? P HOH .  ? B HOH 481 ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OP2 ? D DA  1  ? F DA  7   ? 1_555 97.3  ? 
24 OD2 ? F ASP 73 ? B ASP 74  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OP2 ? D DA  1  ? F DA  7   ? 1_555 158.5 ? 
25 OD1 ? F ASP 73 ? B ASP 74  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 OP2 ? D DA  1  ? F DA  7   ? 1_555 99.1  ? 
26 OE2 ? F GLU 44 ? B GLU 45  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 O   ? N HOH .  ? F HOH 291 ? 1_555 171.8 ? 
27 O   ? P HOH .  ? B HOH 481 ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 O   ? N HOH .  ? F HOH 291 ? 1_555 92.8  ? 
28 OD2 ? F ASP 73 ? B ASP 74  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 O   ? N HOH .  ? F HOH 291 ? 1_555 87.3  ? 
29 OD1 ? F ASP 73 ? B ASP 74  ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 O   ? N HOH .  ? F HOH 291 ? 1_555 83.2  ? 
30 OP2 ? D DA  1  ? F DA  7   ? 1_555 MG ? J MG . ? B MG 403 ? 1_555 O   ? N HOH .  ? F HOH 291 ? 1_555 85.6  ? 
31 O   ? L HOH .  ? D HOH 240 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 OP1 ? B DA  1  ? D DA  7   ? 1_555 78.9  ? 
32 O   ? L HOH .  ? D HOH 240 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? O HOH .  ? A HOH 486 ? 1_555 96.6  ? 
33 OP1 ? B DA  1  ? D DA  7   ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? O HOH .  ? A HOH 486 ? 1_555 83.3  ? 
34 O   ? L HOH .  ? D HOH 240 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 184 ? 1_555 85.8  ? 
35 OP1 ? B DA  1  ? D DA  7   ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 184 ? 1_555 110.8 ? 
36 O   ? O HOH .  ? A HOH 486 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 184 ? 1_555 165.9 ? 
37 O   ? L HOH .  ? D HOH 240 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 299 ? 1_555 171.5 ? 
38 OP1 ? B DA  1  ? D DA  7   ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 299 ? 1_555 107.7 ? 
39 O   ? O HOH .  ? A HOH 486 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 299 ? 1_555 79.2  ? 
40 O   ? L HOH .  ? D HOH 184 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? L HOH .  ? D HOH 299 ? 1_555 96.5  ? 
41 O   ? L HOH .  ? D HOH 240 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? E GLN 68 ? A GLN 69  ? 1_555 74.1  ? 
42 OP1 ? B DA  1  ? D DA  7   ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? E GLN 68 ? A GLN 69  ? 1_555 137.3 ? 
43 O   ? O HOH .  ? A HOH 486 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? E GLN 68 ? A GLN 69  ? 1_555 68.0  ? 
44 O   ? L HOH .  ? D HOH 184 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? E GLN 68 ? A GLN 69  ? 1_555 99.6  ? 
45 O   ? L HOH .  ? D HOH 299 ? 1_555 MG ? G MG . ? D MG 402 ? 1_555 O   ? E GLN 68 ? A GLN 69  ? 1_555 97.5  ? 
46 O   ? O HOH .  ? A HOH 483 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? N HOH .  ? F HOH 126 ? 1_555 79.3  ? 
47 O   ? O HOH .  ? A HOH 483 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? F GLN 68 ? B GLN 69  ? 1_555 92.2  ? 
48 O   ? N HOH .  ? F HOH 126 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? F GLN 68 ? B GLN 69  ? 1_555 86.4  ? 
49 O   ? O HOH .  ? A HOH 483 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 476 ? 1_555 92.2  ? 
50 O   ? N HOH .  ? F HOH 126 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 476 ? 1_555 168.7 ? 
51 O   ? F GLN 68 ? B GLN 69  ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 476 ? 1_555 86.5  ? 
52 O   ? O HOH .  ? A HOH 483 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 460 ? 1_555 158.9 ? 
53 O   ? N HOH .  ? F HOH 126 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 460 ? 1_555 79.8  ? 
54 O   ? F GLN 68 ? B GLN 69  ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 460 ? 1_555 83.0  ? 
55 O   ? P HOH .  ? B HOH 476 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 O   ? P HOH .  ? B HOH 460 ? 1_555 108.0 ? 
56 O   ? O HOH .  ? A HOH 483 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 OP1 ? D DA  1  ? F DA  7   ? 1_555 95.3  ? 
57 O   ? N HOH .  ? F HOH 126 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 OP1 ? D DA  1  ? F DA  7   ? 1_555 88.1  ? 
58 O   ? F GLN 68 ? B GLN 69  ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 OP1 ? D DA  1  ? F DA  7   ? 1_555 169.7 ? 
59 O   ? P HOH .  ? B HOH 476 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 OP1 ? D DA  1  ? F DA  7   ? 1_555 100.2 ? 
60 O   ? P HOH .  ? B HOH 460 ? 1_555 MG ? H MG . ? F MG 404 ? 1_555 OP1 ? D DA  1  ? F DA  7   ? 1_555 87.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-01-26 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "C5'" C DA 1  ? ? "C4'" C DA 1  ? ? 1.560 1.512 0.048  0.007 N 
2  1 N9    C DA 1  ? ? C4    C DA 1  ? ? 1.415 1.374 0.041  0.006 N 
3  1 N9    D DA 7  ? ? C4    D DA 7  ? ? 1.412 1.374 0.038  0.006 N 
4  1 C5    D DT 8  ? ? C7    D DT 8  ? ? 1.534 1.496 0.038  0.006 N 
5  1 "O4'" D DT 10 ? ? "C4'" D DT 10 ? ? 1.379 1.446 -0.067 0.010 N 
6  1 C5    D DT 11 ? ? C7    D DT 11 ? ? 1.547 1.496 0.051  0.006 N 
7  1 "C5'" E DA 1  ? ? "C4'" E DA 1  ? ? 1.592 1.512 0.080  0.007 N 
8  1 P     E DA 2  ? ? "O5'" E DA 2  ? ? 1.658 1.593 0.065  0.010 N 
9  1 C5    F DT 10 ? ? C7    F DT 10 ? ? 1.570 1.496 0.074  0.006 N 
10 1 C5    F DT 11 ? ? C7    F DT 11 ? ? 1.552 1.496 0.056  0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DA 2  ? ? "C1'" C DA 2  ? ? N9    C DA 2  ? ? 102.18 108.00 -5.82  0.70 N 
2  1 "C3'" C DA 3  ? ? "O3'" C DA 3  ? ? P     C DG 4  ? ? 127.62 119.70 7.92   1.20 Y 
3  1 "C1'" C DG 4  ? ? "O4'" C DG 4  ? ? "C4'" C DG 4  ? ? 103.76 110.10 -6.34  1.00 N 
4  1 "C3'" C DG 4  ? ? "C2'" C DG 4  ? ? "C1'" C DG 4  ? ? 97.42  102.40 -4.98  0.80 N 
5  1 "O4'" C DG 4  ? ? "C1'" C DG 4  ? ? N9    C DG 4  ? ? 114.17 108.30 5.87   0.30 N 
6  1 "O4'" C DA 5  ? ? "C1'" C DA 5  ? ? N9    C DA 5  ? ? 103.70 108.00 -4.30  0.70 N 
7  1 C6    C DA 5  ? ? N1    C DA 5  ? ? C2    C DA 5  ? ? 122.90 118.60 4.30   0.60 N 
8  1 "O4'" C DT 6  ? ? "C1'" C DT 6  ? ? N1    C DT 6  ? ? 116.31 108.30 8.01   0.30 N 
9  1 "O4'" D DA 7  ? ? "C1'" D DA 7  ? ? N9    D DA 7  ? ? 113.04 108.30 4.74   0.30 N 
10 1 "C1'" D DT 8  ? ? "O4'" D DT 8  ? ? "C4'" D DT 8  ? ? 99.68  110.10 -10.42 1.00 N 
11 1 "O4'" D DT 8  ? ? "C1'" D DT 8  ? ? N1    D DT 8  ? ? 111.57 108.30 3.27   0.30 N 
12 1 C6    D DT 8  ? ? C5    D DT 8  ? ? C7    D DT 8  ? ? 118.28 122.90 -4.62  0.60 N 
13 1 "C3'" D DT 8  ? ? "O3'" D DT 8  ? ? P     D DC 9  ? ? 132.45 119.70 12.75  1.20 Y 
14 1 "O4'" D DT 10 ? ? "C1'" D DT 10 ? ? N1    D DT 10 ? ? 101.12 108.00 -6.88  0.70 N 
15 1 C4    D DT 11 ? ? C5    D DT 11 ? ? C7    D DT 11 ? ? 123.09 119.00 4.09   0.60 N 
16 1 C6    D DT 11 ? ? C5    D DT 11 ? ? C7    D DT 11 ? ? 117.82 122.90 -5.08  0.60 N 
17 1 "C3'" E DA 1  ? ? "C2'" E DA 1  ? ? "C1'" E DA 1  ? ? 97.18  102.40 -5.22  0.80 N 
18 1 "O4'" E DA 1  ? ? "C1'" E DA 1  ? ? N9    E DA 1  ? ? 102.38 108.00 -5.62  0.70 N 
19 1 "C1'" E DA 3  ? ? "O4'" E DA 3  ? ? "C4'" E DA 3  ? ? 104.00 110.10 -6.10  1.00 N 
20 1 "C4'" E DA 3  ? ? "C3'" E DA 3  ? ? "C2'" E DA 3  ? ? 108.64 103.10 5.54   0.90 N 
21 1 "C3'" E DA 3  ? ? "O3'" E DA 3  ? ? P     E DG 4  ? ? 128.94 119.70 9.24   1.20 Y 
22 1 "C3'" E DG 4  ? ? "C2'" E DG 4  ? ? "C1'" E DG 4  ? ? 97.29  102.40 -5.11  0.80 N 
23 1 "O4'" E DG 4  ? ? "C1'" E DG 4  ? ? N9    E DG 4  ? ? 111.42 108.30 3.12   0.30 N 
24 1 "O4'" E DA 5  ? ? "C1'" E DA 5  ? ? "C2'" E DA 5  ? ? 110.01 106.80 3.21   0.50 N 
25 1 "O4'" E DT 6  ? ? "C4'" E DT 6  ? ? "C3'" E DT 6  ? ? 101.44 104.50 -3.06  0.40 N 
26 1 "O4'" E DT 6  ? ? "C1'" E DT 6  ? ? N1    E DT 6  ? ? 112.24 108.30 3.94   0.30 N 
27 1 "O4'" F DT 10 ? ? "C1'" F DT 10 ? ? N1    F DT 10 ? ? 102.42 108.00 -5.58  0.70 N 
28 1 C6    F DT 10 ? ? C5    F DT 10 ? ? C7    F DT 10 ? ? 118.87 122.90 -4.03  0.60 N 
29 1 "O4'" F DT 11 ? ? "C1'" F DT 11 ? ? "C2'" F DT 11 ? ? 109.87 106.80 3.07   0.50 N 
30 1 C6    F DT 11 ? ? C5    F DT 11 ? ? C7    F DT 11 ? ? 118.53 122.90 -4.37  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 112 ? ? -98.82  -117.64 
2  1 ASN A 117 ? ? -38.45  -28.32  
3  1 ASN A 154 ? ? -69.41  2.84    
4  1 THR A 187 ? ? 33.19   68.15   
5  1 LYS A 229 ? ? -114.67 -103.15 
6  1 ASN B 70  ? ? -105.38 40.91   
7  1 SER B 112 ? ? -99.15  -115.62 
8  1 ASN B 117 ? ? -34.65  -33.49  
9  1 THR B 187 ? ? 30.49   67.93   
10 1 LYS B 229 ? ? -125.90 -85.84  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1RVC 'double helix'        
1RVC 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2 1_555 D DT 5 1_555 -0.161 -0.311 -0.474 -12.453 -6.360  4.608  1  C_DA2:DT11_F C 2  ? F 11 ? 20 1 
1 A DA 3 1_555 D DT 4 1_555 0.172  -0.180 0.031  -3.557  -6.760  0.953  2  C_DA3:DT10_F C 3  ? F 10 ? 20 1 
1 A DG 4 1_555 D DC 3 1_555 0.173  -0.213 0.305  9.118   -12.623 0.640  3  C_DG4:DC9_F  C 4  ? F 9  ? 19 1 
1 A DA 5 1_555 D DT 2 1_555 -0.030 -0.079 0.007  2.277   -2.153  -1.397 4  C_DA5:DT8_F  C 5  ? F 8  ? 20 1 
1 A DT 6 1_555 D DA 1 1_555 -0.049 0.161  -0.095 39.349  -12.688 6.947  5  C_DT6:DA7_F  C 6  ? F 7  ? 20 1 
1 B DA 1 1_555 C DT 6 1_555 0.155  -0.043 0.095  -30.987 -4.424  8.878  6  D_DA7:DT6_E  D 7  ? E 6  ? 20 1 
1 B DT 2 1_555 C DA 5 1_555 0.016  -0.160 0.117  -4.948  0.141   -1.234 7  D_DT8:DA5_E  D 8  ? E 5  ? 20 1 
1 B DC 3 1_555 C DG 4 1_555 -0.135 -0.102 0.251  -9.310  -10.662 1.134  8  D_DC9:DG4_E  D 9  ? E 4  ? 19 1 
1 B DT 4 1_555 C DA 3 1_555 -0.273 -0.169 0.099  2.039   -8.057  3.055  9  D_DT10:DA3_E D 10 ? E 3  ? 20 1 
1 B DT 5 1_555 C DA 2 1_555 0.229  -0.295 -0.296 11.738  -13.501 3.275  10 D_DT11:DA2_E D 11 ? E 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2 1_555 D DT 5 1_555 A DA 3 1_555 D DT 4 1_555 0.016  0.663  3.224 -3.602 2.234   32.514 0.793  -0.643 3.241 3.968   6.400 
32.781 1 CC_DA2DA3:DT10DT11_FF C 2  ? F 11 ? C 3  ? F 10 ? 
1 A DA 3 1_555 D DT 4 1_555 A DG 4 1_555 D DC 3 1_555 0.399  -0.149 3.166 -1.714 2.911   29.771 -0.867 -1.113 3.110 5.643   3.322 
29.958 2 CC_DA3DG4:DC9DT10_FF  C 3  ? F 10 ? C 4  ? F 9  ? 
1 A DG 4 1_555 D DC 3 1_555 A DA 5 1_555 D DT 2 1_555 -0.318 -0.706 3.780 -4.033 -12.129 38.120 0.626  -0.087 3.834 -17.965 5.973 
40.130 3 CC_DG4DA5:DT8DC9_FF   C 4  ? F 9  ? C 5  ? F 8  ? 
1 A DA 5 1_555 D DT 2 1_555 A DT 6 1_555 D DA 1 1_555 -0.434 -2.077 2.853 -9.181 1.996   21.331 -5.744 -1.676 2.609 5.087   23.395 
23.286 4 CC_DA5DT6:DA7DT8_FF   C 5  ? F 8  ? C 6  ? F 7  ? 
1 A DT 6 1_555 D DA 1 1_555 B DA 1 1_555 C DT 6 1_555 -0.056 -2.439 4.167 -1.749 33.377  52.081 -4.136 -0.036 2.357 34.321  1.798 
61.246 5 CD_DT6DA7:DT6DA7_EF   C 6  ? F 7  ? D 7  ? E 6  ? 
1 B DA 1 1_555 C DT 6 1_555 B DT 2 1_555 C DA 5 1_555 0.233  -2.413 3.117 9.989  0.789   19.672 -6.596 3.057  2.802 2.140   
-27.082 22.055 6 DD_DA7DT8:DA5DT6_EE   D 7  ? E 6  ? D 8  ? E 5  ? 
1 B DT 2 1_555 C DA 5 1_555 B DC 3 1_555 C DG 4 1_555 0.128  -0.847 3.614 4.524  -9.106  40.280 -0.094 0.367  3.704 -12.974 -6.445 
41.491 7 DD_DT8DC9:DG4DA5_EE   D 8  ? E 5  ? D 9  ? E 4  ? 
1 B DC 3 1_555 C DG 4 1_555 B DT 4 1_555 C DA 3 1_555 -0.492 -0.220 3.182 0.381  2.456   28.471 -0.986 1.081  3.146 4.982   -0.772 
28.578 8 DD_DC9DT10:DA3DG4_EE  D 9  ? E 4  ? D 10 ? E 3  ? 
1 B DT 4 1_555 C DA 3 1_555 B DT 5 1_555 C DA 2 1_555 -0.350 0.780  3.159 4.706  6.644   31.484 0.249  1.436  3.170 11.994  -8.496 
32.494 9 DD_DT10DT11:DA2DA3_EE D 10 ? E 3  ? D 11 ? E 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
#